2IIDA

Structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
483
structure length
483
Chain Sequence
RNPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino-acid oxidase
publication title Crystal Structure of LAAO from Calloselasma rhodostoma with an L-Phenylalanine Substrate: Insights into Structure and Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 179
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2iidA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2iidA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 2iidA01
1H7WA 3GWFA 4WCTA 4DGKA 4YTMA 2XLRA 4Y4NA 4ADWA 4FK1A 3CGBA 3BI5A 4K8DA 2BS2A 1BGJA 2EQ9A 3FBSA 4U8IA 2JK6A 1PJ6A 2Q6UA 3SFDA 3ADAB 2WQYA 1COYA 3AD7B 3AWIA 3NYEA 1GPEA 3C4AA 4IV9A 1IUXA 4EMWA 3GMBA 1JOAA 3K7QX 3QFAA 4I59A 1TDKA 3NTAA 3AD8B 1VRQB 1IUWA 1GRFA 3DJJA 3GD3A 2YM1A 3GWDA 5TR3A 3NKSA 1L9CA 2R4EA 3ALJA 2F5ZA 3AXBA 3PVCA 4EIPA 1Y56A 3EPTA 3SM8A 4Z43A 4A99A 3CPJG 3ICTA 2BS4A 1KFYA 4PABA 2C67A 4UDRA 2YM2A 3S61A 2R9ZA 1NG3A 3AEDA 1LV0A 1OJDA 4GUVA 2YG7A 2XYOA 5BULA 2A8XA 3NN6X 5BUKA 1Q9IA 4E0VA 1PS9A 2C76A 2O9ZA 4USQA 4TM3A 5U1OA 1B5QA 3PS9A 2XVIA 1BF3A 4OVIA 4H4TA 2YR5A 5BRTA 4EM3A 3GDNA 3SQPA 4BJZA 1K0IA 2Z5XA 3QFBA 2Y6RA 5HYMA 5JCNA 2IVEA 4YSHA 4Z2TA 5HHFA 1ZP0A 3IWAA 1IUVA 1ZY8A 5JCIA 3GMCA 4ZN0A 1OJAA 3ISHA 1GERA 1PXCA 2YLZA 2AR8A 5C3JA 4XWRA 1S3BA 4PAAA 1QJDA 4A7AA 2ARDA 3UP4A 4IVOB 1FEBA 5U25A 3C96A 3FIMB 4O5UA 4A65A 1XPQA 3AE6A 3KD9A 3V3OA 2B76A 1ZOVA 5BVAA 3KVEA 1MOKA 2FJBA 1LJ1A 5KVHA 1F8WA 1ONFA 4Y4LA 4NTDA 1ZOYA 4HA6A 3UKLA 3ICSA 5GSNA 1LPFA 1H86A 4TLXA 3GRSA 2JB3A 3UKFA 1RP0A 1EBDA 3KA7A 1D4EA 4LIIA 4C5OA 1Y0PA 1B4VA 4ZCCA 1IUSA 1E1LA 2B9WA 2JB2A 3F8PA 3VRDB 2C75A 5J60A 2BXSA 1X31B 5KXJA 1O94A 2ZZBA 4YT0A 1TYPA 2GAGB 2QA1A 3NTDA 3PO7A 2GR3A 2WOIA 2GEWA 5U63A 2WS3A 4N9XA 4I58A 3P4QA 1CL0A 3RP8A 4EMIA 3AYJA 2DKHA 2JAEA 2XVEA 3KPFA 1YQZA 4HB9A 4JDRA 4AP3A 3LZWA 4BK2A 1S2YA 3OZ2A 2XLTA 4H2QA 4RSLA 2WPCA 1TDNA 1PN0A 4B69A 2V60A 1NHQA 2DKIA 3RP6A 2C3DA 3LOVA 3UOVA 3IHGA 1NAAA 5C2TA 1LVLA 2YG5A 3F8DA 1H6VA 3LXDA 2V61A 4AP1A 4BURA 2OAMA 3CGCA 4Z44A 4BV6A 1GRTA 3ICRA 2YQUA 3DA1A 2NVKX 1GEUA 1CF3A 1Q1WA 4ECHA 4EQXA 4GDEA 4B64A 1NDAA 2WOWA 3NIXA 4OPLA 2YLWA 3ATQA 5FS6A 2WP6A 1NHSA 2BYBA 2BS3A 3AE9A 2GV8A 3KU9A 3AEGA 3NH3X 2C7GA 4OPDA 4RG4A 5ER0A 4FX9A 4U2SA 1NG4A 1O95A 2VRLA 4EQWA 3NG7X 1Z6LA 1Y56B 2X8GA 4J33A 2Q0LA 2WP9A 2IIDA 1ZX9A 2XFOA 3CTYA 4U8LA 1BZLA 2X99A 2WP5A 4AT2A 4Z2UA 1H82A 3QSEA 2C65A 4H4XA 3H8LA 1N4UA 3R9UA 2WEUA 1GXFA 3CGDA 1GTEA 2H88A 1CC4A 4YSZA 4B66A 2VRMA 2I0ZA 2Q0KA 1PBBA 1KSUA 2C3CA 3B3RA 1DOEA 4U8MA 3QVPA 2YR6A 3GDPA 2E5VA 2E4GA 2C72A 4RG3A 3EF6A 2WU2A 4APNA 2JB1A 3F8RA 3II4A 4OPIA 1XDIA 1KF6A 3BI4A 4H4WA 1E1KA 5GRTA 1KSSA 1PDHA 2GR2A 4YKFA 3UTEA 4H4YA 3NK2X 2CULA 1E6EA 3M0OA 4H4SA 5KRQA 2C66A 1YQ3A 4D04A 3S5WA 4C3XA 4B65A 2WDVA 3K30A 1BGNA 3RNMA 1VQWA 1H81A 4AOSA 5KVIA 4B1BA 3HZLA 2NPXA 4YTPA 1BWCA 1DOBA 1JEHA 3LB8A 3IHMA 1K0LA 3H4KA 3DJEA 4ICYA 1GESA 3AE1A 3DGHA 3NK0X 1P2EA 3P9UA 2C70A 3CPHG 1FL2A 1LQUA 2V6OA 3D1CA 4GCMA 4REKA 3UTHA 2VZ2A 1HYUA 2CVJA 2YLSA 4B68A 4YKGA 3AECA 4GF7A 2A87A 1ZK7A 2QA2A 1E7PA 2YG4A 4EM4A 2ACZA 4U2LA 3L1RA 5HY5A 1VDCA 4C3YA 4LA1A 1CJ2A 3QSMA 3VRAA 3DK9A 1FCDA 5JCLA 4USRA 4ZCDA 3UCLA 5IQ4A 1IUUA 4J56A 3FPZA 1EL5A 4NTEA 2FJEA 5FS9A 3UOZA 4A9WA 3AEFA 1CBOA 3GYJA 1M6IA 3ZDNA 1S2QA 4CRTA 1TDFA 2UZZA 3CNJA 5KOXA 2AAQA 3DK8A 1DOCA 4TLZA 4P9SA 1D7LA 4YSXA 1REOA 3NYCA 4X9MA 1NHRA 3G5SA 4H4ZA 2BC1A 1RSGA 4B67A 4BJYA 2WU5A 5EBKA 3UKQA 4OPUA 4KX6A 3FG2P 1YKJA 1VG9A 3D8XA 5KOWA 1M64A 4TM1A 1S3EA 1K4QA 2GF3A 3LJPA 3NNEA 4CBQA 2YAUA 1XHCA 2B7SA 2XLSA 2B7RA 4M52A 3UOXA 3GRTA 1JRYA 2V5ZA 2GQWA 2V3AA 2WPEA 3AEEA 1JNRA 3NGCX 2HQMA 2X3NA 2E1MA 1FECA 4GDPA 2VQBA 1CC2A 4EQSA 2JBVA 2BK4A 3I6DA 2H89A 2WBAA 1GT8A 4IVMB 2R45A 2R4JA 4D03A 1LQTA 2GMHA 2EQ8A 4UDQA 3AYIA 5L46A 1N1PA 2XLUA 4NEWA 2BCGG 2VOUA 4BK1A 5CQFA 1CJ4A 3QSSA 1F8RA 1PXAA 2Y6QA 1ZMDA 4J34A 3DH9A 4UP3A 2XFPA 3CNTA 3ATRA 5IPYA 2J3NA 1W4XA 1OJTA 2XVJA 4FK1C 1GRHA 2RGJA 4X9NA 1ELIA 1O5WA 2GB0A 3ALLA 5FS7A 4A79A 2YVJA 3UTFA 2XFQA 3ITJA 4U8JA 4KPRA 1L9DA 4MJWA 2YWLA 3DJGX 4J57A 4NZHA 3UP5A 1EL9A 2FBWA 1DNCA 3AE4A 3ZYXA 1JRZA 4U8PA 5EB4A 3BHKA 3K7MX 1XANA 3K7TA 3VRBA 1E1NA 4J36A 1KNPA 4U8KA 2WDRA 2GR0A 2C64A 2BK5A 4Z25A 4K5SA 4H7UA 4C77A 1FOHA 2WPFA 1B37A 1YQ4A 2CFYA 2PYXA 3T37A 3RP7A 3AB1A 4WX1A 1EL7A 1DJQA 2B9YA 2RGHA 3AE3A 4J31A 3VR9A 2VVLA 1F8SA 4CCQA 4H2NA 4XWZA 3UKAA 1DODA 2ZZ0A 2XFNA 1ZDLA 1GV4A 3G5RA 4H4RA 1NPXA 1NHPA 2WHDA 3DGZA 2R0CA 2R46A 4X4JA 4B63A 4CY6A 4Z2RA 2CDUA 3UKKA 1GSNA 1BKWA 4JQ9A 4OPCA 5LV9A 2RGOA 2XVFA 3NHOX 3NRNA 2OALA 1MXTA 2C73A 3BNMA 3NN0X 5M10A 3AEBA 1ZMCA 4JNQA 1NENA 2GH5A 1L9EA 3Q9TA 2WESA 1YY5A 1AOGA 3C4NA 4JNAA 4NTCA 3NYFA 3E1TA 3CNDA 4DSGA 3L8KA 2BK3A 2RABA 3FMWA 1E39A 2VVMA 1GRGA 2R0PA 4H2RA 2A89A 3CIRA 2GVCA 3Q6JA 1EL8A 1GTHA 4EQRA 5JCKA 3P4SA 4EIQA 1B8SA 1JU2A 4YWOA 1PJ7A 3O0HA 2QAEA 3URHA 2GAHB 1N4WA 2ZBWA 2YLXA 1PBCA 3CNPA 3DJDA 4EMJA 3JSKA 1CC6A 4TM4A 1D4CA 4Z26A 1CJ3A 1OJCA 4A6NB 3BHFA 3H8IA 3REDA 2QCUA 3GSIA 4H4QA 3AYLA 3UKHA 3KKJA 3V76A 2X50A 5DBJA 4YXDA 4U2TA 1CJCA 1ZKQA 2FJAA 3NK1X 2YVFA 3UOYA 1FEAA 5FMHA 4CCRA 3WE0A 1H7XA 3OC4A 1PXBA 2YLTA 3VR8A 2GR1A 4H2PA 2B9XA 4OCGA 1GNDA 4FDCB 3GD4A 1UKVG 3DK4A 1F6MA 2XVHA 4K22A 4JY3A 5JCMA 3KLJA 3GYIA 2GQFA 1DJNA 2OLOA 2APGA 3CGEA 5EOWA 3CPIG 3QVRA 2VVLG 1PBFA 2EQ7A 2BA9A 2YR4A 1TYTA 2WETA 3CN8A 4DSHA 1DXLA 1JNZA 1GRBA 2ZZCA 4JN9A 3AE5A 4OPGA 1GALA 2AQJA 4YSYA 1QO8A 1MO9A 3EAOA 4GR1A 4A6NA 3AE2A 1N4VA 4OPTA 2FJDA 2Q7VA 3V3NA 3RHAA 2GMJA 3BI2A 1TDEA 4H4VA 4GRTA 2GRTA 3NLCA 5IQ1A 2OLNA 1PBDA 3I3LA 3IF9A 4DNAA 3COXA 1TDOA 2OA1A 3SGLA 4J2WA 4BK3A 2BXRA 1D4DA 3M12A 4K2XA 2R0GA 3BNUA 1GOSA 4K7ZA 3QJ4A 3LZXA 4YTNA 1V59A 2X8CA 4Z24A 3UTGA 3ALMA 1CHUA 1GETA 1H84A 1KDGA 2YVGA 3AEAA 3G5QA 3IC9A 3M13A 2XFUA 3LADA 4H50A 4NEVA 4AT0A 2XDOA 4LU6A 5KWFA 2W0HA 2TPRA 5FS8A 5M0ZA 4A5LA 1L0VA 2V3BA 2WOVA 3VQRA 4CNJA 2Z5YA 4TM0A 3P4RA 4Y4MA 3B6DA 2PHHA 4JY2A 1LTXR 4IA6A 1TRBA 3AD9B 3DMEA 1K0JA 4IA5A 2X8HA 1F3PA 1JRXA 4CNKA 1IUTA 1OJ9A 2XCGA 1P2HA 4AOXA 5HXIA 4UDPA 3AE7A 1GRAA 4C74A 1Q1RA 2VQ7A 3EANA 2BACA 2WDQA 2BABA 5J7XA 3UKPA 4U8NA 1KNRA 1D5TA 1PHHA 1PBEA 1IJHA 1E1MA 2EQ6A 5EB5A 2TMDA 3AE8A 3NT6A 3CNSA 3P4PA 4U8OA 2BC0A 1GREA 1QLBA 2YG3A 2YLRA 1NEKA 4H4PA 4K5RA 3P1WA 1D7YA 2BCPA 5CKUA 4XXGA 2YG6A 3SFEA 2XLPA 1SEZA 2IVDA 1VG0A 4H4UA 1PJ5A 1RYIA 3ABVA 4O5QA 2JKCA 4CY8A 1H83A
chains in the Genus database with same CATH superfamily
1H7WA 3GWFA 4WCTA 4DGKA 4YTMA 3SYIA 2XLRA 4Y4NA 4ADWA 4FK1A 3CGBA 3BI5A 4K8DA 2BS2A 1BGJA 2EQ9A 3FBSA 4U8IA 2JK6A 1PJ6A 2Q6UA 3SFDA 3ADAB 2WQYA 1COYA 3AD7B 3AWIA 3NYEA 1GPEA 4IV9A 3C4AA 4NWZA 1IUXA 4EMWA 3GMBA 1JOAA 3K7QX 3QFAA 4I59A 1TDKA 3NTAA 5KMRA 3AD8B 1VRQB 1IUWA 1GRFA 3DJJA 3GD3A 2YM1A 3GWDA 5TR3A 3NKSA 1L9CA 2R4EA 3ALJA 2F5ZA 3AXBA 3PVCA 4EIPA 1Y56A 3EPTA 3SM8A 4Z43A 4A99A 3CPJG 3ICTA 3T14A 2BS4A 5KMPA 1KFYA 4PABA 2C67A 4UDRA 2YM2A 3S61A 2R9ZA 1NG3A 3AEDA 1LV0A 1OJDA 4GUVA 2YG7A 2XYOA 5BULA 2A8XA 3NN6X 5BUKA 1Q9IA 4E0VA 1PS9A 2C76A 2O9ZA 4USQA 4TM3A 5U1OA 1B5QA 3PS9A 2XVIA 1BF3A 4OVIA 4H4TA 2YR5A 5BRTA 4EM3A 3GDNA 3SQPA 4BJZA 1K0IA 2Z5XA 3QFBA 2Y6RA 5HYMA 5JCNA 2IVEA 4YSHA 4Z2TA 5HHFA 1ZP0A 3IWAA 1IUVA 1ZY8A 5JCIA 3GMCA 4ZN0A 1OJAA 3ISHA 1GERA 3T31A 1PXCA 3HYXA 2YLZA 2AR8A 5C3JA 4XWRA 1S3BA 4PAAA 1QJDA 4A7AA 2ARDA 3UP4A 4IVOB 1FEBA 5U25A 3C96A 3FIMB 4O5UA 4A65A 1XPQA 3AE6A 3KD9A 3V3OA 2B76A 1ZOVA 5BVAA 3KVEA 1MOKA 2FJBA 1LJ1A 5KVHA 1F8WA 1ONFA 5KMSA 4Y4LA 5KMQA 4NTDA 1ZOYA 4HA6A 3SY4A 3UKLA 3ICSA 5GSNA 1LPFA 3SX6A 1H86A 4TLXA 3GRSA 2JB3A 3UKFA 1RP0A 1EBDA 3KA7A 1D4EA 4LIIA 4C5OA 1Y0PA 1B4VA 4ZCCA 1IUSA 1E1LA 2B9WA 2JB2A 3F8PA 3VRDB 2C75A 5J60A 2BXSA 1X31B 3CMMA 5KXJA 1O94A 2ZZBA 4YT0A 1TYPA 2GAGB 2QA1A 3NTDA 3PO7A 2GR3A 2WOIA 2GEWA 5U63A 2WS3A 4N9XA 4I58A 3P4QA 1CL0A 3RP8A 4EMIA 3AYJA 2DKHA 2JAEA 2XVEA 3KPFA 1YQZA 4HB9A 4JDRA 4AP3A 3LZWA 4BK2A 1S2YA 3OZ2A 2XLTA 4H2QA 4RSLA 2WPCA 1TDNA 1PN0A 4B69A 2V60A 1NHQA 2DKIA 3RP6A 2C3DA 3LOVA 3UOVA 3IHGA 1NAAA 5C2TA 1LVLA 2YG5A 3F8DA 1H6VA 3LXDA 2V61A 4AP1A 4BURA 2OAMA 3CGCA 4Z44A 4BV6A 1GRTA 3ICRA 3T2YA 2YQUA 3DA1A 2NVKX 1GEUA 1CF3A 1Q1WA 4ECHA 4EQXA 4GDEA 4B64A 1NDAA 2WOWA 3NIXA 4OPLA 2YLWA 3ATQA 5FS6A 2WP6A 1NHSA 2BYBA 2BS3A 3AE9A 2GV8A 3KU9A 3AEGA 3NH3X 2C7GA 4OPDA 4RG4A 5ER0A 4FX9A 4U2SA 1NG4A 1O95A 2VRLA 4EQWA 3NG7X 1Z6LA 1Y56B 2X8GA 4J33A 2Q0LA 4G73A 2WP9A 2IIDA 1ZX9A 2XFOA 3CTYA 4U8LA 1BZLA 2X99A 2WP5A 4AT2A 4Z2UA 1H82A 3QSEA 2C65A 4H4XA 3H8LA 1N4UA 3R9UA 2WEUA 1GXFA 3CGDA 1GTEA 2H88A 1CC4A 4YSZA 4B66A 2VRMA 2I0ZA 2Q0KA 1PBBA 1KSUA 2C3CA 3B3RA 1DOEA 4U8MA 3QVPA 2YR6A 3GDPA 2E5VA 2E4GA 2C72A 4RG3A 3EF6A 2WU2A 4APNA 2JB1A 3F8RA 3II4A 4OPIA 1XDIA 1KF6A 3BI4A 4H4WA 1E1KA 5GRTA 1KSSA 3T2KA 1PDHA 2GR2A 4YKFA 3UTEA 4H4YA 3NK2X 2CULA 1E6EA 3M0OA 4H4SA 5KRQA 2C66A 1YQ3A 4D04A 3S5WA 4C3XA 4B65A 2WDVA 3K30A 1BGNA 3RNMA 1VQWA 1H81A 4AOSA 5KVIA 4B1BA 3HZLA 2NPXA 4YTPA 1BWCA 1DOBA 1JEHA 3LB8A 3IHMA 1K0LA 3H4KA 3DJEA 4ICYA 1GESA 3AE1A 3DGHA 3HYWA 3NK0X 1P2EA 3P9UA 2C70A 3CPHG 1FL2A 1LQUA 2V6OA 3D1CA 4GCMA 2C4CA 4REKA 3UTHA 2VZ2A 1HYUA 2CVJA 2YLSA 4B68A 4YKGA 3AECA 4GF7A 2A87A 1ZK7A 2QA2A 1E7PA 2YG4A 4EM4A 2ACZA 4U2LA 3L1RA 3SZFA 5HY5A 1VDCA 4G6HA 4LA1A 4C3YA 1CJ2A 3QSMA 3VRAA 3DK9A 1FCDA 5JCLA 4USRA 4ZCDA 3UCLA 5IQ4A 1IUUA 4J56A 3FPZA 1EL5A 4NTEA 2FJEA 4G6GA 5FS9A 3UOZA 4A9WA 3AEFA 1CBOA 3GYJA 1M6IA 3ZDNA 1S2QA 4CRTA 1TDFA 2UZZA 3CNJA 5KOXA 2AAQA 3DK8A 1DOCA 4TLZA 4P9SA 1D7LA 4YSXA 1REOA 3NYCA 4X9MA 1NHRA 3G5SA 4H4ZA 2BC1A 1RSGA 4B67A 4BJYA 2WU5A 5EBKA 3UKQA 4OPUA 4KX6A 3FG2P 1YKJA 1VG9A 3D8XA 5KOWA 3KPKA 1M64A 4TM1A 1S3EA 1K4QA 2GF3A 3LJPA 3NNEA 4CBQA 2YAUA 1XHCA 2B7SA 2XLSA 2B7RA 4M52A 3UOXA 3GRTA 1JRYA 2V5ZA 2GQWA 2V3AA 2WPEA 3AEEA 1JNRA 3NGCX 2HQMA 2X3NA 2E1MA 1FECA 4GDPA 4GAPA 2VQBA 2BRYA 4II2A 1CC2A 4EQSA 2JBVA 2BK4A 3I6DA 2H89A 2WBAA 1GT8A 4IVMB 2R45A 2R4JA 4D03A 1LQTA 2GMHA 2EQ8A 4UDQA 3AYIA 3GYXA 5L46A 1N1PA 2XLUA 4NEWA 2BCGG 2VOUA 4BK1A 5CQFA 1CJ4A 3T2ZA 3QSSA 1F8RA 1PXAA 2Y6QA 1ZMDA 4J34A 3DH9A 4UP3A 2XFPA 3CNTA 3ATRA 5IPYA 2J3NA 1W4XA 1OJTA 2XVJA 4FK1C 1GRHA 2RGJA 4X9NA 1ELIA 1O5WA 2GB0A 3ALLA 5FS7A 4A79A 2YVJA 3UTFA 2XFQA 3ITJA 4U8JA 4KPRA 1L9DA 4MJWA 2YWLA 3DJGX 4J57A 4NZHA 3UP5A 1EL9A 2FBWA 1DNCA 3AE4A 3ZYXA 1JRZA 4U8PA 5EB4A 3BHKA 3K7MX 1XANA 3K7TA 3VRBA 1E1NA 4J36A 1KNPA 4U8KA 2WDRA 2GR0A 2C64A 2BK5A 4Z25A 4K5SA 4H7UA 4C77A 4G74A 1FOHA 2WPFA 1B37A 1YQ4A 2CFYA 2PYXA 3T37A 3RP7A 3AB1A 4WX1A 4II3A 1EL7A 1DJQA 2B9YA 2RGHA 3AE3A 4J31A 3VR9A 2VVLA 1F8SA 4CCQA 4H2NA 4XWZA 3UKAA 1DODA 2ZZ0A 2XFNA 1ZDLA 1GV4A 3G5RA 4H4RA 1NPXA 1NHPA 2WHDA 3DGZA 2R0CA 2R46A 4X4JA 4B63A 4CY6A 4Z2RA 2CDUA 3UKKA 1GSNA 1BKWA 4JQ9A 4OPCA 3HYVA 5LV9A 2RGOA 2XVFA 3NHOX 3NRNA 2OALA 1MXTA 2C73A 3BNMA 3NN0X 5M10A 3AEBA 1ZMCA 4JNQA 1NENA 2GH5A 1L9EA 3Q9TA 2WESA 1YY5A 1AOGA 3C4NA 4JNAA 4NTCA 3NYFA 3E1TA 3CNDA 4DSGA 3L8KA 2BK3A 2RABA 3FMWA 1E39A 2VVMA 1GRGA 2R0PA 4H2RA 2A89A 3CIRA 2GVCA 3Q6JA 1EL8A 1GTHA 4EQRA 5JCKA 3P4SA 4EIQA 1B8SA 1JU2A 4YWOA 1PJ7A 3O0HA 2QAEA 3URHA 2GAHB 1N4WA 2ZBWA 2YLXA 1PBCA 3CNPA 3DJDA 4EMJA 3JSKA 1CC6A 4TM4A 1D4CA 4Z26A 1CJ3A 1OJCA 4A6NB 3BHFA 3H8IA 3REDA 2QCUA 3GSIA 4H4QA 3AYLA 3UKHA 3KKJA 3V76A 2X50A 5DBJA 4YXDA 4U2TA 1CJCA 1ZKQA 2FJAA 3NK1X 2YVFA 3UOYA 1FEAA 5FMHA 4CCRA 3WE0A 1H7XA 3OC4A 1PXBA 2YLTA 3VR8A 2GR1A 4G9KA 4H2PA 2B9XA 4OCGA 1GNDA 4FDCB 3GD4A 1UKVG 3DK4A 1F6MA 2XVHA 4K22A 4JY3A 5JCMA 3KLJA 3GYIA 2GQFA 1DJNA 2OLOA 4GAVA 2APGA 3CGEA 5EOWA 3SXIA 3CPIG 3QVRA 2VVLG 1PBFA 2EQ7A 2BA9A 2YR4A 1TYTA 2WETA 3CN8A 4DSHA 1DXLA 1JNZA 1GRBA 2ZZCA 4JN9A 3AE5A 4OPGA 1GALA 2AQJA 4YSYA 1QO8A 1MO9A 3EAOA 4GR1A 3SZ0A 4A6NA 3SZWA 3AE2A 1N4VA 4OPTA 2FJDA 2Q7VA 3T0KA 3RHAA 3V3NA 2GMJA 3BI2A 1TDEA 4H4VA 4GRTA 2GRTA 3NLCA 5IQ1A 2OLNA 1PBDA 3I3LA 3IF9A 4DNAA 3COXA 1TDOA 2OA1A 3SGLA 4J2WA 4BK3A 2BXRA 1D4DA 3M12A 4K2XA 4NNJA 2R0GA 3BNUA 1GOSA 4K7ZA 3QJ4A 3LZXA 4YTNA 1V59A 2X8CA 4Z24A 3UTGA 3ALMA 1CHUA 1GETA 1H84A 1KDGA 2YVGA 3AEAA 3G5QA 3IC9A 3M13A 2XFUA 3LADA 4H50A 4NEVA 4AT0A 2XDOA 4LU6A 5KWFA 2W0HA 2TPRA 5FS8A 5M0ZA 4A5LA 1L0VA 2V3BA 2WOVA 3VQRA 4CNJA 2Z5YA 4TM0A 3P4RA 4Y4MA 3B6DA 2PHHA 4JY2A 1LTXR 4IA6A 1TRBA 3AD9B 3DMEA 1K0JA 4IA5A 2BRAA 2X8HA 1F3PA 1JRXA 4CNKA 1IUTA 1OJ9A 2XCGA 1P2HA 4AOXA 5HXIA 4UDPA 3AE7A 1GRAA 4C74A 1Q1RA 2VQ7A 3EANA 2BACA 2WDQA 2BABA 5J7XA 3UKPA 4U8NA 1KNRA 1D5TA 1PHHA 1PBEA 1IJHA 1E1MA 2EQ6A 5EB5A 2TMDA 5KNLA 3AE8A 3NT6A 3CNSA 3P4PA 4U8OA 2BC0A 1GREA 1QLBA 2YG3A 2YLRA 1NEKA 4H4PA 4K5RA 3P1WA 1D7YA 2BCPA 5CKUA 4XXGA 2YG6A 3SFEA 2XLPA 1SEZA 3SZCA 2IVDA 1VG0A 4H4UA 1PJ5A 1RYIA 3ABVA 4O5QA 2JKCA 4CY8A 1H83A
chains in the Genus database with same CATH topology
1H7WA 3GWFA 4WCTA 4DGKA 4YTMA 3SYIA 2XLRA 4Y4NA 4ADWA 4FK1A 3CGBA 3BI5A 4K8DA 2BS2A 1BGJA 2EQ9A 3FBSA 4U8IA 2JK6A 1PJ6A 2Q6UA 3SFDA 3ADAB 2WQYA 1COYA 3AD7B 3AWIA 3NYEA 1GPEA 3C4AA 4IV9A 4NWZA 1IUXA 4EMWA 3GMBA 1JOAA 3K7QX 3QFAA 4I59A 1TDKA 3NTAA 5KMRA 3AD8B 1VRQB 1IUWA 1GRFA 3DJJA 3GD3A 2YM1A 3GWDA 5TR3A 3NKSA 1L9CA 2R4EA 3ALJA 2F5ZA 3AXBA 3PVCA 4EIPA 1Y56A 3EPTA 3SM8A 4Z43A 4A99A 3CPJG 3ICTA 3T14A 2BS4A 5KMPA 1KFYA 4PABA 2C67A 4UDRA 2YM2A 3S61A 2R9ZA 1NG3A 3AEDA 1LV0A 1OJDA 4GUVA 2YG7A 2XYOA 5BULA 2A8XA 3NN6X 5BUKA 1Q9IA 4E0VA 1PS9A 2C76A 2O9ZA 4USQA 4TM3A 5U1OA 1B5QA 3PS9A 2XVIA 1BF3A 4OVIA 4H4TA 2YR5A 5BRTA 4EM3A 3GDNA 3SQPA 4BJZA 1K0IA 2Z5XA 3QFBA 2Y6RA 5HYMA 5JCNA 2IVEA 4YSHA 4Z2TA 5HHFA 1ZP0A 3IWAA 1IUVA 1ZY8A 5JCIA 3GMCA 4ZN0A 1OJAA 3ISHA 1GERA 3T31A 1PXCA 3HYXA 2YLZA 2AR8A 5C3JA 4XWRA 1S3BA 4PAAA 1QJDA 4A7AA 2ARDA 3UP4A 4IVOB 1FEBA 5U25A 3C96A 3FIMB 4O5UA 4A65A 1XPQA 3AE6A 3KD9A 3V3OA 2B76A 1ZOVA 5BVAA 3KVEA 1MOKA 2FJBA 1LJ1A 5KVHA 1F8WA 1ONFA 5KMSA 4Y4LA 5KMQA 4NTDA 1ZOYA 4HA6A 3SY4A 3UKLA 3ICSA 5GSNA 1LPFA 3SX6A 1H86A 4TLXA 3GRSA 2JB3A 3UKFA 1RP0A 1EBDA 3KA7A 1D4EA 4LIIA 4C5OA 1Y0PA 1B4VA 4ZCCA 1IUSA 1E1LA 2B9WA 2JB2A 3F8PA 3VRDB 2C75A 5J60A 2BXSA 1X31B 3CMMA 5KXJA 1O94A 2ZZBA 4YT0A 1TYPA 2GAGB 2QA1A 3NTDA 3PO7A 2GR3A 2WOIA 2GEWA 5U63A 2WS3A 4N9XA 4I58A 3P4QA 1CL0A 3RP8A 4EMIA 3AYJA 2DKHA 2JAEA 2XVEA 3KPFA 1YQZA 4HB9A 4JDRA 4AP3A 3LZWA 4BK2A 1S2YA 3OZ2A 2XLTA 4H2QA 4RSLA 2WPCA 1TDNA 1PN0A 4B69A 2V60A 1NHQA 2DKIA 3RP6A 2C3DA 3LOVA 3UOVA 3IHGA 1NAAA 5C2TA 1LVLA 2YG5A 3F8DA 1H6VA 3LXDA 2V61A 4AP1A 4BURA 2OAMA 3CGCA 4Z44A 4BV6A 1GRTA 3ICRA 3T2YA 2YQUA 3DA1A 2NVKX 1GEUA 1CF3A 1Q1WA 4ECHA 4EQXA 4GDEA 4B64A 1NDAA 2WOWA 3NIXA 4OPLA 2YLWA 3ATQA 5FS6A 2WP6A 1NHSA 2BYBA 2BS3A 3AE9A 2GV8A 3KU9A 3AEGA 3NH3X 2C7GA 4OPDA 4RG4A 5ER0A 4FX9A 4U2SA 1NG4A 1O95A 2VRLA 4EQWA 3NG7X 1Z6LA 1Y56B 2X8GA 4J33A 2Q0LA 4G73A 2WP9A 2IIDA 1ZX9A 2XFOA 3CTYA 4U8LA 1BZLA 2X99A 2WP5A 4AT2A 4Z2UA 1H82A 3QSEA 2C65A 4H4XA 3H8LA 1N4UA 3R9UA 2WEUA 1GXFA 3CGDA 1GTEA 2H88A 1CC4A 4YSZA 4B66A 2VRMA 2I0ZA 2Q0KA 1PBBA 1KSUA 2C3CA 3B3RA 1DOEA 4U8MA 3QVPA 2YR6A 3GDPA 2E5VA 2E4GA 2C72A 4RG3A 3EF6A 2WU2A 4APNA 2JB1A 3F8RA 3II4A 4OPIA 1XDIA 1KF6A 3BI4A 4H4WA 1E1KA 5GRTA 1KSSA 3T2KA 1PDHA 2GR2A 4YKFA 3UTEA 4H4YA 3NK2X 2CULA 1E6EA 3M0OA 4H4SA 5KRQA 2C66A 1YQ3A 4D04A 3S5WA 4C3XA 4B65A 2WDVA 3K30A 1BGNA 3RNMA 1VQWA 1H81A 4AOSA 5KVIA 4B1BA 3HZLA 2NPXA 4YTPA 1BWCA 1DOBA 1JEHA 3LB8A 3IHMA 1K0LA 3H4KA 3DJEA 4ICYA 1GESA 3AE1A 3DGHA 3HYWA 3NK0X 1P2EA 3P9UA 2C70A 3CPHG 1FL2A 1LQUA 2V6OA 3D1CA 4GCMA 2C4CA 4REKA 3UTHA 2VZ2A 1HYUA 2CVJA 2YLSA 4B68A 4YKGA 3AECA 4GF7A 2A87A 1ZK7A 2QA2A 1E7PA 2YG4A 4EM4A 2ACZA 4U2LA 3L1RA 3SZFA 5HY5A 1VDCA 4G6HA 4LA1A 4C3YA 1CJ2A 3QSMA 3VRAA 3DK9A 1FCDA 5JCLA 4USRA 4ZCDA 3UCLA 5IQ4A 1IUUA 4J56A 3FPZA 1EL5A 4NTEA 2FJEA 4G6GA 5FS9A 3UOZA 4A9WA 3AEFA 1CBOA 3GYJA 1M6IA 3ZDNA 1S2QA 4CRTA 1TDFA 2UZZA 3CNJA 5KOXA 2AAQA 3DK8A 1DOCA 4TLZA 4P9SA 1D7LA 4YSXA 1REOA 3NYCA 4X9MA 1NHRA 3G5SA 4H4ZA 2BC1A 1RSGA 4B67A 4BJYA 2WU5A 5EBKA 3UKQA 4OPUA 4KX6A 3FG2P 1YKJA 1VG9A 3D8XA 5KOWA 3KPKA 1M64A 4TM1A 1S3EA 1K4QA 2GF3A 3LJPA 3NNEA 4CBQA 2YAUA 1XHCA 2B7SA 2XLSA 2B7RA 4M52A 3UOXA 3GRTA 1JRYA 2V5ZA 2GQWA 2V3AA 2WPEA 3AEEA 1JNRA 3NGCX 2HQMA 2X3NA 2E1MA 1FECA 4GDPA 4GAPA 2VQBA 2BRYA 4II2A 1CC2A 4EQSA 2JBVA 2BK4A 3I6DA 2H89A 2WBAA 1GT8A 4IVMB 2R45A 2R4JA 4D03A 1LQTA 2GMHA 2EQ8A 4UDQA 3AYIA 3GYXA 5L46A 1N1PA 2XLUA 4NEWA 2BCGG 2VOUA 4BK1A 5CQFA 1CJ4A 3T2ZA 3QSSA 1F8RA 1PXAA 2Y6QA 1ZMDA 4J34A 3DH9A 4UP3A 2XFPA 3CNTA 3ATRA 5IPYA 2J3NA 1W4XA 1OJTA 2XVJA 4FK1C 1GRHA 2RGJA 4X9NA 1ELIA 1O5WA 2GB0A 3ALLA 5FS7A 4A79A 2YVJA 3UTFA 2XFQA 3ITJA 4U8JA 4KPRA 1L9DA 4MJWA 2YWLA 3DJGX 4J57A 4NZHA 3UP5A 1EL9A 2FBWA 1DNCA 3AE4A 3ZYXA 1JRZA 4U8PA 5EB4A 3BHKA 3K7MX 1XANA 3K7TA 3VRBA 1E1NA 4J36A 1KNPA 4U8KA 2WDRA 2GR0A 2C64A 2BK5A 4Z25A 4K5SA 4H7UA 4C77A 4G74A 1FOHA 2WPFA 1B37A 1YQ4A 2CFYA 2PYXA 3T37A 3RP7A 3AB1A 4WX1A 4II3A 1EL7A 1DJQA 2B9YA 2RGHA 3AE3A 4J31A 3VR9A 2VVLA 1F8SA 4CCQA 4H2NA 4XWZA 3UKAA 1DODA 2ZZ0A 2XFNA 1ZDLA 1GV4A 3G5RA 4H4RA 1NPXA 1NHPA 2WHDA 3DGZA 2R0CA 2R46A 4X4JA 4B63A 4CY6A 4Z2RA 2CDUA 3UKKA 1GSNA 1BKWA 4JQ9A 4OPCA 3HYVA 5LV9A 2RGOA 2XVFA 3NHOX 3NRNA 2OALA 1MXTA 2C73A 3BNMA 3NN0X 5M10A 3AEBA 1ZMCA 4JNQA 1NENA 2GH5A 1L9EA 3Q9TA 2WESA 1YY5A 1AOGA 3C4NA 4JNAA 4NTCA 3NYFA 3E1TA 3CNDA 4DSGA 3L8KA 2BK3A 2RABA 3FMWA 1E39A 2VVMA 1GRGA 2R0PA 4H2RA 2A89A 3CIRA 2GVCA 3Q6JA 1EL8A 1GTHA 4EQRA 5JCKA 3P4SA 4EIQA 1B8SA 1JU2A 4YWOA 1PJ7A 3O0HA 2QAEA 3URHA 2GAHB 1N4WA 2ZBWA 2YLXA 1PBCA 3CNPA 3DJDA 4EMJA 3JSKA 1CC6A 4TM4A 1D4CA 4Z26A 1CJ3A 1OJCA 4A6NB 3BHFA 3H8IA 3REDA 2QCUA 3GSIA 4H4QA 3AYLA 3UKHA 3KKJA 3V76A 2X50A 5DBJA 4YXDA 4U2TA 1CJCA 1ZKQA 2FJAA 3NK1X 2YVFA 3UOYA 1FEAA 5FMHA 4CCRA 3WE0A 1H7XA 3OC4A 1PXBA 2YLTA 3VR8A 2GR1A 4G9KA 4H2PA 2B9XA 4OCGA 1GNDA 4FDCB 3GD4A 1UKVG 3DK4A 1F6MA 2XVHA 4K22A 4JY3A 5JCMA 3KLJA 3GYIA 2GQFA 1DJNA 2OLOA 4GAVA 2APGA 3CGEA 5EOWA 3SXIA 3CPIG 3QVRA 2VVLG 1PBFA 2EQ7A 2BA9A 2YR4A 1TYTA 2WETA 3CN8A 4DSHA 1DXLA 1JNZA 1GRBA 2ZZCA 4JN9A 3AE5A 4OPGA 1GALA 2AQJA 4YSYA 1QO8A 1MO9A 3EAOA 4GR1A 3SZ0A 4A6NA 3SZWA 3AE2A 1N4VA 4OPTA 2FJDA 2Q7VA 3T0KA 3RHAA 3V3NA 2GMJA 3BI2A 1TDEA 4H4VA 4GRTA 2GRTA 3NLCA 5IQ1A 2OLNA 1PBDA 3I3LA 3IF9A 4DNAA 3COXA 1TDOA 2OA1A 3SGLA 4J2WA 4BK3A 2BXRA 1D4DA 3M12A 4K2XA 4NNJA 2R0GA 3BNUA 1GOSA 4K7ZA 3QJ4A 3LZXA 4YTNA 1V59A 2X8CA 4Z24A 3UTGA 3ALMA 1CHUA 1GETA 1H84A 1KDGA 2YVGA 3AEAA 3G5QA 3IC9A 3M13A 2XFUA 3LADA 4H50A 4NEVA 4AT0A 2XDOA 4LU6A 5KWFA 2W0HA 2TPRA 5FS8A 5M0ZA 4A5LA 1L0VA 2V3BA 2WOVA 3VQRA 4CNJA 2Z5YA 4TM0A 3P4RA 4Y4MA 3B6DA 2PHHA 4JY2A 1LTXR 4IA6A 1TRBA 3AD9B 3DMEA 1K0JA 4IA5A 2BRAA 2X8HA 1F3PA 1JRXA 4CNKA 1IUTA 1OJ9A 2XCGA 1P2HA 4AOXA 5HXIA 4UDPA 3AE7A 1GRAA 4C74A 1Q1RA 2VQ7A 3EANA 2BACA 2WDQA 2BABA 5J7XA 3UKPA 4U8NA 1KNRA 1D5TA 1PHHA 1PBEA 1IJHA 1E1MA 2EQ6A 5EB5A 2TMDA 5KNLA 3AE8A 3NT6A 3CNSA 3P4PA 4U8OA 2BC0A 1GREA 1QLBA 2YG3A 2YLRA 1NEKA 4H4PA 4K5RA 3P1WA 1D7YA 2BCPA 5CKUA 4XXGA 2YG6A 3SFEA 2XLPA 1SEZA 3SZCA 2IVDA 1VG0A 4H4UA 1PJ5A 1RYIA 3ABVA 4O5QA 2JKCA 4CY8A 1H83A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H7W A;  3GWF A;  4WCT A;  4DGK A;  4YTM A;  2XLR A;  4Y4N A;  4ADW A;  4FK1 A;  3CGB A;  3BI5 A;  4K8D A;  2BS2 A;  1BGJ A;  2EQ9 A;  3FBS A;  4U8I A;  2JK6 A;  1PJ6 A;  2Q6U A;  3SFD A;  3ADA B;  2WQY A;  1COY A;  3AD7 B;  3AWI A;  3NYE A;  1GPE A;  3C4A A;  4IV9 A;  1IUX A;  4EMW A;  3GMB A;  1JOA A;  3K7Q X;  3QFA A;  4I59 A;  1TDK A;  3NTA A;  3AD8 B;  1VRQ B;  1IUW A;  1GRF A;  3DJJ A;  3GD3 A;  2YM1 A;  3GWD A;  5TR3 A;  3NKS A;  1L9C A;  2R4E A;  3ALJ A;  2F5Z A;  3AXB A;  3PVC A;  4EIP A;  1Y56 A;  3EPT A;  3SM8 A;  4Z43 A;  4A99 A;  3CPJ G;  3ICT A;  2BS4 A;  1KFY A;  4PAB A;  2C67 A;  4UDR A;  2YM2 A;  3S61 A;  2R9Z A;  1NG3 A;  3AED A;  1LV0 A;  1OJD A;  4GUV A;  2YG7 A;  2XYO A;  5BUL A;  2A8X A;  3NN6 X;  5BUK A;  1Q9I A;  4E0V A;  1PS9 A;  2C76 A;  2O9Z A;  4USQ A;  4TM3 A;  5U1O A;  1B5Q A;  3PS9 A;  2XVI A;  1BF3 A;  4OVI A;  4H4T A;  2YR5 A;  5BRT A;  4EM3 A;  3GDN A;  3SQP A;  4BJZ A;  1K0I A;  2Z5X A;  3QFB A;  2Y6R A;  5HYM A;  5JCN A;  2IVE A;  4YSH A;  4Z2T A;  5HHF A;  1ZP0 A;  3IWA A;  1IUV A;  1ZY8 A;  5JCI A;  3GMC A;  4ZN0 A;  1OJA A;  3ISH A;  1GER A;  1PXC A;  2YLZ A;  2AR8 A;  5C3J A;  4XWR A;  1S3B A;  4PAA A;  1QJD A;  4A7A A;  2ARD A;  3UP4 A;  4IVO B;  1FEB A;  5U25 A;  3C96 A;  3FIM B;  4O5U A;  4A65 A;  1XPQ A;  3AE6 A;  3KD9 A;  3V3O A;  2B76 A;  1ZOV A;  5BVA A;  3KVE A;  1MOK A;  2FJB A;  1LJ1 A;  5KVH A;  1F8W A;  1ONF A;  4Y4L A;  4NTD A;  1ZOY A;  4HA6 A;  3UKL A;  3ICS A;  5GSN A;  1LPF A;  1H86 A;  4TLX A;  3GRS A;  2JB3 A;  3UKF A;  1RP0 A;  1EBD A;  3KA7 A;  1D4E A;  4LII A;  4C5O A;  1Y0P A;  1B4V A;  4ZCC A;  1IUS A;  1E1L A;  2B9W A;  2JB2 A;  3F8P A;  3VRD B;  2C75 A;  5J60 A;  2BXS A;  1X31 B;  5KXJ A;  1O94 A;  2ZZB A;  4YT0 A;  1TYP A;  2GAG B;  2QA1 A;  3NTD A;  3PO7 A;  2GR3 A;  2WOI A;  2GEW A;  5U63 A;  2WS3 A;  4N9X A;  4I58 A;  3P4Q A;  1CL0 A;  3RP8 A;  4EMI A;  3AYJ A;  2DKH A;  2JAE A;  2XVE A;  3KPF A;  1YQZ A;  4HB9 A;  4JDR A;  4AP3 A;  3LZW A;  4BK2 A;  1S2Y A;  3OZ2 A;  2XLT A;  4H2Q A;  4RSL A;  2WPC A;  1TDN A;  1PN0 A;  4B69 A;  2V60 A;  1NHQ A;  2DKI A;  3RP6 A;  2C3D A;  3LOV A;  3UOV A;  3IHG A;  1NAA A;  5C2T A;  1LVL A;  2YG5 A;  3F8D A;  1H6V A;  3LXD A;  2V61 A;  4AP1 A;  4BUR A;  2OAM A;  3CGC A;  4Z44 A;  4BV6 A;  1GRT A;  3ICR A;  2YQU A;  3DA1 A;  2NVK X;  1GEU A;  1CF3 A;  1Q1W A;  4ECH A;  4EQX A;  4GDE A;  4B64 A;  1NDA A;  2WOW A;  3NIX A;  4OPL A;  2YLW A;  3ATQ A;  5FS6 A;  2WP6 A;  1NHS A;  2BYB A;  2BS3 A;  3AE9 A;  2GV8 A;  3KU9 A;  3AEG A;  3NH3 X;  2C7G A;  4OPD A;  4RG4 A;  5ER0 A;  4FX9 A;  4U2S A;  1NG4 A;  1O95 A;  2VRL A;  4EQW A;  3NG7 X;  1Z6L A;  1Y56 B;  2X8G A;  4J33 A;  2Q0L A;  2WP9 A;  2IID A;  1ZX9 A;  2XFO A;  3CTY A;  4U8L A;  1BZL A;  2X99 A;  2WP5 A;  4AT2 A;  4Z2U A;  1H82 A;  3QSE A;  2C65 A;  4H4X A;  3H8L A;  1N4U A;  3R9U A;  2WEU A;  1GXF A;  3CGD A;  1GTE A;  2H88 A;  1CC4 A;  4YSZ A;  4B66 A;  2VRM A;  2I0Z A;  2Q0K A;  1PBB A;  1KSU A;  2C3C A;  3B3R A;  1DOE A;  4U8M A;  3QVP A;  2YR6 A;  3GDP A;  2E5V A;  2E4G A;  2C72 A;  4RG3 A;  3EF6 A;  2WU2 A;  4APN A;  2JB1 A;  3F8R A;  3II4 A;  4OPI A;  1XDI A;  1KF6 A;  3BI4 A;  4H4W A;  1E1K A;  5GRT A;  1KSS A;  1PDH A;  2GR2 A;  4YKF A;  3UTE A;  4H4Y A;  3NK2 X;  2CUL A;  1E6E A;  3M0O A;  4H4S A;  5KRQ A;  2C66 A;  1YQ3 A;  4D04 A;  3S5W A;  4C3X A;  4B65 A;  2WDV A;  3K30 A;  1BGN A;  3RNM A;  1VQW A;  1H81 A;  4AOS A;  5KVI A;  4B1B A;  3HZL A;  2NPX A;  4YTP A;  1BWC A;  1DOB A;  1JEH A;  3LB8 A;  3IHM A;  1K0L A;  3H4K A;  3DJE A;  4ICY A;  1GES A;  3AE1 A;  3DGH A;  3NK0 X;  1P2E A;  3P9U A;  2C70 A;  3CPH G;  1FL2 A;  1LQU A;  2V6O A;  3D1C A;  4GCM A;  4REK A;  3UTH A;  2VZ2 A;  1HYU A;  2CVJ A;  2YLS A;  4B68 A;  4YKG A;  3AEC A;  4GF7 A;  2A87 A;  1ZK7 A;  2QA2 A;  1E7P A;  2YG4 A;  4EM4 A;  2ACZ A;  4U2L A;  3L1R A;  5HY5 A;  1VDC A;  4C3Y A;  4LA1 A;  1CJ2 A;  3QSM A;  3VRA A;  3DK9 A;  1FCD A;  5JCL A;  4USR A;  4ZCD A;  3UCL A;  5IQ4 A;  1IUU A;  4J56 A;  3FPZ A;  1EL5 A;  4NTE A;  2FJE A;  5FS9 A;  3UOZ A;  4A9W A;  3AEF A;  1CBO A;  3GYJ A;  1M6I A;  3ZDN A;  1S2Q A;  4CRT A;  1TDF A;  2UZZ A;  3CNJ A;  5KOX A;  2AAQ A;  3DK8 A;  1DOC A;  4TLZ A;  4P9S A;  1D7L A;  4YSX A;  1REO A;  3NYC A;  4X9M A;  1NHR A;  3G5S A;  4H4Z A;  2BC1 A;  1RSG A;  4B67 A;  4BJY A;  2WU5 A;  5EBK A;  3UKQ A;  4OPU A;  4KX6 A;  3FG2 P;  1YKJ A;  1VG9 A;  3D8X A;  5KOW A;  1M64 A;  4TM1 A;  1S3E A;  1K4Q A;  2GF3 A;  3LJP A;  3NNE A;  4CBQ A;  2YAU A;  1XHC A;  2B7S A;  2XLS A;  2B7R A;  4M52 A;  3UOX A;  3GRT A;  1JRY A;  2V5Z A;  2GQW A;  2V3A A;  2WPE A;  3AEE A;  1JNR A;  3NGC X;  2HQM A;  2X3N A;  2E1M A;  1FEC A;  4GDP A;  2VQB A;  1CC2 A;  4EQS A;  2JBV A;  2BK4 A;  3I6D A;  2H89 A;  2WBA A;  1GT8 A;  4IVM B;  2R45 A;  2R4J A;  4D03 A;  1LQT A;  2GMH A;  2EQ8 A;  4UDQ A;  3AYI A;  5L46 A;  1N1P A;  2XLU A;  4NEW A;  2BCG G;  2VOU A;  4BK1 A;  5CQF A;  1CJ4 A;  3QSS A;  1F8R A;  1PXA A;  2Y6Q A;  1ZMD A;  4J34 A;  3DH9 A;  4UP3 A;  2XFP A;  3CNT A;  3ATR A;  5IPY A;  2J3N A;  1W4X A;  1OJT A;  2XVJ A;  4FK1 C;  1GRH A;  2RGJ A;  4X9N A;  1ELI A;  1O5W A;  2GB0 A;  3ALL A;  5FS7 A;  4A79 A;  2YVJ A;  3UTF A;  2XFQ A;  3ITJ A;  4U8J A;  4KPR A;  1L9D A;  4MJW A;  2YWL A;  3DJG X;  4J57 A;  4NZH A;  3UP5 A;  1EL9 A;  2FBW A;  1DNC A;  3AE4 A;  3ZYX A;  1JRZ A;  4U8P A;  5EB4 A;  3BHK A;  3K7M X;  1XAN A;  3K7T A;  3VRB A;  1E1N A;  4J36 A;  1KNP A;  4U8K A;  2WDR A;  2GR0 A;  2C64 A;  2BK5 A;  4Z25 A;  4K5S A;  4H7U A;  4C77 A;  1FOH A;  2WPF A;  1B37 A;  1YQ4 A;  2CFY A;  2PYX A;  3T37 A;  3RP7 A;  3AB1 A;  4WX1 A;  1EL7 A;  1DJQ A;  2B9Y A;  2RGH A;  3AE3 A;  4J31 A;  3VR9 A;  2VVL A;  1F8S A;  4CCQ A;  4H2N A;  4XWZ A;  3UKA A;  1DOD A;  2ZZ0 A;  2XFN A;  1ZDL A;  1GV4 A;  3G5R A;  4H4R A;  1NPX A;  1NHP A;  2WHD A;  3DGZ A;  2R0C A;  2R46 A;  4X4J A;  4B63 A;  4CY6 A;  4Z2R A;  2CDU A;  3UKK A;  1GSN A;  1BKW A;  4JQ9 A;  4OPC A;  5LV9 A;  2RGO A;  2XVF A;  3NHO X;  3NRN A;  2OAL A;  1MXT A;  2C73 A;  3BNM A;  3NN0 X;  5M10 A;  3AEB A;  1ZMC A;  4JNQ A;  1NEN A;  2GH5 A;  1L9E A;  3Q9T A;  2WES A;  1YY5 A;  1AOG A;  3C4N A;  4JNA A;  4NTC A;  3NYF A;  3E1T A;  3CND A;  4DSG A;  3L8K A;  2BK3 A;  2RAB A;  3FMW A;  1E39 A;  2VVM A;  1GRG A;  2R0P A;  4H2R A;  2A89 A;  3CIR A;  2GVC A;  3Q6J A;  1EL8 A;  1GTH A;  4EQR A;  5JCK A;  3P4S A;  4EIQ A;  1B8S A;  1JU2 A;  4YWO A;  1PJ7 A;  3O0H A;  2QAE A;  3URH A;  2GAH B;  1N4W A;  2ZBW A;  2YLX A;  1PBC A;  3CNP A;  3DJD A;  4EMJ A;  3JSK A;  1CC6 A;  4TM4 A;  1D4C A;  4Z26 A;  1CJ3 A;  1OJC A;  4A6N B;  3BHF A;  3H8I A;  3RED A;  2QCU A;  3GSI A;  4H4Q A;  3AYL A;  3UKH A;  3KKJ A;  3V76 A;  2X50 A;  5DBJ A;  4YXD A;  4U2T A;  1CJC A;  1ZKQ A;  2FJA A;  3NK1 X;  2YVF A;  3UOY A;  1FEA A;  5FMH A;  4CCR A;  3WE0 A;  1H7X A;  3OC4 A;  1PXB A;  2YLT A;  3VR8 A;  2GR1 A;  4H2P A;  2B9X A;  4OCG A;  1GND A;  4FDC B;  3GD4 A;  1UKV G;  3DK4 A;  1F6M A;  2XVH A;  4K22 A;  4JY3 A;  5JCM A;  3KLJ A;  3GYI A;  2GQF A;  1DJN A;  2OLO A;  2APG A;  3CGE A;  5EOW A;  3CPI G;  3QVR A;  2VVL G;  1PBF A;  2EQ7 A;  2BA9 A;  2YR4 A;  1TYT A;  2WET A;  3CN8 A;  4DSH A;  1DXL A;  1JNZ A;  1GRB A;  2ZZC A;  4JN9 A;  3AE5 A;  4OPG A;  1GAL A;  2AQJ A;  4YSY A;  1QO8 A;  1MO9 A;  3EAO A;  4GR1 A;  4A6N A;  3AE2 A;  1N4V A;  4OPT A;  2FJD A;  2Q7V A;  3V3N A;  3RHA A;  2GMJ A;  3BI2 A;  1TDE A;  4H4V A;  4GRT A;  2GRT A;  3NLC A;  5IQ1 A;  2OLN A;  1PBD A;  3I3L A;  3IF9 A;  4DNA A;  3COX A;  1TDO A;  2OA1 A;  3SGL A;  4J2W A;  4BK3 A;  2BXR A;  1D4D A;  3M12 A;  4K2X A;  2R0G A;  3BNU A;  1GOS A;  4K7Z A;  3QJ4 A;  3LZX A;  4YTN A;  1V59 A;  2X8C A;  4Z24 A;  3UTG A;  3ALM A;  1CHU A;  1GET A;  1H84 A;  1KDG A;  2YVG A;  3AEA A;  3G5Q A;  3IC9 A;  3M13 A;  2XFU A;  3LAD A;  4H50 A;  4NEV A;  4AT0 A;  2XDO A;  4LU6 A;  5KWF A;  2W0H A;  2TPR A;  5FS8 A;  5M0Z A;  4A5L A;  1L0V A;  2V3B A;  2WOV A;  3VQR A;  4CNJ A;  2Z5Y A;  4TM0 A;  3P4R A;  4Y4M A;  3B6D A;  2PHH A;  4JY2 A;  1LTX R;  4IA6 A;  1TRB A;  3AD9 B;  3DME A;  1K0J A;  4IA5 A;  2X8H A;  1F3P A;  1JRX A;  4CNK A;  1IUT A;  1OJ9 A;  2XCG A;  1P2H A;  4AOX A;  5HXI A;  4UDP A;  3AE7 A;  1GRA A;  4C74 A;  1Q1R A;  2VQ7 A;  3EAN A;  2BAC A;  2WDQ A;  2BAB A;  5J7X A;  3UKP A;  4U8N A;  1KNR A;  1D5T A;  1PHH A;  1PBE A;  1IJH A;  1E1M A;  2EQ6 A;  5EB5 A;  2TMD A;  3AE8 A;  3NT6 A;  3CNS A;  3P4P A;  4U8O A;  2BC0 A;  1GRE A;  1QLB A;  2YG3 A;  2YLR A;  1NEK A;  4H4P A;  4K5R A;  3P1W A;  1D7Y A;  2BCP A;  5CKU A;  4XXG A;  2YG6 A;  3SFE A;  2XLP A;  1SEZ A;  2IVD A;  1VG0 A;  4H4U A;  1PJ5 A;  1RYI A;  3ABV A;  4O5Q A;  2JKC A;  4CY8 A;  1H83 A; 
#chains in the Genus database with same CATH topology
 1H7W A;  3GWF A;  4WCT A;  4DGK A;  4YTM A;  3SYI A;  2XLR A;  4Y4N A;  4ADW A;  4FK1 A;  3CGB A;  3BI5 A;  4K8D A;  2BS2 A;  1BGJ A;  2EQ9 A;  3FBS A;  4U8I A;  2JK6 A;  1PJ6 A;  2Q6U A;  3SFD A;  3ADA B;  2WQY A;  1COY A;  3AD7 B;  3AWI A;  3NYE A;  1GPE A;  4IV9 A;  3C4A A;  4NWZ A;  1IUX A;  4EMW A;  3GMB A;  1JOA A;  3K7Q X;  3QFA A;  4I59 A;  1TDK A;  3NTA A;  5KMR A;  3AD8 B;  1VRQ B;  1IUW A;  1GRF A;  3DJJ A;  3GD3 A;  2YM1 A;  3GWD A;  5TR3 A;  3NKS A;  1L9C A;  2R4E A;  3ALJ A;  2F5Z A;  3AXB A;  3PVC A;  4EIP A;  1Y56 A;  3EPT A;  3SM8 A;  4Z43 A;  4A99 A;  3CPJ G;  3ICT A;  3T14 A;  2BS4 A;  5KMP A;  1KFY A;  4PAB A;  2C67 A;  4UDR A;  2YM2 A;  3S61 A;  2R9Z A;  1NG3 A;  3AED A;  1LV0 A;  1OJD A;  4GUV A;  2YG7 A;  2XYO A;  5BUL A;  2A8X A;  3NN6 X;  5BUK A;  1Q9I A;  4E0V A;  1PS9 A;  2C76 A;  2O9Z A;  4USQ A;  4TM3 A;  5U1O A;  1B5Q A;  3PS9 A;  2XVI A;  1BF3 A;  4OVI A;  4H4T A;  2YR5 A;  5BRT A;  4EM3 A;  3GDN A;  3SQP A;  4BJZ A;  1K0I A;  2Z5X A;  3QFB A;  2Y6R A;  5HYM A;  5JCN A;  2IVE A;  4YSH A;  4Z2T A;  5HHF A;  1ZP0 A;  3IWA A;  1IUV A;  1ZY8 A;  5JCI A;  3GMC A;  4ZN0 A;  1OJA A;  3ISH A;  1GER A;  3T31 A;  1PXC A;  3HYX A;  2YLZ A;  2AR8 A;  5C3J A;  4XWR A;  1S3B A;  4PAA A;  1QJD A;  4A7A A;  2ARD A;  3UP4 A;  4IVO B;  1FEB A;  5U25 A;  3C96 A;  3FIM B;  4O5U A;  4A65 A;  1XPQ A;  3AE6 A;  3KD9 A;  3V3O A;  2B76 A;  1ZOV A;  5BVA A;  3KVE A;  1MOK A;  2FJB A;  1LJ1 A;  5KVH A;  1F8W A;  1ONF A;  5KMS A;  4Y4L A;  5KMQ A;  4NTD A;  1ZOY A;  4HA6 A;  3SY4 A;  3UKL A;  3ICS A;  5GSN A;  1LPF A;  3SX6 A;  1H86 A;  4TLX A;  3GRS A;  2JB3 A;  3UKF A;  1RP0 A;  1EBD A;  3KA7 A;  1D4E A;  4LII A;  4C5O A;  1Y0P A;  1B4V A;  4ZCC A;  1IUS A;  1E1L A;  2B9W A;  2JB2 A;  3F8P A;  3VRD B;  2C75 A;  5J60 A;  2BXS A;  1X31 B;  3CMM A;  5KXJ A;  1O94 A;  2ZZB A;  4YT0 A;  1TYP A;  2GAG B;  2QA1 A;  3NTD A;  3PO7 A;  2GR3 A;  2WOI A;  2GEW A;  5U63 A;  2WS3 A;  4N9X A;  4I58 A;  3P4Q A;  1CL0 A;  3RP8 A;  4EMI A;  3AYJ A;  2DKH A;  2JAE A;  2XVE A;  3KPF A;  1YQZ A;  4HB9 A;  4JDR A;  4AP3 A;  3LZW A;  4BK2 A;  1S2Y A;  3OZ2 A;  2XLT A;  4H2Q A;  4RSL A;  2WPC A;  1TDN A;  1PN0 A;  4B69 A;  2V60 A;  1NHQ A;  2DKI A;  3RP6 A;  2C3D A;  3LOV A;  3UOV A;  3IHG A;  1NAA A;  5C2T A;  1LVL A;  2YG5 A;  3F8D A;  1H6V A;  3LXD A;  2V61 A;  4AP1 A;  4BUR A;  2OAM A;  3CGC A;  4Z44 A;  4BV6 A;  1GRT A;  3ICR A;  3T2Y A;  2YQU A;  3DA1 A;  2NVK X;  1GEU A;  1CF3 A;  1Q1W A;  4ECH A;  4EQX A;  4GDE A;  4B64 A;  1NDA A;  2WOW A;  3NIX A;  4OPL A;  2YLW A;  3ATQ A;  5FS6 A;  2WP6 A;  1NHS A;  2BYB A;  2BS3 A;  3AE9 A;  2GV8 A;  3KU9 A;  3AEG A;  3NH3 X;  2C7G A;  4OPD A;  4RG4 A;  5ER0 A;  4FX9 A;  4U2S A;  1NG4 A;  1O95 A;  2VRL A;  4EQW A;  3NG7 X;  1Z6L A;  1Y56 B;  2X8G A;  4J33 A;  2Q0L A;  4G73 A;  2WP9 A;  2IID A;  1ZX9 A;  2XFO A;  3CTY A;  4U8L A;  1BZL A;  2X99 A;  2WP5 A;  4AT2 A;  4Z2U A;  1H82 A;  3QSE A;  2C65 A;  4H4X A;  3H8L A;  1N4U A;  3R9U A;  2WEU A;  1GXF A;  3CGD A;  1GTE A;  2H88 A;  1CC4 A;  4YSZ A;  4B66 A;  2VRM A;  2I0Z A;  2Q0K A;  1PBB A;  1KSU A;  2C3C A;  3B3R A;  1DOE A;  4U8M A;  3QVP A;  2YR6 A;  3GDP A;  2E5V A;  2E4G A;  2C72 A;  4RG3 A;  3EF6 A;  2WU2 A;  4APN A;  2JB1 A;  3F8R A;  3II4 A;  4OPI A;  1XDI A;  1KF6 A;  3BI4 A;  4H4W A;  1E1K A;  5GRT A;  1KSS A;  3T2K A;  1PDH A;  2GR2 A;  4YKF A;  3UTE A;  4H4Y A;  3NK2 X;  2CUL A;  1E6E A;  3M0O A;  4H4S A;  5KRQ A;  2C66 A;  1YQ3 A;  4D04 A;  3S5W A;  4C3X A;  4B65 A;  2WDV A;  3K30 A;  1BGN A;  3RNM A;  1VQW A;  1H81 A;  4AOS A;  5KVI A;  4B1B A;  3HZL A;  2NPX A;  4YTP A;  1BWC A;  1DOB A;  1JEH A;  3LB8 A;  3IHM A;  1K0L A;  3H4K A;  3DJE A;  4ICY A;  1GES A;  3AE1 A;  3DGH A;  3HYW A;  3NK0 X;  1P2E A;  3P9U A;  2C70 A;  3CPH G;  1FL2 A;  1LQU A;  2V6O A;  3D1C A;  4GCM A;  2C4C A;  4REK A;  3UTH A;  2VZ2 A;  1HYU A;  2CVJ A;  2YLS A;  4B68 A;  4YKG A;  3AEC A;  4GF7 A;  2A87 A;  1ZK7 A;  2QA2 A;  1E7P A;  2YG4 A;  4EM4 A;  2ACZ A;  4U2L A;  3L1R A;  3SZF A;  5HY5 A;  1VDC A;  4G6H A;  4LA1 A;  4C3Y A;  1CJ2 A;  3QSM A;  3VRA A;  3DK9 A;  1FCD A;  5JCL A;  4USR A;  4ZCD A;  3UCL A;  5IQ4 A;  1IUU A;  4J56 A;  3FPZ A;  1EL5 A;  4NTE A;  2FJE A;  4G6G A;  5FS9 A;  3UOZ A;  4A9W A;  3AEF A;  1CBO A;  3GYJ A;  1M6I A;  3ZDN A;  1S2Q A;  4CRT A;  1TDF A;  2UZZ A;  3CNJ A;  5KOX A;  2AAQ A;  3DK8 A;  1DOC A;  4TLZ A;  4P9S A;  1D7L A;  4YSX A;  1REO A;  3NYC A;  4X9M A;  1NHR A;  3G5S A;  4H4Z A;  2BC1 A;  1RSG A;  4B67 A;  4BJY A;  2WU5 A;  5EBK A;  3UKQ A;  4OPU A;  4KX6 A;  3FG2 P;  1YKJ A;  1VG9 A;  3D8X A;  5KOW A;  3KPK A;  1M64 A;  4TM1 A;  1S3E A;  1K4Q A;  2GF3 A;  3LJP A;  3NNE A;  4CBQ A;  2YAU A;  1XHC A;  2B7S A;  2XLS A;  2B7R A;  4M52 A;  3UOX A;  3GRT A;  1JRY A;  2V5Z A;  2GQW A;  2V3A A;  2WPE A;  3AEE A;  1JNR A;  3NGC X;  2HQM A;  2X3N A;  2E1M A;  1FEC A;  4GDP A;  4GAP A;  2VQB A;  2BRY A;  4II2 A;  1CC2 A;  4EQS A;  2JBV A;  2BK4 A;  3I6D A;  2H89 A;  2WBA A;  1GT8 A;  4IVM B;  2R45 A;  2R4J A;  4D03 A;  1LQT A;  2GMH A;  2EQ8 A;  4UDQ A;  3AYI A;  3GYX A;  5L46 A;  1N1P A;  2XLU A;  4NEW A;  2BCG G;  2VOU A;  4BK1 A;  5CQF A;  1CJ4 A;  3T2Z A;  3QSS A;  1F8R A;  1PXA A;  2Y6Q A;  1ZMD A;  4J34 A;  3DH9 A;  4UP3 A;  2XFP A;  3CNT A;  3ATR A;  5IPY A;  2J3N A;  1W4X A;  1OJT A;  2XVJ A;  4FK1 C;  1GRH A;  2RGJ A;  4X9N A;  1ELI A;  1O5W A;  2GB0 A;  3ALL A;  5FS7 A;  4A79 A;  2YVJ A;  3UTF A;  2XFQ A;  3ITJ A;  4U8J A;  4KPR A;  1L9D A;  4MJW A;  2YWL A;  3DJG X;  4J57 A;  4NZH A;  3UP5 A;  1EL9 A;  2FBW A;  1DNC A;  3AE4 A;  3ZYX A;  1JRZ A;  4U8P A;  5EB4 A;  3BHK A;  3K7M X;  1XAN A;  3K7T A;  3VRB A;  1E1N A;  4J36 A;  1KNP A;  4U8K A;  2WDR A;  2GR0 A;  2C64 A;  2BK5 A;  4Z25 A;  4K5S A;  4H7U A;  4C77 A;  4G74 A;  1FOH A;  2WPF A;  1B37 A;  1YQ4 A;  2CFY A;  2PYX A;  3T37 A;  3RP7 A;  3AB1 A;  4WX1 A;  4II3 A;  1EL7 A;  1DJQ A;  2B9Y A;  2RGH A;  3AE3 A;  4J31 A;  3VR9 A;  2VVL A;  1F8S A;  4CCQ A;  4H2N A;  4XWZ A;  3UKA A;  1DOD A;  2ZZ0 A;  2XFN A;  1ZDL A;  1GV4 A;  3G5R A;  4H4R A;  1NPX A;  1NHP A;  2WHD A;  3DGZ A;  2R0C A;  2R46 A;  4X4J A;  4B63 A;  4CY6 A;  4Z2R A;  2CDU A;  3UKK A;  1GSN A;  1BKW A;  4JQ9 A;  4OPC A;  3HYV A;  5LV9 A;  2RGO A;  2XVF A;  3NHO X;  3NRN A;  2OAL A;  1MXT A;  2C73 A;  3BNM A;  3NN0 X;  5M10 A;  3AEB A;  1ZMC A;  4JNQ A;  1NEN A;  2GH5 A;  1L9E A;  3Q9T A;  2WES A;  1YY5 A;  1AOG A;  3C4N A;  4JNA A;  4NTC A;  3NYF A;  3E1T A;  3CND A;  4DSG A;  3L8K A;  2BK3 A;  2RAB A;  3FMW A;  1E39 A;  2VVM A;  1GRG A;  2R0P A;  4H2R A;  2A89 A;  3CIR A;  2GVC A;  3Q6J A;  1EL8 A;  1GTH A;  4EQR A;  5JCK A;  3P4S A;  4EIQ A;  1B8S A;  1JU2 A;  4YWO A;  1PJ7 A;  3O0H A;  2QAE A;  3URH A;  2GAH B;  1N4W A;  2ZBW A;  2YLX A;  1PBC A;  3CNP A;  3DJD A;  4EMJ A;  3JSK A;  1CC6 A;  4TM4 A;  1D4C A;  4Z26 A;  1CJ3 A;  1OJC A;  4A6N B;  3BHF A;  3H8I A;  3RED A;  2QCU A;  3GSI A;  4H4Q A;  3AYL A;  3UKH A;  3KKJ A;  3V76 A;  2X50 A;  5DBJ A;  4YXD A;  4U2T A;  1CJC A;  1ZKQ A;  2FJA A;  3NK1 X;  2YVF A;  3UOY A;  1FEA A;  5FMH A;  4CCR A;  3WE0 A;  1H7X A;  3OC4 A;  1PXB A;  2YLT A;  3VR8 A;  2GR1 A;  4G9K A;  4H2P A;  2B9X A;  4OCG A;  1GND A;  4FDC B;  3GD4 A;  1UKV G;  3DK4 A;  1F6M A;  2XVH A;  4K22 A;  4JY3 A;  5JCM A;  3KLJ A;  3GYI A;  2GQF A;  1DJN A;  2OLO A;  4GAV A;  2APG A;  3CGE A;  5EOW A;  3SXI A;  3CPI G;  3QVR A;  2VVL G;  1PBF A;  2EQ7 A;  2BA9 A;  2YR4 A;  1TYT A;  2WET A;  3CN8 A;  4DSH A;  1DXL A;  1JNZ A;  1GRB A;  2ZZC A;  4JN9 A;  3AE5 A;  4OPG A;  1GAL A;  2AQJ A;  4YSY A;  1QO8 A;  1MO9 A;  3EAO A;  4GR1 A;  3SZ0 A;  4A6N A;  3SZW A;  3AE2 A;  1N4V A;  4OPT A;  2FJD A;  2Q7V A;  3T0K A;  3RHA A;  3V3N A;  2GMJ A;  3BI2 A;  1TDE A;  4H4V A;  4GRT A;  2GRT A;  3NLC A;  5IQ1 A;  2OLN A;  1PBD A;  3I3L A;  3IF9 A;  4DNA A;  3COX A;  1TDO A;  2OA1 A;  3SGL A;  4J2W A;  4BK3 A;  2BXR A;  1D4D A;  3M12 A;  4K2X A;  4NNJ A;  2R0G A;  3BNU A;  1GOS A;  4K7Z A;  3QJ4 A;  3LZX A;  4YTN A;  1V59 A;  2X8C A;  4Z24 A;  3UTG A;  3ALM A;  1CHU A;  1GET A;  1H84 A;  1KDG A;  2YVG A;  3AEA A;  3G5Q A;  3IC9 A;  3M13 A;  2XFU A;  3LAD A;  4H50 A;  4NEV A;  4AT0 A;  2XDO A;  4LU6 A;  5KWF A;  2W0H A;  2TPR A;  5FS8 A;  5M0Z A;  4A5L A;  1L0V A;  2V3B A;  2WOV A;  3VQR A;  4CNJ A;  2Z5Y A;  4TM0 A;  3P4R A;  4Y4M A;  3B6D A;  2PHH A;  4JY2 A;  1LTX R;  4IA6 A;  1TRB A;  3AD9 B;  3DME A;  1K0J A;  4IA5 A;  2BRA A;  2X8H A;  1F3P A;  1JRX A;  4CNK A;  1IUT A;  1OJ9 A;  2XCG A;  1P2H A;  4AOX A;  5HXI A;  4UDP A;  3AE7 A;  1GRA A;  4C74 A;  1Q1R A;  2VQ7 A;  3EAN A;  2BAC A;  2WDQ A;  2BAB A;  5J7X A;  3UKP A;  4U8N A;  1KNR A;  1D5T A;  1PHH A;  1PBE A;  1IJH A;  1E1M A;  2EQ6 A;  5EB5 A;  2TMD A;  5KNL A;  3AE8 A;  3NT6 A;  3CNS A;  3P4P A;  4U8O A;  2BC0 A;  1GRE A;  1QLB A;  2YG3 A;  2YLR A;  1NEK A;  4H4P A;  4K5R A;  3P1W A;  1D7Y A;  2BCP A;  5CKU A;  4XXG A;  2YG6 A;  3SFE A;  2XLP A;  1SEZ A;  3SZC A;  2IVD A;  1VG0 A;  4H4U A;  1PJ5 A;  1RYI A;  3ABV A;  4O5Q A;  2JKC A;  4CY8 A;  1H83 A; 
#chains in the Genus database with same CATH homology
 1H7W A;  3GWF A;  4WCT A;  4DGK A;  4YTM A;  3SYI A;  2XLR A;  4Y4N A;  4ADW A;  4FK1 A;  3CGB A;  3BI5 A;  4K8D A;  2BS2 A;  1BGJ A;  2EQ9 A;  3FBS A;  4U8I A;  2JK6 A;  1PJ6 A;  2Q6U A;  3SFD A;  3ADA B;  2WQY A;  1COY A;  3AD7 B;  3AWI A;  3NYE A;  1GPE A;  3C4A A;  4IV9 A;  4NWZ A;  1IUX A;  4EMW A;  3GMB A;  1JOA A;  3K7Q X;  3QFA A;  4I59 A;  1TDK A;  3NTA A;  5KMR A;  3AD8 B;  1VRQ B;  1IUW A;  1GRF A;  3DJJ A;  3GD3 A;  2YM1 A;  3GWD A;  5TR3 A;  3NKS A;  1L9C A;  2R4E A;  3ALJ A;  2F5Z A;  3AXB A;  3PVC A;  4EIP A;  1Y56 A;  3EPT A;  3SM8 A;  4Z43 A;  4A99 A;  3CPJ G;  3ICT A;  3T14 A;  2BS4 A;  5KMP A;  1KFY A;  4PAB A;  2C67 A;  4UDR A;  2YM2 A;  3S61 A;  2R9Z A;  1NG3 A;  3AED A;  1LV0 A;  1OJD A;  4GUV A;  2YG7 A;  2XYO A;  5BUL A;  2A8X A;  3NN6 X;  5BUK A;  1Q9I A;  4E0V A;  1PS9 A;  2C76 A;  2O9Z A;  4USQ A;  4TM3 A;  5U1O A;  1B5Q A;  3PS9 A;  2XVI A;  1BF3 A;  4OVI A;  4H4T A;  2YR5 A;  5BRT A;  4EM3 A;  3GDN A;  3SQP A;  4BJZ A;  1K0I A;  2Z5X A;  3QFB A;  2Y6R A;  5HYM A;  5JCN A;  2IVE A;  4YSH A;  4Z2T A;  5HHF A;  1ZP0 A;  3IWA A;  1IUV A;  1ZY8 A;  5JCI A;  3GMC A;  4ZN0 A;  1OJA A;  3ISH A;  1GER A;  3T31 A;  1PXC A;  3HYX A;  2YLZ A;  2AR8 A;  5C3J A;  4XWR A;  1S3B A;  4PAA A;  1QJD A;  4A7A A;  2ARD A;  3UP4 A;  4IVO B;  1FEB A;  5U25 A;  3C96 A;  3FIM B;  4O5U A;  4A65 A;  1XPQ A;  3AE6 A;  3KD9 A;  3V3O A;  2B76 A;  1ZOV A;  5BVA A;  3KVE A;  1MOK A;  2FJB A;  1LJ1 A;  5KVH A;  1F8W A;  1ONF A;  5KMS A;  4Y4L A;  5KMQ A;  4NTD A;  1ZOY A;  4HA6 A;  3SY4 A;  3UKL A;  3ICS A;  5GSN A;  1LPF A;  3SX6 A;  1H86 A;  4TLX A;  3GRS A;  2JB3 A;  3UKF A;  1RP0 A;  1EBD A;  3KA7 A;  1D4E A;  4LII A;  4C5O A;  1Y0P A;  1B4V A;  4ZCC A;  1IUS A;  1E1L A;  2B9W A;  2JB2 A;  3F8P A;  3VRD B;  2C75 A;  5J60 A;  2BXS A;  1X31 B;  3CMM A;  5KXJ A;  1O94 A;  2ZZB A;  4YT0 A;  1TYP A;  2GAG B;  2QA1 A;  3NTD A;  3PO7 A;  2GR3 A;  2WOI A;  2GEW A;  5U63 A;  2WS3 A;  4N9X A;  4I58 A;  3P4Q A;  1CL0 A;  3RP8 A;  4EMI A;  3AYJ A;  2DKH A;  2JAE A;  2XVE A;  3KPF A;  1YQZ A;  4HB9 A;  4JDR A;  4AP3 A;  3LZW A;  4BK2 A;  1S2Y A;  3OZ2 A;  2XLT A;  4H2Q A;  4RSL A;  2WPC A;  1TDN A;  1PN0 A;  4B69 A;  2V60 A;  1NHQ A;  2DKI A;  3RP6 A;  2C3D A;  3LOV A;  3UOV A;  3IHG A;  1NAA A;  5C2T A;  1LVL A;  2YG5 A;  3F8D A;  1H6V A;  3LXD A;  2V61 A;  4AP1 A;  4BUR A;  2OAM A;  3CGC A;  4Z44 A;  4BV6 A;  1GRT A;  3ICR A;  3T2Y A;  2YQU A;  3DA1 A;  2NVK X;  1GEU A;  1CF3 A;  1Q1W A;  4ECH A;  4EQX A;  4GDE A;  4B64 A;  1NDA A;  2WOW A;  3NIX A;  4OPL A;  2YLW A;  3ATQ A;  5FS6 A;  2WP6 A;  1NHS A;  2BYB A;  2BS3 A;  3AE9 A;  2GV8 A;  3KU9 A;  3AEG A;  3NH3 X;  2C7G A;  4OPD A;  4RG4 A;  5ER0 A;  4FX9 A;  4U2S A;  1NG4 A;  1O95 A;  2VRL A;  4EQW A;  3NG7 X;  1Z6L A;  1Y56 B;  2X8G A;  4J33 A;  2Q0L A;  4G73 A;  2WP9 A;  2IID A;  1ZX9 A;  2XFO A;  3CTY A;  4U8L A;  1BZL A;  2X99 A;  2WP5 A;  4AT2 A;  4Z2U A;  1H82 A;  3QSE A;  2C65 A;  4H4X A;  3H8L A;  1N4U A;  3R9U A;  2WEU A;  1GXF A;  3CGD A;  1GTE A;  2H88 A;  1CC4 A;  4YSZ A;  4B66 A;  2VRM A;  2I0Z A;  2Q0K A;  1PBB A;  1KSU A;  2C3C A;  3B3R A;  1DOE A;  4U8M A;  3QVP A;  2YR6 A;  3GDP A;  2E5V A;  2E4G A;  2C72 A;  4RG3 A;  3EF6 A;  2WU2 A;  4APN A;  2JB1 A;  3F8R A;  3II4 A;  4OPI A;  1XDI A;  1KF6 A;  3BI4 A;  4H4W A;  1E1K A;  5GRT A;  1KSS A;  3T2K A;  1PDH A;  2GR2 A;  4YKF A;  3UTE A;  4H4Y A;  3NK2 X;  2CUL A;  1E6E A;  3M0O A;  4H4S A;  5KRQ A;  2C66 A;  1YQ3 A;  4D04 A;  3S5W A;  4C3X A;  4B65 A;  2WDV A;  3K30 A;  1BGN A;  3RNM A;  1VQW A;  1H81 A;  4AOS A;  5KVI A;  4B1B A;  3HZL A;  2NPX A;  4YTP A;  1BWC A;  1DOB A;  1JEH A;  3LB8 A;  3IHM A;  1K0L A;  3H4K A;  3DJE A;  4ICY A;  1GES A;  3AE1 A;  3DGH A;  3HYW A;  3NK0 X;  1P2E A;  3P9U A;  2C70 A;  3CPH G;  1FL2 A;  1LQU A;  2V6O A;  3D1C A;  4GCM A;  2C4C A;  4REK A;  3UTH A;  2VZ2 A;  1HYU A;  2CVJ A;  2YLS A;  4B68 A;  4YKG A;  3AEC A;  4GF7 A;  2A87 A;  1ZK7 A;  2QA2 A;  1E7P A;  2YG4 A;  4EM4 A;  2ACZ A;  4U2L A;  3L1R A;  3SZF A;  5HY5 A;  1VDC A;  4G6H A;  4LA1 A;  4C3Y A;  1CJ2 A;  3QSM A;  3VRA A;  3DK9 A;  1FCD A;  5JCL A;  4USR A;  4ZCD A;  3UCL A;  5IQ4 A;  1IUU A;  4J56 A;  3FPZ A;  1EL5 A;  4NTE A;  2FJE A;  4G6G A;  5FS9 A;  3UOZ A;  4A9W A;  3AEF A;  1CBO A;  3GYJ A;  1M6I A;  3ZDN A;  1S2Q A;  4CRT A;  1TDF A;  2UZZ A;  3CNJ A;  5KOX A;  2AAQ A;  3DK8 A;  1DOC A;  4TLZ A;  4P9S A;  1D7L A;  4YSX A;  1REO A;  3NYC A;  4X9M A;  1NHR A;  3G5S A;  4H4Z A;  2BC1 A;  1RSG A;  4B67 A;  4BJY A;  2WU5 A;  5EBK A;  3UKQ A;  4OPU A;  4KX6 A;  3FG2 P;  1YKJ A;  1VG9 A;  3D8X A;  5KOW A;  3KPK A;  1M64 A;  4TM1 A;  1S3E A;  1K4Q A;  2GF3 A;  3LJP A;  3NNE A;  4CBQ A;  2YAU A;  1XHC A;  2B7S A;  2XLS A;  2B7R A;  4M52 A;  3UOX A;  3GRT A;  1JRY A;  2V5Z A;  2GQW A;  2V3A A;  2WPE A;  3AEE A;  1JNR A;  3NGC X;  2HQM A;  2X3N A;  2E1M A;  1FEC A;  4GDP A;  4GAP A;  2VQB A;  2BRY A;  4II2 A;  1CC2 A;  4EQS A;  2JBV A;  2BK4 A;  3I6D A;  2H89 A;  2WBA A;  1GT8 A;  4IVM B;  2R45 A;  2R4J A;  4D03 A;  1LQT A;  2GMH A;  2EQ8 A;  4UDQ A;  3AYI A;  3GYX A;  5L46 A;  1N1P A;  2XLU A;  4NEW A;  2BCG G;  2VOU A;  4BK1 A;  5CQF A;  1CJ4 A;  3T2Z A;  3QSS A;  1F8R A;  1PXA A;  2Y6Q A;  1ZMD A;  4J34 A;  3DH9 A;  4UP3 A;  2XFP A;  3CNT A;  3ATR A;  5IPY A;  2J3N A;  1W4X A;  1OJT A;  2XVJ A;  4FK1 C;  1GRH A;  2RGJ A;  4X9N A;  1ELI A;  1O5W A;  2GB0 A;  3ALL A;  5FS7 A;  4A79 A;  2YVJ A;  3UTF A;  2XFQ A;  3ITJ A;  4U8J A;  4KPR A;  1L9D A;  4MJW A;  2YWL A;  3DJG X;  4J57 A;  4NZH A;  3UP5 A;  1EL9 A;  2FBW A;  1DNC A;  3AE4 A;  3ZYX A;  1JRZ A;  4U8P A;  5EB4 A;  3BHK A;  3K7M X;  1XAN A;  3K7T A;  3VRB A;  1E1N A;  4J36 A;  1KNP A;  4U8K A;  2WDR A;  2GR0 A;  2C64 A;  2BK5 A;  4Z25 A;  4K5S A;  4H7U A;  4C77 A;  4G74 A;  1FOH A;  2WPF A;  1B37 A;  1YQ4 A;  2CFY A;  2PYX A;  3T37 A;  3RP7 A;  3AB1 A;  4WX1 A;  4II3 A;  1EL7 A;  1DJQ A;  2B9Y A;  2RGH A;  3AE3 A;  4J31 A;  3VR9 A;  2VVL A;  1F8S A;  4CCQ A;  4H2N A;  4XWZ A;  3UKA A;  1DOD A;  2ZZ0 A;  2XFN A;  1ZDL A;  1GV4 A;  3G5R A;  4H4R A;  1NPX A;  1NHP A;  2WHD A;  3DGZ A;  2R0C A;  2R46 A;  4X4J A;  4B63 A;  4CY6 A;  4Z2R A;  2CDU A;  3UKK A;  1GSN A;  1BKW A;  4JQ9 A;  4OPC A;  3HYV A;  5LV9 A;  2RGO A;  2XVF A;  3NHO X;  3NRN A;  2OAL A;  1MXT A;  2C73 A;  3BNM A;  3NN0 X;  5M10 A;  3AEB A;  1ZMC A;  4JNQ A;  1NEN A;  2GH5 A;  1L9E A;  3Q9T A;  2WES A;  1YY5 A;  1AOG A;  3C4N A;  4JNA A;  4NTC A;  3NYF A;  3E1T A;  3CND A;  4DSG A;  3L8K A;  2BK3 A;  2RAB A;  3FMW A;  1E39 A;  2VVM A;  1GRG A;  2R0P A;  4H2R A;  2A89 A;  3CIR A;  2GVC A;  3Q6J A;  1EL8 A;  1GTH A;  4EQR A;  5JCK A;  3P4S A;  4EIQ A;  1B8S A;  1JU2 A;  4YWO A;  1PJ7 A;  3O0H A;  2QAE A;  3URH A;  2GAH B;  1N4W A;  2ZBW A;  2YLX A;  1PBC A;  3CNP A;  3DJD A;  4EMJ A;  3JSK A;  1CC6 A;  4TM4 A;  1D4C A;  4Z26 A;  1CJ3 A;  1OJC A;  4A6N B;  3BHF A;  3H8I A;  3RED A;  2QCU A;  3GSI A;  4H4Q A;  3AYL A;  3UKH A;  3KKJ A;  3V76 A;  2X50 A;  5DBJ A;  4YXD A;  4U2T A;  1CJC A;  1ZKQ A;  2FJA A;  3NK1 X;  2YVF A;  3UOY A;  1FEA A;  5FMH A;  4CCR A;  3WE0 A;  1H7X A;  3OC4 A;  1PXB A;  2YLT A;  3VR8 A;  2GR1 A;  4G9K A;  4H2P A;  2B9X A;  4OCG A;  1GND A;  4FDC B;  3GD4 A;  1UKV G;  3DK4 A;  1F6M A;  2XVH A;  4K22 A;  4JY3 A;  5JCM A;  3KLJ A;  3GYI A;  2GQF A;  1DJN A;  2OLO A;  4GAV A;  2APG A;  3CGE A;  5EOW A;  3SXI A;  3CPI G;  3QVR A;  2VVL G;  1PBF A;  2EQ7 A;  2BA9 A;  2YR4 A;  1TYT A;  2WET A;  3CN8 A;  4DSH A;  1DXL A;  1JNZ A;  1GRB A;  2ZZC A;  4JN9 A;  3AE5 A;  4OPG A;  1GAL A;  2AQJ A;  4YSY A;  1QO8 A;  1MO9 A;  3EAO A;  4GR1 A;  3SZ0 A;  4A6N A;  3SZW A;  3AE2 A;  1N4V A;  4OPT A;  2FJD A;  2Q7V A;  3T0K A;  3RHA A;  3V3N A;  2GMJ A;  3BI2 A;  1TDE A;  4H4V A;  4GRT A;  2GRT A;  3NLC A;  5IQ1 A;  2OLN A;  1PBD A;  3I3L A;  3IF9 A;  4DNA A;  3COX A;  1TDO A;  2OA1 A;  3SGL A;  4J2W A;  4BK3 A;  2BXR A;  1D4D A;  3M12 A;  4K2X A;  4NNJ A;  2R0G A;  3BNU A;  1GOS A;  4K7Z A;  3QJ4 A;  3LZX A;  4YTN A;  1V59 A;  2X8C A;  4Z24 A;  3UTG A;  3ALM A;  1CHU A;  1GET A;  1H84 A;  1KDG A;  2YVG A;  3AEA A;  3G5Q A;  3IC9 A;  3M13 A;  2XFU A;  3LAD A;  4H50 A;  4NEV A;  4AT0 A;  2XDO A;  4LU6 A;  5KWF A;  2W0H A;  2TPR A;  5FS8 A;  5M0Z A;  4A5L A;  1L0V A;  2V3B A;  2WOV A;  3VQR A;  4CNJ A;  2Z5Y A;  4TM0 A;  3P4R A;  4Y4M A;  3B6D A;  2PHH A;  4JY2 A;  1LTX R;  4IA6 A;  1TRB A;  3AD9 B;  3DME A;  1K0J A;  4IA5 A;  2BRA A;  2X8H A;  1F3P A;  1JRX A;  4CNK A;  1IUT A;  1OJ9 A;  2XCG A;  1P2H A;  4AOX A;  5HXI A;  4UDP A;  3AE7 A;  1GRA A;  4C74 A;  1Q1R A;  2VQ7 A;  3EAN A;  2BAC A;  2WDQ A;  2BAB A;  5J7X A;  3UKP A;  4U8N A;  1KNR A;  1D5T A;  1PHH A;  1PBE A;  1IJH A;  1E1M A;  2EQ6 A;  5EB5 A;  2TMD A;  5KNL A;  3AE8 A;  3NT6 A;  3CNS A;  3P4P A;  4U8O A;  2BC0 A;  1GRE A;  1QLB A;  2YG3 A;  2YLR A;  1NEK A;  4H4P A;  4K5R A;  3P1W A;  1D7Y A;  2BCP A;  5CKU A;  4XXG A;  2YG6 A;  3SFE A;  2XLP A;  1SEZ A;  3SZC A;  2IVD A;  1VG0 A;  4H4U A;  1PJ5 A;  1RYI A;  3ABV A;  4O5Q A;  2JKC A;  4CY8 A;  1H83 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...