3UOYA

Crystal structure of otemo complex with fad and nadp (form 1)
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
540
structure length
537
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 192
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uoyA01
3KA7A 4C77A 3H8IA 1PBDA 2GR3A 3BNUA 1PJ6A 3HZLA 2NVKX 2CVJA 2EQ7A 4LU6A 3NKSA 4CNJA 5HY5A 5HYMA 3PS9A 3ADAB 3AE3A 3NG7X 2JK6A 1H7XA 2H89A 2R4EA 1NDAA 3AE1A 4U8PA 1PXBA 2A8XA 3CNDA 4U2TA 3VRBA 3E1TA 2HQMA 1FOHA 4UDRA 2R4JA 1EL5A 1H86A 4MJWA 4O5QA 4TM1A 2XYOA 1Y56A 1XANA 5BULA 1E39A 2YG3A 1NG4A 4H7UA 4IVMB 4FK1C 4D03A 4A99A 2B9YA 2XLSA 3LOVA 4ADWA 3F8PA 4Z2TA 3V3OA 4JNAA 1S2YA 3EF6A 2DKIA 1QLBA 1OJCA 2CFYA 4BJYA 5BUKA 2WPFA 2GR2A 3UKFA 3GMBA 4K7ZA 4UDPA 2AAQA 1ZK7A 2JAEA 4J56A 4LIIA 3DJGX 2GH5A 2IVEA 2NPXA 3BHKA 4H2NA 4YKGA 4HA6A 1RP0A 3M0OA 3NLCA 4J57A 3IHMA 1OJDA 2DKHA 4H4ZA 4J33A 3RNMA 5KVIA 3RP6A 5EB4A 2YM2A 2YWLA 4Z24A 1ZX9A 3RP8A 3LB8A 4H4RA 4ECHA 2VVLA 1D5TA 4H2PA 2WETA 4CY6A 1VRQB 1IJHA 4XWZA 3FMWA 3GRSA 2B7RA 2XLRA 1GXFA 2R45A 1CJCA 1DOEA 3COXA 4O5UA 4C3YA 1FEBA 4JN9A 4TLXA 2WPCA 4KX6A 4AOXA 4B66A 1JNZA 3CN8A 3G5SA 2X3NA 1E1MA 1JRYA 4H4SA 1NHPA 3KVEA 3UP5A 3ALJA 5U1OA 4ZCDA 2WESA 5EBKA 3UOYA 2RGOA 4JQ9A 3UKKA 4HB9A 2C67A 5JCLA 1E7PA 1JEHA 2WEUA 4RSLA 2AR8A 1EL7A 2YG6A 2GRTA 2V3AA 4DSHA 1ZKQA 3ITJA 3BHFA 3M13A 5IQ1A 3RP7A 3GRTA 3NN6X 4A5LA 1Q1RA 4EQWA 1CC4A 3ATQA 4Z44A 5KXJA 1REOA 2E5VA 3AEEA 3NK1X 1RSGA 3CTYA 3QSSA 4WX1A 3NYFA 1KSUA 3VR9A 4EQRA 4J34A 2X8HA 4ZCCA 1S3EA 1PBEA 2VRMA 2GB0A 2V3BA 1O5WA 3C4NA 4H4UA 3DK4A 1LJ1A 1S2QA 4A6NB 2VQ7A 2WQYA 2YVGA 4B65A 2XFPA 2R0GA 1FEAA 1K0LA 3PO7A 4EMIA 2V61A 3AEDA 4EIPA 1CBOA 3BNMA 3I3LA 3CNTA 2JB3A 3G5QA 2PHHA 2RABA 1YQ4A 3D1CA 1NENA 3UOZA 1GRGA 2GAHB 1B8SA 4YTMA 4Y4NA 4B67A 3NGCX 2FJAA 2VQBA 2BS2A 3DMEA 1MOKA 1KDGA 1DXLA 1CJ2A 3LJPA 5JCNA 1CJ3A 3AEAA 4FDCB 3NYEA 2Z5YA 4Z26A 1LV0A 2APGA 3QJ4A 1Z6LA 1ZDLA 3UKHA 1X31B 1KFYA 4TLZA 2B76A 3AE4A 3S5WA 3NTAA 1YKJA 2EQ6A 3L8KA 2XFNA 3GYJA 1IUUA 2C65A 4A65A 4BK3A 3AD8B 3K7MX 2JB2A 3AE7A 1PN0A 4TM0A 1HYUA 2WDRA 3K30A 4JY2A 2C70A 2C3CA 1GTHA 1Q9IA 3L1RA 3S61A 2GMJA 4OPDA 1H6VA 2VVMA 4AT2A 1MO9A 3CGEA 4CRTA 1FL2A 2A89A 1GOSA 1PJ5A 1YQZA 2TMDA 2FJDA 4C74A 5EOWA 3CGBA 3UKLA 4NEWA 4A7AA 2OAMA 4OPUA 1CF3A 3KKJA 1OJ9A 2B9XA 4YTNA 2C72A 1IUWA 3P4RA 1UKVG 3NH3X 3Q9TA 3UTEA 3P9UA 4K5SA 2GMHA 3LZWA 2GF3A 1F8SA 3UCLA 4OPTA 1F6MA 1ONFA 2XLTA 3AEFA 5GRTA 1NPXA 3KD9A 1CHUA 4PAAA 2CULA 1ZY8A 2GAGB 4J2WA 3ICRA 3O0HA 2YLSA 4UDQA 1GRBA 3GD4A 4IV9A 5HXIA 5U63A 3SGLA 5HHFA 4IA5A 3VR8A 1H84A 4U8NA 4I58A 5KOXA 2ZZBA 3CPHG 1ZOYA 4OPGA 3SM8A 1CL0A 3UKQA 1NAAA 4Z2RA 4U8IA 2Y6RA 2YLTA 1DJQA 1TRBA 1D4DA 2WBAA 3GDPA 4BJZA 3Q6JA 2IIDA 2WP9A 2C3DA 3QVPA 3QVRA 2ZZ0A 3NT6A 4Z2UA 1IUXA 2BCGG 1NHRA 4K2XA 1H83A 2RGJA 3NTDA 1E6EA 2BC0A 3CGCA 1GV4A 4BV6A 1NHSA 2BCPA 2XFOA 5FMHA 2WP5A 1DJNA 5TR3A 3UOXA 2BXRA 1E1LA 1B5QA 1VQWA 3AD7B 2F5ZA 1CJ4A 1EL9A 2WOWA 5DBJA 3DJEA 4H4WA 1LPFA 1QJDA 5GSNA 2C64A 1P2EA 4TM4A 4Y4LA 4B1BA 1DOBA 4BK2A 3AE8A 3UP4A 4E0VA 2A87A 3CPIG 2BACA 3K7TA 1VG0A 2YAUA 1H82A 1GSNA 2XDOA 4K5RA 4JDRA 2BA9A 1GERA 1M64A 2RGHA 2I0ZA 4GDEA 1Q1WA 4GUVA 4LA1A 1ZMCA 1DODA 4U8KA 2WOIA 4U8OA 4CCQA 2Q0KA 3AE2A 5U25A 2WP6A 3UTGA 3V76A 1VG9A 5KRQA 2YVFA 3URHA 1F3PA 1PDHA 3AYJA 1JRZA 4NZHA 1IUVA 1D4CA 3IF9A 4DSGA 4Z25A 5JCIA 2IVDA 1PBCA 3QFAA 4BURA 2OLNA 2WS3A 2X8CA 2QAEA 2YVJA 4WCTA 4USRA 1PHHA 3UTFA 4BK1A 2FBWA 4U2SA 4EIQA 4GR1A 2OA1A 1PBBA 5J60A 1TDOA 4D04A 1YQ3A 1GNDA 3BI2A 2BC1A 4J31A 1OJTA 4B68A 1BGJA 4M52A 3ICSA 1L9DA 5CKUA 4DNAA 1YY5A 1N4WA 3UKPA 5JCMA 3BI4A 3II4A 1GREA 3CGDA 3CNPA 3IC9A 4FX9A 3F8DA 4B64A 1KNRA 4J36A 4H2RA 5FS8A 2WHDA 3EANA 1DNCA 2XVEA 4U8LA 1ZP0A 3PVCA 1L0VA 3DH9A 1GT8A 4FK1A 2C75A 2B7SA 4YKFA 1V59A 4EQSA 4YWOA 4REKA 3AXBA 4YTPA 3AECA 4CY8A 2X50A 1PXCA 3AD9B 1KNPA 4H4PA 4JY3A 1F8RA 1OJAA 4A9WA 3AYIA 3BI5A 3H8LA 2YG7A 1D7YA 1ELIA 1KSSA 2R46A 1BF3A 2YM1A 2YR4A 3ATRA 5EB5A 4CCRA 4CNKA 3WE0A 4EM3A 4ZN0A 2R0PA 2GQWA 2YG5A 1NG3A 2W0HA 1GETA 3NK0X 5BRTA 1VDCA 1LTXR 4EM4A 2ARDA 5J7XA 3DGHA 4H4XA 2GR0A 3LZXA 4AP3A 2GEWA 4NTCA 4YSZA 3NYCA 1GRFA 2C7GA 3KU9A 4U8JA 1GRTA 1BKWA 2BK4A 3D8XA 1PBFA 2VZ2A 3AYLA 2XLPA 1P2HA 3T37A 1PXAA 2XVHA 2ZZCA 3NHOX 5CQFA 2VVLG 2XCGA 4XWRA 3GWFA 4GDPA 2Q0LA 2WDQA 1K0IA 2XFQA 3GWDA 4Y4MA 3QSEA 5KVHA 5LV9A 2C73A 3FPZA 4OPLA 3IWAA 1GALA 2WOVA 4APNA 1JRXA 3KLJA 2Y6QA 3CNSA 1JOAA 5IQ4A 2OLOA 4IA6A 3G5RA 2JB1A 4K8DA 4H4YA 4RG3A 1JNRA 3GSIA 4EMJA 2Q7VA 4DGKA 2BK5A 4GCMA 5ER0A 3AEGA 3FBSA 1QO8A 4U2LA 4ICYA 2XVFA 1W4XA 5BVAA 2YR6A 4AP1A 1XDIA 2C76A 2JBVA 2WU5A 1D4EA 4C3XA 2QA2A 4NTEA 4U8MA 2X8GA 3JSKA 3EAOA 3DJJA 4YXDA 3AWIA 1FECA 2J3NA 4H50A 1LVLA 4UP3A 1K0JA 2E4GA 1CC6A 3VQRA 3I6DA 2YR5A 3DJDA 1CC2A 1NEKA 1XHCA 2Q6UA 2YLXA 2B9WA 4N9XA 1PJ7A 1GTEA 2YG4A 4TM3A 1B37A 1M6IA 4IVOB 1RYIA 2XLUA 2XVJA 1XPQA 2O9ZA 3RHAA 1PS9A 1AOGA 1BGNA 1MXTA 4YSHA 2C66A 2UZZA 3UTHA 2YQUA 2GR1A 1GESA 2GV8A 5KWFA 3GD3A 2FJEA 2VRLA 4JNQA 2ZBWA 3NIXA 3C96A 3P1WA 1ZOVA 2V60A 2AQJA 3EPTA 1DOCA 1B4VA 3FG2P 1GRHA 2X99A 5M10A 3AE5A 1LQUA 1N1PA 2V5ZA 1JU2A 5FS7A 2Z5XA 3LXDA 4X4JA 2V6OA 1TDEA 3C4AA 3P4PA 1D7LA 3NK2X 1O94A 3CIRA 3UKAA 3KPFA 2ACZA 2TPRA 3B3RA 4AT0A 3SQPA 4A79A 2YLZA 4USQA 1LQTA 1COYA 4OCGA 3SFDA 2WU2A 4OPCA 1S3BA 2H88A 4B63A 4P9SA 1N4UA 2YLRA 4KPRA 3DA1A 4NEVA 2JKCA 2OALA 4H4TA 4X9MA 3ALLA 3VRDB 3ZYXA 1H81A 2CDUA 4YSYA 2FJBA 4NTDA 4CBQA 1EL8A 3ZDNA 4Z43A 2QA1A 4OPIA 1GRAA 1IUSA 3B6DA 2PYXA 3FIMB 2QCUA 4H4VA 3SFEA 3DK9A 3VRAA 1TDNA 4YT0A 3AE6A 3ABVA 3F8RA 3NN0X 4X9NA 2R0CA 3AEBA 3NNEA 3P4SA 5FS9A 4EMWA 2BS4A 3ALMA 3DGZA 4C5OA 1SEZA 1TDFA 4AOSA 1GPEA 1KF6A 1GEUA 1L9CA 1Y0PA 1TYPA 1IUTA 1NHQA 3CPJG 3V3NA 3IHGA 3QFBA 4H4QA 3DK8A 2EQ9A 1F8WA 2XVIA 3K7QX 3R9UA 3LADA 1EBDA 3QSMA 2BS3A 2WDVA 2BABA 3GYIA 3CNJA 4XXGA 4K22A 5L46A 2BK3A 2BYBA 4A6NA 2BXSA 1FCDA 4GF7A 1E1NA 2YLWA 1TDKA 4I59A 3REDA 4B69A 3GMCA 5KOWA 3GDNA 2VOUA 4OVIA 5JCKA 1TYTA 3H4KA 4EQXA 5IPYA 5FS6A 4RG4A 1O95A 1L9EA 1BZLA 3AE9A 4YSXA 2WPEA 1E1KA 5C3JA 3M12A 4PABA 1ZMDA 2E1MA 2GVCA 5M0ZA 1BWCA 2XFUA 3OZ2A 3ICTA 4GRTA 3UOVA 5C2TA 1H7WA 2EQ8A 3AB1A 4H2QA 1N4VA 3ISHA 1K4QA 3NRNA 3P4QA 2GQFA 2R9ZA 1Y56B 3OC4A
chains in the Genus database with same CATH superfamily
3KA7A 4C77A 3H8IA 1PBDA 2GR3A 3BNUA 1PJ6A 3HZLA 2NVKX 2CVJA 2EQ7A 4LU6A 3NKSA 4CNJA 5HY5A 5HYMA 3PS9A 3ADAB 3AE3A 3NG7X 2JK6A 1H7XA 2H89A 2R4EA 1NDAA 3AE1A 4U8PA 1PXBA 2A8XA 3CNDA 4II2A 4U2TA 3VRBA 3E1TA 2HQMA 1FOHA 4UDRA 2R4JA 1EL5A 1H86A 4MJWA 4O5QA 4TM1A 2XYOA 1Y56A 1XANA 5BULA 1E39A 2YG3A 1NG4A 4H7UA 4IVMB 4FK1C 4D03A 4A99A 2B9YA 2XLSA 3LOVA 4ADWA 3F8PA 4Z2TA 3V3OA 4JNAA 1S2YA 3EF6A 2DKIA 1QLBA 1OJCA 2CFYA 4BJYA 5BUKA 2WPFA 2GR2A 3UKFA 3GMBA 4K7ZA 4UDPA 2AAQA 1ZK7A 2JAEA 4J56A 4LIIA 3DJGX 2GH5A 2IVEA 2NPXA 3BHKA 4H2NA 4YKGA 4HA6A 1RP0A 3M0OA 3NLCA 4J57A 3IHMA 1OJDA 2DKHA 5KMSA 4H4ZA 4J33A 3RNMA 5KVIA 3RP6A 5EB4A 2YM2A 2YWLA 4Z24A 1ZX9A 3RP8A 3LB8A 4H4RA 4ECHA 2VVLA 1D5TA 4H2PA 2WETA 4CY6A 1VRQB 1IJHA 4XWZA 3FMWA 3GRSA 4II3A 3GYXA 3SXIA 2B7RA 2XLRA 1GXFA 2R45A 1CJCA 1DOEA 3COXA 4O5UA 4C3YA 1FEBA 4JN9A 4TLXA 2WPCA 4KX6A 4AOXA 4B66A 1JNZA 3CN8A 3G5SA 2X3NA 1E1MA 1JRYA 4H4SA 1NHPA 3KVEA 3UP5A 3ALJA 5U1OA 4ZCDA 2WESA 3T0KA 2BRAA 5EBKA 3UOYA 2RGOA 4JQ9A 3UKKA 4HB9A 2C67A 5JCLA 1E7PA 1JEHA 2WEUA 3KPKA 2AR8A 1EL7A 2YG6A 2GRTA 2V3AA 4RSLA 4DSHA 1ZKQA 3ITJA 3BHFA 3M13A 5IQ1A 3RP7A 3GRTA 3NN6X 4A5LA 1Q1RA 4EQWA 1CC4A 3ATQA 4Z44A 5KXJA 1REOA 2E5VA 3AEEA 3NK1X 1RSGA 3CTYA 3HYXA 3QSSA 4WX1A 3NYFA 1KSUA 3VR9A 4EQRA 4J34A 2X8HA 4ZCCA 1S3EA 1PBEA 2VRMA 2GB0A 2V3BA 1O5WA 3C4NA 4H4UA 3DK4A 1LJ1A 1S2QA 4A6NB 2VQ7A 2WQYA 2YVGA 4B65A 2XFPA 2R0GA 1FEAA 1K0LA 3PO7A 4EMIA 2V61A 3AEDA 4EIPA 1CBOA 3BNMA 3I3LA 3CNTA 2JB3A 3G5QA 2PHHA 2RABA 1YQ4A 3D1CA 1NENA 3UOZA 1GRGA 2GAHB 1B8SA 4YTMA 4Y4NA 4B67A 3NGCX 2FJAA 2VQBA 2BS2A 3DMEA 1MOKA 1KDGA 1DXLA 1CJ2A 3LJPA 5JCNA 1CJ3A 3AEAA 4FDCB 3NYEA 2Z5YA 4Z26A 1LV0A 2APGA 3QJ4A 1Z6LA 1ZDLA 3UKHA 1X31B 1KFYA 3HYWA 4TLZA 2B76A 3AE4A 3S5WA 3NTAA 1YKJA 2EQ6A 3L8KA 2XFNA 3GYJA 1IUUA 2C65A 3SZWA 4A65A 3AD8B 3K7MX 4BK3A 2JB2A 3AE7A 1PN0A 4TM0A 1HYUA 3T31A 2WDRA 3K30A 4JY2A 2C70A 2C3CA 1GTHA 1Q9IA 3L1RA 3S61A 2GMJA 4OPDA 1H6VA 2VVMA 4AT2A 1MO9A 3CGEA 4CRTA 1FL2A 2A89A 1GOSA 1PJ5A 1YQZA 2TMDA 2FJDA 4C74A 5EOWA 3CGBA 3UKLA 4NEWA 4A7AA 2OAMA 4OPUA 1CF3A 3KKJA 1OJ9A 2B9XA 4YTNA 2C72A 1IUWA 3P4RA 1UKVG 3NH3X 3Q9TA 3UTEA 3P9UA 4K5SA 2GMHA 3LZWA 2GF3A 1F8SA 3SZCA 3UCLA 4OPTA 1F6MA 1ONFA 2XLTA 3AEFA 5GRTA 1NPXA 3KD9A 1CHUA 4PAAA 2CULA 1ZY8A 2GAGB 4J2WA 3ICRA 3O0HA 2YLSA 4UDQA 2C4CA 1GRBA 3GD4A 3HYVA 4IV9A 5U63A 3SGLA 5HXIA 5HHFA 4IA5A 3VR8A 1H84A 4U8NA 4I58A 5KOXA 2ZZBA 3CPHG 1ZOYA 4OPGA 3SM8A 1CL0A 3UKQA 1NAAA 4Z2RA 4U8IA 2Y6RA 2YLTA 1DJQA 1TRBA 1D4DA 2WBAA 3GDPA 4BJZA 3Q6JA 2IIDA 2WP9A 3T14A 2C3DA 3QVPA 3QVRA 2ZZ0A 3NT6A 4Z2UA 1IUXA 2BCGG 1NHRA 4K2XA 1H83A 2RGJA 3NTDA 1E6EA 2BC0A 3CGCA 1GV4A 4NWZA 3SX6A 1NHSA 2BCPA 4BV6A 2XFOA 4GAPA 5FMHA 2WP5A 1DJNA 5TR3A 3UOXA 2BXRA 1E1LA 1B5QA 1VQWA 3AD7B 2F5ZA 1CJ4A 1EL9A 2WOWA 5DBJA 3DJEA 4H4WA 1LPFA 1QJDA 5GSNA 2C64A 1P2EA 4TM4A 3SZ0A 4Y4LA 4B1BA 1DOBA 4BK2A 3AE8A 3UP4A 4E0VA 3CMMA 2A87A 3CPIG 2BACA 3K7TA 1VG0A 2YAUA 1H82A 1GSNA 3T2KA 2XDOA 4K5RA 4JDRA 2BA9A 1GERA 1M64A 2RGHA 2I0ZA 4GDEA 1Q1WA 4GUVA 4LA1A 1ZMCA 1DODA 4U8KA 2WOIA 4U8OA 4CCQA 2Q0KA 3AE2A 5U25A 2WP6A 3UTGA 3V76A 1VG9A 5KMPA 5KRQA 2YVFA 3URHA 1F3PA 1PDHA 3AYJA 1JRZA 4NZHA 1IUVA 1D4CA 3IF9A 4DSGA 4Z25A 5JCIA 2IVDA 1PBCA 5KMQA 3QFAA 4BURA 2OLNA 2WS3A 2X8CA 2QAEA 2YVJA 4WCTA 4USRA 1PHHA 3UTFA 4BK1A 2FBWA 4U2SA 4EIQA 4GR1A 2OA1A 1PBBA 4G6GA 5J60A 1TDOA 4D04A 1YQ3A 1GNDA 3BI2A 2BC1A 4J31A 1OJTA 4B68A 1BGJA 4M52A 3ICSA 1L9DA 5CKUA 4DNAA 1YY5A 1N4WA 3UKPA 5JCMA 3BI4A 3II4A 1GREA 3CGDA 3CNPA 3IC9A 4FX9A 3F8DA 4B64A 1KNRA 4J36A 4H2RA 5FS8A 2WHDA 3EANA 1DNCA 2XVEA 4U8LA 1ZP0A 3PVCA 1L0VA 3DH9A 1GT8A 4FK1A 2C75A 2B7SA 4YKFA 1V59A 4EQSA 4YWOA 4REKA 3AXBA 4YTPA 3AECA 4CY8A 2X50A 1PXCA 3AD9B 1KNPA 4H4PA 4JY3A 1F8RA 1OJAA 4A9WA 3AYIA 3BI5A 3H8LA 2BRYA 1D7YA 1ELIA 1KSSA 2R46A 1BF3A 2YG7A 2YM1A 2YR4A 3ATRA 5EB5A 4CCRA 3WE0A 4CNKA 4EM3A 2R0PA 2GQWA 2YG5A 4ZN0A 1NG3A 2W0HA 1GETA 3NK0X 5BRTA 1VDCA 1LTXR 4EM4A 2ARDA 5J7XA 3DGHA 4H4XA 2GR0A 3LZXA 4AP3A 2GEWA 4NTCA 4YSZA 3NYCA 1GRFA 2C7GA 3KU9A 4U8JA 1GRTA 1BKWA 2BK4A 3D8XA 1PBFA 2VZ2A 3AYLA 2XLPA 1P2HA 3T37A 1PXAA 2XVHA 2ZZCA 3NHOX 3T2YA 5CQFA 2VVLG 2XCGA 4XWRA 3GWFA 4GDPA 2Q0LA 2WDQA 1K0IA 2XFQA 3GWDA 4Y4MA 3QSEA 5KVHA 5LV9A 2C73A 3FPZA 4OPLA 3IWAA 1GALA 2WOVA 4APNA 1JRXA 3KLJA 2Y6QA 3CNSA 1JOAA 5IQ4A 2OLOA 4IA6A 3G5RA 2JB1A 4K8DA 4H4YA 4RG3A 1JNRA 3GSIA 4EMJA 2Q7VA 4DGKA 2BK5A 4GCMA 5ER0A 3AEGA 3FBSA 1QO8A 4U2LA 4ICYA 2XVFA 1W4XA 3T2ZA 5BVAA 2YR6A 4AP1A 1XDIA 2C76A 2JBVA 2WU5A 1D4EA 4C3XA 2QA2A 4NTEA 4U8MA 2X8GA 3JSKA 3EAOA 3DJJA 4YXDA 3AWIA 1FECA 2J3NA 4H50A 1LVLA 4UP3A 1K0JA 2E4GA 1CC6A 3VQRA 3I6DA 2YR5A 3DJDA 1CC2A 1NEKA 1XHCA 2Q6UA 2YLXA 2B9WA 4N9XA 1PJ7A 1GTEA 2YG4A 4TM3A 1B37A 1M6IA 4IVOB 1RYIA 3SYIA 2XLUA 2XVJA 1XPQA 2O9ZA 3RHAA 1PS9A 4G9KA 1AOGA 1BGNA 1MXTA 4YSHA 2C66A 2UZZA 3UTHA 2YQUA 2GR1A 1GESA 2GV8A 5KWFA 4G6HA 3GD3A 2FJEA 2VRLA 4JNQA 2ZBWA 3NIXA 3C96A 3P1WA 3SZFA 1ZOVA 2V60A 2AQJA 3EPTA 1DOCA 5KMRA 1B4VA 3FG2P 1GRHA 2X99A 5M10A 3AE5A 1LQUA 1N1PA 2V5ZA 1JU2A 5FS7A 2Z5XA 3LXDA 4X4JA 2V6OA 1TDEA 3C4AA 3P4PA 1D7LA 3NK2X 1O94A 3CIRA 3UKAA 3KPFA 2ACZA 2TPRA 3B3RA 4AT0A 3SQPA 4A79A 2YLZA 4G74A 4USQA 1LQTA 1COYA 4OCGA 3SFDA 2WU2A 4OPCA 1S3BA 2H88A 4B63A 4P9SA 1N4UA 2YLRA 4KPRA 3DA1A 4NEVA 2JKCA 2OALA 4H4TA 4X9MA 3ALLA 3VRDB 3ZYXA 1H81A 2CDUA 4YSYA 2FJBA 4NTDA 4CBQA 1EL8A 3ZDNA 4Z43A 2QA1A 4OPIA 1GRAA 1IUSA 3B6DA 2PYXA 3FIMB 2QCUA 4H4VA 3SFEA 3DK9A 3VRAA 1TDNA 4YT0A 3AE6A 4NNJA 3ABVA 3F8RA 3NN0X 4X9NA 2R0CA 3AEBA 3NNEA 3P4SA 5FS9A 4EMWA 2BS4A 3ALMA 3DGZA 4C5OA 1SEZA 1TDFA 4AOSA 1GPEA 1KF6A 1GEUA 1L9CA 1Y0PA 1TYPA 1IUTA 1NHQA 3CPJG 3V3NA 3IHGA 3QFBA 4H4QA 3DK8A 2EQ9A 1F8WA 2XVIA 3K7QX 3R9UA 3LADA 1EBDA 3QSMA 2BS3A 2WDVA 2BABA 3GYIA 3CNJA 4XXGA 4K22A 5L46A 2BK3A 2BYBA 4A6NA 2BXSA 1FCDA 4GF7A 1E1NA 2YLWA 1TDKA 4I59A 3REDA 4B69A 3GMCA 5KOWA 5KNLA 3GDNA 3SY4A 2VOUA 4OVIA 5JCKA 1TYTA 3H4KA 4EQXA 5IPYA 5FS6A 4GAVA 4RG4A 1O95A 1L9EA 1BZLA 3AE9A 4YSXA 2WPEA 1E1KA 5C3JA 3M12A 4PABA 1ZMDA 2E1MA 2GVCA 5M0ZA 1BWCA 2XFUA 4G73A 3OZ2A 3ICTA 4GRTA 3UOVA 5C2TA 1H7WA 2EQ8A 3AB1A 4H2QA 1N4VA 3ISHA 1K4QA 3NRNA 3P4QA 2GQFA 2R9ZA 1Y56B 3OC4A
chains in the Genus database with same CATH topology
3KA7A 4C77A 3H8IA 1PBDA 2GR3A 3BNUA 1PJ6A 3HZLA 2NVKX 2CVJA 2EQ7A 4LU6A 3NKSA 4CNJA 5HY5A 5HYMA 3PS9A 3ADAB 3AE3A 3NG7X 2JK6A 1H7XA 2H89A 2R4EA 1NDAA 3AE1A 4U8PA 1PXBA 2A8XA 3CNDA 4II2A 4U2TA 3VRBA 3E1TA 2HQMA 1FOHA 4UDRA 2R4JA 1EL5A 1H86A 4MJWA 4O5QA 4TM1A 2XYOA 1Y56A 1XANA 5BULA 1E39A 2YG3A 1NG4A 4H7UA 4IVMB 4FK1C 4D03A 4A99A 2B9YA 2XLSA 3LOVA 4ADWA 3F8PA 4Z2TA 3V3OA 4JNAA 1S2YA 3EF6A 2DKIA 1QLBA 1OJCA 2CFYA 4BJYA 5BUKA 2WPFA 2GR2A 3UKFA 3GMBA 4K7ZA 4UDPA 2AAQA 1ZK7A 2JAEA 4J56A 4LIIA 3DJGX 2GH5A 2IVEA 2NPXA 3BHKA 4H2NA 4YKGA 4HA6A 1RP0A 3M0OA 3NLCA 4J57A 3IHMA 1OJDA 2DKHA 5KMSA 4H4ZA 4J33A 3RNMA 5KVIA 3RP6A 5EB4A 2YM2A 2YWLA 4Z24A 1ZX9A 3RP8A 3LB8A 4H4RA 4ECHA 2VVLA 1D5TA 4H2PA 2WETA 4CY6A 1VRQB 1IJHA 4XWZA 3FMWA 3GRSA 4II3A 3GYXA 3SXIA 2B7RA 2XLRA 1GXFA 2R45A 1CJCA 1DOEA 3COXA 4O5UA 4C3YA 1FEBA 4JN9A 4TLXA 2WPCA 4KX6A 4AOXA 4B66A 1JNZA 3CN8A 3G5SA 2X3NA 1E1MA 1JRYA 4H4SA 1NHPA 3KVEA 3UP5A 3ALJA 5U1OA 4ZCDA 2WESA 3T0KA 2BRAA 5EBKA 3UOYA 2RGOA 4JQ9A 3UKKA 4HB9A 2C67A 5JCLA 1E7PA 1JEHA 2WEUA 3KPKA 2AR8A 1EL7A 2YG6A 2GRTA 2V3AA 4RSLA 4DSHA 1ZKQA 3ITJA 3BHFA 3M13A 5IQ1A 3RP7A 3GRTA 3NN6X 4A5LA 1Q1RA 4EQWA 1CC4A 3ATQA 4Z44A 5KXJA 1REOA 2E5VA 3AEEA 3NK1X 1RSGA 3CTYA 3HYXA 3QSSA 4WX1A 3NYFA 1KSUA 3VR9A 4EQRA 4J34A 2X8HA 4ZCCA 1S3EA 1PBEA 2VRMA 2GB0A 2V3BA 1O5WA 3C4NA 4H4UA 3DK4A 1LJ1A 1S2QA 4A6NB 2VQ7A 2WQYA 2YVGA 4B65A 2XFPA 2R0GA 1FEAA 1K0LA 3PO7A 4EMIA 2V61A 3AEDA 4EIPA 1CBOA 3BNMA 3I3LA 3CNTA 2JB3A 3G5QA 2PHHA 2RABA 1YQ4A 3D1CA 1NENA 3UOZA 1GRGA 2GAHB 1B8SA 4YTMA 4Y4NA 4B67A 3NGCX 2FJAA 2VQBA 2BS2A 3DMEA 1MOKA 1KDGA 1DXLA 1CJ2A 3LJPA 5JCNA 1CJ3A 3AEAA 4FDCB 3NYEA 2Z5YA 4Z26A 1LV0A 2APGA 3QJ4A 1Z6LA 1ZDLA 3UKHA 1X31B 1KFYA 3HYWA 4TLZA 2B76A 3AE4A 3S5WA 3NTAA 1YKJA 2EQ6A 3L8KA 2XFNA 3GYJA 1IUUA 2C65A 3SZWA 4A65A 3AD8B 3K7MX 4BK3A 2JB2A 3AE7A 1PN0A 4TM0A 1HYUA 3T31A 2WDRA 3K30A 4JY2A 2C70A 2C3CA 1GTHA 1Q9IA 3L1RA 3S61A 2GMJA 4OPDA 1H6VA 2VVMA 4AT2A 1MO9A 3CGEA 4CRTA 1FL2A 2A89A 1GOSA 1PJ5A 1YQZA 2TMDA 2FJDA 4C74A 5EOWA 3CGBA 3UKLA 4NEWA 4A7AA 2OAMA 4OPUA 1CF3A 3KKJA 1OJ9A 2B9XA 4YTNA 2C72A 1IUWA 3P4RA 1UKVG 3NH3X 3Q9TA 3UTEA 3P9UA 4K5SA 2GMHA 3LZWA 2GF3A 1F8SA 3SZCA 3UCLA 4OPTA 1F6MA 1ONFA 2XLTA 3AEFA 5GRTA 1NPXA 3KD9A 1CHUA 4PAAA 2CULA 1ZY8A 2GAGB 4J2WA 3ICRA 3O0HA 2YLSA 4UDQA 2C4CA 1GRBA 3GD4A 3HYVA 4IV9A 5U63A 3SGLA 5HXIA 5HHFA 4IA5A 3VR8A 1H84A 4U8NA 4I58A 5KOXA 2ZZBA 3CPHG 1ZOYA 4OPGA 3SM8A 1CL0A 3UKQA 1NAAA 4Z2RA 4U8IA 2Y6RA 2YLTA 1DJQA 1TRBA 1D4DA 2WBAA 3GDPA 4BJZA 3Q6JA 2IIDA 2WP9A 3T14A 2C3DA 3QVPA 3QVRA 2ZZ0A 3NT6A 4Z2UA 1IUXA 2BCGG 1NHRA 4K2XA 1H83A 2RGJA 3NTDA 1E6EA 2BC0A 3CGCA 1GV4A 4NWZA 3SX6A 1NHSA 2BCPA 4BV6A 2XFOA 4GAPA 5FMHA 2WP5A 1DJNA 5TR3A 3UOXA 2BXRA 1E1LA 1B5QA 1VQWA 3AD7B 2F5ZA 1CJ4A 1EL9A 2WOWA 5DBJA 3DJEA 4H4WA 1LPFA 1QJDA 5GSNA 2C64A 1P2EA 4TM4A 3SZ0A 4Y4LA 4B1BA 1DOBA 4BK2A 3AE8A 3UP4A 4E0VA 3CMMA 2A87A 3CPIG 2BACA 3K7TA 1VG0A 2YAUA 1H82A 1GSNA 3T2KA 2XDOA 4K5RA 4JDRA 2BA9A 1GERA 1M64A 2RGHA 2I0ZA 4GDEA 1Q1WA 4GUVA 4LA1A 1ZMCA 1DODA 4U8KA 2WOIA 4U8OA 4CCQA 2Q0KA 3AE2A 5U25A 2WP6A 3UTGA 3V76A 1VG9A 5KMPA 5KRQA 2YVFA 3URHA 1F3PA 1PDHA 3AYJA 1JRZA 4NZHA 1IUVA 1D4CA 3IF9A 4DSGA 4Z25A 5JCIA 2IVDA 1PBCA 5KMQA 3QFAA 4BURA 2OLNA 2WS3A 2X8CA 2QAEA 2YVJA 4WCTA 4USRA 1PHHA 3UTFA 4BK1A 2FBWA 4U2SA 4EIQA 4GR1A 2OA1A 1PBBA 4G6GA 5J60A 1TDOA 4D04A 1YQ3A 1GNDA 3BI2A 2BC1A 4J31A 1OJTA 4B68A 1BGJA 4M52A 3ICSA 1L9DA 5CKUA 4DNAA 1YY5A 1N4WA 3UKPA 5JCMA 3BI4A 3II4A 1GREA 3CGDA 3CNPA 3IC9A 4FX9A 3F8DA 4B64A 1KNRA 4J36A 4H2RA 5FS8A 2WHDA 3EANA 1DNCA 2XVEA 4U8LA 1ZP0A 3PVCA 1L0VA 3DH9A 1GT8A 4FK1A 2C75A 2B7SA 4YKFA 1V59A 4EQSA 4YWOA 4REKA 3AXBA 4YTPA 3AECA 4CY8A 2X50A 1PXCA 3AD9B 1KNPA 4H4PA 4JY3A 1F8RA 1OJAA 4A9WA 3AYIA 3BI5A 3H8LA 2BRYA 1D7YA 1ELIA 1KSSA 2R46A 1BF3A 2YG7A 2YM1A 2YR4A 3ATRA 5EB5A 4CCRA 3WE0A 4CNKA 4EM3A 2R0PA 2GQWA 2YG5A 4ZN0A 1NG3A 2W0HA 1GETA 3NK0X 5BRTA 1VDCA 1LTXR 4EM4A 2ARDA 5J7XA 3DGHA 4H4XA 2GR0A 3LZXA 4AP3A 2GEWA 4NTCA 4YSZA 3NYCA 1GRFA 2C7GA 3KU9A 4U8JA 1GRTA 1BKWA 2BK4A 3D8XA 1PBFA 2VZ2A 3AYLA 2XLPA 1P2HA 3T37A 1PXAA 2XVHA 2ZZCA 3NHOX 3T2YA 5CQFA 2VVLG 2XCGA 4XWRA 3GWFA 4GDPA 2Q0LA 2WDQA 1K0IA 2XFQA 3GWDA 4Y4MA 3QSEA 5KVHA 5LV9A 2C73A 3FPZA 4OPLA 3IWAA 1GALA 2WOVA 4APNA 1JRXA 3KLJA 2Y6QA 3CNSA 1JOAA 5IQ4A 2OLOA 4IA6A 3G5RA 2JB1A 4K8DA 4H4YA 4RG3A 1JNRA 3GSIA 4EMJA 2Q7VA 4DGKA 2BK5A 4GCMA 5ER0A 3AEGA 3FBSA 1QO8A 4U2LA 4ICYA 2XVFA 1W4XA 3T2ZA 5BVAA 2YR6A 4AP1A 1XDIA 2C76A 2JBVA 2WU5A 1D4EA 4C3XA 2QA2A 4NTEA 4U8MA 2X8GA 3JSKA 3EAOA 3DJJA 4YXDA 3AWIA 1FECA 2J3NA 4H50A 1LVLA 4UP3A 1K0JA 2E4GA 1CC6A 3VQRA 3I6DA 2YR5A 3DJDA 1CC2A 1NEKA 1XHCA 2Q6UA 2YLXA 2B9WA 4N9XA 1PJ7A 1GTEA 2YG4A 4TM3A 1B37A 1M6IA 4IVOB 1RYIA 3SYIA 2XLUA 2XVJA 1XPQA 2O9ZA 3RHAA 1PS9A 4G9KA 1AOGA 1BGNA 1MXTA 4YSHA 2C66A 2UZZA 3UTHA 2YQUA 2GR1A 1GESA 2GV8A 5KWFA 4G6HA 3GD3A 2FJEA 2VRLA 4JNQA 2ZBWA 3NIXA 3C96A 3P1WA 3SZFA 1ZOVA 2V60A 2AQJA 3EPTA 1DOCA 5KMRA 1B4VA 3FG2P 1GRHA 2X99A 5M10A 3AE5A 1LQUA 1N1PA 2V5ZA 1JU2A 5FS7A 2Z5XA 3LXDA 4X4JA 2V6OA 1TDEA 3C4AA 3P4PA 1D7LA 3NK2X 1O94A 3CIRA 3UKAA 3KPFA 2ACZA 2TPRA 3B3RA 4AT0A 3SQPA 4A79A 2YLZA 4G74A 4USQA 1LQTA 1COYA 4OCGA 3SFDA 2WU2A 4OPCA 1S3BA 2H88A 4B63A 4P9SA 1N4UA 2YLRA 4KPRA 3DA1A 4NEVA 2JKCA 2OALA 4H4TA 4X9MA 3ALLA 3VRDB 3ZYXA 1H81A 2CDUA 4YSYA 2FJBA 4NTDA 4CBQA 1EL8A 3ZDNA 4Z43A 2QA1A 4OPIA 1GRAA 1IUSA 3B6DA 2PYXA 3FIMB 2QCUA 4H4VA 3SFEA 3DK9A 3VRAA 1TDNA 4YT0A 3AE6A 4NNJA 3ABVA 3F8RA 3NN0X 4X9NA 2R0CA 3AEBA 3NNEA 3P4SA 5FS9A 4EMWA 2BS4A 3ALMA 3DGZA 4C5OA 1SEZA 1TDFA 4AOSA 1GPEA 1KF6A 1GEUA 1L9CA 1Y0PA 1TYPA 1IUTA 1NHQA 3CPJG 3V3NA 3IHGA 3QFBA 4H4QA 3DK8A 2EQ9A 1F8WA 2XVIA 3K7QX 3R9UA 3LADA 1EBDA 3QSMA 2BS3A 2WDVA 2BABA 3GYIA 3CNJA 4XXGA 4K22A 5L46A 2BK3A 2BYBA 4A6NA 2BXSA 1FCDA 4GF7A 1E1NA 2YLWA 1TDKA 4I59A 3REDA 4B69A 3GMCA 5KOWA 5KNLA 3GDNA 3SY4A 2VOUA 4OVIA 5JCKA 1TYTA 3H4KA 4EQXA 5IPYA 5FS6A 4GAVA 4RG4A 1O95A 1L9EA 1BZLA 3AE9A 4YSXA 2WPEA 1E1KA 5C3JA 3M12A 4PABA 1ZMDA 2E1MA 2GVCA 5M0ZA 1BWCA 2XFUA 4G73A 3OZ2A 3ICTA 4GRTA 3UOVA 5C2TA 1H7WA 2EQ8A 3AB1A 4H2QA 1N4VA 3ISHA 1K4QA 3NRNA 3P4QA 2GQFA 2R9ZA 1Y56B 3OC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KA7 A;  4C77 A;  3H8I A;  1PBD A;  2GR3 A;  3BNU A;  1PJ6 A;  3HZL A;  2NVK X;  2CVJ A;  2EQ7 A;  4LU6 A;  3NKS A;  4CNJ A;  5HY5 A;  5HYM A;  3PS9 A;  3ADA B;  3AE3 A;  3NG7 X;  2JK6 A;  1H7X A;  2H89 A;  2R4E A;  1NDA A;  3AE1 A;  4U8P A;  1PXB A;  2A8X A;  3CND A;  4U2T A;  3VRB A;  3E1T A;  2HQM A;  1FOH A;  4UDR A;  2R4J A;  1EL5 A;  1H86 A;  4MJW A;  4O5Q A;  4TM1 A;  2XYO A;  1Y56 A;  1XAN A;  5BUL A;  1E39 A;  2YG3 A;  1NG4 A;  4H7U A;  4IVM B;  4FK1 C;  4D03 A;  4A99 A;  2B9Y A;  2XLS A;  3LOV A;  4ADW A;  3F8P A;  4Z2T A;  3V3O A;  4JNA A;  1S2Y A;  3EF6 A;  2DKI A;  1QLB A;  1OJC A;  2CFY A;  4BJY A;  5BUK A;  2WPF A;  2GR2 A;  3UKF A;  3GMB A;  4K7Z A;  4UDP A;  2AAQ A;  1ZK7 A;  2JAE A;  4J56 A;  4LII A;  3DJG X;  2GH5 A;  2IVE A;  2NPX A;  3BHK A;  4H2N A;  4YKG A;  4HA6 A;  1RP0 A;  3M0O A;  3NLC A;  4J57 A;  3IHM A;  1OJD A;  2DKH A;  4H4Z A;  4J33 A;  3RNM A;  5KVI A;  3RP6 A;  5EB4 A;  2YM2 A;  2YWL A;  4Z24 A;  1ZX9 A;  3RP8 A;  3LB8 A;  4H4R A;  4ECH A;  2VVL A;  1D5T A;  4H2P A;  2WET A;  4CY6 A;  1VRQ B;  1IJH A;  4XWZ A;  3FMW A;  3GRS A;  2B7R A;  2XLR A;  1GXF A;  2R45 A;  1CJC A;  1DOE A;  3COX A;  4O5U A;  4C3Y A;  1FEB A;  4JN9 A;  4TLX A;  2WPC A;  4KX6 A;  4AOX A;  4B66 A;  1JNZ A;  3CN8 A;  3G5S A;  2X3N A;  1E1M A;  1JRY A;  4H4S A;  1NHP A;  3KVE A;  3UP5 A;  3ALJ A;  5U1O A;  4ZCD A;  2WES A;  5EBK A;  3UOY A;  2RGO A;  4JQ9 A;  3UKK A;  4HB9 A;  2C67 A;  5JCL A;  1E7P A;  1JEH A;  2WEU A;  4RSL A;  2AR8 A;  1EL7 A;  2YG6 A;  2GRT A;  2V3A A;  4DSH A;  1ZKQ A;  3ITJ A;  3BHF A;  3M13 A;  5IQ1 A;  3RP7 A;  3GRT A;  3NN6 X;  4A5L A;  1Q1R A;  4EQW A;  1CC4 A;  3ATQ A;  4Z44 A;  5KXJ A;  1REO A;  2E5V A;  3AEE A;  3NK1 X;  1RSG A;  3CTY A;  3QSS A;  4WX1 A;  3NYF A;  1KSU A;  3VR9 A;  4EQR A;  4J34 A;  2X8H A;  4ZCC A;  1S3E A;  1PBE A;  2VRM A;  2GB0 A;  2V3B A;  1O5W A;  3C4N A;  4H4U A;  3DK4 A;  1LJ1 A;  1S2Q A;  4A6N B;  2VQ7 A;  2WQY A;  2YVG A;  4B65 A;  2XFP A;  2R0G A;  1FEA A;  1K0L A;  3PO7 A;  4EMI A;  2V61 A;  3AED A;  4EIP A;  1CBO A;  3BNM A;  3I3L A;  3CNT A;  2JB3 A;  3G5Q A;  2PHH A;  2RAB A;  1YQ4 A;  3D1C A;  1NEN A;  3UOZ A;  1GRG A;  2GAH B;  1B8S A;  4YTM A;  4Y4N A;  4B67 A;  3NGC X;  2FJA A;  2VQB A;  2BS2 A;  3DME A;  1MOK A;  1KDG A;  1DXL A;  1CJ2 A;  3LJP A;  5JCN A;  1CJ3 A;  3AEA A;  4FDC B;  3NYE A;  2Z5Y A;  4Z26 A;  1LV0 A;  2APG A;  3QJ4 A;  1Z6L A;  1ZDL A;  3UKH A;  1X31 B;  1KFY A;  4TLZ A;  2B76 A;  3AE4 A;  3S5W A;  3NTA A;  1YKJ A;  2EQ6 A;  3L8K A;  2XFN A;  3GYJ A;  1IUU A;  2C65 A;  4A65 A;  4BK3 A;  3AD8 B;  3K7M X;  2JB2 A;  3AE7 A;  1PN0 A;  4TM0 A;  1HYU A;  2WDR A;  3K30 A;  4JY2 A;  2C70 A;  2C3C A;  1GTH A;  1Q9I A;  3L1R A;  3S61 A;  2GMJ A;  4OPD A;  1H6V A;  2VVM A;  4AT2 A;  1MO9 A;  3CGE A;  4CRT A;  1FL2 A;  2A89 A;  1GOS A;  1PJ5 A;  1YQZ A;  2TMD A;  2FJD A;  4C74 A;  5EOW A;  3CGB A;  3UKL A;  4NEW A;  4A7A A;  2OAM A;  4OPU A;  1CF3 A;  3KKJ A;  1OJ9 A;  2B9X A;  4YTN A;  2C72 A;  1IUW A;  3P4R A;  1UKV G;  3NH3 X;  3Q9T A;  3UTE A;  3P9U A;  4K5S A;  2GMH A;  3LZW A;  2GF3 A;  1F8S A;  3UCL A;  4OPT A;  1F6M A;  1ONF A;  2XLT A;  3AEF A;  5GRT A;  1NPX A;  3KD9 A;  1CHU A;  4PAA A;  2CUL A;  1ZY8 A;  2GAG B;  4J2W A;  3ICR A;  3O0H A;  2YLS A;  4UDQ A;  1GRB A;  3GD4 A;  4IV9 A;  5HXI A;  5U63 A;  3SGL A;  5HHF A;  4IA5 A;  3VR8 A;  1H84 A;  4U8N A;  4I58 A;  5KOX A;  2ZZB A;  3CPH G;  1ZOY A;  4OPG A;  3SM8 A;  1CL0 A;  3UKQ A;  1NAA A;  4Z2R A;  4U8I A;  2Y6R A;  2YLT A;  1DJQ A;  1TRB A;  1D4D A;  2WBA A;  3GDP A;  4BJZ A;  3Q6J A;  2IID A;  2WP9 A;  2C3D A;  3QVP A;  3QVR A;  2ZZ0 A;  3NT6 A;  4Z2U A;  1IUX A;  2BCG G;  1NHR A;  4K2X A;  1H83 A;  2RGJ A;  3NTD A;  1E6E A;  2BC0 A;  3CGC A;  1GV4 A;  4BV6 A;  1NHS A;  2BCP A;  2XFO A;  5FMH A;  2WP5 A;  1DJN A;  5TR3 A;  3UOX A;  2BXR A;  1E1L A;  1B5Q A;  1VQW A;  3AD7 B;  2F5Z A;  1CJ4 A;  1EL9 A;  2WOW A;  5DBJ A;  3DJE A;  4H4W A;  1LPF A;  1QJD A;  5GSN A;  2C64 A;  1P2E A;  4TM4 A;  4Y4L A;  4B1B A;  1DOB A;  4BK2 A;  3AE8 A;  3UP4 A;  4E0V A;  2A87 A;  3CPI G;  2BAC A;  3K7T A;  1VG0 A;  2YAU A;  1H82 A;  1GSN A;  2XDO A;  4K5R A;  4JDR A;  2BA9 A;  1GER A;  1M64 A;  2RGH A;  2I0Z A;  4GDE A;  1Q1W A;  4GUV A;  4LA1 A;  1ZMC A;  1DOD A;  4U8K A;  2WOI A;  4U8O A;  4CCQ A;  2Q0K A;  3AE2 A;  5U25 A;  2WP6 A;  3UTG A;  3V76 A;  1VG9 A;  5KRQ A;  2YVF A;  3URH A;  1F3P A;  1PDH A;  3AYJ A;  1JRZ A;  4NZH A;  1IUV A;  1D4C A;  3IF9 A;  4DSG A;  4Z25 A;  5JCI A;  2IVD A;  1PBC A;  3QFA A;  4BUR A;  2OLN A;  2WS3 A;  2X8C A;  2QAE A;  2YVJ A;  4WCT A;  4USR A;  1PHH A;  3UTF A;  4BK1 A;  2FBW A;  4U2S A;  4EIQ A;  4GR1 A;  2OA1 A;  1PBB A;  5J60 A;  1TDO A;  4D04 A;  1YQ3 A;  1GND A;  3BI2 A;  2BC1 A;  4J31 A;  1OJT A;  4B68 A;  1BGJ A;  4M52 A;  3ICS A;  1L9D A;  5CKU A;  4DNA A;  1YY5 A;  1N4W A;  3UKP A;  5JCM A;  3BI4 A;  3II4 A;  1GRE A;  3CGD A;  3CNP A;  3IC9 A;  4FX9 A;  3F8D A;  4B64 A;  1KNR A;  4J36 A;  4H2R A;  5FS8 A;  2WHD A;  3EAN A;  1DNC A;  2XVE A;  4U8L A;  1ZP0 A;  3PVC A;  1L0V A;  3DH9 A;  1GT8 A;  4FK1 A;  2C75 A;  2B7S A;  4YKF A;  1V59 A;  4EQS A;  4YWO A;  4REK A;  3AXB A;  4YTP A;  3AEC A;  4CY8 A;  2X50 A;  1PXC A;  3AD9 B;  1KNP A;  4H4P A;  4JY3 A;  1F8R A;  1OJA A;  4A9W A;  3AYI A;  3BI5 A;  3H8L A;  2YG7 A;  1D7Y A;  1ELI A;  1KSS A;  2R46 A;  1BF3 A;  2YM1 A;  2YR4 A;  3ATR A;  5EB5 A;  4CCR A;  4CNK A;  3WE0 A;  4EM3 A;  4ZN0 A;  2R0P A;  2GQW A;  2YG5 A;  1NG3 A;  2W0H A;  1GET A;  3NK0 X;  5BRT A;  1VDC A;  1LTX R;  4EM4 A;  2ARD A;  5J7X A;  3DGH A;  4H4X A;  2GR0 A;  3LZX A;  4AP3 A;  2GEW A;  4NTC A;  4YSZ A;  3NYC A;  1GRF A;  2C7G A;  3KU9 A;  4U8J A;  1GRT A;  1BKW A;  2BK4 A;  3D8X A;  1PBF A;  2VZ2 A;  3AYL A;  2XLP A;  1P2H A;  3T37 A;  1PXA A;  2XVH A;  2ZZC A;  3NHO X;  5CQF A;  2VVL G;  2XCG A;  4XWR A;  3GWF A;  4GDP A;  2Q0L A;  2WDQ A;  1K0I A;  2XFQ A;  3GWD A;  4Y4M A;  3QSE A;  5KVH A;  5LV9 A;  2C73 A;  3FPZ A;  4OPL A;  3IWA A;  1GAL A;  2WOV A;  4APN A;  1JRX A;  3KLJ A;  2Y6Q A;  3CNS A;  1JOA A;  5IQ4 A;  2OLO A;  4IA6 A;  3G5R A;  2JB1 A;  4K8D A;  4H4Y A;  4RG3 A;  1JNR A;  3GSI A;  4EMJ A;  2Q7V A;  4DGK A;  2BK5 A;  4GCM A;  5ER0 A;  3AEG A;  3FBS A;  1QO8 A;  4U2L A;  4ICY A;  2XVF A;  1W4X A;  5BVA A;  2YR6 A;  4AP1 A;  1XDI A;  2C76 A;  2JBV A;  2WU5 A;  1D4E A;  4C3X A;  2QA2 A;  4NTE A;  4U8M A;  2X8G A;  3JSK A;  3EAO A;  3DJJ A;  4YXD A;  3AWI A;  1FEC A;  2J3N A;  4H50 A;  1LVL A;  4UP3 A;  1K0J A;  2E4G A;  1CC6 A;  3VQR A;  3I6D A;  2YR5 A;  3DJD A;  1CC2 A;  1NEK A;  1XHC A;  2Q6U A;  2YLX A;  2B9W A;  4N9X A;  1PJ7 A;  1GTE A;  2YG4 A;  4TM3 A;  1B37 A;  1M6I A;  4IVO B;  1RYI A;  2XLU A;  2XVJ A;  1XPQ A;  2O9Z A;  3RHA A;  1PS9 A;  1AOG A;  1BGN A;  1MXT A;  4YSH A;  2C66 A;  2UZZ A;  3UTH A;  2YQU A;  2GR1 A;  1GES A;  2GV8 A;  5KWF A;  3GD3 A;  2FJE A;  2VRL A;  4JNQ A;  2ZBW A;  3NIX A;  3C96 A;  3P1W A;  1ZOV A;  2V60 A;  2AQJ A;  3EPT A;  1DOC A;  1B4V A;  3FG2 P;  1GRH A;  2X99 A;  5M10 A;  3AE5 A;  1LQU A;  1N1P A;  2V5Z A;  1JU2 A;  5FS7 A;  2Z5X A;  3LXD A;  4X4J A;  2V6O A;  1TDE A;  3C4A A;  3P4P A;  1D7L A;  3NK2 X;  1O94 A;  3CIR A;  3UKA A;  3KPF A;  2ACZ A;  2TPR A;  3B3R A;  4AT0 A;  3SQP A;  4A79 A;  2YLZ A;  4USQ A;  1LQT A;  1COY A;  4OCG A;  3SFD A;  2WU2 A;  4OPC A;  1S3B A;  2H88 A;  4B63 A;  4P9S A;  1N4U A;  2YLR A;  4KPR A;  3DA1 A;  4NEV A;  2JKC A;  2OAL A;  4H4T A;  4X9M A;  3ALL A;  3VRD B;  3ZYX A;  1H81 A;  2CDU A;  4YSY A;  2FJB A;  4NTD A;  4CBQ A;  1EL8 A;  3ZDN A;  4Z43 A;  2QA1 A;  4OPI A;  1GRA A;  1IUS A;  3B6D A;  2PYX A;  3FIM B;  2QCU A;  4H4V A;  3SFE A;  3DK9 A;  3VRA A;  1TDN A;  4YT0 A;  3AE6 A;  3ABV A;  3F8R A;  3NN0 X;  4X9N A;  2R0C A;  3AEB A;  3NNE A;  3P4S A;  5FS9 A;  4EMW A;  2BS4 A;  3ALM A;  3DGZ A;  4C5O A;  1SEZ A;  1TDF A;  4AOS A;  1GPE A;  1KF6 A;  1GEU A;  1L9C A;  1Y0P A;  1TYP A;  1IUT A;  1NHQ A;  3CPJ G;  3V3N A;  3IHG A;  3QFB A;  4H4Q A;  3DK8 A;  2EQ9 A;  1F8W A;  2XVI A;  3K7Q X;  3R9U A;  3LAD A;  1EBD A;  3QSM A;  2BS3 A;  2WDV A;  2BAB A;  3GYI A;  3CNJ A;  4XXG A;  4K22 A;  5L46 A;  2BK3 A;  2BYB A;  4A6N A;  2BXS A;  1FCD A;  4GF7 A;  1E1N A;  2YLW A;  1TDK A;  4I59 A;  3RED A;  4B69 A;  3GMC A;  5KOW A;  3GDN A;  2VOU A;  4OVI A;  5JCK A;  1TYT A;  3H4K A;  4EQX A;  5IPY A;  5FS6 A;  4RG4 A;  1O95 A;  1L9E A;  1BZL A;  3AE9 A;  4YSX A;  2WPE A;  1E1K A;  5C3J A;  3M12 A;  4PAB A;  1ZMD A;  2E1M A;  2GVC A;  5M0Z A;  1BWC A;  2XFU A;  3OZ2 A;  3ICT A;  4GRT A;  3UOV A;  5C2T A;  1H7W A;  2EQ8 A;  3AB1 A;  4H2Q A;  1N4V A;  3ISH A;  1K4Q A;  3NRN A;  3P4Q A;  2GQF A;  2R9Z A;  1Y56 B;  3OC4 A; 
#chains in the Genus database with same CATH topology
 3KA7 A;  4C77 A;  3H8I A;  1PBD A;  2GR3 A;  3BNU A;  1PJ6 A;  3HZL A;  2NVK X;  2CVJ A;  2EQ7 A;  4LU6 A;  3NKS A;  4CNJ A;  5HY5 A;  5HYM A;  3PS9 A;  3ADA B;  3AE3 A;  3NG7 X;  2JK6 A;  1H7X A;  2H89 A;  2R4E A;  1NDA A;  3AE1 A;  4U8P A;  1PXB A;  2A8X A;  3CND A;  4II2 A;  4U2T A;  3VRB A;  3E1T A;  2HQM A;  1FOH A;  4UDR A;  2R4J A;  1EL5 A;  1H86 A;  4MJW A;  4O5Q A;  4TM1 A;  2XYO A;  1Y56 A;  1XAN A;  5BUL A;  1E39 A;  2YG3 A;  1NG4 A;  4H7U A;  4IVM B;  4FK1 C;  4D03 A;  4A99 A;  2B9Y A;  2XLS A;  3LOV A;  4ADW A;  3F8P A;  4Z2T A;  3V3O A;  4JNA A;  1S2Y A;  3EF6 A;  2DKI A;  1QLB A;  1OJC A;  2CFY A;  4BJY A;  5BUK A;  2WPF A;  2GR2 A;  3UKF A;  3GMB A;  4K7Z A;  4UDP A;  2AAQ A;  1ZK7 A;  2JAE A;  4J56 A;  4LII A;  3DJG X;  2GH5 A;  2IVE A;  2NPX A;  3BHK A;  4H2N A;  4YKG A;  4HA6 A;  1RP0 A;  3M0O A;  3NLC A;  4J57 A;  3IHM A;  1OJD A;  2DKH A;  5KMS A;  4H4Z A;  4J33 A;  3RNM A;  5KVI A;  3RP6 A;  5EB4 A;  2YM2 A;  2YWL A;  4Z24 A;  1ZX9 A;  3RP8 A;  3LB8 A;  4H4R A;  4ECH A;  2VVL A;  1D5T A;  4H2P A;  2WET A;  4CY6 A;  1VRQ B;  1IJH A;  4XWZ A;  3FMW A;  3GRS A;  4II3 A;  3GYX A;  3SXI A;  2B7R A;  2XLR A;  1GXF A;  2R45 A;  1CJC A;  1DOE A;  3COX A;  4O5U A;  4C3Y A;  1FEB A;  4JN9 A;  4TLX A;  2WPC A;  4KX6 A;  4AOX A;  4B66 A;  1JNZ A;  3CN8 A;  3G5S A;  2X3N A;  1E1M A;  1JRY A;  4H4S A;  1NHP A;  3KVE A;  3UP5 A;  3ALJ A;  5U1O A;  4ZCD A;  2WES A;  3T0K A;  2BRA A;  5EBK A;  3UOY A;  2RGO A;  4JQ9 A;  3UKK A;  4HB9 A;  2C67 A;  5JCL A;  1E7P A;  1JEH A;  2WEU A;  3KPK A;  2AR8 A;  1EL7 A;  2YG6 A;  2GRT A;  2V3A A;  4RSL A;  4DSH A;  1ZKQ A;  3ITJ A;  3BHF A;  3M13 A;  5IQ1 A;  3RP7 A;  3GRT A;  3NN6 X;  4A5L A;  1Q1R A;  4EQW A;  1CC4 A;  3ATQ A;  4Z44 A;  5KXJ A;  1REO A;  2E5V A;  3AEE A;  3NK1 X;  1RSG A;  3CTY A;  3HYX A;  3QSS A;  4WX1 A;  3NYF A;  1KSU A;  3VR9 A;  4EQR A;  4J34 A;  2X8H A;  4ZCC A;  1S3E A;  1PBE A;  2VRM A;  2GB0 A;  2V3B A;  1O5W A;  3C4N A;  4H4U A;  3DK4 A;  1LJ1 A;  1S2Q A;  4A6N B;  2VQ7 A;  2WQY A;  2YVG A;  4B65 A;  2XFP A;  2R0G A;  1FEA A;  1K0L A;  3PO7 A;  4EMI A;  2V61 A;  3AED A;  4EIP A;  1CBO A;  3BNM A;  3I3L A;  3CNT A;  2JB3 A;  3G5Q A;  2PHH A;  2RAB A;  1YQ4 A;  3D1C A;  1NEN A;  3UOZ A;  1GRG A;  2GAH B;  1B8S A;  4YTM A;  4Y4N A;  4B67 A;  3NGC X;  2FJA A;  2VQB A;  2BS2 A;  3DME A;  1MOK A;  1KDG A;  1DXL A;  1CJ2 A;  3LJP A;  5JCN A;  1CJ3 A;  3AEA A;  4FDC B;  3NYE A;  2Z5Y A;  4Z26 A;  1LV0 A;  2APG A;  3QJ4 A;  1Z6L A;  1ZDL A;  3UKH A;  1X31 B;  1KFY A;  3HYW A;  4TLZ A;  2B76 A;  3AE4 A;  3S5W A;  3NTA A;  1YKJ A;  2EQ6 A;  3L8K A;  2XFN A;  3GYJ A;  1IUU A;  2C65 A;  3SZW A;  4A65 A;  3AD8 B;  3K7M X;  4BK3 A;  2JB2 A;  3AE7 A;  1PN0 A;  4TM0 A;  1HYU A;  3T31 A;  2WDR A;  3K30 A;  4JY2 A;  2C70 A;  2C3C A;  1GTH A;  1Q9I A;  3L1R A;  3S61 A;  2GMJ A;  4OPD A;  1H6V A;  2VVM A;  4AT2 A;  1MO9 A;  3CGE A;  4CRT A;  1FL2 A;  2A89 A;  1GOS A;  1PJ5 A;  1YQZ A;  2TMD A;  2FJD A;  4C74 A;  5EOW A;  3CGB A;  3UKL A;  4NEW A;  4A7A A;  2OAM A;  4OPU A;  1CF3 A;  3KKJ A;  1OJ9 A;  2B9X A;  4YTN A;  2C72 A;  1IUW A;  3P4R A;  1UKV G;  3NH3 X;  3Q9T A;  3UTE A;  3P9U A;  4K5S A;  2GMH A;  3LZW A;  2GF3 A;  1F8S A;  3SZC A;  3UCL A;  4OPT A;  1F6M A;  1ONF A;  2XLT A;  3AEF A;  5GRT A;  1NPX A;  3KD9 A;  1CHU A;  4PAA A;  2CUL A;  1ZY8 A;  2GAG B;  4J2W A;  3ICR A;  3O0H A;  2YLS A;  4UDQ A;  2C4C A;  1GRB A;  3GD4 A;  3HYV A;  4IV9 A;  5U63 A;  3SGL A;  5HXI A;  5HHF A;  4IA5 A;  3VR8 A;  1H84 A;  4U8N A;  4I58 A;  5KOX A;  2ZZB A;  3CPH G;  1ZOY A;  4OPG A;  3SM8 A;  1CL0 A;  3UKQ A;  1NAA A;  4Z2R A;  4U8I A;  2Y6R A;  2YLT A;  1DJQ A;  1TRB A;  1D4D A;  2WBA A;  3GDP A;  4BJZ A;  3Q6J A;  2IID A;  2WP9 A;  3T14 A;  2C3D A;  3QVP A;  3QVR A;  2ZZ0 A;  3NT6 A;  4Z2U A;  1IUX A;  2BCG G;  1NHR A;  4K2X A;  1H83 A;  2RGJ A;  3NTD A;  1E6E A;  2BC0 A;  3CGC A;  1GV4 A;  4NWZ A;  3SX6 A;  1NHS A;  2BCP A;  4BV6 A;  2XFO A;  4GAP A;  5FMH A;  2WP5 A;  1DJN A;  5TR3 A;  3UOX A;  2BXR A;  1E1L A;  1B5Q A;  1VQW A;  3AD7 B;  2F5Z A;  1CJ4 A;  1EL9 A;  2WOW A;  5DBJ A;  3DJE A;  4H4W A;  1LPF A;  1QJD A;  5GSN A;  2C64 A;  1P2E A;  4TM4 A;  3SZ0 A;  4Y4L A;  4B1B A;  1DOB A;  4BK2 A;  3AE8 A;  3UP4 A;  4E0V A;  3CMM A;  2A87 A;  3CPI G;  2BAC A;  3K7T A;  1VG0 A;  2YAU A;  1H82 A;  1GSN A;  3T2K A;  2XDO A;  4K5R A;  4JDR A;  2BA9 A;  1GER A;  1M64 A;  2RGH A;  2I0Z A;  4GDE A;  1Q1W A;  4GUV A;  4LA1 A;  1ZMC A;  1DOD A;  4U8K A;  2WOI A;  4U8O A;  4CCQ A;  2Q0K A;  3AE2 A;  5U25 A;  2WP6 A;  3UTG A;  3V76 A;  1VG9 A;  5KMP A;  5KRQ A;  2YVF A;  3URH A;  1F3P A;  1PDH A;  3AYJ A;  1JRZ A;  4NZH A;  1IUV A;  1D4C A;  3IF9 A;  4DSG A;  4Z25 A;  5JCI A;  2IVD A;  1PBC A;  5KMQ A;  3QFA A;  4BUR A;  2OLN A;  2WS3 A;  2X8C A;  2QAE A;  2YVJ A;  4WCT A;  4USR A;  1PHH A;  3UTF A;  4BK1 A;  2FBW A;  4U2S A;  4EIQ A;  4GR1 A;  2OA1 A;  1PBB A;  4G6G A;  5J60 A;  1TDO A;  4D04 A;  1YQ3 A;  1GND A;  3BI2 A;  2BC1 A;  4J31 A;  1OJT A;  4B68 A;  1BGJ A;  4M52 A;  3ICS A;  1L9D A;  5CKU A;  4DNA A;  1YY5 A;  1N4W A;  3UKP A;  5JCM A;  3BI4 A;  3II4 A;  1GRE A;  3CGD A;  3CNP A;  3IC9 A;  4FX9 A;  3F8D A;  4B64 A;  1KNR A;  4J36 A;  4H2R A;  5FS8 A;  2WHD A;  3EAN A;  1DNC A;  2XVE A;  4U8L A;  1ZP0 A;  3PVC A;  1L0V A;  3DH9 A;  1GT8 A;  4FK1 A;  2C75 A;  2B7S A;  4YKF A;  1V59 A;  4EQS A;  4YWO A;  4REK A;  3AXB A;  4YTP A;  3AEC A;  4CY8 A;  2X50 A;  1PXC A;  3AD9 B;  1KNP A;  4H4P A;  4JY3 A;  1F8R A;  1OJA A;  4A9W A;  3AYI A;  3BI5 A;  3H8L A;  2BRY A;  1D7Y A;  1ELI A;  1KSS A;  2R46 A;  1BF3 A;  2YG7 A;  2YM1 A;  2YR4 A;  3ATR A;  5EB5 A;  4CCR A;  3WE0 A;  4CNK A;  4EM3 A;  2R0P A;  2GQW A;  2YG5 A;  4ZN0 A;  1NG3 A;  2W0H A;  1GET A;  3NK0 X;  5BRT A;  1VDC A;  1LTX R;  4EM4 A;  2ARD A;  5J7X A;  3DGH A;  4H4X A;  2GR0 A;  3LZX A;  4AP3 A;  2GEW A;  4NTC A;  4YSZ A;  3NYC A;  1GRF A;  2C7G A;  3KU9 A;  4U8J A;  1GRT A;  1BKW A;  2BK4 A;  3D8X A;  1PBF A;  2VZ2 A;  3AYL A;  2XLP A;  1P2H A;  3T37 A;  1PXA A;  2XVH A;  2ZZC A;  3NHO X;  3T2Y A;  5CQF A;  2VVL G;  2XCG A;  4XWR A;  3GWF A;  4GDP A;  2Q0L A;  2WDQ A;  1K0I A;  2XFQ A;  3GWD A;  4Y4M A;  3QSE A;  5KVH A;  5LV9 A;  2C73 A;  3FPZ A;  4OPL A;  3IWA A;  1GAL A;  2WOV A;  4APN A;  1JRX A;  3KLJ A;  2Y6Q A;  3CNS A;  1JOA A;  5IQ4 A;  2OLO A;  4IA6 A;  3G5R A;  2JB1 A;  4K8D A;  4H4Y A;  4RG3 A;  1JNR A;  3GSI A;  4EMJ A;  2Q7V A;  4DGK A;  2BK5 A;  4GCM A;  5ER0 A;  3AEG A;  3FBS A;  1QO8 A;  4U2L A;  4ICY A;  2XVF A;  1W4X A;  3T2Z A;  5BVA A;  2YR6 A;  4AP1 A;  1XDI A;  2C76 A;  2JBV A;  2WU5 A;  1D4E A;  4C3X A;  2QA2 A;  4NTE A;  4U8M A;  2X8G A;  3JSK A;  3EAO A;  3DJJ A;  4YXD A;  3AWI A;  1FEC A;  2J3N A;  4H50 A;  1LVL A;  4UP3 A;  1K0J A;  2E4G A;  1CC6 A;  3VQR A;  3I6D A;  2YR5 A;  3DJD A;  1CC2 A;  1NEK A;  1XHC A;  2Q6U A;  2YLX A;  2B9W A;  4N9X A;  1PJ7 A;  1GTE A;  2YG4 A;  4TM3 A;  1B37 A;  1M6I A;  4IVO B;  1RYI A;  3SYI A;  2XLU A;  2XVJ A;  1XPQ A;  2O9Z A;  3RHA A;  1PS9 A;  4G9K A;  1AOG A;  1BGN A;  1MXT A;  4YSH A;  2C66 A;  2UZZ A;  3UTH A;  2YQU A;  2GR1 A;  1GES A;  2GV8 A;  5KWF A;  4G6H A;  3GD3 A;  2FJE A;  2VRL A;  4JNQ A;  2ZBW A;  3NIX A;  3C96 A;  3P1W A;  3SZF A;  1ZOV A;  2V60 A;  2AQJ A;  3EPT A;  1DOC A;  5KMR A;  1B4V A;  3FG2 P;  1GRH A;  2X99 A;  5M10 A;  3AE5 A;  1LQU A;  1N1P A;  2V5Z A;  1JU2 A;  5FS7 A;  2Z5X A;  3LXD A;  4X4J A;  2V6O A;  1TDE A;  3C4A A;  3P4P A;  1D7L A;  3NK2 X;  1O94 A;  3CIR A;  3UKA A;  3KPF A;  2ACZ A;  2TPR A;  3B3R A;  4AT0 A;  3SQP A;  4A79 A;  2YLZ A;  4G74 A;  4USQ A;  1LQT A;  1COY A;  4OCG A;  3SFD A;  2WU2 A;  4OPC A;  1S3B A;  2H88 A;  4B63 A;  4P9S A;  1N4U A;  2YLR A;  4KPR A;  3DA1 A;  4NEV A;  2JKC A;  2OAL A;  4H4T A;  4X9M A;  3ALL A;  3VRD B;  3ZYX A;  1H81 A;  2CDU A;  4YSY A;  2FJB A;  4NTD A;  4CBQ A;  1EL8 A;  3ZDN A;  4Z43 A;  2QA1 A;  4OPI A;  1GRA A;  1IUS A;  3B6D A;  2PYX A;  3FIM B;  2QCU A;  4H4V A;  3SFE A;  3DK9 A;  3VRA A;  1TDN A;  4YT0 A;  3AE6 A;  4NNJ A;  3ABV A;  3F8R A;  3NN0 X;  4X9N A;  2R0C A;  3AEB A;  3NNE A;  3P4S A;  5FS9 A;  4EMW A;  2BS4 A;  3ALM A;  3DGZ A;  4C5O A;  1SEZ A;  1TDF A;  4AOS A;  1GPE A;  1KF6 A;  1GEU A;  1L9C A;  1Y0P A;  1TYP A;  1IUT A;  1NHQ A;  3CPJ G;  3V3N A;  3IHG A;  3QFB A;  4H4Q A;  3DK8 A;  2EQ9 A;  1F8W A;  2XVI A;  3K7Q X;  3R9U A;  3LAD A;  1EBD A;  3QSM A;  2BS3 A;  2WDV A;  2BAB A;  3GYI A;  3CNJ A;  4XXG A;  4K22 A;  5L46 A;  2BK3 A;  2BYB A;  4A6N A;  2BXS A;  1FCD A;  4GF7 A;  1E1N A;  2YLW A;  1TDK A;  4I59 A;  3RED A;  4B69 A;  3GMC A;  5KOW A;  5KNL A;  3GDN A;  3SY4 A;  2VOU A;  4OVI A;  5JCK A;  1TYT A;  3H4K A;  4EQX A;  5IPY A;  5FS6 A;  4GAV A;  4RG4 A;  1O95 A;  1L9E A;  1BZL A;  3AE9 A;  4YSX A;  2WPE A;  1E1K A;  5C3J A;  3M12 A;  4PAB A;  1ZMD A;  2E1M A;  2GVC A;  5M0Z A;  1BWC A;  2XFU A;  4G73 A;  3OZ2 A;  3ICT A;  4GRT A;  3UOV A;  5C2T A;  1H7W A;  2EQ8 A;  3AB1 A;  4H2Q A;  1N4V A;  3ISH A;  1K4Q A;  3NRN A;  3P4Q A;  2GQF A;  2R9Z A;  1Y56 B;  3OC4 A; 
#chains in the Genus database with same CATH homology
 3KA7 A;  4C77 A;  3H8I A;  1PBD A;  2GR3 A;  3BNU A;  1PJ6 A;  3HZL A;  2NVK X;  2CVJ A;  2EQ7 A;  4LU6 A;  3NKS A;  4CNJ A;  5HY5 A;  5HYM A;  3PS9 A;  3ADA B;  3AE3 A;  3NG7 X;  2JK6 A;  1H7X A;  2H89 A;  2R4E A;  1NDA A;  3AE1 A;  4U8P A;  1PXB A;  2A8X A;  3CND A;  4II2 A;  4U2T A;  3VRB A;  3E1T A;  2HQM A;  1FOH A;  4UDR A;  2R4J A;  1EL5 A;  1H86 A;  4MJW A;  4O5Q A;  4TM1 A;  2XYO A;  1Y56 A;  1XAN A;  5BUL A;  1E39 A;  2YG3 A;  1NG4 A;  4H7U A;  4IVM B;  4FK1 C;  4D03 A;  4A99 A;  2B9Y A;  2XLS A;  3LOV A;  4ADW A;  3F8P A;  4Z2T A;  3V3O A;  4JNA A;  1S2Y A;  3EF6 A;  2DKI A;  1QLB A;  1OJC A;  2CFY A;  4BJY A;  5BUK A;  2WPF A;  2GR2 A;  3UKF A;  3GMB A;  4K7Z A;  4UDP A;  2AAQ A;  1ZK7 A;  2JAE A;  4J56 A;  4LII A;  3DJG X;  2GH5 A;  2IVE A;  2NPX A;  3BHK A;  4H2N A;  4YKG A;  4HA6 A;  1RP0 A;  3M0O A;  3NLC A;  4J57 A;  3IHM A;  1OJD A;  2DKH A;  5KMS A;  4H4Z A;  4J33 A;  3RNM A;  5KVI A;  3RP6 A;  5EB4 A;  2YM2 A;  2YWL A;  4Z24 A;  1ZX9 A;  3RP8 A;  3LB8 A;  4H4R A;  4ECH A;  2VVL A;  1D5T A;  4H2P A;  2WET A;  4CY6 A;  1VRQ B;  1IJH A;  4XWZ A;  3FMW A;  3GRS A;  4II3 A;  3GYX A;  3SXI A;  2B7R A;  2XLR A;  1GXF A;  2R45 A;  1CJC A;  1DOE A;  3COX A;  4O5U A;  4C3Y A;  1FEB A;  4JN9 A;  4TLX A;  2WPC A;  4KX6 A;  4AOX A;  4B66 A;  1JNZ A;  3CN8 A;  3G5S A;  2X3N A;  1E1M A;  1JRY A;  4H4S A;  1NHP A;  3KVE A;  3UP5 A;  3ALJ A;  5U1O A;  4ZCD A;  2WES A;  3T0K A;  2BRA A;  5EBK A;  3UOY A;  2RGO A;  4JQ9 A;  3UKK A;  4HB9 A;  2C67 A;  5JCL A;  1E7P A;  1JEH A;  2WEU A;  3KPK A;  2AR8 A;  1EL7 A;  2YG6 A;  2GRT A;  2V3A A;  4RSL A;  4DSH A;  1ZKQ A;  3ITJ A;  3BHF A;  3M13 A;  5IQ1 A;  3RP7 A;  3GRT A;  3NN6 X;  4A5L A;  1Q1R A;  4EQW A;  1CC4 A;  3ATQ A;  4Z44 A;  5KXJ A;  1REO A;  2E5V A;  3AEE A;  3NK1 X;  1RSG A;  3CTY A;  3HYX A;  3QSS A;  4WX1 A;  3NYF A;  1KSU A;  3VR9 A;  4EQR A;  4J34 A;  2X8H A;  4ZCC A;  1S3E A;  1PBE A;  2VRM A;  2GB0 A;  2V3B A;  1O5W A;  3C4N A;  4H4U A;  3DK4 A;  1LJ1 A;  1S2Q A;  4A6N B;  2VQ7 A;  2WQY A;  2YVG A;  4B65 A;  2XFP A;  2R0G A;  1FEA A;  1K0L A;  3PO7 A;  4EMI A;  2V61 A;  3AED A;  4EIP A;  1CBO A;  3BNM A;  3I3L A;  3CNT A;  2JB3 A;  3G5Q A;  2PHH A;  2RAB A;  1YQ4 A;  3D1C A;  1NEN A;  3UOZ A;  1GRG A;  2GAH B;  1B8S A;  4YTM A;  4Y4N A;  4B67 A;  3NGC X;  2FJA A;  2VQB A;  2BS2 A;  3DME A;  1MOK A;  1KDG A;  1DXL A;  1CJ2 A;  3LJP A;  5JCN A;  1CJ3 A;  3AEA A;  4FDC B;  3NYE A;  2Z5Y A;  4Z26 A;  1LV0 A;  2APG A;  3QJ4 A;  1Z6L A;  1ZDL A;  3UKH A;  1X31 B;  1KFY A;  3HYW A;  4TLZ A;  2B76 A;  3AE4 A;  3S5W A;  3NTA A;  1YKJ A;  2EQ6 A;  3L8K A;  2XFN A;  3GYJ A;  1IUU A;  2C65 A;  3SZW A;  4A65 A;  3AD8 B;  3K7M X;  4BK3 A;  2JB2 A;  3AE7 A;  1PN0 A;  4TM0 A;  1HYU A;  3T31 A;  2WDR A;  3K30 A;  4JY2 A;  2C70 A;  2C3C A;  1GTH A;  1Q9I A;  3L1R A;  3S61 A;  2GMJ A;  4OPD A;  1H6V A;  2VVM A;  4AT2 A;  1MO9 A;  3CGE A;  4CRT A;  1FL2 A;  2A89 A;  1GOS A;  1PJ5 A;  1YQZ A;  2TMD A;  2FJD A;  4C74 A;  5EOW A;  3CGB A;  3UKL A;  4NEW A;  4A7A A;  2OAM A;  4OPU A;  1CF3 A;  3KKJ A;  1OJ9 A;  2B9X A;  4YTN A;  2C72 A;  1IUW A;  3P4R A;  1UKV G;  3NH3 X;  3Q9T A;  3UTE A;  3P9U A;  4K5S A;  2GMH A;  3LZW A;  2GF3 A;  1F8S A;  3SZC A;  3UCL A;  4OPT A;  1F6M A;  1ONF A;  2XLT A;  3AEF A;  5GRT A;  1NPX A;  3KD9 A;  1CHU A;  4PAA A;  2CUL A;  1ZY8 A;  2GAG B;  4J2W A;  3ICR A;  3O0H A;  2YLS A;  4UDQ A;  2C4C A;  1GRB A;  3GD4 A;  3HYV A;  4IV9 A;  5U63 A;  3SGL A;  5HXI A;  5HHF A;  4IA5 A;  3VR8 A;  1H84 A;  4U8N A;  4I58 A;  5KOX A;  2ZZB A;  3CPH G;  1ZOY A;  4OPG A;  3SM8 A;  1CL0 A;  3UKQ A;  1NAA A;  4Z2R A;  4U8I A;  2Y6R A;  2YLT A;  1DJQ A;  1TRB A;  1D4D A;  2WBA A;  3GDP A;  4BJZ A;  3Q6J A;  2IID A;  2WP9 A;  3T14 A;  2C3D A;  3QVP A;  3QVR A;  2ZZ0 A;  3NT6 A;  4Z2U A;  1IUX A;  2BCG G;  1NHR A;  4K2X A;  1H83 A;  2RGJ A;  3NTD A;  1E6E A;  2BC0 A;  3CGC A;  1GV4 A;  4NWZ A;  3SX6 A;  1NHS A;  2BCP A;  4BV6 A;  2XFO A;  4GAP A;  5FMH A;  2WP5 A;  1DJN A;  5TR3 A;  3UOX A;  2BXR A;  1E1L A;  1B5Q A;  1VQW A;  3AD7 B;  2F5Z A;  1CJ4 A;  1EL9 A;  2WOW A;  5DBJ A;  3DJE A;  4H4W A;  1LPF A;  1QJD A;  5GSN A;  2C64 A;  1P2E A;  4TM4 A;  3SZ0 A;  4Y4L A;  4B1B A;  1DOB A;  4BK2 A;  3AE8 A;  3UP4 A;  4E0V A;  3CMM A;  2A87 A;  3CPI G;  2BAC A;  3K7T A;  1VG0 A;  2YAU A;  1H82 A;  1GSN A;  3T2K A;  2XDO A;  4K5R A;  4JDR A;  2BA9 A;  1GER A;  1M64 A;  2RGH A;  2I0Z A;  4GDE A;  1Q1W A;  4GUV A;  4LA1 A;  1ZMC A;  1DOD A;  4U8K A;  2WOI A;  4U8O A;  4CCQ A;  2Q0K A;  3AE2 A;  5U25 A;  2WP6 A;  3UTG A;  3V76 A;  1VG9 A;  5KMP A;  5KRQ A;  2YVF A;  3URH A;  1F3P A;  1PDH A;  3AYJ A;  1JRZ A;  4NZH A;  1IUV A;  1D4C A;  3IF9 A;  4DSG A;  4Z25 A;  5JCI A;  2IVD A;  1PBC A;  5KMQ A;  3QFA A;  4BUR A;  2OLN A;  2WS3 A;  2X8C A;  2QAE A;  2YVJ A;  4WCT A;  4USR A;  1PHH A;  3UTF A;  4BK1 A;  2FBW A;  4U2S A;  4EIQ A;  4GR1 A;  2OA1 A;  1PBB A;  4G6G A;  5J60 A;  1TDO A;  4D04 A;  1YQ3 A;  1GND A;  3BI2 A;  2BC1 A;  4J31 A;  1OJT A;  4B68 A;  1BGJ A;  4M52 A;  3ICS A;  1L9D A;  5CKU A;  4DNA A;  1YY5 A;  1N4W A;  3UKP A;  5JCM A;  3BI4 A;  3II4 A;  1GRE A;  3CGD A;  3CNP A;  3IC9 A;  4FX9 A;  3F8D A;  4B64 A;  1KNR A;  4J36 A;  4H2R A;  5FS8 A;  2WHD A;  3EAN A;  1DNC A;  2XVE A;  4U8L A;  1ZP0 A;  3PVC A;  1L0V A;  3DH9 A;  1GT8 A;  4FK1 A;  2C75 A;  2B7S A;  4YKF A;  1V59 A;  4EQS A;  4YWO A;  4REK A;  3AXB A;  4YTP A;  3AEC A;  4CY8 A;  2X50 A;  1PXC A;  3AD9 B;  1KNP A;  4H4P A;  4JY3 A;  1F8R A;  1OJA A;  4A9W A;  3AYI A;  3BI5 A;  3H8L A;  2BRY A;  1D7Y A;  1ELI A;  1KSS A;  2R46 A;  1BF3 A;  2YG7 A;  2YM1 A;  2YR4 A;  3ATR A;  5EB5 A;  4CCR A;  3WE0 A;  4CNK A;  4EM3 A;  2R0P A;  2GQW A;  2YG5 A;  4ZN0 A;  1NG3 A;  2W0H A;  1GET A;  3NK0 X;  5BRT A;  1VDC A;  1LTX R;  4EM4 A;  2ARD A;  5J7X A;  3DGH A;  4H4X A;  2GR0 A;  3LZX A;  4AP3 A;  2GEW A;  4NTC A;  4YSZ A;  3NYC A;  1GRF A;  2C7G A;  3KU9 A;  4U8J A;  1GRT A;  1BKW A;  2BK4 A;  3D8X A;  1PBF A;  2VZ2 A;  3AYL A;  2XLP A;  1P2H A;  3T37 A;  1PXA A;  2XVH A;  2ZZC A;  3NHO X;  3T2Y A;  5CQF A;  2VVL G;  2XCG A;  4XWR A;  3GWF A;  4GDP A;  2Q0L A;  2WDQ A;  1K0I A;  2XFQ A;  3GWD A;  4Y4M A;  3QSE A;  5KVH A;  5LV9 A;  2C73 A;  3FPZ A;  4OPL A;  3IWA A;  1GAL A;  2WOV A;  4APN A;  1JRX A;  3KLJ A;  2Y6Q A;  3CNS A;  1JOA A;  5IQ4 A;  2OLO A;  4IA6 A;  3G5R A;  2JB1 A;  4K8D A;  4H4Y A;  4RG3 A;  1JNR A;  3GSI A;  4EMJ A;  2Q7V A;  4DGK A;  2BK5 A;  4GCM A;  5ER0 A;  3AEG A;  3FBS A;  1QO8 A;  4U2L A;  4ICY A;  2XVF A;  1W4X A;  3T2Z A;  5BVA A;  2YR6 A;  4AP1 A;  1XDI A;  2C76 A;  2JBV A;  2WU5 A;  1D4E A;  4C3X A;  2QA2 A;  4NTE A;  4U8M A;  2X8G A;  3JSK A;  3EAO A;  3DJJ A;  4YXD A;  3AWI A;  1FEC A;  2J3N A;  4H50 A;  1LVL A;  4UP3 A;  1K0J A;  2E4G A;  1CC6 A;  3VQR A;  3I6D A;  2YR5 A;  3DJD A;  1CC2 A;  1NEK A;  1XHC A;  2Q6U A;  2YLX A;  2B9W A;  4N9X A;  1PJ7 A;  1GTE A;  2YG4 A;  4TM3 A;  1B37 A;  1M6I A;  4IVO B;  1RYI A;  3SYI A;  2XLU A;  2XVJ A;  1XPQ A;  2O9Z A;  3RHA A;  1PS9 A;  4G9K A;  1AOG A;  1BGN A;  1MXT A;  4YSH A;  2C66 A;  2UZZ A;  3UTH A;  2YQU A;  2GR1 A;  1GES A;  2GV8 A;  5KWF A;  4G6H A;  3GD3 A;  2FJE A;  2VRL A;  4JNQ A;  2ZBW A;  3NIX A;  3C96 A;  3P1W A;  3SZF A;  1ZOV A;  2V60 A;  2AQJ A;  3EPT A;  1DOC A;  5KMR A;  1B4V A;  3FG2 P;  1GRH A;  2X99 A;  5M10 A;  3AE5 A;  1LQU A;  1N1P A;  2V5Z A;  1JU2 A;  5FS7 A;  2Z5X A;  3LXD A;  4X4J A;  2V6O A;  1TDE A;  3C4A A;  3P4P A;  1D7L A;  3NK2 X;  1O94 A;  3CIR A;  3UKA A;  3KPF A;  2ACZ A;  2TPR A;  3B3R A;  4AT0 A;  3SQP A;  4A79 A;  2YLZ A;  4G74 A;  4USQ A;  1LQT A;  1COY A;  4OCG A;  3SFD A;  2WU2 A;  4OPC A;  1S3B A;  2H88 A;  4B63 A;  4P9S A;  1N4U A;  2YLR A;  4KPR A;  3DA1 A;  4NEV A;  2JKC A;  2OAL A;  4H4T A;  4X9M A;  3ALL A;  3VRD B;  3ZYX A;  1H81 A;  2CDU A;  4YSY A;  2FJB A;  4NTD A;  4CBQ A;  1EL8 A;  3ZDN A;  4Z43 A;  2QA1 A;  4OPI A;  1GRA A;  1IUS A;  3B6D A;  2PYX A;  3FIM B;  2QCU A;  4H4V A;  3SFE A;  3DK9 A;  3VRA A;  1TDN A;  4YT0 A;  3AE6 A;  4NNJ A;  3ABV A;  3F8R A;  3NN0 X;  4X9N A;  2R0C A;  3AEB A;  3NNE A;  3P4S A;  5FS9 A;  4EMW A;  2BS4 A;  3ALM A;  3DGZ A;  4C5O A;  1SEZ A;  1TDF A;  4AOS A;  1GPE A;  1KF6 A;  1GEU A;  1L9C A;  1Y0P A;  1TYP A;  1IUT A;  1NHQ A;  3CPJ G;  3V3N A;  3IHG A;  3QFB A;  4H4Q A;  3DK8 A;  2EQ9 A;  1F8W A;  2XVI A;  3K7Q X;  3R9U A;  3LAD A;  1EBD A;  3QSM A;  2BS3 A;  2WDV A;  2BAB A;  3GYI A;  3CNJ A;  4XXG A;  4K22 A;  5L46 A;  2BK3 A;  2BYB A;  4A6N A;  2BXS A;  1FCD A;  4GF7 A;  1E1N A;  2YLW A;  1TDK A;  4I59 A;  3RED A;  4B69 A;  3GMC A;  5KOW A;  5KNL A;  3GDN A;  3SY4 A;  2VOU A;  4OVI A;  5JCK A;  1TYT A;  3H4K A;  4EQX A;  5IPY A;  5FS6 A;  4GAV A;  4RG4 A;  1O95 A;  1L9E A;  1BZL A;  3AE9 A;  4YSX A;  2WPE A;  1E1K A;  5C3J A;  3M12 A;  4PAB A;  1ZMD A;  2E1M A;  2GVC A;  5M0Z A;  1BWC A;  2XFU A;  4G73 A;  3OZ2 A;  3ICT A;  4GRT A;  3UOV A;  5C2T A;  1H7W A;  2EQ8 A;  3AB1 A;  4H2Q A;  1N4V A;  3ISH A;  1K4Q A;  3NRN A;  3P4Q A;  2GQF A;  2R9Z A;  1Y56 B;  3OC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...