3UOYA

Crystal structure of otemo complex with fad and nadp (form 1)
Total Genus 192
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
192
sequence length
540
structure length
537
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 192
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uoyA01
1GT8A 1K0IA 4D04A 3RNMA 4I58A 1Y0PA 2GVCA 4A99A 2BS3A 4OPCA 1DOEA 2BACA 2BK3A 5EOWA 4Y4MA 3T37A 3AEGA 1IUSA 3KA7A 3DGZA 2CFYA 3DH9A 4J56A 2R4JA 4A79A 2YG7A 1CC4A 1ELIA 3ABVA 3ALJA 4EIPA 4H4TA 1RP0A 1NHRA 4X9MA 4J2WA 5C3JA 2WDVA 1PBEA 3G5RA 3FIMB 4HA6A 3ADAB 2YLXA 4GRTA 3K7QX 4U8NA 1GALA 1XDIA 2JB2A 4GR1A 1M6IA 2VVMA 4TM4A 1CC6A 1GOSA 4H4PA 1XPQA 4EQSA 5IPYA 3OZ2A 2ACZA 1H86A 3H8LA 4NTEA 2VRMA 4CY8A 1JNRA 2W0HA 4YT0A 5FS9A 3AD9B 3SQPA 1PHHA 5FMHA 1N4VA 4H2PA 5FS7A 4JN9A 1PDHA 2WP9A 3CGDA 1BGNA 4GDPA 2QAEA 1GETA 4K8DA 4ADWA 1Q9IA 4J33A 4NEVA 1D4DA 2X8CA 3VR8A 4WX1A 3H8IA 1ZDLA 1E1NA 4U8OA 3ALLA 3NTDA 2OAMA 2XVFA 4NTDA 2YR6A 3IWAA 1H6VA 3URHA 3R9UA 4U8JA 1D4EA 4RG4A 2GMHA 1BKWA 3KD9A 1YY5A 4LIIA 2VRLA 3BNUA 4YXDA 3F8RA 1CL0A 1D5TA 2B9WA 1LVLA 2BXRA 2V3AA 3NT6A 4KPRA 4XWRA 3UKKA 5JCMA 5JCKA 4TM1A 3AB1A 3M13A 3SGLA 3CGBA 3KPFA 1H82A 4NZHA 4UDPA 4J31A 1VG9A 1M64A 1VRQB 4AOXA 3IHGA 1KNPA 1H84A 2V60A 2E4GA 2YVFA 1COYA 3VQRA 1QJDA 1MOKA 1MXTA 4H2NA 2C3CA 3FPZA 4U2TA 3GD4A 1OJCA 1PBBA 3DGHA 3GSIA 1RYIA 3NTAA 4XWZA 1L9DA 2XLUA 1E1MA 2EQ9A 5BUKA 4N9XA 1ONFA 3UKFA 1FL2A 4H4WA 3DJEA 1H7XA 2FJDA 2X50A 2Y6QA 2WOVA 3NK2X 4AP3A 2C65A 3KKJA 1JEHA 2WQYA 2XLSA 3NN6X 3AWIA 4TLXA 3VR9A 2BCPA 3UOVA 3GMBA 2E5VA 3AD7B 3DJGX 1ZOYA 1B5QA 2GMJA 1B4VA 3PS9A 1YQ3A 4H2RA 4OPGA 3ZYXA 2WOWA 1GREA 1DJQA 1X31B 1GXFA 5U1OA 4APNA 5KRQA 4U2LA 3QSSA 1LJ1A 1NEKA 2Z5YA 4BJYA 2IVEA 3UP5A 3C4NA 2A8XA 3SFDA 3CPIG 4ICYA 1DOCA 4PAAA 1B8SA 2R4EA 3NGCX 3CGCA 4REKA 1JRZA 2R0CA 1NHPA 2OALA 1BZLA 3S61A 4DSGA 1PXBA 3UTEA 3QSEA 2UZZA 3G5SA 4K2XA 4GCMA 4H4VA 2JAEA 3II4A 1CJ4A 1PJ5A 5IQ4A 3UP4A 3H4KA 3OC4A 2BS4A 4JDRA 1H81A 1O94A 2XFOA 5GSNA 1SEZA 2Q6UA 2IVDA 4J34A 4GUVA 3VRAA 3UOZA 2WPEA 4TM0A 3GDPA 3IHMA 2C7GA 4FK1A 1JNZA 1MO9A 3VRDB 5JCIA 1IUXA 3ATRA 1ZMDA 5HY5A 1N4WA 3SM8A 4EQRA 2XDOA 4DSHA 3V76A 5BVAA 1ZKQA 3BI2A 3NYCA 3NYFA 4OVIA 4I59A 2ARDA 2VZ2A 1P2HA 2YM1A 4JY2A 2WHDA 4B68A 3CTYA 4B63A 1PBFA 3UOXA 3AE9A 4AOSA 3IC9A 1GERA 4JNAA 1GV4A 1NG3A 1K4QA 3AYJA 3ITJA 4H4YA 3UOYA 4B66A 1KSUA 4U8PA 3LZXA 2EQ6A 1S2QA 1ZP0A 4UDRA 4X4JA 2X8HA 5DBJA 2R46A 2GRTA 4USQA 4KX6A 1F6MA 1JRYA 4EMIA 3NYEA 4Z2TA 3ISHA 2B7RA 2XLPA 4ZCDA 2F5ZA 2GB0A 2R0PA 1GNDA 2DKIA 4CNJA 4EMWA 4IVMB 4LU6A 3VRBA 1F8WA 4ZCCA 1EL9A 1BF3A 1BWCA 1QLBA 1TDEA 2X99A 3GWFA 2C64A 2FJBA 1IUWA 4OPLA 3CN8A 1GEUA 1H7WA 1DXLA 2TPRA 2BS2A 1BGJA 2XVIA 3UKQA 1S3BA 1FECA 2WPFA 3S5WA 1YQZA 1GSNA 3LJPA 2YVGA 4BK1A 2WESA 2B9YA 1E39A 1PN0A 2QA2A 4YSXA 3QVRA 3CPHG 1GTEA 3C4AA 4IA5A 1LPFA 3QSMA 4OPTA 3CIRA 4USRA 4B64A 2Q7VA 1EL5A 3ATQA 1D7LA 1VQWA 3EAOA 4A7AA 3FMWA 2GV8A 1H83A 1NENA 5EB5A 3RHAA 3AE4A 4CCRA 2GR1A 2BYBA 2ZBWA 3AEFA 3CNPA 1KDGA 3NIXA 3LZWA 2YLRA 1DODA 3F8PA 2XFQA 5KXJA 2WS3A 2FJAA 4Z2RA 2R0GA 5FS6A 4CCQA 2AR8A 2CVJA 1TRBA 4H50A 3NG7X 4OPUA 3DK8A 4AT2A 4K5RA 2C3DA 2R9ZA 2B9XA 1GRTA 4U8MA 3DK4A 2XLTA 2ZZCA 3UTGA 4UP3A 3SFEA 2HQMA 3P9UA 3QFAA 4M52A 3DJDA 3V3OA 4DNAA 4A9WA 1PJ7A 2YVJA 4NTCA 2B7SA 2TMDA 2YR5A 2C76A 3RP7A 3I6DA 5JCNA 3CNDA 5KWFA 1TDOA 3D1CA 1GRHA 2OA1A 4C77A 5HHFA 4B69A 4U8KA 2A87A 3LXDA 3AEDA 3NK1X 1KNRA 2WOIA 3M0OA 1GPEA 1O5WA 1GRAA 1YKJA 1DJNA 2RGJA 4Z24A 2NVKX 4MJWA 4U8LA 2V6OA 3NN0X 4EQXA 3C96A 4EM4A 4YSHA 2BCGG 2C67A 3AYIA 2R45A 1DOBA 3GYJA 3AE5A 5M0ZA 2GH5A 5M10A 4EM3A 2JB3A 4Z43A 1TYPA 3UCLA 3CNTA 3F8DA 1GRGA 1P2EA 1Y56B 2V61A 4AP1A 3L1RA 2VVLA 2X3NA 1FEAA 1PXAA 1PBCA 3GDNA 4TM3A 2J3NA 3QJ4A 2RGHA 1NHQA 5GRTA 3GRSA 3NNEA 2VVLG 4C3YA 2XVEA 3P4RA 1FOHA 3AE7A 4A6NB 3AE6A 1FEBA 2APGA 1E1LA 4K22A 4H4ZA 3Q6JA 4CBQA 2YLTA 1OJAA 3LADA 1V59A 3O0HA 2JKCA 5IQ1A 4Z26A 3G5QA 5J60A 4YSYA 3P4QA 3AE8A 3IF9A 3PVCA 5J7XA 1LTXR 1F3PA 1VG0A 4U2SA 1GESA 2OLOA 1PS9A 2GEWA 4FDCB 3D8XA 1PJ6A 2BXSA 1FCDA 2AQJA 4A65A 1E1KA 1EL8A 4Y4NA 3L8KA 1F8SA 4O5QA 4YSZA 3I3LA 2YM2A 4ZN0A 3NLCA 2GR0A 1CHUA 1RSGA 1KFYA 2GR3A 2V5ZA 3ICSA 3NK0X 2X8GA 3AEBA 1TYTA 2QA1A 2NPXA 2BABA 4FK1C 2WBAA 4YKFA 3QFBA 1JU2A 3CNSA 4H4XA 2Y6RA 4J36A 2WEUA 4ECHA 2GAGB 4UDQA 2XVHA 3B3RA 3RP6A 5CKUA 1S3EA 2Z5XA 3UKHA 5HYMA 1F8RA 5KVHA 1JOAA 2BK5A 1ZOVA 2XVJA 1OJDA 3DA1A 3NHOX 1D4CA 1HYUA 3K7TA 3DJJA 1D7YA 1CBOA 1E6EA 2VQBA 1ZY8A 1CC2A 2YLWA 2YG4A 2BA9A 2H88A 2YQUA 3KLJA 3AEEA 3M12A 2C75A 3UTFA 4AT0A 5LV9A 3GRTA 2GQWA 1OJTA 1PXCA 1IJHA 1NAAA 2PHHA 3BNMA 2O9ZA 3RP8A 3EPTA 1EBDA 2YLSA 3GYIA 1TDKA 5FS8A 4H4SA 4OPIA 1IUTA 3NH3X 1VDCA 2PYXA 4H7UA 2Q0LA 3DMEA 2YG6A 3AE1A 4D03A 2C66A 2YG5A 5KOXA 2WDQA 3BI4A 2WU2A 1QO8A 1LV0A 4JY3A 3UKLA 3CGEA 4IV9A 1REOA 4GDEA 5C2TA 1KSSA 1CJ2A 2XLRA 4H2QA 4CNKA 4YTPA 3E1TA 5HXIA 2XFUA 4Z2UA 5JCLA 4BK3A 2BC0A 1Y56A 2XYOA 3BHFA 4C5OA 2YG3A 1L0VA 2XFNA 1TDFA 1GTHA 1PBDA 5BULA 5ER0A 2WP6A 3CNJA 2BC1A 3BHKA 3DK9A 1CJCA 4FX9A 5EBKA 1TDNA 2C73A 2CDUA 1NDAA 3KU9A 4K7ZA 4BV6A 3NKSA 4PABA 3BI5A 4A6NA 4EMJA 4LA1A 3AE2A 4XXGA 2B76A 1NHSA 3NRNA 1XANA 4YKGA 3AEAA 1W4XA 4RSLA 1GRFA 2VQ7A 2WETA 2JK6A 3AE3A 5EB4A 1ZX9A 1DNCA 2VOUA 3UKAA 3EF6A 5KOWA 3LOVA 3Q9TA 4OCGA 4H4RA 4U8IA 4YTMA 4A5LA 5TR3A 4DGKA 2AAQA 3HZLA 4O5UA 4E0VA 2IIDA 2GR2A 2FJEA 3P1WA 5CQFA 4BURA 3AXBA 3WE0A 2OLNA 4K5SA 1OJ9A 4IA6A 4GF7A 2CULA 1IUUA 2JB1A 4CY6A 3AECA 1YQ4A 4H4QA 1S2YA 2FBWA 2WDRA 2RABA 4B1BA 1Q1WA 2YAUA 4WCTA 2YR4A 5L46A 2DKHA 2A89A 2WP5A 3AD8B 3FG2P 4TLZA 1KF6A 1AOGA 1Z6LA 3JSKA 2JBVA 4IVOB 4JQ9A 3FBSA 1N1PA 1K0JA 1LQUA 1ZK7A 2QCUA 3B6DA 3AYLA 2GQFA 2BK4A 1GRBA 1NPXA 3PO7A 2EQ7A 4C3XA 4B65A 2XCGA 3UTHA 1NG4A 3V3NA 3KVEA 1B37A 2GF3A 3ALMA 1CF3A 4RG3A 2XFPA 4JNQA 3GMCA 1UKVG 1Q1RA 2ZZBA 4BJZA 1K0LA 1JRXA 4HB9A 4Z44A 4EQWA 1N4UA 4Z25A 2ZZ0A 1CJ3A 3ICRA 4BK2A 1XHCA 2GAHB 1L9CA 2Q0KA 3COXA 3EANA 2E1MA 3ICTA 3LB8A 4OPDA 4NEWA 2WPCA 3REDA 1E7PA 3ZDNA 4CRTA 3GD3A 3K7MX 3P4PA 1ZMCA 2I0ZA 2V3BA 3P4SA 3QVPA 2RGOA 1O95A 2EQ8A 4YWOA 5KVIA 4H4UA 3CPJG 4J57A 4X9NA 5BRTA 4P9SA 1EL7A 4EIQA 3K30A 2C72A 4B67A 2WU5A 3UKPA 4YTNA 2YWLA 3GWDA 5U63A 2YLZA 5U25A 1L9EA 2C70A 4Y4LA 2H89A 1IUVA 4C74A 1LQTA
chains in the Genus database with same CATH superfamily
1GT8A 1K0IA 4D04A 3RNMA 4I58A 1Y0PA 2GVCA 4A99A 2BS3A 4OPCA 1DOEA 2BACA 2BK3A 5EOWA 4Y4MA 3T37A 3AEGA 1IUSA 3KA7A 3DGZA 2CFYA 3DH9A 4J56A 2R4JA 4A79A 2YG7A 1CC4A 1ELIA 3ABVA 3ALJA 3HYXA 3T2ZA 4H4TA 1RP0A 4EIPA 1NHRA 4X9MA 4J2WA 5C3JA 2WDVA 1PBEA 3G5RA 3FIMB 4HA6A 3ADAB 2YLXA 4GRTA 3K7QX 4U8NA 1GALA 1XDIA 2JB2A 4GR1A 1M6IA 2VVMA 4TM4A 1CC6A 1GOSA 4H4PA 1XPQA 4EQSA 5IPYA 3OZ2A 2ACZA 1H86A 3H8LA 4NTEA 2VRMA 4CY8A 1JNRA 2W0HA 4YT0A 5FS9A 3AD9B 3SQPA 1PHHA 5FMHA 1N4VA 4H2PA 5FS7A 4JN9A 1PDHA 2WP9A 3CGDA 1BGNA 4GDPA 2QAEA 1GETA 4K8DA 4ADWA 4GAVA 1Q9IA 4J33A 4NEVA 1D4DA 2X8CA 3VR8A 4WX1A 3H8IA 1ZDLA 1E1NA 4U8OA 3SY4A 3ALLA 3NTDA 2OAMA 2XVFA 4NTDA 2YR6A 3IWAA 1H6VA 3URHA 5KMPA 3R9UA 4U8JA 1D4EA 4RG4A 2GMHA 1BKWA 3KD9A 1YY5A 4LIIA 2VRLA 3BNUA 4YXDA 3F8RA 1CL0A 1D5TA 2B9WA 1LVLA 2BXRA 2V3AA 3NT6A 4KPRA 4XWRA 5KMQA 3T14A 3UKKA 5JCMA 4TM1A 5JCKA 3AB1A 3M13A 3SGLA 3CGBA 3KPFA 1H82A 4NZHA 4UDPA 4J31A 1VG9A 1M64A 1VRQB 4AOXA 3IHGA 1KNPA 1H84A 2V60A 2E4GA 2YVFA 1COYA 3VQRA 4NWZA 1QJDA 1MOKA 1MXTA 4H2NA 2C3CA 3FPZA 4U2TA 3GD4A 1OJCA 1PBBA 3DGHA 3GSIA 1RYIA 3NTAA 4XWZA 1L9DA 3GYXA 2XLUA 1E1MA 2EQ9A 5BUKA 4N9XA 1ONFA 3UKFA 1FL2A 4H4WA 3DJEA 1H7XA 2FJDA 2X50A 2Y6QA 2WOVA 3CMMA 3NK2X 4AP3A 2C65A 3KKJA 1JEHA 2WQYA 2XLSA 3NN6X 3AWIA 4TLXA 3VR9A 2BCPA 3UOVA 3GMBA 2E5VA 4G6GA 3AD7B 3DJGX 1ZOYA 1B5QA 2GMJA 1B4VA 3PS9A 1YQ3A 4H2RA 4OPGA 3ZYXA 2WOWA 1GREA 1DJQA 1X31B 1GXFA 4II2A 5U1OA 4APNA 5KRQA 4U2LA 3KPKA 3QSSA 1LJ1A 1NEKA 2Z5YA 4BJYA 2IVEA 3UP5A 3C4NA 2A8XA 3SFDA 3CPIG 4ICYA 1DOCA 4PAAA 1B8SA 2R4EA 3T31A 3NGCX 3CGCA 4REKA 1JRZA 2R0CA 1NHPA 2OALA 1BZLA 3S61A 4DSGA 1PXBA 3UTEA 3QSEA 2UZZA 3G5SA 4K2XA 4GCMA 4H4VA 2JAEA 3II4A 1CJ4A 1PJ5A 5IQ4A 3UP4A 3H4KA 3OC4A 2BS4A 4JDRA 1H81A 1O94A 2XFOA 5GSNA 1SEZA 2Q6UA 2IVDA 4J34A 4GUVA 3VRAA 5KMSA 3UOZA 2WPEA 4TM0A 3GDPA 3IHMA 2C7GA 4G73A 4FK1A 1JNZA 1MO9A 3VRDB 5JCIA 4GAPA 1IUXA 3ATRA 1ZMDA 5HY5A 1N4WA 3SM8A 4EQRA 2XDOA 4DSHA 3V76A 5BVAA 1ZKQA 3BI2A 3NYCA 3NYFA 4OVIA 4I59A 2ARDA 2VZ2A 1P2HA 2YM1A 4JY2A 2WHDA 4B68A 3CTYA 4B63A 1PBFA 3UOXA 3AE9A 4AOSA 3IC9A 1GERA 4JNAA 1GV4A 1NG3A 1K4QA 3AYJA 3ITJA 4H4YA 3UOYA 4B66A 1KSUA 4U8PA 3LZXA 2EQ6A 1S2QA 1ZP0A 4UDRA 4X4JA 2X8HA 5DBJA 2R46A 2GRTA 4USQA 4KX6A 1F6MA 1JRYA 4EMIA 3NYEA 4Z2TA 3ISHA 2B7RA 2XLPA 4ZCDA 2F5ZA 2GB0A 2R0PA 1GNDA 2DKIA 4CNJA 4EMWA 4IVMB 4LU6A 3VRBA 1F8WA 4ZCCA 1EL9A 1BF3A 1BWCA 1QLBA 1TDEA 2X99A 3GWFA 2BRYA 2C64A 2FJBA 1IUWA 4OPLA 3CN8A 1GEUA 1H7WA 1DXLA 2TPRA 2BS2A 1BGJA 2XVIA 3UKQA 1S3BA 1FECA 2WPFA 3S5WA 1YQZA 1GSNA 3LJPA 2YVGA 4BK1A 2WESA 2B9YA 1E39A 1PN0A 2QA2A 4YSXA 3QVRA 3CPHG 1GTEA 3C4AA 4IA5A 1LPFA 3QSMA 4OPTA 3CIRA 4USRA 4B64A 2Q7VA 1EL5A 3ATQA 1D7LA 1VQWA 3EAOA 4A7AA 3FMWA 2GV8A 1H83A 1NENA 5EB5A 3RHAA 3AE4A 4CCRA 2GR1A 2BYBA 2ZBWA 3AEFA 3CNPA 1KDGA 3NIXA 3LZWA 2YLRA 1DODA 3F8PA 2XFQA 5KXJA 2WS3A 2FJAA 4Z2RA 2R0GA 5FS6A 4CCQA 2AR8A 2CVJA 1TRBA 4H50A 3NG7X 4OPUA 3DK8A 4AT2A 4K5RA 2C3DA 2R9ZA 2B9XA 1GRTA 4U8MA 3DK4A 5KMRA 2XLTA 2ZZCA 3UTGA 4UP3A 3SZFA 3SFEA 2HQMA 3P9UA 3QFAA 4M52A 3DJDA 3V3OA 4DNAA 4A9WA 1PJ7A 2YVJA 4NTCA 2B7SA 2TMDA 2YR5A 2C76A 3RP7A 3I6DA 5JCNA 3CNDA 5KWFA 1TDOA 3D1CA 1GRHA 2OA1A 4C77A 3SX6A 5HHFA 4B69A 4U8KA 2A87A 3LXDA 3AEDA 3NK1X 1KNRA 2WOIA 3M0OA 1GPEA 1O5WA 1GRAA 1YKJA 1DJNA 2RGJA 4Z24A 2NVKX 4MJWA 4U8LA 2V6OA 3NN0X 4EQXA 3C96A 4EM4A 4YSHA 2BCGG 2C67A 3AYIA 2R45A 1DOBA 3GYJA 3AE5A 5M0ZA 2GH5A 5M10A 4EM3A 2JB3A 4Z43A 1TYPA 3UCLA 3CNTA 3F8DA 1GRGA 1P2EA 2C4CA 1Y56B 2V61A 4AP1A 3L1RA 2VVLA 2X3NA 1FEAA 1PXAA 1PBCA 3GDNA 4TM3A 2J3NA 3QJ4A 2RGHA 3T0KA 1NHQA 5GRTA 3GRSA 3NNEA 2VVLG 4C3YA 2XVEA 3P4RA 1FOHA 3AE7A 4A6NB 3AE6A 1FEBA 2APGA 1E1LA 4K22A 4H4ZA 3Q6JA 4CBQA 2YLTA 1OJAA 3LADA 1V59A 3O0HA 2JKCA 5IQ1A 4Z26A 3G5QA 5J60A 4YSYA 3P4QA 3HYWA 3AE8A 3IF9A 3PVCA 5J7XA 1LTXR 1F3PA 1VG0A 4U2SA 1GESA 2OLOA 3SZCA 1PS9A 2GEWA 4FDCB 3D8XA 1PJ6A 2BXSA 1FCDA 2AQJA 4A65A 1E1KA 1EL8A 4Y4NA 3L8KA 1F8SA 4O5QA 4YSZA 3I3LA 2YM2A 4ZN0A 3NLCA 2GR0A 1CHUA 1RSGA 1KFYA 2GR3A 2V5ZA 3ICSA 3NK0X 2X8GA 3AEBA 1TYTA 2QA1A 2NPXA 2BABA 5KNLA 4FK1C 2WBAA 4G6HA 4YKFA 3QFBA 1JU2A 3CNSA 4H4XA 2Y6RA 4J36A 2WEUA 4ECHA 2GAGB 4UDQA 2XVHA 3B3RA 3RP6A 5CKUA 1S3EA 2Z5XA 3UKHA 5HYMA 1F8RA 5KVHA 1JOAA 2BK5A 1ZOVA 2XVJA 1OJDA 3DA1A 3NHOX 1D4CA 1HYUA 3K7TA 3DJJA 1D7YA 1CBOA 1E6EA 2VQBA 1ZY8A 1CC2A 2YLWA 2YG4A 2BA9A 2H88A 2YQUA 3KLJA 3AEEA 3M12A 2C75A 4G9KA 3UTFA 4AT0A 5LV9A 3GRTA 2GQWA 1OJTA 1PXCA 1IJHA 1NAAA 2PHHA 3BNMA 2O9ZA 3RP8A 3EPTA 1EBDA 2YLSA 3GYIA 1TDKA 5FS8A 4H4SA 4OPIA 1IUTA 3NH3X 1VDCA 2PYXA 4H7UA 2Q0LA 3DMEA 2YG6A 3AE1A 4D03A 2C66A 2YG5A 5KOXA 2WDQA 3BI4A 2WU2A 1QO8A 1LV0A 4JY3A 3UKLA 3CGEA 4IV9A 1REOA 4GDEA 5C2TA 1KSSA 1CJ2A 2XLRA 4H2QA 4CNKA 4YTPA 3E1TA 5HXIA 2XFUA 4Z2UA 5JCLA 4BK3A 2BC0A 1Y56A 2XYOA 3BHFA 4C5OA 2YG3A 1L0VA 2XFNA 1TDFA 1GTHA 3T2YA 1PBDA 5BULA 5ER0A 2WP6A 3CNJA 2BC1A 3BHKA 3DK9A 1CJCA 4FX9A 5EBKA 1TDNA 2C73A 2CDUA 1NDAA 3KU9A 4K7ZA 4BV6A 3NKSA 4PABA 3BI5A 4A6NA 4EMJA 4LA1A 3AE2A 4XXGA 2B76A 1NHSA 3NRNA 1XANA 4YKGA 3AEAA 1W4XA 4RSLA 1GRFA 2VQ7A 2WETA 2JK6A 3AE3A 5EB4A 3T2KA 1ZX9A 1DNCA 2VOUA 3UKAA 3EF6A 5KOWA 3LOVA 3Q9TA 4OCGA 4H4RA 4II3A 4U8IA 4YTMA 4A5LA 3SZWA 5TR3A 4DGKA 2AAQA 3HZLA 4O5UA 4E0VA 2IIDA 2GR2A 2FJEA 3P1WA 5CQFA 4BURA 3AXBA 3WE0A 2OLNA 4K5SA 1OJ9A 4IA6A 4GF7A 2CULA 1IUUA 2JB1A 4CY6A 3AECA 1YQ4A 4H4QA 1S2YA 2FBWA 2WDRA 2RABA 4B1BA 1Q1WA 2YAUA 4WCTA 2YR4A 5L46A 2DKHA 2A89A 2WP5A 3AD8B 3FG2P 4TLZA 1KF6A 1AOGA 1Z6LA 3JSKA 2JBVA 4IVOB 4JQ9A 3FBSA 1N1PA 1K0JA 1LQUA 1ZK7A 2QCUA 3B6DA 3AYLA 2GQFA 2BK4A 1GRBA 1NPXA 3PO7A 2EQ7A 4C3XA 4B65A 2XCGA 3UTHA 1NG4A 3SYIA 3V3NA 3KVEA 3SXIA 1B37A 2GF3A 2BRAA 3ALMA 1CF3A 4NNJA 4RG3A 2XFPA 4JNQA 3GMCA 1UKVG 1Q1RA 2ZZBA 4BJZA 1K0LA 1JRXA 4HB9A 4Z44A 4EQWA 1N4UA 4Z25A 2ZZ0A 1CJ3A 3ICRA 4BK2A 1XHCA 2GAHB 1L9CA 2Q0KA 3COXA 3EANA 2E1MA 3ICTA 3LB8A 4OPDA 4NEWA 2WPCA 3REDA 1E7PA 3ZDNA 4CRTA 3GD3A 3SZ0A 3K7MX 3P4PA 1ZMCA 2I0ZA 2V3BA 3P4SA 3QVPA 2RGOA 1O95A 2EQ8A 4YWOA 5KVIA 4H4UA 3CPJG 4J57A 4X9NA 5BRTA 4P9SA 1EL7A 4EIQA 3K30A 2C72A 4B67A 2WU5A 3UKPA 4YTNA 2YWLA 3HYVA 3GWDA 5U63A 2YLZA 5U25A 1L9EA 2C70A 4G74A 4Y4LA 2H89A 1IUVA 4C74A 1LQTA
chains in the Genus database with same CATH topology
1GT8A 1K0IA 4D04A 3RNMA 4I58A 1Y0PA 2GVCA 4A99A 2BS3A 4OPCA 1DOEA 2BACA 2BK3A 5EOWA 4Y4MA 3T37A 3AEGA 1IUSA 3KA7A 3DGZA 2CFYA 3DH9A 4J56A 2R4JA 4A79A 2YG7A 1CC4A 1ELIA 3ABVA 3ALJA 3HYXA 3T2ZA 4H4TA 1RP0A 4EIPA 1NHRA 4X9MA 4J2WA 5C3JA 2WDVA 1PBEA 3G5RA 3FIMB 4HA6A 3ADAB 2YLXA 4GRTA 3K7QX 4U8NA 1GALA 1XDIA 2JB2A 4GR1A 1M6IA 2VVMA 4TM4A 1CC6A 1GOSA 4H4PA 1XPQA 4EQSA 5IPYA 3OZ2A 2ACZA 1H86A 3H8LA 4NTEA 2VRMA 4CY8A 1JNRA 2W0HA 4YT0A 5FS9A 3AD9B 3SQPA 1PHHA 5FMHA 1N4VA 4H2PA 5FS7A 4JN9A 1PDHA 2WP9A 3CGDA 1BGNA 4GDPA 2QAEA 1GETA 4K8DA 4ADWA 4GAVA 1Q9IA 4J33A 4NEVA 1D4DA 2X8CA 3VR8A 4WX1A 3H8IA 1ZDLA 1E1NA 4U8OA 3SY4A 3ALLA 3NTDA 2OAMA 2XVFA 4NTDA 2YR6A 3IWAA 1H6VA 3URHA 5KMPA 3R9UA 4U8JA 1D4EA 4RG4A 2GMHA 1BKWA 3KD9A 1YY5A 4LIIA 2VRLA 3BNUA 4YXDA 3F8RA 1CL0A 1D5TA 2B9WA 1LVLA 2BXRA 2V3AA 3NT6A 4KPRA 4XWRA 5KMQA 3T14A 3UKKA 5JCMA 4TM1A 5JCKA 3AB1A 3M13A 3SGLA 3CGBA 3KPFA 1H82A 4NZHA 4UDPA 4J31A 1VG9A 1M64A 1VRQB 4AOXA 3IHGA 1KNPA 1H84A 2V60A 2E4GA 2YVFA 1COYA 3VQRA 4NWZA 1QJDA 1MOKA 1MXTA 4H2NA 2C3CA 3FPZA 4U2TA 3GD4A 1OJCA 1PBBA 3DGHA 3GSIA 1RYIA 3NTAA 4XWZA 1L9DA 3GYXA 2XLUA 1E1MA 2EQ9A 5BUKA 4N9XA 1ONFA 3UKFA 1FL2A 4H4WA 3DJEA 1H7XA 2FJDA 2X50A 2Y6QA 2WOVA 3CMMA 3NK2X 4AP3A 2C65A 3KKJA 1JEHA 2WQYA 2XLSA 3NN6X 3AWIA 4TLXA 3VR9A 2BCPA 3UOVA 3GMBA 2E5VA 4G6GA 3AD7B 3DJGX 1ZOYA 1B5QA 2GMJA 1B4VA 3PS9A 1YQ3A 4H2RA 4OPGA 3ZYXA 2WOWA 1GREA 1DJQA 1X31B 1GXFA 4II2A 5U1OA 4APNA 5KRQA 4U2LA 3KPKA 3QSSA 1LJ1A 1NEKA 2Z5YA 4BJYA 2IVEA 3UP5A 3C4NA 2A8XA 3SFDA 3CPIG 4ICYA 1DOCA 4PAAA 1B8SA 2R4EA 3T31A 3NGCX 3CGCA 4REKA 1JRZA 2R0CA 1NHPA 2OALA 1BZLA 3S61A 4DSGA 1PXBA 3UTEA 3QSEA 2UZZA 3G5SA 4K2XA 4GCMA 4H4VA 2JAEA 3II4A 1CJ4A 1PJ5A 5IQ4A 3UP4A 3H4KA 3OC4A 2BS4A 4JDRA 1H81A 1O94A 2XFOA 5GSNA 1SEZA 2Q6UA 2IVDA 4J34A 4GUVA 3VRAA 5KMSA 3UOZA 2WPEA 4TM0A 3GDPA 3IHMA 2C7GA 4G73A 4FK1A 1JNZA 1MO9A 3VRDB 5JCIA 4GAPA 1IUXA 3ATRA 1ZMDA 5HY5A 1N4WA 3SM8A 4EQRA 2XDOA 4DSHA 3V76A 5BVAA 1ZKQA 3BI2A 3NYCA 3NYFA 4OVIA 4I59A 2ARDA 2VZ2A 1P2HA 2YM1A 4JY2A 2WHDA 4B68A 3CTYA 4B63A 1PBFA 3UOXA 3AE9A 4AOSA 3IC9A 1GERA 4JNAA 1GV4A 1NG3A 1K4QA 3AYJA 3ITJA 4H4YA 3UOYA 4B66A 1KSUA 4U8PA 3LZXA 2EQ6A 1S2QA 1ZP0A 4UDRA 4X4JA 2X8HA 5DBJA 2R46A 2GRTA 4USQA 4KX6A 1F6MA 1JRYA 4EMIA 3NYEA 4Z2TA 3ISHA 2B7RA 2XLPA 4ZCDA 2F5ZA 2GB0A 2R0PA 1GNDA 2DKIA 4CNJA 4EMWA 4IVMB 4LU6A 3VRBA 1F8WA 4ZCCA 1EL9A 1BF3A 1BWCA 1QLBA 1TDEA 2X99A 3GWFA 2BRYA 2C64A 2FJBA 1IUWA 4OPLA 3CN8A 1GEUA 1H7WA 1DXLA 2TPRA 2BS2A 1BGJA 2XVIA 3UKQA 1S3BA 1FECA 2WPFA 3S5WA 1YQZA 1GSNA 3LJPA 2YVGA 4BK1A 2WESA 2B9YA 1E39A 1PN0A 2QA2A 4YSXA 3QVRA 3CPHG 1GTEA 3C4AA 4IA5A 1LPFA 3QSMA 4OPTA 3CIRA 4USRA 4B64A 2Q7VA 1EL5A 3ATQA 1D7LA 1VQWA 3EAOA 4A7AA 3FMWA 2GV8A 1H83A 1NENA 5EB5A 3RHAA 3AE4A 4CCRA 2GR1A 2BYBA 2ZBWA 3AEFA 3CNPA 1KDGA 3NIXA 3LZWA 2YLRA 1DODA 3F8PA 2XFQA 5KXJA 2WS3A 2FJAA 4Z2RA 2R0GA 5FS6A 4CCQA 2AR8A 2CVJA 1TRBA 4H50A 3NG7X 4OPUA 3DK8A 4AT2A 4K5RA 2C3DA 2R9ZA 2B9XA 1GRTA 4U8MA 3DK4A 5KMRA 2XLTA 2ZZCA 3UTGA 4UP3A 3SZFA 3SFEA 2HQMA 3P9UA 3QFAA 4M52A 3DJDA 3V3OA 4DNAA 4A9WA 1PJ7A 2YVJA 4NTCA 2B7SA 2TMDA 2YR5A 2C76A 3RP7A 3I6DA 5JCNA 3CNDA 5KWFA 1TDOA 3D1CA 1GRHA 2OA1A 4C77A 3SX6A 5HHFA 4B69A 4U8KA 2A87A 3LXDA 3AEDA 3NK1X 1KNRA 2WOIA 3M0OA 1GPEA 1O5WA 1GRAA 1YKJA 1DJNA 2RGJA 4Z24A 2NVKX 4MJWA 4U8LA 2V6OA 3NN0X 4EQXA 3C96A 4EM4A 4YSHA 2BCGG 2C67A 3AYIA 2R45A 1DOBA 3GYJA 3AE5A 5M0ZA 2GH5A 5M10A 4EM3A 2JB3A 4Z43A 1TYPA 3UCLA 3CNTA 3F8DA 1GRGA 1P2EA 2C4CA 1Y56B 2V61A 4AP1A 3L1RA 2VVLA 2X3NA 1FEAA 1PXAA 1PBCA 3GDNA 4TM3A 2J3NA 3QJ4A 2RGHA 3T0KA 1NHQA 5GRTA 3GRSA 3NNEA 2VVLG 4C3YA 2XVEA 3P4RA 1FOHA 3AE7A 4A6NB 3AE6A 1FEBA 2APGA 1E1LA 4K22A 4H4ZA 3Q6JA 4CBQA 2YLTA 1OJAA 3LADA 1V59A 3O0HA 2JKCA 5IQ1A 4Z26A 3G5QA 5J60A 4YSYA 3P4QA 3HYWA 3AE8A 3IF9A 3PVCA 5J7XA 1LTXR 1F3PA 1VG0A 4U2SA 1GESA 2OLOA 3SZCA 1PS9A 2GEWA 4FDCB 3D8XA 1PJ6A 2BXSA 1FCDA 2AQJA 4A65A 1E1KA 1EL8A 4Y4NA 3L8KA 1F8SA 4O5QA 4YSZA 3I3LA 2YM2A 4ZN0A 3NLCA 2GR0A 1CHUA 1RSGA 1KFYA 2GR3A 2V5ZA 3ICSA 3NK0X 2X8GA 3AEBA 1TYTA 2QA1A 2NPXA 2BABA 5KNLA 4FK1C 2WBAA 4G6HA 4YKFA 3QFBA 1JU2A 3CNSA 4H4XA 2Y6RA 4J36A 2WEUA 4ECHA 2GAGB 4UDQA 2XVHA 3B3RA 3RP6A 5CKUA 1S3EA 2Z5XA 3UKHA 5HYMA 1F8RA 5KVHA 1JOAA 2BK5A 1ZOVA 2XVJA 1OJDA 3DA1A 3NHOX 1D4CA 1HYUA 3K7TA 3DJJA 1D7YA 1CBOA 1E6EA 2VQBA 1ZY8A 1CC2A 2YLWA 2YG4A 2BA9A 2H88A 2YQUA 3KLJA 3AEEA 3M12A 2C75A 4G9KA 3UTFA 4AT0A 5LV9A 3GRTA 2GQWA 1OJTA 1PXCA 1IJHA 1NAAA 2PHHA 3BNMA 2O9ZA 3RP8A 3EPTA 1EBDA 2YLSA 3GYIA 1TDKA 5FS8A 4H4SA 4OPIA 1IUTA 3NH3X 1VDCA 2PYXA 4H7UA 2Q0LA 3DMEA 2YG6A 3AE1A 4D03A 2C66A 2YG5A 5KOXA 2WDQA 3BI4A 2WU2A 1QO8A 1LV0A 4JY3A 3UKLA 3CGEA 4IV9A 1REOA 4GDEA 5C2TA 1KSSA 1CJ2A 2XLRA 4H2QA 4CNKA 4YTPA 3E1TA 5HXIA 2XFUA 4Z2UA 5JCLA 4BK3A 2BC0A 1Y56A 2XYOA 3BHFA 4C5OA 2YG3A 1L0VA 2XFNA 1TDFA 1GTHA 3T2YA 1PBDA 5BULA 5ER0A 2WP6A 3CNJA 2BC1A 3BHKA 3DK9A 1CJCA 4FX9A 5EBKA 1TDNA 2C73A 2CDUA 1NDAA 3KU9A 4K7ZA 4BV6A 3NKSA 4PABA 3BI5A 4A6NA 4EMJA 4LA1A 3AE2A 4XXGA 2B76A 1NHSA 3NRNA 1XANA 4YKGA 3AEAA 1W4XA 4RSLA 1GRFA 2VQ7A 2WETA 2JK6A 3AE3A 5EB4A 3T2KA 1ZX9A 1DNCA 2VOUA 3UKAA 3EF6A 5KOWA 3LOVA 3Q9TA 4OCGA 4H4RA 4II3A 4U8IA 4YTMA 4A5LA 3SZWA 5TR3A 4DGKA 2AAQA 3HZLA 4O5UA 4E0VA 2IIDA 2GR2A 2FJEA 3P1WA 5CQFA 4BURA 3AXBA 3WE0A 2OLNA 4K5SA 1OJ9A 4IA6A 4GF7A 2CULA 1IUUA 2JB1A 4CY6A 3AECA 1YQ4A 4H4QA 1S2YA 2FBWA 2WDRA 2RABA 4B1BA 1Q1WA 2YAUA 4WCTA 2YR4A 5L46A 2DKHA 2A89A 2WP5A 3AD8B 3FG2P 4TLZA 1KF6A 1AOGA 1Z6LA 3JSKA 2JBVA 4IVOB 4JQ9A 3FBSA 1N1PA 1K0JA 1LQUA 1ZK7A 2QCUA 3B6DA 3AYLA 2GQFA 2BK4A 1GRBA 1NPXA 3PO7A 2EQ7A 4C3XA 4B65A 2XCGA 3UTHA 1NG4A 3SYIA 3V3NA 3KVEA 3SXIA 1B37A 2GF3A 2BRAA 3ALMA 1CF3A 4NNJA 4RG3A 2XFPA 4JNQA 3GMCA 1UKVG 1Q1RA 2ZZBA 4BJZA 1K0LA 1JRXA 4HB9A 4Z44A 4EQWA 1N4UA 4Z25A 2ZZ0A 1CJ3A 3ICRA 4BK2A 1XHCA 2GAHB 1L9CA 2Q0KA 3COXA 3EANA 2E1MA 3ICTA 3LB8A 4OPDA 4NEWA 2WPCA 3REDA 1E7PA 3ZDNA 4CRTA 3GD3A 3SZ0A 3K7MX 3P4PA 1ZMCA 2I0ZA 2V3BA 3P4SA 3QVPA 2RGOA 1O95A 2EQ8A 4YWOA 5KVIA 4H4UA 3CPJG 4J57A 4X9NA 5BRTA 4P9SA 1EL7A 4EIQA 3K30A 2C72A 4B67A 2WU5A 3UKPA 4YTNA 2YWLA 3HYVA 3GWDA 5U63A 2YLZA 5U25A 1L9EA 2C70A 4G74A 4Y4LA 2H89A 1IUVA 4C74A 1LQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GT8 A;  1K0I A;  4D04 A;  3RNM A;  4I58 A;  1Y0P A;  2GVC A;  4A99 A;  2BS3 A;  4OPC A;  1DOE A;  2BAC A;  2BK3 A;  5EOW A;  4Y4M A;  3T37 A;  3AEG A;  1IUS A;  3KA7 A;  3DGZ A;  2CFY A;  3DH9 A;  4J56 A;  2R4J A;  4A79 A;  2YG7 A;  1CC4 A;  1ELI A;  3ABV A;  3ALJ A;  4EIP A;  4H4T A;  1RP0 A;  1NHR A;  4X9M A;  4J2W A;  5C3J A;  2WDV A;  1PBE A;  3G5R A;  3FIM B;  4HA6 A;  3ADA B;  2YLX A;  4GRT A;  3K7Q X;  4U8N A;  1GAL A;  1XDI A;  2JB2 A;  4GR1 A;  1M6I A;  2VVM A;  4TM4 A;  1CC6 A;  1GOS A;  4H4P A;  1XPQ A;  4EQS A;  5IPY A;  3OZ2 A;  2ACZ A;  1H86 A;  3H8L A;  4NTE A;  2VRM A;  4CY8 A;  1JNR A;  2W0H A;  4YT0 A;  5FS9 A;  3AD9 B;  3SQP A;  1PHH A;  5FMH A;  1N4V A;  4H2P A;  5FS7 A;  4JN9 A;  1PDH A;  2WP9 A;  3CGD A;  1BGN A;  4GDP A;  2QAE A;  1GET A;  4K8D A;  4ADW A;  1Q9I A;  4J33 A;  4NEV A;  1D4D A;  2X8C A;  3VR8 A;  4WX1 A;  3H8I A;  1ZDL A;  1E1N A;  4U8O A;  3ALL A;  3NTD A;  2OAM A;  2XVF A;  4NTD A;  2YR6 A;  3IWA A;  1H6V A;  3URH A;  3R9U A;  4U8J A;  1D4E A;  4RG4 A;  2GMH A;  1BKW A;  3KD9 A;  1YY5 A;  4LII A;  2VRL A;  3BNU A;  4YXD A;  3F8R A;  1CL0 A;  1D5T A;  2B9W A;  1LVL A;  2BXR A;  2V3A A;  3NT6 A;  4KPR A;  4XWR A;  3UKK A;  5JCM A;  5JCK A;  4TM1 A;  3AB1 A;  3M13 A;  3SGL A;  3CGB A;  3KPF A;  1H82 A;  4NZH A;  4UDP A;  4J31 A;  1VG9 A;  1M64 A;  1VRQ B;  4AOX A;  3IHG A;  1KNP A;  1H84 A;  2V60 A;  2E4G A;  2YVF A;  1COY A;  3VQR A;  1QJD A;  1MOK A;  1MXT A;  4H2N A;  2C3C A;  3FPZ A;  4U2T A;  3GD4 A;  1OJC A;  1PBB A;  3DGH A;  3GSI A;  1RYI A;  3NTA A;  4XWZ A;  1L9D A;  2XLU A;  1E1M A;  2EQ9 A;  5BUK A;  4N9X A;  1ONF A;  3UKF A;  1FL2 A;  4H4W A;  3DJE A;  1H7X A;  2FJD A;  2X50 A;  2Y6Q A;  2WOV A;  3NK2 X;  4AP3 A;  2C65 A;  3KKJ A;  1JEH A;  2WQY A;  2XLS A;  3NN6 X;  3AWI A;  4TLX A;  3VR9 A;  2BCP A;  3UOV A;  3GMB A;  2E5V A;  3AD7 B;  3DJG X;  1ZOY A;  1B5Q A;  2GMJ A;  1B4V A;  3PS9 A;  1YQ3 A;  4H2R A;  4OPG A;  3ZYX A;  2WOW A;  1GRE A;  1DJQ A;  1X31 B;  1GXF A;  5U1O A;  4APN A;  5KRQ A;  4U2L A;  3QSS A;  1LJ1 A;  1NEK A;  2Z5Y A;  4BJY A;  2IVE A;  3UP5 A;  3C4N A;  2A8X A;  3SFD A;  3CPI G;  4ICY A;  1DOC A;  4PAA A;  1B8S A;  2R4E A;  3NGC X;  3CGC A;  4REK A;  1JRZ A;  2R0C A;  1NHP A;  2OAL A;  1BZL A;  3S61 A;  4DSG A;  1PXB A;  3UTE A;  3QSE A;  2UZZ A;  3G5S A;  4K2X A;  4GCM A;  4H4V A;  2JAE A;  3II4 A;  1CJ4 A;  1PJ5 A;  5IQ4 A;  3UP4 A;  3H4K A;  3OC4 A;  2BS4 A;  4JDR A;  1H81 A;  1O94 A;  2XFO A;  5GSN A;  1SEZ A;  2Q6U A;  2IVD A;  4J34 A;  4GUV A;  3VRA A;  3UOZ A;  2WPE A;  4TM0 A;  3GDP A;  3IHM A;  2C7G A;  4FK1 A;  1JNZ A;  1MO9 A;  3VRD B;  5JCI A;  1IUX A;  3ATR A;  1ZMD A;  5HY5 A;  1N4W A;  3SM8 A;  4EQR A;  2XDO A;  4DSH A;  3V76 A;  5BVA A;  1ZKQ A;  3BI2 A;  3NYC A;  3NYF A;  4OVI A;  4I59 A;  2ARD A;  2VZ2 A;  1P2H A;  2YM1 A;  4JY2 A;  2WHD A;  4B68 A;  3CTY A;  4B63 A;  1PBF A;  3UOX A;  3AE9 A;  4AOS A;  3IC9 A;  1GER A;  4JNA A;  1GV4 A;  1NG3 A;  1K4Q A;  3AYJ A;  3ITJ A;  4H4Y A;  3UOY A;  4B66 A;  1KSU A;  4U8P A;  3LZX A;  2EQ6 A;  1S2Q A;  1ZP0 A;  4UDR A;  4X4J A;  2X8H A;  5DBJ A;  2R46 A;  2GRT A;  4USQ A;  4KX6 A;  1F6M A;  1JRY A;  4EMI A;  3NYE A;  4Z2T A;  3ISH A;  2B7R A;  2XLP A;  4ZCD A;  2F5Z A;  2GB0 A;  2R0P A;  1GND A;  2DKI A;  4CNJ A;  4EMW A;  4IVM B;  4LU6 A;  3VRB A;  1F8W A;  4ZCC A;  1EL9 A;  1BF3 A;  1BWC A;  1QLB A;  1TDE A;  2X99 A;  3GWF A;  2C64 A;  2FJB A;  1IUW A;  4OPL A;  3CN8 A;  1GEU A;  1H7W A;  1DXL A;  2TPR A;  2BS2 A;  1BGJ A;  2XVI A;  3UKQ A;  1S3B A;  1FEC A;  2WPF A;  3S5W A;  1YQZ A;  1GSN A;  3LJP A;  2YVG A;  4BK1 A;  2WES A;  2B9Y A;  1E39 A;  1PN0 A;  2QA2 A;  4YSX A;  3QVR A;  3CPH G;  1GTE A;  3C4A A;  4IA5 A;  1LPF A;  3QSM A;  4OPT A;  3CIR A;  4USR A;  4B64 A;  2Q7V A;  1EL5 A;  3ATQ A;  1D7L A;  1VQW A;  3EAO A;  4A7A A;  3FMW A;  2GV8 A;  1H83 A;  1NEN A;  5EB5 A;  3RHA A;  3AE4 A;  4CCR A;  2GR1 A;  2BYB A;  2ZBW A;  3AEF A;  3CNP A;  1KDG A;  3NIX A;  3LZW A;  2YLR A;  1DOD A;  3F8P A;  2XFQ A;  5KXJ A;  2WS3 A;  2FJA A;  4Z2R A;  2R0G A;  5FS6 A;  4CCQ A;  2AR8 A;  2CVJ A;  1TRB A;  4H50 A;  3NG7 X;  4OPU A;  3DK8 A;  4AT2 A;  4K5R A;  2C3D A;  2R9Z A;  2B9X A;  1GRT A;  4U8M A;  3DK4 A;  2XLT A;  2ZZC A;  3UTG A;  4UP3 A;  3SFE A;  2HQM A;  3P9U A;  3QFA A;  4M52 A;  3DJD A;  3V3O A;  4DNA A;  4A9W A;  1PJ7 A;  2YVJ A;  4NTC A;  2B7S A;  2TMD A;  2YR5 A;  2C76 A;  3RP7 A;  3I6D A;  5JCN A;  3CND A;  5KWF A;  1TDO A;  3D1C A;  1GRH A;  2OA1 A;  4C77 A;  5HHF A;  4B69 A;  4U8K A;  2A87 A;  3LXD A;  3AED A;  3NK1 X;  1KNR A;  2WOI A;  3M0O A;  1GPE A;  1O5W A;  1GRA A;  1YKJ A;  1DJN A;  2RGJ A;  4Z24 A;  2NVK X;  4MJW A;  4U8L A;  2V6O A;  3NN0 X;  4EQX A;  3C96 A;  4EM4 A;  4YSH A;  2BCG G;  2C67 A;  3AYI A;  2R45 A;  1DOB A;  3GYJ A;  3AE5 A;  5M0Z A;  2GH5 A;  5M10 A;  4EM3 A;  2JB3 A;  4Z43 A;  1TYP A;  3UCL A;  3CNT A;  3F8D A;  1GRG A;  1P2E A;  1Y56 B;  2V61 A;  4AP1 A;  3L1R A;  2VVL A;  2X3N A;  1FEA A;  1PXA A;  1PBC A;  3GDN A;  4TM3 A;  2J3N A;  3QJ4 A;  2RGH A;  1NHQ A;  5GRT A;  3GRS A;  3NNE A;  2VVL G;  4C3Y A;  2XVE A;  3P4R A;  1FOH A;  3AE7 A;  4A6N B;  3AE6 A;  1FEB A;  2APG A;  1E1L A;  4K22 A;  4H4Z A;  3Q6J A;  4CBQ A;  2YLT A;  1OJA A;  3LAD A;  1V59 A;  3O0H A;  2JKC A;  5IQ1 A;  4Z26 A;  3G5Q A;  5J60 A;  4YSY A;  3P4Q A;  3AE8 A;  3IF9 A;  3PVC A;  5J7X A;  1LTX R;  1F3P A;  1VG0 A;  4U2S A;  1GES A;  2OLO A;  1PS9 A;  2GEW A;  4FDC B;  3D8X A;  1PJ6 A;  2BXS A;  1FCD A;  2AQJ A;  4A65 A;  1E1K A;  1EL8 A;  4Y4N A;  3L8K A;  1F8S A;  4O5Q A;  4YSZ A;  3I3L A;  2YM2 A;  4ZN0 A;  3NLC A;  2GR0 A;  1CHU A;  1RSG A;  1KFY A;  2GR3 A;  2V5Z A;  3ICS A;  3NK0 X;  2X8G A;  3AEB A;  1TYT A;  2QA1 A;  2NPX A;  2BAB A;  4FK1 C;  2WBA A;  4YKF A;  3QFB A;  1JU2 A;  3CNS A;  4H4X A;  2Y6R A;  4J36 A;  2WEU A;  4ECH A;  2GAG B;  4UDQ A;  2XVH A;  3B3R A;  3RP6 A;  5CKU A;  1S3E A;  2Z5X A;  3UKH A;  5HYM A;  1F8R A;  5KVH A;  1JOA A;  2BK5 A;  1ZOV A;  2XVJ A;  1OJD A;  3DA1 A;  3NHO X;  1D4C A;  1HYU A;  3K7T A;  3DJJ A;  1D7Y A;  1CBO A;  1E6E A;  2VQB A;  1ZY8 A;  1CC2 A;  2YLW A;  2YG4 A;  2BA9 A;  2H88 A;  2YQU A;  3KLJ A;  3AEE A;  3M12 A;  2C75 A;  3UTF A;  4AT0 A;  5LV9 A;  3GRT A;  2GQW A;  1OJT A;  1PXC A;  1IJH A;  1NAA A;  2PHH A;  3BNM A;  2O9Z A;  3RP8 A;  3EPT A;  1EBD A;  2YLS A;  3GYI A;  1TDK A;  5FS8 A;  4H4S A;  4OPI A;  1IUT A;  3NH3 X;  1VDC A;  2PYX A;  4H7U A;  2Q0L A;  3DME A;  2YG6 A;  3AE1 A;  4D03 A;  2C66 A;  2YG5 A;  5KOX A;  2WDQ A;  3BI4 A;  2WU2 A;  1QO8 A;  1LV0 A;  4JY3 A;  3UKL A;  3CGE A;  4IV9 A;  1REO A;  4GDE A;  5C2T A;  1KSS A;  1CJ2 A;  2XLR A;  4H2Q A;  4CNK A;  4YTP A;  3E1T A;  5HXI A;  2XFU A;  4Z2U A;  5JCL A;  4BK3 A;  2BC0 A;  1Y56 A;  2XYO A;  3BHF A;  4C5O A;  2YG3 A;  1L0V A;  2XFN A;  1TDF A;  1GTH A;  1PBD A;  5BUL A;  5ER0 A;  2WP6 A;  3CNJ A;  2BC1 A;  3BHK A;  3DK9 A;  1CJC A;  4FX9 A;  5EBK A;  1TDN A;  2C73 A;  2CDU A;  1NDA A;  3KU9 A;  4K7Z A;  4BV6 A;  3NKS A;  4PAB A;  3BI5 A;  4A6N A;  4EMJ A;  4LA1 A;  3AE2 A;  4XXG A;  2B76 A;  1NHS A;  3NRN A;  1XAN A;  4YKG A;  3AEA A;  1W4X A;  4RSL A;  1GRF A;  2VQ7 A;  2WET A;  2JK6 A;  3AE3 A;  5EB4 A;  1ZX9 A;  1DNC A;  2VOU A;  3UKA A;  3EF6 A;  5KOW A;  3LOV A;  3Q9T A;  4OCG A;  4H4R A;  4U8I A;  4YTM A;  4A5L A;  5TR3 A;  4DGK A;  2AAQ A;  3HZL A;  4O5U A;  4E0V A;  2IID A;  2GR2 A;  2FJE A;  3P1W A;  5CQF A;  4BUR A;  3AXB A;  3WE0 A;  2OLN A;  4K5S A;  1OJ9 A;  4IA6 A;  4GF7 A;  2CUL A;  1IUU A;  2JB1 A;  4CY6 A;  3AEC A;  1YQ4 A;  4H4Q A;  1S2Y A;  2FBW A;  2WDR A;  2RAB A;  4B1B A;  1Q1W A;  2YAU A;  4WCT A;  2YR4 A;  5L46 A;  2DKH A;  2A89 A;  2WP5 A;  3AD8 B;  3FG2 P;  4TLZ A;  1KF6 A;  1AOG A;  1Z6L A;  3JSK A;  2JBV A;  4IVO B;  4JQ9 A;  3FBS A;  1N1P A;  1K0J A;  1LQU A;  1ZK7 A;  2QCU A;  3B6D A;  3AYL A;  2GQF A;  2BK4 A;  1GRB A;  1NPX A;  3PO7 A;  2EQ7 A;  4C3X A;  4B65 A;  2XCG A;  3UTH A;  1NG4 A;  3V3N A;  3KVE A;  1B37 A;  2GF3 A;  3ALM A;  1CF3 A;  4RG3 A;  2XFP A;  4JNQ A;  3GMC A;  1UKV G;  1Q1R A;  2ZZB A;  4BJZ A;  1K0L A;  1JRX A;  4HB9 A;  4Z44 A;  4EQW A;  1N4U A;  4Z25 A;  2ZZ0 A;  1CJ3 A;  3ICR A;  4BK2 A;  1XHC A;  2GAH B;  1L9C A;  2Q0K A;  3COX A;  3EAN A;  2E1M A;  3ICT A;  3LB8 A;  4OPD A;  4NEW A;  2WPC A;  3RED A;  1E7P A;  3ZDN A;  4CRT A;  3GD3 A;  3K7M X;  3P4P A;  1ZMC A;  2I0Z A;  2V3B A;  3P4S A;  3QVP A;  2RGO A;  1O95 A;  2EQ8 A;  4YWO A;  5KVI A;  4H4U A;  3CPJ G;  4J57 A;  4X9N A;  5BRT A;  4P9S A;  1EL7 A;  4EIQ A;  3K30 A;  2C72 A;  4B67 A;  2WU5 A;  3UKP A;  4YTN A;  2YWL A;  3GWD A;  5U63 A;  2YLZ A;  5U25 A;  1L9E A;  2C70 A;  4Y4L A;  2H89 A;  1IUV A;  4C74 A;  1LQT A; 
#chains in the Genus database with same CATH topology
 1GT8 A;  1K0I A;  4D04 A;  3RNM A;  4I58 A;  1Y0P A;  2GVC A;  4A99 A;  2BS3 A;  4OPC A;  1DOE A;  2BAC A;  2BK3 A;  5EOW A;  4Y4M A;  3T37 A;  3AEG A;  1IUS A;  3KA7 A;  3DGZ A;  2CFY A;  3DH9 A;  4J56 A;  2R4J A;  4A79 A;  2YG7 A;  1CC4 A;  1ELI A;  3ABV A;  3ALJ A;  3HYX A;  3T2Z A;  4H4T A;  1RP0 A;  4EIP A;  1NHR A;  4X9M A;  4J2W A;  5C3J A;  2WDV A;  1PBE A;  3G5R A;  3FIM B;  4HA6 A;  3ADA B;  2YLX A;  4GRT A;  3K7Q X;  4U8N A;  1GAL A;  1XDI A;  2JB2 A;  4GR1 A;  1M6I A;  2VVM A;  4TM4 A;  1CC6 A;  1GOS A;  4H4P A;  1XPQ A;  4EQS A;  5IPY A;  3OZ2 A;  2ACZ A;  1H86 A;  3H8L A;  4NTE A;  2VRM A;  4CY8 A;  1JNR A;  2W0H A;  4YT0 A;  5FS9 A;  3AD9 B;  3SQP A;  1PHH A;  5FMH A;  1N4V A;  4H2P A;  5FS7 A;  4JN9 A;  1PDH A;  2WP9 A;  3CGD A;  1BGN A;  4GDP A;  2QAE A;  1GET A;  4K8D A;  4ADW A;  4GAV A;  1Q9I A;  4J33 A;  4NEV A;  1D4D A;  2X8C A;  3VR8 A;  4WX1 A;  3H8I A;  1ZDL A;  1E1N A;  4U8O A;  3SY4 A;  3ALL A;  3NTD A;  2OAM A;  2XVF A;  4NTD A;  2YR6 A;  3IWA A;  1H6V A;  3URH A;  5KMP A;  3R9U A;  4U8J A;  1D4E A;  4RG4 A;  2GMH A;  1BKW A;  3KD9 A;  1YY5 A;  4LII A;  2VRL A;  3BNU A;  4YXD A;  3F8R A;  1CL0 A;  1D5T A;  2B9W A;  1LVL A;  2BXR A;  2V3A A;  3NT6 A;  4KPR A;  4XWR A;  5KMQ A;  3T14 A;  3UKK A;  5JCM A;  4TM1 A;  5JCK A;  3AB1 A;  3M13 A;  3SGL A;  3CGB A;  3KPF A;  1H82 A;  4NZH A;  4UDP A;  4J31 A;  1VG9 A;  1M64 A;  1VRQ B;  4AOX A;  3IHG A;  1KNP A;  1H84 A;  2V60 A;  2E4G A;  2YVF A;  1COY A;  3VQR A;  4NWZ A;  1QJD A;  1MOK A;  1MXT A;  4H2N A;  2C3C A;  3FPZ A;  4U2T A;  3GD4 A;  1OJC A;  1PBB A;  3DGH A;  3GSI A;  1RYI A;  3NTA A;  4XWZ A;  1L9D A;  3GYX A;  2XLU A;  1E1M A;  2EQ9 A;  5BUK A;  4N9X A;  1ONF A;  3UKF A;  1FL2 A;  4H4W A;  3DJE A;  1H7X A;  2FJD A;  2X50 A;  2Y6Q A;  2WOV A;  3CMM A;  3NK2 X;  4AP3 A;  2C65 A;  3KKJ A;  1JEH A;  2WQY A;  2XLS A;  3NN6 X;  3AWI A;  4TLX A;  3VR9 A;  2BCP A;  3UOV A;  3GMB A;  2E5V A;  4G6G A;  3AD7 B;  3DJG X;  1ZOY A;  1B5Q A;  2GMJ A;  1B4V A;  3PS9 A;  1YQ3 A;  4H2R A;  4OPG A;  3ZYX A;  2WOW A;  1GRE A;  1DJQ A;  1X31 B;  1GXF A;  4II2 A;  5U1O A;  4APN A;  5KRQ A;  4U2L A;  3KPK A;  3QSS A;  1LJ1 A;  1NEK A;  2Z5Y A;  4BJY A;  2IVE A;  3UP5 A;  3C4N A;  2A8X A;  3SFD A;  3CPI G;  4ICY A;  1DOC A;  4PAA A;  1B8S A;  2R4E A;  3T31 A;  3NGC X;  3CGC A;  4REK A;  1JRZ A;  2R0C A;  1NHP A;  2OAL A;  1BZL A;  3S61 A;  4DSG A;  1PXB A;  3UTE A;  3QSE A;  2UZZ A;  3G5S A;  4K2X A;  4GCM A;  4H4V A;  2JAE A;  3II4 A;  1CJ4 A;  1PJ5 A;  5IQ4 A;  3UP4 A;  3H4K A;  3OC4 A;  2BS4 A;  4JDR A;  1H81 A;  1O94 A;  2XFO A;  5GSN A;  1SEZ A;  2Q6U A;  2IVD A;  4J34 A;  4GUV A;  3VRA A;  5KMS A;  3UOZ A;  2WPE A;  4TM0 A;  3GDP A;  3IHM A;  2C7G A;  4G73 A;  4FK1 A;  1JNZ A;  1MO9 A;  3VRD B;  5JCI A;  4GAP A;  1IUX A;  3ATR A;  1ZMD A;  5HY5 A;  1N4W A;  3SM8 A;  4EQR A;  2XDO A;  4DSH A;  3V76 A;  5BVA A;  1ZKQ A;  3BI2 A;  3NYC A;  3NYF A;  4OVI A;  4I59 A;  2ARD A;  2VZ2 A;  1P2H A;  2YM1 A;  4JY2 A;  2WHD A;  4B68 A;  3CTY A;  4B63 A;  1PBF A;  3UOX A;  3AE9 A;  4AOS A;  3IC9 A;  1GER A;  4JNA A;  1GV4 A;  1NG3 A;  1K4Q A;  3AYJ A;  3ITJ A;  4H4Y A;  3UOY A;  4B66 A;  1KSU A;  4U8P A;  3LZX A;  2EQ6 A;  1S2Q A;  1ZP0 A;  4UDR A;  4X4J A;  2X8H A;  5DBJ A;  2R46 A;  2GRT A;  4USQ A;  4KX6 A;  1F6M A;  1JRY A;  4EMI A;  3NYE A;  4Z2T A;  3ISH A;  2B7R A;  2XLP A;  4ZCD A;  2F5Z A;  2GB0 A;  2R0P A;  1GND A;  2DKI A;  4CNJ A;  4EMW A;  4IVM B;  4LU6 A;  3VRB A;  1F8W A;  4ZCC A;  1EL9 A;  1BF3 A;  1BWC A;  1QLB A;  1TDE A;  2X99 A;  3GWF A;  2BRY A;  2C64 A;  2FJB A;  1IUW A;  4OPL A;  3CN8 A;  1GEU A;  1H7W A;  1DXL A;  2TPR A;  2BS2 A;  1BGJ A;  2XVI A;  3UKQ A;  1S3B A;  1FEC A;  2WPF A;  3S5W A;  1YQZ A;  1GSN A;  3LJP A;  2YVG A;  4BK1 A;  2WES A;  2B9Y A;  1E39 A;  1PN0 A;  2QA2 A;  4YSX A;  3QVR A;  3CPH G;  1GTE A;  3C4A A;  4IA5 A;  1LPF A;  3QSM A;  4OPT A;  3CIR A;  4USR A;  4B64 A;  2Q7V A;  1EL5 A;  3ATQ A;  1D7L A;  1VQW A;  3EAO A;  4A7A A;  3FMW A;  2GV8 A;  1H83 A;  1NEN A;  5EB5 A;  3RHA A;  3AE4 A;  4CCR A;  2GR1 A;  2BYB A;  2ZBW A;  3AEF A;  3CNP A;  1KDG A;  3NIX A;  3LZW A;  2YLR A;  1DOD A;  3F8P A;  2XFQ A;  5KXJ A;  2WS3 A;  2FJA A;  4Z2R A;  2R0G A;  5FS6 A;  4CCQ A;  2AR8 A;  2CVJ A;  1TRB A;  4H50 A;  3NG7 X;  4OPU A;  3DK8 A;  4AT2 A;  4K5R A;  2C3D A;  2R9Z A;  2B9X A;  1GRT A;  4U8M A;  3DK4 A;  5KMR A;  2XLT A;  2ZZC A;  3UTG A;  4UP3 A;  3SZF A;  3SFE A;  2HQM A;  3P9U A;  3QFA A;  4M52 A;  3DJD A;  3V3O A;  4DNA A;  4A9W A;  1PJ7 A;  2YVJ A;  4NTC A;  2B7S A;  2TMD A;  2YR5 A;  2C76 A;  3RP7 A;  3I6D A;  5JCN A;  3CND A;  5KWF A;  1TDO A;  3D1C A;  1GRH A;  2OA1 A;  4C77 A;  3SX6 A;  5HHF A;  4B69 A;  4U8K A;  2A87 A;  3LXD A;  3AED A;  3NK1 X;  1KNR A;  2WOI A;  3M0O A;  1GPE A;  1O5W A;  1GRA A;  1YKJ A;  1DJN A;  2RGJ A;  4Z24 A;  2NVK X;  4MJW A;  4U8L A;  2V6O A;  3NN0 X;  4EQX A;  3C96 A;  4EM4 A;  4YSH A;  2BCG G;  2C67 A;  3AYI A;  2R45 A;  1DOB A;  3GYJ A;  3AE5 A;  5M0Z A;  2GH5 A;  5M10 A;  4EM3 A;  2JB3 A;  4Z43 A;  1TYP A;  3UCL A;  3CNT A;  3F8D A;  1GRG A;  1P2E A;  2C4C A;  1Y56 B;  2V61 A;  4AP1 A;  3L1R A;  2VVL A;  2X3N A;  1FEA A;  1PXA A;  1PBC A;  3GDN A;  4TM3 A;  2J3N A;  3QJ4 A;  2RGH A;  3T0K A;  1NHQ A;  5GRT A;  3GRS A;  3NNE A;  2VVL G;  4C3Y A;  2XVE A;  3P4R A;  1FOH A;  3AE7 A;  4A6N B;  3AE6 A;  1FEB A;  2APG A;  1E1L A;  4K22 A;  4H4Z A;  3Q6J A;  4CBQ A;  2YLT A;  1OJA A;  3LAD A;  1V59 A;  3O0H A;  2JKC A;  5IQ1 A;  4Z26 A;  3G5Q A;  5J60 A;  4YSY A;  3P4Q A;  3HYW A;  3AE8 A;  3IF9 A;  3PVC A;  5J7X A;  1LTX R;  1F3P A;  1VG0 A;  4U2S A;  1GES A;  2OLO A;  3SZC A;  1PS9 A;  2GEW A;  4FDC B;  3D8X A;  1PJ6 A;  2BXS A;  1FCD A;  2AQJ A;  4A65 A;  1E1K A;  1EL8 A;  4Y4N A;  3L8K A;  1F8S A;  4O5Q A;  4YSZ A;  3I3L A;  2YM2 A;  4ZN0 A;  3NLC A;  2GR0 A;  1CHU A;  1RSG A;  1KFY A;  2GR3 A;  2V5Z A;  3ICS A;  3NK0 X;  2X8G A;  3AEB A;  1TYT A;  2QA1 A;  2NPX A;  2BAB A;  5KNL A;  4FK1 C;  2WBA A;  4G6H A;  4YKF A;  3QFB A;  1JU2 A;  3CNS A;  4H4X A;  2Y6R A;  4J36 A;  2WEU A;  4ECH A;  2GAG B;  4UDQ A;  2XVH A;  3B3R A;  3RP6 A;  5CKU A;  1S3E A;  2Z5X A;  3UKH A;  5HYM A;  1F8R A;  5KVH A;  1JOA A;  2BK5 A;  1ZOV A;  2XVJ A;  1OJD A;  3DA1 A;  3NHO X;  1D4C A;  1HYU A;  3K7T A;  3DJJ A;  1D7Y A;  1CBO A;  1E6E A;  2VQB A;  1ZY8 A;  1CC2 A;  2YLW A;  2YG4 A;  2BA9 A;  2H88 A;  2YQU A;  3KLJ A;  3AEE A;  3M12 A;  2C75 A;  4G9K A;  3UTF A;  4AT0 A;  5LV9 A;  3GRT A;  2GQW A;  1OJT A;  1PXC A;  1IJH A;  1NAA A;  2PHH A;  3BNM A;  2O9Z A;  3RP8 A;  3EPT A;  1EBD A;  2YLS A;  3GYI A;  1TDK A;  5FS8 A;  4H4S A;  4OPI A;  1IUT A;  3NH3 X;  1VDC A;  2PYX A;  4H7U A;  2Q0L A;  3DME A;  2YG6 A;  3AE1 A;  4D03 A;  2C66 A;  2YG5 A;  5KOX A;  2WDQ A;  3BI4 A;  2WU2 A;  1QO8 A;  1LV0 A;  4JY3 A;  3UKL A;  3CGE A;  4IV9 A;  1REO A;  4GDE A;  5C2T A;  1KSS A;  1CJ2 A;  2XLR A;  4H2Q A;  4CNK A;  4YTP A;  3E1T A;  5HXI A;  2XFU A;  4Z2U A;  5JCL A;  4BK3 A;  2BC0 A;  1Y56 A;  2XYO A;  3BHF A;  4C5O A;  2YG3 A;  1L0V A;  2XFN A;  1TDF A;  1GTH A;  3T2Y A;  1PBD A;  5BUL A;  5ER0 A;  2WP6 A;  3CNJ A;  2BC1 A;  3BHK A;  3DK9 A;  1CJC A;  4FX9 A;  5EBK A;  1TDN A;  2C73 A;  2CDU A;  1NDA A;  3KU9 A;  4K7Z A;  4BV6 A;  3NKS A;  4PAB A;  3BI5 A;  4A6N A;  4EMJ A;  4LA1 A;  3AE2 A;  4XXG A;  2B76 A;  1NHS A;  3NRN A;  1XAN A;  4YKG A;  3AEA A;  1W4X A;  4RSL A;  1GRF A;  2VQ7 A;  2WET A;  2JK6 A;  3AE3 A;  5EB4 A;  3T2K A;  1ZX9 A;  1DNC A;  2VOU A;  3UKA A;  3EF6 A;  5KOW A;  3LOV A;  3Q9T A;  4OCG A;  4H4R A;  4II3 A;  4U8I A;  4YTM A;  4A5L A;  3SZW A;  5TR3 A;  4DGK A;  2AAQ A;  3HZL A;  4O5U A;  4E0V A;  2IID A;  2GR2 A;  2FJE A;  3P1W A;  5CQF A;  4BUR A;  3AXB A;  3WE0 A;  2OLN A;  4K5S A;  1OJ9 A;  4IA6 A;  4GF7 A;  2CUL A;  1IUU A;  2JB1 A;  4CY6 A;  3AEC A;  1YQ4 A;  4H4Q A;  1S2Y A;  2FBW A;  2WDR A;  2RAB A;  4B1B A;  1Q1W A;  2YAU A;  4WCT A;  2YR4 A;  5L46 A;  2DKH A;  2A89 A;  2WP5 A;  3AD8 B;  3FG2 P;  4TLZ A;  1KF6 A;  1AOG A;  1Z6L A;  3JSK A;  2JBV A;  4IVO B;  4JQ9 A;  3FBS A;  1N1P A;  1K0J A;  1LQU A;  1ZK7 A;  2QCU A;  3B6D A;  3AYL A;  2GQF A;  2BK4 A;  1GRB A;  1NPX A;  3PO7 A;  2EQ7 A;  4C3X A;  4B65 A;  2XCG A;  3UTH A;  1NG4 A;  3SYI A;  3V3N A;  3KVE A;  3SXI A;  1B37 A;  2GF3 A;  2BRA A;  3ALM A;  1CF3 A;  4NNJ A;  4RG3 A;  2XFP A;  4JNQ A;  3GMC A;  1UKV G;  1Q1R A;  2ZZB A;  4BJZ A;  1K0L A;  1JRX A;  4HB9 A;  4Z44 A;  4EQW A;  1N4U A;  4Z25 A;  2ZZ0 A;  1CJ3 A;  3ICR A;  4BK2 A;  1XHC A;  2GAH B;  1L9C A;  2Q0K A;  3COX A;  3EAN A;  2E1M A;  3ICT A;  3LB8 A;  4OPD A;  4NEW A;  2WPC A;  3RED A;  1E7P A;  3ZDN A;  4CRT A;  3GD3 A;  3SZ0 A;  3K7M X;  3P4P A;  1ZMC A;  2I0Z A;  2V3B A;  3P4S A;  3QVP A;  2RGO A;  1O95 A;  2EQ8 A;  4YWO A;  5KVI A;  4H4U A;  3CPJ G;  4J57 A;  4X9N A;  5BRT A;  4P9S A;  1EL7 A;  4EIQ A;  3K30 A;  2C72 A;  4B67 A;  2WU5 A;  3UKP A;  4YTN A;  2YWL A;  3HYV A;  3GWD A;  5U63 A;  2YLZ A;  5U25 A;  1L9E A;  2C70 A;  4G74 A;  4Y4L A;  2H89 A;  1IUV A;  4C74 A;  1LQT A; 
#chains in the Genus database with same CATH homology
 1GT8 A;  1K0I A;  4D04 A;  3RNM A;  4I58 A;  1Y0P A;  2GVC A;  4A99 A;  2BS3 A;  4OPC A;  1DOE A;  2BAC A;  2BK3 A;  5EOW A;  4Y4M A;  3T37 A;  3AEG A;  1IUS A;  3KA7 A;  3DGZ A;  2CFY A;  3DH9 A;  4J56 A;  2R4J A;  4A79 A;  2YG7 A;  1CC4 A;  1ELI A;  3ABV A;  3ALJ A;  3HYX A;  3T2Z A;  4H4T A;  1RP0 A;  4EIP A;  1NHR A;  4X9M A;  4J2W A;  5C3J A;  2WDV A;  1PBE A;  3G5R A;  3FIM B;  4HA6 A;  3ADA B;  2YLX A;  4GRT A;  3K7Q X;  4U8N A;  1GAL A;  1XDI A;  2JB2 A;  4GR1 A;  1M6I A;  2VVM A;  4TM4 A;  1CC6 A;  1GOS A;  4H4P A;  1XPQ A;  4EQS A;  5IPY A;  3OZ2 A;  2ACZ A;  1H86 A;  3H8L A;  4NTE A;  2VRM A;  4CY8 A;  1JNR A;  2W0H A;  4YT0 A;  5FS9 A;  3AD9 B;  3SQP A;  1PHH A;  5FMH A;  1N4V A;  4H2P A;  5FS7 A;  4JN9 A;  1PDH A;  2WP9 A;  3CGD A;  1BGN A;  4GDP A;  2QAE A;  1GET A;  4K8D A;  4ADW A;  4GAV A;  1Q9I A;  4J33 A;  4NEV A;  1D4D A;  2X8C A;  3VR8 A;  4WX1 A;  3H8I A;  1ZDL A;  1E1N A;  4U8O A;  3SY4 A;  3ALL A;  3NTD A;  2OAM A;  2XVF A;  4NTD A;  2YR6 A;  3IWA A;  1H6V A;  3URH A;  5KMP A;  3R9U A;  4U8J A;  1D4E A;  4RG4 A;  2GMH A;  1BKW A;  3KD9 A;  1YY5 A;  4LII A;  2VRL A;  3BNU A;  4YXD A;  3F8R A;  1CL0 A;  1D5T A;  2B9W A;  1LVL A;  2BXR A;  2V3A A;  3NT6 A;  4KPR A;  4XWR A;  5KMQ A;  3T14 A;  3UKK A;  5JCM A;  4TM1 A;  5JCK A;  3AB1 A;  3M13 A;  3SGL A;  3CGB A;  3KPF A;  1H82 A;  4NZH A;  4UDP A;  4J31 A;  1VG9 A;  1M64 A;  1VRQ B;  4AOX A;  3IHG A;  1KNP A;  1H84 A;  2V60 A;  2E4G A;  2YVF A;  1COY A;  3VQR A;  4NWZ A;  1QJD A;  1MOK A;  1MXT A;  4H2N A;  2C3C A;  3FPZ A;  4U2T A;  3GD4 A;  1OJC A;  1PBB A;  3DGH A;  3GSI A;  1RYI A;  3NTA A;  4XWZ A;  1L9D A;  3GYX A;  2XLU A;  1E1M A;  2EQ9 A;  5BUK A;  4N9X A;  1ONF A;  3UKF A;  1FL2 A;  4H4W A;  3DJE A;  1H7X A;  2FJD A;  2X50 A;  2Y6Q A;  2WOV A;  3CMM A;  3NK2 X;  4AP3 A;  2C65 A;  3KKJ A;  1JEH A;  2WQY A;  2XLS A;  3NN6 X;  3AWI A;  4TLX A;  3VR9 A;  2BCP A;  3UOV A;  3GMB A;  2E5V A;  4G6G A;  3AD7 B;  3DJG X;  1ZOY A;  1B5Q A;  2GMJ A;  1B4V A;  3PS9 A;  1YQ3 A;  4H2R A;  4OPG A;  3ZYX A;  2WOW A;  1GRE A;  1DJQ A;  1X31 B;  1GXF A;  4II2 A;  5U1O A;  4APN A;  5KRQ A;  4U2L A;  3KPK A;  3QSS A;  1LJ1 A;  1NEK A;  2Z5Y A;  4BJY A;  2IVE A;  3UP5 A;  3C4N A;  2A8X A;  3SFD A;  3CPI G;  4ICY A;  1DOC A;  4PAA A;  1B8S A;  2R4E A;  3T31 A;  3NGC X;  3CGC A;  4REK A;  1JRZ A;  2R0C A;  1NHP A;  2OAL A;  1BZL A;  3S61 A;  4DSG A;  1PXB A;  3UTE A;  3QSE A;  2UZZ A;  3G5S A;  4K2X A;  4GCM A;  4H4V A;  2JAE A;  3II4 A;  1CJ4 A;  1PJ5 A;  5IQ4 A;  3UP4 A;  3H4K A;  3OC4 A;  2BS4 A;  4JDR A;  1H81 A;  1O94 A;  2XFO A;  5GSN A;  1SEZ A;  2Q6U A;  2IVD A;  4J34 A;  4GUV A;  3VRA A;  5KMS A;  3UOZ A;  2WPE A;  4TM0 A;  3GDP A;  3IHM A;  2C7G A;  4G73 A;  4FK1 A;  1JNZ A;  1MO9 A;  3VRD B;  5JCI A;  4GAP A;  1IUX A;  3ATR A;  1ZMD A;  5HY5 A;  1N4W A;  3SM8 A;  4EQR A;  2XDO A;  4DSH A;  3V76 A;  5BVA A;  1ZKQ A;  3BI2 A;  3NYC A;  3NYF A;  4OVI A;  4I59 A;  2ARD A;  2VZ2 A;  1P2H A;  2YM1 A;  4JY2 A;  2WHD A;  4B68 A;  3CTY A;  4B63 A;  1PBF A;  3UOX A;  3AE9 A;  4AOS A;  3IC9 A;  1GER A;  4JNA A;  1GV4 A;  1NG3 A;  1K4Q A;  3AYJ A;  3ITJ A;  4H4Y A;  3UOY A;  4B66 A;  1KSU A;  4U8P A;  3LZX A;  2EQ6 A;  1S2Q A;  1ZP0 A;  4UDR A;  4X4J A;  2X8H A;  5DBJ A;  2R46 A;  2GRT A;  4USQ A;  4KX6 A;  1F6M A;  1JRY A;  4EMI A;  3NYE A;  4Z2T A;  3ISH A;  2B7R A;  2XLP A;  4ZCD A;  2F5Z A;  2GB0 A;  2R0P A;  1GND A;  2DKI A;  4CNJ A;  4EMW A;  4IVM B;  4LU6 A;  3VRB A;  1F8W A;  4ZCC A;  1EL9 A;  1BF3 A;  1BWC A;  1QLB A;  1TDE A;  2X99 A;  3GWF A;  2BRY A;  2C64 A;  2FJB A;  1IUW A;  4OPL A;  3CN8 A;  1GEU A;  1H7W A;  1DXL A;  2TPR A;  2BS2 A;  1BGJ A;  2XVI A;  3UKQ A;  1S3B A;  1FEC A;  2WPF A;  3S5W A;  1YQZ A;  1GSN A;  3LJP A;  2YVG A;  4BK1 A;  2WES A;  2B9Y A;  1E39 A;  1PN0 A;  2QA2 A;  4YSX A;  3QVR A;  3CPH G;  1GTE A;  3C4A A;  4IA5 A;  1LPF A;  3QSM A;  4OPT A;  3CIR A;  4USR A;  4B64 A;  2Q7V A;  1EL5 A;  3ATQ A;  1D7L A;  1VQW A;  3EAO A;  4A7A A;  3FMW A;  2GV8 A;  1H83 A;  1NEN A;  5EB5 A;  3RHA A;  3AE4 A;  4CCR A;  2GR1 A;  2BYB A;  2ZBW A;  3AEF A;  3CNP A;  1KDG A;  3NIX A;  3LZW A;  2YLR A;  1DOD A;  3F8P A;  2XFQ A;  5KXJ A;  2WS3 A;  2FJA A;  4Z2R A;  2R0G A;  5FS6 A;  4CCQ A;  2AR8 A;  2CVJ A;  1TRB A;  4H50 A;  3NG7 X;  4OPU A;  3DK8 A;  4AT2 A;  4K5R A;  2C3D A;  2R9Z A;  2B9X A;  1GRT A;  4U8M A;  3DK4 A;  5KMR A;  2XLT A;  2ZZC A;  3UTG A;  4UP3 A;  3SZF A;  3SFE A;  2HQM A;  3P9U A;  3QFA A;  4M52 A;  3DJD A;  3V3O A;  4DNA A;  4A9W A;  1PJ7 A;  2YVJ A;  4NTC A;  2B7S A;  2TMD A;  2YR5 A;  2C76 A;  3RP7 A;  3I6D A;  5JCN A;  3CND A;  5KWF A;  1TDO A;  3D1C A;  1GRH A;  2OA1 A;  4C77 A;  3SX6 A;  5HHF A;  4B69 A;  4U8K A;  2A87 A;  3LXD A;  3AED A;  3NK1 X;  1KNR A;  2WOI A;  3M0O A;  1GPE A;  1O5W A;  1GRA A;  1YKJ A;  1DJN A;  2RGJ A;  4Z24 A;  2NVK X;  4MJW A;  4U8L A;  2V6O A;  3NN0 X;  4EQX A;  3C96 A;  4EM4 A;  4YSH A;  2BCG G;  2C67 A;  3AYI A;  2R45 A;  1DOB A;  3GYJ A;  3AE5 A;  5M0Z A;  2GH5 A;  5M10 A;  4EM3 A;  2JB3 A;  4Z43 A;  1TYP A;  3UCL A;  3CNT A;  3F8D A;  1GRG A;  1P2E A;  2C4C A;  1Y56 B;  2V61 A;  4AP1 A;  3L1R A;  2VVL A;  2X3N A;  1FEA A;  1PXA A;  1PBC A;  3GDN A;  4TM3 A;  2J3N A;  3QJ4 A;  2RGH A;  3T0K A;  1NHQ A;  5GRT A;  3GRS A;  3NNE A;  2VVL G;  4C3Y A;  2XVE A;  3P4R A;  1FOH A;  3AE7 A;  4A6N B;  3AE6 A;  1FEB A;  2APG A;  1E1L A;  4K22 A;  4H4Z A;  3Q6J A;  4CBQ A;  2YLT A;  1OJA A;  3LAD A;  1V59 A;  3O0H A;  2JKC A;  5IQ1 A;  4Z26 A;  3G5Q A;  5J60 A;  4YSY A;  3P4Q A;  3HYW A;  3AE8 A;  3IF9 A;  3PVC A;  5J7X A;  1LTX R;  1F3P A;  1VG0 A;  4U2S A;  1GES A;  2OLO A;  3SZC A;  1PS9 A;  2GEW A;  4FDC B;  3D8X A;  1PJ6 A;  2BXS A;  1FCD A;  2AQJ A;  4A65 A;  1E1K A;  1EL8 A;  4Y4N A;  3L8K A;  1F8S A;  4O5Q A;  4YSZ A;  3I3L A;  2YM2 A;  4ZN0 A;  3NLC A;  2GR0 A;  1CHU A;  1RSG A;  1KFY A;  2GR3 A;  2V5Z A;  3ICS A;  3NK0 X;  2X8G A;  3AEB A;  1TYT A;  2QA1 A;  2NPX A;  2BAB A;  5KNL A;  4FK1 C;  2WBA A;  4G6H A;  4YKF A;  3QFB A;  1JU2 A;  3CNS A;  4H4X A;  2Y6R A;  4J36 A;  2WEU A;  4ECH A;  2GAG B;  4UDQ A;  2XVH A;  3B3R A;  3RP6 A;  5CKU A;  1S3E A;  2Z5X A;  3UKH A;  5HYM A;  1F8R A;  5KVH A;  1JOA A;  2BK5 A;  1ZOV A;  2XVJ A;  1OJD A;  3DA1 A;  3NHO X;  1D4C A;  1HYU A;  3K7T A;  3DJJ A;  1D7Y A;  1CBO A;  1E6E A;  2VQB A;  1ZY8 A;  1CC2 A;  2YLW A;  2YG4 A;  2BA9 A;  2H88 A;  2YQU A;  3KLJ A;  3AEE A;  3M12 A;  2C75 A;  4G9K A;  3UTF A;  4AT0 A;  5LV9 A;  3GRT A;  2GQW A;  1OJT A;  1PXC A;  1IJH A;  1NAA A;  2PHH A;  3BNM A;  2O9Z A;  3RP8 A;  3EPT A;  1EBD A;  2YLS A;  3GYI A;  1TDK A;  5FS8 A;  4H4S A;  4OPI A;  1IUT A;  3NH3 X;  1VDC A;  2PYX A;  4H7U A;  2Q0L A;  3DME A;  2YG6 A;  3AE1 A;  4D03 A;  2C66 A;  2YG5 A;  5KOX A;  2WDQ A;  3BI4 A;  2WU2 A;  1QO8 A;  1LV0 A;  4JY3 A;  3UKL A;  3CGE A;  4IV9 A;  1REO A;  4GDE A;  5C2T A;  1KSS A;  1CJ2 A;  2XLR A;  4H2Q A;  4CNK A;  4YTP A;  3E1T A;  5HXI A;  2XFU A;  4Z2U A;  5JCL A;  4BK3 A;  2BC0 A;  1Y56 A;  2XYO A;  3BHF A;  4C5O A;  2YG3 A;  1L0V A;  2XFN A;  1TDF A;  1GTH A;  3T2Y A;  1PBD A;  5BUL A;  5ER0 A;  2WP6 A;  3CNJ A;  2BC1 A;  3BHK A;  3DK9 A;  1CJC A;  4FX9 A;  5EBK A;  1TDN A;  2C73 A;  2CDU A;  1NDA A;  3KU9 A;  4K7Z A;  4BV6 A;  3NKS A;  4PAB A;  3BI5 A;  4A6N A;  4EMJ A;  4LA1 A;  3AE2 A;  4XXG A;  2B76 A;  1NHS A;  3NRN A;  1XAN A;  4YKG A;  3AEA A;  1W4X A;  4RSL A;  1GRF A;  2VQ7 A;  2WET A;  2JK6 A;  3AE3 A;  5EB4 A;  3T2K A;  1ZX9 A;  1DNC A;  2VOU A;  3UKA A;  3EF6 A;  5KOW A;  3LOV A;  3Q9T A;  4OCG A;  4H4R A;  4II3 A;  4U8I A;  4YTM A;  4A5L A;  3SZW A;  5TR3 A;  4DGK A;  2AAQ A;  3HZL A;  4O5U A;  4E0V A;  2IID A;  2GR2 A;  2FJE A;  3P1W A;  5CQF A;  4BUR A;  3AXB A;  3WE0 A;  2OLN A;  4K5S A;  1OJ9 A;  4IA6 A;  4GF7 A;  2CUL A;  1IUU A;  2JB1 A;  4CY6 A;  3AEC A;  1YQ4 A;  4H4Q A;  1S2Y A;  2FBW A;  2WDR A;  2RAB A;  4B1B A;  1Q1W A;  2YAU A;  4WCT A;  2YR4 A;  5L46 A;  2DKH A;  2A89 A;  2WP5 A;  3AD8 B;  3FG2 P;  4TLZ A;  1KF6 A;  1AOG A;  1Z6L A;  3JSK A;  2JBV A;  4IVO B;  4JQ9 A;  3FBS A;  1N1P A;  1K0J A;  1LQU A;  1ZK7 A;  2QCU A;  3B6D A;  3AYL A;  2GQF A;  2BK4 A;  1GRB A;  1NPX A;  3PO7 A;  2EQ7 A;  4C3X A;  4B65 A;  2XCG A;  3UTH A;  1NG4 A;  3SYI A;  3V3N A;  3KVE A;  3SXI A;  1B37 A;  2GF3 A;  2BRA A;  3ALM A;  1CF3 A;  4NNJ A;  4RG3 A;  2XFP A;  4JNQ A;  3GMC A;  1UKV G;  1Q1R A;  2ZZB A;  4BJZ A;  1K0L A;  1JRX A;  4HB9 A;  4Z44 A;  4EQW A;  1N4U A;  4Z25 A;  2ZZ0 A;  1CJ3 A;  3ICR A;  4BK2 A;  1XHC A;  2GAH B;  1L9C A;  2Q0K A;  3COX A;  3EAN A;  2E1M A;  3ICT A;  3LB8 A;  4OPD A;  4NEW A;  2WPC A;  3RED A;  1E7P A;  3ZDN A;  4CRT A;  3GD3 A;  3SZ0 A;  3K7M X;  3P4P A;  1ZMC A;  2I0Z A;  2V3B A;  3P4S A;  3QVP A;  2RGO A;  1O95 A;  2EQ8 A;  4YWO A;  5KVI A;  4H4U A;  3CPJ G;  4J57 A;  4X9N A;  5BRT A;  4P9S A;  1EL7 A;  4EIQ A;  3K30 A;  2C72 A;  4B67 A;  2WU5 A;  3UKP A;  4YTN A;  2YWL A;  3HYV A;  3GWD A;  5U63 A;  2YLZ A;  5U25 A;  1L9E A;  2C70 A;  4G74 A;  4Y4L A;  2H89 A;  1IUV A;  4C74 A;  1LQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...