3UOYA

Crystal structure of otemo complex with fad and nadp (form 1)
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
540
structure length
537
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords OTEMO
total genus 192
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uoyA01
2VQBA 3AXBA 4IA6A 1GERA 5DBJA 4EQSA 2R45A 1NAAA 3NGCX 4Z44A 1L9DA 2B9WA 3VR8A 1V59A 4RSLA 2C73A 1H82A 1GRHA 3ABVA 2A87A 3I3LA 2BC1A 4H4WA 3ATRA 3AE3A 4AT0A 4FK1C 2FJBA 1Y0PA 2GR0A 4J33A 4M52A 4Y4NA 1H83A 2YVGA 2FJDA 4JY3A 1NPXA 1EBDA 1JOAA 3EPTA 1BGJA 1GRGA 1CJCA 4H2QA 4H4YA 3UOXA 3LADA 1ZX9A 4C3XA 3VQRA 3P4QA 4XXGA 3C4AA 2X3NA 2YM2A 1ZY8A 2QAEA 2R0PA 4Z2UA 3P9UA 3UCLA 1DOBA 2R4JA 4OPCA 3UKPA 4OPLA 1KNPA 4BV6A 3L8KA 1MXTA 4PABA 2GEWA 1CC4A 1OJ9A 2BS3A 2VVLA 1JRXA 5KVIA 1GRTA 1LJ1A 2ZZ0A 4WX1A 3UKAA 4BK2A 1COYA 2WU5A 4I59A 3F8DA 1EL7A 2X8CA 4GDPA 4YT0A 4YSZA 1NENA 5CQFA 4E0VA 4TM1A 4LU6A 5M10A 3UKFA 4FX9A 1E1KA 4P9SA 1N4WA 1N1PA 2A8XA 3AE8A 2BK4A 2V61A 2WOIA 3P4RA 2CVJA 1O5WA 3PO7A 4IA5A 4AP1A 1TDEA 2TPRA 2YVJA 1X31B 1GNDA 3SFDA 2F5ZA 1KFYA 3BHKA 4EIQA 1CF3A 3KA7A 4TLZA 3AE7A 4FK1A 4NTEA 4B66A 2JK6A 2YG3A 3NTAA 3WE0A 3CNPA 1BF3A 1D5TA 2B7SA 3AEAA 4JQ9A 2YR4A 1JNRA 1KNRA 3FG2P 4H50A 2V3AA 4K7ZA 3RP8A 1Y56A 1ZMDA 2A89A 1D4EA 1F8RA 2VRMA 4CY8A 4K5RA 3VRAA 5M0ZA 2UZZA 4JN9A 2DKHA 1GXFA 2IVDA 1XHCA 3UP5A 4D04A 1YQ3A 2YG5A 4CBQA 1DJNA 3BNUA 4BK3A 1E7PA 1S2YA 3AE5A 4USRA 3REDA 3DH9A 2BCGG 3NTDA 3FMWA 4CNJA 1GESA 3BNMA 4YTPA 2GRTA 1E39A 3QVPA 1RP0A 2OLOA 4A79A 2BCPA 3AB1A 1PXBA 3IHMA 3LXDA 4K2XA 4U8LA 1E1NA 1LTXR 1GETA 3NIXA 5HHFA 2Q0KA 1DOEA 2YG7A 3NK1X 3OZ2A 2GB0A 4REKA 1H7WA 4TM0A 2E4GA 1GOSA 3GRTA 3GD4A 2JAEA 3NT6A 2XLPA 3C96A 1K0LA 1OJAA 4O5QA 1KDGA 4J36A 4IVMB 4BJYA 4J34A 4X9NA 2XFQA 3RHAA 5C2TA 3G5RA 2BXRA 3I6DA 4YXDA 4FDCB 5BVAA 3GRSA 4GUVA 4Z2RA 3NH3X 4EMWA 1NHRA 3CNSA 4ZN0A 2BS4A 1ONFA 2HQMA 2B9XA 2YLTA 3NRNA 2BABA 1QJDA 4J31A 1VG0A 2VOUA 3AEEA 1NG4A 2H89A 2OLNA 1JNZA 4Z26A 1DJQA 3B3RA 3GWFA 4YTNA 1LQUA 1IUWA 4ECHA 3GMBA 1LV0A 3D8XA 3QVRA 3DMEA 1JRYA 3BHFA 4OPTA 3CGCA 4USQA 3UOYA 1SEZA 4Y4LA 3ALMA 3S5WA 4U8KA 1CHUA 2GVCA 1NHPA 1LPFA 4H4TA 1TYTA 2QA1A 4J56A 1AOGA 5U63A 5EOWA 4OPUA 1F3PA 1YQZA 3NYEA 2BACA 3UTFA 1PS9A 3UTHA 3AYJA 1D7YA 4N9XA 2VVMA 3AE1A 2YLRA 3Q9TA 4EMIA 3PS9A 3O0HA 2C72A 4U8IA 2XFPA 1GTEA 2YVFA 3QSSA 4AP3A 1O95A 3II4A 3UOZA 1NHSA 1DODA 4GR1A 2XVEA 3GMCA 4J2WA 1H6VA 1REOA 2JB3A 4U8JA 4OPIA 4JNAA 3M12A 2WESA 5HYMA 3GSIA 3GDPA 1QO8A 4EQXA 1PBFA 5U1OA 3RP7A 2C67A 2ZZBA 3UKQA 4ADWA 1BGNA 5IQ4A 2ACZA 2R4EA 5KWFA 1K0JA 2EQ7A 3CN8A 4H4QA 5JCNA 3K30A 4Z25A 5J60A 1PBBA 4H2NA 5TR3A 2OALA 1L0VA 1OJCA 5KOXA 3KU9A 2GR3A 2WETA 2J3NA 2C75A 1KF6A 1GV4A 3M13A 3KLJA 3AEFA 3CTYA 1E6EA 3AYIA 3K7MX 5BUKA 1TDOA 3S61A 3NNEA 3FPZA 1PDHA 1GRBA 1XDIA 4APNA 1GSNA 1JRZA 1PN0A 4EM3A 2GH5A 3BI5A 4U2SA 4X4JA 4BJZA 1FCDA 2H88A 3ICSA 5FS8A 2RABA 3C4NA 4A7AA 5FS7A 2EQ9A 4GRTA 3AD9B 3UTEA 5JCIA 3DJJA 4CNKA 2CFYA 3AE2A 2VRLA 3ZYXA 3CGDA 2OAMA 3GYJA 3IWAA 2B7RA 1BWCA 2X8HA 1YKJA 4H4UA 3LZWA 4ICYA 3KVEA 4AOSA 4LIIA 4B65A 4A65A 1H84A 4EQRA 3CNTA 2XFOA 2ZZCA 4OPGA 3VR9A 3CNDA 2NPXA 3V76A 3VRDB 2VQ7A 2BC0A 4BURA 4J57A 3R9UA 1H81A 1M64A 4UDQA 1GPEA 2GMJA 2XYOA 2YQUA 1CJ4A 2XVJA 3CGEA 2V3BA 1P2EA 3RNMA 2RGHA 1BKWA 4MJWA 4OVIA 4HB9A 1YQ4A 4UDRA 5GRTA 3OC4A 2WPFA 1CC2A 1VQWA 2R9ZA 1K4QA 3SM8A 5FS9A 4GDEA 3SQPA 3IHGA 2C3CA 3UKLA 2V60A 4TLXA 1EL5A 2FBWA 1TDFA 1ZOYA 2GF3A 2WHDA 2XCGA 4H4VA 4OCGA 4C77A 4D03A 3ISHA 4H2PA 4YKGA 1F8WA 2JBVA 4C3YA 3H8LA 2R0GA 2WQYA 2YAUA 4YSHA 1RSGA 2GAHB 2FJEA 1XANA 1F6MA 3B6DA 2C64A 1S2QA 3NLCA 1CJ2A 4O5UA 4B68A 1Q1RA 4AOXA 4JY2A 2DKIA 3AE4A 4U2TA 2R0CA 2AQJA 2YLWA 2QA2A 5KXJA 1ZOVA 3IF9A 1B5QA 1DNCA 2WBAA 1PJ5A 5BULA 3UKHA 3H8IA 2C66A 2BK5A 3NK2X 4C5OA 2Y6RA 4A99A 3IC9A 1CL0A 2BK3A 4OPDA 4Z43A 1FEBA 3G5QA 4U2LA 1D4DA 5FS6A 5C3JA 4A6NA 4Z24A 1OJTA 1B37A 1PBCA 3D1CA 2WP5A 4B67A 3ADAB 3H4KA 4TM3A 4IVOB 2YG4A 2GQFA 3NG7X 2PHHA 3ATQA 2VVLG 2IIDA 1ELIA 1PJ7A 1ZDLA 4XWZA 1N4UA 1L9EA 3DGHA 3GWDA 1JEHA 2Y6QA 4TM4A 4H4RA 3RP6A 3GYIA 1D7LA 4JDRA 3UOVA 3SGLA 2W0HA 4B63A 3NKSA 2CULA 4LA1A 5EB4A 1GRAA 4UDPA 3UKKA 4HA6A 1VDCA 4NZHA 4CRTA 1PHHA 4IV9A 1H86A 2ZBWA 5EBKA 5KOWA 5HY5A 1GEUA 2XVFA 1TDNA 3AEGA 3SFEA 4NEWA 4DGKA 1IUTA 1ZMCA 2BS2A 2GAGB 3CPJG 3ICTA 4B1BA 1OJDA 2FJAA 2O9ZA 2GQWA 2AAQA 1IUXA 1ZK7A 4JNQA 2WDVA 1VRQB 4U8OA 4A5LA 4U8PA 4U8MA 2JB1A 2WP9A 3ICRA 5FMHA 3DJGX 4H4SA 1KSSA 1MOKA 2XLRA 3AECA 1E1MA 1S3EA 4B64A 1FECA 2TMDA 2X50A 4H2RA 4EM4A 2R46A 4ZCDA 1FL2A 1TDKA 1LQTA 4NTCA 1BZLA 2OA1A 1XPQA 3EF6A 4CCRA 3ALLA 2YLXA 3F8PA 2XVIA 1PJ6A 3Q6JA 1IUUA 1TYPA 1H7XA 1EL8A 1PBDA 3M0OA 3CPIG 1O94A 2WDRA 3CGBA 2XDOA 1K0IA 1GT8A 2Q7VA 4DSHA 3QJ4A 4H4XA 3AD8B 1CC6A 4Y4MA 4EIPA 2WOVA 1LVLA 1GREA 3G5SA 4H4PA 1F8SA 1B4VA 3GDNA 2AR8A 4C74A 2Q6UA 2QCUA 2YR6A 3ALJA 4I58A 1VG9A 4KPRA 3QSEA 1IUVA 1FEAA 1P2HA 2BXSA 3AEDA 1Q1WA 2XVHA 2YR5A 3AE6A 3V3OA 4Z2TA 2I0ZA 1ZP0A 2YLZA 4U8NA 4RG3A 4A6NB 2E5VA 1NDAA 4X9MA 5GSNA 1ZKQA 2YWLA 3KPFA 4NEVA 3LB8A 2JB2A 5BRTA 2EQ8A 3FIMB 2X99A 2CDUA 2PYXA 1IUSA 2WPEA 3P4SA 4NTDA 5HXIA 1B8SA 4A9WA 3DJDA 4WCTA 1Y56B 2XLTA 3AWIA 2C3DA 3LOVA 4H4ZA 2B9YA 1KSUA 2C65A 3GD3A 3NYCA 3T37A 5J7XA 2XFNA 1PBEA 3DGZA 1CBOA 5IQ1A 5U25A 3UP4A 2WOWA 3F8RA 3NK0X 3ZDNA 3E1TA 5EB5A 3CNJA 1N4VA 5KVHA 2X8GA 5ER0A 3AD7B 3UTGA 3VRBA 2NVKX 1UKVG 2Z5YA 4KX6A 1EL9A 2IVEA 1S3BA 2WEUA 1MO9A 3P4PA 1NHQA 4ZCCA 2RGJA 3PVCA 4CY6A 3AE9A 3V3NA 1GALA 4K8DA 4K5SA 3FBSA 1M6IA 3DK8A 3L1RA 2RGOA 2YM1A 1Q9IA 3KKJA 3DA1A 5KRQA 1GRFA 4XWRA 4H7UA 2XLUA 3COXA 3QSMA 3AEBA 4UP3A 5JCKA 4K22A 2GMHA 2GV8A 3ITJA 5L46A 2C7GA 3LZXA 3NN6X 3NN0X 2WU2A 2WS3A 1PXAA 1DXLA 1QLBA 5IPYA 2Z5XA 3DJEA 3HZLA 5JCMA 2GR1A 1GTHA 1W4XA 1HYUA 2JKCA 2BYBA 4BK1A 1IJHA 3K7TA 1JU2A 4YTMA 3JSKA 4EMJA 4YSXA 3NHOX 1L9CA 2B76A 1DOCA 4YWOA 1NEKA 2APGA 1CJ3A 3LJPA 2BA9A 2V6OA 2XFUA 3NYFA 3CPHG 3DK4A 2VZ2A 1PXCA 3KD9A 3CIRA 3BI4A 1E1LA 3QFBA 4DNAA 5LV9A 2YLSA 4DSGA 1Z6LA 1YY5A 2C76A 4GCMA 3QFAA 4EQWA 1TRBA 2WPCA 4B69A 4GF7A 4PAAA 3P1WA 2YG6A 4AT2A 2WDQA 1NG3A 2WP6A 3DK9A 3BI2A 3K7QX 3URHA 4YKFA 1RYIA 2E1MA 2XLSA 5CKUA 5JCLA 4YSYA 2EQ6A 2V5ZA 3EANA 2ARDA 3AYLA 2GR2A 3EAOA 4RG4A 1FOHA 2C70A 4CCQA 1D4CA 2Q0LA
chains in the Genus database with same CATH superfamily
2VQBA 3AXBA 4IA6A 1GERA 5DBJA 4EQSA 2R45A 1NAAA 3NGCX 4Z44A 1L9DA 2B9WA 4NWZA 1V59A 3VR8A 4RSLA 2C73A 1H82A 1GRHA 3ABVA 2A87A 3I3LA 2BC1A 4H4WA 3ATRA 3AE3A 4AT0A 4FK1C 2FJBA 1Y0PA 2GR0A 4J33A 4M52A 4Y4NA 1H83A 2YVGA 2FJDA 4JY3A 1NPXA 1EBDA 1JOAA 3EPTA 1BGJA 1GRGA 1CJCA 4H2QA 4H4YA 3UOXA 3LADA 1ZX9A 4C3XA 3VQRA 3P4QA 4XXGA 3C4AA 2X3NA 2YM2A 1ZY8A 2QAEA 2R0PA 5KNLA 4Z2UA 3P9UA 3UCLA 1DOBA 2R4JA 4OPCA 3UKPA 4OPLA 1KNPA 4BV6A 3L8KA 1MXTA 4PABA 2GEWA 1CC4A 1OJ9A 2BS3A 2VVLA 1JRXA 5KVIA 1GRTA 1LJ1A 2ZZ0A 4WX1A 4G73A 3UKAA 4BK2A 1COYA 2WU5A 4I59A 3F8DA 1EL7A 2X8CA 4GDPA 4YT0A 4YSZA 1NENA 5CQFA 4E0VA 4TM1A 4LU6A 5M10A 3UKFA 4FX9A 1E1KA 4P9SA 1N4WA 1N1PA 2A8XA 3AE8A 2BK4A 2V61A 2WOIA 3P4RA 2CVJA 1O5WA 3PO7A 4IA5A 4AP1A 1TDEA 2TPRA 3T14A 2YVJA 1X31B 1GNDA 3SFDA 2F5ZA 1KFYA 3BHKA 4EIQA 1CF3A 3KA7A 4TLZA 3AE7A 4FK1A 4NTEA 4B66A 2JK6A 2YG3A 3NTAA 3WE0A 3CNPA 1BF3A 1D5TA 2B7SA 3AEAA 4JQ9A 2YR4A 1JNRA 1KNRA 3FG2P 4H50A 2V3AA 4K7ZA 3RP8A 1Y56A 1ZMDA 2A89A 1D4EA 1F8RA 2VRMA 4CY8A 5KMSA 4K5RA 3VRAA 4G6GA 5M0ZA 2UZZA 4JN9A 4II3A 2DKHA 1GXFA 2IVDA 1XHCA 3UP5A 4D04A 1YQ3A 2YG5A 4CBQA 1DJNA 3BNUA 4BK3A 1E7PA 1S2YA 3AE5A 4USRA 3REDA 3DH9A 2BCGG 3NTDA 4GAPA 3FMWA 4CNJA 1GESA 3BNMA 2BRYA 4YTPA 2GRTA 1E39A 3QVPA 1RP0A 2OLOA 4A79A 2BCPA 3AB1A 1PXBA 3IHMA 3LXDA 4K2XA 4U8LA 1E1NA 1LTXR 1GETA 3NIXA 5HHFA 2Q0KA 3T31A 1DOEA 2YG7A 3NK1X 3OZ2A 2GB0A 4REKA 1H7WA 4TM0A 2E4GA 1GOSA 3GRTA 3GD4A 2JAEA 3NT6A 2XLPA 3C96A 1K0LA 1OJAA 4O5QA 1KDGA 4J36A 4IVMB 4BJYA 4J34A 4X9NA 2XFQA 3RHAA 5C2TA 3G5RA 2BXRA 3I6DA 4YXDA 4FDCB 5KMPA 5BVAA 3GRSA 4GUVA 4Z2RA 3NH3X 4EMWA 1NHRA 3CNSA 4ZN0A 2BS4A 1ONFA 2HQMA 2B9XA 2YLTA 3NRNA 2BABA 1QJDA 4J31A 1VG0A 2VOUA 3AEEA 1NG4A 2H89A 2OLNA 1JNZA 4G6HA 4Z26A 1DJQA 3B3RA 3GWFA 4YTNA 1LQUA 1IUWA 4ECHA 3GMBA 1LV0A 3D8XA 3QVRA 3DMEA 1JRYA 3BHFA 4OPTA 3CGCA 4USQA 3UOYA 1SEZA 4Y4LA 3ALMA 3S5WA 4U8KA 1CHUA 2GVCA 1NHPA 1LPFA 4H4TA 1TYTA 2QA1A 4J56A 1AOGA 5U63A 5EOWA 4OPUA 1F3PA 1YQZA 4II2A 3NYEA 2BACA 3UTFA 1PS9A 3UTHA 3AYJA 1D7YA 4N9XA 2VVMA 3AE1A 2YLRA 3Q9TA 4EMIA 3PS9A 3O0HA 2C72A 4U8IA 2XFPA 1GTEA 2YVFA 2C4CA 3QSSA 4AP3A 1O95A 3II4A 3UOZA 1NHSA 1DODA 4GR1A 2XVEA 3GMCA 4J2WA 1H6VA 1REOA 2JB3A 4U8JA 4OPIA 4JNAA 3M12A 2WESA 5HYMA 3GSIA 3GDPA 1QO8A 4EQXA 1PBFA 5U1OA 3RP7A 2C67A 2BRAA 2ZZBA 3UKQA 4ADWA 1BGNA 5IQ4A 2ACZA 2R4EA 3GYXA 5KWFA 1K0JA 2EQ7A 3CN8A 4H4QA 5JCNA 3K30A 4Z25A 5J60A 1PBBA 4H2NA 5TR3A 2OALA 1L0VA 1OJCA 5KOXA 3KU9A 2GR3A 2WETA 2J3NA 2C75A 1KF6A 1GV4A 3M13A 3KLJA 3AEFA 3CTYA 1E6EA 3HYWA 3AYIA 3K7MX 5BUKA 1TDOA 3S61A 3NNEA 3FPZA 1PDHA 1GRBA 1XDIA 4APNA 1GSNA 1JRZA 1PN0A 4EM3A 2GH5A 3BI5A 4U2SA 4X4JA 4BJZA 1FCDA 2H88A 3ICSA 5FS8A 2RABA 3C4NA 4A7AA 3T2ZA 5FS7A 2EQ9A 4GRTA 3AD9B 3UTEA 5JCIA 3DJJA 4CNKA 2CFYA 3AE2A 2VRLA 3ZYXA 4G9KA 3CGDA 2OAMA 3GYJA 3IWAA 3T2KA 2B7RA 1BWCA 2X8HA 1YKJA 4H4UA 3LZWA 4ICYA 3KVEA 4AOSA 4LIIA 4B65A 4A65A 1H84A 4EQRA 3CNTA 2XFOA 2ZZCA 4OPGA 3VR9A 3CNDA 2NPXA 3V76A 3VRDB 2VQ7A 2BC0A 4BURA 4J57A 3R9UA 1H81A 1M64A 4UDQA 1GPEA 2GMJA 2XYOA 2YQUA 1CJ4A 2XVJA 3CGEA 2V3BA 1P2EA 3RNMA 2RGHA 1BKWA 4MJWA 4OVIA 4HB9A 1YQ4A 4UDRA 5GRTA 3OC4A 2WPFA 1CC2A 1VQWA 2R9ZA 1K4QA 3SM8A 5FS9A 4GDEA 3SQPA 3IHGA 2C3CA 3UKLA 2V60A 4TLXA 1EL5A 2FBWA 1TDFA 1ZOYA 2GF3A 2WHDA 2XCGA 4H4VA 4OCGA 4C77A 4D03A 3ISHA 4H2PA 4YKGA 1F8WA 2JBVA 3HYXA 3SZ0A 4C3YA 3H8LA 2R0GA 2WQYA 2YAUA 3SY4A 4YSHA 1RSGA 2GAHB 2FJEA 1XANA 1F6MA 3B6DA 2C64A 1S2QA 3NLCA 1CJ2A 4O5UA 4B68A 1Q1RA 4AOXA 4JY2A 2DKIA 3AE4A 4U2TA 2R0CA 2AQJA 2YLWA 2QA2A 5KXJA 1ZOVA 3IF9A 1B5QA 1DNCA 2WBAA 1PJ5A 5BULA 3UKHA 3H8IA 2C66A 2BK5A 3NK2X 4C5OA 2Y6RA 4A99A 3IC9A 1CL0A 2BK3A 4OPDA 4Z43A 1FEBA 3G5QA 4U2LA 1D4DA 5FS6A 5C3JA 4A6NA 4Z24A 1OJTA 1B37A 1PBCA 3D1CA 2WP5A 4B67A 3ADAB 3H4KA 4TM3A 4IVOB 2YG4A 2GQFA 3NG7X 2PHHA 3ATQA 2VVLG 2IIDA 1ELIA 1PJ7A 1ZDLA 4XWZA 1N4UA 1L9EA 3DGHA 3GWDA 1JEHA 5KMQA 2Y6QA 4TM4A 4H4RA 3RP6A 3GYIA 1D7LA 4JDRA 3UOVA 3SGLA 2W0HA 4B63A 3NKSA 2CULA 4LA1A 5EB4A 1GRAA 4UDPA 3UKKA 3SZFA 4HA6A 1VDCA 4NZHA 4CRTA 1PHHA 4IV9A 1H86A 2ZBWA 5EBKA 5KOWA 5HY5A 1GEUA 2XVFA 1TDNA 3AEGA 3SFEA 4NEWA 4DGKA 1IUTA 1ZMCA 2BS2A 2GAGB 3CPJG 3ICTA 4B1BA 1OJDA 2FJAA 2O9ZA 2GQWA 2AAQA 1IUXA 1ZK7A 4JNQA 2WDVA 1VRQB 4U8OA 4A5LA 4U8PA 4U8MA 2JB1A 2WP9A 3ICRA 5FMHA 3DJGX 4H4SA 1KSSA 3T2YA 1MOKA 2XLRA 3AECA 1E1MA 1S3EA 4B64A 1FECA 2TMDA 2X50A 4H2RA 4EM4A 2R46A 4ZCDA 1FL2A 1TDKA 1LQTA 4NTCA 1BZLA 2OA1A 1XPQA 3EF6A 4CCRA 3ALLA 2YLXA 3F8PA 2XVIA 1PJ6A 3Q6JA 1IUUA 1TYPA 1H7XA 3SZCA 1EL8A 1PBDA 3M0OA 3CPIG 1O94A 2WDRA 3CGBA 2XDOA 1K0IA 1GT8A 2Q7VA 4DSHA 3QJ4A 4H4XA 3AD8B 1CC6A 4Y4MA 3SZWA 4EIPA 2WOVA 1LVLA 1GREA 3G5SA 4H4PA 1F8SA 1B4VA 3GDNA 4GAVA 2AR8A 4C74A 2Q6UA 2QCUA 2YR6A 3ALJA 4I58A 1VG9A 4KPRA 3QSEA 1IUVA 1FEAA 1P2HA 3SXIA 2BXSA 3AEDA 1Q1WA 2XVHA 2YR5A 3AE6A 3V3OA 4Z2TA 2I0ZA 1ZP0A 2YLZA 4U8NA 4RG3A 4A6NB 2E5VA 1NDAA 3SYIA 4X9MA 5GSNA 1ZKQA 2YWLA 3KPFA 4NEVA 3LB8A 2JB2A 5BRTA 2EQ8A 3FIMB 2X99A 2CDUA 2PYXA 1IUSA 2WPEA 3P4SA 4NTDA 5HXIA 1B8SA 4A9WA 3DJDA 4WCTA 1Y56B 2XLTA 3AWIA 2C3DA 3LOVA 4H4ZA 2B9YA 3SX6A 1KSUA 2C65A 3GD3A 3NYCA 3T0KA 3T37A 5J7XA 2XFNA 1PBEA 3DGZA 1CBOA 5IQ1A 5U25A 3UP4A 2WOWA 3F8RA 3NK0X 3ZDNA 3E1TA 5EB5A 3CNJA 1N4VA 5KVHA 2X8GA 5ER0A 3AD7B 3UTGA 3VRBA 2NVKX 1UKVG 2Z5YA 4KX6A 1EL9A 2IVEA 1S3BA 2WEUA 1MO9A 3P4PA 1NHQA 4G74A 2RGJA 3PVCA 4ZCCA 4CY6A 3AE9A 3V3NA 1GALA 4K8DA 4K5SA 3FBSA 1M6IA 3DK8A 3L1RA 2RGOA 2YM1A 1Q9IA 3KKJA 3DA1A 4NNJA 5KRQA 1GRFA 4XWRA 4H7UA 2XLUA 3COXA 3QSMA 3AEBA 4UP3A 5JCKA 4K22A 2GMHA 2GV8A 3ITJA 5L46A 2C7GA 3LZXA 3NN6X 3NN0X 2WU2A 2WS3A 1PXAA 1DXLA 1QLBA 5IPYA 2Z5XA 3DJEA 3HZLA 5JCMA 5KMRA 2GR1A 1GTHA 1W4XA 1HYUA 2JKCA 2BYBA 4BK1A 1IJHA 3K7TA 1JU2A 4YTMA 3JSKA 4EMJA 4YSXA 3NHOX 1L9CA 2B76A 1DOCA 4YWOA 1NEKA 2APGA 1CJ3A 3LJPA 2BA9A 2V6OA 2XFUA 3NYFA 3CPHG 3DK4A 2VZ2A 1PXCA 3KD9A 3CIRA 3BI4A 1E1LA 3QFBA 4DNAA 5LV9A 2YLSA 4DSGA 1Z6LA 1YY5A 2C76A 4GCMA 3QFAA 4EQWA 1TRBA 2WPCA 3HYVA 4B69A 4GF7A 3KPKA 4PAAA 3P1WA 3CMMA 2YG6A 4AT2A 2WDQA 1NG3A 2WP6A 3DK9A 3BI2A 3K7QX 3URHA 4YKFA 1RYIA 2E1MA 2XLSA 5CKUA 5JCLA 4YSYA 2EQ6A 2V5ZA 3EANA 2ARDA 3AYLA 2GR2A 3EAOA 4RG4A 1FOHA 2C70A 4CCQA 1D4CA 2Q0LA
chains in the Genus database with same CATH topology
2VQBA 3AXBA 4IA6A 1GERA 5DBJA 4EQSA 2R45A 1NAAA 3NGCX 4Z44A 1L9DA 2B9WA 4NWZA 1V59A 3VR8A 4RSLA 2C73A 1H82A 1GRHA 3ABVA 2A87A 3I3LA 2BC1A 4H4WA 3ATRA 3AE3A 4AT0A 4FK1C 2FJBA 1Y0PA 2GR0A 4J33A 4M52A 4Y4NA 1H83A 2YVGA 2FJDA 4JY3A 1NPXA 1EBDA 1JOAA 3EPTA 1BGJA 1GRGA 1CJCA 4H2QA 4H4YA 3UOXA 3LADA 1ZX9A 4C3XA 3VQRA 3P4QA 4XXGA 3C4AA 2X3NA 2YM2A 1ZY8A 2QAEA 2R0PA 5KNLA 4Z2UA 3P9UA 3UCLA 1DOBA 2R4JA 4OPCA 3UKPA 4OPLA 1KNPA 4BV6A 3L8KA 1MXTA 4PABA 2GEWA 1CC4A 1OJ9A 2BS3A 2VVLA 1JRXA 5KVIA 1GRTA 1LJ1A 2ZZ0A 4WX1A 4G73A 3UKAA 4BK2A 1COYA 2WU5A 4I59A 3F8DA 1EL7A 2X8CA 4GDPA 4YT0A 4YSZA 1NENA 5CQFA 4E0VA 4TM1A 4LU6A 5M10A 3UKFA 4FX9A 1E1KA 4P9SA 1N4WA 1N1PA 2A8XA 3AE8A 2BK4A 2V61A 2WOIA 3P4RA 2CVJA 1O5WA 3PO7A 4IA5A 4AP1A 1TDEA 2TPRA 3T14A 2YVJA 1X31B 1GNDA 3SFDA 2F5ZA 1KFYA 3BHKA 4EIQA 1CF3A 3KA7A 4TLZA 3AE7A 4FK1A 4NTEA 4B66A 2JK6A 2YG3A 3NTAA 3WE0A 3CNPA 1BF3A 1D5TA 2B7SA 3AEAA 4JQ9A 2YR4A 1JNRA 1KNRA 3FG2P 4H50A 2V3AA 4K7ZA 3RP8A 1Y56A 1ZMDA 2A89A 1D4EA 1F8RA 2VRMA 4CY8A 5KMSA 4K5RA 3VRAA 4G6GA 5M0ZA 2UZZA 4JN9A 4II3A 2DKHA 1GXFA 2IVDA 1XHCA 3UP5A 4D04A 1YQ3A 2YG5A 4CBQA 1DJNA 3BNUA 4BK3A 1E7PA 1S2YA 3AE5A 4USRA 3REDA 3DH9A 2BCGG 3NTDA 4GAPA 3FMWA 4CNJA 1GESA 3BNMA 2BRYA 4YTPA 2GRTA 1E39A 3QVPA 1RP0A 2OLOA 4A79A 2BCPA 3AB1A 1PXBA 3IHMA 3LXDA 4K2XA 4U8LA 1E1NA 1LTXR 1GETA 3NIXA 5HHFA 2Q0KA 3T31A 1DOEA 2YG7A 3NK1X 3OZ2A 2GB0A 4REKA 1H7WA 4TM0A 2E4GA 1GOSA 3GRTA 3GD4A 2JAEA 3NT6A 2XLPA 3C96A 1K0LA 1OJAA 4O5QA 1KDGA 4J36A 4IVMB 4BJYA 4J34A 4X9NA 2XFQA 3RHAA 5C2TA 3G5RA 2BXRA 3I6DA 4YXDA 4FDCB 5KMPA 5BVAA 3GRSA 4GUVA 4Z2RA 3NH3X 4EMWA 1NHRA 3CNSA 4ZN0A 2BS4A 1ONFA 2HQMA 2B9XA 2YLTA 3NRNA 2BABA 1QJDA 4J31A 1VG0A 2VOUA 3AEEA 1NG4A 2H89A 2OLNA 1JNZA 4G6HA 4Z26A 1DJQA 3B3RA 3GWFA 4YTNA 1LQUA 1IUWA 4ECHA 3GMBA 1LV0A 3D8XA 3QVRA 3DMEA 1JRYA 3BHFA 4OPTA 3CGCA 4USQA 3UOYA 1SEZA 4Y4LA 3ALMA 3S5WA 4U8KA 1CHUA 2GVCA 1NHPA 1LPFA 4H4TA 1TYTA 2QA1A 4J56A 1AOGA 5U63A 5EOWA 4OPUA 1F3PA 1YQZA 4II2A 3NYEA 2BACA 3UTFA 1PS9A 3UTHA 3AYJA 1D7YA 4N9XA 2VVMA 3AE1A 2YLRA 3Q9TA 4EMIA 3PS9A 3O0HA 2C72A 4U8IA 2XFPA 1GTEA 2YVFA 2C4CA 3QSSA 4AP3A 1O95A 3II4A 3UOZA 1NHSA 1DODA 4GR1A 2XVEA 3GMCA 4J2WA 1H6VA 1REOA 2JB3A 4U8JA 4OPIA 4JNAA 3M12A 2WESA 5HYMA 3GSIA 3GDPA 1QO8A 4EQXA 1PBFA 5U1OA 3RP7A 2C67A 2BRAA 2ZZBA 3UKQA 4ADWA 1BGNA 5IQ4A 2ACZA 2R4EA 3GYXA 5KWFA 1K0JA 2EQ7A 3CN8A 4H4QA 5JCNA 3K30A 4Z25A 5J60A 1PBBA 4H2NA 5TR3A 2OALA 1L0VA 1OJCA 5KOXA 3KU9A 2GR3A 2WETA 2J3NA 2C75A 1KF6A 1GV4A 3M13A 3KLJA 3AEFA 3CTYA 1E6EA 3HYWA 3AYIA 3K7MX 5BUKA 1TDOA 3S61A 3NNEA 3FPZA 1PDHA 1GRBA 1XDIA 4APNA 1GSNA 1JRZA 1PN0A 4EM3A 2GH5A 3BI5A 4U2SA 4X4JA 4BJZA 1FCDA 2H88A 3ICSA 5FS8A 2RABA 3C4NA 4A7AA 3T2ZA 5FS7A 2EQ9A 4GRTA 3AD9B 3UTEA 5JCIA 3DJJA 4CNKA 2CFYA 3AE2A 2VRLA 3ZYXA 4G9KA 3CGDA 2OAMA 3GYJA 3IWAA 3T2KA 2B7RA 1BWCA 2X8HA 1YKJA 4H4UA 3LZWA 4ICYA 3KVEA 4AOSA 4LIIA 4B65A 4A65A 1H84A 4EQRA 3CNTA 2XFOA 2ZZCA 4OPGA 3VR9A 3CNDA 2NPXA 3V76A 3VRDB 2VQ7A 2BC0A 4BURA 4J57A 3R9UA 1H81A 1M64A 4UDQA 1GPEA 2GMJA 2XYOA 2YQUA 1CJ4A 2XVJA 3CGEA 2V3BA 1P2EA 3RNMA 2RGHA 1BKWA 4MJWA 4OVIA 4HB9A 1YQ4A 4UDRA 5GRTA 3OC4A 2WPFA 1CC2A 1VQWA 2R9ZA 1K4QA 3SM8A 5FS9A 4GDEA 3SQPA 3IHGA 2C3CA 3UKLA 2V60A 4TLXA 1EL5A 2FBWA 1TDFA 1ZOYA 2GF3A 2WHDA 2XCGA 4H4VA 4OCGA 4C77A 4D03A 3ISHA 4H2PA 4YKGA 1F8WA 2JBVA 3HYXA 3SZ0A 4C3YA 3H8LA 2R0GA 2WQYA 2YAUA 3SY4A 4YSHA 1RSGA 2GAHB 2FJEA 1XANA 1F6MA 3B6DA 2C64A 1S2QA 3NLCA 1CJ2A 4O5UA 4B68A 1Q1RA 4AOXA 4JY2A 2DKIA 3AE4A 4U2TA 2R0CA 2AQJA 2YLWA 2QA2A 5KXJA 1ZOVA 3IF9A 1B5QA 1DNCA 2WBAA 1PJ5A 5BULA 3UKHA 3H8IA 2C66A 2BK5A 3NK2X 4C5OA 2Y6RA 4A99A 3IC9A 1CL0A 2BK3A 4OPDA 4Z43A 1FEBA 3G5QA 4U2LA 1D4DA 5FS6A 5C3JA 4A6NA 4Z24A 1OJTA 1B37A 1PBCA 3D1CA 2WP5A 4B67A 3ADAB 3H4KA 4TM3A 4IVOB 2YG4A 2GQFA 3NG7X 2PHHA 3ATQA 2VVLG 2IIDA 1ELIA 1PJ7A 1ZDLA 4XWZA 1N4UA 1L9EA 3DGHA 3GWDA 1JEHA 5KMQA 2Y6QA 4TM4A 4H4RA 3RP6A 3GYIA 1D7LA 4JDRA 3UOVA 3SGLA 2W0HA 4B63A 3NKSA 2CULA 4LA1A 5EB4A 1GRAA 4UDPA 3UKKA 3SZFA 4HA6A 1VDCA 4NZHA 4CRTA 1PHHA 4IV9A 1H86A 2ZBWA 5EBKA 5KOWA 5HY5A 1GEUA 2XVFA 1TDNA 3AEGA 3SFEA 4NEWA 4DGKA 1IUTA 1ZMCA 2BS2A 2GAGB 3CPJG 3ICTA 4B1BA 1OJDA 2FJAA 2O9ZA 2GQWA 2AAQA 1IUXA 1ZK7A 4JNQA 2WDVA 1VRQB 4U8OA 4A5LA 4U8PA 4U8MA 2JB1A 2WP9A 3ICRA 5FMHA 3DJGX 4H4SA 1KSSA 3T2YA 1MOKA 2XLRA 3AECA 1E1MA 1S3EA 4B64A 1FECA 2TMDA 2X50A 4H2RA 4EM4A 2R46A 4ZCDA 1FL2A 1TDKA 1LQTA 4NTCA 1BZLA 2OA1A 1XPQA 3EF6A 4CCRA 3ALLA 2YLXA 3F8PA 2XVIA 1PJ6A 3Q6JA 1IUUA 1TYPA 1H7XA 3SZCA 1EL8A 1PBDA 3M0OA 3CPIG 1O94A 2WDRA 3CGBA 2XDOA 1K0IA 1GT8A 2Q7VA 4DSHA 3QJ4A 4H4XA 3AD8B 1CC6A 4Y4MA 3SZWA 4EIPA 2WOVA 1LVLA 1GREA 3G5SA 4H4PA 1F8SA 1B4VA 3GDNA 4GAVA 2AR8A 4C74A 2Q6UA 2QCUA 2YR6A 3ALJA 4I58A 1VG9A 4KPRA 3QSEA 1IUVA 1FEAA 1P2HA 3SXIA 2BXSA 3AEDA 1Q1WA 2XVHA 2YR5A 3AE6A 3V3OA 4Z2TA 2I0ZA 1ZP0A 2YLZA 4U8NA 4RG3A 4A6NB 2E5VA 1NDAA 3SYIA 4X9MA 5GSNA 1ZKQA 2YWLA 3KPFA 4NEVA 3LB8A 2JB2A 5BRTA 2EQ8A 3FIMB 2X99A 2CDUA 2PYXA 1IUSA 2WPEA 3P4SA 4NTDA 5HXIA 1B8SA 4A9WA 3DJDA 4WCTA 1Y56B 2XLTA 3AWIA 2C3DA 3LOVA 4H4ZA 2B9YA 3SX6A 1KSUA 2C65A 3GD3A 3NYCA 3T0KA 3T37A 5J7XA 2XFNA 1PBEA 3DGZA 1CBOA 5IQ1A 5U25A 3UP4A 2WOWA 3F8RA 3NK0X 3ZDNA 3E1TA 5EB5A 3CNJA 1N4VA 5KVHA 2X8GA 5ER0A 3AD7B 3UTGA 3VRBA 2NVKX 1UKVG 2Z5YA 4KX6A 1EL9A 2IVEA 1S3BA 2WEUA 1MO9A 3P4PA 1NHQA 4G74A 2RGJA 3PVCA 4ZCCA 4CY6A 3AE9A 3V3NA 1GALA 4K8DA 4K5SA 3FBSA 1M6IA 3DK8A 3L1RA 2RGOA 2YM1A 1Q9IA 3KKJA 3DA1A 4NNJA 5KRQA 1GRFA 4XWRA 4H7UA 2XLUA 3COXA 3QSMA 3AEBA 4UP3A 5JCKA 4K22A 2GMHA 2GV8A 3ITJA 5L46A 2C7GA 3LZXA 3NN6X 3NN0X 2WU2A 2WS3A 1PXAA 1DXLA 1QLBA 5IPYA 2Z5XA 3DJEA 3HZLA 5JCMA 5KMRA 2GR1A 1GTHA 1W4XA 1HYUA 2JKCA 2BYBA 4BK1A 1IJHA 3K7TA 1JU2A 4YTMA 3JSKA 4EMJA 4YSXA 3NHOX 1L9CA 2B76A 1DOCA 4YWOA 1NEKA 2APGA 1CJ3A 3LJPA 2BA9A 2V6OA 2XFUA 3NYFA 3CPHG 3DK4A 2VZ2A 1PXCA 3KD9A 3CIRA 3BI4A 1E1LA 3QFBA 4DNAA 5LV9A 2YLSA 4DSGA 1Z6LA 1YY5A 2C76A 4GCMA 3QFAA 4EQWA 1TRBA 2WPCA 3HYVA 4B69A 4GF7A 3KPKA 4PAAA 3P1WA 3CMMA 2YG6A 4AT2A 2WDQA 1NG3A 2WP6A 3DK9A 3BI2A 3K7QX 3URHA 4YKFA 1RYIA 2E1MA 2XLSA 5CKUA 5JCLA 4YSYA 2EQ6A 2V5ZA 3EANA 2ARDA 3AYLA 2GR2A 3EAOA 4RG4A 1FOHA 2C70A 4CCQA 1D4CA 2Q0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQB A;  3AXB A;  4IA6 A;  1GER A;  5DBJ A;  4EQS A;  2R45 A;  1NAA A;  3NGC X;  4Z44 A;  1L9D A;  2B9W A;  3VR8 A;  1V59 A;  4RSL A;  2C73 A;  1H82 A;  1GRH A;  3ABV A;  2A87 A;  3I3L A;  2BC1 A;  4H4W A;  3ATR A;  3AE3 A;  4AT0 A;  4FK1 C;  2FJB A;  1Y0P A;  2GR0 A;  4J33 A;  4M52 A;  4Y4N A;  1H83 A;  2YVG A;  2FJD A;  4JY3 A;  1NPX A;  1EBD A;  1JOA A;  3EPT A;  1BGJ A;  1GRG A;  1CJC A;  4H2Q A;  4H4Y A;  3UOX A;  3LAD A;  1ZX9 A;  4C3X A;  3VQR A;  3P4Q A;  4XXG A;  3C4A A;  2X3N A;  2YM2 A;  1ZY8 A;  2QAE A;  2R0P A;  4Z2U A;  3P9U A;  3UCL A;  1DOB A;  2R4J A;  4OPC A;  3UKP A;  4OPL A;  1KNP A;  4BV6 A;  3L8K A;  1MXT A;  4PAB A;  2GEW A;  1CC4 A;  1OJ9 A;  2BS3 A;  2VVL A;  1JRX A;  5KVI A;  1GRT A;  1LJ1 A;  2ZZ0 A;  4WX1 A;  3UKA A;  4BK2 A;  1COY A;  2WU5 A;  4I59 A;  3F8D A;  1EL7 A;  2X8C A;  4GDP A;  4YT0 A;  4YSZ A;  1NEN A;  5CQF A;  4E0V A;  4TM1 A;  4LU6 A;  5M10 A;  3UKF A;  4FX9 A;  1E1K A;  4P9S A;  1N4W A;  1N1P A;  2A8X A;  3AE8 A;  2BK4 A;  2V61 A;  2WOI A;  3P4R A;  2CVJ A;  1O5W A;  3PO7 A;  4IA5 A;  4AP1 A;  1TDE A;  2TPR A;  2YVJ A;  1X31 B;  1GND A;  3SFD A;  2F5Z A;  1KFY A;  3BHK A;  4EIQ A;  1CF3 A;  3KA7 A;  4TLZ A;  3AE7 A;  4FK1 A;  4NTE A;  4B66 A;  2JK6 A;  2YG3 A;  3NTA A;  3WE0 A;  3CNP A;  1BF3 A;  1D5T A;  2B7S A;  3AEA A;  4JQ9 A;  2YR4 A;  1JNR A;  1KNR A;  3FG2 P;  4H50 A;  2V3A A;  4K7Z A;  3RP8 A;  1Y56 A;  1ZMD A;  2A89 A;  1D4E A;  1F8R A;  2VRM A;  4CY8 A;  4K5R A;  3VRA A;  5M0Z A;  2UZZ A;  4JN9 A;  2DKH A;  1GXF A;  2IVD A;  1XHC A;  3UP5 A;  4D04 A;  1YQ3 A;  2YG5 A;  4CBQ A;  1DJN A;  3BNU A;  4BK3 A;  1E7P A;  1S2Y A;  3AE5 A;  4USR A;  3RED A;  3DH9 A;  2BCG G;  3NTD A;  3FMW A;  4CNJ A;  1GES A;  3BNM A;  4YTP A;  2GRT A;  1E39 A;  3QVP A;  1RP0 A;  2OLO A;  4A79 A;  2BCP A;  3AB1 A;  1PXB A;  3IHM A;  3LXD A;  4K2X A;  4U8L A;  1E1N A;  1LTX R;  1GET A;  3NIX A;  5HHF A;  2Q0K A;  1DOE A;  2YG7 A;  3NK1 X;  3OZ2 A;  2GB0 A;  4REK A;  1H7W A;  4TM0 A;  2E4G A;  1GOS A;  3GRT A;  3GD4 A;  2JAE A;  3NT6 A;  2XLP A;  3C96 A;  1K0L A;  1OJA A;  4O5Q A;  1KDG A;  4J36 A;  4IVM B;  4BJY A;  4J34 A;  4X9N A;  2XFQ A;  3RHA A;  5C2T A;  3G5R A;  2BXR A;  3I6D A;  4YXD A;  4FDC B;  5BVA A;  3GRS A;  4GUV A;  4Z2R A;  3NH3 X;  4EMW A;  1NHR A;  3CNS A;  4ZN0 A;  2BS4 A;  1ONF A;  2HQM A;  2B9X A;  2YLT A;  3NRN A;  2BAB A;  1QJD A;  4J31 A;  1VG0 A;  2VOU A;  3AEE A;  1NG4 A;  2H89 A;  2OLN A;  1JNZ A;  4Z26 A;  1DJQ A;  3B3R A;  3GWF A;  4YTN A;  1LQU A;  1IUW A;  4ECH A;  3GMB A;  1LV0 A;  3D8X A;  3QVR A;  3DME A;  1JRY A;  3BHF A;  4OPT A;  3CGC A;  4USQ A;  3UOY A;  1SEZ A;  4Y4L A;  3ALM A;  3S5W A;  4U8K A;  1CHU A;  2GVC A;  1NHP A;  1LPF A;  4H4T A;  1TYT A;  2QA1 A;  4J56 A;  1AOG A;  5U63 A;  5EOW A;  4OPU A;  1F3P A;  1YQZ A;  3NYE A;  2BAC A;  3UTF A;  1PS9 A;  3UTH A;  3AYJ A;  1D7Y A;  4N9X A;  2VVM A;  3AE1 A;  2YLR A;  3Q9T A;  4EMI A;  3PS9 A;  3O0H A;  2C72 A;  4U8I A;  2XFP A;  1GTE A;  2YVF A;  3QSS A;  4AP3 A;  1O95 A;  3II4 A;  3UOZ A;  1NHS A;  1DOD A;  4GR1 A;  2XVE A;  3GMC A;  4J2W A;  1H6V A;  1REO A;  2JB3 A;  4U8J A;  4OPI A;  4JNA A;  3M12 A;  2WES A;  5HYM A;  3GSI A;  3GDP A;  1QO8 A;  4EQX A;  1PBF A;  5U1O A;  3RP7 A;  2C67 A;  2ZZB A;  3UKQ A;  4ADW A;  1BGN A;  5IQ4 A;  2ACZ A;  2R4E A;  5KWF A;  1K0J A;  2EQ7 A;  3CN8 A;  4H4Q A;  5JCN A;  3K30 A;  4Z25 A;  5J60 A;  1PBB A;  4H2N A;  5TR3 A;  2OAL A;  1L0V A;  1OJC A;  5KOX A;  3KU9 A;  2GR3 A;  2WET A;  2J3N A;  2C75 A;  1KF6 A;  1GV4 A;  3M13 A;  3KLJ A;  3AEF A;  3CTY A;  1E6E A;  3AYI A;  3K7M X;  5BUK A;  1TDO A;  3S61 A;  3NNE A;  3FPZ A;  1PDH A;  1GRB A;  1XDI A;  4APN A;  1GSN A;  1JRZ A;  1PN0 A;  4EM3 A;  2GH5 A;  3BI5 A;  4U2S A;  4X4J A;  4BJZ A;  1FCD A;  2H88 A;  3ICS A;  5FS8 A;  2RAB A;  3C4N A;  4A7A A;  5FS7 A;  2EQ9 A;  4GRT A;  3AD9 B;  3UTE A;  5JCI A;  3DJJ A;  4CNK A;  2CFY A;  3AE2 A;  2VRL A;  3ZYX A;  3CGD A;  2OAM A;  3GYJ A;  3IWA A;  2B7R A;  1BWC A;  2X8H A;  1YKJ A;  4H4U A;  3LZW A;  4ICY A;  3KVE A;  4AOS A;  4LII A;  4B65 A;  4A65 A;  1H84 A;  4EQR A;  3CNT A;  2XFO A;  2ZZC A;  4OPG A;  3VR9 A;  3CND A;  2NPX A;  3V76 A;  3VRD B;  2VQ7 A;  2BC0 A;  4BUR A;  4J57 A;  3R9U A;  1H81 A;  1M64 A;  4UDQ A;  1GPE A;  2GMJ A;  2XYO A;  2YQU A;  1CJ4 A;  2XVJ A;  3CGE A;  2V3B A;  1P2E A;  3RNM A;  2RGH A;  1BKW A;  4MJW A;  4OVI A;  4HB9 A;  1YQ4 A;  4UDR A;  5GRT A;  3OC4 A;  2WPF A;  1CC2 A;  1VQW A;  2R9Z A;  1K4Q A;  3SM8 A;  5FS9 A;  4GDE A;  3SQP A;  3IHG A;  2C3C A;  3UKL A;  2V60 A;  4TLX A;  1EL5 A;  2FBW A;  1TDF A;  1ZOY A;  2GF3 A;  2WHD A;  2XCG A;  4H4V A;  4OCG A;  4C77 A;  4D03 A;  3ISH A;  4H2P A;  4YKG A;  1F8W A;  2JBV A;  4C3Y A;  3H8L A;  2R0G A;  2WQY A;  2YAU A;  4YSH A;  1RSG A;  2GAH B;  2FJE A;  1XAN A;  1F6M A;  3B6D A;  2C64 A;  1S2Q A;  3NLC A;  1CJ2 A;  4O5U A;  4B68 A;  1Q1R A;  4AOX A;  4JY2 A;  2DKI A;  3AE4 A;  4U2T A;  2R0C A;  2AQJ A;  2YLW A;  2QA2 A;  5KXJ A;  1ZOV A;  3IF9 A;  1B5Q A;  1DNC A;  2WBA A;  1PJ5 A;  5BUL A;  3UKH A;  3H8I A;  2C66 A;  2BK5 A;  3NK2 X;  4C5O A;  2Y6R A;  4A99 A;  3IC9 A;  1CL0 A;  2BK3 A;  4OPD A;  4Z43 A;  1FEB A;  3G5Q A;  4U2L A;  1D4D A;  5FS6 A;  5C3J A;  4A6N A;  4Z24 A;  1OJT A;  1B37 A;  1PBC A;  3D1C A;  2WP5 A;  4B67 A;  3ADA B;  3H4K A;  4TM3 A;  4IVO B;  2YG4 A;  2GQF A;  3NG7 X;  2PHH A;  3ATQ A;  2VVL G;  2IID A;  1ELI A;  1PJ7 A;  1ZDL A;  4XWZ A;  1N4U A;  1L9E A;  3DGH A;  3GWD A;  1JEH A;  2Y6Q A;  4TM4 A;  4H4R A;  3RP6 A;  3GYI A;  1D7L A;  4JDR A;  3UOV A;  3SGL A;  2W0H A;  4B63 A;  3NKS A;  2CUL A;  4LA1 A;  5EB4 A;  1GRA A;  4UDP A;  3UKK A;  4HA6 A;  1VDC A;  4NZH A;  4CRT A;  1PHH A;  4IV9 A;  1H86 A;  2ZBW A;  5EBK A;  5KOW A;  5HY5 A;  1GEU A;  2XVF A;  1TDN A;  3AEG A;  3SFE A;  4NEW A;  4DGK A;  1IUT A;  1ZMC A;  2BS2 A;  2GAG B;  3CPJ G;  3ICT A;  4B1B A;  1OJD A;  2FJA A;  2O9Z A;  2GQW A;  2AAQ A;  1IUX A;  1ZK7 A;  4JNQ A;  2WDV A;  1VRQ B;  4U8O A;  4A5L A;  4U8P A;  4U8M A;  2JB1 A;  2WP9 A;  3ICR A;  5FMH A;  3DJG X;  4H4S A;  1KSS A;  1MOK A;  2XLR A;  3AEC A;  1E1M A;  1S3E A;  4B64 A;  1FEC A;  2TMD A;  2X50 A;  4H2R A;  4EM4 A;  2R46 A;  4ZCD A;  1FL2 A;  1TDK A;  1LQT A;  4NTC A;  1BZL A;  2OA1 A;  1XPQ A;  3EF6 A;  4CCR A;  3ALL A;  2YLX A;  3F8P A;  2XVI A;  1PJ6 A;  3Q6J A;  1IUU A;  1TYP A;  1H7X A;  1EL8 A;  1PBD A;  3M0O A;  3CPI G;  1O94 A;  2WDR A;  3CGB A;  2XDO A;  1K0I A;  1GT8 A;  2Q7V A;  4DSH A;  3QJ4 A;  4H4X A;  3AD8 B;  1CC6 A;  4Y4M A;  4EIP A;  2WOV A;  1LVL A;  1GRE A;  3G5S A;  4H4P A;  1F8S A;  1B4V A;  3GDN A;  2AR8 A;  4C74 A;  2Q6U A;  2QCU A;  2YR6 A;  3ALJ A;  4I58 A;  1VG9 A;  4KPR A;  3QSE A;  1IUV A;  1FEA A;  1P2H A;  2BXS A;  3AED A;  1Q1W A;  2XVH A;  2YR5 A;  3AE6 A;  3V3O A;  4Z2T A;  2I0Z A;  1ZP0 A;  2YLZ A;  4U8N A;  4RG3 A;  4A6N B;  2E5V A;  1NDA A;  4X9M A;  5GSN A;  1ZKQ A;  2YWL A;  3KPF A;  4NEV A;  3LB8 A;  2JB2 A;  5BRT A;  2EQ8 A;  3FIM B;  2X99 A;  2CDU A;  2PYX A;  1IUS A;  2WPE A;  3P4S A;  4NTD A;  5HXI A;  1B8S A;  4A9W A;  3DJD A;  4WCT A;  1Y56 B;  2XLT A;  3AWI A;  2C3D A;  3LOV A;  4H4Z A;  2B9Y A;  1KSU A;  2C65 A;  3GD3 A;  3NYC A;  3T37 A;  5J7X A;  2XFN A;  1PBE A;  3DGZ A;  1CBO A;  5IQ1 A;  5U25 A;  3UP4 A;  2WOW A;  3F8R A;  3NK0 X;  3ZDN A;  3E1T A;  5EB5 A;  3CNJ A;  1N4V A;  5KVH A;  2X8G A;  5ER0 A;  3AD7 B;  3UTG A;  3VRB A;  2NVK X;  1UKV G;  2Z5Y A;  4KX6 A;  1EL9 A;  2IVE A;  1S3B A;  2WEU A;  1MO9 A;  3P4P A;  1NHQ A;  4ZCC A;  2RGJ A;  3PVC A;  4CY6 A;  3AE9 A;  3V3N A;  1GAL A;  4K8D A;  4K5S A;  3FBS A;  1M6I A;  3DK8 A;  3L1R A;  2RGO A;  2YM1 A;  1Q9I A;  3KKJ A;  3DA1 A;  5KRQ A;  1GRF A;  4XWR A;  4H7U A;  2XLU A;  3COX A;  3QSM A;  3AEB A;  4UP3 A;  5JCK A;  4K22 A;  2GMH A;  2GV8 A;  3ITJ A;  5L46 A;  2C7G A;  3LZX A;  3NN6 X;  3NN0 X;  2WU2 A;  2WS3 A;  1PXA A;  1DXL A;  1QLB A;  5IPY A;  2Z5X A;  3DJE A;  3HZL A;  5JCM A;  2GR1 A;  1GTH A;  1W4X A;  1HYU A;  2JKC A;  2BYB A;  4BK1 A;  1IJH A;  3K7T A;  1JU2 A;  4YTM A;  3JSK A;  4EMJ A;  4YSX A;  3NHO X;  1L9C A;  2B76 A;  1DOC A;  4YWO A;  1NEK A;  2APG A;  1CJ3 A;  3LJP A;  2BA9 A;  2V6O A;  2XFU A;  3NYF A;  3CPH G;  3DK4 A;  2VZ2 A;  1PXC A;  3KD9 A;  3CIR A;  3BI4 A;  1E1L A;  3QFB A;  4DNA A;  5LV9 A;  2YLS A;  4DSG A;  1Z6L A;  1YY5 A;  2C76 A;  4GCM A;  3QFA A;  4EQW A;  1TRB A;  2WPC A;  4B69 A;  4GF7 A;  4PAA A;  3P1W A;  2YG6 A;  4AT2 A;  2WDQ A;  1NG3 A;  2WP6 A;  3DK9 A;  3BI2 A;  3K7Q X;  3URH A;  4YKF A;  1RYI A;  2E1M A;  2XLS A;  5CKU A;  5JCL A;  4YSY A;  2EQ6 A;  2V5Z A;  3EAN A;  2ARD A;  3AYL A;  2GR2 A;  3EAO A;  4RG4 A;  1FOH A;  2C70 A;  4CCQ A;  1D4C A;  2Q0L A; 
#chains in the Genus database with same CATH topology
 2VQB A;  3AXB A;  4IA6 A;  1GER A;  5DBJ A;  4EQS A;  2R45 A;  1NAA A;  3NGC X;  4Z44 A;  1L9D A;  2B9W A;  4NWZ A;  1V59 A;  3VR8 A;  4RSL A;  2C73 A;  1H82 A;  1GRH A;  3ABV A;  2A87 A;  3I3L A;  2BC1 A;  4H4W A;  3ATR A;  3AE3 A;  4AT0 A;  4FK1 C;  2FJB A;  1Y0P A;  2GR0 A;  4J33 A;  4M52 A;  4Y4N A;  1H83 A;  2YVG A;  2FJD A;  4JY3 A;  1NPX A;  1EBD A;  1JOA A;  3EPT A;  1BGJ A;  1GRG A;  1CJC A;  4H2Q A;  4H4Y A;  3UOX A;  3LAD A;  1ZX9 A;  4C3X A;  3VQR A;  3P4Q A;  4XXG A;  3C4A A;  2X3N A;  2YM2 A;  1ZY8 A;  2QAE A;  2R0P A;  5KNL A;  4Z2U A;  3P9U A;  3UCL A;  1DOB A;  2R4J A;  4OPC A;  3UKP A;  4OPL A;  1KNP A;  4BV6 A;  3L8K A;  1MXT A;  4PAB A;  2GEW A;  1CC4 A;  1OJ9 A;  2BS3 A;  2VVL A;  1JRX A;  5KVI A;  1GRT A;  1LJ1 A;  2ZZ0 A;  4WX1 A;  4G73 A;  3UKA A;  4BK2 A;  1COY A;  2WU5 A;  4I59 A;  3F8D A;  1EL7 A;  2X8C A;  4GDP A;  4YT0 A;  4YSZ A;  1NEN A;  5CQF A;  4E0V A;  4TM1 A;  4LU6 A;  5M10 A;  3UKF A;  4FX9 A;  1E1K A;  4P9S A;  1N4W A;  1N1P A;  2A8X A;  3AE8 A;  2BK4 A;  2V61 A;  2WOI A;  3P4R A;  2CVJ A;  1O5W A;  3PO7 A;  4IA5 A;  4AP1 A;  1TDE A;  2TPR A;  3T14 A;  2YVJ A;  1X31 B;  1GND A;  3SFD A;  2F5Z A;  1KFY A;  3BHK A;  4EIQ A;  1CF3 A;  3KA7 A;  4TLZ A;  3AE7 A;  4FK1 A;  4NTE A;  4B66 A;  2JK6 A;  2YG3 A;  3NTA A;  3WE0 A;  3CNP A;  1BF3 A;  1D5T A;  2B7S A;  3AEA A;  4JQ9 A;  2YR4 A;  1JNR A;  1KNR A;  3FG2 P;  4H50 A;  2V3A A;  4K7Z A;  3RP8 A;  1Y56 A;  1ZMD A;  2A89 A;  1D4E A;  1F8R A;  2VRM A;  4CY8 A;  5KMS A;  4K5R A;  3VRA A;  4G6G A;  5M0Z A;  2UZZ A;  4JN9 A;  4II3 A;  2DKH A;  1GXF A;  2IVD A;  1XHC A;  3UP5 A;  4D04 A;  1YQ3 A;  2YG5 A;  4CBQ A;  1DJN A;  3BNU A;  4BK3 A;  1E7P A;  1S2Y A;  3AE5 A;  4USR A;  3RED A;  3DH9 A;  2BCG G;  3NTD A;  4GAP A;  3FMW A;  4CNJ A;  1GES A;  3BNM A;  2BRY A;  4YTP A;  2GRT A;  1E39 A;  3QVP A;  1RP0 A;  2OLO A;  4A79 A;  2BCP A;  3AB1 A;  1PXB A;  3IHM A;  3LXD A;  4K2X A;  4U8L A;  1E1N A;  1LTX R;  1GET A;  3NIX A;  5HHF A;  2Q0K A;  3T31 A;  1DOE A;  2YG7 A;  3NK1 X;  3OZ2 A;  2GB0 A;  4REK A;  1H7W A;  4TM0 A;  2E4G A;  1GOS A;  3GRT A;  3GD4 A;  2JAE A;  3NT6 A;  2XLP A;  3C96 A;  1K0L A;  1OJA A;  4O5Q A;  1KDG A;  4J36 A;  4IVM B;  4BJY A;  4J34 A;  4X9N A;  2XFQ A;  3RHA A;  5C2T A;  3G5R A;  2BXR A;  3I6D A;  4YXD A;  4FDC B;  5KMP A;  5BVA A;  3GRS A;  4GUV A;  4Z2R A;  3NH3 X;  4EMW A;  1NHR A;  3CNS A;  4ZN0 A;  2BS4 A;  1ONF A;  2HQM A;  2B9X A;  2YLT A;  3NRN A;  2BAB A;  1QJD A;  4J31 A;  1VG0 A;  2VOU A;  3AEE A;  1NG4 A;  2H89 A;  2OLN A;  1JNZ A;  4G6H A;  4Z26 A;  1DJQ A;  3B3R A;  3GWF A;  4YTN A;  1LQU A;  1IUW A;  4ECH A;  3GMB A;  1LV0 A;  3D8X A;  3QVR A;  3DME A;  1JRY A;  3BHF A;  4OPT A;  3CGC A;  4USQ A;  3UOY A;  1SEZ A;  4Y4L A;  3ALM A;  3S5W A;  4U8K A;  1CHU A;  2GVC A;  1NHP A;  1LPF A;  4H4T A;  1TYT A;  2QA1 A;  4J56 A;  1AOG A;  5U63 A;  5EOW A;  4OPU A;  1F3P A;  1YQZ A;  4II2 A;  3NYE A;  2BAC A;  3UTF A;  1PS9 A;  3UTH A;  3AYJ A;  1D7Y A;  4N9X A;  2VVM A;  3AE1 A;  2YLR A;  3Q9T A;  4EMI A;  3PS9 A;  3O0H A;  2C72 A;  4U8I A;  2XFP A;  1GTE A;  2YVF A;  2C4C A;  3QSS A;  4AP3 A;  1O95 A;  3II4 A;  3UOZ A;  1NHS A;  1DOD A;  4GR1 A;  2XVE A;  3GMC A;  4J2W A;  1H6V A;  1REO A;  2JB3 A;  4U8J A;  4OPI A;  4JNA A;  3M12 A;  2WES A;  5HYM A;  3GSI A;  3GDP A;  1QO8 A;  4EQX A;  1PBF A;  5U1O A;  3RP7 A;  2C67 A;  2BRA A;  2ZZB A;  3UKQ A;  4ADW A;  1BGN A;  5IQ4 A;  2ACZ A;  2R4E A;  3GYX A;  5KWF A;  1K0J A;  2EQ7 A;  3CN8 A;  4H4Q A;  5JCN A;  3K30 A;  4Z25 A;  5J60 A;  1PBB A;  4H2N A;  5TR3 A;  2OAL A;  1L0V A;  1OJC A;  5KOX A;  3KU9 A;  2GR3 A;  2WET A;  2J3N A;  2C75 A;  1KF6 A;  1GV4 A;  3M13 A;  3KLJ A;  3AEF A;  3CTY A;  1E6E A;  3HYW A;  3AYI A;  3K7M X;  5BUK A;  1TDO A;  3S61 A;  3NNE A;  3FPZ A;  1PDH A;  1GRB A;  1XDI A;  4APN A;  1GSN A;  1JRZ A;  1PN0 A;  4EM3 A;  2GH5 A;  3BI5 A;  4U2S A;  4X4J A;  4BJZ A;  1FCD A;  2H88 A;  3ICS A;  5FS8 A;  2RAB A;  3C4N A;  4A7A A;  3T2Z A;  5FS7 A;  2EQ9 A;  4GRT A;  3AD9 B;  3UTE A;  5JCI A;  3DJJ A;  4CNK A;  2CFY A;  3AE2 A;  2VRL A;  3ZYX A;  4G9K A;  3CGD A;  2OAM A;  3GYJ A;  3IWA A;  3T2K A;  2B7R A;  1BWC A;  2X8H A;  1YKJ A;  4H4U A;  3LZW A;  4ICY A;  3KVE A;  4AOS A;  4LII A;  4B65 A;  4A65 A;  1H84 A;  4EQR A;  3CNT A;  2XFO A;  2ZZC A;  4OPG A;  3VR9 A;  3CND A;  2NPX A;  3V76 A;  3VRD B;  2VQ7 A;  2BC0 A;  4BUR A;  4J57 A;  3R9U A;  1H81 A;  1M64 A;  4UDQ A;  1GPE A;  2GMJ A;  2XYO A;  2YQU A;  1CJ4 A;  2XVJ A;  3CGE A;  2V3B A;  1P2E A;  3RNM A;  2RGH A;  1BKW A;  4MJW A;  4OVI A;  4HB9 A;  1YQ4 A;  4UDR A;  5GRT A;  3OC4 A;  2WPF A;  1CC2 A;  1VQW A;  2R9Z A;  1K4Q A;  3SM8 A;  5FS9 A;  4GDE A;  3SQP A;  3IHG A;  2C3C A;  3UKL A;  2V60 A;  4TLX A;  1EL5 A;  2FBW A;  1TDF A;  1ZOY A;  2GF3 A;  2WHD A;  2XCG A;  4H4V A;  4OCG A;  4C77 A;  4D03 A;  3ISH A;  4H2P A;  4YKG A;  1F8W A;  2JBV A;  3HYX A;  3SZ0 A;  4C3Y A;  3H8L A;  2R0G A;  2WQY A;  2YAU A;  3SY4 A;  4YSH A;  1RSG A;  2GAH B;  2FJE A;  1XAN A;  1F6M A;  3B6D A;  2C64 A;  1S2Q A;  3NLC A;  1CJ2 A;  4O5U A;  4B68 A;  1Q1R A;  4AOX A;  4JY2 A;  2DKI A;  3AE4 A;  4U2T A;  2R0C A;  2AQJ A;  2YLW A;  2QA2 A;  5KXJ A;  1ZOV A;  3IF9 A;  1B5Q A;  1DNC A;  2WBA A;  1PJ5 A;  5BUL A;  3UKH A;  3H8I A;  2C66 A;  2BK5 A;  3NK2 X;  4C5O A;  2Y6R A;  4A99 A;  3IC9 A;  1CL0 A;  2BK3 A;  4OPD A;  4Z43 A;  1FEB A;  3G5Q A;  4U2L A;  1D4D A;  5FS6 A;  5C3J A;  4A6N A;  4Z24 A;  1OJT A;  1B37 A;  1PBC A;  3D1C A;  2WP5 A;  4B67 A;  3ADA B;  3H4K A;  4TM3 A;  4IVO B;  2YG4 A;  2GQF A;  3NG7 X;  2PHH A;  3ATQ A;  2VVL G;  2IID A;  1ELI A;  1PJ7 A;  1ZDL A;  4XWZ A;  1N4U A;  1L9E A;  3DGH A;  3GWD A;  1JEH A;  5KMQ A;  2Y6Q A;  4TM4 A;  4H4R A;  3RP6 A;  3GYI A;  1D7L A;  4JDR A;  3UOV A;  3SGL A;  2W0H A;  4B63 A;  3NKS A;  2CUL A;  4LA1 A;  5EB4 A;  1GRA A;  4UDP A;  3UKK A;  3SZF A;  4HA6 A;  1VDC A;  4NZH A;  4CRT A;  1PHH A;  4IV9 A;  1H86 A;  2ZBW A;  5EBK A;  5KOW A;  5HY5 A;  1GEU A;  2XVF A;  1TDN A;  3AEG A;  3SFE A;  4NEW A;  4DGK A;  1IUT A;  1ZMC A;  2BS2 A;  2GAG B;  3CPJ G;  3ICT A;  4B1B A;  1OJD A;  2FJA A;  2O9Z A;  2GQW A;  2AAQ A;  1IUX A;  1ZK7 A;  4JNQ A;  2WDV A;  1VRQ B;  4U8O A;  4A5L A;  4U8P A;  4U8M A;  2JB1 A;  2WP9 A;  3ICR A;  5FMH A;  3DJG X;  4H4S A;  1KSS A;  3T2Y A;  1MOK A;  2XLR A;  3AEC A;  1E1M A;  1S3E A;  4B64 A;  1FEC A;  2TMD A;  2X50 A;  4H2R A;  4EM4 A;  2R46 A;  4ZCD A;  1FL2 A;  1TDK A;  1LQT A;  4NTC A;  1BZL A;  2OA1 A;  1XPQ A;  3EF6 A;  4CCR A;  3ALL A;  2YLX A;  3F8P A;  2XVI A;  1PJ6 A;  3Q6J A;  1IUU A;  1TYP A;  1H7X A;  3SZC A;  1EL8 A;  1PBD A;  3M0O A;  3CPI G;  1O94 A;  2WDR A;  3CGB A;  2XDO A;  1K0I A;  1GT8 A;  2Q7V A;  4DSH A;  3QJ4 A;  4H4X A;  3AD8 B;  1CC6 A;  4Y4M A;  3SZW A;  4EIP A;  2WOV A;  1LVL A;  1GRE A;  3G5S A;  4H4P A;  1F8S A;  1B4V A;  3GDN A;  4GAV A;  2AR8 A;  4C74 A;  2Q6U A;  2QCU A;  2YR6 A;  3ALJ A;  4I58 A;  1VG9 A;  4KPR A;  3QSE A;  1IUV A;  1FEA A;  1P2H A;  3SXI A;  2BXS A;  3AED A;  1Q1W A;  2XVH A;  2YR5 A;  3AE6 A;  3V3O A;  4Z2T A;  2I0Z A;  1ZP0 A;  2YLZ A;  4U8N A;  4RG3 A;  4A6N B;  2E5V A;  1NDA A;  3SYI A;  4X9M A;  5GSN A;  1ZKQ A;  2YWL A;  3KPF A;  4NEV A;  3LB8 A;  2JB2 A;  5BRT A;  2EQ8 A;  3FIM B;  2X99 A;  2CDU A;  2PYX A;  1IUS A;  2WPE A;  3P4S A;  4NTD A;  5HXI A;  1B8S A;  4A9W A;  3DJD A;  4WCT A;  1Y56 B;  2XLT A;  3AWI A;  2C3D A;  3LOV A;  4H4Z A;  2B9Y A;  3SX6 A;  1KSU A;  2C65 A;  3GD3 A;  3NYC A;  3T0K A;  3T37 A;  5J7X A;  2XFN A;  1PBE A;  3DGZ A;  1CBO A;  5IQ1 A;  5U25 A;  3UP4 A;  2WOW A;  3F8R A;  3NK0 X;  3ZDN A;  3E1T A;  5EB5 A;  3CNJ A;  1N4V A;  5KVH A;  2X8G A;  5ER0 A;  3AD7 B;  3UTG A;  3VRB A;  2NVK X;  1UKV G;  2Z5Y A;  4KX6 A;  1EL9 A;  2IVE A;  1S3B A;  2WEU A;  1MO9 A;  3P4P A;  1NHQ A;  4G74 A;  2RGJ A;  3PVC A;  4ZCC A;  4CY6 A;  3AE9 A;  3V3N A;  1GAL A;  4K8D A;  4K5S A;  3FBS A;  1M6I A;  3DK8 A;  3L1R A;  2RGO A;  2YM1 A;  1Q9I A;  3KKJ A;  3DA1 A;  4NNJ A;  5KRQ A;  1GRF A;  4XWR A;  4H7U A;  2XLU A;  3COX A;  3QSM A;  3AEB A;  4UP3 A;  5JCK A;  4K22 A;  2GMH A;  2GV8 A;  3ITJ A;  5L46 A;  2C7G A;  3LZX A;  3NN6 X;  3NN0 X;  2WU2 A;  2WS3 A;  1PXA A;  1DXL A;  1QLB A;  5IPY A;  2Z5X A;  3DJE A;  3HZL A;  5JCM A;  5KMR A;  2GR1 A;  1GTH A;  1W4X A;  1HYU A;  2JKC A;  2BYB A;  4BK1 A;  1IJH A;  3K7T A;  1JU2 A;  4YTM A;  3JSK A;  4EMJ A;  4YSX A;  3NHO X;  1L9C A;  2B76 A;  1DOC A;  4YWO A;  1NEK A;  2APG A;  1CJ3 A;  3LJP A;  2BA9 A;  2V6O A;  2XFU A;  3NYF A;  3CPH G;  3DK4 A;  2VZ2 A;  1PXC A;  3KD9 A;  3CIR A;  3BI4 A;  1E1L A;  3QFB A;  4DNA A;  5LV9 A;  2YLS A;  4DSG A;  1Z6L A;  1YY5 A;  2C76 A;  4GCM A;  3QFA A;  4EQW A;  1TRB A;  2WPC A;  3HYV A;  4B69 A;  4GF7 A;  3KPK A;  4PAA A;  3P1W A;  3CMM A;  2YG6 A;  4AT2 A;  2WDQ A;  1NG3 A;  2WP6 A;  3DK9 A;  3BI2 A;  3K7Q X;  3URH A;  4YKF A;  1RYI A;  2E1M A;  2XLS A;  5CKU A;  5JCL A;  4YSY A;  2EQ6 A;  2V5Z A;  3EAN A;  2ARD A;  3AYL A;  2GR2 A;  3EAO A;  4RG4 A;  1FOH A;  2C70 A;  4CCQ A;  1D4C A;  2Q0L A; 
#chains in the Genus database with same CATH homology
 2VQB A;  3AXB A;  4IA6 A;  1GER A;  5DBJ A;  4EQS A;  2R45 A;  1NAA A;  3NGC X;  4Z44 A;  1L9D A;  2B9W A;  4NWZ A;  1V59 A;  3VR8 A;  4RSL A;  2C73 A;  1H82 A;  1GRH A;  3ABV A;  2A87 A;  3I3L A;  2BC1 A;  4H4W A;  3ATR A;  3AE3 A;  4AT0 A;  4FK1 C;  2FJB A;  1Y0P A;  2GR0 A;  4J33 A;  4M52 A;  4Y4N A;  1H83 A;  2YVG A;  2FJD A;  4JY3 A;  1NPX A;  1EBD A;  1JOA A;  3EPT A;  1BGJ A;  1GRG A;  1CJC A;  4H2Q A;  4H4Y A;  3UOX A;  3LAD A;  1ZX9 A;  4C3X A;  3VQR A;  3P4Q A;  4XXG A;  3C4A A;  2X3N A;  2YM2 A;  1ZY8 A;  2QAE A;  2R0P A;  5KNL A;  4Z2U A;  3P9U A;  3UCL A;  1DOB A;  2R4J A;  4OPC A;  3UKP A;  4OPL A;  1KNP A;  4BV6 A;  3L8K A;  1MXT A;  4PAB A;  2GEW A;  1CC4 A;  1OJ9 A;  2BS3 A;  2VVL A;  1JRX A;  5KVI A;  1GRT A;  1LJ1 A;  2ZZ0 A;  4WX1 A;  4G73 A;  3UKA A;  4BK2 A;  1COY A;  2WU5 A;  4I59 A;  3F8D A;  1EL7 A;  2X8C A;  4GDP A;  4YT0 A;  4YSZ A;  1NEN A;  5CQF A;  4E0V A;  4TM1 A;  4LU6 A;  5M10 A;  3UKF A;  4FX9 A;  1E1K A;  4P9S A;  1N4W A;  1N1P A;  2A8X A;  3AE8 A;  2BK4 A;  2V61 A;  2WOI A;  3P4R A;  2CVJ A;  1O5W A;  3PO7 A;  4IA5 A;  4AP1 A;  1TDE A;  2TPR A;  3T14 A;  2YVJ A;  1X31 B;  1GND A;  3SFD A;  2F5Z A;  1KFY A;  3BHK A;  4EIQ A;  1CF3 A;  3KA7 A;  4TLZ A;  3AE7 A;  4FK1 A;  4NTE A;  4B66 A;  2JK6 A;  2YG3 A;  3NTA A;  3WE0 A;  3CNP A;  1BF3 A;  1D5T A;  2B7S A;  3AEA A;  4JQ9 A;  2YR4 A;  1JNR A;  1KNR A;  3FG2 P;  4H50 A;  2V3A A;  4K7Z A;  3RP8 A;  1Y56 A;  1ZMD A;  2A89 A;  1D4E A;  1F8R A;  2VRM A;  4CY8 A;  5KMS A;  4K5R A;  3VRA A;  4G6G A;  5M0Z A;  2UZZ A;  4JN9 A;  4II3 A;  2DKH A;  1GXF A;  2IVD A;  1XHC A;  3UP5 A;  4D04 A;  1YQ3 A;  2YG5 A;  4CBQ A;  1DJN A;  3BNU A;  4BK3 A;  1E7P A;  1S2Y A;  3AE5 A;  4USR A;  3RED A;  3DH9 A;  2BCG G;  3NTD A;  4GAP A;  3FMW A;  4CNJ A;  1GES A;  3BNM A;  2BRY A;  4YTP A;  2GRT A;  1E39 A;  3QVP A;  1RP0 A;  2OLO A;  4A79 A;  2BCP A;  3AB1 A;  1PXB A;  3IHM A;  3LXD A;  4K2X A;  4U8L A;  1E1N A;  1LTX R;  1GET A;  3NIX A;  5HHF A;  2Q0K A;  3T31 A;  1DOE A;  2YG7 A;  3NK1 X;  3OZ2 A;  2GB0 A;  4REK A;  1H7W A;  4TM0 A;  2E4G A;  1GOS A;  3GRT A;  3GD4 A;  2JAE A;  3NT6 A;  2XLP A;  3C96 A;  1K0L A;  1OJA A;  4O5Q A;  1KDG A;  4J36 A;  4IVM B;  4BJY A;  4J34 A;  4X9N A;  2XFQ A;  3RHA A;  5C2T A;  3G5R A;  2BXR A;  3I6D A;  4YXD A;  4FDC B;  5KMP A;  5BVA A;  3GRS A;  4GUV A;  4Z2R A;  3NH3 X;  4EMW A;  1NHR A;  3CNS A;  4ZN0 A;  2BS4 A;  1ONF A;  2HQM A;  2B9X A;  2YLT A;  3NRN A;  2BAB A;  1QJD A;  4J31 A;  1VG0 A;  2VOU A;  3AEE A;  1NG4 A;  2H89 A;  2OLN A;  1JNZ A;  4G6H A;  4Z26 A;  1DJQ A;  3B3R A;  3GWF A;  4YTN A;  1LQU A;  1IUW A;  4ECH A;  3GMB A;  1LV0 A;  3D8X A;  3QVR A;  3DME A;  1JRY A;  3BHF A;  4OPT A;  3CGC A;  4USQ A;  3UOY A;  1SEZ A;  4Y4L A;  3ALM A;  3S5W A;  4U8K A;  1CHU A;  2GVC A;  1NHP A;  1LPF A;  4H4T A;  1TYT A;  2QA1 A;  4J56 A;  1AOG A;  5U63 A;  5EOW A;  4OPU A;  1F3P A;  1YQZ A;  4II2 A;  3NYE A;  2BAC A;  3UTF A;  1PS9 A;  3UTH A;  3AYJ A;  1D7Y A;  4N9X A;  2VVM A;  3AE1 A;  2YLR A;  3Q9T A;  4EMI A;  3PS9 A;  3O0H A;  2C72 A;  4U8I A;  2XFP A;  1GTE A;  2YVF A;  2C4C A;  3QSS A;  4AP3 A;  1O95 A;  3II4 A;  3UOZ A;  1NHS A;  1DOD A;  4GR1 A;  2XVE A;  3GMC A;  4J2W A;  1H6V A;  1REO A;  2JB3 A;  4U8J A;  4OPI A;  4JNA A;  3M12 A;  2WES A;  5HYM A;  3GSI A;  3GDP A;  1QO8 A;  4EQX A;  1PBF A;  5U1O A;  3RP7 A;  2C67 A;  2BRA A;  2ZZB A;  3UKQ A;  4ADW A;  1BGN A;  5IQ4 A;  2ACZ A;  2R4E A;  3GYX A;  5KWF A;  1K0J A;  2EQ7 A;  3CN8 A;  4H4Q A;  5JCN A;  3K30 A;  4Z25 A;  5J60 A;  1PBB A;  4H2N A;  5TR3 A;  2OAL A;  1L0V A;  1OJC A;  5KOX A;  3KU9 A;  2GR3 A;  2WET A;  2J3N A;  2C75 A;  1KF6 A;  1GV4 A;  3M13 A;  3KLJ A;  3AEF A;  3CTY A;  1E6E A;  3HYW A;  3AYI A;  3K7M X;  5BUK A;  1TDO A;  3S61 A;  3NNE A;  3FPZ A;  1PDH A;  1GRB A;  1XDI A;  4APN A;  1GSN A;  1JRZ A;  1PN0 A;  4EM3 A;  2GH5 A;  3BI5 A;  4U2S A;  4X4J A;  4BJZ A;  1FCD A;  2H88 A;  3ICS A;  5FS8 A;  2RAB A;  3C4N A;  4A7A A;  3T2Z A;  5FS7 A;  2EQ9 A;  4GRT A;  3AD9 B;  3UTE A;  5JCI A;  3DJJ A;  4CNK A;  2CFY A;  3AE2 A;  2VRL A;  3ZYX A;  4G9K A;  3CGD A;  2OAM A;  3GYJ A;  3IWA A;  3T2K A;  2B7R A;  1BWC A;  2X8H A;  1YKJ A;  4H4U A;  3LZW A;  4ICY A;  3KVE A;  4AOS A;  4LII A;  4B65 A;  4A65 A;  1H84 A;  4EQR A;  3CNT A;  2XFO A;  2ZZC A;  4OPG A;  3VR9 A;  3CND A;  2NPX A;  3V76 A;  3VRD B;  2VQ7 A;  2BC0 A;  4BUR A;  4J57 A;  3R9U A;  1H81 A;  1M64 A;  4UDQ A;  1GPE A;  2GMJ A;  2XYO A;  2YQU A;  1CJ4 A;  2XVJ A;  3CGE A;  2V3B A;  1P2E A;  3RNM A;  2RGH A;  1BKW A;  4MJW A;  4OVI A;  4HB9 A;  1YQ4 A;  4UDR A;  5GRT A;  3OC4 A;  2WPF A;  1CC2 A;  1VQW A;  2R9Z A;  1K4Q A;  3SM8 A;  5FS9 A;  4GDE A;  3SQP A;  3IHG A;  2C3C A;  3UKL A;  2V60 A;  4TLX A;  1EL5 A;  2FBW A;  1TDF A;  1ZOY A;  2GF3 A;  2WHD A;  2XCG A;  4H4V A;  4OCG A;  4C77 A;  4D03 A;  3ISH A;  4H2P A;  4YKG A;  1F8W A;  2JBV A;  3HYX A;  3SZ0 A;  4C3Y A;  3H8L A;  2R0G A;  2WQY A;  2YAU A;  3SY4 A;  4YSH A;  1RSG A;  2GAH B;  2FJE A;  1XAN A;  1F6M A;  3B6D A;  2C64 A;  1S2Q A;  3NLC A;  1CJ2 A;  4O5U A;  4B68 A;  1Q1R A;  4AOX A;  4JY2 A;  2DKI A;  3AE4 A;  4U2T A;  2R0C A;  2AQJ A;  2YLW A;  2QA2 A;  5KXJ A;  1ZOV A;  3IF9 A;  1B5Q A;  1DNC A;  2WBA A;  1PJ5 A;  5BUL A;  3UKH A;  3H8I A;  2C66 A;  2BK5 A;  3NK2 X;  4C5O A;  2Y6R A;  4A99 A;  3IC9 A;  1CL0 A;  2BK3 A;  4OPD A;  4Z43 A;  1FEB A;  3G5Q A;  4U2L A;  1D4D A;  5FS6 A;  5C3J A;  4A6N A;  4Z24 A;  1OJT A;  1B37 A;  1PBC A;  3D1C A;  2WP5 A;  4B67 A;  3ADA B;  3H4K A;  4TM3 A;  4IVO B;  2YG4 A;  2GQF A;  3NG7 X;  2PHH A;  3ATQ A;  2VVL G;  2IID A;  1ELI A;  1PJ7 A;  1ZDL A;  4XWZ A;  1N4U A;  1L9E A;  3DGH A;  3GWD A;  1JEH A;  5KMQ A;  2Y6Q A;  4TM4 A;  4H4R A;  3RP6 A;  3GYI A;  1D7L A;  4JDR A;  3UOV A;  3SGL A;  2W0H A;  4B63 A;  3NKS A;  2CUL A;  4LA1 A;  5EB4 A;  1GRA A;  4UDP A;  3UKK A;  3SZF A;  4HA6 A;  1VDC A;  4NZH A;  4CRT A;  1PHH A;  4IV9 A;  1H86 A;  2ZBW A;  5EBK A;  5KOW A;  5HY5 A;  1GEU A;  2XVF A;  1TDN A;  3AEG A;  3SFE A;  4NEW A;  4DGK A;  1IUT A;  1ZMC A;  2BS2 A;  2GAG B;  3CPJ G;  3ICT A;  4B1B A;  1OJD A;  2FJA A;  2O9Z A;  2GQW A;  2AAQ A;  1IUX A;  1ZK7 A;  4JNQ A;  2WDV A;  1VRQ B;  4U8O A;  4A5L A;  4U8P A;  4U8M A;  2JB1 A;  2WP9 A;  3ICR A;  5FMH A;  3DJG X;  4H4S A;  1KSS A;  3T2Y A;  1MOK A;  2XLR A;  3AEC A;  1E1M A;  1S3E A;  4B64 A;  1FEC A;  2TMD A;  2X50 A;  4H2R A;  4EM4 A;  2R46 A;  4ZCD A;  1FL2 A;  1TDK A;  1LQT A;  4NTC A;  1BZL A;  2OA1 A;  1XPQ A;  3EF6 A;  4CCR A;  3ALL A;  2YLX A;  3F8P A;  2XVI A;  1PJ6 A;  3Q6J A;  1IUU A;  1TYP A;  1H7X A;  3SZC A;  1EL8 A;  1PBD A;  3M0O A;  3CPI G;  1O94 A;  2WDR A;  3CGB A;  2XDO A;  1K0I A;  1GT8 A;  2Q7V A;  4DSH A;  3QJ4 A;  4H4X A;  3AD8 B;  1CC6 A;  4Y4M A;  3SZW A;  4EIP A;  2WOV A;  1LVL A;  1GRE A;  3G5S A;  4H4P A;  1F8S A;  1B4V A;  3GDN A;  4GAV A;  2AR8 A;  4C74 A;  2Q6U A;  2QCU A;  2YR6 A;  3ALJ A;  4I58 A;  1VG9 A;  4KPR A;  3QSE A;  1IUV A;  1FEA A;  1P2H A;  3SXI A;  2BXS A;  3AED A;  1Q1W A;  2XVH A;  2YR5 A;  3AE6 A;  3V3O A;  4Z2T A;  2I0Z A;  1ZP0 A;  2YLZ A;  4U8N A;  4RG3 A;  4A6N B;  2E5V A;  1NDA A;  3SYI A;  4X9M A;  5GSN A;  1ZKQ A;  2YWL A;  3KPF A;  4NEV A;  3LB8 A;  2JB2 A;  5BRT A;  2EQ8 A;  3FIM B;  2X99 A;  2CDU A;  2PYX A;  1IUS A;  2WPE A;  3P4S A;  4NTD A;  5HXI A;  1B8S A;  4A9W A;  3DJD A;  4WCT A;  1Y56 B;  2XLT A;  3AWI A;  2C3D A;  3LOV A;  4H4Z A;  2B9Y A;  3SX6 A;  1KSU A;  2C65 A;  3GD3 A;  3NYC A;  3T0K A;  3T37 A;  5J7X A;  2XFN A;  1PBE A;  3DGZ A;  1CBO A;  5IQ1 A;  5U25 A;  3UP4 A;  2WOW A;  3F8R A;  3NK0 X;  3ZDN A;  3E1T A;  5EB5 A;  3CNJ A;  1N4V A;  5KVH A;  2X8G A;  5ER0 A;  3AD7 B;  3UTG A;  3VRB A;  2NVK X;  1UKV G;  2Z5Y A;  4KX6 A;  1EL9 A;  2IVE A;  1S3B A;  2WEU A;  1MO9 A;  3P4P A;  1NHQ A;  4G74 A;  2RGJ A;  3PVC A;  4ZCC A;  4CY6 A;  3AE9 A;  3V3N A;  1GAL A;  4K8D A;  4K5S A;  3FBS A;  1M6I A;  3DK8 A;  3L1R A;  2RGO A;  2YM1 A;  1Q9I A;  3KKJ A;  3DA1 A;  4NNJ A;  5KRQ A;  1GRF A;  4XWR A;  4H7U A;  2XLU A;  3COX A;  3QSM A;  3AEB A;  4UP3 A;  5JCK A;  4K22 A;  2GMH A;  2GV8 A;  3ITJ A;  5L46 A;  2C7G A;  3LZX A;  3NN6 X;  3NN0 X;  2WU2 A;  2WS3 A;  1PXA A;  1DXL A;  1QLB A;  5IPY A;  2Z5X A;  3DJE A;  3HZL A;  5JCM A;  5KMR A;  2GR1 A;  1GTH A;  1W4X A;  1HYU A;  2JKC A;  2BYB A;  4BK1 A;  1IJH A;  3K7T A;  1JU2 A;  4YTM A;  3JSK A;  4EMJ A;  4YSX A;  3NHO X;  1L9C A;  2B76 A;  1DOC A;  4YWO A;  1NEK A;  2APG A;  1CJ3 A;  3LJP A;  2BA9 A;  2V6O A;  2XFU A;  3NYF A;  3CPH G;  3DK4 A;  2VZ2 A;  1PXC A;  3KD9 A;  3CIR A;  3BI4 A;  1E1L A;  3QFB A;  4DNA A;  5LV9 A;  2YLS A;  4DSG A;  1Z6L A;  1YY5 A;  2C76 A;  4GCM A;  3QFA A;  4EQW A;  1TRB A;  2WPC A;  3HYV A;  4B69 A;  4GF7 A;  3KPK A;  4PAA A;  3P1W A;  3CMM A;  2YG6 A;  4AT2 A;  2WDQ A;  1NG3 A;  2WP6 A;  3DK9 A;  3BI2 A;  3K7Q X;  3URH A;  4YKF A;  1RYI A;  2E1M A;  2XLS A;  5CKU A;  5JCL A;  4YSY A;  2EQ6 A;  2V5Z A;  3EAN A;  2ARD A;  3AYL A;  2GR2 A;  3EAO A;  4RG4 A;  1FOH A;  2C70 A;  4CCQ A;  1D4C A;  2Q0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...