2WHDA

Barley nadph-dependent thioredoxin reductase 2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
318
structure length
318
Chain Sequence
b'AAPLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEGWMANDIAAGGQLTTTTDVENFPGFPTGIMGIDLMDNCRAQSVRFGTNILSETVTEVDFSARPFRVTSDSTTVLADTVVVATGAVARRLYFSGSDTYWNRGISACAVCDGAAPIFRNKPIAVIGGGDSAMEEGNFLTKYGSQVYIIHRRNTFRASKIMQARALSNPKIQVVWDSEVVEAYGGAGGGPLAGVKVKNLVTGEVSDLQVSGLFFAIGHEPATKFLNGQLELHADGYVATKPGSTHTSVEGVFAAGDVQDKKYRQAITAAGSGCMAALDAEHYLQEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Structure of Hordeum Vulgare Nadph-Dependent Thioredoxin Reductase 2. Unwinding the Reaction Mechanism.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 92
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA02
3AB1A 2X8GA 3NTDA 2XLTA 4OVIA 5FS9A 2C7GA 2GV8A 2OLNA 1PHHA 3AEEA 4EQSA 3DK4A 2C72A 1DODA 3L1RA 1E1LA 1Y56A 3AE6A 4AT0A 1KF6A 3ICTA 1ZY8A 3IC9A 2YG3A 3UKQA 5U63A 1H6VA 3AYJA 2C66A 4PABA 3WE0A 3C4AA 3AWIA 4YXDA 2C75A 4GDEA 2XCGA 3NT6A 4DGKA 3NYEA 3QSMA 3DGHA 1EL9A 4FDCB 3P1WA 3ABVA 3DK8A 1GSNA 1Z6LA 3NYFA 2VQBA 1GERA 2XVEA 1PBFA 4PAAA 2XYOA 1DOEA 4A9WA 1S2QA 3GDNA 1O94A 2Y6QA 3CTYA 1Y0PA 2JB3A 3P9UA 3UTEA 2WESA 2UZZA 1E39A 4H4QA 4YKFA 3DJDA 2GVCA 4ECHA 4U8IA 3PVCA 3GD4A 4OPIA 1GRTA 3OZ2A 4OPUA 1TYPA 1HYUA 2YAUA 4OPCA 3M13A 4H4SA 1N4WA 2VVMA 1LJ1A 3ATRA 3NGCX 4O5QA 1VQWA 4BURA 1OJ9A 2Q0KA 4U8KA 2B9XA 3VQRA 3UOVA 4D03A 3GRSA 4GUVA 3D1CA 3LADA 3ICRA 2FJBA 2ZBWA 5KOWA 1E1NA 4DSHA 4P9SA 2R0GA 2YG4A 5CKUA 2XVJA 2YR4A 2ZZBA 4A6NA 1OJTA 2YR5A 4N9XA 5EOWA 2X50A 4J2WA 1DJNA 3M12A 1YKJA 2WETA 4H2PA 1PS9A 3AEDA 3AXBA 5ER0A 5M10A 4C3YA 2WDVA 1TYTA 1ONFA 4EIQA 1H7WA 1S3BA 3E1TA 3AE5A 2YVGA 4J34A 4B64A 1X31B 5IQ1A 3AD7B 1K0LA 1E7PA 1DXLA 1NHPA 4TM3A 3NIXA 4XWRA 2XFPA 4A7AA 1KNRA 4U8PA 5J60A 2C73A 4GDPA 2H88A 3BHKA 4JN9A 1PXCA 1TDFA 2WU5A 1K0JA 3CNSA 3NN0X 5KVIA 3B6DA 4U8NA 4REKA 4JDRA 4TM0A 5KVHA 3LJPA 4M52A 2C70A 1IUTA 3QFBA 1H84A 1COYA 3QSEA 5J7XA 2A87A 1PBBA 1D7LA 4Z2UA 1B4VA 1MO9A 2E4GA 2PYXA 3GYJA 3KU9A 1K0IA 4CY8A 4YWOA 3B3RA 3P4PA 3VR9A 3CGCA 1FOHA 2WDQA 2BS2A 3EPTA 3Q9TA 2YQUA 2X8CA 1BKWA 4I59A 1CC2A 1Q1WA 1DJQA 3VR8A 3AE3A 2I0ZA 3NNEA 1IUWA 4CBQA 2VRLA 1VDCA 3KA7A 3SFEA 2WP5A 3UTFA 2BABA 4IA5A 3DH9A 1E6EA 1GRHA 3UOXA 2X8HA 1F8WA 3CPJG 3KD9A 3RNMA 1BGNA 4YTPA 2X3NA 4ZCCA 1XANA 2XLPA 3BI4A 5BUKA 4BK2A 4O5UA 3CNPA 2BS4A 4UP3A 3GYIA 4K5SA 3CNJA 1F6MA 4MJWA 4YSZA 1DOBA 4IA6A 4USQA 2CVJA 1KSSA 1V59A 3K7QX 1BF3A 2YLSA 4B66A 2BK5A 2XVIA 4ADWA 3FMWA 2GB0A 2HQMA 2F5ZA 1KNPA 1PXBA 3GRTA 4EMJA 2YR6A 1NAAA 1REOA 4X9NA 5HXIA 4Z24A 1GTHA 4CNKA 2IVEA 5HY5A 3OC4A 3K7MX 3T37A 4A79A 3ICSA 4C5OA 4LU6A 2VVLG 3H4KA 1GT8A 1PBCA 4H2RA 1LQTA 1JOAA 3D8XA 3KKJA 4NTCA 3RP8A 2QA2A 2V61A 2NPXA 3COXA 1GRAA 2WP9A 2GAGB 3IHGA 2YLWA 1VRQB 3UKAA 1Q9IA 1GEUA 3UKHA 5C3JA 1PJ5A 2WOVA 1H7XA 1BWCA 3AD8B 3EF6A 3BNUA 2V5ZA 2RGOA 3CNTA 1NHRA 1F3PA 2GR3A 3FIMB 1F8SA 2VRMA 4UDRA 4J57A 4H4ZA 2C64A 3DMEA 2C3CA 2YLRA 4ZCDA 1CJ3A 1LVLA 1MXTA 4H4UA 4C74A 2YLTA 4YSHA 1GRFA 3GSIA 4CY6A 2WPFA 1NG4A 1D7YA 2GF3A 3P4SA 2GQWA 1XPQA 4IVOB 4NTEA 1S2YA 2YG6A 4TLXA 1N4VA 2PHHA 3NH3X 4IVMB 1EBDA 2WS3A 2E5VA 1KSUA 3ALLA 3QVRA 5JCKA 2WDRA 1E1MA 2WU2A 1CHUA 4KX6A 5KRQA 3NG7X 4H7UA 1ZDLA 4NEWA 3AEBA 3DJEA 5FS7A 1ZK7A 3AD9B 4YTNA 3REDA 1CJ2A 1IUUA 1QLBA 4AOXA 5GRTA 1O5WA 1EL8A 4K8DA 2W0HA 2R4EA 4XWZA 2YLXA 3IHMA 2FBWA 1YQ3A 2JBVA 4C3XA 1B37A 2R45A 3CGEA 2XVFA 2AQJA 1IUXA 5BVAA 3II4A 3VRAA 2XLRA 3UKLA 1OJAA 4FK1C 4U8LA 3HZLA 4H2NA 2B76A 1NENA 2V3BA 3SM8A 1JEHA 2TMDA 4JNQA 1VG9A 4GCMA 3F8RA 2JB2A 3QSSA 2A89A 2DKHA 4EIPA 2GMHA 1NHSA 2V60A 1PBDA 4YTMA 5CQFA 4NTDA 2H89A 4CRTA 4U2TA 5JCLA 3NN6X 1CC4A 3GWDA 4U2SA 2Q7VA 3NK2X 3K7TA 2IVDA 4D04A 1GRGA 3DGZA 4A65A 3GMCA 4JY3A 3UKKA 1JNZA 1OJDA 1YQZA 3Q6JA 4BV6A 2OLOA 3CNDA 1KFYA 4CCQA 4EM4A 2VVLA 3PO7A 1SEZA 2YWLA 4U2LA 4WX1A 1H82A 3AEGA 3VRBA 4APNA 2BXRA 2YG5A 3NLCA 1DOCA 1TDOA 3GMBA 2C65A 1CBOA 3BI2A 3EAOA 2WHDA 1NDAA 4X4JA 5JCIA 1NHQA 4K22A 1ZKQA 1EL7A 1GNDA 4LA1A 1L0VA 2BXSA 3G5QA 1NEKA 1TDEA 3UTHA 1P2EA 3IF9A 1CJ4A 3UP5A 5KOXA 5KWFA 2V3AA 3SQPA 4H4XA 3LOVA 2JAEA 2XFUA 2DKIA 3CIRA 3F8DA 4H2QA 2BS3A 1PDHA 1W4XA 1D5TA 4OPGA 3V76A 2B7RA 2BK3A 2JKCA 3DJJA 4Y4LA 4A6NB 2B9WA 2R4JA 2WEUA 3H8IA 1CC6A 4TM4A 4Z26A 4OPTA 3AE1A 1JU2A 2R46A 3S5WA 3UKPA 2Q0LA 3JSKA 1JRYA 2XFQA 1JRXA 3ISHA 2GEWA 4FK1A 2VQ7A 3O0HA 4YSXA 2EQ7A 3KVEA 2Q6UA 3AYLA 2GR0A 1E1KA 2BC1A 3FBSA 1TDKA 1ZP0A 4Y4NA 1GV4A 2OALA 4DNAA 2B7SA 1GALA 2ACZA 5EBKA 1AOGA 4BK3A 1MOKA 4J56A 4JY2A 1TDNA 3UCLA 3ZYXA 5JCMA 3AE8A 4GRTA 5EB4A 1S3EA 2WPEA 4DSGA 3QFAA 4AP1A 2C3DA 3NKSA 2C76A 1LQUA 2ZZCA 4C77A 4EQRA 4H4PA 2CDUA 1QO8A 3P4RA 3QJ4A 4B67A 4B65A 5LV9A 2YVFA 3UTGA 2OA1A 1D4DA 4OPDA 3V3OA 4Z44A 4BK1A 2YM1A 3EANA 4Z43A 2TPRA 2XDOA 3I6DA 2ARDA 2XLUA 1ZMDA 4RG3A 5BRTA 1RYIA 3NRNA 3V3NA 3AE2A 1M64A 3LZWA 5GSNA 1L9CA 1L9DA 1LPFA 5FMHA 1BGJA 4J33A 5HHFA 4EMIA 3AE9A 3UOYA 5C2TA 4H4WA 3SGLA 1PJ7A 3CPIG 3P4QA 4BJYA 2GMJA 4WCTA 3R9UA 3K30A 4IV9A 1L9EA 5U1OA 3RP6A 4EMWA 3ALMA 3S61A 2V6OA 4XXGA 2VOUA 4BJZA 2IIDA 1TRBA 1ZX9A 4KPRA 1GREA 4OCGA 1DNCA 3NYCA 2YLZA 1FECA 1PXAA 4OPLA 4USRA 4AP3A 2XFNA 4K2XA 3NTAA 3CGDA 2CFYA 5FS6A 2FJAA 1D4CA 2GR2A 1N4UA 3H8LA 4B69A 3URHA 3CN8A 3I3LA 1H86A 3NK1X 2EQ6A 4TM1A 4UDPA 2AR8A 5BULA 3UOZA 1B5QA 4NEVA 3UKFA 1PBEA 3LZXA 1FL2A 2FJEA 2WQYA 2BK4A 3FPZA 1GESA 4JQ9A 5HYMA 1CF3A 1XHCA 1GOSA 4B1BA 1ELIA 4NZHA 1Y56B 1ZOVA 1RP0A 3ADAB 4CNJA 2QA1A 4HA6A 2RABA 4Y4MA 2NVKX 5EB5A 2BA9A 2X99A 4H4RA 3ATQA 2YVJA 3NK0X 1IUSA 3AYIA 2VZ2A 4K5RA 1NG3A 3GD3A 4ICYA 4RSLA 1F8RA 2GQFA 2BC0A 3GWFA 4TLZA 2A8XA 1FEBA 4AT2A 1ZOYA 3BNMA 1ZMCA 1FCDA 2Y6RA 2Z5XA 3C4NA 3IWAA 3LB8A 5DBJA 4K7ZA 2BCPA 5U25A 1N1PA 2FJDA 1GTEA 2BYBA 3GDPA 4E0VA 3AE7A 4X9MA 1K4QA 2GAHB 2AAQA 1CJCA 2YM2A 2B9YA 3KPFA 4GF7A 2J3NA 5IPYA 5L46A 1CL0A 1H81A 2BCGG 1LV0A 1UKVG 4ZN0A 5M0ZA 1P2HA 2WBAA 1YQ4A 4H4YA 4U8JA 3G5SA 3RHAA 2EQ9A 3FG2P 3CPHG 1Q1RA 3SFDA 4GR1A 4EM3A 3AEFA 3LXDA 3NHOX 4H4TA 2XFOA 2QCUA 1D4EA 2GRTA 3KLJA 1BZLA 4J36A 1GPEA 4Z2RA 3DA1A 2WOWA 3UP4A 4EQWA 2EQ8A 4I58A 3DJGX 3CGBA 3RP7A 4EQXA 2JK6A 2WPCA 4A5LA 4U8OA 3QVPA 5JCNA 5IQ4A 5FS8A 1FEAA 5KXJA 1NPXA 2CULA 2R0CA 1VG0A 4JNAA 2APGA 4CCRA 1GRBA 2OAMA 3ITJA 4H50A 2ZZ0A 3PS9A 1JRZA 1LTXR 3L8KA 1KDGA 1OJCA 1PN0A 3C96A 1IUVA 4U8MA 3VRDB 4HB9A 4YSYA 4B63A 3BI5A 1H83A 1XDIA 3ZDNA 4A99A 4J31A 3ALJA 4YKGA 4B68A 4AOSA 3DK9A 3AEAA 2RGHA 2XVHA 4FX9A 3G5RA 3AE4A 1M6IA 1O95A 4Z25A 4H4VA 4UDQA 1RSGA 1B8SA 1GXFA 1EL5A 1GETA 4Z2TA 2WOIA 1YY5A 2R9ZA 2RGJA 3AECA 2GH5A 2R0PA 1IJHA 3F8PA 4RG4A 5TR3A 2QAEA 3BHFA 1PJ6A 2JB1A 1JNRA 2BACA 2YG7A 2C67A 2GR1A 2Z5YA 2E1MA 3M0OA 4LIIA 2WP6A 4YT0A 2XLSA 1QJDA 2O9ZA
chains in the Genus database with same CATH superfamily
3AB1A 2X8GA 4GAVA 3SZWA 3NTDA 2XLTA 4OVIA 5FS9A 2C7GA 2GV8A 2OLNA 1PHHA 3AEEA 4EQSA 3DK4A 2C72A 1DODA 3L1RA 1E1LA 1Y56A 3AE6A 4AT0A 1KF6A 3ICTA 1ZY8A 3IC9A 2YG3A 3UKQA 5U63A 1H6VA 3AYJA 2C66A 4PABA 3WE0A 3C4AA 3AWIA 4YXDA 2C75A 4GDEA 2XCGA 3NT6A 4DGKA 3NYEA 3QSMA 3DGHA 1EL9A 4FDCB 3P1WA 3ABVA 3DK8A 1GSNA 1Z6LA 3NYFA 3SY4A 2VQBA 1GERA 2XVEA 1PBFA 4PAAA 2XYOA 4GAPA 1DOEA 3T0KA 4A9WA 1S2QA 3GDNA 1O94A 2Y6QA 3CTYA 1Y0PA 2JB3A 3P9UA 3UTEA 2WESA 2UZZA 1E39A 4H4QA 4YKFA 3DJDA 2GVCA 4ECHA 4U8IA 3PVCA 3GD4A 4OPIA 1GRTA 3OZ2A 4OPUA 1TYPA 1HYUA 2YAUA 4OPCA 3M13A 4H4SA 1N4WA 2VVMA 1LJ1A 3ATRA 3NGCX 4O5QA 1VQWA 4BURA 1OJ9A 2Q0KA 4U8KA 2B9XA 3VQRA 3UOVA 4D03A 3GRSA 4GUVA 3D1CA 3LADA 3T2YA 3ICRA 2FJBA 2ZBWA 5KOWA 1E1NA 4DSHA 4P9SA 2R0GA 2YG4A 5CKUA 2XVJA 2YR4A 2ZZBA 4G74A 1OJTA 2YR5A 4A6NA 4N9XA 5EOWA 2X50A 4J2WA 1DJNA 3M12A 1YKJA 2WETA 4H2PA 1PS9A 3AEDA 3AXBA 5ER0A 5M10A 4C3YA 2WDVA 1TYTA 1ONFA 4EIQA 1H7WA 1S3BA 3E1TA 3AE5A 2YVGA 4J34A 4B64A 1X31B 5IQ1A 3AD7B 1K0LA 1E7PA 1DXLA 1NHPA 4TM3A 3NIXA 4XWRA 2XFPA 4A7AA 1KNRA 4U8PA 5J60A 2C73A 4GDPA 2H88A 3BHKA 4JN9A 1PXCA 1TDFA 2WU5A 1K0JA 3CNSA 3NN0X 5KVIA 3B6DA 4U8NA 4REKA 4JDRA 4TM0A 5KVHA 3LJPA 4M52A 2C70A 1IUTA 3QFBA 1H84A 1COYA 3QSEA 5J7XA 2A87A 1PBBA 1D7LA 4Z2UA 1B4VA 1MO9A 2E4GA 2PYXA 3GYJA 3KU9A 1K0IA 4CY8A 4YWOA 3B3RA 3P4PA 3VR9A 3CGCA 1FOHA 2WDQA 2BS2A 3EPTA 3Q9TA 2YQUA 2X8CA 1BKWA 4I59A 1CC2A 1Q1WA 4II2A 1DJQA 3VR8A 3AE3A 2I0ZA 3NNEA 1IUWA 4CBQA 2VRLA 1VDCA 3KA7A 3SFEA 2WP5A 3UTFA 2BABA 4IA5A 3DH9A 1E6EA 1GRHA 3UOXA 2X8HA 1F8WA 3CPJG 3KD9A 3RNMA 1BGNA 4YTPA 2X3NA 4ZCCA 1XANA 2XLPA 3BI4A 5BUKA 4BK2A 4O5UA 3CNPA 3T2ZA 2BS4A 4UP3A 3GYIA 4K5SA 3CNJA 1F6MA 4MJWA 4YSZA 1DOBA 4IA6A 4USQA 2CVJA 1KSSA 1V59A 3K7QX 1BF3A 2YLSA 4B66A 5KMSA 2BK5A 2XVIA 4ADWA 3FMWA 2GB0A 2HQMA 2F5ZA 1KNPA 1PXBA 3GRTA 4EMJA 2YR6A 1NAAA 1REOA 4X9NA 5HXIA 4Z24A 1GTHA 4CNKA 2IVEA 5HY5A 3OC4A 3K7MX 3T37A 4A79A 3ICSA 4C5OA 4LU6A 2VVLG 3H4KA 1GT8A 1PBCA 4H2RA 1LQTA 1JOAA 3D8XA 3KKJA 4NTCA 3RP8A 2QA2A 2V61A 2NPXA 3COXA 1GRAA 2WP9A 2GAGB 3IHGA 2YLWA 1VRQB 3UKAA 1Q9IA 1GEUA 3UKHA 5C3JA 1PJ5A 2BRYA 2WOVA 1H7XA 1BWCA 3AD8B 3EF6A 3BNUA 2V5ZA 2RGOA 3CNTA 1NHRA 1F3PA 2GR3A 3FIMB 1F8SA 2VRMA 4UDRA 4J57A 4H4ZA 2C64A 3DMEA 2C3CA 3T31A 2YLRA 4ZCDA 1CJ3A 1LVLA 1MXTA 4H4UA 4C74A 2YLTA 3HYVA 4YSHA 1GRFA 3GSIA 4CY6A 2WPFA 1NG4A 1D7YA 2GF3A 3P4SA 2GQWA 1XPQA 4IVOB 4NTEA 1S2YA 2YG6A 4TLXA 1N4VA 2PHHA 3NH3X 4IVMB 1EBDA 2WS3A 2E5VA 1KSUA 3ALLA 3QVRA 5JCKA 2WDRA 1E1MA 2WU2A 1CHUA 4KX6A 5KRQA 3NG7X 4H7UA 1ZDLA 3HYWA 4NEWA 3AEBA 3DJEA 5FS7A 1ZK7A 3AD9B 4YTNA 3REDA 1CJ2A 1IUUA 1QLBA 4AOXA 5GRTA 1O5WA 1EL8A 4K8DA 2W0HA 2R4EA 4XWZA 2YLXA 3IHMA 2FBWA 1YQ3A 2JBVA 4C3XA 1B37A 2R45A 3CGEA 2XVFA 2AQJA 1IUXA 5BVAA 3II4A 3VRAA 2XLRA 3UKLA 1OJAA 4FK1C 4U8LA 3HZLA 4H2NA 2B76A 1NENA 2V3BA 3SM8A 1JEHA 2TMDA 4JNQA 1VG9A 4GCMA 3F8RA 2JB2A 3QSSA 2A89A 2DKHA 4EIPA 2GMHA 1NHSA 2V60A 1PBDA 4YTMA 5CQFA 4NTDA 2H89A 4CRTA 4U2TA 5JCLA 3NN6X 1CC4A 3GWDA 4U2SA 2Q7VA 3NK2X 3SZFA 3K7TA 2IVDA 4D04A 1GRGA 3DGZA 4A65A 4II3A 3GMCA 4JY3A 3UKKA 1JNZA 1OJDA 1YQZA 3Q6JA 4BV6A 2OLOA 3CNDA 1KFYA 4CCQA 4EM4A 2VVLA 3PO7A 1SEZA 2YWLA 4U2LA 4WX1A 1H82A 3AEGA 3VRBA 4APNA 2BXRA 2YG5A 3NLCA 1DOCA 1TDOA 3GMBA 2C65A 1CBOA 3BI2A 3EAOA 2WHDA 1NDAA 4X4JA 5JCIA 1NHQA 4K22A 1ZKQA 1EL7A 1GNDA 4LA1A 1L0VA 2BXSA 3G5QA 1NEKA 1TDEA 3UTHA 1P2EA 3IF9A 1CJ4A 3UP5A 5KOXA 5KWFA 2V3AA 3SQPA 4H4XA 3LOVA 2JAEA 2XFUA 2DKIA 3CIRA 3F8DA 4H2QA 2BS3A 1PDHA 1W4XA 1D5TA 4OPGA 3V76A 2B7RA 2BK3A 2JKCA 3DJJA 4Y4LA 3SXIA 4A6NB 2B9WA 2R4JA 2WEUA 3SYIA 3H8IA 1CC6A 3GYXA 4TM4A 4Z26A 4OPTA 3AE1A 1JU2A 2R46A 3S5WA 3UKPA 2Q0LA 3JSKA 1JRYA 2XFQA 1JRXA 3ISHA 2GEWA 4FK1A 2VQ7A 3O0HA 4G9KA 4YSXA 2EQ7A 3KVEA 2Q6UA 3AYLA 2GR0A 1E1KA 2BC1A 3FBSA 1TDKA 5KNLA 1ZP0A 4Y4NA 1GV4A 2OALA 4DNAA 2B7SA 3SX6A 1GALA 2ACZA 5EBKA 1AOGA 4BK3A 1MOKA 4J56A 4JY2A 1TDNA 3UCLA 3ZYXA 5JCMA 5KMPA 3AE8A 4GRTA 2BRAA 1S3EA 2WPEA 5EB4A 4DSGA 3QFAA 4AP1A 2C3DA 3NKSA 2C76A 1LQUA 2ZZCA 4C77A 4EQRA 4H4PA 2CDUA 1QO8A 3P4RA 3QJ4A 4B67A 4B65A 5LV9A 2YVFA 3UTGA 4NNJA 2OA1A 1D4DA 4OPDA 3V3OA 4Z44A 4BK1A 2YM1A 3EANA 4Z43A 2TPRA 2XDOA 3I6DA 2ARDA 2XLUA 1ZMDA 4RG3A 5BRTA 1RYIA 3NRNA 3V3NA 3AE2A 1M64A 3LZWA 5GSNA 1L9CA 1L9DA 1LPFA 5FMHA 1BGJA 4J33A 5HHFA 4EMIA 3AE9A 3UOYA 5C2TA 4H4WA 3SGLA 1PJ7A 3CPIG 3P4QA 4BJYA 2GMJA 4WCTA 3R9UA 3K30A 4IV9A 1L9EA 5U1OA 3RP6A 4EMWA 3ALMA 3S61A 2V6OA 4XXGA 2VOUA 4BJZA 2IIDA 1TRBA 1ZX9A 4KPRA 1GREA 4OCGA 3KPKA 1DNCA 3NYCA 2YLZA 1FECA 1PXAA 4OPLA 4USRA 4AP3A 2XFNA 4K2XA 3NTAA 3CGDA 2CFYA 5FS6A 3T14A 2FJAA 1D4CA 2GR2A 1N4UA 3H8LA 3HYXA 4G6GA 4B69A 3URHA 3CN8A 3I3LA 1H86A 3NK1X 5KMRA 2EQ6A 4TM1A 4UDPA 2AR8A 3CMMA 5BULA 3UOZA 1B5QA 4NEVA 3UKFA 1PBEA 3LZXA 1FL2A 2FJEA 2WQYA 2BK4A 3FPZA 1GESA 4JQ9A 5HYMA 1CF3A 1XHCA 1GOSA 4B1BA 1ELIA 4NZHA 1Y56B 1ZOVA 1RP0A 3ADAB 4CNJA 2QA1A 4HA6A 2RABA 4Y4MA 2NVKX 5EB5A 2BA9A 2X99A 4H4RA 3ATQA 2YVJA 3NK0X 1IUSA 3AYIA 2VZ2A 4K5RA 1NG3A 3GD3A 4ICYA 4RSLA 1F8RA 2GQFA 2BC0A 3GWFA 4TLZA 2A8XA 1FEBA 4AT2A 1ZOYA 3BNMA 1ZMCA 1FCDA 2Y6RA 2Z5XA 3C4NA 3IWAA 3LB8A 5DBJA 4K7ZA 2BCPA 4NWZA 5U25A 1N1PA 2FJDA 1GTEA 2BYBA 3GDPA 5KMQA 4E0VA 3AE7A 4X9MA 1K4QA 2GAHB 2AAQA 1CJCA 2YM2A 2B9YA 3KPFA 4GF7A 2J3NA 5IPYA 5L46A 1CL0A 1H81A 2BCGG 1LV0A 1UKVG 4ZN0A 5M0ZA 1P2HA 2WBAA 1YQ4A 4H4YA 4U8JA 3G5SA 3RHAA 2EQ9A 3FG2P 3CPHG 1Q1RA 3SFDA 4GR1A 4EM3A 3AEFA 3LXDA 3NHOX 4H4TA 2XFOA 2QCUA 1D4EA 2GRTA 3KLJA 1BZLA 4J36A 1GPEA 4Z2RA 3DA1A 2WOWA 3SZCA 3UP4A 4EQWA 2EQ8A 4I58A 3DJGX 3CGBA 3RP7A 4EQXA 2JK6A 2WPCA 4A5LA 4U8OA 3QVPA 5JCNA 5IQ4A 5FS8A 1FEAA 2C4CA 5KXJA 1NPXA 2CULA 2R0CA 1VG0A 4G6HA 4JNAA 2APGA 3SZ0A 1GRBA 2OAMA 3ITJA 4H50A 2ZZ0A 3PS9A 4CCRA 1JRZA 1LTXR 3L8KA 1KDGA 1OJCA 1PN0A 3C96A 1IUVA 4U8MA 3VRDB 4HB9A 4G73A 4YSYA 4B63A 3BI5A 1H83A 1XDIA 3ZDNA 4A99A 4J31A 3ALJA 4YKGA 4B68A 4AOSA 3DK9A 3AEAA 2RGHA 2XVHA 4FX9A 3G5RA 3AE4A 1M6IA 1O95A 4Z25A 4H4VA 4UDQA 1RSGA 1B8SA 1GXFA 1EL5A 1GETA 3T2KA 2WOIA 4Z2TA 1YY5A 2R9ZA 2RGJA 3AECA 2GH5A 2R0PA 1IJHA 3F8PA 4RG4A 5TR3A 2QAEA 3BHFA 1PJ6A 2JB1A 1JNRA 2BACA 2YG7A 2C67A 2GR1A 2Z5YA 2E1MA 3M0OA 4LIIA 2WP6A 4YT0A 2XLSA 1QJDA 2O9ZA
chains in the Genus database with same CATH topology
3AB1A 2X8GA 4GAVA 3SZWA 3NTDA 2XLTA 4OVIA 5FS9A 2C7GA 2GV8A 2OLNA 1PHHA 3AEEA 4EQSA 3DK4A 2C72A 1DODA 3L1RA 1E1LA 1Y56A 3AE6A 4AT0A 1KF6A 3ICTA 1ZY8A 3IC9A 2YG3A 3UKQA 5U63A 1H6VA 3AYJA 2C66A 4PABA 3WE0A 3C4AA 3AWIA 4YXDA 2C75A 4GDEA 2XCGA 3NT6A 4DGKA 3NYEA 3QSMA 3DGHA 1EL9A 4FDCB 3P1WA 3ABVA 3DK8A 1GSNA 1Z6LA 3NYFA 3SY4A 2VQBA 1GERA 2XVEA 1PBFA 4PAAA 2XYOA 4GAPA 1DOEA 3T0KA 4A9WA 1S2QA 3GDNA 1O94A 2Y6QA 3CTYA 1Y0PA 2JB3A 3P9UA 3UTEA 2WESA 2UZZA 1E39A 4H4QA 4YKFA 3DJDA 2GVCA 4ECHA 4U8IA 3PVCA 3GD4A 4OPIA 1GRTA 3OZ2A 4OPUA 1TYPA 1HYUA 2YAUA 4OPCA 3M13A 4H4SA 1N4WA 2VVMA 1LJ1A 3ATRA 3NGCX 4O5QA 1VQWA 4BURA 1OJ9A 2Q0KA 4U8KA 2B9XA 3VQRA 3UOVA 4D03A 3GRSA 4GUVA 3D1CA 3LADA 3T2YA 3ICRA 2FJBA 2ZBWA 5KOWA 1E1NA 4DSHA 4P9SA 2R0GA 2YG4A 5CKUA 2XVJA 2YR4A 2ZZBA 4G74A 1OJTA 2YR5A 4A6NA 4N9XA 5EOWA 2X50A 4J2WA 1DJNA 3M12A 1YKJA 2WETA 4H2PA 1PS9A 3AEDA 3AXBA 5ER0A 5M10A 4C3YA 2WDVA 1TYTA 1ONFA 4EIQA 1H7WA 1S3BA 3E1TA 3AE5A 2YVGA 4J34A 4B64A 1X31B 5IQ1A 3AD7B 1K0LA 1E7PA 1DXLA 1NHPA 4TM3A 3NIXA 4XWRA 2XFPA 4A7AA 1KNRA 4U8PA 5J60A 2C73A 4GDPA 2H88A 3BHKA 4JN9A 1PXCA 1TDFA 2WU5A 1K0JA 3CNSA 3NN0X 5KVIA 3B6DA 4U8NA 4REKA 4JDRA 4TM0A 5KVHA 3LJPA 4M52A 2C70A 1IUTA 3QFBA 1H84A 1COYA 3QSEA 5J7XA 2A87A 1PBBA 1D7LA 4Z2UA 1B4VA 1MO9A 2E4GA 2PYXA 3GYJA 3KU9A 1K0IA 4CY8A 4YWOA 3B3RA 3P4PA 3VR9A 3CGCA 1FOHA 2WDQA 2BS2A 3EPTA 3Q9TA 2YQUA 2X8CA 1BKWA 4I59A 1CC2A 1Q1WA 4II2A 1DJQA 3VR8A 3AE3A 2I0ZA 3NNEA 1IUWA 4CBQA 2VRLA 1VDCA 3KA7A 3SFEA 2WP5A 3UTFA 2BABA 4IA5A 3DH9A 1E6EA 1GRHA 3UOXA 2X8HA 1F8WA 3CPJG 3KD9A 3RNMA 1BGNA 4YTPA 2X3NA 4ZCCA 1XANA 2XLPA 3BI4A 5BUKA 4BK2A 4O5UA 3CNPA 3T2ZA 2BS4A 4UP3A 3GYIA 4K5SA 3CNJA 1F6MA 4MJWA 4YSZA 1DOBA 4IA6A 4USQA 2CVJA 1KSSA 1V59A 3K7QX 1BF3A 2YLSA 4B66A 5KMSA 2BK5A 2XVIA 4ADWA 3FMWA 2GB0A 2HQMA 2F5ZA 1KNPA 1PXBA 3GRTA 4EMJA 2YR6A 1NAAA 1REOA 4X9NA 5HXIA 4Z24A 1GTHA 4CNKA 2IVEA 5HY5A 3OC4A 3K7MX 3T37A 4A79A 3ICSA 4C5OA 4LU6A 2VVLG 3H4KA 1GT8A 1PBCA 4H2RA 1LQTA 1JOAA 3D8XA 3KKJA 4NTCA 3RP8A 2QA2A 2V61A 2NPXA 3COXA 1GRAA 2WP9A 2GAGB 3IHGA 2YLWA 1VRQB 3UKAA 1Q9IA 1GEUA 3UKHA 5C3JA 1PJ5A 2BRYA 2WOVA 1H7XA 1BWCA 3AD8B 3EF6A 3BNUA 2V5ZA 2RGOA 3CNTA 1NHRA 1F3PA 2GR3A 3FIMB 1F8SA 2VRMA 4UDRA 4J57A 4H4ZA 2C64A 3DMEA 2C3CA 3T31A 2YLRA 4ZCDA 1CJ3A 1LVLA 1MXTA 4H4UA 4C74A 2YLTA 3HYVA 4YSHA 1GRFA 3GSIA 4CY6A 2WPFA 1NG4A 1D7YA 2GF3A 3P4SA 2GQWA 1XPQA 4IVOB 4NTEA 1S2YA 2YG6A 4TLXA 1N4VA 2PHHA 3NH3X 4IVMB 1EBDA 2WS3A 2E5VA 1KSUA 3ALLA 3QVRA 5JCKA 2WDRA 1E1MA 2WU2A 1CHUA 4KX6A 5KRQA 3NG7X 4H7UA 1ZDLA 3HYWA 4NEWA 3AEBA 3DJEA 5FS7A 1ZK7A 3AD9B 4YTNA 3REDA 1CJ2A 1IUUA 1QLBA 4AOXA 5GRTA 1O5WA 1EL8A 4K8DA 2W0HA 2R4EA 4XWZA 2YLXA 3IHMA 2FBWA 1YQ3A 2JBVA 4C3XA 1B37A 2R45A 3CGEA 2XVFA 2AQJA 1IUXA 5BVAA 3II4A 3VRAA 2XLRA 3UKLA 1OJAA 4FK1C 4U8LA 3HZLA 4H2NA 2B76A 1NENA 2V3BA 3SM8A 1JEHA 2TMDA 4JNQA 1VG9A 4GCMA 3F8RA 2JB2A 3QSSA 2A89A 2DKHA 4EIPA 2GMHA 1NHSA 2V60A 1PBDA 4YTMA 5CQFA 4NTDA 2H89A 4CRTA 4U2TA 5JCLA 3NN6X 1CC4A 3GWDA 4U2SA 2Q7VA 3NK2X 3SZFA 3K7TA 2IVDA 4D04A 1GRGA 3DGZA 4A65A 4II3A 3GMCA 4JY3A 3UKKA 1JNZA 1OJDA 1YQZA 3Q6JA 4BV6A 2OLOA 3CNDA 1KFYA 4CCQA 4EM4A 2VVLA 3PO7A 1SEZA 2YWLA 4U2LA 4WX1A 1H82A 3AEGA 3VRBA 4APNA 2BXRA 2YG5A 3NLCA 1DOCA 1TDOA 3GMBA 2C65A 1CBOA 3BI2A 3EAOA 2WHDA 1NDAA 4X4JA 5JCIA 1NHQA 4K22A 1ZKQA 1EL7A 1GNDA 4LA1A 1L0VA 2BXSA 3G5QA 1NEKA 1TDEA 3UTHA 1P2EA 3IF9A 1CJ4A 3UP5A 5KOXA 5KWFA 2V3AA 3SQPA 4H4XA 3LOVA 2JAEA 2XFUA 2DKIA 3CIRA 3F8DA 4H2QA 2BS3A 1PDHA 1W4XA 1D5TA 4OPGA 3V76A 2B7RA 2BK3A 2JKCA 3DJJA 4Y4LA 3SXIA 4A6NB 2B9WA 2R4JA 2WEUA 3SYIA 3H8IA 1CC6A 3GYXA 4TM4A 4Z26A 4OPTA 3AE1A 1JU2A 2R46A 3S5WA 3UKPA 2Q0LA 3JSKA 1JRYA 2XFQA 1JRXA 3ISHA 2GEWA 4FK1A 2VQ7A 3O0HA 4G9KA 4YSXA 2EQ7A 3KVEA 2Q6UA 3AYLA 2GR0A 1E1KA 2BC1A 3FBSA 1TDKA 5KNLA 1ZP0A 4Y4NA 1GV4A 2OALA 4DNAA 2B7SA 3SX6A 1GALA 2ACZA 5EBKA 1AOGA 4BK3A 1MOKA 4J56A 4JY2A 1TDNA 3UCLA 3ZYXA 5JCMA 5KMPA 3AE8A 4GRTA 2BRAA 1S3EA 2WPEA 5EB4A 4DSGA 3QFAA 4AP1A 2C3DA 3NKSA 2C76A 1LQUA 2ZZCA 4C77A 4EQRA 4H4PA 2CDUA 1QO8A 3P4RA 3QJ4A 4B67A 4B65A 5LV9A 2YVFA 3UTGA 4NNJA 2OA1A 1D4DA 4OPDA 3V3OA 4Z44A 4BK1A 2YM1A 3EANA 4Z43A 2TPRA 2XDOA 3I6DA 2ARDA 2XLUA 1ZMDA 4RG3A 5BRTA 1RYIA 3NRNA 3V3NA 3AE2A 1M64A 3LZWA 5GSNA 1L9CA 1L9DA 1LPFA 5FMHA 1BGJA 4J33A 5HHFA 4EMIA 3AE9A 3UOYA 5C2TA 4H4WA 3SGLA 1PJ7A 3CPIG 3P4QA 4BJYA 2GMJA 4WCTA 3R9UA 3K30A 4IV9A 1L9EA 5U1OA 3RP6A 4EMWA 3ALMA 3S61A 2V6OA 4XXGA 2VOUA 4BJZA 2IIDA 1TRBA 1ZX9A 4KPRA 1GREA 4OCGA 3KPKA 1DNCA 3NYCA 2YLZA 1FECA 1PXAA 4OPLA 4USRA 4AP3A 2XFNA 4K2XA 3NTAA 3CGDA 2CFYA 5FS6A 3T14A 2FJAA 1D4CA 2GR2A 1N4UA 3H8LA 3HYXA 4G6GA 4B69A 3URHA 3CN8A 3I3LA 1H86A 3NK1X 5KMRA 2EQ6A 4TM1A 4UDPA 2AR8A 3CMMA 5BULA 3UOZA 1B5QA 4NEVA 3UKFA 1PBEA 3LZXA 1FL2A 2FJEA 2WQYA 2BK4A 3FPZA 1GESA 4JQ9A 5HYMA 1CF3A 1XHCA 1GOSA 4B1BA 1ELIA 4NZHA 1Y56B 1ZOVA 1RP0A 3ADAB 4CNJA 2QA1A 4HA6A 2RABA 4Y4MA 2NVKX 5EB5A 2BA9A 2X99A 4H4RA 3ATQA 2YVJA 3NK0X 1IUSA 3AYIA 2VZ2A 4K5RA 1NG3A 3GD3A 4ICYA 4RSLA 1F8RA 2GQFA 2BC0A 3GWFA 4TLZA 2A8XA 1FEBA 4AT2A 1ZOYA 3BNMA 1ZMCA 1FCDA 2Y6RA 2Z5XA 3C4NA 3IWAA 3LB8A 5DBJA 4K7ZA 2BCPA 4NWZA 5U25A 1N1PA 2FJDA 1GTEA 2BYBA 3GDPA 5KMQA 4E0VA 3AE7A 4X9MA 1K4QA 2GAHB 2AAQA 1CJCA 2YM2A 2B9YA 3KPFA 4GF7A 2J3NA 5IPYA 5L46A 1CL0A 1H81A 2BCGG 1LV0A 1UKVG 4ZN0A 5M0ZA 1P2HA 2WBAA 1YQ4A 4H4YA 4U8JA 3G5SA 3RHAA 2EQ9A 3FG2P 3CPHG 1Q1RA 3SFDA 4GR1A 4EM3A 3AEFA 3LXDA 3NHOX 4H4TA 2XFOA 2QCUA 1D4EA 2GRTA 3KLJA 1BZLA 4J36A 1GPEA 4Z2RA 3DA1A 2WOWA 3SZCA 3UP4A 4EQWA 2EQ8A 4I58A 3DJGX 3CGBA 3RP7A 4EQXA 2JK6A 2WPCA 4A5LA 4U8OA 3QVPA 5JCNA 5IQ4A 5FS8A 1FEAA 2C4CA 5KXJA 1NPXA 2CULA 2R0CA 1VG0A 4G6HA 4JNAA 2APGA 3SZ0A 1GRBA 2OAMA 3ITJA 4H50A 2ZZ0A 3PS9A 4CCRA 1JRZA 1LTXR 3L8KA 1KDGA 1OJCA 1PN0A 3C96A 1IUVA 4U8MA 3VRDB 4HB9A 4G73A 4YSYA 4B63A 3BI5A 1H83A 1XDIA 3ZDNA 4A99A 4J31A 3ALJA 4YKGA 4B68A 4AOSA 3DK9A 3AEAA 2RGHA 2XVHA 4FX9A 3G5RA 3AE4A 1M6IA 1O95A 4Z25A 4H4VA 4UDQA 1RSGA 1B8SA 1GXFA 1EL5A 1GETA 3T2KA 2WOIA 4Z2TA 1YY5A 2R9ZA 2RGJA 3AECA 2GH5A 2R0PA 1IJHA 3F8PA 4RG4A 5TR3A 2QAEA 3BHFA 1PJ6A 2JB1A 1JNRA 2BACA 2YG7A 2C67A 2GR1A 2Z5YA 2E1MA 3M0OA 4LIIA 2WP6A 4YT0A 2XLSA 1QJDA 2O9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB1 A;  2X8G A;  3NTD A;  2XLT A;  4OVI A;  5FS9 A;  2C7G A;  2GV8 A;  2OLN A;  1PHH A;  3AEE A;  4EQS A;  3DK4 A;  2C72 A;  1DOD A;  3L1R A;  1E1L A;  1Y56 A;  3AE6 A;  4AT0 A;  1KF6 A;  3ICT A;  1ZY8 A;  3IC9 A;  2YG3 A;  3UKQ A;  5U63 A;  1H6V A;  3AYJ A;  2C66 A;  4PAB A;  3WE0 A;  3C4A A;  3AWI A;  4YXD A;  2C75 A;  4GDE A;  2XCG A;  3NT6 A;  4DGK A;  3NYE A;  3QSM A;  3DGH A;  1EL9 A;  4FDC B;  3P1W A;  3ABV A;  3DK8 A;  1GSN A;  1Z6L A;  3NYF A;  2VQB A;  1GER A;  2XVE A;  1PBF A;  4PAA A;  2XYO A;  1DOE A;  4A9W A;  1S2Q A;  3GDN A;  1O94 A;  2Y6Q A;  3CTY A;  1Y0P A;  2JB3 A;  3P9U A;  3UTE A;  2WES A;  2UZZ A;  1E39 A;  4H4Q A;  4YKF A;  3DJD A;  2GVC A;  4ECH A;  4U8I A;  3PVC A;  3GD4 A;  4OPI A;  1GRT A;  3OZ2 A;  4OPU A;  1TYP A;  1HYU A;  2YAU A;  4OPC A;  3M13 A;  4H4S A;  1N4W A;  2VVM A;  1LJ1 A;  3ATR A;  3NGC X;  4O5Q A;  1VQW A;  4BUR A;  1OJ9 A;  2Q0K A;  4U8K A;  2B9X A;  3VQR A;  3UOV A;  4D03 A;  3GRS A;  4GUV A;  3D1C A;  3LAD A;  3ICR A;  2FJB A;  2ZBW A;  5KOW A;  1E1N A;  4DSH A;  4P9S A;  2R0G A;  2YG4 A;  5CKU A;  2XVJ A;  2YR4 A;  2ZZB A;  4A6N A;  1OJT A;  2YR5 A;  4N9X A;  5EOW A;  2X50 A;  4J2W A;  1DJN A;  3M12 A;  1YKJ A;  2WET A;  4H2P A;  1PS9 A;  3AED A;  3AXB A;  5ER0 A;  5M10 A;  4C3Y A;  2WDV A;  1TYT A;  1ONF A;  4EIQ A;  1H7W A;  1S3B A;  3E1T A;  3AE5 A;  2YVG A;  4J34 A;  4B64 A;  1X31 B;  5IQ1 A;  3AD7 B;  1K0L A;  1E7P A;  1DXL A;  1NHP A;  4TM3 A;  3NIX A;  4XWR A;  2XFP A;  4A7A A;  1KNR A;  4U8P A;  5J60 A;  2C73 A;  4GDP A;  2H88 A;  3BHK A;  4JN9 A;  1PXC A;  1TDF A;  2WU5 A;  1K0J A;  3CNS A;  3NN0 X;  5KVI A;  3B6D A;  4U8N A;  4REK A;  4JDR A;  4TM0 A;  5KVH A;  3LJP A;  4M52 A;  2C70 A;  1IUT A;  3QFB A;  1H84 A;  1COY A;  3QSE A;  5J7X A;  2A87 A;  1PBB A;  1D7L A;  4Z2U A;  1B4V A;  1MO9 A;  2E4G A;  2PYX A;  3GYJ A;  3KU9 A;  1K0I A;  4CY8 A;  4YWO A;  3B3R A;  3P4P A;  3VR9 A;  3CGC A;  1FOH A;  2WDQ A;  2BS2 A;  3EPT A;  3Q9T A;  2YQU A;  2X8C A;  1BKW A;  4I59 A;  1CC2 A;  1Q1W A;  1DJQ A;  3VR8 A;  3AE3 A;  2I0Z A;  3NNE A;  1IUW A;  4CBQ A;  2VRL A;  1VDC A;  3KA7 A;  3SFE A;  2WP5 A;  3UTF A;  2BAB A;  4IA5 A;  3DH9 A;  1E6E A;  1GRH A;  3UOX A;  2X8H A;  1F8W A;  3CPJ G;  3KD9 A;  3RNM A;  1BGN A;  4YTP A;  2X3N A;  4ZCC A;  1XAN A;  2XLP A;  3BI4 A;  5BUK A;  4BK2 A;  4O5U A;  3CNP A;  2BS4 A;  4UP3 A;  3GYI A;  4K5S A;  3CNJ A;  1F6M A;  4MJW A;  4YSZ A;  1DOB A;  4IA6 A;  4USQ A;  2CVJ A;  1KSS A;  1V59 A;  3K7Q X;  1BF3 A;  2YLS A;  4B66 A;  2BK5 A;  2XVI A;  4ADW A;  3FMW A;  2GB0 A;  2HQM A;  2F5Z A;  1KNP A;  1PXB A;  3GRT A;  4EMJ A;  2YR6 A;  1NAA A;  1REO A;  4X9N A;  5HXI A;  4Z24 A;  1GTH A;  4CNK A;  2IVE A;  5HY5 A;  3OC4 A;  3K7M X;  3T37 A;  4A79 A;  3ICS A;  4C5O A;  4LU6 A;  2VVL G;  3H4K A;  1GT8 A;  1PBC A;  4H2R A;  1LQT A;  1JOA A;  3D8X A;  3KKJ A;  4NTC A;  3RP8 A;  2QA2 A;  2V61 A;  2NPX A;  3COX A;  1GRA A;  2WP9 A;  2GAG B;  3IHG A;  2YLW A;  1VRQ B;  3UKA A;  1Q9I A;  1GEU A;  3UKH A;  5C3J A;  1PJ5 A;  2WOV A;  1H7X A;  1BWC A;  3AD8 B;  3EF6 A;  3BNU A;  2V5Z A;  2RGO A;  3CNT A;  1NHR A;  1F3P A;  2GR3 A;  3FIM B;  1F8S A;  2VRM A;  4UDR A;  4J57 A;  4H4Z A;  2C64 A;  3DME A;  2C3C A;  2YLR A;  4ZCD A;  1CJ3 A;  1LVL A;  1MXT A;  4H4U A;  4C74 A;  2YLT A;  4YSH A;  1GRF A;  3GSI A;  4CY6 A;  2WPF A;  1NG4 A;  1D7Y A;  2GF3 A;  3P4S A;  2GQW A;  1XPQ A;  4IVO B;  4NTE A;  1S2Y A;  2YG6 A;  4TLX A;  1N4V A;  2PHH A;  3NH3 X;  4IVM B;  1EBD A;  2WS3 A;  2E5V A;  1KSU A;  3ALL A;  3QVR A;  5JCK A;  2WDR A;  1E1M A;  2WU2 A;  1CHU A;  4KX6 A;  5KRQ A;  3NG7 X;  4H7U A;  1ZDL A;  4NEW A;  3AEB A;  3DJE A;  5FS7 A;  1ZK7 A;  3AD9 B;  4YTN A;  3RED A;  1CJ2 A;  1IUU A;  1QLB A;  4AOX A;  5GRT A;  1O5W A;  1EL8 A;  4K8D A;  2W0H A;  2R4E A;  4XWZ A;  2YLX A;  3IHM A;  2FBW A;  1YQ3 A;  2JBV A;  4C3X A;  1B37 A;  2R45 A;  3CGE A;  2XVF A;  2AQJ A;  1IUX A;  5BVA A;  3II4 A;  3VRA A;  2XLR A;  3UKL A;  1OJA A;  4FK1 C;  4U8L A;  3HZL A;  4H2N A;  2B76 A;  1NEN A;  2V3B A;  3SM8 A;  1JEH A;  2TMD A;  4JNQ A;  1VG9 A;  4GCM A;  3F8R A;  2JB2 A;  3QSS A;  2A89 A;  2DKH A;  4EIP A;  2GMH A;  1NHS A;  2V60 A;  1PBD A;  4YTM A;  5CQF A;  4NTD A;  2H89 A;  4CRT A;  4U2T A;  5JCL A;  3NN6 X;  1CC4 A;  3GWD A;  4U2S A;  2Q7V A;  3NK2 X;  3K7T A;  2IVD A;  4D04 A;  1GRG A;  3DGZ A;  4A65 A;  3GMC A;  4JY3 A;  3UKK A;  1JNZ A;  1OJD A;  1YQZ A;  3Q6J A;  4BV6 A;  2OLO A;  3CND A;  1KFY A;  4CCQ A;  4EM4 A;  2VVL A;  3PO7 A;  1SEZ A;  2YWL A;  4U2L A;  4WX1 A;  1H82 A;  3AEG A;  3VRB A;  4APN A;  2BXR A;  2YG5 A;  3NLC A;  1DOC A;  1TDO A;  3GMB A;  2C65 A;  1CBO A;  3BI2 A;  3EAO A;  2WHD A;  1NDA A;  4X4J A;  5JCI A;  1NHQ A;  4K22 A;  1ZKQ A;  1EL7 A;  1GND A;  4LA1 A;  1L0V A;  2BXS A;  3G5Q A;  1NEK A;  1TDE A;  3UTH A;  1P2E A;  3IF9 A;  1CJ4 A;  3UP5 A;  5KOX A;  5KWF A;  2V3A A;  3SQP A;  4H4X A;  3LOV A;  2JAE A;  2XFU A;  2DKI A;  3CIR A;  3F8D A;  4H2Q A;  2BS3 A;  1PDH A;  1W4X A;  1D5T A;  4OPG A;  3V76 A;  2B7R A;  2BK3 A;  2JKC A;  3DJJ A;  4Y4L A;  4A6N B;  2B9W A;  2R4J A;  2WEU A;  3H8I A;  1CC6 A;  4TM4 A;  4Z26 A;  4OPT A;  3AE1 A;  1JU2 A;  2R46 A;  3S5W A;  3UKP A;  2Q0L A;  3JSK A;  1JRY A;  2XFQ A;  1JRX A;  3ISH A;  2GEW A;  4FK1 A;  2VQ7 A;  3O0H A;  4YSX A;  2EQ7 A;  3KVE A;  2Q6U A;  3AYL A;  2GR0 A;  1E1K A;  2BC1 A;  3FBS A;  1TDK A;  1ZP0 A;  4Y4N A;  1GV4 A;  2OAL A;  4DNA A;  2B7S A;  1GAL A;  2ACZ A;  5EBK A;  1AOG A;  4BK3 A;  1MOK A;  4J56 A;  4JY2 A;  1TDN A;  3UCL A;  3ZYX A;  5JCM A;  3AE8 A;  4GRT A;  5EB4 A;  1S3E A;  2WPE A;  4DSG A;  3QFA A;  4AP1 A;  2C3D A;  3NKS A;  2C76 A;  1LQU A;  2ZZC A;  4C77 A;  4EQR A;  4H4P A;  2CDU A;  1QO8 A;  3P4R A;  3QJ4 A;  4B67 A;  4B65 A;  5LV9 A;  2YVF A;  3UTG A;  2OA1 A;  1D4D A;  4OPD A;  3V3O A;  4Z44 A;  4BK1 A;  2YM1 A;  3EAN A;  4Z43 A;  2TPR A;  2XDO A;  3I6D A;  2ARD A;  2XLU A;  1ZMD A;  4RG3 A;  5BRT A;  1RYI A;  3NRN A;  3V3N A;  3AE2 A;  1M64 A;  3LZW A;  5GSN A;  1L9C A;  1L9D A;  1LPF A;  5FMH A;  1BGJ A;  4J33 A;  5HHF A;  4EMI A;  3AE9 A;  3UOY A;  5C2T A;  4H4W A;  3SGL A;  1PJ7 A;  3CPI G;  3P4Q A;  4BJY A;  2GMJ A;  4WCT A;  3R9U A;  3K30 A;  4IV9 A;  1L9E A;  5U1O A;  3RP6 A;  4EMW A;  3ALM A;  3S61 A;  2V6O A;  4XXG A;  2VOU A;  4BJZ A;  2IID A;  1TRB A;  1ZX9 A;  4KPR A;  1GRE A;  4OCG A;  1DNC A;  3NYC A;  2YLZ A;  1FEC A;  1PXA A;  4OPL A;  4USR A;  4AP3 A;  2XFN A;  4K2X A;  3NTA A;  3CGD A;  2CFY A;  5FS6 A;  2FJA A;  1D4C A;  2GR2 A;  1N4U A;  3H8L A;  4B69 A;  3URH A;  3CN8 A;  3I3L A;  1H86 A;  3NK1 X;  2EQ6 A;  4TM1 A;  4UDP A;  2AR8 A;  5BUL A;  3UOZ A;  1B5Q A;  4NEV A;  3UKF A;  1PBE A;  3LZX A;  1FL2 A;  2FJE A;  2WQY A;  2BK4 A;  3FPZ A;  1GES A;  4JQ9 A;  5HYM A;  1CF3 A;  1XHC A;  1GOS A;  4B1B A;  1ELI A;  4NZH A;  1Y56 B;  1ZOV A;  1RP0 A;  3ADA B;  4CNJ A;  2QA1 A;  4HA6 A;  2RAB A;  4Y4M A;  2NVK X;  5EB5 A;  2BA9 A;  2X99 A;  4H4R A;  3ATQ A;  2YVJ A;  3NK0 X;  1IUS A;  3AYI A;  2VZ2 A;  4K5R A;  1NG3 A;  3GD3 A;  4ICY A;  4RSL A;  1F8R A;  2GQF A;  2BC0 A;  3GWF A;  4TLZ A;  2A8X A;  1FEB A;  4AT2 A;  1ZOY A;  3BNM A;  1ZMC A;  1FCD A;  2Y6R A;  2Z5X A;  3C4N A;  3IWA A;  3LB8 A;  5DBJ A;  4K7Z A;  2BCP A;  5U25 A;  1N1P A;  2FJD A;  1GTE A;  2BYB A;  3GDP A;  4E0V A;  3AE7 A;  4X9M A;  1K4Q A;  2GAH B;  2AAQ A;  1CJC A;  2YM2 A;  2B9Y A;  3KPF A;  4GF7 A;  2J3N A;  5IPY A;  5L46 A;  1CL0 A;  1H81 A;  2BCG G;  1LV0 A;  1UKV G;  4ZN0 A;  5M0Z A;  1P2H A;  2WBA A;  1YQ4 A;  4H4Y A;  4U8J A;  3G5S A;  3RHA A;  2EQ9 A;  3FG2 P;  3CPH G;  1Q1R A;  3SFD A;  4GR1 A;  4EM3 A;  3AEF A;  3LXD A;  3NHO X;  4H4T A;  2XFO A;  2QCU A;  1D4E A;  2GRT A;  3KLJ A;  1BZL A;  4J36 A;  1GPE A;  4Z2R A;  3DA1 A;  2WOW A;  3UP4 A;  4EQW A;  2EQ8 A;  4I58 A;  3DJG X;  3CGB A;  3RP7 A;  4EQX A;  2JK6 A;  2WPC A;  4A5L A;  4U8O A;  3QVP A;  5JCN A;  5IQ4 A;  5FS8 A;  1FEA A;  5KXJ A;  1NPX A;  2CUL A;  2R0C A;  1VG0 A;  4JNA A;  2APG A;  4CCR A;  1GRB A;  2OAM A;  3ITJ A;  4H50 A;  2ZZ0 A;  3PS9 A;  1JRZ A;  1LTX R;  3L8K A;  1KDG A;  1OJC A;  1PN0 A;  3C96 A;  1IUV A;  4U8M A;  3VRD B;  4HB9 A;  4YSY A;  4B63 A;  3BI5 A;  1H83 A;  1XDI A;  3ZDN A;  4A99 A;  4J31 A;  3ALJ A;  4YKG A;  4B68 A;  4AOS A;  3DK9 A;  3AEA A;  2RGH A;  2XVH A;  4FX9 A;  3G5R A;  3AE4 A;  1M6I A;  1O95 A;  4Z25 A;  4H4V A;  4UDQ A;  1RSG A;  1B8S A;  1GXF A;  1EL5 A;  1GET A;  4Z2T A;  2WOI A;  1YY5 A;  2R9Z A;  2RGJ A;  3AEC A;  2GH5 A;  2R0P A;  1IJH A;  3F8P A;  4RG4 A;  5TR3 A;  2QAE A;  3BHF A;  1PJ6 A;  2JB1 A;  1JNR A;  2BAC A;  2YG7 A;  2C67 A;  2GR1 A;  2Z5Y A;  2E1M A;  3M0O A;  4LII A;  2WP6 A;  4YT0 A;  2XLS A;  1QJD A;  2O9Z A; 
#chains in the Genus database with same CATH topology
 3AB1 A;  2X8G A;  4GAV A;  3SZW A;  3NTD A;  2XLT A;  4OVI A;  5FS9 A;  2C7G A;  2GV8 A;  2OLN A;  1PHH A;  3AEE A;  4EQS A;  3DK4 A;  2C72 A;  1DOD A;  3L1R A;  1E1L A;  1Y56 A;  3AE6 A;  4AT0 A;  1KF6 A;  3ICT A;  1ZY8 A;  3IC9 A;  2YG3 A;  3UKQ A;  5U63 A;  1H6V A;  3AYJ A;  2C66 A;  4PAB A;  3WE0 A;  3C4A A;  3AWI A;  4YXD A;  2C75 A;  4GDE A;  2XCG A;  3NT6 A;  4DGK A;  3NYE A;  3QSM A;  3DGH A;  1EL9 A;  4FDC B;  3P1W A;  3ABV A;  3DK8 A;  1GSN A;  1Z6L A;  3NYF A;  3SY4 A;  2VQB A;  1GER A;  2XVE A;  1PBF A;  4PAA A;  2XYO A;  4GAP A;  1DOE A;  3T0K A;  4A9W A;  1S2Q A;  3GDN A;  1O94 A;  2Y6Q A;  3CTY A;  1Y0P A;  2JB3 A;  3P9U A;  3UTE A;  2WES A;  2UZZ A;  1E39 A;  4H4Q A;  4YKF A;  3DJD A;  2GVC A;  4ECH A;  4U8I A;  3PVC A;  3GD4 A;  4OPI A;  1GRT A;  3OZ2 A;  4OPU A;  1TYP A;  1HYU A;  2YAU A;  4OPC A;  3M13 A;  4H4S A;  1N4W A;  2VVM A;  1LJ1 A;  3ATR A;  3NGC X;  4O5Q A;  1VQW A;  4BUR A;  1OJ9 A;  2Q0K A;  4U8K A;  2B9X A;  3VQR A;  3UOV A;  4D03 A;  3GRS A;  4GUV A;  3D1C A;  3LAD A;  3T2Y A;  3ICR A;  2FJB A;  2ZBW A;  5KOW A;  1E1N A;  4DSH A;  4P9S A;  2R0G A;  2YG4 A;  5CKU A;  2XVJ A;  2YR4 A;  2ZZB A;  4G74 A;  1OJT A;  2YR5 A;  4A6N A;  4N9X A;  5EOW A;  2X50 A;  4J2W A;  1DJN A;  3M12 A;  1YKJ A;  2WET A;  4H2P A;  1PS9 A;  3AED A;  3AXB A;  5ER0 A;  5M10 A;  4C3Y A;  2WDV A;  1TYT A;  1ONF A;  4EIQ A;  1H7W A;  1S3B A;  3E1T A;  3AE5 A;  2YVG A;  4J34 A;  4B64 A;  1X31 B;  5IQ1 A;  3AD7 B;  1K0L A;  1E7P A;  1DXL A;  1NHP A;  4TM3 A;  3NIX A;  4XWR A;  2XFP A;  4A7A A;  1KNR A;  4U8P A;  5J60 A;  2C73 A;  4GDP A;  2H88 A;  3BHK A;  4JN9 A;  1PXC A;  1TDF A;  2WU5 A;  1K0J A;  3CNS A;  3NN0 X;  5KVI A;  3B6D A;  4U8N A;  4REK A;  4JDR A;  4TM0 A;  5KVH A;  3LJP A;  4M52 A;  2C70 A;  1IUT A;  3QFB A;  1H84 A;  1COY A;  3QSE A;  5J7X A;  2A87 A;  1PBB A;  1D7L A;  4Z2U A;  1B4V A;  1MO9 A;  2E4G A;  2PYX A;  3GYJ A;  3KU9 A;  1K0I A;  4CY8 A;  4YWO A;  3B3R A;  3P4P A;  3VR9 A;  3CGC A;  1FOH A;  2WDQ A;  2BS2 A;  3EPT A;  3Q9T A;  2YQU A;  2X8C A;  1BKW A;  4I59 A;  1CC2 A;  1Q1W A;  4II2 A;  1DJQ A;  3VR8 A;  3AE3 A;  2I0Z A;  3NNE A;  1IUW A;  4CBQ A;  2VRL A;  1VDC A;  3KA7 A;  3SFE A;  2WP5 A;  3UTF A;  2BAB A;  4IA5 A;  3DH9 A;  1E6E A;  1GRH A;  3UOX A;  2X8H A;  1F8W A;  3CPJ G;  3KD9 A;  3RNM A;  1BGN A;  4YTP A;  2X3N A;  4ZCC A;  1XAN A;  2XLP A;  3BI4 A;  5BUK A;  4BK2 A;  4O5U A;  3CNP A;  3T2Z A;  2BS4 A;  4UP3 A;  3GYI A;  4K5S A;  3CNJ A;  1F6M A;  4MJW A;  4YSZ A;  1DOB A;  4IA6 A;  4USQ A;  2CVJ A;  1KSS A;  1V59 A;  3K7Q X;  1BF3 A;  2YLS A;  4B66 A;  5KMS A;  2BK5 A;  2XVI A;  4ADW A;  3FMW A;  2GB0 A;  2HQM A;  2F5Z A;  1KNP A;  1PXB A;  3GRT A;  4EMJ A;  2YR6 A;  1NAA A;  1REO A;  4X9N A;  5HXI A;  4Z24 A;  1GTH A;  4CNK A;  2IVE A;  5HY5 A;  3OC4 A;  3K7M X;  3T37 A;  4A79 A;  3ICS A;  4C5O A;  4LU6 A;  2VVL G;  3H4K A;  1GT8 A;  1PBC A;  4H2R A;  1LQT A;  1JOA A;  3D8X A;  3KKJ A;  4NTC A;  3RP8 A;  2QA2 A;  2V61 A;  2NPX A;  3COX A;  1GRA A;  2WP9 A;  2GAG B;  3IHG A;  2YLW A;  1VRQ B;  3UKA A;  1Q9I A;  1GEU A;  3UKH A;  5C3J A;  1PJ5 A;  2BRY A;  2WOV A;  1H7X A;  1BWC A;  3AD8 B;  3EF6 A;  3BNU A;  2V5Z A;  2RGO A;  3CNT A;  1NHR A;  1F3P A;  2GR3 A;  3FIM B;  1F8S A;  2VRM A;  4UDR A;  4J57 A;  4H4Z A;  2C64 A;  3DME A;  2C3C A;  3T31 A;  2YLR A;  4ZCD A;  1CJ3 A;  1LVL A;  1MXT A;  4H4U A;  4C74 A;  2YLT A;  3HYV A;  4YSH A;  1GRF A;  3GSI A;  4CY6 A;  2WPF A;  1NG4 A;  1D7Y A;  2GF3 A;  3P4S A;  2GQW A;  1XPQ A;  4IVO B;  4NTE A;  1S2Y A;  2YG6 A;  4TLX A;  1N4V A;  2PHH A;  3NH3 X;  4IVM B;  1EBD A;  2WS3 A;  2E5V A;  1KSU A;  3ALL A;  3QVR A;  5JCK A;  2WDR A;  1E1M A;  2WU2 A;  1CHU A;  4KX6 A;  5KRQ A;  3NG7 X;  4H7U A;  1ZDL A;  3HYW A;  4NEW A;  3AEB A;  3DJE A;  5FS7 A;  1ZK7 A;  3AD9 B;  4YTN A;  3RED A;  1CJ2 A;  1IUU A;  1QLB A;  4AOX A;  5GRT A;  1O5W A;  1EL8 A;  4K8D A;  2W0H A;  2R4E A;  4XWZ A;  2YLX A;  3IHM A;  2FBW A;  1YQ3 A;  2JBV A;  4C3X A;  1B37 A;  2R45 A;  3CGE A;  2XVF A;  2AQJ A;  1IUX A;  5BVA A;  3II4 A;  3VRA A;  2XLR A;  3UKL A;  1OJA A;  4FK1 C;  4U8L A;  3HZL A;  4H2N A;  2B76 A;  1NEN A;  2V3B A;  3SM8 A;  1JEH A;  2TMD A;  4JNQ A;  1VG9 A;  4GCM A;  3F8R A;  2JB2 A;  3QSS A;  2A89 A;  2DKH A;  4EIP A;  2GMH A;  1NHS A;  2V60 A;  1PBD A;  4YTM A;  5CQF A;  4NTD A;  2H89 A;  4CRT A;  4U2T A;  5JCL A;  3NN6 X;  1CC4 A;  3GWD A;  4U2S A;  2Q7V A;  3NK2 X;  3SZF A;  3K7T A;  2IVD A;  4D04 A;  1GRG A;  3DGZ A;  4A65 A;  4II3 A;  3GMC A;  4JY3 A;  3UKK A;  1JNZ A;  1OJD A;  1YQZ A;  3Q6J A;  4BV6 A;  2OLO A;  3CND A;  1KFY A;  4CCQ A;  4EM4 A;  2VVL A;  3PO7 A;  1SEZ A;  2YWL A;  4U2L A;  4WX1 A;  1H82 A;  3AEG A;  3VRB A;  4APN A;  2BXR A;  2YG5 A;  3NLC A;  1DOC A;  1TDO A;  3GMB A;  2C65 A;  1CBO A;  3BI2 A;  3EAO A;  2WHD A;  1NDA A;  4X4J A;  5JCI A;  1NHQ A;  4K22 A;  1ZKQ A;  1EL7 A;  1GND A;  4LA1 A;  1L0V A;  2BXS A;  3G5Q A;  1NEK A;  1TDE A;  3UTH A;  1P2E A;  3IF9 A;  1CJ4 A;  3UP5 A;  5KOX A;  5KWF A;  2V3A A;  3SQP A;  4H4X A;  3LOV A;  2JAE A;  2XFU A;  2DKI A;  3CIR A;  3F8D A;  4H2Q A;  2BS3 A;  1PDH A;  1W4X A;  1D5T A;  4OPG A;  3V76 A;  2B7R A;  2BK3 A;  2JKC A;  3DJJ A;  4Y4L A;  3SXI A;  4A6N B;  2B9W A;  2R4J A;  2WEU A;  3SYI A;  3H8I A;  1CC6 A;  3GYX A;  4TM4 A;  4Z26 A;  4OPT A;  3AE1 A;  1JU2 A;  2R46 A;  3S5W A;  3UKP A;  2Q0L A;  3JSK A;  1JRY A;  2XFQ A;  1JRX A;  3ISH A;  2GEW A;  4FK1 A;  2VQ7 A;  3O0H A;  4G9K A;  4YSX A;  2EQ7 A;  3KVE A;  2Q6U A;  3AYL A;  2GR0 A;  1E1K A;  2BC1 A;  3FBS A;  1TDK A;  5KNL A;  1ZP0 A;  4Y4N A;  1GV4 A;  2OAL A;  4DNA A;  2B7S A;  3SX6 A;  1GAL A;  2ACZ A;  5EBK A;  1AOG A;  4BK3 A;  1MOK A;  4J56 A;  4JY2 A;  1TDN A;  3UCL A;  3ZYX A;  5JCM A;  5KMP A;  3AE8 A;  4GRT A;  2BRA A;  1S3E A;  2WPE A;  5EB4 A;  4DSG A;  3QFA A;  4AP1 A;  2C3D A;  3NKS A;  2C76 A;  1LQU A;  2ZZC A;  4C77 A;  4EQR A;  4H4P A;  2CDU A;  1QO8 A;  3P4R A;  3QJ4 A;  4B67 A;  4B65 A;  5LV9 A;  2YVF A;  3UTG A;  4NNJ A;  2OA1 A;  1D4D A;  4OPD A;  3V3O A;  4Z44 A;  4BK1 A;  2YM1 A;  3EAN A;  4Z43 A;  2TPR A;  2XDO A;  3I6D A;  2ARD A;  2XLU A;  1ZMD A;  4RG3 A;  5BRT A;  1RYI A;  3NRN A;  3V3N A;  3AE2 A;  1M64 A;  3LZW A;  5GSN A;  1L9C A;  1L9D A;  1LPF A;  5FMH A;  1BGJ A;  4J33 A;  5HHF A;  4EMI A;  3AE9 A;  3UOY A;  5C2T A;  4H4W A;  3SGL A;  1PJ7 A;  3CPI G;  3P4Q A;  4BJY A;  2GMJ A;  4WCT A;  3R9U A;  3K30 A;  4IV9 A;  1L9E A;  5U1O A;  3RP6 A;  4EMW A;  3ALM A;  3S61 A;  2V6O A;  4XXG A;  2VOU A;  4BJZ A;  2IID A;  1TRB A;  1ZX9 A;  4KPR A;  1GRE A;  4OCG A;  3KPK A;  1DNC A;  3NYC A;  2YLZ A;  1FEC A;  1PXA A;  4OPL A;  4USR A;  4AP3 A;  2XFN A;  4K2X A;  3NTA A;  3CGD A;  2CFY A;  5FS6 A;  3T14 A;  2FJA A;  1D4C A;  2GR2 A;  1N4U A;  3H8L A;  3HYX A;  4G6G A;  4B69 A;  3URH A;  3CN8 A;  3I3L A;  1H86 A;  3NK1 X;  5KMR A;  2EQ6 A;  4TM1 A;  4UDP A;  2AR8 A;  3CMM A;  5BUL A;  3UOZ A;  1B5Q A;  4NEV A;  3UKF A;  1PBE A;  3LZX A;  1FL2 A;  2FJE A;  2WQY A;  2BK4 A;  3FPZ A;  1GES A;  4JQ9 A;  5HYM A;  1CF3 A;  1XHC A;  1GOS A;  4B1B A;  1ELI A;  4NZH A;  1Y56 B;  1ZOV A;  1RP0 A;  3ADA B;  4CNJ A;  2QA1 A;  4HA6 A;  2RAB A;  4Y4M A;  2NVK X;  5EB5 A;  2BA9 A;  2X99 A;  4H4R A;  3ATQ A;  2YVJ A;  3NK0 X;  1IUS A;  3AYI A;  2VZ2 A;  4K5R A;  1NG3 A;  3GD3 A;  4ICY A;  4RSL A;  1F8R A;  2GQF A;  2BC0 A;  3GWF A;  4TLZ A;  2A8X A;  1FEB A;  4AT2 A;  1ZOY A;  3BNM A;  1ZMC A;  1FCD A;  2Y6R A;  2Z5X A;  3C4N A;  3IWA A;  3LB8 A;  5DBJ A;  4K7Z A;  2BCP A;  4NWZ A;  5U25 A;  1N1P A;  2FJD A;  1GTE A;  2BYB A;  3GDP A;  5KMQ A;  4E0V A;  3AE7 A;  4X9M A;  1K4Q A;  2GAH B;  2AAQ A;  1CJC A;  2YM2 A;  2B9Y A;  3KPF A;  4GF7 A;  2J3N A;  5IPY A;  5L46 A;  1CL0 A;  1H81 A;  2BCG G;  1LV0 A;  1UKV G;  4ZN0 A;  5M0Z A;  1P2H A;  2WBA A;  1YQ4 A;  4H4Y A;  4U8J A;  3G5S A;  3RHA A;  2EQ9 A;  3FG2 P;  3CPH G;  1Q1R A;  3SFD A;  4GR1 A;  4EM3 A;  3AEF A;  3LXD A;  3NHO X;  4H4T A;  2XFO A;  2QCU A;  1D4E A;  2GRT A;  3KLJ A;  1BZL A;  4J36 A;  1GPE A;  4Z2R A;  3DA1 A;  2WOW A;  3SZC A;  3UP4 A;  4EQW A;  2EQ8 A;  4I58 A;  3DJG X;  3CGB A;  3RP7 A;  4EQX A;  2JK6 A;  2WPC A;  4A5L A;  4U8O A;  3QVP A;  5JCN A;  5IQ4 A;  5FS8 A;  1FEA A;  2C4C A;  5KXJ A;  1NPX A;  2CUL A;  2R0C A;  1VG0 A;  4G6H A;  4JNA A;  2APG A;  3SZ0 A;  1GRB A;  2OAM A;  3ITJ A;  4H50 A;  2ZZ0 A;  3PS9 A;  4CCR A;  1JRZ A;  1LTX R;  3L8K A;  1KDG A;  1OJC A;  1PN0 A;  3C96 A;  1IUV A;  4U8M A;  3VRD B;  4HB9 A;  4G73 A;  4YSY A;  4B63 A;  3BI5 A;  1H83 A;  1XDI A;  3ZDN A;  4A99 A;  4J31 A;  3ALJ A;  4YKG A;  4B68 A;  4AOS A;  3DK9 A;  3AEA A;  2RGH A;  2XVH A;  4FX9 A;  3G5R A;  3AE4 A;  1M6I A;  1O95 A;  4Z25 A;  4H4V A;  4UDQ A;  1RSG A;  1B8S A;  1GXF A;  1EL5 A;  1GET A;  3T2K A;  2WOI A;  4Z2T A;  1YY5 A;  2R9Z A;  2RGJ A;  3AEC A;  2GH5 A;  2R0P A;  1IJH A;  3F8P A;  4RG4 A;  5TR3 A;  2QAE A;  3BHF A;  1PJ6 A;  2JB1 A;  1JNR A;  2BAC A;  2YG7 A;  2C67 A;  2GR1 A;  2Z5Y A;  2E1M A;  3M0O A;  4LII A;  2WP6 A;  4YT0 A;  2XLS A;  1QJD A;  2O9Z A; 
#chains in the Genus database with same CATH homology
 3AB1 A;  2X8G A;  4GAV A;  3SZW A;  3NTD A;  2XLT A;  4OVI A;  5FS9 A;  2C7G A;  2GV8 A;  2OLN A;  1PHH A;  3AEE A;  4EQS A;  3DK4 A;  2C72 A;  1DOD A;  3L1R A;  1E1L A;  1Y56 A;  3AE6 A;  4AT0 A;  1KF6 A;  3ICT A;  1ZY8 A;  3IC9 A;  2YG3 A;  3UKQ A;  5U63 A;  1H6V A;  3AYJ A;  2C66 A;  4PAB A;  3WE0 A;  3C4A A;  3AWI A;  4YXD A;  2C75 A;  4GDE A;  2XCG A;  3NT6 A;  4DGK A;  3NYE A;  3QSM A;  3DGH A;  1EL9 A;  4FDC B;  3P1W A;  3ABV A;  3DK8 A;  1GSN A;  1Z6L A;  3NYF A;  3SY4 A;  2VQB A;  1GER A;  2XVE A;  1PBF A;  4PAA A;  2XYO A;  4GAP A;  1DOE A;  3T0K A;  4A9W A;  1S2Q A;  3GDN A;  1O94 A;  2Y6Q A;  3CTY A;  1Y0P A;  2JB3 A;  3P9U A;  3UTE A;  2WES A;  2UZZ A;  1E39 A;  4H4Q A;  4YKF A;  3DJD A;  2GVC A;  4ECH A;  4U8I A;  3PVC A;  3GD4 A;  4OPI A;  1GRT A;  3OZ2 A;  4OPU A;  1TYP A;  1HYU A;  2YAU A;  4OPC A;  3M13 A;  4H4S A;  1N4W A;  2VVM A;  1LJ1 A;  3ATR A;  3NGC X;  4O5Q A;  1VQW A;  4BUR A;  1OJ9 A;  2Q0K A;  4U8K A;  2B9X A;  3VQR A;  3UOV A;  4D03 A;  3GRS A;  4GUV A;  3D1C A;  3LAD A;  3T2Y A;  3ICR A;  2FJB A;  2ZBW A;  5KOW A;  1E1N A;  4DSH A;  4P9S A;  2R0G A;  2YG4 A;  5CKU A;  2XVJ A;  2YR4 A;  2ZZB A;  4G74 A;  1OJT A;  2YR5 A;  4A6N A;  4N9X A;  5EOW A;  2X50 A;  4J2W A;  1DJN A;  3M12 A;  1YKJ A;  2WET A;  4H2P A;  1PS9 A;  3AED A;  3AXB A;  5ER0 A;  5M10 A;  4C3Y A;  2WDV A;  1TYT A;  1ONF A;  4EIQ A;  1H7W A;  1S3B A;  3E1T A;  3AE5 A;  2YVG A;  4J34 A;  4B64 A;  1X31 B;  5IQ1 A;  3AD7 B;  1K0L A;  1E7P A;  1DXL A;  1NHP A;  4TM3 A;  3NIX A;  4XWR A;  2XFP A;  4A7A A;  1KNR A;  4U8P A;  5J60 A;  2C73 A;  4GDP A;  2H88 A;  3BHK A;  4JN9 A;  1PXC A;  1TDF A;  2WU5 A;  1K0J A;  3CNS A;  3NN0 X;  5KVI A;  3B6D A;  4U8N A;  4REK A;  4JDR A;  4TM0 A;  5KVH A;  3LJP A;  4M52 A;  2C70 A;  1IUT A;  3QFB A;  1H84 A;  1COY A;  3QSE A;  5J7X A;  2A87 A;  1PBB A;  1D7L A;  4Z2U A;  1B4V A;  1MO9 A;  2E4G A;  2PYX A;  3GYJ A;  3KU9 A;  1K0I A;  4CY8 A;  4YWO A;  3B3R A;  3P4P A;  3VR9 A;  3CGC A;  1FOH A;  2WDQ A;  2BS2 A;  3EPT A;  3Q9T A;  2YQU A;  2X8C A;  1BKW A;  4I59 A;  1CC2 A;  1Q1W A;  4II2 A;  1DJQ A;  3VR8 A;  3AE3 A;  2I0Z A;  3NNE A;  1IUW A;  4CBQ A;  2VRL A;  1VDC A;  3KA7 A;  3SFE A;  2WP5 A;  3UTF A;  2BAB A;  4IA5 A;  3DH9 A;  1E6E A;  1GRH A;  3UOX A;  2X8H A;  1F8W A;  3CPJ G;  3KD9 A;  3RNM A;  1BGN A;  4YTP A;  2X3N A;  4ZCC A;  1XAN A;  2XLP A;  3BI4 A;  5BUK A;  4BK2 A;  4O5U A;  3CNP A;  3T2Z A;  2BS4 A;  4UP3 A;  3GYI A;  4K5S A;  3CNJ A;  1F6M A;  4MJW A;  4YSZ A;  1DOB A;  4IA6 A;  4USQ A;  2CVJ A;  1KSS A;  1V59 A;  3K7Q X;  1BF3 A;  2YLS A;  4B66 A;  5KMS A;  2BK5 A;  2XVI A;  4ADW A;  3FMW A;  2GB0 A;  2HQM A;  2F5Z A;  1KNP A;  1PXB A;  3GRT A;  4EMJ A;  2YR6 A;  1NAA A;  1REO A;  4X9N A;  5HXI A;  4Z24 A;  1GTH A;  4CNK A;  2IVE A;  5HY5 A;  3OC4 A;  3K7M X;  3T37 A;  4A79 A;  3ICS A;  4C5O A;  4LU6 A;  2VVL G;  3H4K A;  1GT8 A;  1PBC A;  4H2R A;  1LQT A;  1JOA A;  3D8X A;  3KKJ A;  4NTC A;  3RP8 A;  2QA2 A;  2V61 A;  2NPX A;  3COX A;  1GRA A;  2WP9 A;  2GAG B;  3IHG A;  2YLW A;  1VRQ B;  3UKA A;  1Q9I A;  1GEU A;  3UKH A;  5C3J A;  1PJ5 A;  2BRY A;  2WOV A;  1H7X A;  1BWC A;  3AD8 B;  3EF6 A;  3BNU A;  2V5Z A;  2RGO A;  3CNT A;  1NHR A;  1F3P A;  2GR3 A;  3FIM B;  1F8S A;  2VRM A;  4UDR A;  4J57 A;  4H4Z A;  2C64 A;  3DME A;  2C3C A;  3T31 A;  2YLR A;  4ZCD A;  1CJ3 A;  1LVL A;  1MXT A;  4H4U A;  4C74 A;  2YLT A;  3HYV A;  4YSH A;  1GRF A;  3GSI A;  4CY6 A;  2WPF A;  1NG4 A;  1D7Y A;  2GF3 A;  3P4S A;  2GQW A;  1XPQ A;  4IVO B;  4NTE A;  1S2Y A;  2YG6 A;  4TLX A;  1N4V A;  2PHH A;  3NH3 X;  4IVM B;  1EBD A;  2WS3 A;  2E5V A;  1KSU A;  3ALL A;  3QVR A;  5JCK A;  2WDR A;  1E1M A;  2WU2 A;  1CHU A;  4KX6 A;  5KRQ A;  3NG7 X;  4H7U A;  1ZDL A;  3HYW A;  4NEW A;  3AEB A;  3DJE A;  5FS7 A;  1ZK7 A;  3AD9 B;  4YTN A;  3RED A;  1CJ2 A;  1IUU A;  1QLB A;  4AOX A;  5GRT A;  1O5W A;  1EL8 A;  4K8D A;  2W0H A;  2R4E A;  4XWZ A;  2YLX A;  3IHM A;  2FBW A;  1YQ3 A;  2JBV A;  4C3X A;  1B37 A;  2R45 A;  3CGE A;  2XVF A;  2AQJ A;  1IUX A;  5BVA A;  3II4 A;  3VRA A;  2XLR A;  3UKL A;  1OJA A;  4FK1 C;  4U8L A;  3HZL A;  4H2N A;  2B76 A;  1NEN A;  2V3B A;  3SM8 A;  1JEH A;  2TMD A;  4JNQ A;  1VG9 A;  4GCM A;  3F8R A;  2JB2 A;  3QSS A;  2A89 A;  2DKH A;  4EIP A;  2GMH A;  1NHS A;  2V60 A;  1PBD A;  4YTM A;  5CQF A;  4NTD A;  2H89 A;  4CRT A;  4U2T A;  5JCL A;  3NN6 X;  1CC4 A;  3GWD A;  4U2S A;  2Q7V A;  3NK2 X;  3SZF A;  3K7T A;  2IVD A;  4D04 A;  1GRG A;  3DGZ A;  4A65 A;  4II3 A;  3GMC A;  4JY3 A;  3UKK A;  1JNZ A;  1OJD A;  1YQZ A;  3Q6J A;  4BV6 A;  2OLO A;  3CND A;  1KFY A;  4CCQ A;  4EM4 A;  2VVL A;  3PO7 A;  1SEZ A;  2YWL A;  4U2L A;  4WX1 A;  1H82 A;  3AEG A;  3VRB A;  4APN A;  2BXR A;  2YG5 A;  3NLC A;  1DOC A;  1TDO A;  3GMB A;  2C65 A;  1CBO A;  3BI2 A;  3EAO A;  2WHD A;  1NDA A;  4X4J A;  5JCI A;  1NHQ A;  4K22 A;  1ZKQ A;  1EL7 A;  1GND A;  4LA1 A;  1L0V A;  2BXS A;  3G5Q A;  1NEK A;  1TDE A;  3UTH A;  1P2E A;  3IF9 A;  1CJ4 A;  3UP5 A;  5KOX A;  5KWF A;  2V3A A;  3SQP A;  4H4X A;  3LOV A;  2JAE A;  2XFU A;  2DKI A;  3CIR A;  3F8D A;  4H2Q A;  2BS3 A;  1PDH A;  1W4X A;  1D5T A;  4OPG A;  3V76 A;  2B7R A;  2BK3 A;  2JKC A;  3DJJ A;  4Y4L A;  3SXI A;  4A6N B;  2B9W A;  2R4J A;  2WEU A;  3SYI A;  3H8I A;  1CC6 A;  3GYX A;  4TM4 A;  4Z26 A;  4OPT A;  3AE1 A;  1JU2 A;  2R46 A;  3S5W A;  3UKP A;  2Q0L A;  3JSK A;  1JRY A;  2XFQ A;  1JRX A;  3ISH A;  2GEW A;  4FK1 A;  2VQ7 A;  3O0H A;  4G9K A;  4YSX A;  2EQ7 A;  3KVE A;  2Q6U A;  3AYL A;  2GR0 A;  1E1K A;  2BC1 A;  3FBS A;  1TDK A;  5KNL A;  1ZP0 A;  4Y4N A;  1GV4 A;  2OAL A;  4DNA A;  2B7S A;  3SX6 A;  1GAL A;  2ACZ A;  5EBK A;  1AOG A;  4BK3 A;  1MOK A;  4J56 A;  4JY2 A;  1TDN A;  3UCL A;  3ZYX A;  5JCM A;  5KMP A;  3AE8 A;  4GRT A;  2BRA A;  1S3E A;  2WPE A;  5EB4 A;  4DSG A;  3QFA A;  4AP1 A;  2C3D A;  3NKS A;  2C76 A;  1LQU A;  2ZZC A;  4C77 A;  4EQR A;  4H4P A;  2CDU A;  1QO8 A;  3P4R A;  3QJ4 A;  4B67 A;  4B65 A;  5LV9 A;  2YVF A;  3UTG A;  4NNJ A;  2OA1 A;  1D4D A;  4OPD A;  3V3O A;  4Z44 A;  4BK1 A;  2YM1 A;  3EAN A;  4Z43 A;  2TPR A;  2XDO A;  3I6D A;  2ARD A;  2XLU A;  1ZMD A;  4RG3 A;  5BRT A;  1RYI A;  3NRN A;  3V3N A;  3AE2 A;  1M64 A;  3LZW A;  5GSN A;  1L9C A;  1L9D A;  1LPF A;  5FMH A;  1BGJ A;  4J33 A;  5HHF A;  4EMI A;  3AE9 A;  3UOY A;  5C2T A;  4H4W A;  3SGL A;  1PJ7 A;  3CPI G;  3P4Q A;  4BJY A;  2GMJ A;  4WCT A;  3R9U A;  3K30 A;  4IV9 A;  1L9E A;  5U1O A;  3RP6 A;  4EMW A;  3ALM A;  3S61 A;  2V6O A;  4XXG A;  2VOU A;  4BJZ A;  2IID A;  1TRB A;  1ZX9 A;  4KPR A;  1GRE A;  4OCG A;  3KPK A;  1DNC A;  3NYC A;  2YLZ A;  1FEC A;  1PXA A;  4OPL A;  4USR A;  4AP3 A;  2XFN A;  4K2X A;  3NTA A;  3CGD A;  2CFY A;  5FS6 A;  3T14 A;  2FJA A;  1D4C A;  2GR2 A;  1N4U A;  3H8L A;  3HYX A;  4G6G A;  4B69 A;  3URH A;  3CN8 A;  3I3L A;  1H86 A;  3NK1 X;  5KMR A;  2EQ6 A;  4TM1 A;  4UDP A;  2AR8 A;  3CMM A;  5BUL A;  3UOZ A;  1B5Q A;  4NEV A;  3UKF A;  1PBE A;  3LZX A;  1FL2 A;  2FJE A;  2WQY A;  2BK4 A;  3FPZ A;  1GES A;  4JQ9 A;  5HYM A;  1CF3 A;  1XHC A;  1GOS A;  4B1B A;  1ELI A;  4NZH A;  1Y56 B;  1ZOV A;  1RP0 A;  3ADA B;  4CNJ A;  2QA1 A;  4HA6 A;  2RAB A;  4Y4M A;  2NVK X;  5EB5 A;  2BA9 A;  2X99 A;  4H4R A;  3ATQ A;  2YVJ A;  3NK0 X;  1IUS A;  3AYI A;  2VZ2 A;  4K5R A;  1NG3 A;  3GD3 A;  4ICY A;  4RSL A;  1F8R A;  2GQF A;  2BC0 A;  3GWF A;  4TLZ A;  2A8X A;  1FEB A;  4AT2 A;  1ZOY A;  3BNM A;  1ZMC A;  1FCD A;  2Y6R A;  2Z5X A;  3C4N A;  3IWA A;  3LB8 A;  5DBJ A;  4K7Z A;  2BCP A;  4NWZ A;  5U25 A;  1N1P A;  2FJD A;  1GTE A;  2BYB A;  3GDP A;  5KMQ A;  4E0V A;  3AE7 A;  4X9M A;  1K4Q A;  2GAH B;  2AAQ A;  1CJC A;  2YM2 A;  2B9Y A;  3KPF A;  4GF7 A;  2J3N A;  5IPY A;  5L46 A;  1CL0 A;  1H81 A;  2BCG G;  1LV0 A;  1UKV G;  4ZN0 A;  5M0Z A;  1P2H A;  2WBA A;  1YQ4 A;  4H4Y A;  4U8J A;  3G5S A;  3RHA A;  2EQ9 A;  3FG2 P;  3CPH G;  1Q1R A;  3SFD A;  4GR1 A;  4EM3 A;  3AEF A;  3LXD A;  3NHO X;  4H4T A;  2XFO A;  2QCU A;  1D4E A;  2GRT A;  3KLJ A;  1BZL A;  4J36 A;  1GPE A;  4Z2R A;  3DA1 A;  2WOW A;  3SZC A;  3UP4 A;  4EQW A;  2EQ8 A;  4I58 A;  3DJG X;  3CGB A;  3RP7 A;  4EQX A;  2JK6 A;  2WPC A;  4A5L A;  4U8O A;  3QVP A;  5JCN A;  5IQ4 A;  5FS8 A;  1FEA A;  2C4C A;  5KXJ A;  1NPX A;  2CUL A;  2R0C A;  1VG0 A;  4G6H A;  4JNA A;  2APG A;  3SZ0 A;  1GRB A;  2OAM A;  3ITJ A;  4H50 A;  2ZZ0 A;  3PS9 A;  4CCR A;  1JRZ A;  1LTX R;  3L8K A;  1KDG A;  1OJC A;  1PN0 A;  3C96 A;  1IUV A;  4U8M A;  3VRD B;  4HB9 A;  4G73 A;  4YSY A;  4B63 A;  3BI5 A;  1H83 A;  1XDI A;  3ZDN A;  4A99 A;  4J31 A;  3ALJ A;  4YKG A;  4B68 A;  4AOS A;  3DK9 A;  3AEA A;  2RGH A;  2XVH A;  4FX9 A;  3G5R A;  3AE4 A;  1M6I A;  1O95 A;  4Z25 A;  4H4V A;  4UDQ A;  1RSG A;  1B8S A;  1GXF A;  1EL5 A;  1GET A;  3T2K A;  2WOI A;  4Z2T A;  1YY5 A;  2R9Z A;  2RGJ A;  3AEC A;  2GH5 A;  2R0P A;  1IJH A;  3F8P A;  4RG4 A;  5TR3 A;  2QAE A;  3BHF A;  1PJ6 A;  2JB1 A;  1JNR A;  2BAC A;  2YG7 A;  2C67 A;  2GR1 A;  2Z5Y A;  2E1M A;  3M0O A;  4LII A;  2WP6 A;  4YT0 A;  2XLS A;  1QJD A;  2O9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...