3L1RA

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermidine
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
467
structure length
467
Chain Sequence
TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant k300m of polyamine oxidase from zea mays unveils the role of lys300 in catalysis
rcsb
source organism Zea mays
total genus 157
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3l1rA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3l1rA02
2CVJA 2FJDA 1GEUA 4CCRA 1NG3A 3DK4A 4GUVA 3JSKA 3PO7A 1XDIA 2YG5A 3LXDA 5EOWA 3IF9A 2XLPA 4CRTA 2GMJA 1FEAA 3I6DA 1B5QA 3REDA 1ZY8A 1TYTA 3GMBA 3BHKA 4H4XA 5JCNA 1ONFA 2B9WA 4Z24A 2XFPA 1N4VA 1IUSA 3Q6JA 3UTEA 1DJNA 1GRTA 1K0LA 3I3LA 4CNJA 2XVJA 5JCLA 5FS9A 4EM3A 1MXTA 2H89A 4BK2A 4YSYA 1GT8A 2B76A 4OPIA 4B68A 1L0VA 4A9WA 1NHPA 4OPTA 2X8HA 2EQ7A 1OJAA 2BCGG 2WOVA 1IUWA 4AOXA 1PJ6A 1D4EA 1F8SA 1N4UA 3K30A 2Q0LA 3E1TA 4JNAA 2WPCA 3NIXA 1TDFA 1ZMCA 5KOWA 4NTEA 2VQBA 3LOVA 3AE9A 4A6NA 1P2HA 3KVEA 4Z2UA 4U2SA 2VQ7A 4UP3A 3GRTA 5U1OA 4H2QA 2V3AA 3CTYA 1LVLA 4OCGA 5GSNA 4H7UA 1S3BA 2IVEA 4CY8A 3O0HA 2RGJA 4U8MA 3LB8A 3M0OA 5KWFA 1KFYA 1GESA 2TMDA 2C66A 2YG4A 3VR8A 4TLZA 3AD9B 1CBOA 4U8NA 2QA2A 1VG9A 3AD7B 2GV8A 1LQTA 4H2PA 2XVHA 2GF3A 2VRMA 2WBAA 5BVAA 3NHOX 3AYJA 3NRNA 2FJEA 3P4RA 1CJCA 1QJDA 3F8DA 4TM4A 3HZLA 3SFDA 2QAEA 1PBCA 1EL9A 3AD8B 3H4KA 4H4TA 1FOHA 3CGDA 4YKGA 2BK3A 2Z5YA 4H4QA 4WX1A 1GTHA 1TDEA 3NK1X 4AP3A 2WP5A 4DNAA 4IVMB 4C3XA 4A99A 4J34A 4TLXA 1NHRA 1N1PA 1UKVG 1ZKQA 4U8OA 1GRBA 2Q0KA 1GERA 1PXCA 4BK3A 4AT0A 1FECA 5EB4A 1PBEA 5LV9A 4CY6A 1ELIA 1H7WA 5CKUA 3GD3A 2GR3A 3IHGA 3DJGX 2Y6RA 3DH9A 4EQXA 4BURA 2JAEA 1FCDA 3LJPA 4UDQA 1F3PA 3NN6X 4NZHA 2X8CA 4BK1A 2E4GA 3ZDNA 3P1WA 2VVLA 2WPFA 2FJBA 3CGCA 3CN8A 2JB2A 3BHFA 3QSSA 3EPTA 3UP4A 2BXSA 2E1MA 2W0HA 4B66A 3KKJA 1PBDA 2YG6A 2RABA 1Q1WA 3VRBA 2WP9A 2C67A 4AOSA 2ACZA 2BK4A 5C2TA 3NTDA 1JRYA 1ZP0A 2CFYA 2VOUA 4DGKA 3NNEA 4Z43A 1OJCA 2B7RA 3VQRA 2ZZ0A 3OZ2A 4PAAA 3UKHA 5IQ4A 1CC6A 3CPIG 3H8IA 3GWDA 3NTAA 1GALA 4B67A 3P4SA 3GYJA 1VG0A 4C5OA 4H4UA 2BC0A 3M12A 4YXDA 2JBVA 4JY2A 2YVGA 3K7TA 1Y56B 3UOYA 2GR1A 2YM2A 3DMEA 4JN9A 2GAHB 4CNKA 1Q9IA 2AQJA 3EAOA 5BULA 3UKFA 1S2QA 2WP6A 4K8DA 2QCUA 4H50A 2WDRA 1F6MA 1H6VA 3C96A 3G5QA 2B9XA 4H4SA 4EIQA 4H2RA 2WU5A 3K7QX 4IV9A 1ZOVA 2XYOA 3AE2A 4OVIA 2AAQA 1EL7A 3IHMA 2I0ZA 2ZBWA 2YVJA 2A87A 3KPFA 2JB3A 4K22A 5KXJA 3P9UA 3UOZA 4FK1A 4YTMA 1GREA 2E5VA 4ZCDA 4JY3A 1K0IA 3CPJG 4H4YA 3VRDB 1TRBA 3V3NA 4K5SA 3UOVA 3F8PA 2XFQA 3FBSA 3WE0A 5FS6A 4B65A 5HYMA 1H82A 2R0CA 1YY5A 2YLXA 4APNA 1GETA 4U2TA 2DKHA 2BK5A 4H2NA 1YKJA 2NPXA 1E1MA 2IVDA 3VR9A 1D4DA 1QLBA 4KPRA 1NENA 2FJAA 1RP0A 1LQUA 5L46A 4ZCCA 4EIPA 4JDRA 2J3NA 1YQZA 4KX6A 4GRTA 3SGLA 4OPDA 1B37A 3L1RA 2X50A 1CHUA 1Y56A 1DOBA 2A8XA 4NTCA 2OLNA 5KOXA 4DSHA 1XANA 2Q7VA 2C75A 2CULA 2BA9A 3II4A 3UKQA 4GF7A 4TM1A 2A89A 3CNDA 1REOA 2JK6A 3UKLA 4DSGA 3KU9A 3AECA 4U8JA 4E0VA 1H84A 1PN0A 2C73A 1RSGA 2GEWA 3CGBA 1OJ9A 4RG4A 4NEWA 1E39A 1F8WA 5KRQA 1PXAA 2YR4A 3AEBA 1E7PA 3ATQA 2OA1A 3BI2A 1ZDLA 1PJ7A 3D8XA 1BF3A 3UKPA 3DJEA 1GSNA 2F5ZA 5HHFA 2XLUA 2WS3A 3RP7A 2R9ZA 2V5ZA 4ECHA 1IUXA 2BABA 2PHHA 4LA1A 4Z26A 4ICYA 4LIIA 2R4JA 1CC4A 1D7LA 1EL8A 1QO8A 1M6IA 3AEAA 3QFAA 5DBJA 4K5RA 1CJ3A 5FS8A 1VDCA 3GD4A 1E1KA 4B64A 1H7XA 3UTGA 4EQRA 4EQSA 4ADWA 1P2EA 1NPXA 2DKIA 2WU2A 1COYA 4H4RA 1DJQA 1H86A 3UCLA 1NHSA 2TPRA 1GRAA 4D04A 4ZN0A 1TDOA 1PHHA 4TM3A 1JOAA 1O5WA 2EQ9A 2BS4A 2GQFA 3AE3A 5ER0A 3OC4A 4A79A 3AE7A 1NHQA 1NEKA 3B3RA 3BI5A 4AP1A 2GR0A 4EQWA 4RG3A 1EBDA 1L9CA 2BCPA 4B1BA 4IA5A 4Z2TA 3R9UA 4H4ZA 1MOKA 2WDVA 2FBWA 4YWOA 1L9EA 3AEFA 3D1CA 4XWZA 1O95A 4NEVA 1KDGA 1OJTA 3CIRA 4NTDA 3CGEA 3CNJA 3NGCX 4YT0A 4Y4MA 3RP8A 3NYEA 3SFEA 3UTHA 4C74A 2YG3A 1PJ5A 2R0GA 2C72A 3G5SA 1Z6LA 4OPGA 1VRQB 3FMWA 2C76A 3AEEA 3CPHG 2O9ZA 1NG4A 1NDAA 2RGHA 1PBFA 1W4XA 1KNRA 4FDCB 4BJZA 4K2XA 1D4CA 1KF6A 3AWIA 5EBKA 5M0ZA 1KSSA 2OLOA 1DOCA 4A5LA 1BKWA 2XDOA 4OPLA 4YTNA 5TR3A 1PXBA 3NKSA 1TDNA 2C3DA 4J2WA 1DNCA 1YQ4A 1B4VA 4D03A 2X8GA 3DJDA 3NN0X 1IUUA 2JKCA 5JCIA 3BI4A 1TYPA 1BGNA 1DOEA 1E1NA 2ZZCA 3GSIA 3ISHA 3M13A 2GMHA 1EL5A 1ZMDA 2UZZA 3ADAB 4O5UA 5IPYA 2GR2A 4U8IA 1GPEA 4U8PA 4CCQA 1CJ2A 3GRSA 5C3JA 1CL0A 3ALLA 1GNDA 2R0PA 3AE4A 3RNMA 2BACA 3DA1A 2WQYA 3L8KA 1AOGA 1GXFA 4JQ9A 1SEZA 2XCGA 2C3CA 3AB1A 5KVIA 1VQWA 2BS3A 2Y6QA 2YLRA 1BZLA 2H88A 1HYUA 3COXA 4I58A 1ZX9A 2WESA 3ABVA 3EANA 1Q1RA 4PABA 4YSZA 2WEUA 3GDNA 3ICTA 2BYBA 5CQFA 3GYIA 2AR8A 3IC9A 5JCMA 3BNMA 4J36A 4M52A 1JRXA 3ICRA 3AE1A 3AYLA 3C4NA 2ZZBA 2CDUA 3KLJA 5U63A 2WDQA 1XHCA 1GOSA 4YSHA 4EMJA 1F8RA 2V6OA 1DODA 3ITJA 5J7XA 2XFNA 3NH3X 2C70A 2R4EA 3FIMB 2XLSA 3F8RA 1CJ4A 4USQA 4GCMA 3URHA 3NLCA 3DGZA 1L9DA 2Z5XA 1FL2A 4Y4LA 1V59A 4EMWA 1GTEA 4X9NA 5J60A 2X99A 3AYIA 1PBBA 4H4PA 2Q6UA 1GRHA 1E6EA 2XLRA 2QA1A 5BRTA 1CF3A 1DXLA 3FPZA 4U2LA 5BUKA 2RGOA 3FG2P 3BNUA 3GMCA 4UDRA 1FEBA 4IA6A 3GWFA 1PS9A 1LV0A 2YM1A 4XXGA 2YLSA 4J57A 3UP5A 3AE5A 4J56A 3K7MX 3UOXA 3V3OA 2R46A 3SQPA 2BC1A 2YVFA 1S2YA 3ATRA 2EQ8A 4YKFA 3QVRA 2VVMA 1KSUA 3DGHA 3EF6A 4HB9A 4X4JA 4JNQA 4J33A 3RP6A 4C77A 3P4PA 1MO9A 2V3BA 2YWLA 3DK9A 3KA7A 4Y4NA 4B69A 3Q9TA 4UDPA 2XFOA 2OAMA 2WPEA 1JNRA 3QVPA 1IJHA 1LTXR 4FX9A 4GR1A 3CNSA 5KVHA 1H81A 4BV6A 2WOWA 1KNPA 2HQMA 3G5RA 1XPQA 2OALA 4H4VA 1O94A 1YQ3A 3S61A 4OPUA 4YSXA 3GDPA 3UTFA 2VRLA 2VZ2A 2GAGB 4TM0A 3QSEA 2C7GA 1JU2A 2B9YA 3AE8A 1BGJA 3NG7X 4K7ZA 2XLTA 2PYXA 4REKA 5FS7A 5GRTA 4A65A 3PVCA 2NVKX 3ZYXA 3P4QA 1JRZA 3QFBA 2BS2A 4A7AA 3NT6A 4CBQA 5M10A 4MJWA 2JB1A 1X31B 2GH5A 4H4WA 2YQUA 1N4WA 4USRA 3NK2X 3NK0X 1D7YA 4U8LA 4C3YA 1IUTA 1E1LA 3NYCA 3ALJA 2V60A 3DJJA 4HA6A 2XVFA 3AE6A 3V76A 4Z44A 5EB5A 4WCTA 4AT2A 2APGA 2C65A 1IUVA 1H83A 3LZXA 5HY5A 3PS9A 1K4QA 4O5QA 5IQ1A 4BJYA 2X3NA 4J31A 3T37A 3LADA 4Z2RA 2ARDA 1PDHA 3AEDA 2GQWA 1LPFA 2GB0A 3NYFA 4X9MA 1NAAA 3ALMA 3IWAA 3QJ4A 5HXIA 3AEGA 4N9XA 3ICSA 1D5TA 3QSMA 5U25A 1RYIA 3UKKA 3VRAA 3AXBA 3LZWA 1OJDA 2YLTA 1ZK7A 4P9SA 4GDEA 4U8KA 4Z25A 1B8SA 2YR6A 3CNTA 2YAUA 2XVIA 2YLWA 4RSLA 2YLZA 3KD9A 2XFUA 2VVLG 2V61A 2WETA 4FK1C 4LU6A 1K0JA 3B6DA 2C64A 2XVEA 3C4AA 1GRGA 2R45A 1GV4A 2B7SA 3RHAA 4EMIA 4GDPA 4I59A 1JEHA 1M64A 2IIDA 5FMHA 1BWCA 3DK8A 1JNZA 3CNPA 4EM4A 3UKAA 4A6NB 4XWRA 4IVOB 1LJ1A 2WHDA 4YTPA 4OPCA 2EQ6A 5JCKA 3S5WA 1TDKA 1Y0PA 3H8LA 2GVCA 2WOIA 1GRFA 2BXRA 1ZOYA 2YR5A 1CC2A 1S3EA 3SM8A 4B63A 2GRTA 2YG7A
chains in the Genus database with same CATH superfamily
2CVJA 3SZ0A 2FJDA 1GEUA 4CCRA 1NG3A 3DK4A 4GUVA 3JSKA 3PO7A 1XDIA 2YG5A 3LXDA 5EOWA 3IF9A 2XLPA 4CRTA 2GMJA 1FEAA 3I6DA 4GAPA 1B5QA 3REDA 1ZY8A 1TYTA 3GMBA 3BHKA 4H4XA 5JCNA 1ONFA 2B9WA 4Z24A 2XFPA 1N4VA 1IUSA 3Q6JA 3UTEA 1DJNA 1GRTA 1K0LA 3I3LA 4CNJA 2XVJA 5JCLA 5FS9A 4EM3A 1MXTA 2H89A 4BK2A 4YSYA 1GT8A 2B76A 4OPIA 4B68A 1L0VA 4A9WA 1NHPA 4OPTA 2X8HA 2EQ7A 1OJAA 2BCGG 2C4CA 2WOVA 1IUWA 4AOXA 1PJ6A 1D4EA 1F8SA 1N4UA 3T31A 3K30A 2Q0LA 2BRAA 3E1TA 4JNAA 2WPCA 3NIXA 1TDFA 1ZMCA 5KOWA 4NTEA 2VQBA 3LOVA 3AE9A 4A6NA 1P2HA 3KVEA 4Z2UA 4U2SA 2VQ7A 4UP3A 3GRTA 5U1OA 4H2QA 2V3AA 3CTYA 1LVLA 4OCGA 5GSNA 4H7UA 1S3BA 2IVEA 4CY8A 3O0HA 2RGJA 4U8MA 3LB8A 3M0OA 5KWFA 1KFYA 1GESA 2TMDA 2C66A 2YG4A 3VR8A 4TLZA 3AD9B 1CBOA 4U8NA 2QA2A 1VG9A 3T0KA 3AD7B 2GV8A 1LQTA 4H2PA 2XVHA 2GF3A 2VRMA 2WBAA 5BVAA 3NHOX 3AYJA 3NRNA 2FJEA 3P4RA 1CJCA 1QJDA 3F8DA 4TM4A 3HZLA 3SFDA 2QAEA 1PBCA 5KMSA 1EL9A 3AD8B 3H4KA 4H4TA 1FOHA 3CGDA 4YKGA 2BK3A 2Z5YA 4H4QA 4WX1A 1GTHA 1TDEA 3NK1X 4AP3A 2WP5A 4DNAA 4IVMB 4C3XA 3SX6A 4A99A 4J34A 4TLXA 1NHRA 1N1PA 1UKVG 1ZKQA 4U8OA 1GRBA 2Q0KA 1GERA 1PXCA 4BK3A 4AT0A 1FECA 5EB4A 1PBEA 5LV9A 4CY6A 1ELIA 1H7WA 5CKUA 3GD3A 2GR3A 3IHGA 3DJGX 2Y6RA 3DH9A 4EQXA 4BURA 2JAEA 1FCDA 3LJPA 4UDQA 1F3PA 3NN6X 4NZHA 2X8CA 4BK1A 2E4GA 3ZDNA 3P1WA 2VVLA 2WPFA 2FJBA 3CGCA 3CN8A 2JB2A 3BHFA 3QSSA 3EPTA 3UP4A 2BXSA 2E1MA 2W0HA 4B66A 3KKJA 1PBDA 2YG6A 5KMPA 2RABA 1Q1WA 3VRBA 2WP9A 2C67A 4AOSA 2ACZA 3HYXA 2BK4A 3T2ZA 5C2TA 3NTDA 1JRYA 1ZP0A 2CFYA 2VOUA 4DGKA 3NNEA 4Z43A 1OJCA 2B7RA 3SZWA 3VQRA 2ZZ0A 3OZ2A 4PAAA 3UKHA 5IQ4A 1CC6A 3CPIG 3H8IA 3GWDA 3NTAA 1GALA 4B67A 3P4SA 3GYJA 1VG0A 4C5OA 4H4UA 3SYIA 2BC0A 3M12A 4YXDA 2JBVA 4JY2A 2YVGA 3K7TA 1Y56B 3UOYA 2GR1A 2YM2A 3DMEA 4JN9A 2GAHB 4CNKA 1Q9IA 2AQJA 5KNLA 3EAOA 5BULA 3UKFA 1S2QA 2BRYA 2WP6A 4K8DA 2QCUA 4H50A 2WDRA 1F6MA 1H6VA 3C96A 3G5QA 2B9XA 4H4SA 4EIQA 4H2RA 2WU5A 3K7QX 4IV9A 1ZOVA 2XYOA 3AE2A 4OVIA 2AAQA 1EL7A 3IHMA 2I0ZA 2ZBWA 2YVJA 2A87A 3KPFA 2JB3A 4K22A 5KXJA 3P9UA 3UOZA 4G6GA 4FK1A 4YTMA 1GREA 2E5VA 4ZCDA 4JY3A 1K0IA 3CPJG 4H4YA 3VRDB 1TRBA 3V3NA 4K5SA 3UOVA 3F8PA 2XFQA 3FBSA 3WE0A 5FS6A 4B65A 5HYMA 1H82A 2R0CA 1YY5A 2YLXA 4APNA 1GETA 4U2TA 2DKHA 2BK5A 4H2NA 1YKJA 2NPXA 3T2YA 1E1MA 4G74A 2IVDA 3VR9A 1D4DA 1QLBA 4KPRA 1NENA 2FJAA 1RP0A 1LQUA 5L46A 4ZCCA 4EIPA 4JDRA 2J3NA 1YQZA 3HYVA 4KX6A 4GRTA 3SGLA 4OPDA 1B37A 3L1RA 2X50A 1CHUA 1Y56A 1DOBA 2A8XA 4NTCA 2OLNA 5KOXA 4DSHA 4G9KA 1XANA 2Q7VA 2C75A 2CULA 2BA9A 3II4A 3UKQA 4GF7A 4TM1A 2A89A 3CNDA 1REOA 2JK6A 4II3A 3UKLA 3KU9A 3AECA 4U8JA 4DSGA 1H84A 1PN0A 2C73A 1RSGA 2GEWA 3CGBA 1OJ9A 4RG4A 4NEWA 1E39A 1F8WA 5KRQA 1PXAA 2YR4A 3AEBA 1E7PA 3ATQA 2OA1A 3BI2A 1ZDLA 1PJ7A 3D8XA 1BF3A 3UKPA 3DJEA 1GSNA 2F5ZA 5HHFA 2XLUA 2WS3A 3RP7A 2R9ZA 2V5ZA 4ECHA 1IUXA 2BABA 2PHHA 4LA1A 4Z26A 4ICYA 4LIIA 2R4JA 1CC4A 1D7LA 1EL8A 1QO8A 1M6IA 3AEAA 3QFAA 5DBJA 4K5RA 1CJ3A 5FS8A 1VDCA 3GD4A 1E1KA 4B64A 1H7XA 4G6HA 3UTGA 4EQRA 4EQSA 4ADWA 1P2EA 1NPXA 2DKIA 2WU2A 1COYA 4H4RA 1DJQA 1H86A 3UCLA 1NHSA 2TPRA 1GRAA 4D04A 4ZN0A 1TDOA 1PHHA 4TM3A 3HYWA 1JOAA 1O5WA 2EQ9A 2BS4A 2GQFA 3AE3A 5ER0A 3OC4A 5KMRA 4A79A 3AE7A 1NHQA 1NEKA 3B3RA 3BI5A 4AP1A 2GR0A 4EQWA 4RG3A 1EBDA 1L9CA 2BCPA 4B1BA 4IA5A 4Z2TA 3GYXA 3R9UA 4H4ZA 1MOKA 2WDVA 2FBWA 4YWOA 1L9EA 3AEFA 3D1CA 4XWZA 1O95A 4NEVA 1KDGA 1OJTA 3CIRA 4NTDA 3CGEA 3CNJA 3NGCX 4YT0A 4Y4MA 3RP8A 3NYEA 3SFEA 3UTHA 4C74A 2YG3A 1PJ5A 2R0GA 2C72A 3G5SA 1Z6LA 4OPGA 1VRQB 3FMWA 2C76A 3AEEA 3CPHG 2O9ZA 1NG4A 1NDAA 2RGHA 1PBFA 1W4XA 1KNRA 4FDCB 4BJZA 4K2XA 1D4CA 1KF6A 3AWIA 5EBKA 5M0ZA 1KSSA 2OLOA 1DOCA 4A5LA 1BKWA 2XDOA 4OPLA 4YTNA 5TR3A 1PXBA 3NKSA 1TDNA 2C3DA 4J2WA 1DNCA 1YQ4A 1B4VA 4D03A 2X8GA 3DJDA 3NN0X 1IUUA 2JKCA 5JCIA 3BI4A 1TYPA 1BGNA 1DOEA 1E1NA 2ZZCA 3GSIA 3ISHA 3M13A 2GMHA 1EL5A 1ZMDA 2UZZA 3ADAB 4O5UA 5IPYA 2GR2A 4U8IA 1GPEA 4U8PA 4CCQA 1CJ2A 3GRSA 5C3JA 1CL0A 3ALLA 1GNDA 2R0PA 3AE4A 3RNMA 3T14A 2BACA 3DA1A 2WQYA 3L8KA 1AOGA 1GXFA 4JQ9A 1SEZA 2XCGA 2C3CA 3AB1A 5KVIA 1VQWA 2BS3A 2Y6QA 2YLRA 4G73A 1BZLA 2H88A 1HYUA 3COXA 4I58A 1ZX9A 2WESA 3ABVA 3EANA 1Q1RA 4PABA 4YSZA 2WEUA 3GDNA 3ICTA 2BYBA 5CQFA 3GYIA 2AR8A 3IC9A 5JCMA 3BNMA 4J36A 4M52A 1JRXA 3ICRA 3AE1A 3AYLA 3C4NA 2ZZBA 2CDUA 3KLJA 5U63A 2WDQA 1XHCA 1GOSA 4YSHA 4EMJA 1F8RA 2V6OA 1DODA 3ITJA 5J7XA 2XFNA 4E0VA 3NH3X 2C70A 2R4EA 3FIMB 2XLSA 3F8RA 4NNJA 1CJ4A 4USQA 4GCMA 3URHA 3NLCA 3DGZA 1L9DA 2Z5XA 1FL2A 4Y4LA 1V59A 4EMWA 1GTEA 3KPKA 4X9NA 5J60A 2X99A 3AYIA 1PBBA 4H4PA 2Q6UA 1GRHA 1E6EA 2XLRA 2QA1A 5BRTA 1CF3A 1DXLA 3SZCA 3FPZA 4U2LA 5BUKA 2RGOA 3FG2P 4NWZA 3BNUA 3GMCA 4UDRA 1FEBA 4IA6A 3GWFA 1PS9A 1LV0A 2YM1A 4XXGA 2YLSA 4GAVA 4J57A 3UP5A 3AE5A 4J56A 3K7MX 3UOXA 3V3OA 2R46A 3SQPA 2BC1A 2YVFA 1S2YA 3ATRA 2EQ8A 4YKFA 3QVRA 2VVMA 1KSUA 3DGHA 3EF6A 4HB9A 4X4JA 4JNQA 4J33A 3RP6A 4C77A 3P4PA 3SZFA 1MO9A 2V3BA 2YWLA 3DK9A 3KA7A 4Y4NA 4B69A 3Q9TA 4UDPA 2XFOA 2OAMA 5KMQA 2WPEA 1JNRA 3QVPA 1IJHA 1LTXR 4FX9A 4II2A 4GR1A 3CNSA 5KVHA 1H81A 4BV6A 2WOWA 1KNPA 2HQMA 3G5RA 1XPQA 2OALA 4H4VA 3SXIA 1O94A 1YQ3A 3S61A 4OPUA 4YSXA 3GDPA 3UTFA 2VRLA 2VZ2A 2GAGB 4TM0A 3QSEA 2C7GA 1JU2A 2B9YA 3AE8A 1BGJA 3NG7X 4K7ZA 2XLTA 2PYXA 4REKA 5FS7A 5GRTA 4A65A 3PVCA 2NVKX 3ZYXA 3P4QA 1JRZA 3QFBA 2BS2A 4A7AA 3NT6A 4CBQA 5M10A 4MJWA 2JB1A 1X31B 2GH5A 4H4WA 2YQUA 1N4WA 4USRA 3NK2X 3NK0X 1D7YA 4U8LA 4C3YA 1IUTA 1E1LA 3NYCA 3ALJA 2V60A 3DJJA 4HA6A 2XVFA 3AE6A 3V76A 4Z44A 5EB5A 4WCTA 4AT2A 2APGA 2C65A 1IUVA 1H83A 3LZXA 5HY5A 3PS9A 1K4QA 4O5QA 5IQ1A 4BJYA 2X3NA 4J31A 3T37A 3LADA 4Z2RA 2ARDA 1PDHA 3AEDA 2GQWA 3SY4A 1LPFA 2GB0A 3NYFA 4X9MA 1NAAA 3ALMA 3IWAA 3QJ4A 5HXIA 3AEGA 4N9XA 3ICSA 1D5TA 3QSMA 5U25A 1RYIA 3UKKA 3VRAA 3AXBA 3LZWA 1OJDA 2YLTA 1ZK7A 4P9SA 4GDEA 4U8KA 4Z25A 1B8SA 2YR6A 3CNTA 2YAUA 2XVIA 2YLWA 4RSLA 2YLZA 3KD9A 2XFUA 2VVLG 2V61A 2WETA 4FK1C 4LU6A 1K0JA 3B6DA 2C64A 2XVEA 3C4AA 1GRGA 2R45A 1GV4A 2B7SA 3RHAA 4EMIA 4GDPA 4I59A 1JEHA 1M64A 2IIDA 5FMHA 1BWCA 3DK8A 1JNZA 3CNPA 4EM4A 3UKAA 4A6NB 4XWRA 4IVOB 1LJ1A 3T2KA 2WHDA 4YTPA 4OPCA 2EQ6A 5JCKA 3S5WA 1TDKA 1Y0PA 3H8LA 3CMMA 2GVCA 2WOIA 1GRFA 2BXRA 1ZOYA 2YR5A 1CC2A 1S3EA 3SM8A 4B63A 2GRTA 2YG7A
chains in the Genus database with same CATH topology
2CVJA 3SZ0A 2FJDA 1GEUA 4CCRA 1NG3A 3DK4A 4GUVA 3JSKA 3PO7A 1XDIA 2YG5A 3LXDA 5EOWA 3IF9A 2XLPA 4CRTA 2GMJA 1FEAA 3I6DA 4GAPA 1B5QA 3REDA 1ZY8A 1TYTA 3GMBA 3BHKA 4H4XA 5JCNA 1ONFA 2B9WA 4Z24A 2XFPA 1N4VA 1IUSA 3Q6JA 3UTEA 1DJNA 1GRTA 1K0LA 3I3LA 4CNJA 2XVJA 5JCLA 5FS9A 4EM3A 1MXTA 2H89A 4BK2A 4YSYA 1GT8A 2B76A 4OPIA 4B68A 1L0VA 4A9WA 1NHPA 4OPTA 2X8HA 2EQ7A 1OJAA 2BCGG 2C4CA 2WOVA 1IUWA 4AOXA 1PJ6A 1D4EA 1F8SA 1N4UA 3T31A 3K30A 2Q0LA 2BRAA 3E1TA 4JNAA 2WPCA 3NIXA 1TDFA 1ZMCA 5KOWA 4NTEA 2VQBA 3LOVA 3AE9A 4A6NA 1P2HA 3KVEA 4Z2UA 4U2SA 2VQ7A 4UP3A 3GRTA 5U1OA 4H2QA 2V3AA 3CTYA 1LVLA 4OCGA 5GSNA 4H7UA 1S3BA 2IVEA 4CY8A 3O0HA 2RGJA 4U8MA 3LB8A 3M0OA 5KWFA 1KFYA 1GESA 2TMDA 2C66A 2YG4A 3VR8A 4TLZA 3AD9B 1CBOA 4U8NA 2QA2A 1VG9A 3T0KA 3AD7B 2GV8A 1LQTA 4H2PA 2XVHA 2GF3A 2VRMA 2WBAA 5BVAA 3NHOX 3AYJA 3NRNA 2FJEA 3P4RA 1CJCA 1QJDA 3F8DA 4TM4A 3HZLA 3SFDA 2QAEA 1PBCA 5KMSA 1EL9A 3AD8B 3H4KA 4H4TA 1FOHA 3CGDA 4YKGA 2BK3A 2Z5YA 4H4QA 4WX1A 1GTHA 1TDEA 3NK1X 4AP3A 2WP5A 4DNAA 4IVMB 4C3XA 3SX6A 4A99A 4J34A 4TLXA 1NHRA 1N1PA 1UKVG 1ZKQA 4U8OA 1GRBA 2Q0KA 1GERA 1PXCA 4BK3A 4AT0A 1FECA 5EB4A 1PBEA 5LV9A 4CY6A 1ELIA 1H7WA 5CKUA 3GD3A 2GR3A 3IHGA 3DJGX 2Y6RA 3DH9A 4EQXA 4BURA 2JAEA 1FCDA 3LJPA 4UDQA 1F3PA 3NN6X 4NZHA 2X8CA 4BK1A 2E4GA 3ZDNA 3P1WA 2VVLA 2WPFA 2FJBA 3CGCA 3CN8A 2JB2A 3BHFA 3QSSA 3EPTA 3UP4A 2BXSA 2E1MA 2W0HA 4B66A 3KKJA 1PBDA 2YG6A 5KMPA 2RABA 1Q1WA 3VRBA 2WP9A 2C67A 4AOSA 2ACZA 3HYXA 2BK4A 3T2ZA 5C2TA 3NTDA 1JRYA 1ZP0A 2CFYA 2VOUA 4DGKA 3NNEA 4Z43A 1OJCA 2B7RA 3SZWA 3VQRA 2ZZ0A 3OZ2A 4PAAA 3UKHA 5IQ4A 1CC6A 3CPIG 3H8IA 3GWDA 3NTAA 1GALA 4B67A 3P4SA 3GYJA 1VG0A 4C5OA 4H4UA 3SYIA 2BC0A 3M12A 4YXDA 2JBVA 4JY2A 2YVGA 3K7TA 1Y56B 3UOYA 2GR1A 2YM2A 3DMEA 4JN9A 2GAHB 4CNKA 1Q9IA 2AQJA 5KNLA 3EAOA 5BULA 3UKFA 1S2QA 2BRYA 2WP6A 4K8DA 2QCUA 4H50A 2WDRA 1F6MA 1H6VA 3C96A 3G5QA 2B9XA 4H4SA 4EIQA 4H2RA 2WU5A 3K7QX 4IV9A 1ZOVA 2XYOA 3AE2A 4OVIA 2AAQA 1EL7A 3IHMA 2I0ZA 2ZBWA 2YVJA 2A87A 3KPFA 2JB3A 4K22A 5KXJA 3P9UA 3UOZA 4G6GA 4FK1A 4YTMA 1GREA 2E5VA 4ZCDA 4JY3A 1K0IA 3CPJG 4H4YA 3VRDB 1TRBA 3V3NA 4K5SA 3UOVA 3F8PA 2XFQA 3FBSA 3WE0A 5FS6A 4B65A 5HYMA 1H82A 2R0CA 1YY5A 2YLXA 4APNA 1GETA 4U2TA 2DKHA 2BK5A 4H2NA 1YKJA 2NPXA 3T2YA 1E1MA 4G74A 2IVDA 3VR9A 1D4DA 1QLBA 4KPRA 1NENA 2FJAA 1RP0A 1LQUA 5L46A 4ZCCA 4EIPA 4JDRA 2J3NA 1YQZA 3HYVA 4KX6A 4GRTA 3SGLA 4OPDA 1B37A 3L1RA 2X50A 1CHUA 1Y56A 1DOBA 2A8XA 4NTCA 2OLNA 5KOXA 4DSHA 4G9KA 1XANA 2Q7VA 2C75A 2CULA 2BA9A 3II4A 3UKQA 4GF7A 4TM1A 2A89A 3CNDA 1REOA 2JK6A 4II3A 3UKLA 3KU9A 3AECA 4U8JA 4DSGA 1H84A 1PN0A 2C73A 1RSGA 2GEWA 3CGBA 1OJ9A 4RG4A 4NEWA 1E39A 1F8WA 5KRQA 1PXAA 2YR4A 3AEBA 1E7PA 3ATQA 2OA1A 3BI2A 1ZDLA 1PJ7A 3D8XA 1BF3A 3UKPA 3DJEA 1GSNA 2F5ZA 5HHFA 2XLUA 2WS3A 3RP7A 2R9ZA 2V5ZA 4ECHA 1IUXA 2BABA 2PHHA 4LA1A 4Z26A 4ICYA 4LIIA 2R4JA 1CC4A 1D7LA 1EL8A 1QO8A 1M6IA 3AEAA 3QFAA 5DBJA 4K5RA 1CJ3A 5FS8A 1VDCA 3GD4A 1E1KA 4B64A 1H7XA 4G6HA 3UTGA 4EQRA 4EQSA 4ADWA 1P2EA 1NPXA 2DKIA 2WU2A 1COYA 4H4RA 1DJQA 1H86A 3UCLA 1NHSA 2TPRA 1GRAA 4D04A 4ZN0A 1TDOA 1PHHA 4TM3A 3HYWA 1JOAA 1O5WA 2EQ9A 2BS4A 2GQFA 3AE3A 5ER0A 3OC4A 5KMRA 4A79A 3AE7A 1NHQA 1NEKA 3B3RA 3BI5A 4AP1A 2GR0A 4EQWA 4RG3A 1EBDA 1L9CA 2BCPA 4B1BA 4IA5A 4Z2TA 3GYXA 3R9UA 4H4ZA 1MOKA 2WDVA 2FBWA 4YWOA 1L9EA 3AEFA 3D1CA 4XWZA 1O95A 4NEVA 1KDGA 1OJTA 3CIRA 4NTDA 3CGEA 3CNJA 3NGCX 4YT0A 4Y4MA 3RP8A 3NYEA 3SFEA 3UTHA 4C74A 2YG3A 1PJ5A 2R0GA 2C72A 3G5SA 1Z6LA 4OPGA 1VRQB 3FMWA 2C76A 3AEEA 3CPHG 2O9ZA 1NG4A 1NDAA 2RGHA 1PBFA 1W4XA 1KNRA 4FDCB 4BJZA 4K2XA 1D4CA 1KF6A 3AWIA 5EBKA 5M0ZA 1KSSA 2OLOA 1DOCA 4A5LA 1BKWA 2XDOA 4OPLA 4YTNA 5TR3A 1PXBA 3NKSA 1TDNA 2C3DA 4J2WA 1DNCA 1YQ4A 1B4VA 4D03A 2X8GA 3DJDA 3NN0X 1IUUA 2JKCA 5JCIA 3BI4A 1TYPA 1BGNA 1DOEA 1E1NA 2ZZCA 3GSIA 3ISHA 3M13A 2GMHA 1EL5A 1ZMDA 2UZZA 3ADAB 4O5UA 5IPYA 2GR2A 4U8IA 1GPEA 4U8PA 4CCQA 1CJ2A 3GRSA 5C3JA 1CL0A 3ALLA 1GNDA 2R0PA 3AE4A 3RNMA 3T14A 2BACA 3DA1A 2WQYA 3L8KA 1AOGA 1GXFA 4JQ9A 1SEZA 2XCGA 2C3CA 3AB1A 5KVIA 1VQWA 2BS3A 2Y6QA 2YLRA 4G73A 1BZLA 2H88A 1HYUA 3COXA 4I58A 1ZX9A 2WESA 3ABVA 3EANA 1Q1RA 4PABA 4YSZA 2WEUA 3GDNA 3ICTA 2BYBA 5CQFA 3GYIA 2AR8A 3IC9A 5JCMA 3BNMA 4J36A 4M52A 1JRXA 3ICRA 3AE1A 3AYLA 3C4NA 2ZZBA 2CDUA 3KLJA 5U63A 2WDQA 1XHCA 1GOSA 4YSHA 4EMJA 1F8RA 2V6OA 1DODA 3ITJA 5J7XA 2XFNA 4E0VA 3NH3X 2C70A 2R4EA 3FIMB 2XLSA 3F8RA 4NNJA 1CJ4A 4USQA 4GCMA 3URHA 3NLCA 3DGZA 1L9DA 2Z5XA 1FL2A 4Y4LA 1V59A 4EMWA 1GTEA 3KPKA 4X9NA 5J60A 2X99A 3AYIA 1PBBA 4H4PA 2Q6UA 1GRHA 1E6EA 2XLRA 2QA1A 5BRTA 1CF3A 1DXLA 3SZCA 3FPZA 4U2LA 5BUKA 2RGOA 3FG2P 4NWZA 3BNUA 3GMCA 4UDRA 1FEBA 4IA6A 3GWFA 1PS9A 1LV0A 2YM1A 4XXGA 2YLSA 4GAVA 4J57A 3UP5A 3AE5A 4J56A 3K7MX 3UOXA 3V3OA 2R46A 3SQPA 2BC1A 2YVFA 1S2YA 3ATRA 2EQ8A 4YKFA 3QVRA 2VVMA 1KSUA 3DGHA 3EF6A 4HB9A 4X4JA 4JNQA 4J33A 3RP6A 4C77A 3P4PA 3SZFA 1MO9A 2V3BA 2YWLA 3DK9A 3KA7A 4Y4NA 4B69A 3Q9TA 4UDPA 2XFOA 2OAMA 5KMQA 2WPEA 1JNRA 3QVPA 1IJHA 1LTXR 4FX9A 4II2A 4GR1A 3CNSA 5KVHA 1H81A 4BV6A 2WOWA 1KNPA 2HQMA 3G5RA 1XPQA 2OALA 4H4VA 3SXIA 1O94A 1YQ3A 3S61A 4OPUA 4YSXA 3GDPA 3UTFA 2VRLA 2VZ2A 2GAGB 4TM0A 3QSEA 2C7GA 1JU2A 2B9YA 3AE8A 1BGJA 3NG7X 4K7ZA 2XLTA 2PYXA 4REKA 5FS7A 5GRTA 4A65A 3PVCA 2NVKX 3ZYXA 3P4QA 1JRZA 3QFBA 2BS2A 4A7AA 3NT6A 4CBQA 5M10A 4MJWA 2JB1A 1X31B 2GH5A 4H4WA 2YQUA 1N4WA 4USRA 3NK2X 3NK0X 1D7YA 4U8LA 4C3YA 1IUTA 1E1LA 3NYCA 3ALJA 2V60A 3DJJA 4HA6A 2XVFA 3AE6A 3V76A 4Z44A 5EB5A 4WCTA 4AT2A 2APGA 2C65A 1IUVA 1H83A 3LZXA 5HY5A 3PS9A 1K4QA 4O5QA 5IQ1A 4BJYA 2X3NA 4J31A 3T37A 3LADA 4Z2RA 2ARDA 1PDHA 3AEDA 2GQWA 3SY4A 1LPFA 2GB0A 3NYFA 4X9MA 1NAAA 3ALMA 3IWAA 3QJ4A 5HXIA 3AEGA 4N9XA 3ICSA 1D5TA 3QSMA 5U25A 1RYIA 3UKKA 3VRAA 3AXBA 3LZWA 1OJDA 2YLTA 1ZK7A 4P9SA 4GDEA 4U8KA 4Z25A 1B8SA 2YR6A 3CNTA 2YAUA 2XVIA 2YLWA 4RSLA 2YLZA 3KD9A 2XFUA 2VVLG 2V61A 2WETA 4FK1C 4LU6A 1K0JA 3B6DA 2C64A 2XVEA 3C4AA 1GRGA 2R45A 1GV4A 2B7SA 3RHAA 4EMIA 4GDPA 4I59A 1JEHA 1M64A 2IIDA 5FMHA 1BWCA 3DK8A 1JNZA 3CNPA 4EM4A 3UKAA 4A6NB 4XWRA 4IVOB 1LJ1A 3T2KA 2WHDA 4YTPA 4OPCA 2EQ6A 5JCKA 3S5WA 1TDKA 1Y0PA 3H8LA 3CMMA 2GVCA 2WOIA 1GRFA 2BXRA 1ZOYA 2YR5A 1CC2A 1S3EA 3SM8A 4B63A 2GRTA 2YG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CVJ A;  2FJD A;  1GEU A;  4CCR A;  1NG3 A;  3DK4 A;  4GUV A;  3JSK A;  3PO7 A;  1XDI A;  2YG5 A;  3LXD A;  5EOW A;  3IF9 A;  2XLP A;  4CRT A;  2GMJ A;  1FEA A;  3I6D A;  1B5Q A;  3RED A;  1ZY8 A;  1TYT A;  3GMB A;  3BHK A;  4H4X A;  5JCN A;  1ONF A;  2B9W A;  4Z24 A;  2XFP A;  1N4V A;  1IUS A;  3Q6J A;  3UTE A;  1DJN A;  1GRT A;  1K0L A;  3I3L A;  4CNJ A;  2XVJ A;  5JCL A;  5FS9 A;  4EM3 A;  1MXT A;  2H89 A;  4BK2 A;  4YSY A;  1GT8 A;  2B76 A;  4OPI A;  4B68 A;  1L0V A;  4A9W A;  1NHP A;  4OPT A;  2X8H A;  2EQ7 A;  1OJA A;  2BCG G;  2WOV A;  1IUW A;  4AOX A;  1PJ6 A;  1D4E A;  1F8S A;  1N4U A;  3K30 A;  2Q0L A;  3E1T A;  4JNA A;  2WPC A;  3NIX A;  1TDF A;  1ZMC A;  5KOW A;  4NTE A;  2VQB A;  3LOV A;  3AE9 A;  4A6N A;  1P2H A;  3KVE A;  4Z2U A;  4U2S A;  2VQ7 A;  4UP3 A;  3GRT A;  5U1O A;  4H2Q A;  2V3A A;  3CTY A;  1LVL A;  4OCG A;  5GSN A;  4H7U A;  1S3B A;  2IVE A;  4CY8 A;  3O0H A;  2RGJ A;  4U8M A;  3LB8 A;  3M0O A;  5KWF A;  1KFY A;  1GES A;  2TMD A;  2C66 A;  2YG4 A;  3VR8 A;  4TLZ A;  3AD9 B;  1CBO A;  4U8N A;  2QA2 A;  1VG9 A;  3AD7 B;  2GV8 A;  1LQT A;  4H2P A;  2XVH A;  2GF3 A;  2VRM A;  2WBA A;  5BVA A;  3NHO X;  3AYJ A;  3NRN A;  2FJE A;  3P4R A;  1CJC A;  1QJD A;  3F8D A;  4TM4 A;  3HZL A;  3SFD A;  2QAE A;  1PBC A;  1EL9 A;  3AD8 B;  3H4K A;  4H4T A;  1FOH A;  3CGD A;  4YKG A;  2BK3 A;  2Z5Y A;  4H4Q A;  4WX1 A;  1GTH A;  1TDE A;  3NK1 X;  4AP3 A;  2WP5 A;  4DNA A;  4IVM B;  4C3X A;  4A99 A;  4J34 A;  4TLX A;  1NHR A;  1N1P A;  1UKV G;  1ZKQ A;  4U8O A;  1GRB A;  2Q0K A;  1GER A;  1PXC A;  4BK3 A;  4AT0 A;  1FEC A;  5EB4 A;  1PBE A;  5LV9 A;  4CY6 A;  1ELI A;  1H7W A;  5CKU A;  3GD3 A;  2GR3 A;  3IHG A;  3DJG X;  2Y6R A;  3DH9 A;  4EQX A;  4BUR A;  2JAE A;  1FCD A;  3LJP A;  4UDQ A;  1F3P A;  3NN6 X;  4NZH A;  2X8C A;  4BK1 A;  2E4G A;  3ZDN A;  3P1W A;  2VVL A;  2WPF A;  2FJB A;  3CGC A;  3CN8 A;  2JB2 A;  3BHF A;  3QSS A;  3EPT A;  3UP4 A;  2BXS A;  2E1M A;  2W0H A;  4B66 A;  3KKJ A;  1PBD A;  2YG6 A;  2RAB A;  1Q1W A;  3VRB A;  2WP9 A;  2C67 A;  4AOS A;  2ACZ A;  2BK4 A;  5C2T A;  3NTD A;  1JRY A;  1ZP0 A;  2CFY A;  2VOU A;  4DGK A;  3NNE A;  4Z43 A;  1OJC A;  2B7R A;  3VQR A;  2ZZ0 A;  3OZ2 A;  4PAA A;  3UKH A;  5IQ4 A;  1CC6 A;  3CPI G;  3H8I A;  3GWD A;  3NTA A;  1GAL A;  4B67 A;  3P4S A;  3GYJ A;  1VG0 A;  4C5O A;  4H4U A;  2BC0 A;  3M12 A;  4YXD A;  2JBV A;  4JY2 A;  2YVG A;  3K7T A;  1Y56 B;  3UOY A;  2GR1 A;  2YM2 A;  3DME A;  4JN9 A;  2GAH B;  4CNK A;  1Q9I A;  2AQJ A;  3EAO A;  5BUL A;  3UKF A;  1S2Q A;  2WP6 A;  4K8D A;  2QCU A;  4H50 A;  2WDR A;  1F6M A;  1H6V A;  3C96 A;  3G5Q A;  2B9X A;  4H4S A;  4EIQ A;  4H2R A;  2WU5 A;  3K7Q X;  4IV9 A;  1ZOV A;  2XYO A;  3AE2 A;  4OVI A;  2AAQ A;  1EL7 A;  3IHM A;  2I0Z A;  2ZBW A;  2YVJ A;  2A87 A;  3KPF A;  2JB3 A;  4K22 A;  5KXJ A;  3P9U A;  3UOZ A;  4FK1 A;  4YTM A;  1GRE A;  2E5V A;  4ZCD A;  4JY3 A;  1K0I A;  3CPJ G;  4H4Y A;  3VRD B;  1TRB A;  3V3N A;  4K5S A;  3UOV A;  3F8P A;  2XFQ A;  3FBS A;  3WE0 A;  5FS6 A;  4B65 A;  5HYM A;  1H82 A;  2R0C A;  1YY5 A;  2YLX A;  4APN A;  1GET A;  4U2T A;  2DKH A;  2BK5 A;  4H2N A;  1YKJ A;  2NPX A;  1E1M A;  2IVD A;  3VR9 A;  1D4D A;  1QLB A;  4KPR A;  1NEN A;  2FJA A;  1RP0 A;  1LQU A;  5L46 A;  4ZCC A;  4EIP A;  4JDR A;  2J3N A;  1YQZ A;  4KX6 A;  4GRT A;  3SGL A;  4OPD A;  1B37 A;  3L1R A;  2X50 A;  1CHU A;  1Y56 A;  1DOB A;  2A8X A;  4NTC A;  2OLN A;  5KOX A;  4DSH A;  1XAN A;  2Q7V A;  2C75 A;  2CUL A;  2BA9 A;  3II4 A;  3UKQ A;  4GF7 A;  4TM1 A;  2A89 A;  3CND A;  1REO A;  2JK6 A;  3UKL A;  4DSG A;  3KU9 A;  3AEC A;  4U8J A;  4E0V A;  1H84 A;  1PN0 A;  2C73 A;  1RSG A;  2GEW A;  3CGB A;  1OJ9 A;  4RG4 A;  4NEW A;  1E39 A;  1F8W A;  5KRQ A;  1PXA A;  2YR4 A;  3AEB A;  1E7P A;  3ATQ A;  2OA1 A;  3BI2 A;  1ZDL A;  1PJ7 A;  3D8X A;  1BF3 A;  3UKP A;  3DJE A;  1GSN A;  2F5Z A;  5HHF A;  2XLU A;  2WS3 A;  3RP7 A;  2R9Z A;  2V5Z A;  4ECH A;  1IUX A;  2BAB A;  2PHH A;  4LA1 A;  4Z26 A;  4ICY A;  4LII A;  2R4J A;  1CC4 A;  1D7L A;  1EL8 A;  1QO8 A;  1M6I A;  3AEA A;  3QFA A;  5DBJ A;  4K5R A;  1CJ3 A;  5FS8 A;  1VDC A;  3GD4 A;  1E1K A;  4B64 A;  1H7X A;  3UTG A;  4EQR A;  4EQS A;  4ADW A;  1P2E A;  1NPX A;  2DKI A;  2WU2 A;  1COY A;  4H4R A;  1DJQ A;  1H86 A;  3UCL A;  1NHS A;  2TPR A;  1GRA A;  4D04 A;  4ZN0 A;  1TDO A;  1PHH A;  4TM3 A;  1JOA A;  1O5W A;  2EQ9 A;  2BS4 A;  2GQF A;  3AE3 A;  5ER0 A;  3OC4 A;  4A79 A;  3AE7 A;  1NHQ A;  1NEK A;  3B3R A;  3BI5 A;  4AP1 A;  2GR0 A;  4EQW A;  4RG3 A;  1EBD A;  1L9C A;  2BCP A;  4B1B A;  4IA5 A;  4Z2T A;  3R9U A;  4H4Z A;  1MOK A;  2WDV A;  2FBW A;  4YWO A;  1L9E A;  3AEF A;  3D1C A;  4XWZ A;  1O95 A;  4NEV A;  1KDG A;  1OJT A;  3CIR A;  4NTD A;  3CGE A;  3CNJ A;  3NGC X;  4YT0 A;  4Y4M A;  3RP8 A;  3NYE A;  3SFE A;  3UTH A;  4C74 A;  2YG3 A;  1PJ5 A;  2R0G A;  2C72 A;  3G5S A;  1Z6L A;  4OPG A;  1VRQ B;  3FMW A;  2C76 A;  3AEE A;  3CPH G;  2O9Z A;  1NG4 A;  1NDA A;  2RGH A;  1PBF A;  1W4X A;  1KNR A;  4FDC B;  4BJZ A;  4K2X A;  1D4C A;  1KF6 A;  3AWI A;  5EBK A;  5M0Z A;  1KSS A;  2OLO A;  1DOC A;  4A5L A;  1BKW A;  2XDO A;  4OPL A;  4YTN A;  5TR3 A;  1PXB A;  3NKS A;  1TDN A;  2C3D A;  4J2W A;  1DNC A;  1YQ4 A;  1B4V A;  4D03 A;  2X8G A;  3DJD A;  3NN0 X;  1IUU A;  2JKC A;  5JCI A;  3BI4 A;  1TYP A;  1BGN A;  1DOE A;  1E1N A;  2ZZC A;  3GSI A;  3ISH A;  3M13 A;  2GMH A;  1EL5 A;  1ZMD A;  2UZZ A;  3ADA B;  4O5U A;  5IPY A;  2GR2 A;  4U8I A;  1GPE A;  4U8P A;  4CCQ A;  1CJ2 A;  3GRS A;  5C3J A;  1CL0 A;  3ALL A;  1GND A;  2R0P A;  3AE4 A;  3RNM A;  2BAC A;  3DA1 A;  2WQY A;  3L8K A;  1AOG A;  1GXF A;  4JQ9 A;  1SEZ A;  2XCG A;  2C3C A;  3AB1 A;  5KVI A;  1VQW A;  2BS3 A;  2Y6Q A;  2YLR A;  1BZL A;  2H88 A;  1HYU A;  3COX A;  4I58 A;  1ZX9 A;  2WES A;  3ABV A;  3EAN A;  1Q1R A;  4PAB A;  4YSZ A;  2WEU A;  3GDN A;  3ICT A;  2BYB A;  5CQF A;  3GYI A;  2AR8 A;  3IC9 A;  5JCM A;  3BNM A;  4J36 A;  4M52 A;  1JRX A;  3ICR A;  3AE1 A;  3AYL A;  3C4N A;  2ZZB A;  2CDU A;  3KLJ A;  5U63 A;  2WDQ A;  1XHC A;  1GOS A;  4YSH A;  4EMJ A;  1F8R A;  2V6O A;  1DOD A;  3ITJ A;  5J7X A;  2XFN A;  3NH3 X;  2C70 A;  2R4E A;  3FIM B;  2XLS A;  3F8R A;  1CJ4 A;  4USQ A;  4GCM A;  3URH A;  3NLC A;  3DGZ A;  1L9D A;  2Z5X A;  1FL2 A;  4Y4L A;  1V59 A;  4EMW A;  1GTE A;  4X9N A;  5J60 A;  2X99 A;  3AYI A;  1PBB A;  4H4P A;  2Q6U A;  1GRH A;  1E6E A;  2XLR A;  2QA1 A;  5BRT A;  1CF3 A;  1DXL A;  3FPZ A;  4U2L A;  5BUK A;  2RGO A;  3FG2 P;  3BNU A;  3GMC A;  4UDR A;  1FEB A;  4IA6 A;  3GWF A;  1PS9 A;  1LV0 A;  2YM1 A;  4XXG A;  2YLS A;  4J57 A;  3UP5 A;  3AE5 A;  4J56 A;  3K7M X;  3UOX A;  3V3O A;  2R46 A;  3SQP A;  2BC1 A;  2YVF A;  1S2Y A;  3ATR A;  2EQ8 A;  4YKF A;  3QVR A;  2VVM A;  1KSU A;  3DGH A;  3EF6 A;  4HB9 A;  4X4J A;  4JNQ A;  4J33 A;  3RP6 A;  4C77 A;  3P4P A;  1MO9 A;  2V3B A;  2YWL A;  3DK9 A;  3KA7 A;  4Y4N A;  4B69 A;  3Q9T A;  4UDP A;  2XFO A;  2OAM A;  2WPE A;  1JNR A;  3QVP A;  1IJH A;  1LTX R;  4FX9 A;  4GR1 A;  3CNS A;  5KVH A;  1H81 A;  4BV6 A;  2WOW A;  1KNP A;  2HQM A;  3G5R A;  1XPQ A;  2OAL A;  4H4V A;  1O94 A;  1YQ3 A;  3S61 A;  4OPU A;  4YSX A;  3GDP A;  3UTF A;  2VRL A;  2VZ2 A;  2GAG B;  4TM0 A;  3QSE A;  2C7G A;  1JU2 A;  2B9Y A;  3AE8 A;  1BGJ A;  3NG7 X;  4K7Z A;  2XLT A;  2PYX A;  4REK A;  5FS7 A;  5GRT A;  4A65 A;  3PVC A;  2NVK X;  3ZYX A;  3P4Q A;  1JRZ A;  3QFB A;  2BS2 A;  4A7A A;  3NT6 A;  4CBQ A;  5M10 A;  4MJW A;  2JB1 A;  1X31 B;  2GH5 A;  4H4W A;  2YQU A;  1N4W A;  4USR A;  3NK2 X;  3NK0 X;  1D7Y A;  4U8L A;  4C3Y A;  1IUT A;  1E1L A;  3NYC A;  3ALJ A;  2V60 A;  3DJJ A;  4HA6 A;  2XVF A;  3AE6 A;  3V76 A;  4Z44 A;  5EB5 A;  4WCT A;  4AT2 A;  2APG A;  2C65 A;  1IUV A;  1H83 A;  3LZX A;  5HY5 A;  3PS9 A;  1K4Q A;  4O5Q A;  5IQ1 A;  4BJY A;  2X3N A;  4J31 A;  3T37 A;  3LAD A;  4Z2R A;  2ARD A;  1PDH A;  3AED A;  2GQW A;  1LPF A;  2GB0 A;  3NYF A;  4X9M A;  1NAA A;  3ALM A;  3IWA A;  3QJ4 A;  5HXI A;  3AEG A;  4N9X A;  3ICS A;  1D5T A;  3QSM A;  5U25 A;  1RYI A;  3UKK A;  3VRA A;  3AXB A;  3LZW A;  1OJD A;  2YLT A;  1ZK7 A;  4P9S A;  4GDE A;  4U8K A;  4Z25 A;  1B8S A;  2YR6 A;  3CNT A;  2YAU A;  2XVI A;  2YLW A;  4RSL A;  2YLZ A;  3KD9 A;  2XFU A;  2VVL G;  2V61 A;  2WET A;  4FK1 C;  4LU6 A;  1K0J A;  3B6D A;  2C64 A;  2XVE A;  3C4A A;  1GRG A;  2R45 A;  1GV4 A;  2B7S A;  3RHA A;  4EMI A;  4GDP A;  4I59 A;  1JEH A;  1M64 A;  2IID A;  5FMH A;  1BWC A;  3DK8 A;  1JNZ A;  3CNP A;  4EM4 A;  3UKA A;  4A6N B;  4XWR A;  4IVO B;  1LJ1 A;  2WHD A;  4YTP A;  4OPC A;  2EQ6 A;  5JCK A;  3S5W A;  1TDK A;  1Y0P A;  3H8L A;  2GVC A;  2WOI A;  1GRF A;  2BXR A;  1ZOY A;  2YR5 A;  1CC2 A;  1S3E A;  3SM8 A;  4B63 A;  2GRT A;  2YG7 A; 
#chains in the Genus database with same CATH topology
 2CVJ A;  3SZ0 A;  2FJD A;  1GEU A;  4CCR A;  1NG3 A;  3DK4 A;  4GUV A;  3JSK A;  3PO7 A;  1XDI A;  2YG5 A;  3LXD A;  5EOW A;  3IF9 A;  2XLP A;  4CRT A;  2GMJ A;  1FEA A;  3I6D A;  4GAP A;  1B5Q A;  3RED A;  1ZY8 A;  1TYT A;  3GMB A;  3BHK A;  4H4X A;  5JCN A;  1ONF A;  2B9W A;  4Z24 A;  2XFP A;  1N4V A;  1IUS A;  3Q6J A;  3UTE A;  1DJN A;  1GRT A;  1K0L A;  3I3L A;  4CNJ A;  2XVJ A;  5JCL A;  5FS9 A;  4EM3 A;  1MXT A;  2H89 A;  4BK2 A;  4YSY A;  1GT8 A;  2B76 A;  4OPI A;  4B68 A;  1L0V A;  4A9W A;  1NHP A;  4OPT A;  2X8H A;  2EQ7 A;  1OJA A;  2BCG G;  2C4C A;  2WOV A;  1IUW A;  4AOX A;  1PJ6 A;  1D4E A;  1F8S A;  1N4U A;  3T31 A;  3K30 A;  2Q0L A;  2BRA A;  3E1T A;  4JNA A;  2WPC A;  3NIX A;  1TDF A;  1ZMC A;  5KOW A;  4NTE A;  2VQB A;  3LOV A;  3AE9 A;  4A6N A;  1P2H A;  3KVE A;  4Z2U A;  4U2S A;  2VQ7 A;  4UP3 A;  3GRT A;  5U1O A;  4H2Q A;  2V3A A;  3CTY A;  1LVL A;  4OCG A;  5GSN A;  4H7U A;  1S3B A;  2IVE A;  4CY8 A;  3O0H A;  2RGJ A;  4U8M A;  3LB8 A;  3M0O A;  5KWF A;  1KFY A;  1GES A;  2TMD A;  2C66 A;  2YG4 A;  3VR8 A;  4TLZ A;  3AD9 B;  1CBO A;  4U8N A;  2QA2 A;  1VG9 A;  3T0K A;  3AD7 B;  2GV8 A;  1LQT A;  4H2P A;  2XVH A;  2GF3 A;  2VRM A;  2WBA A;  5BVA A;  3NHO X;  3AYJ A;  3NRN A;  2FJE A;  3P4R A;  1CJC A;  1QJD A;  3F8D A;  4TM4 A;  3HZL A;  3SFD A;  2QAE A;  1PBC A;  5KMS A;  1EL9 A;  3AD8 B;  3H4K A;  4H4T A;  1FOH A;  3CGD A;  4YKG A;  2BK3 A;  2Z5Y A;  4H4Q A;  4WX1 A;  1GTH A;  1TDE A;  3NK1 X;  4AP3 A;  2WP5 A;  4DNA A;  4IVM B;  4C3X A;  3SX6 A;  4A99 A;  4J34 A;  4TLX A;  1NHR A;  1N1P A;  1UKV G;  1ZKQ A;  4U8O A;  1GRB A;  2Q0K A;  1GER A;  1PXC A;  4BK3 A;  4AT0 A;  1FEC A;  5EB4 A;  1PBE A;  5LV9 A;  4CY6 A;  1ELI A;  1H7W A;  5CKU A;  3GD3 A;  2GR3 A;  3IHG A;  3DJG X;  2Y6R A;  3DH9 A;  4EQX A;  4BUR A;  2JAE A;  1FCD A;  3LJP A;  4UDQ A;  1F3P A;  3NN6 X;  4NZH A;  2X8C A;  4BK1 A;  2E4G A;  3ZDN A;  3P1W A;  2VVL A;  2WPF A;  2FJB A;  3CGC A;  3CN8 A;  2JB2 A;  3BHF A;  3QSS A;  3EPT A;  3UP4 A;  2BXS A;  2E1M A;  2W0H A;  4B66 A;  3KKJ A;  1PBD A;  2YG6 A;  5KMP A;  2RAB A;  1Q1W A;  3VRB A;  2WP9 A;  2C67 A;  4AOS A;  2ACZ A;  3HYX A;  2BK4 A;  3T2Z A;  5C2T A;  3NTD A;  1JRY A;  1ZP0 A;  2CFY A;  2VOU A;  4DGK A;  3NNE A;  4Z43 A;  1OJC A;  2B7R A;  3SZW A;  3VQR A;  2ZZ0 A;  3OZ2 A;  4PAA A;  3UKH A;  5IQ4 A;  1CC6 A;  3CPI G;  3H8I A;  3GWD A;  3NTA A;  1GAL A;  4B67 A;  3P4S A;  3GYJ A;  1VG0 A;  4C5O A;  4H4U A;  3SYI A;  2BC0 A;  3M12 A;  4YXD A;  2JBV A;  4JY2 A;  2YVG A;  3K7T A;  1Y56 B;  3UOY A;  2GR1 A;  2YM2 A;  3DME A;  4JN9 A;  2GAH B;  4CNK A;  1Q9I A;  2AQJ A;  5KNL A;  3EAO A;  5BUL A;  3UKF A;  1S2Q A;  2BRY A;  2WP6 A;  4K8D A;  2QCU A;  4H50 A;  2WDR A;  1F6M A;  1H6V A;  3C96 A;  3G5Q A;  2B9X A;  4H4S A;  4EIQ A;  4H2R A;  2WU5 A;  3K7Q X;  4IV9 A;  1ZOV A;  2XYO A;  3AE2 A;  4OVI A;  2AAQ A;  1EL7 A;  3IHM A;  2I0Z A;  2ZBW A;  2YVJ A;  2A87 A;  3KPF A;  2JB3 A;  4K22 A;  5KXJ A;  3P9U A;  3UOZ A;  4G6G A;  4FK1 A;  4YTM A;  1GRE A;  2E5V A;  4ZCD A;  4JY3 A;  1K0I A;  3CPJ G;  4H4Y A;  3VRD B;  1TRB A;  3V3N A;  4K5S A;  3UOV A;  3F8P A;  2XFQ A;  3FBS A;  3WE0 A;  5FS6 A;  4B65 A;  5HYM A;  1H82 A;  2R0C A;  1YY5 A;  2YLX A;  4APN A;  1GET A;  4U2T A;  2DKH A;  2BK5 A;  4H2N A;  1YKJ A;  2NPX A;  3T2Y A;  1E1M A;  4G74 A;  2IVD A;  3VR9 A;  1D4D A;  1QLB A;  4KPR A;  1NEN A;  2FJA A;  1RP0 A;  1LQU A;  5L46 A;  4ZCC A;  4EIP A;  4JDR A;  2J3N A;  1YQZ A;  3HYV A;  4KX6 A;  4GRT A;  3SGL A;  4OPD A;  1B37 A;  3L1R A;  2X50 A;  1CHU A;  1Y56 A;  1DOB A;  2A8X A;  4NTC A;  2OLN A;  5KOX A;  4DSH A;  4G9K A;  1XAN A;  2Q7V A;  2C75 A;  2CUL A;  2BA9 A;  3II4 A;  3UKQ A;  4GF7 A;  4TM1 A;  2A89 A;  3CND A;  1REO A;  2JK6 A;  4II3 A;  3UKL A;  3KU9 A;  3AEC A;  4U8J A;  4DSG A;  1H84 A;  1PN0 A;  2C73 A;  1RSG A;  2GEW A;  3CGB A;  1OJ9 A;  4RG4 A;  4NEW A;  1E39 A;  1F8W A;  5KRQ A;  1PXA A;  2YR4 A;  3AEB A;  1E7P A;  3ATQ A;  2OA1 A;  3BI2 A;  1ZDL A;  1PJ7 A;  3D8X A;  1BF3 A;  3UKP A;  3DJE A;  1GSN A;  2F5Z A;  5HHF A;  2XLU A;  2WS3 A;  3RP7 A;  2R9Z A;  2V5Z A;  4ECH A;  1IUX A;  2BAB A;  2PHH A;  4LA1 A;  4Z26 A;  4ICY A;  4LII A;  2R4J A;  1CC4 A;  1D7L A;  1EL8 A;  1QO8 A;  1M6I A;  3AEA A;  3QFA A;  5DBJ A;  4K5R A;  1CJ3 A;  5FS8 A;  1VDC A;  3GD4 A;  1E1K A;  4B64 A;  1H7X A;  4G6H A;  3UTG A;  4EQR A;  4EQS A;  4ADW A;  1P2E A;  1NPX A;  2DKI A;  2WU2 A;  1COY A;  4H4R A;  1DJQ A;  1H86 A;  3UCL A;  1NHS A;  2TPR A;  1GRA A;  4D04 A;  4ZN0 A;  1TDO A;  1PHH A;  4TM3 A;  3HYW A;  1JOA A;  1O5W A;  2EQ9 A;  2BS4 A;  2GQF A;  3AE3 A;  5ER0 A;  3OC4 A;  5KMR A;  4A79 A;  3AE7 A;  1NHQ A;  1NEK A;  3B3R A;  3BI5 A;  4AP1 A;  2GR0 A;  4EQW A;  4RG3 A;  1EBD A;  1L9C A;  2BCP A;  4B1B A;  4IA5 A;  4Z2T A;  3GYX A;  3R9U A;  4H4Z A;  1MOK A;  2WDV A;  2FBW A;  4YWO A;  1L9E A;  3AEF A;  3D1C A;  4XWZ A;  1O95 A;  4NEV A;  1KDG A;  1OJT A;  3CIR A;  4NTD A;  3CGE A;  3CNJ A;  3NGC X;  4YT0 A;  4Y4M A;  3RP8 A;  3NYE A;  3SFE A;  3UTH A;  4C74 A;  2YG3 A;  1PJ5 A;  2R0G A;  2C72 A;  3G5S A;  1Z6L A;  4OPG A;  1VRQ B;  3FMW A;  2C76 A;  3AEE A;  3CPH G;  2O9Z A;  1NG4 A;  1NDA A;  2RGH A;  1PBF A;  1W4X A;  1KNR A;  4FDC B;  4BJZ A;  4K2X A;  1D4C A;  1KF6 A;  3AWI A;  5EBK A;  5M0Z A;  1KSS A;  2OLO A;  1DOC A;  4A5L A;  1BKW A;  2XDO A;  4OPL A;  4YTN A;  5TR3 A;  1PXB A;  3NKS A;  1TDN A;  2C3D A;  4J2W A;  1DNC A;  1YQ4 A;  1B4V A;  4D03 A;  2X8G A;  3DJD A;  3NN0 X;  1IUU A;  2JKC A;  5JCI A;  3BI4 A;  1TYP A;  1BGN A;  1DOE A;  1E1N A;  2ZZC A;  3GSI A;  3ISH A;  3M13 A;  2GMH A;  1EL5 A;  1ZMD A;  2UZZ A;  3ADA B;  4O5U A;  5IPY A;  2GR2 A;  4U8I A;  1GPE A;  4U8P A;  4CCQ A;  1CJ2 A;  3GRS A;  5C3J A;  1CL0 A;  3ALL A;  1GND A;  2R0P A;  3AE4 A;  3RNM A;  3T14 A;  2BAC A;  3DA1 A;  2WQY A;  3L8K A;  1AOG A;  1GXF A;  4JQ9 A;  1SEZ A;  2XCG A;  2C3C A;  3AB1 A;  5KVI A;  1VQW A;  2BS3 A;  2Y6Q A;  2YLR A;  4G73 A;  1BZL A;  2H88 A;  1HYU A;  3COX A;  4I58 A;  1ZX9 A;  2WES A;  3ABV A;  3EAN A;  1Q1R A;  4PAB A;  4YSZ A;  2WEU A;  3GDN A;  3ICT A;  2BYB A;  5CQF A;  3GYI A;  2AR8 A;  3IC9 A;  5JCM A;  3BNM A;  4J36 A;  4M52 A;  1JRX A;  3ICR A;  3AE1 A;  3AYL A;  3C4N A;  2ZZB A;  2CDU A;  3KLJ A;  5U63 A;  2WDQ A;  1XHC A;  1GOS A;  4YSH A;  4EMJ A;  1F8R A;  2V6O A;  1DOD A;  3ITJ A;  5J7X A;  2XFN A;  4E0V A;  3NH3 X;  2C70 A;  2R4E A;  3FIM B;  2XLS A;  3F8R A;  4NNJ A;  1CJ4 A;  4USQ A;  4GCM A;  3URH A;  3NLC A;  3DGZ A;  1L9D A;  2Z5X A;  1FL2 A;  4Y4L A;  1V59 A;  4EMW A;  1GTE A;  3KPK A;  4X9N A;  5J60 A;  2X99 A;  3AYI A;  1PBB A;  4H4P A;  2Q6U A;  1GRH A;  1E6E A;  2XLR A;  2QA1 A;  5BRT A;  1CF3 A;  1DXL A;  3SZC A;  3FPZ A;  4U2L A;  5BUK A;  2RGO A;  3FG2 P;  4NWZ A;  3BNU A;  3GMC A;  4UDR A;  1FEB A;  4IA6 A;  3GWF A;  1PS9 A;  1LV0 A;  2YM1 A;  4XXG A;  2YLS A;  4GAV A;  4J57 A;  3UP5 A;  3AE5 A;  4J56 A;  3K7M X;  3UOX A;  3V3O A;  2R46 A;  3SQP A;  2BC1 A;  2YVF A;  1S2Y A;  3ATR A;  2EQ8 A;  4YKF A;  3QVR A;  2VVM A;  1KSU A;  3DGH A;  3EF6 A;  4HB9 A;  4X4J A;  4JNQ A;  4J33 A;  3RP6 A;  4C77 A;  3P4P A;  3SZF A;  1MO9 A;  2V3B A;  2YWL A;  3DK9 A;  3KA7 A;  4Y4N A;  4B69 A;  3Q9T A;  4UDP A;  2XFO A;  2OAM A;  5KMQ A;  2WPE A;  1JNR A;  3QVP A;  1IJH A;  1LTX R;  4FX9 A;  4II2 A;  4GR1 A;  3CNS A;  5KVH A;  1H81 A;  4BV6 A;  2WOW A;  1KNP A;  2HQM A;  3G5R A;  1XPQ A;  2OAL A;  4H4V A;  3SXI A;  1O94 A;  1YQ3 A;  3S61 A;  4OPU A;  4YSX A;  3GDP A;  3UTF A;  2VRL A;  2VZ2 A;  2GAG B;  4TM0 A;  3QSE A;  2C7G A;  1JU2 A;  2B9Y A;  3AE8 A;  1BGJ A;  3NG7 X;  4K7Z A;  2XLT A;  2PYX A;  4REK A;  5FS7 A;  5GRT A;  4A65 A;  3PVC A;  2NVK X;  3ZYX A;  3P4Q A;  1JRZ A;  3QFB A;  2BS2 A;  4A7A A;  3NT6 A;  4CBQ A;  5M10 A;  4MJW A;  2JB1 A;  1X31 B;  2GH5 A;  4H4W A;  2YQU A;  1N4W A;  4USR A;  3NK2 X;  3NK0 X;  1D7Y A;  4U8L A;  4C3Y A;  1IUT A;  1E1L A;  3NYC A;  3ALJ A;  2V60 A;  3DJJ A;  4HA6 A;  2XVF A;  3AE6 A;  3V76 A;  4Z44 A;  5EB5 A;  4WCT A;  4AT2 A;  2APG A;  2C65 A;  1IUV A;  1H83 A;  3LZX A;  5HY5 A;  3PS9 A;  1K4Q A;  4O5Q A;  5IQ1 A;  4BJY A;  2X3N A;  4J31 A;  3T37 A;  3LAD A;  4Z2R A;  2ARD A;  1PDH A;  3AED A;  2GQW A;  3SY4 A;  1LPF A;  2GB0 A;  3NYF A;  4X9M A;  1NAA A;  3ALM A;  3IWA A;  3QJ4 A;  5HXI A;  3AEG A;  4N9X A;  3ICS A;  1D5T A;  3QSM A;  5U25 A;  1RYI A;  3UKK A;  3VRA A;  3AXB A;  3LZW A;  1OJD A;  2YLT A;  1ZK7 A;  4P9S A;  4GDE A;  4U8K A;  4Z25 A;  1B8S A;  2YR6 A;  3CNT A;  2YAU A;  2XVI A;  2YLW A;  4RSL A;  2YLZ A;  3KD9 A;  2XFU A;  2VVL G;  2V61 A;  2WET A;  4FK1 C;  4LU6 A;  1K0J A;  3B6D A;  2C64 A;  2XVE A;  3C4A A;  1GRG A;  2R45 A;  1GV4 A;  2B7S A;  3RHA A;  4EMI A;  4GDP A;  4I59 A;  1JEH A;  1M64 A;  2IID A;  5FMH A;  1BWC A;  3DK8 A;  1JNZ A;  3CNP A;  4EM4 A;  3UKA A;  4A6N B;  4XWR A;  4IVO B;  1LJ1 A;  3T2K A;  2WHD A;  4YTP A;  4OPC A;  2EQ6 A;  5JCK A;  3S5W A;  1TDK A;  1Y0P A;  3H8L A;  3CMM A;  2GVC A;  2WOI A;  1GRF A;  2BXR A;  1ZOY A;  2YR5 A;  1CC2 A;  1S3E A;  3SM8 A;  4B63 A;  2GRT A;  2YG7 A; 
#chains in the Genus database with same CATH homology
 2CVJ A;  3SZ0 A;  2FJD A;  1GEU A;  4CCR A;  1NG3 A;  3DK4 A;  4GUV A;  3JSK A;  3PO7 A;  1XDI A;  2YG5 A;  3LXD A;  5EOW A;  3IF9 A;  2XLP A;  4CRT A;  2GMJ A;  1FEA A;  3I6D A;  4GAP A;  1B5Q A;  3RED A;  1ZY8 A;  1TYT A;  3GMB A;  3BHK A;  4H4X A;  5JCN A;  1ONF A;  2B9W A;  4Z24 A;  2XFP A;  1N4V A;  1IUS A;  3Q6J A;  3UTE A;  1DJN A;  1GRT A;  1K0L A;  3I3L A;  4CNJ A;  2XVJ A;  5JCL A;  5FS9 A;  4EM3 A;  1MXT A;  2H89 A;  4BK2 A;  4YSY A;  1GT8 A;  2B76 A;  4OPI A;  4B68 A;  1L0V A;  4A9W A;  1NHP A;  4OPT A;  2X8H A;  2EQ7 A;  1OJA A;  2BCG G;  2C4C A;  2WOV A;  1IUW A;  4AOX A;  1PJ6 A;  1D4E A;  1F8S A;  1N4U A;  3T31 A;  3K30 A;  2Q0L A;  2BRA A;  3E1T A;  4JNA A;  2WPC A;  3NIX A;  1TDF A;  1ZMC A;  5KOW A;  4NTE A;  2VQB A;  3LOV A;  3AE9 A;  4A6N A;  1P2H A;  3KVE A;  4Z2U A;  4U2S A;  2VQ7 A;  4UP3 A;  3GRT A;  5U1O A;  4H2Q A;  2V3A A;  3CTY A;  1LVL A;  4OCG A;  5GSN A;  4H7U A;  1S3B A;  2IVE A;  4CY8 A;  3O0H A;  2RGJ A;  4U8M A;  3LB8 A;  3M0O A;  5KWF A;  1KFY A;  1GES A;  2TMD A;  2C66 A;  2YG4 A;  3VR8 A;  4TLZ A;  3AD9 B;  1CBO A;  4U8N A;  2QA2 A;  1VG9 A;  3T0K A;  3AD7 B;  2GV8 A;  1LQT A;  4H2P A;  2XVH A;  2GF3 A;  2VRM A;  2WBA A;  5BVA A;  3NHO X;  3AYJ A;  3NRN A;  2FJE A;  3P4R A;  1CJC A;  1QJD A;  3F8D A;  4TM4 A;  3HZL A;  3SFD A;  2QAE A;  1PBC A;  5KMS A;  1EL9 A;  3AD8 B;  3H4K A;  4H4T A;  1FOH A;  3CGD A;  4YKG A;  2BK3 A;  2Z5Y A;  4H4Q A;  4WX1 A;  1GTH A;  1TDE A;  3NK1 X;  4AP3 A;  2WP5 A;  4DNA A;  4IVM B;  4C3X A;  3SX6 A;  4A99 A;  4J34 A;  4TLX A;  1NHR A;  1N1P A;  1UKV G;  1ZKQ A;  4U8O A;  1GRB A;  2Q0K A;  1GER A;  1PXC A;  4BK3 A;  4AT0 A;  1FEC A;  5EB4 A;  1PBE A;  5LV9 A;  4CY6 A;  1ELI A;  1H7W A;  5CKU A;  3GD3 A;  2GR3 A;  3IHG A;  3DJG X;  2Y6R A;  3DH9 A;  4EQX A;  4BUR A;  2JAE A;  1FCD A;  3LJP A;  4UDQ A;  1F3P A;  3NN6 X;  4NZH A;  2X8C A;  4BK1 A;  2E4G A;  3ZDN A;  3P1W A;  2VVL A;  2WPF A;  2FJB A;  3CGC A;  3CN8 A;  2JB2 A;  3BHF A;  3QSS A;  3EPT A;  3UP4 A;  2BXS A;  2E1M A;  2W0H A;  4B66 A;  3KKJ A;  1PBD A;  2YG6 A;  5KMP A;  2RAB A;  1Q1W A;  3VRB A;  2WP9 A;  2C67 A;  4AOS A;  2ACZ A;  3HYX A;  2BK4 A;  3T2Z A;  5C2T A;  3NTD A;  1JRY A;  1ZP0 A;  2CFY A;  2VOU A;  4DGK A;  3NNE A;  4Z43 A;  1OJC A;  2B7R A;  3SZW A;  3VQR A;  2ZZ0 A;  3OZ2 A;  4PAA A;  3UKH A;  5IQ4 A;  1CC6 A;  3CPI G;  3H8I A;  3GWD A;  3NTA A;  1GAL A;  4B67 A;  3P4S A;  3GYJ A;  1VG0 A;  4C5O A;  4H4U A;  3SYI A;  2BC0 A;  3M12 A;  4YXD A;  2JBV A;  4JY2 A;  2YVG A;  3K7T A;  1Y56 B;  3UOY A;  2GR1 A;  2YM2 A;  3DME A;  4JN9 A;  2GAH B;  4CNK A;  1Q9I A;  2AQJ A;  5KNL A;  3EAO A;  5BUL A;  3UKF A;  1S2Q A;  2BRY A;  2WP6 A;  4K8D A;  2QCU A;  4H50 A;  2WDR A;  1F6M A;  1H6V A;  3C96 A;  3G5Q A;  2B9X A;  4H4S A;  4EIQ A;  4H2R A;  2WU5 A;  3K7Q X;  4IV9 A;  1ZOV A;  2XYO A;  3AE2 A;  4OVI A;  2AAQ A;  1EL7 A;  3IHM A;  2I0Z A;  2ZBW A;  2YVJ A;  2A87 A;  3KPF A;  2JB3 A;  4K22 A;  5KXJ A;  3P9U A;  3UOZ A;  4G6G A;  4FK1 A;  4YTM A;  1GRE A;  2E5V A;  4ZCD A;  4JY3 A;  1K0I A;  3CPJ G;  4H4Y A;  3VRD B;  1TRB A;  3V3N A;  4K5S A;  3UOV A;  3F8P A;  2XFQ A;  3FBS A;  3WE0 A;  5FS6 A;  4B65 A;  5HYM A;  1H82 A;  2R0C A;  1YY5 A;  2YLX A;  4APN A;  1GET A;  4U2T A;  2DKH A;  2BK5 A;  4H2N A;  1YKJ A;  2NPX A;  3T2Y A;  1E1M A;  4G74 A;  2IVD A;  3VR9 A;  1D4D A;  1QLB A;  4KPR A;  1NEN A;  2FJA A;  1RP0 A;  1LQU A;  5L46 A;  4ZCC A;  4EIP A;  4JDR A;  2J3N A;  1YQZ A;  3HYV A;  4KX6 A;  4GRT A;  3SGL A;  4OPD A;  1B37 A;  3L1R A;  2X50 A;  1CHU A;  1Y56 A;  1DOB A;  2A8X A;  4NTC A;  2OLN A;  5KOX A;  4DSH A;  4G9K A;  1XAN A;  2Q7V A;  2C75 A;  2CUL A;  2BA9 A;  3II4 A;  3UKQ A;  4GF7 A;  4TM1 A;  2A89 A;  3CND A;  1REO A;  2JK6 A;  4II3 A;  3UKL A;  3KU9 A;  3AEC A;  4U8J A;  4DSG A;  1H84 A;  1PN0 A;  2C73 A;  1RSG A;  2GEW A;  3CGB A;  1OJ9 A;  4RG4 A;  4NEW A;  1E39 A;  1F8W A;  5KRQ A;  1PXA A;  2YR4 A;  3AEB A;  1E7P A;  3ATQ A;  2OA1 A;  3BI2 A;  1ZDL A;  1PJ7 A;  3D8X A;  1BF3 A;  3UKP A;  3DJE A;  1GSN A;  2F5Z A;  5HHF A;  2XLU A;  2WS3 A;  3RP7 A;  2R9Z A;  2V5Z A;  4ECH A;  1IUX A;  2BAB A;  2PHH A;  4LA1 A;  4Z26 A;  4ICY A;  4LII A;  2R4J A;  1CC4 A;  1D7L A;  1EL8 A;  1QO8 A;  1M6I A;  3AEA A;  3QFA A;  5DBJ A;  4K5R A;  1CJ3 A;  5FS8 A;  1VDC A;  3GD4 A;  1E1K A;  4B64 A;  1H7X A;  4G6H A;  3UTG A;  4EQR A;  4EQS A;  4ADW A;  1P2E A;  1NPX A;  2DKI A;  2WU2 A;  1COY A;  4H4R A;  1DJQ A;  1H86 A;  3UCL A;  1NHS A;  2TPR A;  1GRA A;  4D04 A;  4ZN0 A;  1TDO A;  1PHH A;  4TM3 A;  3HYW A;  1JOA A;  1O5W A;  2EQ9 A;  2BS4 A;  2GQF A;  3AE3 A;  5ER0 A;  3OC4 A;  5KMR A;  4A79 A;  3AE7 A;  1NHQ A;  1NEK A;  3B3R A;  3BI5 A;  4AP1 A;  2GR0 A;  4EQW A;  4RG3 A;  1EBD A;  1L9C A;  2BCP A;  4B1B A;  4IA5 A;  4Z2T A;  3GYX A;  3R9U A;  4H4Z A;  1MOK A;  2WDV A;  2FBW A;  4YWO A;  1L9E A;  3AEF A;  3D1C A;  4XWZ A;  1O95 A;  4NEV A;  1KDG A;  1OJT A;  3CIR A;  4NTD A;  3CGE A;  3CNJ A;  3NGC X;  4YT0 A;  4Y4M A;  3RP8 A;  3NYE A;  3SFE A;  3UTH A;  4C74 A;  2YG3 A;  1PJ5 A;  2R0G A;  2C72 A;  3G5S A;  1Z6L A;  4OPG A;  1VRQ B;  3FMW A;  2C76 A;  3AEE A;  3CPH G;  2O9Z A;  1NG4 A;  1NDA A;  2RGH A;  1PBF A;  1W4X A;  1KNR A;  4FDC B;  4BJZ A;  4K2X A;  1D4C A;  1KF6 A;  3AWI A;  5EBK A;  5M0Z A;  1KSS A;  2OLO A;  1DOC A;  4A5L A;  1BKW A;  2XDO A;  4OPL A;  4YTN A;  5TR3 A;  1PXB A;  3NKS A;  1TDN A;  2C3D A;  4J2W A;  1DNC A;  1YQ4 A;  1B4V A;  4D03 A;  2X8G A;  3DJD A;  3NN0 X;  1IUU A;  2JKC A;  5JCI A;  3BI4 A;  1TYP A;  1BGN A;  1DOE A;  1E1N A;  2ZZC A;  3GSI A;  3ISH A;  3M13 A;  2GMH A;  1EL5 A;  1ZMD A;  2UZZ A;  3ADA B;  4O5U A;  5IPY A;  2GR2 A;  4U8I A;  1GPE A;  4U8P A;  4CCQ A;  1CJ2 A;  3GRS A;  5C3J A;  1CL0 A;  3ALL A;  1GND A;  2R0P A;  3AE4 A;  3RNM A;  3T14 A;  2BAC A;  3DA1 A;  2WQY A;  3L8K A;  1AOG A;  1GXF A;  4JQ9 A;  1SEZ A;  2XCG A;  2C3C A;  3AB1 A;  5KVI A;  1VQW A;  2BS3 A;  2Y6Q A;  2YLR A;  4G73 A;  1BZL A;  2H88 A;  1HYU A;  3COX A;  4I58 A;  1ZX9 A;  2WES A;  3ABV A;  3EAN A;  1Q1R A;  4PAB A;  4YSZ A;  2WEU A;  3GDN A;  3ICT A;  2BYB A;  5CQF A;  3GYI A;  2AR8 A;  3IC9 A;  5JCM A;  3BNM A;  4J36 A;  4M52 A;  1JRX A;  3ICR A;  3AE1 A;  3AYL A;  3C4N A;  2ZZB A;  2CDU A;  3KLJ A;  5U63 A;  2WDQ A;  1XHC A;  1GOS A;  4YSH A;  4EMJ A;  1F8R A;  2V6O A;  1DOD A;  3ITJ A;  5J7X A;  2XFN A;  4E0V A;  3NH3 X;  2C70 A;  2R4E A;  3FIM B;  2XLS A;  3F8R A;  4NNJ A;  1CJ4 A;  4USQ A;  4GCM A;  3URH A;  3NLC A;  3DGZ A;  1L9D A;  2Z5X A;  1FL2 A;  4Y4L A;  1V59 A;  4EMW A;  1GTE A;  3KPK A;  4X9N A;  5J60 A;  2X99 A;  3AYI A;  1PBB A;  4H4P A;  2Q6U A;  1GRH A;  1E6E A;  2XLR A;  2QA1 A;  5BRT A;  1CF3 A;  1DXL A;  3SZC A;  3FPZ A;  4U2L A;  5BUK A;  2RGO A;  3FG2 P;  4NWZ A;  3BNU A;  3GMC A;  4UDR A;  1FEB A;  4IA6 A;  3GWF A;  1PS9 A;  1LV0 A;  2YM1 A;  4XXG A;  2YLS A;  4GAV A;  4J57 A;  3UP5 A;  3AE5 A;  4J56 A;  3K7M X;  3UOX A;  3V3O A;  2R46 A;  3SQP A;  2BC1 A;  2YVF A;  1S2Y A;  3ATR A;  2EQ8 A;  4YKF A;  3QVR A;  2VVM A;  1KSU A;  3DGH A;  3EF6 A;  4HB9 A;  4X4J A;  4JNQ A;  4J33 A;  3RP6 A;  4C77 A;  3P4P A;  3SZF A;  1MO9 A;  2V3B A;  2YWL A;  3DK9 A;  3KA7 A;  4Y4N A;  4B69 A;  3Q9T A;  4UDP A;  2XFO A;  2OAM A;  5KMQ A;  2WPE A;  1JNR A;  3QVP A;  1IJH A;  1LTX R;  4FX9 A;  4II2 A;  4GR1 A;  3CNS A;  5KVH A;  1H81 A;  4BV6 A;  2WOW A;  1KNP A;  2HQM A;  3G5R A;  1XPQ A;  2OAL A;  4H4V A;  3SXI A;  1O94 A;  1YQ3 A;  3S61 A;  4OPU A;  4YSX A;  3GDP A;  3UTF A;  2VRL A;  2VZ2 A;  2GAG B;  4TM0 A;  3QSE A;  2C7G A;  1JU2 A;  2B9Y A;  3AE8 A;  1BGJ A;  3NG7 X;  4K7Z A;  2XLT A;  2PYX A;  4REK A;  5FS7 A;  5GRT A;  4A65 A;  3PVC A;  2NVK X;  3ZYX A;  3P4Q A;  1JRZ A;  3QFB A;  2BS2 A;  4A7A A;  3NT6 A;  4CBQ A;  5M10 A;  4MJW A;  2JB1 A;  1X31 B;  2GH5 A;  4H4W A;  2YQU A;  1N4W A;  4USR A;  3NK2 X;  3NK0 X;  1D7Y A;  4U8L A;  4C3Y A;  1IUT A;  1E1L A;  3NYC A;  3ALJ A;  2V60 A;  3DJJ A;  4HA6 A;  2XVF A;  3AE6 A;  3V76 A;  4Z44 A;  5EB5 A;  4WCT A;  4AT2 A;  2APG A;  2C65 A;  1IUV A;  1H83 A;  3LZX A;  5HY5 A;  3PS9 A;  1K4Q A;  4O5Q A;  5IQ1 A;  4BJY A;  2X3N A;  4J31 A;  3T37 A;  3LAD A;  4Z2R A;  2ARD A;  1PDH A;  3AED A;  2GQW A;  3SY4 A;  1LPF A;  2GB0 A;  3NYF A;  4X9M A;  1NAA A;  3ALM A;  3IWA A;  3QJ4 A;  5HXI A;  3AEG A;  4N9X A;  3ICS A;  1D5T A;  3QSM A;  5U25 A;  1RYI A;  3UKK A;  3VRA A;  3AXB A;  3LZW A;  1OJD A;  2YLT A;  1ZK7 A;  4P9S A;  4GDE A;  4U8K A;  4Z25 A;  1B8S A;  2YR6 A;  3CNT A;  2YAU A;  2XVI A;  2YLW A;  4RSL A;  2YLZ A;  3KD9 A;  2XFU A;  2VVL G;  2V61 A;  2WET A;  4FK1 C;  4LU6 A;  1K0J A;  3B6D A;  2C64 A;  2XVE A;  3C4A A;  1GRG A;  2R45 A;  1GV4 A;  2B7S A;  3RHA A;  4EMI A;  4GDP A;  4I59 A;  1JEH A;  1M64 A;  2IID A;  5FMH A;  1BWC A;  3DK8 A;  1JNZ A;  3CNP A;  4EM4 A;  3UKA A;  4A6N B;  4XWR A;  4IVO B;  1LJ1 A;  3T2K A;  2WHD A;  4YTP A;  4OPC A;  2EQ6 A;  5JCK A;  3S5W A;  1TDK A;  1Y0P A;  3H8L A;  3CMM A;  2GVC A;  2WOI A;  1GRF A;  2BXR A;  1ZOY A;  2YR5 A;  1CC2 A;  1S3E A;  3SM8 A;  4B63 A;  2GRT A;  2YG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...