2WHDA

Barley nadph-dependent thioredoxin reductase 2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
318
structure length
318
Chain Sequence
AAPLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEGWMANDIAAGGQLTTTTDVENFPGFPTGIMGIDLMDNCRAQSVRFGTNILSETVTEVDFSARPFRVTSDSTTVLADTVVVATGAVARRLYFSGSDTYWNRGISACAVCDGAAPIFRNKPIAVIGGGDSAMEEGNFLTKYGSQVYIIHRRNTFRASKIMQARALSNPKIQVVWDSEVVEAYGGAGGGPLAGVKVKNLVTGEVSDLQVSGLFFAIGHEPATKFLNGQLELHADGYVATKPGSTHTSVEGVFAAGDVQDKKYRQAITAAGSGCMAALDAEHYLQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title Structure of Hordeum Vulgare Nadph-Dependent Thioredoxin Reductase 2. Unwinding the Reaction Mechanism.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
total genus 92
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA02
3CN8A 5GRTA 1P2HA 4YT0A 1JRYA 1NDAA 4ZN0A 4X9MA 2GRTA 3AE5A 1S3EA 5U1OA 3D8XA 3DJJA 3R9UA 4I59A 4GDPA 3RP8A 1DODA 1P2EA 4U8MA 4CBQA 3UKQA 2V3AA 4EQSA 1FL2A 3UOYA 3D1CA 4B66A 4H4YA 1CJ3A 1OJ9A 3AE7A 3EF6A 4TLXA 3CGEA 4IV9A 1IUXA 3QSMA 3SQPA 3G5QA 1BZLA 3S5WA 1M6IA 1Q1WA 3AE9A 3ALMA 4UDQA 4DSGA 2XLUA 3M12A 2GR2A 2R4JA 1ONFA 3CNTA 3FPZA 1TDNA 2R0GA 2E1MA 3II4A 3AE8A 4H2NA 4AOSA 2VZ2A 1GTEA 1TYTA 3EPTA 3CGBA 1IUVA 1KNRA 4JNQA 3UP4A 2X50A 1NHSA 1RSGA 2OA1A 3AD9B 2JB3A 3VQRA 3CNPA 4O5QA 1TDFA 2AR8A 3DK8A 3GMCA 2BK3A 1CJCA 4YKFA 1W4XA 4X9NA 5CQFA 1L9CA 4A6NA 4ECHA 2Q7VA 3L8KA 3FIMB 3OC4A 1CJ2A 1M64A 3ADAB 4OVIA 4K5SA 3LXDA 1GXFA 2IVDA 3B6DA 2B76A 5HYMA 4LA1A 4HB9A 2A8XA 1ELIA 1F8RA 1S2YA 4A6NB 4J31A 2WOWA 3GD4A 1K0LA 2OALA 2YR5A 2GF3A 3C4NA 2WETA 3NHOX 3NK1X 4OPTA 4U8OA 4A65A 1D7YA 2EQ9A 3AE1A 5HY5A 2YLWA 3SFEA 4KX6A 1ZMCA 4IVMB 3BI2A 4B68A 3URHA 1N4WA 1K4QA 1TDEA 1LQUA 3BNMA 4M52A 1GPEA 4O5UA 4BJYA 1TRBA 3ZYXA 4HA6A 1E1KA 1D4DA 2BC1A 1E39A 2GR1A 1NPXA 4JN9A 3UKKA 4EQXA 1PBFA 3QFAA 2TPRA 3H8IA 5TR3A 4TM1A 3IF9A 4H4ZA 3BI4A 3COXA 2AAQA 3NH3X 2VVLG 4GCMA 1PDHA 1QO8A 1XDIA 1XPQA 3HZLA 1PXAA 2JB2A 1YQ3A 2Y6RA 3GYJA 3P4RA 4JQ9A 4U2TA 4K7ZA 2R0CA 3C4AA 1PJ6A 4YSXA 1PS9A 2BC0A 2V3BA 3FG2P 4GRTA 4K2XA 3AEEA 4H50A 3H4KA 5HXIA 3S61A 2ACZA 2FJDA 2RGHA 3VRAA 5JCKA 2AQJA 4NTDA 4U8NA 1DOBA 2DKIA 4EIPA 3UKLA 2WP9A 1X31B 2QAEA 1BF3A 3RP7A 5ER0A 2VRMA 2WU5A 4DGKA 2GVCA 3F8DA 1DOEA 3PS9A 1B4VA 4B1BA 3LB8A 3KLJA 2EQ8A 4Y4MA 2V5ZA 1GRAA 4A7AA 5FS7A 1KSUA 4CCRA 5JCLA 4IA6A 4A99A 3NRNA 4LU6A 2Q0KA 4USQA 1L9EA 1ZOYA 4WX1A 3UOZA 4J34A 4U2LA 2WDVA 4OPIA 3JSKA 2C67A 4USRA 5J60A 2WOVA 4YXDA 3CGDA 2WPFA 3I6DA 4YTMA 4Z24A 2BABA 1DJNA 4WCTA 1XANA 3REDA 2VOUA 1ZMDA 5BUKA 2YVGA 4BK2A 2WHDA 3GRTA 2FJEA 3PVCA 2Z5XA 3CPJG 4H4RA 4H2RA 2R45A 3G5SA 3UCLA 1GV4A 4K8DA 2OAMA 2YLRA 4EQRA 1O5WA 2V60A 3P4PA 2YLXA 1GRFA 2DKHA 2B9WA 2GV8A 4CNJA 1TYPA 5KXJA 2WDQA 1ZK7A 4Z2UA 2E4GA 3ISHA 2GR0A 5HHFA 2WOIA 2YLZA 4GF7A 4K5RA 3KU9A 4EQWA 3V76A 2BACA 2BYBA 1EBDA 1AOGA 4OPUA 5FS8A 3WE0A 1REOA 2VQBA 3DJEA 2ZBWA 3AE3A 3DK9A 2C66A 3NT6A 3Q6JA 4H7UA 5JCNA 3UKAA 1DJQA 2YG6A 1TDOA 2J3NA 3DJGX 3DH9A 2GQFA 4H2PA 5KVIA 5U25A 2XVEA 3GD3A 4EMWA 1DNCA 2YG3A 3AEFA 1F8WA 5BVAA 4YSYA 2Z5YA 3NYCA 3SGLA 3GMBA 1F8SA 2B9YA 3ALLA 1UKVG 3NN0X 1E1NA 1JU2A 4N9XA 2ARDA 3ATRA 1IUSA 1RYIA 1E1MA 3AEBA 1SEZA 3DK4A 3VRBA 1FECA 2BCPA 4XWZA 2XFUA 3AWIA 4MJWA 3DGZA 1PBBA 3P1WA 4NTCA 3NK2X 4H4SA 3UTEA 3NTAA 1JRZA 1GALA 3UKFA 1NHRA 3AB1A 4UP3A 3FMWA 4A79A 1L9DA 2XCGA 2WESA 4EM4A 1GERA 4E0VA 4YSZA 5JCIA 1B5QA 1N4UA 2YG4A 2VRLA 2BXRA 2RGJA 4I58A 2XVFA 1D4CA 1F6MA 2RABA 2GH5A 3ITJA 3P9UA 1PHHA 1E6EA 2WU2A 5DBJA 2B7RA 5CKUA 3AEDA 2BK5A 1PBEA 4TM0A 4D04A 2B7SA 1N1PA 2W0HA 3EAOA 2OLOA 1MXTA 2GQWA 4H4VA 4CRTA 4EMIA 1KNPA 1ZOVA 4H4QA 4B63A 4JY2A 1H84A 3UKPA 1ZP0A 2BS2A 1H86A 3BHKA 3LJPA 1JNRA 3ICRA 1OJAA 2YLTA 1NHQA 3NLCA 3O0HA 3CTYA 1IJHA 2QA1A 2GB0A 4NTEA 2CDUA 4AP3A 1LVLA 4D03A 4YWOA 1JRXA 4OPGA 3AD8B 2X8HA 1CF3A 2YG5A 4J57A 3RHAA 3V3OA 1Q9IA 3QVPA 4DNAA 2Y6QA 4NEVA 1ZKQA 3NG7X 1Y56A 2V61A 4U8JA 2UZZA 4TM4A 2C3CA 2FJAA 1ZDLA 4U8PA 2GMJA 4OCGA 3GWFA 1NG3A 1NAAA 4Z43A 2VVMA 3QJ4A 1CC6A 1H81A 4CY8A 3CIRA 3GRSA 1EL9A 1KFYA 2CFYA 2YR6A 3UOVA 2EQ7A 3AYIA 1Y56B 2Q6UA 3IC9A 4B65A 1Q1RA 3ICSA 2XFPA 1H82A 3UTHA 2IVEA 4J33A 1QJDA 1GSNA 1O95A 2YM2A 2Q0LA 3NYEA 3CPHG 2GAHB 1GREA 3NTDA 1VDCA 2X8CA 4NZHA 1K0IA 3UOXA 3IWAA 3KA7A 3GWDA 1BWCA 1IUWA 3BNUA 3DA1A 1TDKA 5J7XA 4P9SA 3AE4A 2C7GA 3UTFA 4ZCCA 1HYUA 4Z44A 3SM8A 1Y0PA 2YWLA 2FBWA 2VQ7A 3GYIA 4FDCB 4C3YA 1GT8A 1OJTA 3NGCX 2WQYA 3RNMA 4ADWA 2XFQA 2XYOA 1YQZA 4Z2RA 2H88A 2IIDA 3AD7B 2ZZBA 3DJDA 4GUVA 4X4JA 1DXLA 2X8GA 2XFOA 3DMEA 5GSNA 1PBDA 2OLNA 3AE2A 1BGNA 4C3XA 4UDRA 4H4TA 5KOXA 1YKJA 4JDRA 1FCDA 4GDEA 4ZCDA 1ZY8A 4Y4NA 5M10A 2NPXA 2QA2A 2XVIA 3LOVA 4DSHA 3AEGA 3SFDA 4JNAA 1GRGA 3DGHA 1PXCA 3T37A 2JAEA 3QVRA 4OPDA 2YAUA 5L46A 4AP1A 2JK6A 3BI5A 5FS6A 4TM3A 4BK1A 2I0ZA 1K0JA 3GSIA 3H8LA 1KDGA 1GESA 1E1LA 1B8SA 4H2QA 4B69A 4B67A 3QSEA 1JOAA 3CNJA 3F8PA 3AE6A 1PJ5A 1GNDA 3NYFA 4EIQA 4A5LA 1VG0A 4H4PA 5KOWA 4ICYA 1D7LA 2ZZ0A 2RGOA 2BS4A 3AYLA 5EOWA 3NNEA 3VRDB 4C77A 1GTHA 1VQWA 2R9ZA 4J56A 1CHUA 3M13A 1BGJA 2WEUA 2YR4A 3LADA 1IUUA 1MOKA 3BHFA 3KD9A 2ZZCA 1OJCA 2XLTA 2VVLA 1D4EA 4J36A 1H7XA 1Z6LA 3NK0X 4YKGA 1YY5A 2HQMA 4K22A 1GETA 3ICTA 3ZDNA 4FK1A 1PJ7A 4Z26A 1RP0A 5IQ1A 1FOHA 3B3RA 3E1TA 4GR1A 1KF6A 3KKJA 1NENA 3OZ2A 5U63A 2F5ZA 4A9WA 3NIXA 1LTXR 4AT0A 3L1RA 3KVEA 2GMHA 4OPCA 5JCMA 2R0PA 5EB4A 3CGCA 3M0OA 4Z2TA 2BK4A 3QFBA 4IVOB 1MO9A 1L0VA 5FMHA 3GDNA 2YLSA 1CJ4A 2CVJA 2WPEA 4YTNA 1GRBA 1VRQB 2C64A 2APGA 2C3DA 2X3NA 4XXGA 1H6VA 2WPCA 1D5TA 1GRHA 3UTGA 4H4XA 4BJZA 2YG7A 4C5OA 3AXBA 2B9XA 1IUTA 2BXSA 2C75A 3NN6X 3LZWA 1NG4A 2EQ6A 2YVJA 2GAGB 3IHMA 1LPFA 2GR3A 4B64A 5BRTA 1CL0A 3QSSA 1OJDA 3IHGA 1GEUA 3CPIG 2E5VA 2QCUA 2V6OA 3AYJA 4J2WA 4BV6A 4BURA 4YTPA 1PN0A 4H4WA 3ATQA 2C70A 1B37A 2XLRA 4Z25A 1NHPA 3CNDA 4JY3A 1H7WA 2CULA 3GDPA 4XWRA 1ZX9A 2BS3A 3EANA 1QLBA 1DOCA 5KWFA 1EL8A 2BCGG 2R4EA 3KPFA 1CC2A 1FEAA 4KPRA 1S3BA 1NEKA 2XDOA 4RSLA 1S2QA 2C72A 2FJBA 1JEHA 4U2SA 3UKHA 1KSSA 1PXBA 3NKSA 1XHCA 3P4SA 3G5RA 1E7PA 3PO7A 4PAAA 4FX9A 1PBCA 1V59A 2JBVA 4NEWA 4RG4A 2C65A 1BKWA 4U8IA 3V3NA 4EM3A 2WBAA 2H89A 1GOSA 3F8RA 4YSHA 1LV0A 5IQ4A 2A89A 3I3LA 3CNSA 5EBKA 3K30A 4H4UA 4AOXA 4IA5A 2WP6A 3Q9TA 3VR8A 4CY6A 1VG9A 1H83A 2WP5A 4AT2A 2C76A 2XFNA 5BULA 2JB1A 3FBSA 1CBOA 4C74A 5FS9A 4FK1C 2C73A 2X99A 3ABVA 4OPLA 3LZXA 2XVHA 2TMDA 5M0ZA 4CNKA 4BK3A 2XLPA 1EL7A 4RG3A 3ALJA 2XVJA 2R46A 2XLSA 4CCQA 1YQ4A 4LIIA 2BA9A 2YVFA 4APNA 1COYA 4EMJA 4TLZA 1FEBA 2YM1A 5KVHA 3K7TA 1N4VA 3AECA 2JKCA 1F3PA 5C3JA 4UDPA 5IPYA 1EL5A 3K7MX 5EB5A 5C2TA 2O9ZA 2A87A 2WS3A 5KRQA 2GEWA 5LV9A 3C96A 3UP5A 2PYXA 4PABA 1LJ1A 1O94A 2YQUA 3AEAA 4REKA 1CC4A 1LQTA 2PHHA 3VR9A 1GRTA 3K7QX 2NVKX 1JNZA 2WDRA 4U8LA 4Y4LA 3RP6A 4U8KA 3P4QA
chains in the Genus database with same CATH superfamily
3CN8A 5GRTA 1P2HA 4YT0A 1JRYA 1NDAA 4ZN0A 4X9MA 3HYVA 2GRTA 3AE5A 1S3EA 5U1OA 3D8XA 3DJJA 3R9UA 4I59A 4GDPA 3RP8A 1DODA 1P2EA 4U8MA 4CBQA 3KPKA 3UKQA 2V3AA 4EQSA 1FL2A 3UOYA 3D1CA 4B66A 4H4YA 1CJ3A 1OJ9A 3AE7A 3EF6A 4TLXA 3CGEA 4IV9A 1IUXA 3QSMA 2BRAA 3SQPA 3G5QA 1BZLA 3HYXA 3S5WA 1M6IA 1Q1WA 3AE9A 3ALMA 4UDQA 4DSGA 2XLUA 3CMMA 3M12A 2GR2A 2R4JA 1ONFA 3CNTA 3FPZA 1TDNA 2R0GA 2E1MA 3II4A 3AE8A 4H2NA 4AOSA 2VZ2A 1GTEA 1TYTA 3SXIA 3EPTA 3CGBA 1IUVA 1KNRA 4JNQA 3UP4A 2X50A 1NHSA 1RSGA 2OA1A 3AD9B 2JB3A 3VQRA 3CNPA 4O5QA 1TDFA 2AR8A 3DK8A 3GMCA 2BK3A 1CJCA 4YKFA 1W4XA 4X9NA 5CQFA 1L9CA 4A6NA 4ECHA 2Q7VA 3L8KA 3FIMB 3OC4A 1CJ2A 1M64A 3ADAB 3T31A 4OVIA 4K5SA 3LXDA 1GXFA 2IVDA 3B6DA 2B76A 5HYMA 4LA1A 4HB9A 2A8XA 3SZCA 3T2ZA 4NWZA 4G9KA 1ELIA 1F8RA 1S2YA 4A6NB 4GAVA 4J31A 2WOWA 3GD4A 1K0LA 2OALA 2YR5A 2GF3A 3C4NA 2WETA 3NHOX 3NK1X 4OPTA 4U8OA 4A65A 1D7YA 2EQ9A 3AE1A 5HY5A 2YLWA 3SFEA 4KX6A 1ZMCA 4IVMB 3BI2A 4B68A 3URHA 1N4WA 1K4QA 1TDEA 1LQUA 3BNMA 4M52A 1GPEA 4O5UA 4BJYA 1TRBA 3ZYXA 4HA6A 1E1KA 1D4DA 2BC1A 1E39A 2GR1A 1NPXA 4JN9A 3UKKA 5KMQA 1PBFA 4EQXA 3QFAA 4G74A 2TPRA 3H8IA 5TR3A 4TM1A 3IF9A 4H4ZA 3SZFA 3BI4A 3COXA 2AAQA 3NH3X 2VVLG 4GCMA 1PDHA 1QO8A 1XDIA 1XPQA 3HZLA 1PXAA 2JB2A 1YQ3A 2Y6RA 3GYJA 3P4RA 4JQ9A 4U2TA 4K7ZA 2R0CA 3C4AA 1PJ6A 4YSXA 1PS9A 2BC0A 2V3BA 3FG2P 4GRTA 4K2XA 3AEEA 4H50A 3H4KA 2C4CA 5HXIA 3S61A 2ACZA 2FJDA 2RGHA 3VRAA 5JCKA 2AQJA 4NTDA 4U8NA 5KNLA 1DOBA 2DKIA 3T2KA 4EIPA 3UKLA 2WP9A 1X31B 2QAEA 1BF3A 3RP7A 5ER0A 2VRMA 2WU5A 4DGKA 2GVCA 3F8DA 1DOEA 3PS9A 1B4VA 4B1BA 3LB8A 3KLJA 2EQ8A 4Y4MA 2V5ZA 1GRAA 4A7AA 5FS7A 1KSUA 4CCRA 5JCLA 4IA6A 4A99A 3NRNA 4LU6A 2Q0KA 4USQA 1L9EA 4G6HA 1ZOYA 4WX1A 3UOZA 4J34A 4U2LA 2WDVA 4II3A 4OPIA 3JSKA 3GYXA 2C67A 5KMSA 4USRA 5J60A 2WOVA 4YXDA 3CGDA 2WPFA 3I6DA 5KMRA 4YTMA 4Z24A 2BABA 1DJNA 4WCTA 1XANA 3REDA 2VOUA 1ZMDA 5BUKA 2YVGA 4BK2A 2WHDA 3GRTA 2FJEA 3PVCA 2Z5XA 4NNJA 3CPJG 4H4RA 4H2RA 2R45A 3G5SA 3UCLA 1GV4A 4K8DA 2OAMA 2YLRA 4EQRA 1O5WA 2V60A 3P4PA 4GAPA 2YLXA 1GRFA 2DKHA 2B9WA 2GV8A 4CNJA 1TYPA 5KXJA 2WDQA 1ZK7A 4Z2UA 2E4GA 3SZ0A 3ISHA 2GR0A 5HHFA 2WOIA 2YLZA 4GF7A 4K5RA 3KU9A 4EQWA 3V76A 2BACA 2BYBA 1EBDA 1AOGA 4OPUA 5FS8A 3WE0A 1REOA 2VQBA 3DJEA 2ZBWA 3AE3A 3DK9A 2C66A 3NT6A 3Q6JA 4H7UA 5JCNA 3UKAA 1DJQA 2YG6A 1TDOA 2J3NA 3DJGX 3DH9A 2GQFA 4H2PA 5KVIA 5U25A 2XVEA 3GD3A 4EMWA 1DNCA 2YG3A 3AEFA 1F8WA 5BVAA 4YSYA 2Z5YA 3NYCA 3SGLA 3GMBA 1F8SA 2B9YA 3ALLA 1UKVG 3NN0X 1E1NA 1JU2A 4N9XA 2ARDA 3ATRA 1IUSA 1RYIA 1E1MA 3AEBA 1SEZA 3DK4A 3VRBA 1FECA 2BCPA 4XWZA 2XFUA 3AWIA 4MJWA 3DGZA 1PBBA 3P1WA 4NTCA 3NK2X 4H4SA 3UTEA 3NTAA 1JRZA 1GALA 3UKFA 1NHRA 3AB1A 4UP3A 3FMWA 4A79A 1L9DA 2XCGA 2WESA 4EM4A 1GERA 4E0VA 4YSZA 5JCIA 1B5QA 1N4UA 2YG4A 2VRLA 2BXRA 2RGJA 4I58A 2XVFA 1D4CA 1F6MA 2RABA 2GH5A 3ITJA 3P9UA 1PHHA 1E6EA 2WU2A 5DBJA 2B7RA 5CKUA 3AEDA 2BK5A 1PBEA 4TM0A 4D04A 2B7SA 1N1PA 2W0HA 3EAOA 2OLOA 1MXTA 2GQWA 4H4VA 4CRTA 4EMIA 1KNPA 1ZOVA 4H4QA 4B63A 4JY2A 1H84A 3UKPA 1ZP0A 2BS2A 1H86A 3BHKA 3LJPA 1JNRA 3ICRA 1OJAA 2YLTA 1NHQA 3NLCA 3O0HA 3CTYA 1IJHA 2QA1A 2GB0A 4NTEA 2CDUA 4AP3A 1LVLA 4D03A 4YWOA 1JRXA 4OPGA 3AD8B 2X8HA 1CF3A 2YG5A 4J57A 3RHAA 3V3OA 1Q9IA 3QVPA 4DNAA 2Y6QA 4NEVA 1ZKQA 3NG7X 3SY4A 1Y56A 2V61A 4U8JA 2UZZA 4TM4A 2C3CA 2FJAA 1ZDLA 4U8PA 2GMJA 4OCGA 3GWFA 1NG3A 1NAAA 4Z43A 2VVMA 3QJ4A 1CC6A 1H81A 4CY8A 3CIRA 3GRSA 1EL9A 1KFYA 2CFYA 2YR6A 3UOVA 2EQ7A 3AYIA 1Y56B 2Q6UA 3IC9A 4B65A 1Q1RA 3ICSA 2XFPA 1H82A 3UTHA 2IVEA 4J33A 1QJDA 1GSNA 1O95A 2YM2A 2Q0LA 3NYEA 3CPHG 2GAHB 1GREA 3NTDA 1VDCA 2X8CA 4NZHA 1K0IA 3UOXA 3IWAA 3T2YA 3KA7A 3GWDA 1BWCA 1IUWA 3BNUA 3DA1A 1TDKA 5J7XA 4P9SA 3AE4A 2C7GA 3UTFA 4ZCCA 1HYUA 4Z44A 3SM8A 1Y0PA 2YWLA 2FBWA 2VQ7A 3SX6A 3GYIA 4FDCB 4C3YA 1GT8A 1OJTA 3NGCX 2WQYA 3RNMA 4ADWA 2XFQA 2XYOA 1YQZA 4Z2RA 2H88A 2IIDA 3AD7B 2ZZBA 3DJDA 4GUVA 4X4JA 1DXLA 2X8GA 2XFOA 3DMEA 5GSNA 1PBDA 2OLNA 3AE2A 1BGNA 4C3XA 4UDRA 4H4TA 5KOXA 1YKJA 4JDRA 1FCDA 4GDEA 4ZCDA 1ZY8A 4Y4NA 5M10A 2NPXA 2QA2A 2XVIA 3LOVA 3T14A 5KMPA 4DSHA 3AEGA 3SFDA 4JNAA 1GRGA 3DGHA 1PXCA 3T37A 2JAEA 3QVRA 4OPDA 2YAUA 5L46A 4AP1A 2JK6A 3BI5A 5FS6A 4TM3A 4BK1A 2I0ZA 1K0JA 3GSIA 3H8LA 4G73A 1KDGA 1GESA 1E1LA 1B8SA 4H2QA 4B69A 4B67A 3QSEA 1JOAA 3CNJA 3F8PA 3AE6A 1PJ5A 1GNDA 3NYFA 4EIQA 4A5LA 1VG0A 4H4PA 5KOWA 4ICYA 1D7LA 2ZZ0A 2RGOA 2BS4A 3AYLA 5EOWA 3NNEA 3VRDB 4C77A 1GTHA 1VQWA 2R9ZA 4J56A 1CHUA 3M13A 1BGJA 2WEUA 2YR4A 3LADA 1IUUA 1MOKA 3BHFA 3KD9A 2ZZCA 1OJCA 2XLTA 2VVLA 1D4EA 4J36A 1H7XA 1Z6LA 3NK0X 4YKGA 1YY5A 2HQMA 4K22A 1GETA 3ICTA 3ZDNA 4FK1A 1PJ7A 4Z26A 1RP0A 5IQ1A 1FOHA 3B3RA 3E1TA 4GR1A 1KF6A 3KKJA 1NENA 3OZ2A 5U63A 3SZWA 2F5ZA 4A9WA 3NIXA 1LTXR 4AT0A 3L1RA 3KVEA 2GMHA 4OPCA 5JCMA 2R0PA 5EB4A 3CGCA 3M0OA 3SYIA 4Z2TA 2BK4A 3QFBA 4IVOB 1MO9A 1L0VA 5FMHA 3GDNA 2YLSA 1CJ4A 2CVJA 2WPEA 4YTNA 1GRBA 1VRQB 2C64A 2APGA 2C3DA 2X3NA 4XXGA 1H6VA 2WPCA 1D5TA 1GRHA 3UTGA 4H4XA 4BJZA 2YG7A 4C5OA 3AXBA 2B9XA 2BRYA 1IUTA 2BXSA 2C75A 3NN6X 3LZWA 1NG4A 2EQ6A 2YVJA 4II2A 2GAGB 3IHMA 1LPFA 2GR3A 4B64A 3T0KA 5BRTA 1CL0A 3QSSA 1OJDA 3IHGA 1GEUA 3CPIG 2E5VA 2QCUA 2V6OA 3AYJA 4J2WA 4BV6A 4BURA 4YTPA 1PN0A 4H4WA 3ATQA 2C70A 1B37A 2XLRA 4Z25A 1NHPA 3CNDA 4JY3A 1H7WA 2CULA 3GDPA 4XWRA 1ZX9A 2BS3A 3EANA 1QLBA 1DOCA 5KWFA 1EL8A 2BCGG 2R4EA 3KPFA 1CC2A 1FEAA 4KPRA 1S3BA 1NEKA 2XDOA 4RSLA 1S2QA 2C72A 2FJBA 1JEHA 4U2SA 3UKHA 1KSSA 1PXBA 3NKSA 1XHCA 4G6GA 3P4SA 3G5RA 1E7PA 3PO7A 4PAAA 4FX9A 1PBCA 1V59A 2JBVA 4NEWA 4RG4A 2C65A 1BKWA 4U8IA 3V3NA 4EM3A 2WBAA 2H89A 1GOSA 3F8RA 4YSHA 1LV0A 5IQ4A 2A89A 3I3LA 3CNSA 5EBKA 3K30A 4H4UA 4AOXA 4IA5A 2WP6A 3Q9TA 3VR8A 4CY6A 1VG9A 1H83A 2WP5A 4AT2A 2C76A 2XFNA 5BULA 2JB1A 3FBSA 1CBOA 4C74A 5FS9A 4FK1C 2C73A 2X99A 3ABVA 4OPLA 3LZXA 2XVHA 2TMDA 5M0ZA 4CNKA 4BK3A 2XLPA 1EL7A 4RG3A 3ALJA 2XVJA 2R46A 2XLSA 4CCQA 1YQ4A 4LIIA 2BA9A 2YVFA 4APNA 1COYA 4EMJA 3HYWA 4TLZA 1FEBA 2YM1A 5KVHA 3K7TA 1N4VA 3AECA 2JKCA 1F3PA 5C3JA 4UDPA 5IPYA 1EL5A 3K7MX 5EB5A 5C2TA 2O9ZA 2A87A 2WS3A 5KRQA 2GEWA 5LV9A 3C96A 3UP5A 2PYXA 4PABA 1LJ1A 1O94A 2YQUA 3AEAA 4REKA 1CC4A 1LQTA 2PHHA 3VR9A 1GRTA 3K7QX 2NVKX 1JNZA 2WDRA 4U8LA 4Y4LA 3RP6A 4U8KA 3P4QA
chains in the Genus database with same CATH topology
3CN8A 5GRTA 1P2HA 4YT0A 1JRYA 1NDAA 4ZN0A 4X9MA 3HYVA 2GRTA 3AE5A 1S3EA 5U1OA 3D8XA 3DJJA 3R9UA 4I59A 4GDPA 3RP8A 1DODA 1P2EA 4U8MA 4CBQA 3KPKA 3UKQA 2V3AA 4EQSA 1FL2A 3UOYA 3D1CA 4B66A 4H4YA 1CJ3A 1OJ9A 3AE7A 3EF6A 4TLXA 3CGEA 4IV9A 1IUXA 3QSMA 2BRAA 3SQPA 3G5QA 1BZLA 3HYXA 3S5WA 1M6IA 1Q1WA 3AE9A 3ALMA 4UDQA 4DSGA 2XLUA 3CMMA 3M12A 2GR2A 2R4JA 1ONFA 3CNTA 3FPZA 1TDNA 2R0GA 2E1MA 3II4A 3AE8A 4H2NA 4AOSA 2VZ2A 1GTEA 1TYTA 3SXIA 3EPTA 3CGBA 1IUVA 1KNRA 4JNQA 3UP4A 2X50A 1NHSA 1RSGA 2OA1A 3AD9B 2JB3A 3VQRA 3CNPA 4O5QA 1TDFA 2AR8A 3DK8A 3GMCA 2BK3A 1CJCA 4YKFA 1W4XA 4X9NA 5CQFA 1L9CA 4A6NA 4ECHA 2Q7VA 3L8KA 3FIMB 3OC4A 1CJ2A 1M64A 3ADAB 3T31A 4OVIA 4K5SA 3LXDA 1GXFA 2IVDA 3B6DA 2B76A 5HYMA 4LA1A 4HB9A 2A8XA 3SZCA 3T2ZA 4NWZA 4G9KA 1ELIA 1F8RA 1S2YA 4A6NB 4GAVA 4J31A 2WOWA 3GD4A 1K0LA 2OALA 2YR5A 2GF3A 3C4NA 2WETA 3NHOX 3NK1X 4OPTA 4U8OA 4A65A 1D7YA 2EQ9A 3AE1A 5HY5A 2YLWA 3SFEA 4KX6A 1ZMCA 4IVMB 3BI2A 4B68A 3URHA 1N4WA 1K4QA 1TDEA 1LQUA 3BNMA 4M52A 1GPEA 4O5UA 4BJYA 1TRBA 3ZYXA 4HA6A 1E1KA 1D4DA 2BC1A 1E39A 2GR1A 1NPXA 4JN9A 3UKKA 5KMQA 1PBFA 4EQXA 3QFAA 4G74A 2TPRA 3H8IA 5TR3A 4TM1A 3IF9A 4H4ZA 3SZFA 3BI4A 3COXA 2AAQA 3NH3X 2VVLG 4GCMA 1PDHA 1QO8A 1XDIA 1XPQA 3HZLA 1PXAA 2JB2A 1YQ3A 2Y6RA 3GYJA 3P4RA 4JQ9A 4U2TA 4K7ZA 2R0CA 3C4AA 1PJ6A 4YSXA 1PS9A 2BC0A 2V3BA 3FG2P 4GRTA 4K2XA 3AEEA 4H50A 3H4KA 2C4CA 5HXIA 3S61A 2ACZA 2FJDA 2RGHA 3VRAA 5JCKA 2AQJA 4NTDA 4U8NA 5KNLA 1DOBA 2DKIA 3T2KA 4EIPA 3UKLA 2WP9A 1X31B 2QAEA 1BF3A 3RP7A 5ER0A 2VRMA 2WU5A 4DGKA 2GVCA 3F8DA 1DOEA 3PS9A 1B4VA 4B1BA 3LB8A 3KLJA 2EQ8A 4Y4MA 2V5ZA 1GRAA 4A7AA 5FS7A 1KSUA 4CCRA 5JCLA 4IA6A 4A99A 3NRNA 4LU6A 2Q0KA 4USQA 1L9EA 4G6HA 1ZOYA 4WX1A 3UOZA 4J34A 4U2LA 2WDVA 4II3A 4OPIA 3JSKA 3GYXA 2C67A 5KMSA 4USRA 5J60A 2WOVA 4YXDA 3CGDA 2WPFA 3I6DA 5KMRA 4YTMA 4Z24A 2BABA 1DJNA 4WCTA 1XANA 3REDA 2VOUA 1ZMDA 5BUKA 2YVGA 4BK2A 2WHDA 3GRTA 2FJEA 3PVCA 2Z5XA 4NNJA 3CPJG 4H4RA 4H2RA 2R45A 3G5SA 3UCLA 1GV4A 4K8DA 2OAMA 2YLRA 4EQRA 1O5WA 2V60A 3P4PA 4GAPA 2YLXA 1GRFA 2DKHA 2B9WA 2GV8A 4CNJA 1TYPA 5KXJA 2WDQA 1ZK7A 4Z2UA 2E4GA 3SZ0A 3ISHA 2GR0A 5HHFA 2WOIA 2YLZA 4GF7A 4K5RA 3KU9A 4EQWA 3V76A 2BACA 2BYBA 1EBDA 1AOGA 4OPUA 5FS8A 3WE0A 1REOA 2VQBA 3DJEA 2ZBWA 3AE3A 3DK9A 2C66A 3NT6A 3Q6JA 4H7UA 5JCNA 3UKAA 1DJQA 2YG6A 1TDOA 2J3NA 3DJGX 3DH9A 2GQFA 4H2PA 5KVIA 5U25A 2XVEA 3GD3A 4EMWA 1DNCA 2YG3A 3AEFA 1F8WA 5BVAA 4YSYA 2Z5YA 3NYCA 3SGLA 3GMBA 1F8SA 2B9YA 3ALLA 1UKVG 3NN0X 1E1NA 1JU2A 4N9XA 2ARDA 3ATRA 1IUSA 1RYIA 1E1MA 3AEBA 1SEZA 3DK4A 3VRBA 1FECA 2BCPA 4XWZA 2XFUA 3AWIA 4MJWA 3DGZA 1PBBA 3P1WA 4NTCA 3NK2X 4H4SA 3UTEA 3NTAA 1JRZA 1GALA 3UKFA 1NHRA 3AB1A 4UP3A 3FMWA 4A79A 1L9DA 2XCGA 2WESA 4EM4A 1GERA 4E0VA 4YSZA 5JCIA 1B5QA 1N4UA 2YG4A 2VRLA 2BXRA 2RGJA 4I58A 2XVFA 1D4CA 1F6MA 2RABA 2GH5A 3ITJA 3P9UA 1PHHA 1E6EA 2WU2A 5DBJA 2B7RA 5CKUA 3AEDA 2BK5A 1PBEA 4TM0A 4D04A 2B7SA 1N1PA 2W0HA 3EAOA 2OLOA 1MXTA 2GQWA 4H4VA 4CRTA 4EMIA 1KNPA 1ZOVA 4H4QA 4B63A 4JY2A 1H84A 3UKPA 1ZP0A 2BS2A 1H86A 3BHKA 3LJPA 1JNRA 3ICRA 1OJAA 2YLTA 1NHQA 3NLCA 3O0HA 3CTYA 1IJHA 2QA1A 2GB0A 4NTEA 2CDUA 4AP3A 1LVLA 4D03A 4YWOA 1JRXA 4OPGA 3AD8B 2X8HA 1CF3A 2YG5A 4J57A 3RHAA 3V3OA 1Q9IA 3QVPA 4DNAA 2Y6QA 4NEVA 1ZKQA 3NG7X 3SY4A 1Y56A 2V61A 4U8JA 2UZZA 4TM4A 2C3CA 2FJAA 1ZDLA 4U8PA 2GMJA 4OCGA 3GWFA 1NG3A 1NAAA 4Z43A 2VVMA 3QJ4A 1CC6A 1H81A 4CY8A 3CIRA 3GRSA 1EL9A 1KFYA 2CFYA 2YR6A 3UOVA 2EQ7A 3AYIA 1Y56B 2Q6UA 3IC9A 4B65A 1Q1RA 3ICSA 2XFPA 1H82A 3UTHA 2IVEA 4J33A 1QJDA 1GSNA 1O95A 2YM2A 2Q0LA 3NYEA 3CPHG 2GAHB 1GREA 3NTDA 1VDCA 2X8CA 4NZHA 1K0IA 3UOXA 3IWAA 3T2YA 3KA7A 3GWDA 1BWCA 1IUWA 3BNUA 3DA1A 1TDKA 5J7XA 4P9SA 3AE4A 2C7GA 3UTFA 4ZCCA 1HYUA 4Z44A 3SM8A 1Y0PA 2YWLA 2FBWA 2VQ7A 3SX6A 3GYIA 4FDCB 4C3YA 1GT8A 1OJTA 3NGCX 2WQYA 3RNMA 4ADWA 2XFQA 2XYOA 1YQZA 4Z2RA 2H88A 2IIDA 3AD7B 2ZZBA 3DJDA 4GUVA 4X4JA 1DXLA 2X8GA 2XFOA 3DMEA 5GSNA 1PBDA 2OLNA 3AE2A 1BGNA 4C3XA 4UDRA 4H4TA 5KOXA 1YKJA 4JDRA 1FCDA 4GDEA 4ZCDA 1ZY8A 4Y4NA 5M10A 2NPXA 2QA2A 2XVIA 3LOVA 3T14A 5KMPA 4DSHA 3AEGA 3SFDA 4JNAA 1GRGA 3DGHA 1PXCA 3T37A 2JAEA 3QVRA 4OPDA 2YAUA 5L46A 4AP1A 2JK6A 3BI5A 5FS6A 4TM3A 4BK1A 2I0ZA 1K0JA 3GSIA 3H8LA 4G73A 1KDGA 1GESA 1E1LA 1B8SA 4H2QA 4B69A 4B67A 3QSEA 1JOAA 3CNJA 3F8PA 3AE6A 1PJ5A 1GNDA 3NYFA 4EIQA 4A5LA 1VG0A 4H4PA 5KOWA 4ICYA 1D7LA 2ZZ0A 2RGOA 2BS4A 3AYLA 5EOWA 3NNEA 3VRDB 4C77A 1GTHA 1VQWA 2R9ZA 4J56A 1CHUA 3M13A 1BGJA 2WEUA 2YR4A 3LADA 1IUUA 1MOKA 3BHFA 3KD9A 2ZZCA 1OJCA 2XLTA 2VVLA 1D4EA 4J36A 1H7XA 1Z6LA 3NK0X 4YKGA 1YY5A 2HQMA 4K22A 1GETA 3ICTA 3ZDNA 4FK1A 1PJ7A 4Z26A 1RP0A 5IQ1A 1FOHA 3B3RA 3E1TA 4GR1A 1KF6A 3KKJA 1NENA 3OZ2A 5U63A 3SZWA 2F5ZA 4A9WA 3NIXA 1LTXR 4AT0A 3L1RA 3KVEA 2GMHA 4OPCA 5JCMA 2R0PA 5EB4A 3CGCA 3M0OA 3SYIA 4Z2TA 2BK4A 3QFBA 4IVOB 1MO9A 1L0VA 5FMHA 3GDNA 2YLSA 1CJ4A 2CVJA 2WPEA 4YTNA 1GRBA 1VRQB 2C64A 2APGA 2C3DA 2X3NA 4XXGA 1H6VA 2WPCA 1D5TA 1GRHA 3UTGA 4H4XA 4BJZA 2YG7A 4C5OA 3AXBA 2B9XA 2BRYA 1IUTA 2BXSA 2C75A 3NN6X 3LZWA 1NG4A 2EQ6A 2YVJA 4II2A 2GAGB 3IHMA 1LPFA 2GR3A 4B64A 3T0KA 5BRTA 1CL0A 3QSSA 1OJDA 3IHGA 1GEUA 3CPIG 2E5VA 2QCUA 2V6OA 3AYJA 4J2WA 4BV6A 4BURA 4YTPA 1PN0A 4H4WA 3ATQA 2C70A 1B37A 2XLRA 4Z25A 1NHPA 3CNDA 4JY3A 1H7WA 2CULA 3GDPA 4XWRA 1ZX9A 2BS3A 3EANA 1QLBA 1DOCA 5KWFA 1EL8A 2BCGG 2R4EA 3KPFA 1CC2A 1FEAA 4KPRA 1S3BA 1NEKA 2XDOA 4RSLA 1S2QA 2C72A 2FJBA 1JEHA 4U2SA 3UKHA 1KSSA 1PXBA 3NKSA 1XHCA 4G6GA 3P4SA 3G5RA 1E7PA 3PO7A 4PAAA 4FX9A 1PBCA 1V59A 2JBVA 4NEWA 4RG4A 2C65A 1BKWA 4U8IA 3V3NA 4EM3A 2WBAA 2H89A 1GOSA 3F8RA 4YSHA 1LV0A 5IQ4A 2A89A 3I3LA 3CNSA 5EBKA 3K30A 4H4UA 4AOXA 4IA5A 2WP6A 3Q9TA 3VR8A 4CY6A 1VG9A 1H83A 2WP5A 4AT2A 2C76A 2XFNA 5BULA 2JB1A 3FBSA 1CBOA 4C74A 5FS9A 4FK1C 2C73A 2X99A 3ABVA 4OPLA 3LZXA 2XVHA 2TMDA 5M0ZA 4CNKA 4BK3A 2XLPA 1EL7A 4RG3A 3ALJA 2XVJA 2R46A 2XLSA 4CCQA 1YQ4A 4LIIA 2BA9A 2YVFA 4APNA 1COYA 4EMJA 3HYWA 4TLZA 1FEBA 2YM1A 5KVHA 3K7TA 1N4VA 3AECA 2JKCA 1F3PA 5C3JA 4UDPA 5IPYA 1EL5A 3K7MX 5EB5A 5C2TA 2O9ZA 2A87A 2WS3A 5KRQA 2GEWA 5LV9A 3C96A 3UP5A 2PYXA 4PABA 1LJ1A 1O94A 2YQUA 3AEAA 4REKA 1CC4A 1LQTA 2PHHA 3VR9A 1GRTA 3K7QX 2NVKX 1JNZA 2WDRA 4U8LA 4Y4LA 3RP6A 4U8KA 3P4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CN8 A;  5GRT A;  1P2H A;  4YT0 A;  1JRY A;  1NDA A;  4ZN0 A;  4X9M A;  2GRT A;  3AE5 A;  1S3E A;  5U1O A;  3D8X A;  3DJJ A;  3R9U A;  4I59 A;  4GDP A;  3RP8 A;  1DOD A;  1P2E A;  4U8M A;  4CBQ A;  3UKQ A;  2V3A A;  4EQS A;  1FL2 A;  3UOY A;  3D1C A;  4B66 A;  4H4Y A;  1CJ3 A;  1OJ9 A;  3AE7 A;  3EF6 A;  4TLX A;  3CGE A;  4IV9 A;  1IUX A;  3QSM A;  3SQP A;  3G5Q A;  1BZL A;  3S5W A;  1M6I A;  1Q1W A;  3AE9 A;  3ALM A;  4UDQ A;  4DSG A;  2XLU A;  3M12 A;  2GR2 A;  2R4J A;  1ONF A;  3CNT A;  3FPZ A;  1TDN A;  2R0G A;  2E1M A;  3II4 A;  3AE8 A;  4H2N A;  4AOS A;  2VZ2 A;  1GTE A;  1TYT A;  3EPT A;  3CGB A;  1IUV A;  1KNR A;  4JNQ A;  3UP4 A;  2X50 A;  1NHS A;  1RSG A;  2OA1 A;  3AD9 B;  2JB3 A;  3VQR A;  3CNP A;  4O5Q A;  1TDF A;  2AR8 A;  3DK8 A;  3GMC A;  2BK3 A;  1CJC A;  4YKF A;  1W4X A;  4X9N A;  5CQF A;  1L9C A;  4A6N A;  4ECH A;  2Q7V A;  3L8K A;  3FIM B;  3OC4 A;  1CJ2 A;  1M64 A;  3ADA B;  4OVI A;  4K5S A;  3LXD A;  1GXF A;  2IVD A;  3B6D A;  2B76 A;  5HYM A;  4LA1 A;  4HB9 A;  2A8X A;  1ELI A;  1F8R A;  1S2Y A;  4A6N B;  4J31 A;  2WOW A;  3GD4 A;  1K0L A;  2OAL A;  2YR5 A;  2GF3 A;  3C4N A;  2WET A;  3NHO X;  3NK1 X;  4OPT A;  4U8O A;  4A65 A;  1D7Y A;  2EQ9 A;  3AE1 A;  5HY5 A;  2YLW A;  3SFE A;  4KX6 A;  1ZMC A;  4IVM B;  3BI2 A;  4B68 A;  3URH A;  1N4W A;  1K4Q A;  1TDE A;  1LQU A;  3BNM A;  4M52 A;  1GPE A;  4O5U A;  4BJY A;  1TRB A;  3ZYX A;  4HA6 A;  1E1K A;  1D4D A;  2BC1 A;  1E39 A;  2GR1 A;  1NPX A;  4JN9 A;  3UKK A;  4EQX A;  1PBF A;  3QFA A;  2TPR A;  3H8I A;  5TR3 A;  4TM1 A;  3IF9 A;  4H4Z A;  3BI4 A;  3COX A;  2AAQ A;  3NH3 X;  2VVL G;  4GCM A;  1PDH A;  1QO8 A;  1XDI A;  1XPQ A;  3HZL A;  1PXA A;  2JB2 A;  1YQ3 A;  2Y6R A;  3GYJ A;  3P4R A;  4JQ9 A;  4U2T A;  4K7Z A;  2R0C A;  3C4A A;  1PJ6 A;  4YSX A;  1PS9 A;  2BC0 A;  2V3B A;  3FG2 P;  4GRT A;  4K2X A;  3AEE A;  4H50 A;  3H4K A;  5HXI A;  3S61 A;  2ACZ A;  2FJD A;  2RGH A;  3VRA A;  5JCK A;  2AQJ A;  4NTD A;  4U8N A;  1DOB A;  2DKI A;  4EIP A;  3UKL A;  2WP9 A;  1X31 B;  2QAE A;  1BF3 A;  3RP7 A;  5ER0 A;  2VRM A;  2WU5 A;  4DGK A;  2GVC A;  3F8D A;  1DOE A;  3PS9 A;  1B4V A;  4B1B A;  3LB8 A;  3KLJ A;  2EQ8 A;  4Y4M A;  2V5Z A;  1GRA A;  4A7A A;  5FS7 A;  1KSU A;  4CCR A;  5JCL A;  4IA6 A;  4A99 A;  3NRN A;  4LU6 A;  2Q0K A;  4USQ A;  1L9E A;  1ZOY A;  4WX1 A;  3UOZ A;  4J34 A;  4U2L A;  2WDV A;  4OPI A;  3JSK A;  2C67 A;  4USR A;  5J60 A;  2WOV A;  4YXD A;  3CGD A;  2WPF A;  3I6D A;  4YTM A;  4Z24 A;  2BAB A;  1DJN A;  4WCT A;  1XAN A;  3RED A;  2VOU A;  1ZMD A;  5BUK A;  2YVG A;  4BK2 A;  2WHD A;  3GRT A;  2FJE A;  3PVC A;  2Z5X A;  3CPJ G;  4H4R A;  4H2R A;  2R45 A;  3G5S A;  3UCL A;  1GV4 A;  4K8D A;  2OAM A;  2YLR A;  4EQR A;  1O5W A;  2V60 A;  3P4P A;  2YLX A;  1GRF A;  2DKH A;  2B9W A;  2GV8 A;  4CNJ A;  1TYP A;  5KXJ A;  2WDQ A;  1ZK7 A;  4Z2U A;  2E4G A;  3ISH A;  2GR0 A;  5HHF A;  2WOI A;  2YLZ A;  4GF7 A;  4K5R A;  3KU9 A;  4EQW A;  3V76 A;  2BAC A;  2BYB A;  1EBD A;  1AOG A;  4OPU A;  5FS8 A;  3WE0 A;  1REO A;  2VQB A;  3DJE A;  2ZBW A;  3AE3 A;  3DK9 A;  2C66 A;  3NT6 A;  3Q6J A;  4H7U A;  5JCN A;  3UKA A;  1DJQ A;  2YG6 A;  1TDO A;  2J3N A;  3DJG X;  3DH9 A;  2GQF A;  4H2P A;  5KVI A;  5U25 A;  2XVE A;  3GD3 A;  4EMW A;  1DNC A;  2YG3 A;  3AEF A;  1F8W A;  5BVA A;  4YSY A;  2Z5Y A;  3NYC A;  3SGL A;  3GMB A;  1F8S A;  2B9Y A;  3ALL A;  1UKV G;  3NN0 X;  1E1N A;  1JU2 A;  4N9X A;  2ARD A;  3ATR A;  1IUS A;  1RYI A;  1E1M A;  3AEB A;  1SEZ A;  3DK4 A;  3VRB A;  1FEC A;  2BCP A;  4XWZ A;  2XFU A;  3AWI A;  4MJW A;  3DGZ A;  1PBB A;  3P1W A;  4NTC A;  3NK2 X;  4H4S A;  3UTE A;  3NTA A;  1JRZ A;  1GAL A;  3UKF A;  1NHR A;  3AB1 A;  4UP3 A;  3FMW A;  4A79 A;  1L9D A;  2XCG A;  2WES A;  4EM4 A;  1GER A;  4E0V A;  4YSZ A;  5JCI A;  1B5Q A;  1N4U A;  2YG4 A;  2VRL A;  2BXR A;  2RGJ A;  4I58 A;  2XVF A;  1D4C A;  1F6M A;  2RAB A;  2GH5 A;  3ITJ A;  3P9U A;  1PHH A;  1E6E A;  2WU2 A;  5DBJ A;  2B7R A;  5CKU A;  3AED A;  2BK5 A;  1PBE A;  4TM0 A;  4D04 A;  2B7S A;  1N1P A;  2W0H A;  3EAO A;  2OLO A;  1MXT A;  2GQW A;  4H4V A;  4CRT A;  4EMI A;  1KNP A;  1ZOV A;  4H4Q A;  4B63 A;  4JY2 A;  1H84 A;  3UKP A;  1ZP0 A;  2BS2 A;  1H86 A;  3BHK A;  3LJP A;  1JNR A;  3ICR A;  1OJA A;  2YLT A;  1NHQ A;  3NLC A;  3O0H A;  3CTY A;  1IJH A;  2QA1 A;  2GB0 A;  4NTE A;  2CDU A;  4AP3 A;  1LVL A;  4D03 A;  4YWO A;  1JRX A;  4OPG A;  3AD8 B;  2X8H A;  1CF3 A;  2YG5 A;  4J57 A;  3RHA A;  3V3O A;  1Q9I A;  3QVP A;  4DNA A;  2Y6Q A;  4NEV A;  1ZKQ A;  3NG7 X;  1Y56 A;  2V61 A;  4U8J A;  2UZZ A;  4TM4 A;  2C3C A;  2FJA A;  1ZDL A;  4U8P A;  2GMJ A;  4OCG A;  3GWF A;  1NG3 A;  1NAA A;  4Z43 A;  2VVM A;  3QJ4 A;  1CC6 A;  1H81 A;  4CY8 A;  3CIR A;  3GRS A;  1EL9 A;  1KFY A;  2CFY A;  2YR6 A;  3UOV A;  2EQ7 A;  3AYI A;  1Y56 B;  2Q6U A;  3IC9 A;  4B65 A;  1Q1R A;  3ICS A;  2XFP A;  1H82 A;  3UTH A;  2IVE A;  4J33 A;  1QJD A;  1GSN A;  1O95 A;  2YM2 A;  2Q0L A;  3NYE A;  3CPH G;  2GAH B;  1GRE A;  3NTD A;  1VDC A;  2X8C A;  4NZH A;  1K0I A;  3UOX A;  3IWA A;  3KA7 A;  3GWD A;  1BWC A;  1IUW A;  3BNU A;  3DA1 A;  1TDK A;  5J7X A;  4P9S A;  3AE4 A;  2C7G A;  3UTF A;  4ZCC A;  1HYU A;  4Z44 A;  3SM8 A;  1Y0P A;  2YWL A;  2FBW A;  2VQ7 A;  3GYI A;  4FDC B;  4C3Y A;  1GT8 A;  1OJT A;  3NGC X;  2WQY A;  3RNM A;  4ADW A;  2XFQ A;  2XYO A;  1YQZ A;  4Z2R A;  2H88 A;  2IID A;  3AD7 B;  2ZZB A;  3DJD A;  4GUV A;  4X4J A;  1DXL A;  2X8G A;  2XFO A;  3DME A;  5GSN A;  1PBD A;  2OLN A;  3AE2 A;  1BGN A;  4C3X A;  4UDR A;  4H4T A;  5KOX A;  1YKJ A;  4JDR A;  1FCD A;  4GDE A;  4ZCD A;  1ZY8 A;  4Y4N A;  5M10 A;  2NPX A;  2QA2 A;  2XVI A;  3LOV A;  4DSH A;  3AEG A;  3SFD A;  4JNA A;  1GRG A;  3DGH A;  1PXC A;  3T37 A;  2JAE A;  3QVR A;  4OPD A;  2YAU A;  5L46 A;  4AP1 A;  2JK6 A;  3BI5 A;  5FS6 A;  4TM3 A;  4BK1 A;  2I0Z A;  1K0J A;  3GSI A;  3H8L A;  1KDG A;  1GES A;  1E1L A;  1B8S A;  4H2Q A;  4B69 A;  4B67 A;  3QSE A;  1JOA A;  3CNJ A;  3F8P A;  3AE6 A;  1PJ5 A;  1GND A;  3NYF A;  4EIQ A;  4A5L A;  1VG0 A;  4H4P A;  5KOW A;  4ICY A;  1D7L A;  2ZZ0 A;  2RGO A;  2BS4 A;  3AYL A;  5EOW A;  3NNE A;  3VRD B;  4C77 A;  1GTH A;  1VQW A;  2R9Z A;  4J56 A;  1CHU A;  3M13 A;  1BGJ A;  2WEU A;  2YR4 A;  3LAD A;  1IUU A;  1MOK A;  3BHF A;  3KD9 A;  2ZZC A;  1OJC A;  2XLT A;  2VVL A;  1D4E A;  4J36 A;  1H7X A;  1Z6L A;  3NK0 X;  4YKG A;  1YY5 A;  2HQM A;  4K22 A;  1GET A;  3ICT A;  3ZDN A;  4FK1 A;  1PJ7 A;  4Z26 A;  1RP0 A;  5IQ1 A;  1FOH A;  3B3R A;  3E1T A;  4GR1 A;  1KF6 A;  3KKJ A;  1NEN A;  3OZ2 A;  5U63 A;  2F5Z A;  4A9W A;  3NIX A;  1LTX R;  4AT0 A;  3L1R A;  3KVE A;  2GMH A;  4OPC A;  5JCM A;  2R0P A;  5EB4 A;  3CGC A;  3M0O A;  4Z2T A;  2BK4 A;  3QFB A;  4IVO B;  1MO9 A;  1L0V A;  5FMH A;  3GDN A;  2YLS A;  1CJ4 A;  2CVJ A;  2WPE A;  4YTN A;  1GRB A;  1VRQ B;  2C64 A;  2APG A;  2C3D A;  2X3N A;  4XXG A;  1H6V A;  2WPC A;  1D5T A;  1GRH A;  3UTG A;  4H4X A;  4BJZ A;  2YG7 A;  4C5O A;  3AXB A;  2B9X A;  1IUT A;  2BXS A;  2C75 A;  3NN6 X;  3LZW A;  1NG4 A;  2EQ6 A;  2YVJ A;  2GAG B;  3IHM A;  1LPF A;  2GR3 A;  4B64 A;  5BRT A;  1CL0 A;  3QSS A;  1OJD A;  3IHG A;  1GEU A;  3CPI G;  2E5V A;  2QCU A;  2V6O A;  3AYJ A;  4J2W A;  4BV6 A;  4BUR A;  4YTP A;  1PN0 A;  4H4W A;  3ATQ A;  2C70 A;  1B37 A;  2XLR A;  4Z25 A;  1NHP A;  3CND A;  4JY3 A;  1H7W A;  2CUL A;  3GDP A;  4XWR A;  1ZX9 A;  2BS3 A;  3EAN A;  1QLB A;  1DOC A;  5KWF A;  1EL8 A;  2BCG G;  2R4E A;  3KPF A;  1CC2 A;  1FEA A;  4KPR A;  1S3B A;  1NEK A;  2XDO A;  4RSL A;  1S2Q A;  2C72 A;  2FJB A;  1JEH A;  4U2S A;  3UKH A;  1KSS A;  1PXB A;  3NKS A;  1XHC A;  3P4S A;  3G5R A;  1E7P A;  3PO7 A;  4PAA A;  4FX9 A;  1PBC A;  1V59 A;  2JBV A;  4NEW A;  4RG4 A;  2C65 A;  1BKW A;  4U8I A;  3V3N A;  4EM3 A;  2WBA A;  2H89 A;  1GOS A;  3F8R A;  4YSH A;  1LV0 A;  5IQ4 A;  2A89 A;  3I3L A;  3CNS A;  5EBK A;  3K30 A;  4H4U A;  4AOX A;  4IA5 A;  2WP6 A;  3Q9T A;  3VR8 A;  4CY6 A;  1VG9 A;  1H83 A;  2WP5 A;  4AT2 A;  2C76 A;  2XFN A;  5BUL A;  2JB1 A;  3FBS A;  1CBO A;  4C74 A;  5FS9 A;  4FK1 C;  2C73 A;  2X99 A;  3ABV A;  4OPL A;  3LZX A;  2XVH A;  2TMD A;  5M0Z A;  4CNK A;  4BK3 A;  2XLP A;  1EL7 A;  4RG3 A;  3ALJ A;  2XVJ A;  2R46 A;  2XLS A;  4CCQ A;  1YQ4 A;  4LII A;  2BA9 A;  2YVF A;  4APN A;  1COY A;  4EMJ A;  4TLZ A;  1FEB A;  2YM1 A;  5KVH A;  3K7T A;  1N4V A;  3AEC A;  2JKC A;  1F3P A;  5C3J A;  4UDP A;  5IPY A;  1EL5 A;  3K7M X;  5EB5 A;  5C2T A;  2O9Z A;  2A87 A;  2WS3 A;  5KRQ A;  2GEW A;  5LV9 A;  3C96 A;  3UP5 A;  2PYX A;  4PAB A;  1LJ1 A;  1O94 A;  2YQU A;  3AEA A;  4REK A;  1CC4 A;  1LQT A;  2PHH A;  3VR9 A;  1GRT A;  3K7Q X;  2NVK X;  1JNZ A;  2WDR A;  4U8L A;  4Y4L A;  3RP6 A;  4U8K A;  3P4Q A; 
#chains in the Genus database with same CATH topology
 3CN8 A;  5GRT A;  1P2H A;  4YT0 A;  1JRY A;  1NDA A;  4ZN0 A;  4X9M A;  3HYV A;  2GRT A;  3AE5 A;  1S3E A;  5U1O A;  3D8X A;  3DJJ A;  3R9U A;  4I59 A;  4GDP A;  3RP8 A;  1DOD A;  1P2E A;  4U8M A;  4CBQ A;  3KPK A;  3UKQ A;  2V3A A;  4EQS A;  1FL2 A;  3UOY A;  3D1C A;  4B66 A;  4H4Y A;  1CJ3 A;  1OJ9 A;  3AE7 A;  3EF6 A;  4TLX A;  3CGE A;  4IV9 A;  1IUX A;  3QSM A;  2BRA A;  3SQP A;  3G5Q A;  1BZL A;  3HYX A;  3S5W A;  1M6I A;  1Q1W A;  3AE9 A;  3ALM A;  4UDQ A;  4DSG A;  2XLU A;  3CMM A;  3M12 A;  2GR2 A;  2R4J A;  1ONF A;  3CNT A;  3FPZ A;  1TDN A;  2R0G A;  2E1M A;  3II4 A;  3AE8 A;  4H2N A;  4AOS A;  2VZ2 A;  1GTE A;  1TYT A;  3SXI A;  3EPT A;  3CGB A;  1IUV A;  1KNR A;  4JNQ A;  3UP4 A;  2X50 A;  1NHS A;  1RSG A;  2OA1 A;  3AD9 B;  2JB3 A;  3VQR A;  3CNP A;  4O5Q A;  1TDF A;  2AR8 A;  3DK8 A;  3GMC A;  2BK3 A;  1CJC A;  4YKF A;  1W4X A;  4X9N A;  5CQF A;  1L9C A;  4A6N A;  4ECH A;  2Q7V A;  3L8K A;  3FIM B;  3OC4 A;  1CJ2 A;  1M64 A;  3ADA B;  3T31 A;  4OVI A;  4K5S A;  3LXD A;  1GXF A;  2IVD A;  3B6D A;  2B76 A;  5HYM A;  4LA1 A;  4HB9 A;  2A8X A;  3SZC A;  3T2Z A;  4NWZ A;  4G9K A;  1ELI A;  1F8R A;  1S2Y A;  4A6N B;  4GAV A;  4J31 A;  2WOW A;  3GD4 A;  1K0L A;  2OAL A;  2YR5 A;  2GF3 A;  3C4N A;  2WET A;  3NHO X;  3NK1 X;  4OPT A;  4U8O A;  4A65 A;  1D7Y A;  2EQ9 A;  3AE1 A;  5HY5 A;  2YLW A;  3SFE A;  4KX6 A;  1ZMC A;  4IVM B;  3BI2 A;  4B68 A;  3URH A;  1N4W A;  1K4Q A;  1TDE A;  1LQU A;  3BNM A;  4M52 A;  1GPE A;  4O5U A;  4BJY A;  1TRB A;  3ZYX A;  4HA6 A;  1E1K A;  1D4D A;  2BC1 A;  1E39 A;  2GR1 A;  1NPX A;  4JN9 A;  3UKK A;  5KMQ A;  1PBF A;  4EQX A;  3QFA A;  4G74 A;  2TPR A;  3H8I A;  5TR3 A;  4TM1 A;  3IF9 A;  4H4Z A;  3SZF A;  3BI4 A;  3COX A;  2AAQ A;  3NH3 X;  2VVL G;  4GCM A;  1PDH A;  1QO8 A;  1XDI A;  1XPQ A;  3HZL A;  1PXA A;  2JB2 A;  1YQ3 A;  2Y6R A;  3GYJ A;  3P4R A;  4JQ9 A;  4U2T A;  4K7Z A;  2R0C A;  3C4A A;  1PJ6 A;  4YSX A;  1PS9 A;  2BC0 A;  2V3B A;  3FG2 P;  4GRT A;  4K2X A;  3AEE A;  4H50 A;  3H4K A;  2C4C A;  5HXI A;  3S61 A;  2ACZ A;  2FJD A;  2RGH A;  3VRA A;  5JCK A;  2AQJ A;  4NTD A;  4U8N A;  5KNL A;  1DOB A;  2DKI A;  3T2K A;  4EIP A;  3UKL A;  2WP9 A;  1X31 B;  2QAE A;  1BF3 A;  3RP7 A;  5ER0 A;  2VRM A;  2WU5 A;  4DGK A;  2GVC A;  3F8D A;  1DOE A;  3PS9 A;  1B4V A;  4B1B A;  3LB8 A;  3KLJ A;  2EQ8 A;  4Y4M A;  2V5Z A;  1GRA A;  4A7A A;  5FS7 A;  1KSU A;  4CCR A;  5JCL A;  4IA6 A;  4A99 A;  3NRN A;  4LU6 A;  2Q0K A;  4USQ A;  1L9E A;  4G6H A;  1ZOY A;  4WX1 A;  3UOZ A;  4J34 A;  4U2L A;  2WDV A;  4II3 A;  4OPI A;  3JSK A;  3GYX A;  2C67 A;  5KMS A;  4USR A;  5J60 A;  2WOV A;  4YXD A;  3CGD A;  2WPF A;  3I6D A;  5KMR A;  4YTM A;  4Z24 A;  2BAB A;  1DJN A;  4WCT A;  1XAN A;  3RED A;  2VOU A;  1ZMD A;  5BUK A;  2YVG A;  4BK2 A;  2WHD A;  3GRT A;  2FJE A;  3PVC A;  2Z5X A;  4NNJ A;  3CPJ G;  4H4R A;  4H2R A;  2R45 A;  3G5S A;  3UCL A;  1GV4 A;  4K8D A;  2OAM A;  2YLR A;  4EQR A;  1O5W A;  2V60 A;  3P4P A;  4GAP A;  2YLX A;  1GRF A;  2DKH A;  2B9W A;  2GV8 A;  4CNJ A;  1TYP A;  5KXJ A;  2WDQ A;  1ZK7 A;  4Z2U A;  2E4G A;  3SZ0 A;  3ISH A;  2GR0 A;  5HHF A;  2WOI A;  2YLZ A;  4GF7 A;  4K5R A;  3KU9 A;  4EQW A;  3V76 A;  2BAC A;  2BYB A;  1EBD A;  1AOG A;  4OPU A;  5FS8 A;  3WE0 A;  1REO A;  2VQB A;  3DJE A;  2ZBW A;  3AE3 A;  3DK9 A;  2C66 A;  3NT6 A;  3Q6J A;  4H7U A;  5JCN A;  3UKA A;  1DJQ A;  2YG6 A;  1TDO A;  2J3N A;  3DJG X;  3DH9 A;  2GQF A;  4H2P A;  5KVI A;  5U25 A;  2XVE A;  3GD3 A;  4EMW A;  1DNC A;  2YG3 A;  3AEF A;  1F8W A;  5BVA A;  4YSY A;  2Z5Y A;  3NYC A;  3SGL A;  3GMB A;  1F8S A;  2B9Y A;  3ALL A;  1UKV G;  3NN0 X;  1E1N A;  1JU2 A;  4N9X A;  2ARD A;  3ATR A;  1IUS A;  1RYI A;  1E1M A;  3AEB A;  1SEZ A;  3DK4 A;  3VRB A;  1FEC A;  2BCP A;  4XWZ A;  2XFU A;  3AWI A;  4MJW A;  3DGZ A;  1PBB A;  3P1W A;  4NTC A;  3NK2 X;  4H4S A;  3UTE A;  3NTA A;  1JRZ A;  1GAL A;  3UKF A;  1NHR A;  3AB1 A;  4UP3 A;  3FMW A;  4A79 A;  1L9D A;  2XCG A;  2WES A;  4EM4 A;  1GER A;  4E0V A;  4YSZ A;  5JCI A;  1B5Q A;  1N4U A;  2YG4 A;  2VRL A;  2BXR A;  2RGJ A;  4I58 A;  2XVF A;  1D4C A;  1F6M A;  2RAB A;  2GH5 A;  3ITJ A;  3P9U A;  1PHH A;  1E6E A;  2WU2 A;  5DBJ A;  2B7R A;  5CKU A;  3AED A;  2BK5 A;  1PBE A;  4TM0 A;  4D04 A;  2B7S A;  1N1P A;  2W0H A;  3EAO A;  2OLO A;  1MXT A;  2GQW A;  4H4V A;  4CRT A;  4EMI A;  1KNP A;  1ZOV A;  4H4Q A;  4B63 A;  4JY2 A;  1H84 A;  3UKP A;  1ZP0 A;  2BS2 A;  1H86 A;  3BHK A;  3LJP A;  1JNR A;  3ICR A;  1OJA A;  2YLT A;  1NHQ A;  3NLC A;  3O0H A;  3CTY A;  1IJH A;  2QA1 A;  2GB0 A;  4NTE A;  2CDU A;  4AP3 A;  1LVL A;  4D03 A;  4YWO A;  1JRX A;  4OPG A;  3AD8 B;  2X8H A;  1CF3 A;  2YG5 A;  4J57 A;  3RHA A;  3V3O A;  1Q9I A;  3QVP A;  4DNA A;  2Y6Q A;  4NEV A;  1ZKQ A;  3NG7 X;  3SY4 A;  1Y56 A;  2V61 A;  4U8J A;  2UZZ A;  4TM4 A;  2C3C A;  2FJA A;  1ZDL A;  4U8P A;  2GMJ A;  4OCG A;  3GWF A;  1NG3 A;  1NAA A;  4Z43 A;  2VVM A;  3QJ4 A;  1CC6 A;  1H81 A;  4CY8 A;  3CIR A;  3GRS A;  1EL9 A;  1KFY A;  2CFY A;  2YR6 A;  3UOV A;  2EQ7 A;  3AYI A;  1Y56 B;  2Q6U A;  3IC9 A;  4B65 A;  1Q1R A;  3ICS A;  2XFP A;  1H82 A;  3UTH A;  2IVE A;  4J33 A;  1QJD A;  1GSN A;  1O95 A;  2YM2 A;  2Q0L A;  3NYE A;  3CPH G;  2GAH B;  1GRE A;  3NTD A;  1VDC A;  2X8C A;  4NZH A;  1K0I A;  3UOX A;  3IWA A;  3T2Y A;  3KA7 A;  3GWD A;  1BWC A;  1IUW A;  3BNU A;  3DA1 A;  1TDK A;  5J7X A;  4P9S A;  3AE4 A;  2C7G A;  3UTF A;  4ZCC A;  1HYU A;  4Z44 A;  3SM8 A;  1Y0P A;  2YWL A;  2FBW A;  2VQ7 A;  3SX6 A;  3GYI A;  4FDC B;  4C3Y A;  1GT8 A;  1OJT A;  3NGC X;  2WQY A;  3RNM A;  4ADW A;  2XFQ A;  2XYO A;  1YQZ A;  4Z2R A;  2H88 A;  2IID A;  3AD7 B;  2ZZB A;  3DJD A;  4GUV A;  4X4J A;  1DXL A;  2X8G A;  2XFO A;  3DME A;  5GSN A;  1PBD A;  2OLN A;  3AE2 A;  1BGN A;  4C3X A;  4UDR A;  4H4T A;  5KOX A;  1YKJ A;  4JDR A;  1FCD A;  4GDE A;  4ZCD A;  1ZY8 A;  4Y4N A;  5M10 A;  2NPX A;  2QA2 A;  2XVI A;  3LOV A;  3T14 A;  5KMP A;  4DSH A;  3AEG A;  3SFD A;  4JNA A;  1GRG A;  3DGH A;  1PXC A;  3T37 A;  2JAE A;  3QVR A;  4OPD A;  2YAU A;  5L46 A;  4AP1 A;  2JK6 A;  3BI5 A;  5FS6 A;  4TM3 A;  4BK1 A;  2I0Z A;  1K0J A;  3GSI A;  3H8L A;  4G73 A;  1KDG A;  1GES A;  1E1L A;  1B8S A;  4H2Q A;  4B69 A;  4B67 A;  3QSE A;  1JOA A;  3CNJ A;  3F8P A;  3AE6 A;  1PJ5 A;  1GND A;  3NYF A;  4EIQ A;  4A5L A;  1VG0 A;  4H4P A;  5KOW A;  4ICY A;  1D7L A;  2ZZ0 A;  2RGO A;  2BS4 A;  3AYL A;  5EOW A;  3NNE A;  3VRD B;  4C77 A;  1GTH A;  1VQW A;  2R9Z A;  4J56 A;  1CHU A;  3M13 A;  1BGJ A;  2WEU A;  2YR4 A;  3LAD A;  1IUU A;  1MOK A;  3BHF A;  3KD9 A;  2ZZC A;  1OJC A;  2XLT A;  2VVL A;  1D4E A;  4J36 A;  1H7X A;  1Z6L A;  3NK0 X;  4YKG A;  1YY5 A;  2HQM A;  4K22 A;  1GET A;  3ICT A;  3ZDN A;  4FK1 A;  1PJ7 A;  4Z26 A;  1RP0 A;  5IQ1 A;  1FOH A;  3B3R A;  3E1T A;  4GR1 A;  1KF6 A;  3KKJ A;  1NEN A;  3OZ2 A;  5U63 A;  3SZW A;  2F5Z A;  4A9W A;  3NIX A;  1LTX R;  4AT0 A;  3L1R A;  3KVE A;  2GMH A;  4OPC A;  5JCM A;  2R0P A;  5EB4 A;  3CGC A;  3M0O A;  3SYI A;  4Z2T A;  2BK4 A;  3QFB A;  4IVO B;  1MO9 A;  1L0V A;  5FMH A;  3GDN A;  2YLS A;  1CJ4 A;  2CVJ A;  2WPE A;  4YTN A;  1GRB A;  1VRQ B;  2C64 A;  2APG A;  2C3D A;  2X3N A;  4XXG A;  1H6V A;  2WPC A;  1D5T A;  1GRH A;  3UTG A;  4H4X A;  4BJZ A;  2YG7 A;  4C5O A;  3AXB A;  2B9X A;  2BRY A;  1IUT A;  2BXS A;  2C75 A;  3NN6 X;  3LZW A;  1NG4 A;  2EQ6 A;  2YVJ A;  4II2 A;  2GAG B;  3IHM A;  1LPF A;  2GR3 A;  4B64 A;  3T0K A;  5BRT A;  1CL0 A;  3QSS A;  1OJD A;  3IHG A;  1GEU A;  3CPI G;  2E5V A;  2QCU A;  2V6O A;  3AYJ A;  4J2W A;  4BV6 A;  4BUR A;  4YTP A;  1PN0 A;  4H4W A;  3ATQ A;  2C70 A;  1B37 A;  2XLR A;  4Z25 A;  1NHP A;  3CND A;  4JY3 A;  1H7W A;  2CUL A;  3GDP A;  4XWR A;  1ZX9 A;  2BS3 A;  3EAN A;  1QLB A;  1DOC A;  5KWF A;  1EL8 A;  2BCG G;  2R4E A;  3KPF A;  1CC2 A;  1FEA A;  4KPR A;  1S3B A;  1NEK A;  2XDO A;  4RSL A;  1S2Q A;  2C72 A;  2FJB A;  1JEH A;  4U2S A;  3UKH A;  1KSS A;  1PXB A;  3NKS A;  1XHC A;  4G6G A;  3P4S A;  3G5R A;  1E7P A;  3PO7 A;  4PAA A;  4FX9 A;  1PBC A;  1V59 A;  2JBV A;  4NEW A;  4RG4 A;  2C65 A;  1BKW A;  4U8I A;  3V3N A;  4EM3 A;  2WBA A;  2H89 A;  1GOS A;  3F8R A;  4YSH A;  1LV0 A;  5IQ4 A;  2A89 A;  3I3L A;  3CNS A;  5EBK A;  3K30 A;  4H4U A;  4AOX A;  4IA5 A;  2WP6 A;  3Q9T A;  3VR8 A;  4CY6 A;  1VG9 A;  1H83 A;  2WP5 A;  4AT2 A;  2C76 A;  2XFN A;  5BUL A;  2JB1 A;  3FBS A;  1CBO A;  4C74 A;  5FS9 A;  4FK1 C;  2C73 A;  2X99 A;  3ABV A;  4OPL A;  3LZX A;  2XVH A;  2TMD A;  5M0Z A;  4CNK A;  4BK3 A;  2XLP A;  1EL7 A;  4RG3 A;  3ALJ A;  2XVJ A;  2R46 A;  2XLS A;  4CCQ A;  1YQ4 A;  4LII A;  2BA9 A;  2YVF A;  4APN A;  1COY A;  4EMJ A;  3HYW A;  4TLZ A;  1FEB A;  2YM1 A;  5KVH A;  3K7T A;  1N4V A;  3AEC A;  2JKC A;  1F3P A;  5C3J A;  4UDP A;  5IPY A;  1EL5 A;  3K7M X;  5EB5 A;  5C2T A;  2O9Z A;  2A87 A;  2WS3 A;  5KRQ A;  2GEW A;  5LV9 A;  3C96 A;  3UP5 A;  2PYX A;  4PAB A;  1LJ1 A;  1O94 A;  2YQU A;  3AEA A;  4REK A;  1CC4 A;  1LQT A;  2PHH A;  3VR9 A;  1GRT A;  3K7Q X;  2NVK X;  1JNZ A;  2WDR A;  4U8L A;  4Y4L A;  3RP6 A;  4U8K A;  3P4Q A; 
#chains in the Genus database with same CATH homology
 3CN8 A;  5GRT A;  1P2H A;  4YT0 A;  1JRY A;  1NDA A;  4ZN0 A;  4X9M A;  3HYV A;  2GRT A;  3AE5 A;  1S3E A;  5U1O A;  3D8X A;  3DJJ A;  3R9U A;  4I59 A;  4GDP A;  3RP8 A;  1DOD A;  1P2E A;  4U8M A;  4CBQ A;  3KPK A;  3UKQ A;  2V3A A;  4EQS A;  1FL2 A;  3UOY A;  3D1C A;  4B66 A;  4H4Y A;  1CJ3 A;  1OJ9 A;  3AE7 A;  3EF6 A;  4TLX A;  3CGE A;  4IV9 A;  1IUX A;  3QSM A;  2BRA A;  3SQP A;  3G5Q A;  1BZL A;  3HYX A;  3S5W A;  1M6I A;  1Q1W A;  3AE9 A;  3ALM A;  4UDQ A;  4DSG A;  2XLU A;  3CMM A;  3M12 A;  2GR2 A;  2R4J A;  1ONF A;  3CNT A;  3FPZ A;  1TDN A;  2R0G A;  2E1M A;  3II4 A;  3AE8 A;  4H2N A;  4AOS A;  2VZ2 A;  1GTE A;  1TYT A;  3SXI A;  3EPT A;  3CGB A;  1IUV A;  1KNR A;  4JNQ A;  3UP4 A;  2X50 A;  1NHS A;  1RSG A;  2OA1 A;  3AD9 B;  2JB3 A;  3VQR A;  3CNP A;  4O5Q A;  1TDF A;  2AR8 A;  3DK8 A;  3GMC A;  2BK3 A;  1CJC A;  4YKF A;  1W4X A;  4X9N A;  5CQF A;  1L9C A;  4A6N A;  4ECH A;  2Q7V A;  3L8K A;  3FIM B;  3OC4 A;  1CJ2 A;  1M64 A;  3ADA B;  3T31 A;  4OVI A;  4K5S A;  3LXD A;  1GXF A;  2IVD A;  3B6D A;  2B76 A;  5HYM A;  4LA1 A;  4HB9 A;  2A8X A;  3SZC A;  3T2Z A;  4NWZ A;  4G9K A;  1ELI A;  1F8R A;  1S2Y A;  4A6N B;  4GAV A;  4J31 A;  2WOW A;  3GD4 A;  1K0L A;  2OAL A;  2YR5 A;  2GF3 A;  3C4N A;  2WET A;  3NHO X;  3NK1 X;  4OPT A;  4U8O A;  4A65 A;  1D7Y A;  2EQ9 A;  3AE1 A;  5HY5 A;  2YLW A;  3SFE A;  4KX6 A;  1ZMC A;  4IVM B;  3BI2 A;  4B68 A;  3URH A;  1N4W A;  1K4Q A;  1TDE A;  1LQU A;  3BNM A;  4M52 A;  1GPE A;  4O5U A;  4BJY A;  1TRB A;  3ZYX A;  4HA6 A;  1E1K A;  1D4D A;  2BC1 A;  1E39 A;  2GR1 A;  1NPX A;  4JN9 A;  3UKK A;  5KMQ A;  1PBF A;  4EQX A;  3QFA A;  4G74 A;  2TPR A;  3H8I A;  5TR3 A;  4TM1 A;  3IF9 A;  4H4Z A;  3SZF A;  3BI4 A;  3COX A;  2AAQ A;  3NH3 X;  2VVL G;  4GCM A;  1PDH A;  1QO8 A;  1XDI A;  1XPQ A;  3HZL A;  1PXA A;  2JB2 A;  1YQ3 A;  2Y6R A;  3GYJ A;  3P4R A;  4JQ9 A;  4U2T A;  4K7Z A;  2R0C A;  3C4A A;  1PJ6 A;  4YSX A;  1PS9 A;  2BC0 A;  2V3B A;  3FG2 P;  4GRT A;  4K2X A;  3AEE A;  4H50 A;  3H4K A;  2C4C A;  5HXI A;  3S61 A;  2ACZ A;  2FJD A;  2RGH A;  3VRA A;  5JCK A;  2AQJ A;  4NTD A;  4U8N A;  5KNL A;  1DOB A;  2DKI A;  3T2K A;  4EIP A;  3UKL A;  2WP9 A;  1X31 B;  2QAE A;  1BF3 A;  3RP7 A;  5ER0 A;  2VRM A;  2WU5 A;  4DGK A;  2GVC A;  3F8D A;  1DOE A;  3PS9 A;  1B4V A;  4B1B A;  3LB8 A;  3KLJ A;  2EQ8 A;  4Y4M A;  2V5Z A;  1GRA A;  4A7A A;  5FS7 A;  1KSU A;  4CCR A;  5JCL A;  4IA6 A;  4A99 A;  3NRN A;  4LU6 A;  2Q0K A;  4USQ A;  1L9E A;  4G6H A;  1ZOY A;  4WX1 A;  3UOZ A;  4J34 A;  4U2L A;  2WDV A;  4II3 A;  4OPI A;  3JSK A;  3GYX A;  2C67 A;  5KMS A;  4USR A;  5J60 A;  2WOV A;  4YXD A;  3CGD A;  2WPF A;  3I6D A;  5KMR A;  4YTM A;  4Z24 A;  2BAB A;  1DJN A;  4WCT A;  1XAN A;  3RED A;  2VOU A;  1ZMD A;  5BUK A;  2YVG A;  4BK2 A;  2WHD A;  3GRT A;  2FJE A;  3PVC A;  2Z5X A;  4NNJ A;  3CPJ G;  4H4R A;  4H2R A;  2R45 A;  3G5S A;  3UCL A;  1GV4 A;  4K8D A;  2OAM A;  2YLR A;  4EQR A;  1O5W A;  2V60 A;  3P4P A;  4GAP A;  2YLX A;  1GRF A;  2DKH A;  2B9W A;  2GV8 A;  4CNJ A;  1TYP A;  5KXJ A;  2WDQ A;  1ZK7 A;  4Z2U A;  2E4G A;  3SZ0 A;  3ISH A;  2GR0 A;  5HHF A;  2WOI A;  2YLZ A;  4GF7 A;  4K5R A;  3KU9 A;  4EQW A;  3V76 A;  2BAC A;  2BYB A;  1EBD A;  1AOG A;  4OPU A;  5FS8 A;  3WE0 A;  1REO A;  2VQB A;  3DJE A;  2ZBW A;  3AE3 A;  3DK9 A;  2C66 A;  3NT6 A;  3Q6J A;  4H7U A;  5JCN A;  3UKA A;  1DJQ A;  2YG6 A;  1TDO A;  2J3N A;  3DJG X;  3DH9 A;  2GQF A;  4H2P A;  5KVI A;  5U25 A;  2XVE A;  3GD3 A;  4EMW A;  1DNC A;  2YG3 A;  3AEF A;  1F8W A;  5BVA A;  4YSY A;  2Z5Y A;  3NYC A;  3SGL A;  3GMB A;  1F8S A;  2B9Y A;  3ALL A;  1UKV G;  3NN0 X;  1E1N A;  1JU2 A;  4N9X A;  2ARD A;  3ATR A;  1IUS A;  1RYI A;  1E1M A;  3AEB A;  1SEZ A;  3DK4 A;  3VRB A;  1FEC A;  2BCP A;  4XWZ A;  2XFU A;  3AWI A;  4MJW A;  3DGZ A;  1PBB A;  3P1W A;  4NTC A;  3NK2 X;  4H4S A;  3UTE A;  3NTA A;  1JRZ A;  1GAL A;  3UKF A;  1NHR A;  3AB1 A;  4UP3 A;  3FMW A;  4A79 A;  1L9D A;  2XCG A;  2WES A;  4EM4 A;  1GER A;  4E0V A;  4YSZ A;  5JCI A;  1B5Q A;  1N4U A;  2YG4 A;  2VRL A;  2BXR A;  2RGJ A;  4I58 A;  2XVF A;  1D4C A;  1F6M A;  2RAB A;  2GH5 A;  3ITJ A;  3P9U A;  1PHH A;  1E6E A;  2WU2 A;  5DBJ A;  2B7R A;  5CKU A;  3AED A;  2BK5 A;  1PBE A;  4TM0 A;  4D04 A;  2B7S A;  1N1P A;  2W0H A;  3EAO A;  2OLO A;  1MXT A;  2GQW A;  4H4V A;  4CRT A;  4EMI A;  1KNP A;  1ZOV A;  4H4Q A;  4B63 A;  4JY2 A;  1H84 A;  3UKP A;  1ZP0 A;  2BS2 A;  1H86 A;  3BHK A;  3LJP A;  1JNR A;  3ICR A;  1OJA A;  2YLT A;  1NHQ A;  3NLC A;  3O0H A;  3CTY A;  1IJH A;  2QA1 A;  2GB0 A;  4NTE A;  2CDU A;  4AP3 A;  1LVL A;  4D03 A;  4YWO A;  1JRX A;  4OPG A;  3AD8 B;  2X8H A;  1CF3 A;  2YG5 A;  4J57 A;  3RHA A;  3V3O A;  1Q9I A;  3QVP A;  4DNA A;  2Y6Q A;  4NEV A;  1ZKQ A;  3NG7 X;  3SY4 A;  1Y56 A;  2V61 A;  4U8J A;  2UZZ A;  4TM4 A;  2C3C A;  2FJA A;  1ZDL A;  4U8P A;  2GMJ A;  4OCG A;  3GWF A;  1NG3 A;  1NAA A;  4Z43 A;  2VVM A;  3QJ4 A;  1CC6 A;  1H81 A;  4CY8 A;  3CIR A;  3GRS A;  1EL9 A;  1KFY A;  2CFY A;  2YR6 A;  3UOV A;  2EQ7 A;  3AYI A;  1Y56 B;  2Q6U A;  3IC9 A;  4B65 A;  1Q1R A;  3ICS A;  2XFP A;  1H82 A;  3UTH A;  2IVE A;  4J33 A;  1QJD A;  1GSN A;  1O95 A;  2YM2 A;  2Q0L A;  3NYE A;  3CPH G;  2GAH B;  1GRE A;  3NTD A;  1VDC A;  2X8C A;  4NZH A;  1K0I A;  3UOX A;  3IWA A;  3T2Y A;  3KA7 A;  3GWD A;  1BWC A;  1IUW A;  3BNU A;  3DA1 A;  1TDK A;  5J7X A;  4P9S A;  3AE4 A;  2C7G A;  3UTF A;  4ZCC A;  1HYU A;  4Z44 A;  3SM8 A;  1Y0P A;  2YWL A;  2FBW A;  2VQ7 A;  3SX6 A;  3GYI A;  4FDC B;  4C3Y A;  1GT8 A;  1OJT A;  3NGC X;  2WQY A;  3RNM A;  4ADW A;  2XFQ A;  2XYO A;  1YQZ A;  4Z2R A;  2H88 A;  2IID A;  3AD7 B;  2ZZB A;  3DJD A;  4GUV A;  4X4J A;  1DXL A;  2X8G A;  2XFO A;  3DME A;  5GSN A;  1PBD A;  2OLN A;  3AE2 A;  1BGN A;  4C3X A;  4UDR A;  4H4T A;  5KOX A;  1YKJ A;  4JDR A;  1FCD A;  4GDE A;  4ZCD A;  1ZY8 A;  4Y4N A;  5M10 A;  2NPX A;  2QA2 A;  2XVI A;  3LOV A;  3T14 A;  5KMP A;  4DSH A;  3AEG A;  3SFD A;  4JNA A;  1GRG A;  3DGH A;  1PXC A;  3T37 A;  2JAE A;  3QVR A;  4OPD A;  2YAU A;  5L46 A;  4AP1 A;  2JK6 A;  3BI5 A;  5FS6 A;  4TM3 A;  4BK1 A;  2I0Z A;  1K0J A;  3GSI A;  3H8L A;  4G73 A;  1KDG A;  1GES A;  1E1L A;  1B8S A;  4H2Q A;  4B69 A;  4B67 A;  3QSE A;  1JOA A;  3CNJ A;  3F8P A;  3AE6 A;  1PJ5 A;  1GND A;  3NYF A;  4EIQ A;  4A5L A;  1VG0 A;  4H4P A;  5KOW A;  4ICY A;  1D7L A;  2ZZ0 A;  2RGO A;  2BS4 A;  3AYL A;  5EOW A;  3NNE A;  3VRD B;  4C77 A;  1GTH A;  1VQW A;  2R9Z A;  4J56 A;  1CHU A;  3M13 A;  1BGJ A;  2WEU A;  2YR4 A;  3LAD A;  1IUU A;  1MOK A;  3BHF A;  3KD9 A;  2ZZC A;  1OJC A;  2XLT A;  2VVL A;  1D4E A;  4J36 A;  1H7X A;  1Z6L A;  3NK0 X;  4YKG A;  1YY5 A;  2HQM A;  4K22 A;  1GET A;  3ICT A;  3ZDN A;  4FK1 A;  1PJ7 A;  4Z26 A;  1RP0 A;  5IQ1 A;  1FOH A;  3B3R A;  3E1T A;  4GR1 A;  1KF6 A;  3KKJ A;  1NEN A;  3OZ2 A;  5U63 A;  3SZW A;  2F5Z A;  4A9W A;  3NIX A;  1LTX R;  4AT0 A;  3L1R A;  3KVE A;  2GMH A;  4OPC A;  5JCM A;  2R0P A;  5EB4 A;  3CGC A;  3M0O A;  3SYI A;  4Z2T A;  2BK4 A;  3QFB A;  4IVO B;  1MO9 A;  1L0V A;  5FMH A;  3GDN A;  2YLS A;  1CJ4 A;  2CVJ A;  2WPE A;  4YTN A;  1GRB A;  1VRQ B;  2C64 A;  2APG A;  2C3D A;  2X3N A;  4XXG A;  1H6V A;  2WPC A;  1D5T A;  1GRH A;  3UTG A;  4H4X A;  4BJZ A;  2YG7 A;  4C5O A;  3AXB A;  2B9X A;  2BRY A;  1IUT A;  2BXS A;  2C75 A;  3NN6 X;  3LZW A;  1NG4 A;  2EQ6 A;  2YVJ A;  4II2 A;  2GAG B;  3IHM A;  1LPF A;  2GR3 A;  4B64 A;  3T0K A;  5BRT A;  1CL0 A;  3QSS A;  1OJD A;  3IHG A;  1GEU A;  3CPI G;  2E5V A;  2QCU A;  2V6O A;  3AYJ A;  4J2W A;  4BV6 A;  4BUR A;  4YTP A;  1PN0 A;  4H4W A;  3ATQ A;  2C70 A;  1B37 A;  2XLR A;  4Z25 A;  1NHP A;  3CND A;  4JY3 A;  1H7W A;  2CUL A;  3GDP A;  4XWR A;  1ZX9 A;  2BS3 A;  3EAN A;  1QLB A;  1DOC A;  5KWF A;  1EL8 A;  2BCG G;  2R4E A;  3KPF A;  1CC2 A;  1FEA A;  4KPR A;  1S3B A;  1NEK A;  2XDO A;  4RSL A;  1S2Q A;  2C72 A;  2FJB A;  1JEH A;  4U2S A;  3UKH A;  1KSS A;  1PXB A;  3NKS A;  1XHC A;  4G6G A;  3P4S A;  3G5R A;  1E7P A;  3PO7 A;  4PAA A;  4FX9 A;  1PBC A;  1V59 A;  2JBV A;  4NEW A;  4RG4 A;  2C65 A;  1BKW A;  4U8I A;  3V3N A;  4EM3 A;  2WBA A;  2H89 A;  1GOS A;  3F8R A;  4YSH A;  1LV0 A;  5IQ4 A;  2A89 A;  3I3L A;  3CNS A;  5EBK A;  3K30 A;  4H4U A;  4AOX A;  4IA5 A;  2WP6 A;  3Q9T A;  3VR8 A;  4CY6 A;  1VG9 A;  1H83 A;  2WP5 A;  4AT2 A;  2C76 A;  2XFN A;  5BUL A;  2JB1 A;  3FBS A;  1CBO A;  4C74 A;  5FS9 A;  4FK1 C;  2C73 A;  2X99 A;  3ABV A;  4OPL A;  3LZX A;  2XVH A;  2TMD A;  5M0Z A;  4CNK A;  4BK3 A;  2XLP A;  1EL7 A;  4RG3 A;  3ALJ A;  2XVJ A;  2R46 A;  2XLS A;  4CCQ A;  1YQ4 A;  4LII A;  2BA9 A;  2YVF A;  4APN A;  1COY A;  4EMJ A;  3HYW A;  4TLZ A;  1FEB A;  2YM1 A;  5KVH A;  3K7T A;  1N4V A;  3AEC A;  2JKC A;  1F3P A;  5C3J A;  4UDP A;  5IPY A;  1EL5 A;  3K7M X;  5EB5 A;  5C2T A;  2O9Z A;  2A87 A;  2WS3 A;  5KRQ A;  2GEW A;  5LV9 A;  3C96 A;  3UP5 A;  2PYX A;  4PAB A;  1LJ1 A;  1O94 A;  2YQU A;  3AEA A;  4REK A;  1CC4 A;  1LQT A;  2PHH A;  3VR9 A;  1GRT A;  3K7Q X;  2NVK X;  1JNZ A;  2WDR A;  4U8L A;  4Y4L A;  3RP6 A;  4U8K A;  3P4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...