2WHDA

Barley nadph-dependent thioredoxin reductase 2
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
318
structure length
318
Chain Sequence
AAPLRTRVCIIGSGPAAHTAAIYAARAELKPVLFEGWMANDIAAGGQLTTTTDVENFPGFPTGIMGIDLMDNCRAQSVRFGTNILSETVTEVDFSARPFRVTSDSTTVLADTVVVATGAVARRLYFSGSDTYWNRGISACAVCDGAAPIFRNKPIAVIGGGDSAMEEGNFLTKYGSQVYIIHRRNTFRASKIMQARALSNPKIQVVWDSEVVEAYGGAGGGPLAGVKVKNLVTGEVSDLQVSGLFFAIGHEPATKFLNGQLELHADGYVATKPGSTHTSVEGVFAAGDVQDKKYRQAITAAGSGCMAALDAEHYLQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title Structure of Hordeum Vulgare Nadph-Dependent Thioredoxin Reductase 2. Unwinding the Reaction Mechanism.
pubmed doi rcsb
source organism Hordeum vulgare
total genus 92
structure length 318
sequence length 318
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2whdA02
3QSEA 2E5VA 4UDQA 1RSGA 3KU9A 1DOCA 3AXBA 1Z6LA 4NTEA 4YSXA 1GRBA 4X4JA 3GDPA 5CQFA 3CPHG 1D4CA 3PS9A 1NDAA 1PS9A 3DJDA 3F8RA 1OJAA 2YVFA 4H4YA 1GV4A 5TR3A 5BVAA 4H2PA 1MXTA 3FIMB 4LA1A 4OVIA 4D04A 2OLNA 4YKFA 2V61A 1L9DA 4WCTA 4GR1A 4K5RA 4A6NB 3E1TA 3BHKA 1DJNA 3NG7X 3SGLA 1NG3A 3O0HA 2CVJA 1D4DA 3DH9A 2WDRA 1E1MA 3SFEA 1L0VA 5KRQA 3QVRA 4TM1A 4Z26A 4JQ9A 4NTDA 5HY5A 4EMJA 1BKWA 1MOKA 1IUXA 3NTAA 1Q1WA 1ZY8A 2QCUA 1ELIA 1KSUA 2YR5A 3EF6A 1ZDLA 1VG9A 3HZLA 4U8LA 3VR8A 2DKIA 3NT6A 1O94A 4YT0A 2XVJA 4ADWA 3RHAA 1M6IA 2WS3A 2ARDA 2QA2A 2XLUA 3DK8A 3RP6A 1ZMDA 3ALMA 4D03A 4FK1A 2C65A 4YSZA 1DOEA 3UKHA 1KSSA 3NTDA 2XFOA 4H50A 3BI4A 4U8JA 4FDCB 4B1BA 5EOWA 3GMCA 1N1PA 1O5WA 1S3EA 2BS2A 3DGZA 4J36A 2WU5A 3SQPA 4OPCA 3D8XA 1NEKA 4P9SA 1KDGA 1CBOA 1YKJA 4XWZA 5HXIA 1GNDA 4X9NA 3AE7A 1F8SA 1IUSA 3ICTA 1NHQA 1ONFA 3Q6JA 4IA6A 3M0OA 5FS6A 3LXDA 4X9MA 2C76A 2VVLA 3NKSA 2XFQA 4A7AA 5GRTA 1S2QA 2UZZA 4I58A 3REDA 2JB3A 4H7UA 2W0HA 1YY5A 4IVOB 4BJZA 3ISHA 1CJCA 2WPCA 4K5SA 1PHHA 1Y0PA 3DJGX 1UKVG 3AE1A 2XFPA 2VQ7A 4A79A 2H88A 4EQRA 4E0VA 1CJ3A 1KNRA 3AD8B 1GTHA 2JBVA 2H89A 2QA1A 3ALLA 1B8SA 2ZZBA 2WEUA 4EM3A 4OPIA 1DXLA 3CPJG 5DBJA 5JCIA 1P2EA 2BXRA 4Z2RA 4LU6A 1BZLA 2VVMA 4IV9A 1GALA 1TRBA 2J3NA 1F6MA 1JRZA 2YG7A 4YSYA 5C2TA 3PO7A 2WHDA 2XLRA 4B69A 2XLSA 4Z43A 2C67A 5JCKA 4GF7A 3CGDA 1FOHA 4U2SA 2BACA 3SFDA 2CFYA 1JNRA 1H83A 1F3PA 4YXDA 2YLZA 1O95A 4JY2A 3UP5A 4REKA 4U8OA 3AE4A 1FEBA 5FS8A 2B7SA 3G5QA 4ZCCA 3FMWA 2AQJA 4LIIA 4RSLA 5IQ4A 1AOGA 3NNEA 5EB4A 1NAAA 3IHMA 4B67A 1BF3A 4EQSA 2YLRA 4ZN0A 2VZ2A 2X8GA 1BWCA 1L9EA 5KVIA 4KPRA 3CIRA 2GR0A 3UKQA 3QFAA 2PYXA 1IUTA 2C73A 4U2LA 2XVFA 3G5RA 4AT0A 2OA1A 4ECHA 3DJJA 3H8LA 3GRTA 3DJEA 4B65A 4U8IA 3UKPA 3L1RA 4H4RA 3GRSA 4RG4A 1IUUA 1XANA 3OZ2A 1CC4A 2R0PA 4C5OA 4AP3A 4BV6A 1OJDA 1OJTA 2C3CA 2JAEA 2X8CA 3QFBA 4H4WA 4EMIA 1GOSA 2B7RA 2YLWA 1CC6A 2GAHB 1GREA 3K30A 1FCDA 4UDRA 1FEAA 1K4QA 2XDOA 1DOBA 1HYUA 1QO8A 1LQTA 2XLPA 4Y4NA 2V5ZA 4U8KA 3LZXA 2R9ZA 4NEWA 3LB8A 4TM3A 3DGHA 3P9UA 2WESA 3CGEA 2R0CA 2VVLG 2VRMA 3ICSA 4AT2A 3AE6A 1NG4A 2YLSA 3CTYA 3JSKA 1EL7A 4DSGA 2GMJA 3FG2P 3P4SA 4YTMA 4OPTA 4C74A 5J60A 4Z44A 2CDUA 1CJ4A 1JEHA 3KVEA 3NIXA 4K2XA 4OPDA 3GSIA 3UOZA 3CN8A 4IVMB 1IUVA 2Y6RA 4B66A 4C77A 1RP0A 2R45A 2XVHA 3UOVA 1YQZA 3VRDB 2B9XA 3AYIA 4H4PA 4JNAA 4EIPA 1PBDA 4GRTA 1S2YA 1S3BA 2A8XA 4FX9A 3L8KA 2JB1A 5JCMA 3AE9A 5M10A 2C3DA 3ATRA 3DK9A 1ZX9A 2RGOA 4A9WA 1JU2A 1PJ6A 1TYTA 3NK1X 3P4RA 3RNMA 2BCPA 3CNDA 5BUKA 3B6DA 4M52A 4J34A 4HA6A 2V3AA 3D1CA 3BNUA 3DA1A 4TM4A 3IF9A 5GSNA 2AR8A 4DNAA 1X31B 4H4SA 1GESA 3T37A 1Q9IA 2Q0LA 3AEEA 4AOXA 4K7ZA 5ER0A 2NVKX 3IHGA 1LPFA 2QAEA 5L46A 2ZZ0A 4Z2UA 2NPXA 2Z5XA 3AYJA 4BURA 2GAGB 1EL5A 1PJ5A 3CNTA 4YTPA 3H4KA 2BK5A 2YG3A 1BGJA 2EQ7A 3CNJA 3F8PA 1Q1RA 3LOVA 4Z2TA 3RP8A 3UCLA 1JOAA 4JDRA 2Q6UA 3UKAA 4A6NA 1JRXA 4NTCA 1DNCA 2WP6A 1XDIA 1TDEA 4A99A 5HHFA 2EQ9A 4I59A 4B64A 1F8RA 4USRA 2R4EA 2WP9A 4YTNA 3FPZA 5FMHA 1DODA 2OAMA 4A5LA 4U8PA 5EBKA 2X3NA 3ICRA 3NK2X 1PXAA 4OCGA 3GD4A 3NK0X 2ACZA 4OPLA 1B37A 5KVHA 1NHPA 2FJAA 2XLTA 5IQ1A 1GEUA 5U1OA 3VRBA 3AEBA 2C66A 1H7XA 3II4A 4H4VA 2GQWA 1D7YA 2ZBWA 3LADA 5JCNA 4O5UA 4TLZA 3KA7A 4JNQA 4CCQA 4EQXA 5U25A 1D4EA 3I3LA 2HQMA 1Y56B 4B63A 2GH5A 2GQFA 2O9ZA 2TPRA 1IJHA 4GDPA 3AE5A 3OC4A 1CJ2A 4ZCDA 3GWDA 2YLXA 3V3OA 2BYBA 1E1NA 5J7XA 2WQYA 3M12A 1H82A 4OPUA 4ICYA 1GRTA 1PXCA 4J33A 1NENA 4Z25A 4PABA 4YSHA 2B9YA 3WE0A 1TYPA 3QSSA 1GT8A 5U63A 1GRGA 3BI5A 4UP3A 4CCRA 4FK1C 1VG0A 3UTGA 2YR4A 2FJEA 1LQUA 2WETA 1N4UA 3GD3A 1DJQA 1V59A 1TDOA 5FS9A 4DSHA 2XVIA 1B4VA 1CHUA 3G5SA 1YQ3A 4GDEA 4N9XA 1M64A 1GPEA 5EB5A 2C70A 2WDVA 2E1MA 3QSMA 4GCMA 3KD9A 3AEDA 1QLBA 1E1KA 2XYOA 3NGCX 1H81A 2XCGA 1GSNA 2GEWA 1CL0A 1N4VA 3PVCA 2X99A 5C3JA 1D7LA 2JK6A 2XFUA 4TM0A 2RABA 2JB2A 3LJPA 4YKGA 2A87A 2WDQA 1K0LA 3Q9TA 1NHSA 4H2RA 4BK1A 3UKKA 2BS3A 2C75A 2GR3A 1P2HA 1TDNA 1ZOVA 2VRLA 1ZK7A 2YQUA 1SEZA 2GR2A 3H8IA 2Z5YA 4J2WA 2YR6A 4K8DA 2Y6QA 1Y56A 2GMHA 3QJ4A 2X8HA 3F8DA 1ZKQA 1LV0A 2R46A 1LVLA 2YM2A 4C3YA 2E4GA 2IVDA 1GXFA 5FS7A 3RP7A 5BRTA 1YQ4A 2AAQA 2OALA 2Q7VA 2VQBA 4RG3A 2IVEA 2WBAA 4H4TA 3CGCA 4Y4LA 5KOXA 2GR1A 2BA9A 2CULA 4U2TA 4UDPA 1XPQA 3C96A 3KKJA 3AEGA 2BCGG 2R0GA 2TMDA 2BK4A 4CNJA 1OJCA 3UKFA 2B9WA 1K0IA 2YM1A 1RYIA 4H4ZA 3AECA 3DK4A 5KOWA 1K0JA 5KXJA 4APNA 1JRYA 1B5QA 4EMWA 3CNPA 1MO9A 1CF3A 1N4WA 2YG5A 1JNZA 3SM8A 1D5TA 2Q0KA 4J56A 2GF3A 1E39A 4O5QA 3P1WA 1GRAA 4HB9A 5CKUA 3S61A 4A65A 3M13A 3GYJA 1PBFA 3AWIA 1PBBA 3IWAA 2YG6A 3VRAA 1XHCA 1GRHA 3ABVA 2YAUA 4JN9A 3V76A 5LV9A 1W4XA 3K7TA 3P4PA 1NPXA 3AYLA 3AE3A 4U8NA 3ALJA 3GWFA 2OLOA 1GERA 2C72A 1KNPA 2RGHA 1OJ9A 1NHRA 2F5ZA 2B76A 4K22A 3NYCA 4U8MA 1PXBA 1PDHA 3QVPA 3UTHA 4YWOA 3AE8A 4CY8A 2WOVA 4BK3A 1VRQB 3NH3X 1H6VA 2BC1A 2WPFA 1E7PA 1LTXR 3C4AA 5KWFA 2FJBA 2WOWA 3AD9B 5BULA 1L9CA 1TDFA 4IA5A 2FBWA 3NLCA 3UKLA 3ATQA 1GTEA 2YLTA 4MJWA 4H4QA 2YVGA 4OPGA 1F8WA 4PAAA 4TLXA 3UOXA 4C3XA 3GMBA 3ADAB 3NHOX 4BJYA 1ZOYA 2A89A 3COXA 3AEFA 3BHFA 4Z24A 3EANA 4DGKA 2I0ZA 3B3RA 3V3NA 4CRTA 3EPTA 2PHHA 3AEAA 4NZHA 4XWRA 1REOA 4AOSA 4CY6A 3CPIG 1E6EA 3UP4A 3NN0X 4J31A 3ZDNA 1H86A 2BK3A 3URHA 2V3BA 2YVJA 3GYIA 4J57A 2DKHA 2EQ8A 2FJDA 1BGNA 4GUVA 3BI2A 3BNMA 4H4XA 5IPYA 4KX6A 2GB0A 2GVCA 3NYFA 1PJ7A 5HYMA 4EIQA 3FBSA 2XFNA 4NEVA 4WX1A 4Y4MA 3NRNA 1KF6A 2JKCA 3UTEA 1EBDA 1ZMCA 1H7WA 3AD7B 1COYA 1VDCA 2WU2A 4H2NA 4BK2A 3KPFA 2WP5A 2YG4A 1QJDA 3CGBA 3DMEA 2BS4A 4XXGA 3UOYA 3LZWA 1FECA 1E1LA 2GRTA 1EL9A 3EAOA 3S5WA 3UTFA 3ZYXA 4CBQA 3AE2A 3ITJA 5M0ZA 2V60A 4H4UA 1CC2A 2XVEA 3K7MX 1VQWA 4H2QA 4AP1A 1PBEA 1GRFA 2BXSA 4CNKA 1GETA 3CNSA 3K7QX 2C7GA 3KLJA 3P4QA 2BABA 1H84A 2YWLA 2EQ6A 3NN6X 5JCLA 4B68A 4USQA 2GV8A 2RGJA 4JY3A 2WPEA 3I6DA 3R9UA 2IIDA 2V6OA 1PBCA 4EQWA 1KFYA 1TDKA 1EL8A 3GDNA 1PN0A 4EM4A 2APGA 1FL2A 2C64A 2WOIA 2R4JA 3NYEA 2VOUA 1LJ1A 2ZZCA 3VR9A 2X50A 3VQRA 1ZP0A 2BC0A 3AB1A 3C4NA 3IC9A 1IUWA
chains in the Genus database with same CATH superfamily
3QSEA 2E5VA 4UDQA 4II3A 1RSGA 3KU9A 1DOCA 3AXBA 1Z6LA 4NTEA 4YSXA 1GRBA 4X4JA 3GDPA 5CQFA 3CPHG 1D4CA 3PS9A 1NDAA 1PS9A 3DJDA 3F8RA 1OJAA 2YVFA 4H4YA 1GV4A 5TR3A 5BVAA 5KMPA 4H2PA 1MXTA 3FIMB 4LA1A 4OVIA 4D04A 2OLNA 4YKFA 2V61A 1L9DA 4WCTA 4GR1A 4K5RA 4A6NB 3E1TA 3BHKA 1DJNA 3NG7X 3SGLA 1NG3A 3O0HA 2CVJA 1D4DA 3DH9A 2WDRA 1E1MA 3SFEA 1L0VA 4G6HA 3SZWA 5KRQA 4NWZA 3QVRA 4TM1A 4Z26A 4JQ9A 4NTDA 5HY5A 4EMJA 1BKWA 1MOKA 1IUXA 3NTAA 1Q1WA 1ZY8A 2QCUA 1ELIA 1KSUA 2YR5A 3EF6A 3T14A 1ZDLA 1VG9A 3HZLA 4U8LA 3VR8A 2DKIA 3NT6A 1O94A 4YT0A 2XVJA 4ADWA 3RHAA 1M6IA 2WS3A 2ARDA 2QA2A 2XLUA 3DK8A 3RP6A 1ZMDA 3ALMA 4D03A 4FK1A 2C65A 4YSZA 1DOEA 3UKHA 1KSSA 3NTDA 2XFOA 4H50A 3BI4A 4U8JA 4FDCB 4B1BA 5EOWA 3GMCA 1N1PA 1O5WA 1S3EA 2BS2A 3DGZA 4J36A 2WU5A 3SQPA 4OPCA 3D8XA 1NEKA 4P9SA 1KDGA 1CBOA 1YKJA 4XWZA 5HXIA 1GNDA 4X9NA 3AE7A 1F8SA 1IUSA 3ICTA 1NHQA 1ONFA 3Q6JA 4IA6A 3M0OA 5FS6A 3LXDA 4X9MA 2C76A 2VVLA 3NKSA 2XFQA 4A7AA 5GRTA 1S2QA 4GAPA 2UZZA 4I58A 3REDA 2JB3A 4H7UA 2W0HA 1YY5A 4IVOB 4BJZA 3ISHA 1CJCA 2WPCA 4K5SA 1PHHA 1Y0PA 3DJGX 1UKVG 3AE1A 2XFPA 2VQ7A 4A79A 2H88A 4EQRA 4E0VA 1CJ3A 1KNRA 3AD8B 1GTHA 2JBVA 2H89A 2QA1A 3ALLA 1B8SA 2ZZBA 2WEUA 4EM3A 3SYIA 4II2A 4OPIA 1DXLA 3CPJG 5DBJA 5JCIA 1P2EA 2BXRA 4Z2RA 4LU6A 1BZLA 2VVMA 4IV9A 4NNJA 1GALA 1TRBA 2J3NA 1F6MA 1JRZA 2YG7A 4YSYA 5C2TA 3PO7A 2WHDA 2XLRA 4B69A 2XLSA 4Z43A 2C67A 5JCKA 4GF7A 3CGDA 1FOHA 4U2SA 2BACA 3SFDA 2CFYA 1JNRA 1H83A 1F3PA 4YXDA 2YLZA 3SZ0A 1O95A 4JY2A 3UP5A 4REKA 4U8OA 3AE4A 1FEBA 3HYXA 5FS8A 2B7SA 3G5QA 4ZCCA 3KPKA 3FMWA 2AQJA 4LIIA 2C4CA 4RSLA 5IQ4A 3NNEA 1AOGA 5EB4A 1NAAA 3IHMA 4B67A 1BF3A 4EQSA 2YLRA 4ZN0A 2VZ2A 2X8GA 1BWCA 1L9EA 5KVIA 4KPRA 3CIRA 2GR0A 3UKQA 3QFAA 2PYXA 1IUTA 2C73A 4U2LA 3GYXA 2XVFA 3G5RA 4AT0A 2OA1A 4ECHA 3DJJA 3H8LA 3GRTA 3DJEA 4B65A 4U8IA 3UKPA 3L1RA 4H4RA 3GRSA 4RG4A 1IUUA 1XANA 3OZ2A 1CC4A 2R0PA 4C5OA 4AP3A 4BV6A 1OJDA 1OJTA 2C3CA 2JAEA 2X8CA 3QFBA 4H4WA 4EMIA 1GOSA 2B7RA 2YLWA 1CC6A 2GAHB 1GREA 3K30A 1FCDA 4UDRA 1FEAA 1K4QA 2XDOA 1DOBA 1HYUA 1QO8A 1LQTA 2XLPA 4Y4NA 2V5ZA 4U8KA 3LZXA 2R9ZA 4NEWA 3LB8A 4TM3A 3DGHA 3P9UA 2WESA 3CGEA 2R0CA 2VVLG 2VRMA 3ICSA 4AT2A 3AE6A 1NG4A 2YLSA 3CTYA 3JSKA 1EL7A 4DSGA 2GMJA 3FG2P 3P4SA 4YTMA 4OPTA 4C74A 5J60A 4Z44A 2CDUA 1CJ4A 1JEHA 3KVEA 3NIXA 4K2XA 4OPDA 3GSIA 3UOZA 3CN8A 4IVMB 1IUVA 2Y6RA 4B66A 4C77A 5KMRA 1RP0A 4G74A 2R45A 2XVHA 3UOVA 1YQZA 4G73A 3VRDB 2B9XA 3AYIA 4H4PA 4JNAA 2BRAA 4EIPA 1PBDA 4GRTA 1S2YA 1S3BA 2A8XA 4FX9A 3L8KA 2JB1A 5JCMA 3AE9A 5M10A 2C3DA 3ATRA 3DK9A 1ZX9A 2RGOA 4A9WA 1JU2A 1PJ6A 1TYTA 3NK1X 3P4RA 3RNMA 2BCPA 3CNDA 5BUKA 3CMMA 3B6DA 4M52A 4J34A 4HA6A 2V3AA 3D1CA 3BNUA 3DA1A 3T2YA 4TM4A 3IF9A 5GSNA 2AR8A 4DNAA 1X31B 4H4SA 1GESA 3T37A 1Q9IA 2Q0LA 3AEEA 4AOXA 4K7ZA 5ER0A 2NVKX 3IHGA 1LPFA 2QAEA 5L46A 2ZZ0A 4Z2UA 2NPXA 2Z5XA 3AYJA 4BURA 2GAGB 1EL5A 1PJ5A 3CNTA 4YTPA 3H4KA 2BK5A 2YG3A 1BGJA 2EQ7A 3CNJA 3F8PA 1Q1RA 3LOVA 4Z2TA 3RP8A 3UCLA 1JOAA 4JDRA 2Q6UA 3UKAA 4A6NA 1JRXA 4NTCA 1DNCA 2WP6A 1XDIA 1TDEA 4A99A 5HHFA 2EQ9A 3T0KA 4I59A 4B64A 1F8RA 4USRA 2R4EA 2WP9A 4YTNA 3FPZA 5FMHA 1DODA 2OAMA 4A5LA 4U8PA 5EBKA 2X3NA 3ICRA 3NK2X 1PXAA 4OCGA 3GD4A 3NK0X 2ACZA 4OPLA 1B37A 5KVHA 1NHPA 2FJAA 2XLTA 5IQ1A 1GEUA 5U1OA 3VRBA 3SXIA 3AEBA 2C66A 1H7XA 3II4A 4H4VA 2GQWA 1D7YA 2ZBWA 3LADA 5JCNA 4O5UA 4TLZA 3KA7A 4JNQA 4CCQA 4EQXA 5U25A 1D4EA 3I3LA 2HQMA 1Y56B 4B63A 2GH5A 2GQFA 2O9ZA 2TPRA 1IJHA 4GDPA 3AE5A 3OC4A 1CJ2A 4ZCDA 3GWDA 2YLXA 3V3OA 2BYBA 1E1NA 3SZCA 5J7XA 2WQYA 3M12A 3SZFA 1H82A 4OPUA 4ICYA 1GRTA 1PXCA 4J33A 1NENA 4Z25A 4PABA 4YSHA 2B9YA 3WE0A 1TYPA 3QSSA 1GT8A 5U63A 1GRGA 3BI5A 4UP3A 4CCRA 4FK1C 1VG0A 4GAVA 2YR4A 3UTGA 2FJEA 1LQUA 2WETA 1N4UA 3GD3A 1DJQA 1V59A 1TDOA 5FS9A 4DSHA 2XVIA 1B4VA 1CHUA 3G5SA 1YQ3A 4GDEA 4N9XA 1M64A 1GPEA 5EB5A 2C70A 2WDVA 2E1MA 3QSMA 4GCMA 3KD9A 3AEDA 1QLBA 1E1KA 2XYOA 3NGCX 1H81A 2XCGA 3HYWA 1GSNA 2GEWA 1CL0A 1N4VA 3PVCA 2X99A 5C3JA 1D7LA 2JK6A 2XFUA 4TM0A 2RABA 2JB2A 3LJPA 4YKGA 2A87A 2WDQA 1K0LA 3Q9TA 1NHSA 4H2RA 4BK1A 3UKKA 2BS3A 2C75A 2GR3A 3T31A 1P2HA 1TDNA 1ZOVA 2VRLA 1ZK7A 2YQUA 1SEZA 2GR2A 3H8IA 2Z5YA 4J2WA 2YR6A 4K8DA 2Y6QA 1Y56A 2GMHA 3QJ4A 2X8HA 3F8DA 1ZKQA 1LV0A 2R46A 1LVLA 2YM2A 4C3YA 2E4GA 2IVDA 1GXFA 5FS7A 3RP7A 5BRTA 1YQ4A 2AAQA 2OALA 2Q7VA 2VQBA 4RG3A 2IVEA 2WBAA 3T2KA 4H4TA 3CGCA 4Y4LA 5KOXA 2GR1A 2BA9A 2CULA 4U2TA 4UDPA 1XPQA 3C96A 3KKJA 3AEGA 3HYVA 2BCGG 2R0GA 2TMDA 2BK4A 4CNJA 1OJCA 3UKFA 2B9WA 1K0IA 2YM1A 1RYIA 4H4ZA 3AECA 3DK4A 5KOWA 1K0JA 5KXJA 4APNA 1JRYA 1B5QA 4EMWA 3CNPA 1MO9A 1CF3A 1N4WA 2YG5A 1JNZA 3SM8A 1D5TA 2Q0KA 4J56A 2GF3A 1E39A 4O5QA 3P1WA 1GRAA 4HB9A 5CKUA 3S61A 4A65A 3M13A 3GYJA 1PBFA 3AWIA 1PBBA 3IWAA 2YG6A 3VRAA 1XHCA 1GRHA 3ABVA 2YAUA 4JN9A 3V76A 5LV9A 1W4XA 3K7TA 3P4PA 1NPXA 3AYLA 3AE3A 4U8NA 3ALJA 3GWFA 3SX6A 2OLOA 1GERA 2C72A 1KNPA 2RGHA 1OJ9A 1NHRA 2F5ZA 2B76A 4G9KA 4K22A 3NYCA 4U8MA 1PXBA 1PDHA 3QVPA 3UTHA 4YWOA 3AE8A 4CY8A 2WOVA 4BK3A 1VRQB 3NH3X 1H6VA 2BC1A 2WPFA 1E7PA 5KMSA 1LTXR 3C4AA 5KWFA 2FJBA 2WOWA 3AD9B 5BULA 1L9CA 1TDFA 4IA5A 2FBWA 3NLCA 3UKLA 3ATQA 1GTEA 2YLTA 4MJWA 4H4QA 2YVGA 4OPGA 1F8WA 4PAAA 4TLXA 3UOXA 4C3XA 3GMBA 3ADAB 3NHOX 4BJYA 1ZOYA 2A89A 3COXA 3AEFA 3BHFA 4Z24A 3EANA 4DGKA 2I0ZA 3B3RA 3V3NA 5KMQA 4CRTA 3EPTA 2PHHA 3AEAA 4NZHA 4XWRA 1REOA 4AOSA 4CY6A 3CPIG 1E6EA 3UP4A 3NN0X 4J31A 2BRYA 3ZDNA 1H86A 2BK3A 3URHA 2V3BA 2YVJA 3GYIA 4J57A 2DKHA 2EQ8A 2FJDA 1BGNA 4GUVA 3BI2A 3BNMA 4H4XA 5IPYA 4KX6A 2GB0A 2GVCA 3NYFA 1PJ7A 5HYMA 4EIQA 3FBSA 2XFNA 4NEVA 4WX1A 4Y4MA 3NRNA 1KF6A 2JKCA 3UTEA 1EBDA 1ZMCA 1H7WA 3AD7B 1COYA 1VDCA 2WU2A 4H2NA 4BK2A 3KPFA 2WP5A 2YG4A 1QJDA 3CGBA 3DMEA 2BS4A 4XXGA 3UOYA 3LZWA 1FECA 1E1LA 2GRTA 1EL9A 3EAOA 3S5WA 3UTFA 3ZYXA 4CBQA 3AE2A 3ITJA 5M0ZA 2V60A 4H4UA 1CC2A 2XVEA 3K7MX 1VQWA 4H2QA 4AP1A 1PBEA 1GRFA 2BXSA 4CNKA 1GETA 3CNSA 3K7QX 2C7GA 3KLJA 3P4QA 2BABA 1H84A 2YWLA 2EQ6A 3NN6X 5JCLA 4B68A 4G6GA 4USQA 2GV8A 2RGJA 4JY3A 3SY4A 2WPEA 5KNLA 3I6DA 3R9UA 2IIDA 2V6OA 1PBCA 4EQWA 1KFYA 1TDKA 3T2ZA 1EL8A 3GDNA 1PN0A 4EM4A 2APGA 1FL2A 2C64A 2WOIA 2R4JA 3NYEA 2VOUA 1LJ1A 2ZZCA 3VR9A 2X50A 3VQRA 1ZP0A 2BC0A 3AB1A 3C4NA 3IC9A 1IUWA
chains in the Genus database with same CATH topology
3QSEA 2E5VA 4UDQA 4II3A 1RSGA 3KU9A 1DOCA 3AXBA 1Z6LA 4NTEA 4YSXA 1GRBA 4X4JA 3GDPA 5CQFA 3CPHG 1D4CA 3PS9A 1NDAA 1PS9A 3DJDA 3F8RA 1OJAA 2YVFA 4H4YA 1GV4A 5TR3A 5BVAA 5KMPA 4H2PA 1MXTA 3FIMB 4LA1A 4OVIA 4D04A 2OLNA 4YKFA 2V61A 1L9DA 4WCTA 4GR1A 4K5RA 4A6NB 3E1TA 3BHKA 1DJNA 3NG7X 3SGLA 1NG3A 3O0HA 2CVJA 1D4DA 3DH9A 2WDRA 1E1MA 3SFEA 1L0VA 4G6HA 3SZWA 5KRQA 4NWZA 3QVRA 4TM1A 4Z26A 4JQ9A 4NTDA 5HY5A 4EMJA 1BKWA 1MOKA 1IUXA 3NTAA 1Q1WA 1ZY8A 2QCUA 1ELIA 1KSUA 2YR5A 3EF6A 3T14A 1ZDLA 1VG9A 3HZLA 4U8LA 3VR8A 2DKIA 3NT6A 1O94A 4YT0A 2XVJA 4ADWA 3RHAA 1M6IA 2WS3A 2ARDA 2QA2A 2XLUA 3DK8A 3RP6A 1ZMDA 3ALMA 4D03A 4FK1A 2C65A 4YSZA 1DOEA 3UKHA 1KSSA 3NTDA 2XFOA 4H50A 3BI4A 4U8JA 4FDCB 4B1BA 5EOWA 3GMCA 1N1PA 1O5WA 1S3EA 2BS2A 3DGZA 4J36A 2WU5A 3SQPA 4OPCA 3D8XA 1NEKA 4P9SA 1KDGA 1CBOA 1YKJA 4XWZA 5HXIA 1GNDA 4X9NA 3AE7A 1F8SA 1IUSA 3ICTA 1NHQA 1ONFA 3Q6JA 4IA6A 3M0OA 5FS6A 3LXDA 4X9MA 2C76A 2VVLA 3NKSA 2XFQA 4A7AA 5GRTA 1S2QA 4GAPA 2UZZA 4I58A 3REDA 2JB3A 4H7UA 2W0HA 1YY5A 4IVOB 4BJZA 3ISHA 1CJCA 2WPCA 4K5SA 1PHHA 1Y0PA 3DJGX 1UKVG 3AE1A 2XFPA 2VQ7A 4A79A 2H88A 4EQRA 4E0VA 1CJ3A 1KNRA 3AD8B 1GTHA 2JBVA 2H89A 2QA1A 3ALLA 1B8SA 2ZZBA 2WEUA 4EM3A 3SYIA 4II2A 4OPIA 1DXLA 3CPJG 5DBJA 5JCIA 1P2EA 2BXRA 4Z2RA 4LU6A 1BZLA 2VVMA 4IV9A 4NNJA 1GALA 1TRBA 2J3NA 1F6MA 1JRZA 2YG7A 4YSYA 5C2TA 3PO7A 2WHDA 2XLRA 4B69A 2XLSA 4Z43A 2C67A 5JCKA 4GF7A 3CGDA 1FOHA 4U2SA 2BACA 3SFDA 2CFYA 1JNRA 1H83A 1F3PA 4YXDA 2YLZA 3SZ0A 1O95A 4JY2A 3UP5A 4REKA 4U8OA 3AE4A 1FEBA 3HYXA 5FS8A 2B7SA 3G5QA 4ZCCA 3KPKA 3FMWA 2AQJA 4LIIA 2C4CA 4RSLA 5IQ4A 3NNEA 1AOGA 5EB4A 1NAAA 3IHMA 4B67A 1BF3A 4EQSA 2YLRA 4ZN0A 2VZ2A 2X8GA 1BWCA 1L9EA 5KVIA 4KPRA 3CIRA 2GR0A 3UKQA 3QFAA 2PYXA 1IUTA 2C73A 4U2LA 3GYXA 2XVFA 3G5RA 4AT0A 2OA1A 4ECHA 3DJJA 3H8LA 3GRTA 3DJEA 4B65A 4U8IA 3UKPA 3L1RA 4H4RA 3GRSA 4RG4A 1IUUA 1XANA 3OZ2A 1CC4A 2R0PA 4C5OA 4AP3A 4BV6A 1OJDA 1OJTA 2C3CA 2JAEA 2X8CA 3QFBA 4H4WA 4EMIA 1GOSA 2B7RA 2YLWA 1CC6A 2GAHB 1GREA 3K30A 1FCDA 4UDRA 1FEAA 1K4QA 2XDOA 1DOBA 1HYUA 1QO8A 1LQTA 2XLPA 4Y4NA 2V5ZA 4U8KA 3LZXA 2R9ZA 4NEWA 3LB8A 4TM3A 3DGHA 3P9UA 2WESA 3CGEA 2R0CA 2VVLG 2VRMA 3ICSA 4AT2A 3AE6A 1NG4A 2YLSA 3CTYA 3JSKA 1EL7A 4DSGA 2GMJA 3FG2P 3P4SA 4YTMA 4OPTA 4C74A 5J60A 4Z44A 2CDUA 1CJ4A 1JEHA 3KVEA 3NIXA 4K2XA 4OPDA 3GSIA 3UOZA 3CN8A 4IVMB 1IUVA 2Y6RA 4B66A 4C77A 5KMRA 1RP0A 4G74A 2R45A 2XVHA 3UOVA 1YQZA 4G73A 3VRDB 2B9XA 3AYIA 4H4PA 4JNAA 2BRAA 4EIPA 1PBDA 4GRTA 1S2YA 1S3BA 2A8XA 4FX9A 3L8KA 2JB1A 5JCMA 3AE9A 5M10A 2C3DA 3ATRA 3DK9A 1ZX9A 2RGOA 4A9WA 1JU2A 1PJ6A 1TYTA 3NK1X 3P4RA 3RNMA 2BCPA 3CNDA 5BUKA 3CMMA 3B6DA 4M52A 4J34A 4HA6A 2V3AA 3D1CA 3BNUA 3DA1A 3T2YA 4TM4A 3IF9A 5GSNA 2AR8A 4DNAA 1X31B 4H4SA 1GESA 3T37A 1Q9IA 2Q0LA 3AEEA 4AOXA 4K7ZA 5ER0A 2NVKX 3IHGA 1LPFA 2QAEA 5L46A 2ZZ0A 4Z2UA 2NPXA 2Z5XA 3AYJA 4BURA 2GAGB 1EL5A 1PJ5A 3CNTA 4YTPA 3H4KA 2BK5A 2YG3A 1BGJA 2EQ7A 3CNJA 3F8PA 1Q1RA 3LOVA 4Z2TA 3RP8A 3UCLA 1JOAA 4JDRA 2Q6UA 3UKAA 4A6NA 1JRXA 4NTCA 1DNCA 2WP6A 1XDIA 1TDEA 4A99A 5HHFA 2EQ9A 3T0KA 4I59A 4B64A 1F8RA 4USRA 2R4EA 2WP9A 4YTNA 3FPZA 5FMHA 1DODA 2OAMA 4A5LA 4U8PA 5EBKA 2X3NA 3ICRA 3NK2X 1PXAA 4OCGA 3GD4A 3NK0X 2ACZA 4OPLA 1B37A 5KVHA 1NHPA 2FJAA 2XLTA 5IQ1A 1GEUA 5U1OA 3VRBA 3SXIA 3AEBA 2C66A 1H7XA 3II4A 4H4VA 2GQWA 1D7YA 2ZBWA 3LADA 5JCNA 4O5UA 4TLZA 3KA7A 4JNQA 4CCQA 4EQXA 5U25A 1D4EA 3I3LA 2HQMA 1Y56B 4B63A 2GH5A 2GQFA 2O9ZA 2TPRA 1IJHA 4GDPA 3AE5A 3OC4A 1CJ2A 4ZCDA 3GWDA 2YLXA 3V3OA 2BYBA 1E1NA 3SZCA 5J7XA 2WQYA 3M12A 3SZFA 1H82A 4OPUA 4ICYA 1GRTA 1PXCA 4J33A 1NENA 4Z25A 4PABA 4YSHA 2B9YA 3WE0A 1TYPA 3QSSA 1GT8A 5U63A 1GRGA 3BI5A 4UP3A 4CCRA 4FK1C 1VG0A 4GAVA 2YR4A 3UTGA 2FJEA 1LQUA 2WETA 1N4UA 3GD3A 1DJQA 1V59A 1TDOA 5FS9A 4DSHA 2XVIA 1B4VA 1CHUA 3G5SA 1YQ3A 4GDEA 4N9XA 1M64A 1GPEA 5EB5A 2C70A 2WDVA 2E1MA 3QSMA 4GCMA 3KD9A 3AEDA 1QLBA 1E1KA 2XYOA 3NGCX 1H81A 2XCGA 3HYWA 1GSNA 2GEWA 1CL0A 1N4VA 3PVCA 2X99A 5C3JA 1D7LA 2JK6A 2XFUA 4TM0A 2RABA 2JB2A 3LJPA 4YKGA 2A87A 2WDQA 1K0LA 3Q9TA 1NHSA 4H2RA 4BK1A 3UKKA 2BS3A 2C75A 2GR3A 3T31A 1P2HA 1TDNA 1ZOVA 2VRLA 1ZK7A 2YQUA 1SEZA 2GR2A 3H8IA 2Z5YA 4J2WA 2YR6A 4K8DA 2Y6QA 1Y56A 2GMHA 3QJ4A 2X8HA 3F8DA 1ZKQA 1LV0A 2R46A 1LVLA 2YM2A 4C3YA 2E4GA 2IVDA 1GXFA 5FS7A 3RP7A 5BRTA 1YQ4A 2AAQA 2OALA 2Q7VA 2VQBA 4RG3A 2IVEA 2WBAA 3T2KA 4H4TA 3CGCA 4Y4LA 5KOXA 2GR1A 2BA9A 2CULA 4U2TA 4UDPA 1XPQA 3C96A 3KKJA 3AEGA 3HYVA 2BCGG 2R0GA 2TMDA 2BK4A 4CNJA 1OJCA 3UKFA 2B9WA 1K0IA 2YM1A 1RYIA 4H4ZA 3AECA 3DK4A 5KOWA 1K0JA 5KXJA 4APNA 1JRYA 1B5QA 4EMWA 3CNPA 1MO9A 1CF3A 1N4WA 2YG5A 1JNZA 3SM8A 1D5TA 2Q0KA 4J56A 2GF3A 1E39A 4O5QA 3P1WA 1GRAA 4HB9A 5CKUA 3S61A 4A65A 3M13A 3GYJA 1PBFA 3AWIA 1PBBA 3IWAA 2YG6A 3VRAA 1XHCA 1GRHA 3ABVA 2YAUA 4JN9A 3V76A 5LV9A 1W4XA 3K7TA 3P4PA 1NPXA 3AYLA 3AE3A 4U8NA 3ALJA 3GWFA 3SX6A 2OLOA 1GERA 2C72A 1KNPA 2RGHA 1OJ9A 1NHRA 2F5ZA 2B76A 4G9KA 4K22A 3NYCA 4U8MA 1PXBA 1PDHA 3QVPA 3UTHA 4YWOA 3AE8A 4CY8A 2WOVA 4BK3A 1VRQB 3NH3X 1H6VA 2BC1A 2WPFA 1E7PA 5KMSA 1LTXR 3C4AA 5KWFA 2FJBA 2WOWA 3AD9B 5BULA 1L9CA 1TDFA 4IA5A 2FBWA 3NLCA 3UKLA 3ATQA 1GTEA 2YLTA 4MJWA 4H4QA 2YVGA 4OPGA 1F8WA 4PAAA 4TLXA 3UOXA 4C3XA 3GMBA 3ADAB 3NHOX 4BJYA 1ZOYA 2A89A 3COXA 3AEFA 3BHFA 4Z24A 3EANA 4DGKA 2I0ZA 3B3RA 3V3NA 5KMQA 4CRTA 3EPTA 2PHHA 3AEAA 4NZHA 4XWRA 1REOA 4AOSA 4CY6A 3CPIG 1E6EA 3UP4A 3NN0X 4J31A 2BRYA 3ZDNA 1H86A 2BK3A 3URHA 2V3BA 2YVJA 3GYIA 4J57A 2DKHA 2EQ8A 2FJDA 1BGNA 4GUVA 3BI2A 3BNMA 4H4XA 5IPYA 4KX6A 2GB0A 2GVCA 3NYFA 1PJ7A 5HYMA 4EIQA 3FBSA 2XFNA 4NEVA 4WX1A 4Y4MA 3NRNA 1KF6A 2JKCA 3UTEA 1EBDA 1ZMCA 1H7WA 3AD7B 1COYA 1VDCA 2WU2A 4H2NA 4BK2A 3KPFA 2WP5A 2YG4A 1QJDA 3CGBA 3DMEA 2BS4A 4XXGA 3UOYA 3LZWA 1FECA 1E1LA 2GRTA 1EL9A 3EAOA 3S5WA 3UTFA 3ZYXA 4CBQA 3AE2A 3ITJA 5M0ZA 2V60A 4H4UA 1CC2A 2XVEA 3K7MX 1VQWA 4H2QA 4AP1A 1PBEA 1GRFA 2BXSA 4CNKA 1GETA 3CNSA 3K7QX 2C7GA 3KLJA 3P4QA 2BABA 1H84A 2YWLA 2EQ6A 3NN6X 5JCLA 4B68A 4G6GA 4USQA 2GV8A 2RGJA 4JY3A 3SY4A 2WPEA 5KNLA 3I6DA 3R9UA 2IIDA 2V6OA 1PBCA 4EQWA 1KFYA 1TDKA 3T2ZA 1EL8A 3GDNA 1PN0A 4EM4A 2APGA 1FL2A 2C64A 2WOIA 2R4JA 3NYEA 2VOUA 1LJ1A 2ZZCA 3VR9A 2X50A 3VQRA 1ZP0A 2BC0A 3AB1A 3C4NA 3IC9A 1IUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSE A;  2E5V A;  4UDQ A;  1RSG A;  3KU9 A;  1DOC A;  3AXB A;  1Z6L A;  4NTE A;  4YSX A;  1GRB A;  4X4J A;  3GDP A;  5CQF A;  3CPH G;  1D4C A;  3PS9 A;  1NDA A;  1PS9 A;  3DJD A;  3F8R A;  1OJA A;  2YVF A;  4H4Y A;  1GV4 A;  5TR3 A;  5BVA A;  4H2P A;  1MXT A;  3FIM B;  4LA1 A;  4OVI A;  4D04 A;  2OLN A;  4YKF A;  2V61 A;  1L9D A;  4WCT A;  4GR1 A;  4K5R A;  4A6N B;  3E1T A;  3BHK A;  1DJN A;  3NG7 X;  3SGL A;  1NG3 A;  3O0H A;  2CVJ A;  1D4D A;  3DH9 A;  2WDR A;  1E1M A;  3SFE A;  1L0V A;  5KRQ A;  3QVR A;  4TM1 A;  4Z26 A;  4JQ9 A;  4NTD A;  5HY5 A;  4EMJ A;  1BKW A;  1MOK A;  1IUX A;  3NTA A;  1Q1W A;  1ZY8 A;  2QCU A;  1ELI A;  1KSU A;  2YR5 A;  3EF6 A;  1ZDL A;  1VG9 A;  3HZL A;  4U8L A;  3VR8 A;  2DKI A;  3NT6 A;  1O94 A;  4YT0 A;  2XVJ A;  4ADW A;  3RHA A;  1M6I A;  2WS3 A;  2ARD A;  2QA2 A;  2XLU A;  3DK8 A;  3RP6 A;  1ZMD A;  3ALM A;  4D03 A;  4FK1 A;  2C65 A;  4YSZ A;  1DOE A;  3UKH A;  1KSS A;  3NTD A;  2XFO A;  4H50 A;  3BI4 A;  4U8J A;  4FDC B;  4B1B A;  5EOW A;  3GMC A;  1N1P A;  1O5W A;  1S3E A;  2BS2 A;  3DGZ A;  4J36 A;  2WU5 A;  3SQP A;  4OPC A;  3D8X A;  1NEK A;  4P9S A;  1KDG A;  1CBO A;  1YKJ A;  4XWZ A;  5HXI A;  1GND A;  4X9N A;  3AE7 A;  1F8S A;  1IUS A;  3ICT A;  1NHQ A;  1ONF A;  3Q6J A;  4IA6 A;  3M0O A;  5FS6 A;  3LXD A;  4X9M A;  2C76 A;  2VVL A;  3NKS A;  2XFQ A;  4A7A A;  5GRT A;  1S2Q A;  2UZZ A;  4I58 A;  3RED A;  2JB3 A;  4H7U A;  2W0H A;  1YY5 A;  4IVO B;  4BJZ A;  3ISH A;  1CJC A;  2WPC A;  4K5S A;  1PHH A;  1Y0P A;  3DJG X;  1UKV G;  3AE1 A;  2XFP A;  2VQ7 A;  4A79 A;  2H88 A;  4EQR A;  4E0V A;  1CJ3 A;  1KNR A;  3AD8 B;  1GTH A;  2JBV A;  2H89 A;  2QA1 A;  3ALL A;  1B8S A;  2ZZB A;  2WEU A;  4EM3 A;  4OPI A;  1DXL A;  3CPJ G;  5DBJ A;  5JCI A;  1P2E A;  2BXR A;  4Z2R A;  4LU6 A;  1BZL A;  2VVM A;  4IV9 A;  1GAL A;  1TRB A;  2J3N A;  1F6M A;  1JRZ A;  2YG7 A;  4YSY A;  5C2T A;  3PO7 A;  2WHD A;  2XLR A;  4B69 A;  2XLS A;  4Z43 A;  2C67 A;  5JCK A;  4GF7 A;  3CGD A;  1FOH A;  4U2S A;  2BAC A;  3SFD A;  2CFY A;  1JNR A;  1H83 A;  1F3P A;  4YXD A;  2YLZ A;  1O95 A;  4JY2 A;  3UP5 A;  4REK A;  4U8O A;  3AE4 A;  1FEB A;  5FS8 A;  2B7S A;  3G5Q A;  4ZCC A;  3FMW A;  2AQJ A;  4LII A;  4RSL A;  5IQ4 A;  1AOG A;  3NNE A;  5EB4 A;  1NAA A;  3IHM A;  4B67 A;  1BF3 A;  4EQS A;  2YLR A;  4ZN0 A;  2VZ2 A;  2X8G A;  1BWC A;  1L9E A;  5KVI A;  4KPR A;  3CIR A;  2GR0 A;  3UKQ A;  3QFA A;  2PYX A;  1IUT A;  2C73 A;  4U2L A;  2XVF A;  3G5R A;  4AT0 A;  2OA1 A;  4ECH A;  3DJJ A;  3H8L A;  3GRT A;  3DJE A;  4B65 A;  4U8I A;  3UKP A;  3L1R A;  4H4R A;  3GRS A;  4RG4 A;  1IUU A;  1XAN A;  3OZ2 A;  1CC4 A;  2R0P A;  4C5O A;  4AP3 A;  4BV6 A;  1OJD A;  1OJT A;  2C3C A;  2JAE A;  2X8C A;  3QFB A;  4H4W A;  4EMI A;  1GOS A;  2B7R A;  2YLW A;  1CC6 A;  2GAH B;  1GRE A;  3K30 A;  1FCD A;  4UDR A;  1FEA A;  1K4Q A;  2XDO A;  1DOB A;  1HYU A;  1QO8 A;  1LQT A;  2XLP A;  4Y4N A;  2V5Z A;  4U8K A;  3LZX A;  2R9Z A;  4NEW A;  3LB8 A;  4TM3 A;  3DGH A;  3P9U A;  2WES A;  3CGE A;  2R0C A;  2VVL G;  2VRM A;  3ICS A;  4AT2 A;  3AE6 A;  1NG4 A;  2YLS A;  3CTY A;  3JSK A;  1EL7 A;  4DSG A;  2GMJ A;  3FG2 P;  3P4S A;  4YTM A;  4OPT A;  4C74 A;  5J60 A;  4Z44 A;  2CDU A;  1CJ4 A;  1JEH A;  3KVE A;  3NIX A;  4K2X A;  4OPD A;  3GSI A;  3UOZ A;  3CN8 A;  4IVM B;  1IUV A;  2Y6R A;  4B66 A;  4C77 A;  1RP0 A;  2R45 A;  2XVH A;  3UOV A;  1YQZ A;  3VRD B;  2B9X A;  3AYI A;  4H4P A;  4JNA A;  4EIP A;  1PBD A;  4GRT A;  1S2Y A;  1S3B A;  2A8X A;  4FX9 A;  3L8K A;  2JB1 A;  5JCM A;  3AE9 A;  5M10 A;  2C3D A;  3ATR A;  3DK9 A;  1ZX9 A;  2RGO A;  4A9W A;  1JU2 A;  1PJ6 A;  1TYT A;  3NK1 X;  3P4R A;  3RNM A;  2BCP A;  3CND A;  5BUK A;  3B6D A;  4M52 A;  4J34 A;  4HA6 A;  2V3A A;  3D1C A;  3BNU A;  3DA1 A;  4TM4 A;  3IF9 A;  5GSN A;  2AR8 A;  4DNA A;  1X31 B;  4H4S A;  1GES A;  3T37 A;  1Q9I A;  2Q0L A;  3AEE A;  4AOX A;  4K7Z A;  5ER0 A;  2NVK X;  3IHG A;  1LPF A;  2QAE A;  5L46 A;  2ZZ0 A;  4Z2U A;  2NPX A;  2Z5X A;  3AYJ A;  4BUR A;  2GAG B;  1EL5 A;  1PJ5 A;  3CNT A;  4YTP A;  3H4K A;  2BK5 A;  2YG3 A;  1BGJ A;  2EQ7 A;  3CNJ A;  3F8P A;  1Q1R A;  3LOV A;  4Z2T A;  3RP8 A;  3UCL A;  1JOA A;  4JDR A;  2Q6U A;  3UKA A;  4A6N A;  1JRX A;  4NTC A;  1DNC A;  2WP6 A;  1XDI A;  1TDE A;  4A99 A;  5HHF A;  2EQ9 A;  4I59 A;  4B64 A;  1F8R A;  4USR A;  2R4E A;  2WP9 A;  4YTN A;  3FPZ A;  5FMH A;  1DOD A;  2OAM A;  4A5L A;  4U8P A;  5EBK A;  2X3N A;  3ICR A;  3NK2 X;  1PXA A;  4OCG A;  3GD4 A;  3NK0 X;  2ACZ A;  4OPL A;  1B37 A;  5KVH A;  1NHP A;  2FJA A;  2XLT A;  5IQ1 A;  1GEU A;  5U1O A;  3VRB A;  3AEB A;  2C66 A;  1H7X A;  3II4 A;  4H4V A;  2GQW A;  1D7Y A;  2ZBW A;  3LAD A;  5JCN A;  4O5U A;  4TLZ A;  3KA7 A;  4JNQ A;  4CCQ A;  4EQX A;  5U25 A;  1D4E A;  3I3L A;  2HQM A;  1Y56 B;  4B63 A;  2GH5 A;  2GQF A;  2O9Z A;  2TPR A;  1IJH A;  4GDP A;  3AE5 A;  3OC4 A;  1CJ2 A;  4ZCD A;  3GWD A;  2YLX A;  3V3O A;  2BYB A;  1E1N A;  5J7X A;  2WQY A;  3M12 A;  1H82 A;  4OPU A;  4ICY A;  1GRT A;  1PXC A;  4J33 A;  1NEN A;  4Z25 A;  4PAB A;  4YSH A;  2B9Y A;  3WE0 A;  1TYP A;  3QSS A;  1GT8 A;  5U63 A;  1GRG A;  3BI5 A;  4UP3 A;  4CCR A;  4FK1 C;  1VG0 A;  3UTG A;  2YR4 A;  2FJE A;  1LQU A;  2WET A;  1N4U A;  3GD3 A;  1DJQ A;  1V59 A;  1TDO A;  5FS9 A;  4DSH A;  2XVI A;  1B4V A;  1CHU A;  3G5S A;  1YQ3 A;  4GDE A;  4N9X A;  1M64 A;  1GPE A;  5EB5 A;  2C70 A;  2WDV A;  2E1M A;  3QSM A;  4GCM A;  3KD9 A;  3AED A;  1QLB A;  1E1K A;  2XYO A;  3NGC X;  1H81 A;  2XCG A;  1GSN A;  2GEW A;  1CL0 A;  1N4V A;  3PVC A;  2X99 A;  5C3J A;  1D7L A;  2JK6 A;  2XFU A;  4TM0 A;  2RAB A;  2JB2 A;  3LJP A;  4YKG A;  2A87 A;  2WDQ A;  1K0L A;  3Q9T A;  1NHS A;  4H2R A;  4BK1 A;  3UKK A;  2BS3 A;  2C75 A;  2GR3 A;  1P2H A;  1TDN A;  1ZOV A;  2VRL A;  1ZK7 A;  2YQU A;  1SEZ A;  2GR2 A;  3H8I A;  2Z5Y A;  4J2W A;  2YR6 A;  4K8D A;  2Y6Q A;  1Y56 A;  2GMH A;  3QJ4 A;  2X8H A;  3F8D A;  1ZKQ A;  1LV0 A;  2R46 A;  1LVL A;  2YM2 A;  4C3Y A;  2E4G A;  2IVD A;  1GXF A;  5FS7 A;  3RP7 A;  5BRT A;  1YQ4 A;  2AAQ A;  2OAL A;  2Q7V A;  2VQB A;  4RG3 A;  2IVE A;  2WBA A;  4H4T A;  3CGC A;  4Y4L A;  5KOX A;  2GR1 A;  2BA9 A;  2CUL A;  4U2T A;  4UDP A;  1XPQ A;  3C96 A;  3KKJ A;  3AEG A;  2BCG G;  2R0G A;  2TMD A;  2BK4 A;  4CNJ A;  1OJC A;  3UKF A;  2B9W A;  1K0I A;  2YM1 A;  1RYI A;  4H4Z A;  3AEC A;  3DK4 A;  5KOW A;  1K0J A;  5KXJ A;  4APN A;  1JRY A;  1B5Q A;  4EMW A;  3CNP A;  1MO9 A;  1CF3 A;  1N4W A;  2YG5 A;  1JNZ A;  3SM8 A;  1D5T A;  2Q0K A;  4J56 A;  2GF3 A;  1E39 A;  4O5Q A;  3P1W A;  1GRA A;  4HB9 A;  5CKU A;  3S61 A;  4A65 A;  3M13 A;  3GYJ A;  1PBF A;  3AWI A;  1PBB A;  3IWA A;  2YG6 A;  3VRA A;  1XHC A;  1GRH A;  3ABV A;  2YAU A;  4JN9 A;  3V76 A;  5LV9 A;  1W4X A;  3K7T A;  3P4P A;  1NPX A;  3AYL A;  3AE3 A;  4U8N A;  3ALJ A;  3GWF A;  2OLO A;  1GER A;  2C72 A;  1KNP A;  2RGH A;  1OJ9 A;  1NHR A;  2F5Z A;  2B76 A;  4K22 A;  3NYC A;  4U8M A;  1PXB A;  1PDH A;  3QVP A;  3UTH A;  4YWO A;  3AE8 A;  4CY8 A;  2WOV A;  4BK3 A;  1VRQ B;  3NH3 X;  1H6V A;  2BC1 A;  2WPF A;  1E7P A;  1LTX R;  3C4A A;  5KWF A;  2FJB A;  2WOW A;  3AD9 B;  5BUL A;  1L9C A;  1TDF A;  4IA5 A;  2FBW A;  3NLC A;  3UKL A;  3ATQ A;  1GTE A;  2YLT A;  4MJW A;  4H4Q A;  2YVG A;  4OPG A;  1F8W A;  4PAA A;  4TLX A;  3UOX A;  4C3X A;  3GMB A;  3ADA B;  3NHO X;  4BJY A;  1ZOY A;  2A89 A;  3COX A;  3AEF A;  3BHF A;  4Z24 A;  3EAN A;  4DGK A;  2I0Z A;  3B3R A;  3V3N A;  4CRT A;  3EPT A;  2PHH A;  3AEA A;  4NZH A;  4XWR A;  1REO A;  4AOS A;  4CY6 A;  3CPI G;  1E6E A;  3UP4 A;  3NN0 X;  4J31 A;  3ZDN A;  1H86 A;  2BK3 A;  3URH A;  2V3B A;  2YVJ A;  3GYI A;  4J57 A;  2DKH A;  2EQ8 A;  2FJD A;  1BGN A;  4GUV A;  3BI2 A;  3BNM A;  4H4X A;  5IPY A;  4KX6 A;  2GB0 A;  2GVC A;  3NYF A;  1PJ7 A;  5HYM A;  4EIQ A;  3FBS A;  2XFN A;  4NEV A;  4WX1 A;  4Y4M A;  3NRN A;  1KF6 A;  2JKC A;  3UTE A;  1EBD A;  1ZMC A;  1H7W A;  3AD7 B;  1COY A;  1VDC A;  2WU2 A;  4H2N A;  4BK2 A;  3KPF A;  2WP5 A;  2YG4 A;  1QJD A;  3CGB A;  3DME A;  2BS4 A;  4XXG A;  3UOY A;  3LZW A;  1FEC A;  1E1L A;  2GRT A;  1EL9 A;  3EAO A;  3S5W A;  3UTF A;  3ZYX A;  4CBQ A;  3AE2 A;  3ITJ A;  5M0Z A;  2V60 A;  4H4U A;  1CC2 A;  2XVE A;  3K7M X;  1VQW A;  4H2Q A;  4AP1 A;  1PBE A;  1GRF A;  2BXS A;  4CNK A;  1GET A;  3CNS A;  3K7Q X;  2C7G A;  3KLJ A;  3P4Q A;  2BAB A;  1H84 A;  2YWL A;  2EQ6 A;  3NN6 X;  5JCL A;  4B68 A;  4USQ A;  2GV8 A;  2RGJ A;  4JY3 A;  2WPE A;  3I6D A;  3R9U A;  2IID A;  2V6O A;  1PBC A;  4EQW A;  1KFY A;  1TDK A;  1EL8 A;  3GDN A;  1PN0 A;  4EM4 A;  2APG A;  1FL2 A;  2C64 A;  2WOI A;  2R4J A;  3NYE A;  2VOU A;  1LJ1 A;  2ZZC A;  3VR9 A;  2X50 A;  3VQR A;  1ZP0 A;  2BC0 A;  3AB1 A;  3C4N A;  3IC9 A;  1IUW A; 
#chains in the Genus database with same CATH topology
 3QSE A;  2E5V A;  4UDQ A;  4II3 A;  1RSG A;  3KU9 A;  1DOC A;  3AXB A;  1Z6L A;  4NTE A;  4YSX A;  1GRB A;  4X4J A;  3GDP A;  5CQF A;  3CPH G;  1D4C A;  3PS9 A;  1NDA A;  1PS9 A;  3DJD A;  3F8R A;  1OJA A;  2YVF A;  4H4Y A;  1GV4 A;  5TR3 A;  5BVA A;  5KMP A;  4H2P A;  1MXT A;  3FIM B;  4LA1 A;  4OVI A;  4D04 A;  2OLN A;  4YKF A;  2V61 A;  1L9D A;  4WCT A;  4GR1 A;  4K5R A;  4A6N B;  3E1T A;  3BHK A;  1DJN A;  3NG7 X;  3SGL A;  1NG3 A;  3O0H A;  2CVJ A;  1D4D A;  3DH9 A;  2WDR A;  1E1M A;  3SFE A;  1L0V A;  4G6H A;  3SZW A;  5KRQ A;  4NWZ A;  3QVR A;  4TM1 A;  4Z26 A;  4JQ9 A;  4NTD A;  5HY5 A;  4EMJ A;  1BKW A;  1MOK A;  1IUX A;  3NTA A;  1Q1W A;  1ZY8 A;  2QCU A;  1ELI A;  1KSU A;  2YR5 A;  3EF6 A;  3T14 A;  1ZDL A;  1VG9 A;  3HZL A;  4U8L A;  3VR8 A;  2DKI A;  3NT6 A;  1O94 A;  4YT0 A;  2XVJ A;  4ADW A;  3RHA A;  1M6I A;  2WS3 A;  2ARD A;  2QA2 A;  2XLU A;  3DK8 A;  3RP6 A;  1ZMD A;  3ALM A;  4D03 A;  4FK1 A;  2C65 A;  4YSZ A;  1DOE A;  3UKH A;  1KSS A;  3NTD A;  2XFO A;  4H50 A;  3BI4 A;  4U8J A;  4FDC B;  4B1B A;  5EOW A;  3GMC A;  1N1P A;  1O5W A;  1S3E A;  2BS2 A;  3DGZ A;  4J36 A;  2WU5 A;  3SQP A;  4OPC A;  3D8X A;  1NEK A;  4P9S A;  1KDG A;  1CBO A;  1YKJ A;  4XWZ A;  5HXI A;  1GND A;  4X9N A;  3AE7 A;  1F8S A;  1IUS A;  3ICT A;  1NHQ A;  1ONF A;  3Q6J A;  4IA6 A;  3M0O A;  5FS6 A;  3LXD A;  4X9M A;  2C76 A;  2VVL A;  3NKS A;  2XFQ A;  4A7A A;  5GRT A;  1S2Q A;  4GAP A;  2UZZ A;  4I58 A;  3RED A;  2JB3 A;  4H7U A;  2W0H A;  1YY5 A;  4IVO B;  4BJZ A;  3ISH A;  1CJC A;  2WPC A;  4K5S A;  1PHH A;  1Y0P A;  3DJG X;  1UKV G;  3AE1 A;  2XFP A;  2VQ7 A;  4A79 A;  2H88 A;  4EQR A;  4E0V A;  1CJ3 A;  1KNR A;  3AD8 B;  1GTH A;  2JBV A;  2H89 A;  2QA1 A;  3ALL A;  1B8S A;  2ZZB A;  2WEU A;  4EM3 A;  3SYI A;  4II2 A;  4OPI A;  1DXL A;  3CPJ G;  5DBJ A;  5JCI A;  1P2E A;  2BXR A;  4Z2R A;  4LU6 A;  1BZL A;  2VVM A;  4IV9 A;  4NNJ A;  1GAL A;  1TRB A;  2J3N A;  1F6M A;  1JRZ A;  2YG7 A;  4YSY A;  5C2T A;  3PO7 A;  2WHD A;  2XLR A;  4B69 A;  2XLS A;  4Z43 A;  2C67 A;  5JCK A;  4GF7 A;  3CGD A;  1FOH A;  4U2S A;  2BAC A;  3SFD A;  2CFY A;  1JNR A;  1H83 A;  1F3P A;  4YXD A;  2YLZ A;  3SZ0 A;  1O95 A;  4JY2 A;  3UP5 A;  4REK A;  4U8O A;  3AE4 A;  1FEB A;  3HYX A;  5FS8 A;  2B7S A;  3G5Q A;  4ZCC A;  3KPK A;  3FMW A;  2AQJ A;  4LII A;  2C4C A;  4RSL A;  5IQ4 A;  3NNE A;  1AOG A;  5EB4 A;  1NAA A;  3IHM A;  4B67 A;  1BF3 A;  4EQS A;  2YLR A;  4ZN0 A;  2VZ2 A;  2X8G A;  1BWC A;  1L9E A;  5KVI A;  4KPR A;  3CIR A;  2GR0 A;  3UKQ A;  3QFA A;  2PYX A;  1IUT A;  2C73 A;  4U2L A;  3GYX A;  2XVF A;  3G5R A;  4AT0 A;  2OA1 A;  4ECH A;  3DJJ A;  3H8L A;  3GRT A;  3DJE A;  4B65 A;  4U8I A;  3UKP A;  3L1R A;  4H4R A;  3GRS A;  4RG4 A;  1IUU A;  1XAN A;  3OZ2 A;  1CC4 A;  2R0P A;  4C5O A;  4AP3 A;  4BV6 A;  1OJD A;  1OJT A;  2C3C A;  2JAE A;  2X8C A;  3QFB A;  4H4W A;  4EMI A;  1GOS A;  2B7R A;  2YLW A;  1CC6 A;  2GAH B;  1GRE A;  3K30 A;  1FCD A;  4UDR A;  1FEA A;  1K4Q A;  2XDO A;  1DOB A;  1HYU A;  1QO8 A;  1LQT A;  2XLP A;  4Y4N A;  2V5Z A;  4U8K A;  3LZX A;  2R9Z A;  4NEW A;  3LB8 A;  4TM3 A;  3DGH A;  3P9U A;  2WES A;  3CGE A;  2R0C A;  2VVL G;  2VRM A;  3ICS A;  4AT2 A;  3AE6 A;  1NG4 A;  2YLS A;  3CTY A;  3JSK A;  1EL7 A;  4DSG A;  2GMJ A;  3FG2 P;  3P4S A;  4YTM A;  4OPT A;  4C74 A;  5J60 A;  4Z44 A;  2CDU A;  1CJ4 A;  1JEH A;  3KVE A;  3NIX A;  4K2X A;  4OPD A;  3GSI A;  3UOZ A;  3CN8 A;  4IVM B;  1IUV A;  2Y6R A;  4B66 A;  4C77 A;  5KMR A;  1RP0 A;  4G74 A;  2R45 A;  2XVH A;  3UOV A;  1YQZ A;  4G73 A;  3VRD B;  2B9X A;  3AYI A;  4H4P A;  4JNA A;  2BRA A;  4EIP A;  1PBD A;  4GRT A;  1S2Y A;  1S3B A;  2A8X A;  4FX9 A;  3L8K A;  2JB1 A;  5JCM A;  3AE9 A;  5M10 A;  2C3D A;  3ATR A;  3DK9 A;  1ZX9 A;  2RGO A;  4A9W A;  1JU2 A;  1PJ6 A;  1TYT A;  3NK1 X;  3P4R A;  3RNM A;  2BCP A;  3CND A;  5BUK A;  3CMM A;  3B6D A;  4M52 A;  4J34 A;  4HA6 A;  2V3A A;  3D1C A;  3BNU A;  3DA1 A;  3T2Y A;  4TM4 A;  3IF9 A;  5GSN A;  2AR8 A;  4DNA A;  1X31 B;  4H4S A;  1GES A;  3T37 A;  1Q9I A;  2Q0L A;  3AEE A;  4AOX A;  4K7Z A;  5ER0 A;  2NVK X;  3IHG A;  1LPF A;  2QAE A;  5L46 A;  2ZZ0 A;  4Z2U A;  2NPX A;  2Z5X A;  3AYJ A;  4BUR A;  2GAG B;  1EL5 A;  1PJ5 A;  3CNT A;  4YTP A;  3H4K A;  2BK5 A;  2YG3 A;  1BGJ A;  2EQ7 A;  3CNJ A;  3F8P A;  1Q1R A;  3LOV A;  4Z2T A;  3RP8 A;  3UCL A;  1JOA A;  4JDR A;  2Q6U A;  3UKA A;  4A6N A;  1JRX A;  4NTC A;  1DNC A;  2WP6 A;  1XDI A;  1TDE A;  4A99 A;  5HHF A;  2EQ9 A;  3T0K A;  4I59 A;  4B64 A;  1F8R A;  4USR A;  2R4E A;  2WP9 A;  4YTN A;  3FPZ A;  5FMH A;  1DOD A;  2OAM A;  4A5L A;  4U8P A;  5EBK A;  2X3N A;  3ICR A;  3NK2 X;  1PXA A;  4OCG A;  3GD4 A;  3NK0 X;  2ACZ A;  4OPL A;  1B37 A;  5KVH A;  1NHP A;  2FJA A;  2XLT A;  5IQ1 A;  1GEU A;  5U1O A;  3VRB A;  3SXI A;  3AEB A;  2C66 A;  1H7X A;  3II4 A;  4H4V A;  2GQW A;  1D7Y A;  2ZBW A;  3LAD A;  5JCN A;  4O5U A;  4TLZ A;  3KA7 A;  4JNQ A;  4CCQ A;  4EQX A;  5U25 A;  1D4E A;  3I3L A;  2HQM A;  1Y56 B;  4B63 A;  2GH5 A;  2GQF A;  2O9Z A;  2TPR A;  1IJH A;  4GDP A;  3AE5 A;  3OC4 A;  1CJ2 A;  4ZCD A;  3GWD A;  2YLX A;  3V3O A;  2BYB A;  1E1N A;  3SZC A;  5J7X A;  2WQY A;  3M12 A;  3SZF A;  1H82 A;  4OPU A;  4ICY A;  1GRT A;  1PXC A;  4J33 A;  1NEN A;  4Z25 A;  4PAB A;  4YSH A;  2B9Y A;  3WE0 A;  1TYP A;  3QSS A;  1GT8 A;  5U63 A;  1GRG A;  3BI5 A;  4UP3 A;  4CCR A;  4FK1 C;  1VG0 A;  4GAV A;  2YR4 A;  3UTG A;  2FJE A;  1LQU A;  2WET A;  1N4U A;  3GD3 A;  1DJQ A;  1V59 A;  1TDO A;  5FS9 A;  4DSH A;  2XVI A;  1B4V A;  1CHU A;  3G5S A;  1YQ3 A;  4GDE A;  4N9X A;  1M64 A;  1GPE A;  5EB5 A;  2C70 A;  2WDV A;  2E1M A;  3QSM A;  4GCM A;  3KD9 A;  3AED A;  1QLB A;  1E1K A;  2XYO A;  3NGC X;  1H81 A;  2XCG A;  3HYW A;  1GSN A;  2GEW A;  1CL0 A;  1N4V A;  3PVC A;  2X99 A;  5C3J A;  1D7L A;  2JK6 A;  2XFU A;  4TM0 A;  2RAB A;  2JB2 A;  3LJP A;  4YKG A;  2A87 A;  2WDQ A;  1K0L A;  3Q9T A;  1NHS A;  4H2R A;  4BK1 A;  3UKK A;  2BS3 A;  2C75 A;  2GR3 A;  3T31 A;  1P2H A;  1TDN A;  1ZOV A;  2VRL A;  1ZK7 A;  2YQU A;  1SEZ A;  2GR2 A;  3H8I A;  2Z5Y A;  4J2W A;  2YR6 A;  4K8D A;  2Y6Q A;  1Y56 A;  2GMH A;  3QJ4 A;  2X8H A;  3F8D A;  1ZKQ A;  1LV0 A;  2R46 A;  1LVL A;  2YM2 A;  4C3Y A;  2E4G A;  2IVD A;  1GXF A;  5FS7 A;  3RP7 A;  5BRT A;  1YQ4 A;  2AAQ A;  2OAL A;  2Q7V A;  2VQB A;  4RG3 A;  2IVE A;  2WBA A;  3T2K A;  4H4T A;  3CGC A;  4Y4L A;  5KOX A;  2GR1 A;  2BA9 A;  2CUL A;  4U2T A;  4UDP A;  1XPQ A;  3C96 A;  3KKJ A;  3AEG A;  3HYV A;  2BCG G;  2R0G A;  2TMD A;  2BK4 A;  4CNJ A;  1OJC A;  3UKF A;  2B9W A;  1K0I A;  2YM1 A;  1RYI A;  4H4Z A;  3AEC A;  3DK4 A;  5KOW A;  1K0J A;  5KXJ A;  4APN A;  1JRY A;  1B5Q A;  4EMW A;  3CNP A;  1MO9 A;  1CF3 A;  1N4W A;  2YG5 A;  1JNZ A;  3SM8 A;  1D5T A;  2Q0K A;  4J56 A;  2GF3 A;  1E39 A;  4O5Q A;  3P1W A;  1GRA A;  4HB9 A;  5CKU A;  3S61 A;  4A65 A;  3M13 A;  3GYJ A;  1PBF A;  3AWI A;  1PBB A;  3IWA A;  2YG6 A;  3VRA A;  1XHC A;  1GRH A;  3ABV A;  2YAU A;  4JN9 A;  3V76 A;  5LV9 A;  1W4X A;  3K7T A;  3P4P A;  1NPX A;  3AYL A;  3AE3 A;  4U8N A;  3ALJ A;  3GWF A;  3SX6 A;  2OLO A;  1GER A;  2C72 A;  1KNP A;  2RGH A;  1OJ9 A;  1NHR A;  2F5Z A;  2B76 A;  4G9K A;  4K22 A;  3NYC A;  4U8M A;  1PXB A;  1PDH A;  3QVP A;  3UTH A;  4YWO A;  3AE8 A;  4CY8 A;  2WOV A;  4BK3 A;  1VRQ B;  3NH3 X;  1H6V A;  2BC1 A;  2WPF A;  1E7P A;  5KMS A;  1LTX R;  3C4A A;  5KWF A;  2FJB A;  2WOW A;  3AD9 B;  5BUL A;  1L9C A;  1TDF A;  4IA5 A;  2FBW A;  3NLC A;  3UKL A;  3ATQ A;  1GTE A;  2YLT A;  4MJW A;  4H4Q A;  2YVG A;  4OPG A;  1F8W A;  4PAA A;  4TLX A;  3UOX A;  4C3X A;  3GMB A;  3ADA B;  3NHO X;  4BJY A;  1ZOY A;  2A89 A;  3COX A;  3AEF A;  3BHF A;  4Z24 A;  3EAN A;  4DGK A;  2I0Z A;  3B3R A;  3V3N A;  5KMQ A;  4CRT A;  3EPT A;  2PHH A;  3AEA A;  4NZH A;  4XWR A;  1REO A;  4AOS A;  4CY6 A;  3CPI G;  1E6E A;  3UP4 A;  3NN0 X;  4J31 A;  2BRY A;  3ZDN A;  1H86 A;  2BK3 A;  3URH A;  2V3B A;  2YVJ A;  3GYI A;  4J57 A;  2DKH A;  2EQ8 A;  2FJD A;  1BGN A;  4GUV A;  3BI2 A;  3BNM A;  4H4X A;  5IPY A;  4KX6 A;  2GB0 A;  2GVC A;  3NYF A;  1PJ7 A;  5HYM A;  4EIQ A;  3FBS A;  2XFN A;  4NEV A;  4WX1 A;  4Y4M A;  3NRN A;  1KF6 A;  2JKC A;  3UTE A;  1EBD A;  1ZMC A;  1H7W A;  3AD7 B;  1COY A;  1VDC A;  2WU2 A;  4H2N A;  4BK2 A;  3KPF A;  2WP5 A;  2YG4 A;  1QJD A;  3CGB A;  3DME A;  2BS4 A;  4XXG A;  3UOY A;  3LZW A;  1FEC A;  1E1L A;  2GRT A;  1EL9 A;  3EAO A;  3S5W A;  3UTF A;  3ZYX A;  4CBQ A;  3AE2 A;  3ITJ A;  5M0Z A;  2V60 A;  4H4U A;  1CC2 A;  2XVE A;  3K7M X;  1VQW A;  4H2Q A;  4AP1 A;  1PBE A;  1GRF A;  2BXS A;  4CNK A;  1GET A;  3CNS A;  3K7Q X;  2C7G A;  3KLJ A;  3P4Q A;  2BAB A;  1H84 A;  2YWL A;  2EQ6 A;  3NN6 X;  5JCL A;  4B68 A;  4G6G A;  4USQ A;  2GV8 A;  2RGJ A;  4JY3 A;  3SY4 A;  2WPE A;  5KNL A;  3I6D A;  3R9U A;  2IID A;  2V6O A;  1PBC A;  4EQW A;  1KFY A;  1TDK A;  3T2Z A;  1EL8 A;  3GDN A;  1PN0 A;  4EM4 A;  2APG A;  1FL2 A;  2C64 A;  2WOI A;  2R4J A;  3NYE A;  2VOU A;  1LJ1 A;  2ZZC A;  3VR9 A;  2X50 A;  3VQR A;  1ZP0 A;  2BC0 A;  3AB1 A;  3C4N A;  3IC9 A;  1IUW A; 
#chains in the Genus database with same CATH homology
 3QSE A;  2E5V A;  4UDQ A;  4II3 A;  1RSG A;  3KU9 A;  1DOC A;  3AXB A;  1Z6L A;  4NTE A;  4YSX A;  1GRB A;  4X4J A;  3GDP A;  5CQF A;  3CPH G;  1D4C A;  3PS9 A;  1NDA A;  1PS9 A;  3DJD A;  3F8R A;  1OJA A;  2YVF A;  4H4Y A;  1GV4 A;  5TR3 A;  5BVA A;  5KMP A;  4H2P A;  1MXT A;  3FIM B;  4LA1 A;  4OVI A;  4D04 A;  2OLN A;  4YKF A;  2V61 A;  1L9D A;  4WCT A;  4GR1 A;  4K5R A;  4A6N B;  3E1T A;  3BHK A;  1DJN A;  3NG7 X;  3SGL A;  1NG3 A;  3O0H A;  2CVJ A;  1D4D A;  3DH9 A;  2WDR A;  1E1M A;  3SFE A;  1L0V A;  4G6H A;  3SZW A;  5KRQ A;  4NWZ A;  3QVR A;  4TM1 A;  4Z26 A;  4JQ9 A;  4NTD A;  5HY5 A;  4EMJ A;  1BKW A;  1MOK A;  1IUX A;  3NTA A;  1Q1W A;  1ZY8 A;  2QCU A;  1ELI A;  1KSU A;  2YR5 A;  3EF6 A;  3T14 A;  1ZDL A;  1VG9 A;  3HZL A;  4U8L A;  3VR8 A;  2DKI A;  3NT6 A;  1O94 A;  4YT0 A;  2XVJ A;  4ADW A;  3RHA A;  1M6I A;  2WS3 A;  2ARD A;  2QA2 A;  2XLU A;  3DK8 A;  3RP6 A;  1ZMD A;  3ALM A;  4D03 A;  4FK1 A;  2C65 A;  4YSZ A;  1DOE A;  3UKH A;  1KSS A;  3NTD A;  2XFO A;  4H50 A;  3BI4 A;  4U8J A;  4FDC B;  4B1B A;  5EOW A;  3GMC A;  1N1P A;  1O5W A;  1S3E A;  2BS2 A;  3DGZ A;  4J36 A;  2WU5 A;  3SQP A;  4OPC A;  3D8X A;  1NEK A;  4P9S A;  1KDG A;  1CBO A;  1YKJ A;  4XWZ A;  5HXI A;  1GND A;  4X9N A;  3AE7 A;  1F8S A;  1IUS A;  3ICT A;  1NHQ A;  1ONF A;  3Q6J A;  4IA6 A;  3M0O A;  5FS6 A;  3LXD A;  4X9M A;  2C76 A;  2VVL A;  3NKS A;  2XFQ A;  4A7A A;  5GRT A;  1S2Q A;  4GAP A;  2UZZ A;  4I58 A;  3RED A;  2JB3 A;  4H7U A;  2W0H A;  1YY5 A;  4IVO B;  4BJZ A;  3ISH A;  1CJC A;  2WPC A;  4K5S A;  1PHH A;  1Y0P A;  3DJG X;  1UKV G;  3AE1 A;  2XFP A;  2VQ7 A;  4A79 A;  2H88 A;  4EQR A;  4E0V A;  1CJ3 A;  1KNR A;  3AD8 B;  1GTH A;  2JBV A;  2H89 A;  2QA1 A;  3ALL A;  1B8S A;  2ZZB A;  2WEU A;  4EM3 A;  3SYI A;  4II2 A;  4OPI A;  1DXL A;  3CPJ G;  5DBJ A;  5JCI A;  1P2E A;  2BXR A;  4Z2R A;  4LU6 A;  1BZL A;  2VVM A;  4IV9 A;  4NNJ A;  1GAL A;  1TRB A;  2J3N A;  1F6M A;  1JRZ A;  2YG7 A;  4YSY A;  5C2T A;  3PO7 A;  2WHD A;  2XLR A;  4B69 A;  2XLS A;  4Z43 A;  2C67 A;  5JCK A;  4GF7 A;  3CGD A;  1FOH A;  4U2S A;  2BAC A;  3SFD A;  2CFY A;  1JNR A;  1H83 A;  1F3P A;  4YXD A;  2YLZ A;  3SZ0 A;  1O95 A;  4JY2 A;  3UP5 A;  4REK A;  4U8O A;  3AE4 A;  1FEB A;  3HYX A;  5FS8 A;  2B7S A;  3G5Q A;  4ZCC A;  3KPK A;  3FMW A;  2AQJ A;  4LII A;  2C4C A;  4RSL A;  5IQ4 A;  3NNE A;  1AOG A;  5EB4 A;  1NAA A;  3IHM A;  4B67 A;  1BF3 A;  4EQS A;  2YLR A;  4ZN0 A;  2VZ2 A;  2X8G A;  1BWC A;  1L9E A;  5KVI A;  4KPR A;  3CIR A;  2GR0 A;  3UKQ A;  3QFA A;  2PYX A;  1IUT A;  2C73 A;  4U2L A;  3GYX A;  2XVF A;  3G5R A;  4AT0 A;  2OA1 A;  4ECH A;  3DJJ A;  3H8L A;  3GRT A;  3DJE A;  4B65 A;  4U8I A;  3UKP A;  3L1R A;  4H4R A;  3GRS A;  4RG4 A;  1IUU A;  1XAN A;  3OZ2 A;  1CC4 A;  2R0P A;  4C5O A;  4AP3 A;  4BV6 A;  1OJD A;  1OJT A;  2C3C A;  2JAE A;  2X8C A;  3QFB A;  4H4W A;  4EMI A;  1GOS A;  2B7R A;  2YLW A;  1CC6 A;  2GAH B;  1GRE A;  3K30 A;  1FCD A;  4UDR A;  1FEA A;  1K4Q A;  2XDO A;  1DOB A;  1HYU A;  1QO8 A;  1LQT A;  2XLP A;  4Y4N A;  2V5Z A;  4U8K A;  3LZX A;  2R9Z A;  4NEW A;  3LB8 A;  4TM3 A;  3DGH A;  3P9U A;  2WES A;  3CGE A;  2R0C A;  2VVL G;  2VRM A;  3ICS A;  4AT2 A;  3AE6 A;  1NG4 A;  2YLS A;  3CTY A;  3JSK A;  1EL7 A;  4DSG A;  2GMJ A;  3FG2 P;  3P4S A;  4YTM A;  4OPT A;  4C74 A;  5J60 A;  4Z44 A;  2CDU A;  1CJ4 A;  1JEH A;  3KVE A;  3NIX A;  4K2X A;  4OPD A;  3GSI A;  3UOZ A;  3CN8 A;  4IVM B;  1IUV A;  2Y6R A;  4B66 A;  4C77 A;  5KMR A;  1RP0 A;  4G74 A;  2R45 A;  2XVH A;  3UOV A;  1YQZ A;  4G73 A;  3VRD B;  2B9X A;  3AYI A;  4H4P A;  4JNA A;  2BRA A;  4EIP A;  1PBD A;  4GRT A;  1S2Y A;  1S3B A;  2A8X A;  4FX9 A;  3L8K A;  2JB1 A;  5JCM A;  3AE9 A;  5M10 A;  2C3D A;  3ATR A;  3DK9 A;  1ZX9 A;  2RGO A;  4A9W A;  1JU2 A;  1PJ6 A;  1TYT A;  3NK1 X;  3P4R A;  3RNM A;  2BCP A;  3CND A;  5BUK A;  3CMM A;  3B6D A;  4M52 A;  4J34 A;  4HA6 A;  2V3A A;  3D1C A;  3BNU A;  3DA1 A;  3T2Y A;  4TM4 A;  3IF9 A;  5GSN A;  2AR8 A;  4DNA A;  1X31 B;  4H4S A;  1GES A;  3T37 A;  1Q9I A;  2Q0L A;  3AEE A;  4AOX A;  4K7Z A;  5ER0 A;  2NVK X;  3IHG A;  1LPF A;  2QAE A;  5L46 A;  2ZZ0 A;  4Z2U A;  2NPX A;  2Z5X A;  3AYJ A;  4BUR A;  2GAG B;  1EL5 A;  1PJ5 A;  3CNT A;  4YTP A;  3H4K A;  2BK5 A;  2YG3 A;  1BGJ A;  2EQ7 A;  3CNJ A;  3F8P A;  1Q1R A;  3LOV A;  4Z2T A;  3RP8 A;  3UCL A;  1JOA A;  4JDR A;  2Q6U A;  3UKA A;  4A6N A;  1JRX A;  4NTC A;  1DNC A;  2WP6 A;  1XDI A;  1TDE A;  4A99 A;  5HHF A;  2EQ9 A;  3T0K A;  4I59 A;  4B64 A;  1F8R A;  4USR A;  2R4E A;  2WP9 A;  4YTN A;  3FPZ A;  5FMH A;  1DOD A;  2OAM A;  4A5L A;  4U8P A;  5EBK A;  2X3N A;  3ICR A;  3NK2 X;  1PXA A;  4OCG A;  3GD4 A;  3NK0 X;  2ACZ A;  4OPL A;  1B37 A;  5KVH A;  1NHP A;  2FJA A;  2XLT A;  5IQ1 A;  1GEU A;  5U1O A;  3VRB A;  3SXI A;  3AEB A;  2C66 A;  1H7X A;  3II4 A;  4H4V A;  2GQW A;  1D7Y A;  2ZBW A;  3LAD A;  5JCN A;  4O5U A;  4TLZ A;  3KA7 A;  4JNQ A;  4CCQ A;  4EQX A;  5U25 A;  1D4E A;  3I3L A;  2HQM A;  1Y56 B;  4B63 A;  2GH5 A;  2GQF A;  2O9Z A;  2TPR A;  1IJH A;  4GDP A;  3AE5 A;  3OC4 A;  1CJ2 A;  4ZCD A;  3GWD A;  2YLX A;  3V3O A;  2BYB A;  1E1N A;  3SZC A;  5J7X A;  2WQY A;  3M12 A;  3SZF A;  1H82 A;  4OPU A;  4ICY A;  1GRT A;  1PXC A;  4J33 A;  1NEN A;  4Z25 A;  4PAB A;  4YSH A;  2B9Y A;  3WE0 A;  1TYP A;  3QSS A;  1GT8 A;  5U63 A;  1GRG A;  3BI5 A;  4UP3 A;  4CCR A;  4FK1 C;  1VG0 A;  4GAV A;  2YR4 A;  3UTG A;  2FJE A;  1LQU A;  2WET A;  1N4U A;  3GD3 A;  1DJQ A;  1V59 A;  1TDO A;  5FS9 A;  4DSH A;  2XVI A;  1B4V A;  1CHU A;  3G5S A;  1YQ3 A;  4GDE A;  4N9X A;  1M64 A;  1GPE A;  5EB5 A;  2C70 A;  2WDV A;  2E1M A;  3QSM A;  4GCM A;  3KD9 A;  3AED A;  1QLB A;  1E1K A;  2XYO A;  3NGC X;  1H81 A;  2XCG A;  3HYW A;  1GSN A;  2GEW A;  1CL0 A;  1N4V A;  3PVC A;  2X99 A;  5C3J A;  1D7L A;  2JK6 A;  2XFU A;  4TM0 A;  2RAB A;  2JB2 A;  3LJP A;  4YKG A;  2A87 A;  2WDQ A;  1K0L A;  3Q9T A;  1NHS A;  4H2R A;  4BK1 A;  3UKK A;  2BS3 A;  2C75 A;  2GR3 A;  3T31 A;  1P2H A;  1TDN A;  1ZOV A;  2VRL A;  1ZK7 A;  2YQU A;  1SEZ A;  2GR2 A;  3H8I A;  2Z5Y A;  4J2W A;  2YR6 A;  4K8D A;  2Y6Q A;  1Y56 A;  2GMH A;  3QJ4 A;  2X8H A;  3F8D A;  1ZKQ A;  1LV0 A;  2R46 A;  1LVL A;  2YM2 A;  4C3Y A;  2E4G A;  2IVD A;  1GXF A;  5FS7 A;  3RP7 A;  5BRT A;  1YQ4 A;  2AAQ A;  2OAL A;  2Q7V A;  2VQB A;  4RG3 A;  2IVE A;  2WBA A;  3T2K A;  4H4T A;  3CGC A;  4Y4L A;  5KOX A;  2GR1 A;  2BA9 A;  2CUL A;  4U2T A;  4UDP A;  1XPQ A;  3C96 A;  3KKJ A;  3AEG A;  3HYV A;  2BCG G;  2R0G A;  2TMD A;  2BK4 A;  4CNJ A;  1OJC A;  3UKF A;  2B9W A;  1K0I A;  2YM1 A;  1RYI A;  4H4Z A;  3AEC A;  3DK4 A;  5KOW A;  1K0J A;  5KXJ A;  4APN A;  1JRY A;  1B5Q A;  4EMW A;  3CNP A;  1MO9 A;  1CF3 A;  1N4W A;  2YG5 A;  1JNZ A;  3SM8 A;  1D5T A;  2Q0K A;  4J56 A;  2GF3 A;  1E39 A;  4O5Q A;  3P1W A;  1GRA A;  4HB9 A;  5CKU A;  3S61 A;  4A65 A;  3M13 A;  3GYJ A;  1PBF A;  3AWI A;  1PBB A;  3IWA A;  2YG6 A;  3VRA A;  1XHC A;  1GRH A;  3ABV A;  2YAU A;  4JN9 A;  3V76 A;  5LV9 A;  1W4X A;  3K7T A;  3P4P A;  1NPX A;  3AYL A;  3AE3 A;  4U8N A;  3ALJ A;  3GWF A;  3SX6 A;  2OLO A;  1GER A;  2C72 A;  1KNP A;  2RGH A;  1OJ9 A;  1NHR A;  2F5Z A;  2B76 A;  4G9K A;  4K22 A;  3NYC A;  4U8M A;  1PXB A;  1PDH A;  3QVP A;  3UTH A;  4YWO A;  3AE8 A;  4CY8 A;  2WOV A;  4BK3 A;  1VRQ B;  3NH3 X;  1H6V A;  2BC1 A;  2WPF A;  1E7P A;  5KMS A;  1LTX R;  3C4A A;  5KWF A;  2FJB A;  2WOW A;  3AD9 B;  5BUL A;  1L9C A;  1TDF A;  4IA5 A;  2FBW A;  3NLC A;  3UKL A;  3ATQ A;  1GTE A;  2YLT A;  4MJW A;  4H4Q A;  2YVG A;  4OPG A;  1F8W A;  4PAA A;  4TLX A;  3UOX A;  4C3X A;  3GMB A;  3ADA B;  3NHO X;  4BJY A;  1ZOY A;  2A89 A;  3COX A;  3AEF A;  3BHF A;  4Z24 A;  3EAN A;  4DGK A;  2I0Z A;  3B3R A;  3V3N A;  5KMQ A;  4CRT A;  3EPT A;  2PHH A;  3AEA A;  4NZH A;  4XWR A;  1REO A;  4AOS A;  4CY6 A;  3CPI G;  1E6E A;  3UP4 A;  3NN0 X;  4J31 A;  2BRY A;  3ZDN A;  1H86 A;  2BK3 A;  3URH A;  2V3B A;  2YVJ A;  3GYI A;  4J57 A;  2DKH A;  2EQ8 A;  2FJD A;  1BGN A;  4GUV A;  3BI2 A;  3BNM A;  4H4X A;  5IPY A;  4KX6 A;  2GB0 A;  2GVC A;  3NYF A;  1PJ7 A;  5HYM A;  4EIQ A;  3FBS A;  2XFN A;  4NEV A;  4WX1 A;  4Y4M A;  3NRN A;  1KF6 A;  2JKC A;  3UTE A;  1EBD A;  1ZMC A;  1H7W A;  3AD7 B;  1COY A;  1VDC A;  2WU2 A;  4H2N A;  4BK2 A;  3KPF A;  2WP5 A;  2YG4 A;  1QJD A;  3CGB A;  3DME A;  2BS4 A;  4XXG A;  3UOY A;  3LZW A;  1FEC A;  1E1L A;  2GRT A;  1EL9 A;  3EAO A;  3S5W A;  3UTF A;  3ZYX A;  4CBQ A;  3AE2 A;  3ITJ A;  5M0Z A;  2V60 A;  4H4U A;  1CC2 A;  2XVE A;  3K7M X;  1VQW A;  4H2Q A;  4AP1 A;  1PBE A;  1GRF A;  2BXS A;  4CNK A;  1GET A;  3CNS A;  3K7Q X;  2C7G A;  3KLJ A;  3P4Q A;  2BAB A;  1H84 A;  2YWL A;  2EQ6 A;  3NN6 X;  5JCL A;  4B68 A;  4G6G A;  4USQ A;  2GV8 A;  2RGJ A;  4JY3 A;  3SY4 A;  2WPE A;  5KNL A;  3I6D A;  3R9U A;  2IID A;  2V6O A;  1PBC A;  4EQW A;  1KFY A;  1TDK A;  3T2Z A;  1EL8 A;  3GDN A;  1PN0 A;  4EM4 A;  2APG A;  1FL2 A;  2C64 A;  2WOI A;  2R4J A;  3NYE A;  2VOU A;  1LJ1 A;  2ZZC A;  3VR9 A;  2X50 A;  3VQR A;  1ZP0 A;  2BC0 A;  3AB1 A;  3C4N A;  3IC9 A;  1IUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...