2WHDA

Barley nadph-dependent thioredoxin reductase 2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
318
structure length
318
Chain Sequence
AAPLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEGWMANDIAAGGQLTTTTDVENFPGFPTGIMGIDLMDNCRAQSVRFGTNILSETVTEVDFSARPFRVTSDSTTVLADTVVVATGAVARRLYFSGSDTYWNRGISACAVCDGAAPIFRNKPIAVIGGGDSAMEEGNFLTKYGSQVYIIHRRNTFRASKIMQARALSNPKIQVVWDSEVVEAYGGAGGGPLAGVKVKNLVTGEVSDLQVSGLFFAIGHEPATKFLNGQLELHADGYVATKPGSTHTSVEGVFAAGDVQDKKYRQAITAAGSGCMAALDAEHYLQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Hordeum Vulgare Nadph-Dependent Thioredoxin Reductase 2. Unwinding the Reaction Mechanism.
pubmed doi rcsb
source organism Hordeum vulgare
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 92
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA02
3S5WA 4UP3A 4X9NA 2WOVA 2X8CA 3FPZA 4GDEA 4JDRA 2R4JA 4NZHA 3AE2A 4D03A 1NPXA 4ICYA 1GALA 1Z6LA 2PYXA 2GR1A 1H83A 2R0CA 2BA9A 4EIPA 2R0PA 4OPUA 3CNJA 1H82A 3VQRA 4O5QA 3SFEA 4EQSA 3UTGA 3KU9A 4H7UA 4X9MA 2BACA 1PBEA 1PJ6A 3QVRA 2R46A 3KA7A 4H4XA 2WS3A 1DODA 2RABA 2YM2A 1CF3A 1YKJA 2Z5XA 3CGBA 5HYMA 2AAQA 3NG7X 3SM8A 4TLZA 3IC9A 3BI2A 1LPFA 2X50A 2WU2A 3VR9A 3DJGX 4UDPA 4GDPA 3FBSA 2YG7A 1K4QA 4EM4A 3CNTA 2XVHA 5EB5A 4CCRA 1PXBA 2OA1A 3AYIA 2EQ8A 3NNEA 4REKA 1LTXR 3T37A 4OPTA 2WESA 4CCQA 2WP5A 4USRA 5ER0A 1L0VA 2B9XA 1BZLA 2XFNA 3LZWA 1NHSA 3E1TA 2YR4A 2YG3A 2YWLA 4J33A 3RP8A 3UKKA 2GF3A 3P9UA 4J57A 2WDVA 4Z44A 3P4PA 3AD8B 1JRYA 3ABVA 3EANA 4JY2A 3F8DA 3CPIG 2Y6QA 4WCTA 5EOWA 1Q1RA 2NPXA 1OJAA 2CULA 4A6NB 1BKWA 2YLRA 1REOA 3V3NA 3VR8A 4A7AA 4B63A 1E1LA 4EMIA 1GSNA 1GRFA 2QAEA 1KSUA 1FECA 3ICSA 3LADA 4LU6A 4H4SA 4LA1A 2C70A 5JCKA 5EB4A 3UP4A 1EL9A 1S2YA 2XCGA 1K0IA 3GSIA 4H4YA 3EPTA 1QJDA 3CNPA 3UCLA 4YXDA 1GRAA 1ZMCA 1EL8A 4JN9A 4BURA 3NT6A 2YLZA 2C66A 2JAEA 3CGCA 2A89A 1FCDA 1K0JA 3GDPA 1YQ3A 1ZY8A 2GR2A 2FJAA 2IIDA 4IA6A 4CY8A 2YG5A 1GT8A 1JNRA 5FS6A 3GWDA 3VRDB 2A87A 4H50A 4IV9A 1GRBA 5KVHA 4CNKA 3KKJA 4YWOA 5JCLA 2C67A 2BCPA 2BC0A 1NDAA 4C3XA 4BK3A 1ZK7A 1ZOVA 2H88A 2YR5A 4EMWA 1NG4A 1PJ5A 3M13A 2WP9A 1N4WA 4EQXA 2JKCA 3DGHA 2YQUA 1H6VA 4U8KA 3BNMA 2VRLA 1GETA 5JCMA 4ZN0A 4U8OA 4U8LA 4U8MA 5EBKA 1TYPA 1PS9A 1EBDA 3AE1A 3UTEA 4AP3A 2GMJA 4H4QA 1PDHA 4H2NA 3BHFA 2HQMA 4J34A 1S3BA 4J36A 1CBOA 3OZ2A 4Z2TA 2WQYA 3HZLA 3RNMA 2VZ2A 1AOGA 2YLXA 2GH5A 1GRHA 2GR3A 3K30A 2X8GA 4FK1A 2C7GA 3AE9A 3NIXA 3WE0A 3ALMA 4EIQA 4BV6A 1D5TA 2XYOA 3UOZA 1TDFA 4P9SA 3ALJA 4H4TA 5KRQA 1M64A 4OPIA 2XVJA 2YM1A 1IUVA 2CDUA 4TM0A 4PABA 4C77A 3RP6A 4CBQA 1IUXA 4Z26A 1N4UA 4AOXA 1GRGA 5HHFA 4TLXA 1QO8A 2X99A 5U25A 2XVFA 3AWIA 3C96A 4B64A 4H4ZA 1TDOA 3LOVA 4AP1A 1DJNA 3AE3A 3ATRA 4FX9A 1E6EA 4YKFA 3NYEA 4E0VA 4NTEA 2WDQA 4O5UA 3BI4A 3CN8A 1B5QA 4B65A 3BI5A 3H4KA 3SGLA 3B6DA 3KLJA 1DOEA 1FEBA 1F3PA 2VQ7A 4XWRA 4CRTA 2XVEA 3DA1A 1TDNA 4GF7A 1GV4A 3R9UA 3NGCX 4TM1A 4DSHA 3GDNA 2WHDA 3LJPA 5C2TA 2X8HA 4OVIA 3NKSA 4GCMA 1ZDLA 2XLRA 4NEVA 3AEFA 3AD9B 1DOCA 4OPCA 1E1MA 2TPRA 1L9EA 3P1WA 2CFYA 5M10A 4YT0A 1CJCA 1CJ3A 1CC6A 1EL5A 2V3BA 4YTPA 2XFUA 2ACZA 3AYJA 3AE7A 4YSYA 4H4WA 2YLSA 2AQJA 1X31B 1H84A 3AE4A 2WBAA 2WU5A 3GYJA 1LQUA 2XFPA 4EQWA 2BYBA 4NEWA 1VQWA 3D8XA 4M52A 4JNAA 4ADWA 5IQ4A 2VOUA 2OALA 2B7RA 3GWFA 1Q9IA 4OPGA 3O0HA 4LIIA 1LQTA 1OJTA 4CY6A 2C3CA 2ZZBA 3DK8A 2BS4A 2Q7VA 1IJHA 2OAMA 1E39A 1VRQB 1O95A 2C72A 2YG4A 3AE5A 3BHKA 1YQZA 3LXDA 3NK2X 3NTAA 2FJDA 3FMWA 2JB2A 4AT0A 4D04A 3P4SA 3NK0X 1ELIA 3K7TA 3NYCA 3UP5A 2BABA 3AEAA 3ICTA 1IUTA 3V3OA 3V76A 1W4XA 3NYFA 3I6DA 1P2HA 4C5OA 2CVJA 5IPYA 2YLWA 2WETA 3Q6JA 3DJDA 2JK6A 4H4VA 1CC2A 2BK3A 2J3NA 4A6NA 1MXTA 3IHMA 3VRAA 1DXLA 4X4JA 1VG9A 5M0ZA 3GMBA 4K7ZA 2APGA 3BNUA 3JSKA 2GR0A 4A99A 4K22A 3NHOX 4DNAA 4YSZA 5U63A 2WPCA 3CNSA 3UOXA 3AEGA 5BULA 4U8PA 4U2LA 1ZX9A 2RGOA 1LV0A 3Q9TA 3QFBA 1S3EA 1CC4A 2VQBA 1Q1WA 2X3NA 2XFOA 3URHA 2R9ZA 2YAUA 4Y4NA 1H7XA 4A79A 1XHCA 1PBBA 2Z5YA 4USQA 1OJDA 3NH3X 2JB3A 1QLBA 3EAOA 3RHAA 2B7SA 4TM4A 5KOXA 3P4RA 3UKQA 5FS9A 2W0HA 1PJ7A 4BJZA 1RYIA 1DNCA 1S2QA 4YSXA 2R45A 4B69A 4Z43A 3ADAB 1TDEA 1NENA 3AEBA 3C4AA 3UKPA 3GRSA 1L9DA 1SEZA 1PXAA 1GTHA 1GXFA 2GMHA 3AYLA 3KVEA 1VDCA 3NRNA 4ZCDA 1GREA 2GQWA 4GR1A 5U1OA 4JNQA 4GRTA 1PBFA 4Z2UA 3UOYA 1L9CA 3IWAA 5JCIA 4XXGA 2C73A 4UDRA 3DGZA 2BXSA 3CIRA 1N1PA 3UTHA 2OLNA 4U2TA 1YY5A 3II4A 1P2EA 1TRBA 2V61A 4U8IA 5HXIA 1NHPA 3QSSA 3CGEA 4JQ9A 4PAAA 4K8DA 3DK9A 2GAGB 3NN6X 5BRTA 4C74A 5FMHA 5BUKA 2C3DA 4H2PA 2WOWA 2YVFA 3CGDA 2C76A 1ZMDA 3GD3A 2O9ZA 5CKUA 1E7PA 2A8XA 1IUSA 3S61A 1GPEA 2GEWA 3AECA 4A65A 3CPJG 1D7LA 3EF6A 3IHGA 3DH9A 4APNA 1Y0PA 4CNJA 3F8RA 1D7YA 1NEKA 1KFYA 2EQ9A 1FOHA 2V5ZA 4MJWA 3KPFA 1MOKA 3IF9A 4U8JA 5TR3A 3KD9A 1PBCA 1RSGA 2Q0KA 4ECHA 1KDGA 5KVIA 1GERA 2VVMA 5IQ1A 2C65A 2WEUA 4B66A 3I3LA 5KWFA 2C75A 2DKIA 2QA2A 3C4NA 3NK1X 5C3JA 4B68A 4HB9A 1GTEA 2FJBA 3G5QA 3CNDA 4FK1C 2XLSA 1XDIA 1OJ9A 1PN0A 1GESA 3UTFA 4EM3A 4NTDA 3M12A 1KNPA 2XDOA 1JEHA 3PO7A 1IUUA 1FEAA 1BGJA 3M0OA 2XLTA 3FIMB 2GQFA 4GUVA 1CL0A 1NG3A 1F8WA 4DGKA 2TMDA 3G5RA 1D4DA 2EQ7A 2GRTA 2BK4A 4YTMA 1E1KA 4JY3A 5J7XA 4BK1A 2B9WA 2ZZCA 4C3YA 1ZP0A 3QFAA 3DMEA 3RP7A 5L46A 2XVIA 4OPDA 4I58A 2VRMA 1E1NA 2VVLA 4EQRA 3ITJA 3OC4A 1M6IA 4Z24A 3AEEA 4WX1A 5JCNA 2YVGA 3DJEA 1DOBA 2YVJA 3DK4A 1COYA 3QSMA 2E4GA 2BK5A 4IVOB 5GSNA 4BK2A 2WP6A 4AT2A 4FDCB 5DBJA 1PXCA 1K0LA 3ISHA 5LV9A 2I0ZA 1BGNA 1XPQA 2XFQA 3QVPA 3ZDNA 2YG6A 3AD7B 2BCGG 2Q6UA 4KPRA 4N9XA 4A5LA 5HY5A 3GYIA 3PVCA 1B4VA 1IUWA 4UDQA 1ZOYA 4HA6A 3ICRA 1B37A 2E5VA 4Z2RA 1GRTA 3H8IA 3CPHG 5KOWA 4Y4MA 1CHUA 1D4CA 1F8RA 4B1BA 4YSHA 4NTCA 1H7WA 1UKVG 2B9YA 3GMCA 1FL2A 2BS2A 1D4EA 1BF3A 3QSEA 4IA5A 2PHHA 2WDRA 2WOIA 3DJJA 4H2RA 3NLCA 2FBWA 2GVCA 1O94A 1TYTA 5GRTA 2ARDA 1EL7A 1Y56B 2IVEA 1H86A 1H81A 1LVLA 1OJCA 2BXRA 3AXBA 3AE6A 3GRTA 3L8KA 1GEUA 2Q0LA 3LZXA 2RGHA 1B8SA 3SQPA 4U8NA 2OLOA 1MO9A 1XANA 1HYUA 4A9WA 2UZZA 3GD4A 1JRXA 4AOSA 2WPEA 2GV8A 1GOSA 4RG3A 4K5RA 4J31A 1YQ4A 4Z25A 3B3RA 1PBDA 4IVMB 4Y4LA 4RG4A 2V3AA 1JNZA 2V60A 1BWCA 3K7MX 3UKLA 2RGJA 2V6OA 4KX6A 1CJ2A 2F5ZA 2GAHB 1KNRA 4YTNA 1KF6A 3AB1A 2BC1A 2BS3A 3UKAA 3G5SA 5FS7A 2Y6RA 4YKGA 2AR8A 2DKHA 4BJYA 2VVLG 3H8LA 3P4QA 3FG2P 1Y56A 1O5WA 2H89A 3ATQA 3COXA 4K5SA 2WPFA 2YLTA 4EMJA 2E1MA 3L1RA 4B67A 3F8PA 4DSGA 1NHQA 1NHRA 1NAAA 2B76A 4ZCCA 1JRZA 3D1CA 3LB8A 2ZBWA 1F6MA 2EQ6A 3NN0X 4J56A 4TM3A 1ZKQA 4H2QA 1F8SA 5FS8A 4J2WA 3VRBA 4H4RA 3UOVA 2R0GA 4OPLA 2NVKX 4XWZA 2QA1A 1KSSA 5BVAA 4I59A 1PHHA 3SFDA 5KXJA 3CTYA 3ZYXA 1V59A 1JU2A 3UKHA 2GB0A 2IVDA 2JB1A 2YR6A 1GNDA 3NTDA 1TDKA 1VG0A 4H4PA 2FJEA 4U2SA 3AEDA 1CJ4A 2XLUA 4K2XA 5J60A 2R4EA 3AE8A 3PS9A 3QJ4A 2XLPA 4H4UA 4OCGA 1DJQA 2C64A 3REDA 1JOAA 1LJ1A 1N4VA 1ONFA 1RP0A 2ZZ0A 3ALLA 4RSLA 5CQFA 2QCUA 3K7QX 3UKFA 2JBVA
chains in the Genus database with same CATH superfamily
3S5WA 4UP3A 4X9NA 2WOVA 2X8CA 3FPZA 4GDEA 4JDRA 2R4JA 4NZHA 3AE2A 4D03A 1NPXA 4ICYA 1GALA 1Z6LA 2PYXA 2GR1A 1H83A 2R0CA 2BA9A 4EIPA 2R0PA 4OPUA 3CNJA 1H82A 3VQRA 4O5QA 3SFEA 4EQSA 3UTGA 3KU9A 4H7UA 4X9MA 2BACA 1PBEA 1PJ6A 3QVRA 2R46A 3KA7A 4H4XA 2WS3A 1DODA 2RABA 2YM2A 1CF3A 1YKJA 2Z5XA 3CGBA 5HYMA 2AAQA 4G73A 3NG7X 3SM8A 4TLZA 3IC9A 3BI2A 1LPFA 2X50A 2WU2A 3VR9A 3DJGX 4UDPA 4GDPA 3FBSA 2YG7A 1K4QA 3HYWA 3SZFA 4EM4A 3CNTA 2XVHA 5EB5A 4CCRA 1PXBA 2OA1A 3AYIA 2EQ8A 3NNEA 4REKA 1LTXR 3T37A 4OPTA 2WESA 4CCQA 2WP5A 4USRA 5ER0A 1L0VA 2B9XA 1BZLA 2XFNA 3LZWA 1NHSA 3E1TA 3SY4A 2YR4A 4NWZA 2YG3A 2YWLA 4J33A 3RP8A 3UKKA 2GF3A 3P9UA 4J57A 2WDVA 4Z44A 3P4PA 3AD8B 1JRYA 3ABVA 3EANA 4JY2A 3F8DA 3CPIG 2Y6QA 4WCTA 5EOWA 1Q1RA 2NPXA 1OJAA 2CULA 4A6NB 1BKWA 2YLRA 1REOA 3V3NA 3VR8A 4A7AA 4B63A 1E1LA 4EMIA 1GSNA 1GRFA 2QAEA 1KSUA 3T2YA 1FECA 3ICSA 3LADA 4LU6A 4H4SA 4LA1A 2C70A 5JCKA 5EB4A 3UP4A 1EL9A 1S2YA 2XCGA 1K0IA 3GSIA 4H4YA 3EPTA 1QJDA 3CNPA 3UCLA 4YXDA 1GRAA 1ZMCA 4G9KA 1EL8A 4JN9A 4BURA 3NT6A 2YLZA 2C66A 2JAEA 3CGCA 2A89A 1FCDA 1K0JA 3GDPA 1YQ3A 1ZY8A 2GR2A 2FJAA 2IIDA 4IA6A 4CY8A 2YG5A 3SZWA 1GT8A 1JNRA 5FS6A 3GWDA 3VRDB 2A87A 4H50A 4IV9A 1GRBA 5KVHA 4CNKA 3KKJA 4YWOA 5JCLA 2C67A 2BCPA 2BC0A 1NDAA 4C3XA 4BK3A 1ZK7A 1ZOVA 2H88A 2YR5A 4EMWA 1NG4A 1PJ5A 3M13A 2WP9A 1N4WA 4EQXA 2JKCA 3DGHA 2YQUA 1H6VA 4U8KA 3BNMA 2VRLA 1GETA 5JCMA 4ZN0A 4U8OA 4U8LA 4U8MA 5EBKA 1TYPA 1PS9A 1EBDA 3AE1A 3UTEA 4AP3A 2GMJA 4H4QA 1PDHA 4H2NA 3BHFA 2HQMA 4J34A 1S3BA 4J36A 1CBOA 3OZ2A 4Z2TA 2WQYA 3HZLA 3RNMA 2VZ2A 1AOGA 2YLXA 2GH5A 1GRHA 2GR3A 4GAVA 3K30A 2X8GA 4FK1A 2C7GA 3AE9A 3NIXA 3WE0A 3ALMA 4EIQA 4BV6A 1D5TA 2XYOA 3UOZA 1TDFA 4P9SA 3ALJA 4H4TA 5KRQA 1M64A 4OPIA 2XVJA 2YM1A 1IUVA 2CDUA 4TM0A 4PABA 4C77A 3RP6A 4CBQA 1IUXA 4Z26A 1N4UA 4AOXA 1GRGA 5HHFA 4TLXA 1QO8A 2X99A 5U25A 2XVFA 3AWIA 3C96A 4B64A 4H4ZA 3SYIA 1TDOA 3LOVA 4II2A 4AP1A 1DJNA 3AE3A 4II3A 3ATRA 4FX9A 1E6EA 4YKFA 3NYEA 4E0VA 4NTEA 3CMMA 2WDQA 4O5UA 3BI4A 3CN8A 3SXIA 1B5QA 3SZCA 4B65A 3BI5A 3H4KA 5KMPA 3SGLA 3B6DA 3KLJA 1DOEA 1FEBA 1F3PA 2VQ7A 4XWRA 4CRTA 2XVEA 3DA1A 1TDNA 4GF7A 1GV4A 3R9UA 3NGCX 4TM1A 4DSHA 3GDNA 2WHDA 3LJPA 3HYXA 2X8HA 5C2TA 4OVIA 3NKSA 4GCMA 1ZDLA 2XLRA 4NEVA 3AEFA 3AD9B 1DOCA 3T31A 4OPCA 1E1MA 2TPRA 1L9EA 3P1WA 2CFYA 5M10A 4YT0A 1CJCA 1CJ3A 3SX6A 1CC6A 1EL5A 2V3BA 4YTPA 2XFUA 2ACZA 3AYJA 3AE7A 4YSYA 4H4WA 2YLSA 2AQJA 1X31B 1H84A 3AE4A 2WBAA 2WU5A 3GYJA 1LQUA 2XFPA 4EQWA 2BYBA 4GAPA 4NEWA 1VQWA 3D8XA 4M52A 4JNAA 4ADWA 5IQ4A 2VOUA 2OALA 2B7RA 3GWFA 1Q9IA 4OPGA 3O0HA 4LIIA 3SZ0A 1LQTA 5KMQA 1OJTA 4CY6A 2C3CA 2ZZBA 3DK8A 2BS4A 2Q7VA 1IJHA 2OAMA 1E39A 1VRQB 1O95A 2C72A 2YG4A 3AE5A 3BHKA 1YQZA 3LXDA 3NK2X 3NTAA 2FJDA 3FMWA 2JB2A 4AT0A 4D04A 3P4SA 3NK0X 1ELIA 3K7TA 3NYCA 3UP5A 2BABA 3AEAA 3ICTA 1IUTA 3V3OA 3V76A 1W4XA 3NYFA 3I6DA 1P2HA 4C5OA 2CVJA 5IPYA 2YLWA 2WETA 3Q6JA 3DJDA 2JK6A 4H4VA 1CC2A 2BK3A 2J3NA 4A6NA 1MXTA 3IHMA 3VRAA 1DXLA 4X4JA 1VG9A 5M0ZA 3GMBA 4K7ZA 2APGA 3BNUA 3JSKA 2GR0A 4A99A 4K22A 3T2ZA 3NHOX 3T14A 4DNAA 4NNJA 4YSZA 5KMRA 5U63A 2WPCA 3CNSA 3UOXA 3AEGA 5BULA 4U8PA 3GYXA 4U2LA 1ZX9A 2RGOA 1LV0A 3Q9TA 3QFBA 1S3EA 1CC4A 2VQBA 1Q1WA 2X3NA 2XFOA 3T0KA 3URHA 2R9ZA 2YAUA 4Y4NA 1H7XA 4A79A 1XHCA 1PBBA 2Z5YA 4USQA 1OJDA 3NH3X 2JB3A 1QLBA 3EAOA 3RHAA 2B7SA 4TM4A 5KOXA 3P4RA 3UKQA 5FS9A 2W0HA 1PJ7A 4BJZA 1RYIA 1DNCA 1S2QA 4YSXA 2R45A 4B69A 4Z43A 3ADAB 1TDEA 1NENA 3AEBA 3C4AA 3UKPA 3GRSA 1L9DA 1SEZA 1PXAA 1GTHA 1GXFA 2GMHA 3AYLA 3KVEA 1VDCA 3NRNA 4ZCDA 1GREA 2GQWA 4GR1A 5U1OA 4JNQA 4GRTA 1PBFA 4Z2UA 3UOYA 1L9CA 3IWAA 5JCIA 4XXGA 2C73A 4UDRA 3DGZA 2BXSA 3CIRA 1N1PA 3UTHA 2OLNA 4U2TA 1YY5A 3II4A 1P2EA 3KPKA 1TRBA 2V61A 4U8IA 5HXIA 1NHPA 3QSSA 3CGEA 4JQ9A 4PAAA 4K8DA 3DK9A 2GAGB 3NN6X 5BRTA 4C74A 5FMHA 5BUKA 2C3DA 4H2PA 2WOWA 2YVFA 3CGDA 2C76A 3HYVA 1ZMDA 3GD3A 2O9ZA 5CKUA 1E7PA 2A8XA 1IUSA 3S61A 1GPEA 2GEWA 3AECA 4A65A 3CPJG 1D7LA 3EF6A 3IHGA 3DH9A 4APNA 1Y0PA 4CNJA 3F8RA 1D7YA 1NEKA 3T2KA 1KFYA 2EQ9A 1FOHA 2V5ZA 4MJWA 3KPFA 1MOKA 3IF9A 4U8JA 4G6GA 5TR3A 3KD9A 1PBCA 1RSGA 2Q0KA 4ECHA 1KDGA 5KVIA 1GERA 2VVMA 5IQ1A 2C65A 2WEUA 4B66A 3I3LA 5KWFA 2C75A 2DKIA 2QA2A 3C4NA 3NK1X 5C3JA 4B68A 4HB9A 1GTEA 2FJBA 3G5QA 3CNDA 4FK1C 2XLSA 1XDIA 1OJ9A 1PN0A 1GESA 3UTFA 4EM3A 4NTDA 3M12A 1KNPA 2XDOA 1JEHA 3PO7A 1IUUA 1FEAA 1BGJA 3M0OA 2XLTA 3FIMB 2GQFA 4GUVA 1CL0A 1NG3A 1F8WA 4G74A 2TMDA 3G5RA 1D4DA 2EQ7A 2GRTA 2BK4A 4DGKA 4YTMA 1E1KA 4JY3A 5J7XA 4BK1A 2B9WA 2ZZCA 4C3YA 1ZP0A 3QFAA 3DMEA 3RP7A 5L46A 2XVIA 4OPDA 4I58A 2VRMA 1E1NA 2VVLA 4EQRA 3ITJA 3OC4A 1M6IA 4Z24A 3AEEA 4WX1A 5JCNA 2YVGA 2BRAA 3DJEA 1DOBA 2YVJA 3DK4A 1COYA 3QSMA 2E4GA 2BK5A 4IVOB 5GSNA 4BK2A 2WP6A 4AT2A 4FDCB 5DBJA 1PXCA 1K0LA 3ISHA 5LV9A 2I0ZA 1BGNA 1XPQA 2XFQA 3QVPA 3ZDNA 2YG6A 3AD7B 2BCGG 2Q6UA 4KPRA 4N9XA 4A5LA 5HY5A 3GYIA 3PVCA 1B4VA 1IUWA 4UDQA 1ZOYA 4HA6A 3ICRA 1B37A 2E5VA 4Z2RA 1GRTA 3H8IA 3CPHG 5KOWA 4Y4MA 1CHUA 1D4CA 1F8RA 4B1BA 4YSHA 4NTCA 1H7WA 1UKVG 2B9YA 3GMCA 1FL2A 2BS2A 1D4EA 1BF3A 3QSEA 4IA5A 2PHHA 2WDRA 2WOIA 3DJJA 4H2RA 3NLCA 2FBWA 2GVCA 1O94A 1TYTA 5GRTA 2ARDA 1EL7A 1Y56B 2IVEA 1H86A 1H81A 1LVLA 1OJCA 2BXRA 3AXBA 3AE6A 3GRTA 4G6HA 3L8KA 1GEUA 2Q0LA 3LZXA 2RGHA 1B8SA 3SQPA 4U8NA 2OLOA 1MO9A 1XANA 1HYUA 4A9WA 2UZZA 3GD4A 1JRXA 4AOSA 2WPEA 2GV8A 1GOSA 5KNLA 4RG3A 4K5RA 4J31A 1YQ4A 4Z25A 3B3RA 1PBDA 4IVMB 4Y4LA 4RG4A 2V3AA 1JNZA 2V60A 1BWCA 3K7MX 3UKLA 2RGJA 2BRYA 2V6OA 1CJ2A 4KX6A 2F5ZA 2GAHB 1KNRA 4YTNA 1KF6A 3AB1A 2BC1A 2BS3A 3UKAA 3G5SA 5FS7A 2Y6RA 4YKGA 2AR8A 2DKHA 4BJYA 2C4CA 2VVLG 3H8LA 3P4QA 3FG2P 1Y56A 1O5WA 2H89A 3ATQA 3COXA 4K5SA 2WPFA 2YLTA 4EMJA 2E1MA 5KMSA 3L1RA 4B67A 3F8PA 4DSGA 1NHQA 1NHRA 1NAAA 2B76A 4ZCCA 1JRZA 3D1CA 3LB8A 2ZBWA 1F6MA 2EQ6A 3NN0X 4J56A 4TM3A 1ZKQA 4H2QA 1F8SA 5FS8A 4J2WA 3VRBA 4H4RA 3UOVA 2R0GA 4OPLA 2NVKX 4XWZA 2QA1A 1KSSA 5BVAA 4I59A 1PHHA 3SFDA 5KXJA 3CTYA 3ZYXA 1V59A 1JU2A 3UKHA 2GB0A 2IVDA 2JB1A 2YR6A 1GNDA 3NTDA 1TDKA 1VG0A 4H4PA 2FJEA 4U2SA 3AEDA 1CJ4A 2XLUA 4K2XA 5J60A 2R4EA 3AE8A 3PS9A 3QJ4A 2XLPA 4H4UA 4OCGA 1DJQA 2C64A 3REDA 1JOAA 1LJ1A 1N4VA 1ONFA 1RP0A 2ZZ0A 3ALLA 4RSLA 5CQFA 2QCUA 3K7QX 3UKFA 2JBVA
chains in the Genus database with same CATH topology
3S5WA 4UP3A 4X9NA 2WOVA 2X8CA 3FPZA 4GDEA 4JDRA 2R4JA 4NZHA 3AE2A 4D03A 1NPXA 4ICYA 1GALA 1Z6LA 2PYXA 2GR1A 1H83A 2R0CA 2BA9A 4EIPA 2R0PA 4OPUA 3CNJA 1H82A 3VQRA 4O5QA 3SFEA 4EQSA 3UTGA 3KU9A 4H7UA 4X9MA 2BACA 1PBEA 1PJ6A 3QVRA 2R46A 3KA7A 4H4XA 2WS3A 1DODA 2RABA 2YM2A 1CF3A 1YKJA 2Z5XA 3CGBA 5HYMA 2AAQA 4G73A 3NG7X 3SM8A 4TLZA 3IC9A 3BI2A 1LPFA 2X50A 2WU2A 3VR9A 3DJGX 4UDPA 4GDPA 3FBSA 2YG7A 1K4QA 3HYWA 3SZFA 4EM4A 3CNTA 2XVHA 5EB5A 4CCRA 1PXBA 2OA1A 3AYIA 2EQ8A 3NNEA 4REKA 1LTXR 3T37A 4OPTA 2WESA 4CCQA 2WP5A 4USRA 5ER0A 1L0VA 2B9XA 1BZLA 2XFNA 3LZWA 1NHSA 3E1TA 3SY4A 2YR4A 4NWZA 2YG3A 2YWLA 4J33A 3RP8A 3UKKA 2GF3A 3P9UA 4J57A 2WDVA 4Z44A 3P4PA 3AD8B 1JRYA 3ABVA 3EANA 4JY2A 3F8DA 3CPIG 2Y6QA 4WCTA 5EOWA 1Q1RA 2NPXA 1OJAA 2CULA 4A6NB 1BKWA 2YLRA 1REOA 3V3NA 3VR8A 4A7AA 4B63A 1E1LA 4EMIA 1GSNA 1GRFA 2QAEA 1KSUA 3T2YA 1FECA 3ICSA 3LADA 4LU6A 4H4SA 4LA1A 2C70A 5JCKA 5EB4A 3UP4A 1EL9A 1S2YA 2XCGA 1K0IA 3GSIA 4H4YA 3EPTA 1QJDA 3CNPA 3UCLA 4YXDA 1GRAA 1ZMCA 4G9KA 1EL8A 4JN9A 4BURA 3NT6A 2YLZA 2C66A 2JAEA 3CGCA 2A89A 1FCDA 1K0JA 3GDPA 1YQ3A 1ZY8A 2GR2A 2FJAA 2IIDA 4IA6A 4CY8A 2YG5A 3SZWA 1GT8A 1JNRA 5FS6A 3GWDA 3VRDB 2A87A 4H50A 4IV9A 1GRBA 5KVHA 4CNKA 3KKJA 4YWOA 5JCLA 2C67A 2BCPA 2BC0A 1NDAA 4C3XA 4BK3A 1ZK7A 1ZOVA 2H88A 2YR5A 4EMWA 1NG4A 1PJ5A 3M13A 2WP9A 1N4WA 4EQXA 2JKCA 3DGHA 2YQUA 1H6VA 4U8KA 3BNMA 2VRLA 1GETA 5JCMA 4ZN0A 4U8OA 4U8LA 4U8MA 5EBKA 1TYPA 1PS9A 1EBDA 3AE1A 3UTEA 4AP3A 2GMJA 4H4QA 1PDHA 4H2NA 3BHFA 2HQMA 4J34A 1S3BA 4J36A 1CBOA 3OZ2A 4Z2TA 2WQYA 3HZLA 3RNMA 2VZ2A 1AOGA 2YLXA 2GH5A 1GRHA 2GR3A 4GAVA 3K30A 2X8GA 4FK1A 2C7GA 3AE9A 3NIXA 3WE0A 3ALMA 4EIQA 4BV6A 1D5TA 2XYOA 3UOZA 1TDFA 4P9SA 3ALJA 4H4TA 5KRQA 1M64A 4OPIA 2XVJA 2YM1A 1IUVA 2CDUA 4TM0A 4PABA 4C77A 3RP6A 4CBQA 1IUXA 4Z26A 1N4UA 4AOXA 1GRGA 5HHFA 4TLXA 1QO8A 2X99A 5U25A 2XVFA 3AWIA 3C96A 4B64A 4H4ZA 3SYIA 1TDOA 3LOVA 4II2A 4AP1A 1DJNA 3AE3A 4II3A 3ATRA 4FX9A 1E6EA 4YKFA 3NYEA 4E0VA 4NTEA 3CMMA 2WDQA 4O5UA 3BI4A 3CN8A 3SXIA 1B5QA 3SZCA 4B65A 3BI5A 3H4KA 5KMPA 3SGLA 3B6DA 3KLJA 1DOEA 1FEBA 1F3PA 2VQ7A 4XWRA 4CRTA 2XVEA 3DA1A 1TDNA 4GF7A 1GV4A 3R9UA 3NGCX 4TM1A 4DSHA 3GDNA 2WHDA 3LJPA 3HYXA 2X8HA 5C2TA 4OVIA 3NKSA 4GCMA 1ZDLA 2XLRA 4NEVA 3AEFA 3AD9B 1DOCA 3T31A 4OPCA 1E1MA 2TPRA 1L9EA 3P1WA 2CFYA 5M10A 4YT0A 1CJCA 1CJ3A 3SX6A 1CC6A 1EL5A 2V3BA 4YTPA 2XFUA 2ACZA 3AYJA 3AE7A 4YSYA 4H4WA 2YLSA 2AQJA 1X31B 1H84A 3AE4A 2WBAA 2WU5A 3GYJA 1LQUA 2XFPA 4EQWA 2BYBA 4GAPA 4NEWA 1VQWA 3D8XA 4M52A 4JNAA 4ADWA 5IQ4A 2VOUA 2OALA 2B7RA 3GWFA 1Q9IA 4OPGA 3O0HA 4LIIA 3SZ0A 1LQTA 5KMQA 1OJTA 4CY6A 2C3CA 2ZZBA 3DK8A 2BS4A 2Q7VA 1IJHA 2OAMA 1E39A 1VRQB 1O95A 2C72A 2YG4A 3AE5A 3BHKA 1YQZA 3LXDA 3NK2X 3NTAA 2FJDA 3FMWA 2JB2A 4AT0A 4D04A 3P4SA 3NK0X 1ELIA 3K7TA 3NYCA 3UP5A 2BABA 3AEAA 3ICTA 1IUTA 3V3OA 3V76A 1W4XA 3NYFA 3I6DA 1P2HA 4C5OA 2CVJA 5IPYA 2YLWA 2WETA 3Q6JA 3DJDA 2JK6A 4H4VA 1CC2A 2BK3A 2J3NA 4A6NA 1MXTA 3IHMA 3VRAA 1DXLA 4X4JA 1VG9A 5M0ZA 3GMBA 4K7ZA 2APGA 3BNUA 3JSKA 2GR0A 4A99A 4K22A 3T2ZA 3NHOX 3T14A 4DNAA 4NNJA 4YSZA 5KMRA 5U63A 2WPCA 3CNSA 3UOXA 3AEGA 5BULA 4U8PA 3GYXA 4U2LA 1ZX9A 2RGOA 1LV0A 3Q9TA 3QFBA 1S3EA 1CC4A 2VQBA 1Q1WA 2X3NA 2XFOA 3T0KA 3URHA 2R9ZA 2YAUA 4Y4NA 1H7XA 4A79A 1XHCA 1PBBA 2Z5YA 4USQA 1OJDA 3NH3X 2JB3A 1QLBA 3EAOA 3RHAA 2B7SA 4TM4A 5KOXA 3P4RA 3UKQA 5FS9A 2W0HA 1PJ7A 4BJZA 1RYIA 1DNCA 1S2QA 4YSXA 2R45A 4B69A 4Z43A 3ADAB 1TDEA 1NENA 3AEBA 3C4AA 3UKPA 3GRSA 1L9DA 1SEZA 1PXAA 1GTHA 1GXFA 2GMHA 3AYLA 3KVEA 1VDCA 3NRNA 4ZCDA 1GREA 2GQWA 4GR1A 5U1OA 4JNQA 4GRTA 1PBFA 4Z2UA 3UOYA 1L9CA 3IWAA 5JCIA 4XXGA 2C73A 4UDRA 3DGZA 2BXSA 3CIRA 1N1PA 3UTHA 2OLNA 4U2TA 1YY5A 3II4A 1P2EA 3KPKA 1TRBA 2V61A 4U8IA 5HXIA 1NHPA 3QSSA 3CGEA 4JQ9A 4PAAA 4K8DA 3DK9A 2GAGB 3NN6X 5BRTA 4C74A 5FMHA 5BUKA 2C3DA 4H2PA 2WOWA 2YVFA 3CGDA 2C76A 3HYVA 1ZMDA 3GD3A 2O9ZA 5CKUA 1E7PA 2A8XA 1IUSA 3S61A 1GPEA 2GEWA 3AECA 4A65A 3CPJG 1D7LA 3EF6A 3IHGA 3DH9A 4APNA 1Y0PA 4CNJA 3F8RA 1D7YA 1NEKA 3T2KA 1KFYA 2EQ9A 1FOHA 2V5ZA 4MJWA 3KPFA 1MOKA 3IF9A 4U8JA 4G6GA 5TR3A 3KD9A 1PBCA 1RSGA 2Q0KA 4ECHA 1KDGA 5KVIA 1GERA 2VVMA 5IQ1A 2C65A 2WEUA 4B66A 3I3LA 5KWFA 2C75A 2DKIA 2QA2A 3C4NA 3NK1X 5C3JA 4B68A 4HB9A 1GTEA 2FJBA 3G5QA 3CNDA 4FK1C 2XLSA 1XDIA 1OJ9A 1PN0A 1GESA 3UTFA 4EM3A 4NTDA 3M12A 1KNPA 2XDOA 1JEHA 3PO7A 1IUUA 1FEAA 1BGJA 3M0OA 2XLTA 3FIMB 2GQFA 4GUVA 1CL0A 1NG3A 1F8WA 4G74A 2TMDA 3G5RA 1D4DA 2EQ7A 2GRTA 2BK4A 4DGKA 4YTMA 1E1KA 4JY3A 5J7XA 4BK1A 2B9WA 2ZZCA 4C3YA 1ZP0A 3QFAA 3DMEA 3RP7A 5L46A 2XVIA 4OPDA 4I58A 2VRMA 1E1NA 2VVLA 4EQRA 3ITJA 3OC4A 1M6IA 4Z24A 3AEEA 4WX1A 5JCNA 2YVGA 2BRAA 3DJEA 1DOBA 2YVJA 3DK4A 1COYA 3QSMA 2E4GA 2BK5A 4IVOB 5GSNA 4BK2A 2WP6A 4AT2A 4FDCB 5DBJA 1PXCA 1K0LA 3ISHA 5LV9A 2I0ZA 1BGNA 1XPQA 2XFQA 3QVPA 3ZDNA 2YG6A 3AD7B 2BCGG 2Q6UA 4KPRA 4N9XA 4A5LA 5HY5A 3GYIA 3PVCA 1B4VA 1IUWA 4UDQA 1ZOYA 4HA6A 3ICRA 1B37A 2E5VA 4Z2RA 1GRTA 3H8IA 3CPHG 5KOWA 4Y4MA 1CHUA 1D4CA 1F8RA 4B1BA 4YSHA 4NTCA 1H7WA 1UKVG 2B9YA 3GMCA 1FL2A 2BS2A 1D4EA 1BF3A 3QSEA 4IA5A 2PHHA 2WDRA 2WOIA 3DJJA 4H2RA 3NLCA 2FBWA 2GVCA 1O94A 1TYTA 5GRTA 2ARDA 1EL7A 1Y56B 2IVEA 1H86A 1H81A 1LVLA 1OJCA 2BXRA 3AXBA 3AE6A 3GRTA 4G6HA 3L8KA 1GEUA 2Q0LA 3LZXA 2RGHA 1B8SA 3SQPA 4U8NA 2OLOA 1MO9A 1XANA 1HYUA 4A9WA 2UZZA 3GD4A 1JRXA 4AOSA 2WPEA 2GV8A 1GOSA 5KNLA 4RG3A 4K5RA 4J31A 1YQ4A 4Z25A 3B3RA 1PBDA 4IVMB 4Y4LA 4RG4A 2V3AA 1JNZA 2V60A 1BWCA 3K7MX 3UKLA 2RGJA 2BRYA 2V6OA 1CJ2A 4KX6A 2F5ZA 2GAHB 1KNRA 4YTNA 1KF6A 3AB1A 2BC1A 2BS3A 3UKAA 3G5SA 5FS7A 2Y6RA 4YKGA 2AR8A 2DKHA 4BJYA 2C4CA 2VVLG 3H8LA 3P4QA 3FG2P 1Y56A 1O5WA 2H89A 3ATQA 3COXA 4K5SA 2WPFA 2YLTA 4EMJA 2E1MA 5KMSA 3L1RA 4B67A 3F8PA 4DSGA 1NHQA 1NHRA 1NAAA 2B76A 4ZCCA 1JRZA 3D1CA 3LB8A 2ZBWA 1F6MA 2EQ6A 3NN0X 4J56A 4TM3A 1ZKQA 4H2QA 1F8SA 5FS8A 4J2WA 3VRBA 4H4RA 3UOVA 2R0GA 4OPLA 2NVKX 4XWZA 2QA1A 1KSSA 5BVAA 4I59A 1PHHA 3SFDA 5KXJA 3CTYA 3ZYXA 1V59A 1JU2A 3UKHA 2GB0A 2IVDA 2JB1A 2YR6A 1GNDA 3NTDA 1TDKA 1VG0A 4H4PA 2FJEA 4U2SA 3AEDA 1CJ4A 2XLUA 4K2XA 5J60A 2R4EA 3AE8A 3PS9A 3QJ4A 2XLPA 4H4UA 4OCGA 1DJQA 2C64A 3REDA 1JOAA 1LJ1A 1N4VA 1ONFA 1RP0A 2ZZ0A 3ALLA 4RSLA 5CQFA 2QCUA 3K7QX 3UKFA 2JBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S5W A;  4UP3 A;  4X9N A;  2WOV A;  2X8C A;  3FPZ A;  4GDE A;  4JDR A;  2R4J A;  4NZH A;  3AE2 A;  4D03 A;  1NPX A;  4ICY A;  1GAL A;  1Z6L A;  2PYX A;  2GR1 A;  1H83 A;  2R0C A;  2BA9 A;  4EIP A;  2R0P A;  4OPU A;  3CNJ A;  1H82 A;  3VQR A;  4O5Q A;  3SFE A;  4EQS A;  3UTG A;  3KU9 A;  4H7U A;  4X9M A;  2BAC A;  1PBE A;  1PJ6 A;  3QVR A;  2R46 A;  3KA7 A;  4H4X A;  2WS3 A;  1DOD A;  2RAB A;  2YM2 A;  1CF3 A;  1YKJ A;  2Z5X A;  3CGB A;  5HYM A;  2AAQ A;  3NG7 X;  3SM8 A;  4TLZ A;  3IC9 A;  3BI2 A;  1LPF A;  2X50 A;  2WU2 A;  3VR9 A;  3DJG X;  4UDP A;  4GDP A;  3FBS A;  2YG7 A;  1K4Q A;  4EM4 A;  3CNT A;  2XVH A;  5EB5 A;  4CCR A;  1PXB A;  2OA1 A;  3AYI A;  2EQ8 A;  3NNE A;  4REK A;  1LTX R;  3T37 A;  4OPT A;  2WES A;  4CCQ A;  2WP5 A;  4USR A;  5ER0 A;  1L0V A;  2B9X A;  1BZL A;  2XFN A;  3LZW A;  1NHS A;  3E1T A;  2YR4 A;  2YG3 A;  2YWL A;  4J33 A;  3RP8 A;  3UKK A;  2GF3 A;  3P9U A;  4J57 A;  2WDV A;  4Z44 A;  3P4P A;  3AD8 B;  1JRY A;  3ABV A;  3EAN A;  4JY2 A;  3F8D A;  3CPI G;  2Y6Q A;  4WCT A;  5EOW A;  1Q1R A;  2NPX A;  1OJA A;  2CUL A;  4A6N B;  1BKW A;  2YLR A;  1REO A;  3V3N A;  3VR8 A;  4A7A A;  4B63 A;  1E1L A;  4EMI A;  1GSN A;  1GRF A;  2QAE A;  1KSU A;  1FEC A;  3ICS A;  3LAD A;  4LU6 A;  4H4S A;  4LA1 A;  2C70 A;  5JCK A;  5EB4 A;  3UP4 A;  1EL9 A;  1S2Y A;  2XCG A;  1K0I A;  3GSI A;  4H4Y A;  3EPT A;  1QJD A;  3CNP A;  3UCL A;  4YXD A;  1GRA A;  1ZMC A;  1EL8 A;  4JN9 A;  4BUR A;  3NT6 A;  2YLZ A;  2C66 A;  2JAE A;  3CGC A;  2A89 A;  1FCD A;  1K0J A;  3GDP A;  1YQ3 A;  1ZY8 A;  2GR2 A;  2FJA A;  2IID A;  4IA6 A;  4CY8 A;  2YG5 A;  1GT8 A;  1JNR A;  5FS6 A;  3GWD A;  3VRD B;  2A87 A;  4H50 A;  4IV9 A;  1GRB A;  5KVH A;  4CNK A;  3KKJ A;  4YWO A;  5JCL A;  2C67 A;  2BCP A;  2BC0 A;  1NDA A;  4C3X A;  4BK3 A;  1ZK7 A;  1ZOV A;  2H88 A;  2YR5 A;  4EMW A;  1NG4 A;  1PJ5 A;  3M13 A;  2WP9 A;  1N4W A;  4EQX A;  2JKC A;  3DGH A;  2YQU A;  1H6V A;  4U8K A;  3BNM A;  2VRL A;  1GET A;  5JCM A;  4ZN0 A;  4U8O A;  4U8L A;  4U8M A;  5EBK A;  1TYP A;  1PS9 A;  1EBD A;  3AE1 A;  3UTE A;  4AP3 A;  2GMJ A;  4H4Q A;  1PDH A;  4H2N A;  3BHF A;  2HQM A;  4J34 A;  1S3B A;  4J36 A;  1CBO A;  3OZ2 A;  4Z2T A;  2WQY A;  3HZL A;  3RNM A;  2VZ2 A;  1AOG A;  2YLX A;  2GH5 A;  1GRH A;  2GR3 A;  3K30 A;  2X8G A;  4FK1 A;  2C7G A;  3AE9 A;  3NIX A;  3WE0 A;  3ALM A;  4EIQ A;  4BV6 A;  1D5T A;  2XYO A;  3UOZ A;  1TDF A;  4P9S A;  3ALJ A;  4H4T A;  5KRQ A;  1M64 A;  4OPI A;  2XVJ A;  2YM1 A;  1IUV A;  2CDU A;  4TM0 A;  4PAB A;  4C77 A;  3RP6 A;  4CBQ A;  1IUX A;  4Z26 A;  1N4U A;  4AOX A;  1GRG A;  5HHF A;  4TLX A;  1QO8 A;  2X99 A;  5U25 A;  2XVF A;  3AWI A;  3C96 A;  4B64 A;  4H4Z A;  1TDO A;  3LOV A;  4AP1 A;  1DJN A;  3AE3 A;  3ATR A;  4FX9 A;  1E6E A;  4YKF A;  3NYE A;  4E0V A;  4NTE A;  2WDQ A;  4O5U A;  3BI4 A;  3CN8 A;  1B5Q A;  4B65 A;  3BI5 A;  3H4K A;  3SGL A;  3B6D A;  3KLJ A;  1DOE A;  1FEB A;  1F3P A;  2VQ7 A;  4XWR A;  4CRT A;  2XVE A;  3DA1 A;  1TDN A;  4GF7 A;  1GV4 A;  3R9U A;  3NGC X;  4TM1 A;  4DSH A;  3GDN A;  2WHD A;  3LJP A;  5C2T A;  2X8H A;  4OVI A;  3NKS A;  4GCM A;  1ZDL A;  2XLR A;  4NEV A;  3AEF A;  3AD9 B;  1DOC A;  4OPC A;  1E1M A;  2TPR A;  1L9E A;  3P1W A;  2CFY A;  5M10 A;  4YT0 A;  1CJC A;  1CJ3 A;  1CC6 A;  1EL5 A;  2V3B A;  4YTP A;  2XFU A;  2ACZ A;  3AYJ A;  3AE7 A;  4YSY A;  4H4W A;  2YLS A;  2AQJ A;  1X31 B;  1H84 A;  3AE4 A;  2WBA A;  2WU5 A;  3GYJ A;  1LQU A;  2XFP A;  4EQW A;  2BYB A;  4NEW A;  1VQW A;  3D8X A;  4M52 A;  4JNA A;  4ADW A;  5IQ4 A;  2VOU A;  2OAL A;  2B7R A;  3GWF A;  1Q9I A;  4OPG A;  3O0H A;  4LII A;  1LQT A;  1OJT A;  4CY6 A;  2C3C A;  2ZZB A;  3DK8 A;  2BS4 A;  2Q7V A;  1IJH A;  2OAM A;  1E39 A;  1VRQ B;  1O95 A;  2C72 A;  2YG4 A;  3AE5 A;  3BHK A;  1YQZ A;  3LXD A;  3NK2 X;  3NTA A;  2FJD A;  3FMW A;  2JB2 A;  4AT0 A;  4D04 A;  3P4S A;  3NK0 X;  1ELI A;  3K7T A;  3NYC A;  3UP5 A;  2BAB A;  3AEA A;  3ICT A;  1IUT A;  3V3O A;  3V76 A;  1W4X A;  3NYF A;  3I6D A;  1P2H A;  4C5O A;  2CVJ A;  5IPY A;  2YLW A;  2WET A;  3Q6J A;  3DJD A;  2JK6 A;  4H4V A;  1CC2 A;  2BK3 A;  2J3N A;  4A6N A;  1MXT A;  3IHM A;  3VRA A;  1DXL A;  4X4J A;  1VG9 A;  5M0Z A;  3GMB A;  4K7Z A;  2APG A;  3BNU A;  3JSK A;  2GR0 A;  4A99 A;  4K22 A;  3NHO X;  4DNA A;  4YSZ A;  5U63 A;  2WPC A;  3CNS A;  3UOX A;  3AEG A;  5BUL A;  4U8P A;  4U2L A;  1ZX9 A;  2RGO A;  1LV0 A;  3Q9T A;  3QFB A;  1S3E A;  1CC4 A;  2VQB A;  1Q1W A;  2X3N A;  2XFO A;  3URH A;  2R9Z A;  2YAU A;  4Y4N A;  1H7X A;  4A79 A;  1XHC A;  1PBB A;  2Z5Y A;  4USQ A;  1OJD A;  3NH3 X;  2JB3 A;  1QLB A;  3EAO A;  3RHA A;  2B7S A;  4TM4 A;  5KOX A;  3P4R A;  3UKQ A;  5FS9 A;  2W0H A;  1PJ7 A;  4BJZ A;  1RYI A;  1DNC A;  1S2Q A;  4YSX A;  2R45 A;  4B69 A;  4Z43 A;  3ADA B;  1TDE A;  1NEN A;  3AEB A;  3C4A A;  3UKP A;  3GRS A;  1L9D A;  1SEZ A;  1PXA A;  1GTH A;  1GXF A;  2GMH A;  3AYL A;  3KVE A;  1VDC A;  3NRN A;  4ZCD A;  1GRE A;  2GQW A;  4GR1 A;  5U1O A;  4JNQ A;  4GRT A;  1PBF A;  4Z2U A;  3UOY A;  1L9C A;  3IWA A;  5JCI A;  4XXG A;  2C73 A;  4UDR A;  3DGZ A;  2BXS A;  3CIR A;  1N1P A;  3UTH A;  2OLN A;  4U2T A;  1YY5 A;  3II4 A;  1P2E A;  1TRB A;  2V61 A;  4U8I A;  5HXI A;  1NHP A;  3QSS A;  3CGE A;  4JQ9 A;  4PAA A;  4K8D A;  3DK9 A;  2GAG B;  3NN6 X;  5BRT A;  4C74 A;  5FMH A;  5BUK A;  2C3D A;  4H2P A;  2WOW A;  2YVF A;  3CGD A;  2C76 A;  1ZMD A;  3GD3 A;  2O9Z A;  5CKU A;  1E7P A;  2A8X A;  1IUS A;  3S61 A;  1GPE A;  2GEW A;  3AEC A;  4A65 A;  3CPJ G;  1D7L A;  3EF6 A;  3IHG A;  3DH9 A;  4APN A;  1Y0P A;  4CNJ A;  3F8R A;  1D7Y A;  1NEK A;  1KFY A;  2EQ9 A;  1FOH A;  2V5Z A;  4MJW A;  3KPF A;  1MOK A;  3IF9 A;  4U8J A;  5TR3 A;  3KD9 A;  1PBC A;  1RSG A;  2Q0K A;  4ECH A;  1KDG A;  5KVI A;  1GER A;  2VVM A;  5IQ1 A;  2C65 A;  2WEU A;  4B66 A;  3I3L A;  5KWF A;  2C75 A;  2DKI A;  2QA2 A;  3C4N A;  3NK1 X;  5C3J A;  4B68 A;  4HB9 A;  1GTE A;  2FJB A;  3G5Q A;  3CND A;  4FK1 C;  2XLS A;  1XDI A;  1OJ9 A;  1PN0 A;  1GES A;  3UTF A;  4EM3 A;  4NTD A;  3M12 A;  1KNP A;  2XDO A;  1JEH A;  3PO7 A;  1IUU A;  1FEA A;  1BGJ A;  3M0O A;  2XLT A;  3FIM B;  2GQF A;  4GUV A;  1CL0 A;  1NG3 A;  1F8W A;  4DGK A;  2TMD A;  3G5R A;  1D4D A;  2EQ7 A;  2GRT A;  2BK4 A;  4YTM A;  1E1K A;  4JY3 A;  5J7X A;  4BK1 A;  2B9W A;  2ZZC A;  4C3Y A;  1ZP0 A;  3QFA A;  3DME A;  3RP7 A;  5L46 A;  2XVI A;  4OPD A;  4I58 A;  2VRM A;  1E1N A;  2VVL A;  4EQR A;  3ITJ A;  3OC4 A;  1M6I A;  4Z24 A;  3AEE A;  4WX1 A;  5JCN A;  2YVG A;  3DJE A;  1DOB A;  2YVJ A;  3DK4 A;  1COY A;  3QSM A;  2E4G A;  2BK5 A;  4IVO B;  5GSN A;  4BK2 A;  2WP6 A;  4AT2 A;  4FDC B;  5DBJ A;  1PXC A;  1K0L A;  3ISH A;  5LV9 A;  2I0Z A;  1BGN A;  1XPQ A;  2XFQ A;  3QVP A;  3ZDN A;  2YG6 A;  3AD7 B;  2BCG G;  2Q6U A;  4KPR A;  4N9X A;  4A5L A;  5HY5 A;  3GYI A;  3PVC A;  1B4V A;  1IUW A;  4UDQ A;  1ZOY A;  4HA6 A;  3ICR A;  1B37 A;  2E5V A;  4Z2R A;  1GRT A;  3H8I A;  3CPH G;  5KOW A;  4Y4M A;  1CHU A;  1D4C A;  1F8R A;  4B1B A;  4YSH A;  4NTC A;  1H7W A;  1UKV G;  2B9Y A;  3GMC A;  1FL2 A;  2BS2 A;  1D4E A;  1BF3 A;  3QSE A;  4IA5 A;  2PHH A;  2WDR A;  2WOI A;  3DJJ A;  4H2R A;  3NLC A;  2FBW A;  2GVC A;  1O94 A;  1TYT A;  5GRT A;  2ARD A;  1EL7 A;  1Y56 B;  2IVE A;  1H86 A;  1H81 A;  1LVL A;  1OJC A;  2BXR A;  3AXB A;  3AE6 A;  3GRT A;  3L8K A;  1GEU A;  2Q0L A;  3LZX A;  2RGH A;  1B8S A;  3SQP A;  4U8N A;  2OLO A;  1MO9 A;  1XAN A;  1HYU A;  4A9W A;  2UZZ A;  3GD4 A;  1JRX A;  4AOS A;  2WPE A;  2GV8 A;  1GOS A;  4RG3 A;  4K5R A;  4J31 A;  1YQ4 A;  4Z25 A;  3B3R A;  1PBD A;  4IVM B;  4Y4L A;  4RG4 A;  2V3A A;  1JNZ A;  2V60 A;  1BWC A;  3K7M X;  3UKL A;  2RGJ A;  2V6O A;  4KX6 A;  1CJ2 A;  2F5Z A;  2GAH B;  1KNR A;  4YTN A;  1KF6 A;  3AB1 A;  2BC1 A;  2BS3 A;  3UKA A;  3G5S A;  5FS7 A;  2Y6R A;  4YKG A;  2AR8 A;  2DKH A;  4BJY A;  2VVL G;  3H8L A;  3P4Q A;  3FG2 P;  1Y56 A;  1O5W A;  2H89 A;  3ATQ A;  3COX A;  4K5S A;  2WPF A;  2YLT A;  4EMJ A;  2E1M A;  3L1R A;  4B67 A;  3F8P A;  4DSG A;  1NHQ A;  1NHR A;  1NAA A;  2B76 A;  4ZCC A;  1JRZ A;  3D1C A;  3LB8 A;  2ZBW A;  1F6M A;  2EQ6 A;  3NN0 X;  4J56 A;  4TM3 A;  1ZKQ A;  4H2Q A;  1F8S A;  5FS8 A;  4J2W A;  3VRB A;  4H4R A;  3UOV A;  2R0G A;  4OPL A;  2NVK X;  4XWZ A;  2QA1 A;  1KSS A;  5BVA A;  4I59 A;  1PHH A;  3SFD A;  5KXJ A;  3CTY A;  3ZYX A;  1V59 A;  1JU2 A;  3UKH A;  2GB0 A;  2IVD A;  2JB1 A;  2YR6 A;  1GND A;  3NTD A;  1TDK A;  1VG0 A;  4H4P A;  2FJE A;  4U2S A;  3AED A;  1CJ4 A;  2XLU A;  4K2X A;  5J60 A;  2R4E A;  3AE8 A;  3PS9 A;  3QJ4 A;  2XLP A;  4H4U A;  4OCG A;  1DJQ A;  2C64 A;  3RED A;  1JOA A;  1LJ1 A;  1N4V A;  1ONF A;  1RP0 A;  2ZZ0 A;  3ALL A;  4RSL A;  5CQF A;  2QCU A;  3K7Q X;  3UKF A;  2JBV A; 
#chains in the Genus database with same CATH topology
 3S5W A;  4UP3 A;  4X9N A;  2WOV A;  2X8C A;  3FPZ A;  4GDE A;  4JDR A;  2R4J A;  4NZH A;  3AE2 A;  4D03 A;  1NPX A;  4ICY A;  1GAL A;  1Z6L A;  2PYX A;  2GR1 A;  1H83 A;  2R0C A;  2BA9 A;  4EIP A;  2R0P A;  4OPU A;  3CNJ A;  1H82 A;  3VQR A;  4O5Q A;  3SFE A;  4EQS A;  3UTG A;  3KU9 A;  4H7U A;  4X9M A;  2BAC A;  1PBE A;  1PJ6 A;  3QVR A;  2R46 A;  3KA7 A;  4H4X A;  2WS3 A;  1DOD A;  2RAB A;  2YM2 A;  1CF3 A;  1YKJ A;  2Z5X A;  3CGB A;  5HYM A;  2AAQ A;  4G73 A;  3NG7 X;  3SM8 A;  4TLZ A;  3IC9 A;  3BI2 A;  1LPF A;  2X50 A;  2WU2 A;  3VR9 A;  3DJG X;  4UDP A;  4GDP A;  3FBS A;  2YG7 A;  1K4Q A;  3HYW A;  3SZF A;  4EM4 A;  3CNT A;  2XVH A;  5EB5 A;  4CCR A;  1PXB A;  2OA1 A;  3AYI A;  2EQ8 A;  3NNE A;  4REK A;  1LTX R;  3T37 A;  4OPT A;  2WES A;  4CCQ A;  2WP5 A;  4USR A;  5ER0 A;  1L0V A;  2B9X A;  1BZL A;  2XFN A;  3LZW A;  1NHS A;  3E1T A;  3SY4 A;  2YR4 A;  4NWZ A;  2YG3 A;  2YWL A;  4J33 A;  3RP8 A;  3UKK A;  2GF3 A;  3P9U A;  4J57 A;  2WDV A;  4Z44 A;  3P4P A;  3AD8 B;  1JRY A;  3ABV A;  3EAN A;  4JY2 A;  3F8D A;  3CPI G;  2Y6Q A;  4WCT A;  5EOW A;  1Q1R A;  2NPX A;  1OJA A;  2CUL A;  4A6N B;  1BKW A;  2YLR A;  1REO A;  3V3N A;  3VR8 A;  4A7A A;  4B63 A;  1E1L A;  4EMI A;  1GSN A;  1GRF A;  2QAE A;  1KSU A;  3T2Y A;  1FEC A;  3ICS A;  3LAD A;  4LU6 A;  4H4S A;  4LA1 A;  2C70 A;  5JCK A;  5EB4 A;  3UP4 A;  1EL9 A;  1S2Y A;  2XCG A;  1K0I A;  3GSI A;  4H4Y A;  3EPT A;  1QJD A;  3CNP A;  3UCL A;  4YXD A;  1GRA A;  1ZMC A;  4G9K A;  1EL8 A;  4JN9 A;  4BUR A;  3NT6 A;  2YLZ A;  2C66 A;  2JAE A;  3CGC A;  2A89 A;  1FCD A;  1K0J A;  3GDP A;  1YQ3 A;  1ZY8 A;  2GR2 A;  2FJA A;  2IID A;  4IA6 A;  4CY8 A;  2YG5 A;  3SZW A;  1GT8 A;  1JNR A;  5FS6 A;  3GWD A;  3VRD B;  2A87 A;  4H50 A;  4IV9 A;  1GRB A;  5KVH A;  4CNK A;  3KKJ A;  4YWO A;  5JCL A;  2C67 A;  2BCP A;  2BC0 A;  1NDA A;  4C3X A;  4BK3 A;  1ZK7 A;  1ZOV A;  2H88 A;  2YR5 A;  4EMW A;  1NG4 A;  1PJ5 A;  3M13 A;  2WP9 A;  1N4W A;  4EQX A;  2JKC A;  3DGH A;  2YQU A;  1H6V A;  4U8K A;  3BNM A;  2VRL A;  1GET A;  5JCM A;  4ZN0 A;  4U8O A;  4U8L A;  4U8M A;  5EBK A;  1TYP A;  1PS9 A;  1EBD A;  3AE1 A;  3UTE A;  4AP3 A;  2GMJ A;  4H4Q A;  1PDH A;  4H2N A;  3BHF A;  2HQM A;  4J34 A;  1S3B A;  4J36 A;  1CBO A;  3OZ2 A;  4Z2T A;  2WQY A;  3HZL A;  3RNM A;  2VZ2 A;  1AOG A;  2YLX A;  2GH5 A;  1GRH A;  2GR3 A;  4GAV A;  3K30 A;  2X8G A;  4FK1 A;  2C7G A;  3AE9 A;  3NIX A;  3WE0 A;  3ALM A;  4EIQ A;  4BV6 A;  1D5T A;  2XYO A;  3UOZ A;  1TDF A;  4P9S A;  3ALJ A;  4H4T A;  5KRQ A;  1M64 A;  4OPI A;  2XVJ A;  2YM1 A;  1IUV A;  2CDU A;  4TM0 A;  4PAB A;  4C77 A;  3RP6 A;  4CBQ A;  1IUX A;  4Z26 A;  1N4U A;  4AOX A;  1GRG A;  5HHF A;  4TLX A;  1QO8 A;  2X99 A;  5U25 A;  2XVF A;  3AWI A;  3C96 A;  4B64 A;  4H4Z A;  3SYI A;  1TDO A;  3LOV A;  4II2 A;  4AP1 A;  1DJN A;  3AE3 A;  4II3 A;  3ATR A;  4FX9 A;  1E6E A;  4YKF A;  3NYE A;  4E0V A;  4NTE A;  3CMM A;  2WDQ A;  4O5U A;  3BI4 A;  3CN8 A;  3SXI A;  1B5Q A;  3SZC A;  4B65 A;  3BI5 A;  3H4K A;  5KMP A;  3SGL A;  3B6D A;  3KLJ A;  1DOE A;  1FEB A;  1F3P A;  2VQ7 A;  4XWR A;  4CRT A;  2XVE A;  3DA1 A;  1TDN A;  4GF7 A;  1GV4 A;  3R9U A;  3NGC X;  4TM1 A;  4DSH A;  3GDN A;  2WHD A;  3LJP A;  3HYX A;  2X8H A;  5C2T A;  4OVI A;  3NKS A;  4GCM A;  1ZDL A;  2XLR A;  4NEV A;  3AEF A;  3AD9 B;  1DOC A;  3T31 A;  4OPC A;  1E1M A;  2TPR A;  1L9E A;  3P1W A;  2CFY A;  5M10 A;  4YT0 A;  1CJC A;  1CJ3 A;  3SX6 A;  1CC6 A;  1EL5 A;  2V3B A;  4YTP A;  2XFU A;  2ACZ A;  3AYJ A;  3AE7 A;  4YSY A;  4H4W A;  2YLS A;  2AQJ A;  1X31 B;  1H84 A;  3AE4 A;  2WBA A;  2WU5 A;  3GYJ A;  1LQU A;  2XFP A;  4EQW A;  2BYB A;  4GAP A;  4NEW A;  1VQW A;  3D8X A;  4M52 A;  4JNA A;  4ADW A;  5IQ4 A;  2VOU A;  2OAL A;  2B7R A;  3GWF A;  1Q9I A;  4OPG A;  3O0H A;  4LII A;  3SZ0 A;  1LQT A;  5KMQ A;  1OJT A;  4CY6 A;  2C3C A;  2ZZB A;  3DK8 A;  2BS4 A;  2Q7V A;  1IJH A;  2OAM A;  1E39 A;  1VRQ B;  1O95 A;  2C72 A;  2YG4 A;  3AE5 A;  3BHK A;  1YQZ A;  3LXD A;  3NK2 X;  3NTA A;  2FJD A;  3FMW A;  2JB2 A;  4AT0 A;  4D04 A;  3P4S A;  3NK0 X;  1ELI A;  3K7T A;  3NYC A;  3UP5 A;  2BAB A;  3AEA A;  3ICT A;  1IUT A;  3V3O A;  3V76 A;  1W4X A;  3NYF A;  3I6D A;  1P2H A;  4C5O A;  2CVJ A;  5IPY A;  2YLW A;  2WET A;  3Q6J A;  3DJD A;  2JK6 A;  4H4V A;  1CC2 A;  2BK3 A;  2J3N A;  4A6N A;  1MXT A;  3IHM A;  3VRA A;  1DXL A;  4X4J A;  1VG9 A;  5M0Z A;  3GMB A;  4K7Z A;  2APG A;  3BNU A;  3JSK A;  2GR0 A;  4A99 A;  4K22 A;  3T2Z A;  3NHO X;  3T14 A;  4DNA A;  4NNJ A;  4YSZ A;  5KMR A;  5U63 A;  2WPC A;  3CNS A;  3UOX A;  3AEG A;  5BUL A;  4U8P A;  3GYX A;  4U2L A;  1ZX9 A;  2RGO A;  1LV0 A;  3Q9T A;  3QFB A;  1S3E A;  1CC4 A;  2VQB A;  1Q1W A;  2X3N A;  2XFO A;  3T0K A;  3URH A;  2R9Z A;  2YAU A;  4Y4N A;  1H7X A;  4A79 A;  1XHC A;  1PBB A;  2Z5Y A;  4USQ A;  1OJD A;  3NH3 X;  2JB3 A;  1QLB A;  3EAO A;  3RHA A;  2B7S A;  4TM4 A;  5KOX A;  3P4R A;  3UKQ A;  5FS9 A;  2W0H A;  1PJ7 A;  4BJZ A;  1RYI A;  1DNC A;  1S2Q A;  4YSX A;  2R45 A;  4B69 A;  4Z43 A;  3ADA B;  1TDE A;  1NEN A;  3AEB A;  3C4A A;  3UKP A;  3GRS A;  1L9D A;  1SEZ A;  1PXA A;  1GTH A;  1GXF A;  2GMH A;  3AYL A;  3KVE A;  1VDC A;  3NRN A;  4ZCD A;  1GRE A;  2GQW A;  4GR1 A;  5U1O A;  4JNQ A;  4GRT A;  1PBF A;  4Z2U A;  3UOY A;  1L9C A;  3IWA A;  5JCI A;  4XXG A;  2C73 A;  4UDR A;  3DGZ A;  2BXS A;  3CIR A;  1N1P A;  3UTH A;  2OLN A;  4U2T A;  1YY5 A;  3II4 A;  1P2E A;  3KPK A;  1TRB A;  2V61 A;  4U8I A;  5HXI A;  1NHP A;  3QSS A;  3CGE A;  4JQ9 A;  4PAA A;  4K8D A;  3DK9 A;  2GAG B;  3NN6 X;  5BRT A;  4C74 A;  5FMH A;  5BUK A;  2C3D A;  4H2P A;  2WOW A;  2YVF A;  3CGD A;  2C76 A;  3HYV A;  1ZMD A;  3GD3 A;  2O9Z A;  5CKU A;  1E7P A;  2A8X A;  1IUS A;  3S61 A;  1GPE A;  2GEW A;  3AEC A;  4A65 A;  3CPJ G;  1D7L A;  3EF6 A;  3IHG A;  3DH9 A;  4APN A;  1Y0P A;  4CNJ A;  3F8R A;  1D7Y A;  1NEK A;  3T2K A;  1KFY A;  2EQ9 A;  1FOH A;  2V5Z A;  4MJW A;  3KPF A;  1MOK A;  3IF9 A;  4U8J A;  4G6G A;  5TR3 A;  3KD9 A;  1PBC A;  1RSG A;  2Q0K A;  4ECH A;  1KDG A;  5KVI A;  1GER A;  2VVM A;  5IQ1 A;  2C65 A;  2WEU A;  4B66 A;  3I3L A;  5KWF A;  2C75 A;  2DKI A;  2QA2 A;  3C4N A;  3NK1 X;  5C3J A;  4B68 A;  4HB9 A;  1GTE A;  2FJB A;  3G5Q A;  3CND A;  4FK1 C;  2XLS A;  1XDI A;  1OJ9 A;  1PN0 A;  1GES A;  3UTF A;  4EM3 A;  4NTD A;  3M12 A;  1KNP A;  2XDO A;  1JEH A;  3PO7 A;  1IUU A;  1FEA A;  1BGJ A;  3M0O A;  2XLT A;  3FIM B;  2GQF A;  4GUV A;  1CL0 A;  1NG3 A;  1F8W A;  4G74 A;  2TMD A;  3G5R A;  1D4D A;  2EQ7 A;  2GRT A;  2BK4 A;  4DGK A;  4YTM A;  1E1K A;  4JY3 A;  5J7X A;  4BK1 A;  2B9W A;  2ZZC A;  4C3Y A;  1ZP0 A;  3QFA A;  3DME A;  3RP7 A;  5L46 A;  2XVI A;  4OPD A;  4I58 A;  2VRM A;  1E1N A;  2VVL A;  4EQR A;  3ITJ A;  3OC4 A;  1M6I A;  4Z24 A;  3AEE A;  4WX1 A;  5JCN A;  2YVG A;  2BRA A;  3DJE A;  1DOB A;  2YVJ A;  3DK4 A;  1COY A;  3QSM A;  2E4G A;  2BK5 A;  4IVO B;  5GSN A;  4BK2 A;  2WP6 A;  4AT2 A;  4FDC B;  5DBJ A;  1PXC A;  1K0L A;  3ISH A;  5LV9 A;  2I0Z A;  1BGN A;  1XPQ A;  2XFQ A;  3QVP A;  3ZDN A;  2YG6 A;  3AD7 B;  2BCG G;  2Q6U A;  4KPR A;  4N9X A;  4A5L A;  5HY5 A;  3GYI A;  3PVC A;  1B4V A;  1IUW A;  4UDQ A;  1ZOY A;  4HA6 A;  3ICR A;  1B37 A;  2E5V A;  4Z2R A;  1GRT A;  3H8I A;  3CPH G;  5KOW A;  4Y4M A;  1CHU A;  1D4C A;  1F8R A;  4B1B A;  4YSH A;  4NTC A;  1H7W A;  1UKV G;  2B9Y A;  3GMC A;  1FL2 A;  2BS2 A;  1D4E A;  1BF3 A;  3QSE A;  4IA5 A;  2PHH A;  2WDR A;  2WOI A;  3DJJ A;  4H2R A;  3NLC A;  2FBW A;  2GVC A;  1O94 A;  1TYT A;  5GRT A;  2ARD A;  1EL7 A;  1Y56 B;  2IVE A;  1H86 A;  1H81 A;  1LVL A;  1OJC A;  2BXR A;  3AXB A;  3AE6 A;  3GRT A;  4G6H A;  3L8K A;  1GEU A;  2Q0L A;  3LZX A;  2RGH A;  1B8S A;  3SQP A;  4U8N A;  2OLO A;  1MO9 A;  1XAN A;  1HYU A;  4A9W A;  2UZZ A;  3GD4 A;  1JRX A;  4AOS A;  2WPE A;  2GV8 A;  1GOS A;  5KNL A;  4RG3 A;  4K5R A;  4J31 A;  1YQ4 A;  4Z25 A;  3B3R A;  1PBD A;  4IVM B;  4Y4L A;  4RG4 A;  2V3A A;  1JNZ A;  2V60 A;  1BWC A;  3K7M X;  3UKL A;  2RGJ A;  2BRY A;  2V6O A;  1CJ2 A;  4KX6 A;  2F5Z A;  2GAH B;  1KNR A;  4YTN A;  1KF6 A;  3AB1 A;  2BC1 A;  2BS3 A;  3UKA A;  3G5S A;  5FS7 A;  2Y6R A;  4YKG A;  2AR8 A;  2DKH A;  4BJY A;  2C4C A;  2VVL G;  3H8L A;  3P4Q A;  3FG2 P;  1Y56 A;  1O5W A;  2H89 A;  3ATQ A;  3COX A;  4K5S A;  2WPF A;  2YLT A;  4EMJ A;  2E1M A;  5KMS A;  3L1R A;  4B67 A;  3F8P A;  4DSG A;  1NHQ A;  1NHR A;  1NAA A;  2B76 A;  4ZCC A;  1JRZ A;  3D1C A;  3LB8 A;  2ZBW A;  1F6M A;  2EQ6 A;  3NN0 X;  4J56 A;  4TM3 A;  1ZKQ A;  4H2Q A;  1F8S A;  5FS8 A;  4J2W A;  3VRB A;  4H4R A;  3UOV A;  2R0G A;  4OPL A;  2NVK X;  4XWZ A;  2QA1 A;  1KSS A;  5BVA A;  4I59 A;  1PHH A;  3SFD A;  5KXJ A;  3CTY A;  3ZYX A;  1V59 A;  1JU2 A;  3UKH A;  2GB0 A;  2IVD A;  2JB1 A;  2YR6 A;  1GND A;  3NTD A;  1TDK A;  1VG0 A;  4H4P A;  2FJE A;  4U2S A;  3AED A;  1CJ4 A;  2XLU A;  4K2X A;  5J60 A;  2R4E A;  3AE8 A;  3PS9 A;  3QJ4 A;  2XLP A;  4H4U A;  4OCG A;  1DJQ A;  2C64 A;  3RED A;  1JOA A;  1LJ1 A;  1N4V A;  1ONF A;  1RP0 A;  2ZZ0 A;  3ALL A;  4RSL A;  5CQF A;  2QCU A;  3K7Q X;  3UKF A;  2JBV A; 
#chains in the Genus database with same CATH homology
 3S5W A;  4UP3 A;  4X9N A;  2WOV A;  2X8C A;  3FPZ A;  4GDE A;  4JDR A;  2R4J A;  4NZH A;  3AE2 A;  4D03 A;  1NPX A;  4ICY A;  1GAL A;  1Z6L A;  2PYX A;  2GR1 A;  1H83 A;  2R0C A;  2BA9 A;  4EIP A;  2R0P A;  4OPU A;  3CNJ A;  1H82 A;  3VQR A;  4O5Q A;  3SFE A;  4EQS A;  3UTG A;  3KU9 A;  4H7U A;  4X9M A;  2BAC A;  1PBE A;  1PJ6 A;  3QVR A;  2R46 A;  3KA7 A;  4H4X A;  2WS3 A;  1DOD A;  2RAB A;  2YM2 A;  1CF3 A;  1YKJ A;  2Z5X A;  3CGB A;  5HYM A;  2AAQ A;  4G73 A;  3NG7 X;  3SM8 A;  4TLZ A;  3IC9 A;  3BI2 A;  1LPF A;  2X50 A;  2WU2 A;  3VR9 A;  3DJG X;  4UDP A;  4GDP A;  3FBS A;  2YG7 A;  1K4Q A;  3HYW A;  3SZF A;  4EM4 A;  3CNT A;  2XVH A;  5EB5 A;  4CCR A;  1PXB A;  2OA1 A;  3AYI A;  2EQ8 A;  3NNE A;  4REK A;  1LTX R;  3T37 A;  4OPT A;  2WES A;  4CCQ A;  2WP5 A;  4USR A;  5ER0 A;  1L0V A;  2B9X A;  1BZL A;  2XFN A;  3LZW A;  1NHS A;  3E1T A;  3SY4 A;  2YR4 A;  4NWZ A;  2YG3 A;  2YWL A;  4J33 A;  3RP8 A;  3UKK A;  2GF3 A;  3P9U A;  4J57 A;  2WDV A;  4Z44 A;  3P4P A;  3AD8 B;  1JRY A;  3ABV A;  3EAN A;  4JY2 A;  3F8D A;  3CPI G;  2Y6Q A;  4WCT A;  5EOW A;  1Q1R A;  2NPX A;  1OJA A;  2CUL A;  4A6N B;  1BKW A;  2YLR A;  1REO A;  3V3N A;  3VR8 A;  4A7A A;  4B63 A;  1E1L A;  4EMI A;  1GSN A;  1GRF A;  2QAE A;  1KSU A;  3T2Y A;  1FEC A;  3ICS A;  3LAD A;  4LU6 A;  4H4S A;  4LA1 A;  2C70 A;  5JCK A;  5EB4 A;  3UP4 A;  1EL9 A;  1S2Y A;  2XCG A;  1K0I A;  3GSI A;  4H4Y A;  3EPT A;  1QJD A;  3CNP A;  3UCL A;  4YXD A;  1GRA A;  1ZMC A;  4G9K A;  1EL8 A;  4JN9 A;  4BUR A;  3NT6 A;  2YLZ A;  2C66 A;  2JAE A;  3CGC A;  2A89 A;  1FCD A;  1K0J A;  3GDP A;  1YQ3 A;  1ZY8 A;  2GR2 A;  2FJA A;  2IID A;  4IA6 A;  4CY8 A;  2YG5 A;  3SZW A;  1GT8 A;  1JNR A;  5FS6 A;  3GWD A;  3VRD B;  2A87 A;  4H50 A;  4IV9 A;  1GRB A;  5KVH A;  4CNK A;  3KKJ A;  4YWO A;  5JCL A;  2C67 A;  2BCP A;  2BC0 A;  1NDA A;  4C3X A;  4BK3 A;  1ZK7 A;  1ZOV A;  2H88 A;  2YR5 A;  4EMW A;  1NG4 A;  1PJ5 A;  3M13 A;  2WP9 A;  1N4W A;  4EQX A;  2JKC A;  3DGH A;  2YQU A;  1H6V A;  4U8K A;  3BNM A;  2VRL A;  1GET A;  5JCM A;  4ZN0 A;  4U8O A;  4U8L A;  4U8M A;  5EBK A;  1TYP A;  1PS9 A;  1EBD A;  3AE1 A;  3UTE A;  4AP3 A;  2GMJ A;  4H4Q A;  1PDH A;  4H2N A;  3BHF A;  2HQM A;  4J34 A;  1S3B A;  4J36 A;  1CBO A;  3OZ2 A;  4Z2T A;  2WQY A;  3HZL A;  3RNM A;  2VZ2 A;  1AOG A;  2YLX A;  2GH5 A;  1GRH A;  2GR3 A;  4GAV A;  3K30 A;  2X8G A;  4FK1 A;  2C7G A;  3AE9 A;  3NIX A;  3WE0 A;  3ALM A;  4EIQ A;  4BV6 A;  1D5T A;  2XYO A;  3UOZ A;  1TDF A;  4P9S A;  3ALJ A;  4H4T A;  5KRQ A;  1M64 A;  4OPI A;  2XVJ A;  2YM1 A;  1IUV A;  2CDU A;  4TM0 A;  4PAB A;  4C77 A;  3RP6 A;  4CBQ A;  1IUX A;  4Z26 A;  1N4U A;  4AOX A;  1GRG A;  5HHF A;  4TLX A;  1QO8 A;  2X99 A;  5U25 A;  2XVF A;  3AWI A;  3C96 A;  4B64 A;  4H4Z A;  3SYI A;  1TDO A;  3LOV A;  4II2 A;  4AP1 A;  1DJN A;  3AE3 A;  4II3 A;  3ATR A;  4FX9 A;  1E6E A;  4YKF A;  3NYE A;  4E0V A;  4NTE A;  3CMM A;  2WDQ A;  4O5U A;  3BI4 A;  3CN8 A;  3SXI A;  1B5Q A;  3SZC A;  4B65 A;  3BI5 A;  3H4K A;  5KMP A;  3SGL A;  3B6D A;  3KLJ A;  1DOE A;  1FEB A;  1F3P A;  2VQ7 A;  4XWR A;  4CRT A;  2XVE A;  3DA1 A;  1TDN A;  4GF7 A;  1GV4 A;  3R9U A;  3NGC X;  4TM1 A;  4DSH A;  3GDN A;  2WHD A;  3LJP A;  3HYX A;  2X8H A;  5C2T A;  4OVI A;  3NKS A;  4GCM A;  1ZDL A;  2XLR A;  4NEV A;  3AEF A;  3AD9 B;  1DOC A;  3T31 A;  4OPC A;  1E1M A;  2TPR A;  1L9E A;  3P1W A;  2CFY A;  5M10 A;  4YT0 A;  1CJC A;  1CJ3 A;  3SX6 A;  1CC6 A;  1EL5 A;  2V3B A;  4YTP A;  2XFU A;  2ACZ A;  3AYJ A;  3AE7 A;  4YSY A;  4H4W A;  2YLS A;  2AQJ A;  1X31 B;  1H84 A;  3AE4 A;  2WBA A;  2WU5 A;  3GYJ A;  1LQU A;  2XFP A;  4EQW A;  2BYB A;  4GAP A;  4NEW A;  1VQW A;  3D8X A;  4M52 A;  4JNA A;  4ADW A;  5IQ4 A;  2VOU A;  2OAL A;  2B7R A;  3GWF A;  1Q9I A;  4OPG A;  3O0H A;  4LII A;  3SZ0 A;  1LQT A;  5KMQ A;  1OJT A;  4CY6 A;  2C3C A;  2ZZB A;  3DK8 A;  2BS4 A;  2Q7V A;  1IJH A;  2OAM A;  1E39 A;  1VRQ B;  1O95 A;  2C72 A;  2YG4 A;  3AE5 A;  3BHK A;  1YQZ A;  3LXD A;  3NK2 X;  3NTA A;  2FJD A;  3FMW A;  2JB2 A;  4AT0 A;  4D04 A;  3P4S A;  3NK0 X;  1ELI A;  3K7T A;  3NYC A;  3UP5 A;  2BAB A;  3AEA A;  3ICT A;  1IUT A;  3V3O A;  3V76 A;  1W4X A;  3NYF A;  3I6D A;  1P2H A;  4C5O A;  2CVJ A;  5IPY A;  2YLW A;  2WET A;  3Q6J A;  3DJD A;  2JK6 A;  4H4V A;  1CC2 A;  2BK3 A;  2J3N A;  4A6N A;  1MXT A;  3IHM A;  3VRA A;  1DXL A;  4X4J A;  1VG9 A;  5M0Z A;  3GMB A;  4K7Z A;  2APG A;  3BNU A;  3JSK A;  2GR0 A;  4A99 A;  4K22 A;  3T2Z A;  3NHO X;  3T14 A;  4DNA A;  4NNJ A;  4YSZ A;  5KMR A;  5U63 A;  2WPC A;  3CNS A;  3UOX A;  3AEG A;  5BUL A;  4U8P A;  3GYX A;  4U2L A;  1ZX9 A;  2RGO A;  1LV0 A;  3Q9T A;  3QFB A;  1S3E A;  1CC4 A;  2VQB A;  1Q1W A;  2X3N A;  2XFO A;  3T0K A;  3URH A;  2R9Z A;  2YAU A;  4Y4N A;  1H7X A;  4A79 A;  1XHC A;  1PBB A;  2Z5Y A;  4USQ A;  1OJD A;  3NH3 X;  2JB3 A;  1QLB A;  3EAO A;  3RHA A;  2B7S A;  4TM4 A;  5KOX A;  3P4R A;  3UKQ A;  5FS9 A;  2W0H A;  1PJ7 A;  4BJZ A;  1RYI A;  1DNC A;  1S2Q A;  4YSX A;  2R45 A;  4B69 A;  4Z43 A;  3ADA B;  1TDE A;  1NEN A;  3AEB A;  3C4A A;  3UKP A;  3GRS A;  1L9D A;  1SEZ A;  1PXA A;  1GTH A;  1GXF A;  2GMH A;  3AYL A;  3KVE A;  1VDC A;  3NRN A;  4ZCD A;  1GRE A;  2GQW A;  4GR1 A;  5U1O A;  4JNQ A;  4GRT A;  1PBF A;  4Z2U A;  3UOY A;  1L9C A;  3IWA A;  5JCI A;  4XXG A;  2C73 A;  4UDR A;  3DGZ A;  2BXS A;  3CIR A;  1N1P A;  3UTH A;  2OLN A;  4U2T A;  1YY5 A;  3II4 A;  1P2E A;  3KPK A;  1TRB A;  2V61 A;  4U8I A;  5HXI A;  1NHP A;  3QSS A;  3CGE A;  4JQ9 A;  4PAA A;  4K8D A;  3DK9 A;  2GAG B;  3NN6 X;  5BRT A;  4C74 A;  5FMH A;  5BUK A;  2C3D A;  4H2P A;  2WOW A;  2YVF A;  3CGD A;  2C76 A;  3HYV A;  1ZMD A;  3GD3 A;  2O9Z A;  5CKU A;  1E7P A;  2A8X A;  1IUS A;  3S61 A;  1GPE A;  2GEW A;  3AEC A;  4A65 A;  3CPJ G;  1D7L A;  3EF6 A;  3IHG A;  3DH9 A;  4APN A;  1Y0P A;  4CNJ A;  3F8R A;  1D7Y A;  1NEK A;  3T2K A;  1KFY A;  2EQ9 A;  1FOH A;  2V5Z A;  4MJW A;  3KPF A;  1MOK A;  3IF9 A;  4U8J A;  4G6G A;  5TR3 A;  3KD9 A;  1PBC A;  1RSG A;  2Q0K A;  4ECH A;  1KDG A;  5KVI A;  1GER A;  2VVM A;  5IQ1 A;  2C65 A;  2WEU A;  4B66 A;  3I3L A;  5KWF A;  2C75 A;  2DKI A;  2QA2 A;  3C4N A;  3NK1 X;  5C3J A;  4B68 A;  4HB9 A;  1GTE A;  2FJB A;  3G5Q A;  3CND A;  4FK1 C;  2XLS A;  1XDI A;  1OJ9 A;  1PN0 A;  1GES A;  3UTF A;  4EM3 A;  4NTD A;  3M12 A;  1KNP A;  2XDO A;  1JEH A;  3PO7 A;  1IUU A;  1FEA A;  1BGJ A;  3M0O A;  2XLT A;  3FIM B;  2GQF A;  4GUV A;  1CL0 A;  1NG3 A;  1F8W A;  4G74 A;  2TMD A;  3G5R A;  1D4D A;  2EQ7 A;  2GRT A;  2BK4 A;  4DGK A;  4YTM A;  1E1K A;  4JY3 A;  5J7X A;  4BK1 A;  2B9W A;  2ZZC A;  4C3Y A;  1ZP0 A;  3QFA A;  3DME A;  3RP7 A;  5L46 A;  2XVI A;  4OPD A;  4I58 A;  2VRM A;  1E1N A;  2VVL A;  4EQR A;  3ITJ A;  3OC4 A;  1M6I A;  4Z24 A;  3AEE A;  4WX1 A;  5JCN A;  2YVG A;  2BRA A;  3DJE A;  1DOB A;  2YVJ A;  3DK4 A;  1COY A;  3QSM A;  2E4G A;  2BK5 A;  4IVO B;  5GSN A;  4BK2 A;  2WP6 A;  4AT2 A;  4FDC B;  5DBJ A;  1PXC A;  1K0L A;  3ISH A;  5LV9 A;  2I0Z A;  1BGN A;  1XPQ A;  2XFQ A;  3QVP A;  3ZDN A;  2YG6 A;  3AD7 B;  2BCG G;  2Q6U A;  4KPR A;  4N9X A;  4A5L A;  5HY5 A;  3GYI A;  3PVC A;  1B4V A;  1IUW A;  4UDQ A;  1ZOY A;  4HA6 A;  3ICR A;  1B37 A;  2E5V A;  4Z2R A;  1GRT A;  3H8I A;  3CPH G;  5KOW A;  4Y4M A;  1CHU A;  1D4C A;  1F8R A;  4B1B A;  4YSH A;  4NTC A;  1H7W A;  1UKV G;  2B9Y A;  3GMC A;  1FL2 A;  2BS2 A;  1D4E A;  1BF3 A;  3QSE A;  4IA5 A;  2PHH A;  2WDR A;  2WOI A;  3DJJ A;  4H2R A;  3NLC A;  2FBW A;  2GVC A;  1O94 A;  1TYT A;  5GRT A;  2ARD A;  1EL7 A;  1Y56 B;  2IVE A;  1H86 A;  1H81 A;  1LVL A;  1OJC A;  2BXR A;  3AXB A;  3AE6 A;  3GRT A;  4G6H A;  3L8K A;  1GEU A;  2Q0L A;  3LZX A;  2RGH A;  1B8S A;  3SQP A;  4U8N A;  2OLO A;  1MO9 A;  1XAN A;  1HYU A;  4A9W A;  2UZZ A;  3GD4 A;  1JRX A;  4AOS A;  2WPE A;  2GV8 A;  1GOS A;  5KNL A;  4RG3 A;  4K5R A;  4J31 A;  1YQ4 A;  4Z25 A;  3B3R A;  1PBD A;  4IVM B;  4Y4L A;  4RG4 A;  2V3A A;  1JNZ A;  2V60 A;  1BWC A;  3K7M X;  3UKL A;  2RGJ A;  2BRY A;  2V6O A;  1CJ2 A;  4KX6 A;  2F5Z A;  2GAH B;  1KNR A;  4YTN A;  1KF6 A;  3AB1 A;  2BC1 A;  2BS3 A;  3UKA A;  3G5S A;  5FS7 A;  2Y6R A;  4YKG A;  2AR8 A;  2DKH A;  4BJY A;  2C4C A;  2VVL G;  3H8L A;  3P4Q A;  3FG2 P;  1Y56 A;  1O5W A;  2H89 A;  3ATQ A;  3COX A;  4K5S A;  2WPF A;  2YLT A;  4EMJ A;  2E1M A;  5KMS A;  3L1R A;  4B67 A;  3F8P A;  4DSG A;  1NHQ A;  1NHR A;  1NAA A;  2B76 A;  4ZCC A;  1JRZ A;  3D1C A;  3LB8 A;  2ZBW A;  1F6M A;  2EQ6 A;  3NN0 X;  4J56 A;  4TM3 A;  1ZKQ A;  4H2Q A;  1F8S A;  5FS8 A;  4J2W A;  3VRB A;  4H4R A;  3UOV A;  2R0G A;  4OPL A;  2NVK X;  4XWZ A;  2QA1 A;  1KSS A;  5BVA A;  4I59 A;  1PHH A;  3SFD A;  5KXJ A;  3CTY A;  3ZYX A;  1V59 A;  1JU2 A;  3UKH A;  2GB0 A;  2IVD A;  2JB1 A;  2YR6 A;  1GND A;  3NTD A;  1TDK A;  1VG0 A;  4H4P A;  2FJE A;  4U2S A;  3AED A;  1CJ4 A;  2XLU A;  4K2X A;  5J60 A;  2R4E A;  3AE8 A;  3PS9 A;  3QJ4 A;  2XLP A;  4H4U A;  4OCG A;  1DJQ A;  2C64 A;  3RED A;  1JOA A;  1LJ1 A;  1N4V A;  1ONF A;  1RP0 A;  2ZZ0 A;  3ALL A;  4RSL A;  5CQF A;  2QCU A;  3K7Q X;  3UKF A;  2JBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...