2IIDA

Structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
483
structure length
483
Chain Sequence
RNPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-amino-acid oxidase
publication title Crystal Structure of LAAO from Calloselasma rhodostoma with an L-Phenylalanine Substrate: Insights into Structure and Mechanism
pubmed doi rcsb
total genus 179
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2iidA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2iidA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 2iidA01
1BWCA 2TPRA 5CKUA 1NHQA 2YLSA 3CGEA 1NHSA 3BNUA 4Z44A 3CGDA 2I0ZA 4RG3A 4U8JA 2C65A 1YKJA 3P9UA 1VG9A 4YTNA 1Q1WA 1MOKA 1MO9A 3UCLA 4B63A 4UDPA 3VR8A 1OJ9A 3D8XA 3RP7A 2BXSA 5BVAA 1L9CA 4B67A 2BS4A 1B8SA 2R0PA 4TLXA 3H4KA 4BURA 4USQA 4GCMA 2EQ8A 4OPLA 2R4JA 2E4GA 2DKHA 1AOGA 2RGOA 2VRMA 4N9XA 2BXRA 4IVOB 3AB1A 1LV0A 3QFAA 2YVGA 2XDOA 2BACA 5FS8A 1OJCA 2ZZ0A 3DGHA 1IUSA 1CJ2A 2FJBA 2GMHA 2RGHA 2YLWA 4OVIA 3SM8A 3DK4A 3AYJA 5J7XA 4E0VA 1K0IA 2A89A 5HHFA 3AECA 2WU2A 1VRQB 2YAUA 4DSGA 2IVDA 1S2YA 3CIRA 4A5LA 4YSZA 3CPIG 2BK3A 1ZKQA 3G5RA 4UP3A 2BC1A 3LOVA 5HYMA 3AYLA 4Y4LA 4Z26A 1CC4A 1MXTA 4EQSA 2Y6RA 2GEWA 3DJDA 2WDVA 4LIIA 1O5WA 1FL2A 3K30A 1DNCA 3CPHG 2RABA 2O9ZA 1H6VA 1EL5A 2FJDA 2YR6A 1JNZA 3UKQA 3UOVA 1D4CA 1DOEA 2CDUA 1PBFA 2X8GA 3GDPA 1CBOA 3LXDA 5DBJA 2BK5A 4C3YA 4REKA 2H89A 5C2TA 3NK0X 2A8XA 4U8IA 4BK3A 3CNSA 2OLNA 3CGBA 4Z25A 3H8LA 1E1KA 1GESA 4H4XA 1DODA 5HY5A 5KRQA 2B76A 4BK1A 1CL0A 4OPDA 3SFDA 2CULA 4HB9A 5BULA 2YLZA 1FECA 4I58A 2QCUA 3IHGA 3NT6A 4FX9A 4K5RA 5IQ4A 4B64A 3GRSA 3CTYA 4H50A 1ONFA 1FEBA 2R0CA 3GMBA 2Z5YA 3PS9A 4H7UA 1GPEA 1O94A 2FJAA 2Q0KA 2XVIA 1IUUA 3L8KA 1LJ1A 1GALA 1PBCA 2B9YA 1PJ7A 1ZDLA 4J31A 4APNA 3S61A 1JEHA 2Y6QA 4JQ9A 1O95A 2JB3A 4D04A 1TDEA 1QJDA 3BNMA 3NNEA 2F5ZA 2GQFA 2WHDA 3CGCA 1BKWA 2YVFA 3CNPA 4ZCDA 3ICTA 4EQRA 2C72A 1EL8A 1ZOVA 2IIDA 4CNKA 2XLSA 1B37A 4JDRA 4K5SA 4EM4A 2B9WA 3ALJA 3C96A 3KPFA 3AE7A 1Q9IA 4YT0A 2WOIA 2BYBA 5BUKA 2BC0A 2WPFA 1LQUA 4CCQA 3LB8A 1F8SA 3IWAA 4H4WA 1H81A 1GT8A 4WCTA 1EL7A 2R0GA 2V3BA 1NHRA 2WOWA 4UDRA 3AE2A 4EIQA 4YWOA 2X50A 4IVMB 2EQ9A 1N4VA 3GD3A 4HA6A 2ARDA 4AT2A 3QVRA 3AWIA 3UTGA 2GRTA 1XHCA 1ZMDA 3RP6A 3I3LA 1PBDA 1JRXA 4BJZA 2VRLA 1IUXA 2UZZA 3GDNA 3VRAA 2YG3A 3IC9A 2WOVA 1TRBA 2GR0A 1Y56B 2VVMA 3AEGA 3AE4A 5BRTA 2ACZA 5J60A 1KNRA 3JSKA 1NEKA 4FDCB 2AR8A 3AEFA 3DK9A 1ELIA 1CHUA 1M6IA 5FMHA 2BCGG 1NHPA 1LQTA 4H4SA 4RSLA 1E1MA 1CJCA 4NEWA 5ER0A 4Z24A 4A9WA 1H7WA 2IVEA 4CY8A 4M52A 1ZOYA 1LTXR 3QFBA 1EBDA 2QA1A 1XDIA 2WESA 3FIMB 1DXLA 1GRGA 3M12A 2APGA 3ATQA 2B9XA 4H4YA 4LA1A 4ADWA 3QSSA 1D7LA 3COXA 3OC4A 4EMWA 4YTPA 4NTCA 2JAEA 4YKFA 4A79A 2CFYA 4B69A 4EM3A 3URHA 1TDFA 3D1CA 1IUWA 4CRTA 2GR2A 5KWFA 4J33A 2C70A 2XFUA 4C77A 1ZP0A 2TMDA 3REDA 1F3PA 4A6NA 1BGNA 4C5OA 2R9ZA 3DJJA 5U1OA 2OLOA 2DKIA 2VOUA 2WDRA 2GMJA 3GYJA 2NPXA 1PHHA 3IF9A 2X8CA 4DNAA 1EL9A 3ABVA 3ICRA 1HYUA 3UKKA 3KA7A 1PXBA 2WS3A 1E6EA 1NG4A 1H86A 3V3NA 4AP1A 2WQYA 4ICYA 1KSUA 3V76A 3K7MX 4Y4NA 2X99A 1H84A 2YLRA 1GRFA 3DJEA 3AE5A 1FCDA 3GWDA 3EF6A 3ALMA 3O0HA 4IV9A 1H7XA 2C75A 2XFNA 3AE8A 3GWFA 4H4VA 2GH5A 2E5VA 4A65A 4FK1A 4EQXA 5FS6A 1TDNA 2Z5XA 3FPZA 2ZZBA 4IA5A 1PBEA 4YTMA 3DH9A 5KVIA 2VZ2A 3P4SA 1BF3A 3ISHA 3AD7B 1OJAA 1KSSA 1ZK7A 2AQJA 2ZZCA 4B65A 2B7RA 3BI4A 3EPTA 1GTEA 4XWRA 1CF3A 1GV4A 3CNTA 3UKHA 4Z2TA 1CC2A 3PO7A 4H4QA 1OJDA 3P4QA 4NZHA 1QLBA 4K22A 2FBWA 1JOAA 3KU9A 1JU2A 4KX6A 3RP8A 3DK8A 3AYIA 3AE9A 4FK1C 3DGZA 1YQ4A 2XLUA 4H2PA 1JRZA 3PVCA 4Z43A 4GF7A 3NYCA 1GOSA 5KOWA 3ICSA 3QSEA 3II4A 1VG0A 1NDAA 3K7QX 4H4RA 4B1BA 4OPUA 4X9NA 3GYIA 3NHOX 2JK6A 4TM4A 1GETA 4U8MA 1JNRA 3P1WA 1M64A 4JN9A 1GNDA 4J36A 3BHFA 1OJTA 2GAGB 3CN8A 4H2QA 5CQFA 1DJNA 2GQWA 2V6OA 1LPFA 2WP9A 2BABA 3BI2A 3F8RA 5JCKA 1JRYA 4A7AA 2FJEA 2XVHA 2X3NA 1QO8A 4K2XA 2YG5A 4GUVA 3OZ2A 3NRNA 5L46A 3UTEA 3CPJG 4ECHA 5KOXA 4JNQA 4U2SA 1L0VA 2YLTA 5LV9A 2YG7A 4H4ZA 3AEAA 3AE3A 1V59A 3SQPA 1TYTA 3NG7X 1COYA 2XLRA 2XVEA 1KDGA 2V5ZA 3K7TA 5IPYA 3CNDA 3EANA 3LJPA 3M0OA 2JB1A 1PN0A 3BI5A 2XFPA 2A87A 3AEBA 4Z2RA 2GV8A 2YR5A 3V3OA 4DSHA 2WDQA 5EOWA 2GB0A 4D03A 5M0ZA 3GSIA 4AOXA 2YG4A 1D4EA 1FEAA 2QAEA 1NPXA 3UP5A 4U8OA 1F8RA 4JY2A 4YSXA 5M10A 2GR3A 2R45A 2AAQA 2H88A 2EQ6A 4NTDA 3AEDA 3ADAB 1PBBA 3SFEA 2V60A 4I59A 2WEUA 1UKVG 3P4RA 1IUVA 4BJYA 2VQ7A 1L9DA 3B3RA 2Q6UA 1XPQA 3DMEA 3NTAA 4O5QA 1YY5A 4P9SA 4TLZA 2OALA 2HQMA 4J57A 4H4TA 2V61A 3KD9A 5JCLA 4B68A 5FS7A 3IHMA 4U2LA 1W4XA 2B7SA 3NN6X 5C3JA 2E1MA 1GRBA 1F8WA 2XCGA 1VQWA 5HXIA 5EB4A 2YLXA 3FG2P 3UP4A 1F6MA 1DOBA 4YKGA 1GEUA 1PJ6A 4U8NA 1E7PA 2YVJA 2BS2A 2GAHB 1NAAA 3DJGX 3KLJA 3VQRA 1RYIA 1S2QA 3M13A 2XVJA 1D7YA 4YSHA 2YG6A 2Q0LA 3NKSA 4J56A 2XFOA 3QVPA 3FMWA 3UKPA 4WX1A 3ATRA 3Q9TA 4TM3A 3GMCA 2C67A 4H2RA 1PXAA 2C66A 1BGJA 1FOHA 1H83A 2Q7VA 2VVLG 1CC6A 4GDEA 2RGJA 3UKAA 2V3AA 4OPCA 2JKCA 4EMJA 1CJ4A 4CY6A 4PABA 2GVCA 1TDOA 2BS3A 1NENA 4OPGA 3UOZA 4CCRA 1YQ3A 1BZLA 3NYEA 2BCPA 4BK2A 3S5WA 4TM1A 4ZN0A 4A6NB 5EBKA 1TYPA 1D4DA 1KFYA 1GREA 2R4EA 2GF3A 1K0JA 1N4UA 5GRTA 3UKFA 1GXFA 3SGLA 1XANA 1Q1RA 1PS9A 2GR1A 1DOCA 3ZYXA 2W0HA 3GD4A 3WE0A 1RP0A 4PAAA 4B66A 3RNMA 1KNPA 4U8LA 1PXCA 1Z6LA 3RHAA 3LZXA 3QJ4A 2PHHA 1PJ5A 3UOYA 3NK1X 3E1TA 1GTHA 5TR3A 1ZMCA 1ZY8A 4CBQA 3AXBA 2WPCA 3NYFA 3NTDA 2EQ7A 4NTEA 2YR4A 3DA1A 4JY3A 2R46A 3UOXA 2WU5A 2VQBA 3BHKA 4Y4MA 2PYXA 2J3NA 3ALLA 4X9MA 2XLTA 4O5UA 1RSGA 5JCNA 2WP5A 3UKLA 3NGCX 4XWZA 3GRTA 2C3CA 3AD9B 1KF6A 3EAOA 3F8DA 1E39A 4XXGA 2XVFA 5U63A 1DJQA 4EIPA 2YM2A 4J2WA 4AOSA 4C74A 4EQWA 4U2TA 4H4UA 3FBSA 1K4QA 4C3XA 1GRHA 3L1RA 3CNJA 4U8KA 4A99A 3VR9A 4JNAA 1REOA 2YQUA 3AE1A 3AEEA 1LVLA 1L9EA 3NH3X 3Q6JA 4J34A 1X31B 1K0LA 1ZX9A 1H82A 4GR1A 4DGKA 1P2EA 4CNJA 1IUTA 2YWLA 4MJWA 5KXJA 4OCGA 2OAMA 1GSNA 2QA2A 1VDCA 5EB5A 3LZWA 2JBVA 1S3EA 1B4VA 2ZBWA 4K7ZA 5JCIA 4U8PA 1B5QA 4GDPA 4KPRA 4EMIA 1CJ3A 2NVKX 3HZLA 4GRTA 4YXDA 4X4JA 4H4PA 4TM0A 3NIXA 3VRDB 5KVHA 5JCMA 3C4AA 3AD8B 3KKJA 2X8HA 1P2HA 2C7GA 3T37A 3B6DA 2YM1A 2OA1A 5IQ1A 3QSMA 5FS9A 4H2NA 4IA6A 3KVEA 4YSYA 3H8IA 1GRAA 1PDHA 2C3DA 4LU6A 4USRA 2XFQA 1YQZA 2XYOA 1GRTA 4UDQA 1S3BA 3G5SA 1D5TA 2WP6A 1Y56A 3AE6A 2WETA 1GERA 3ZDNA 1SEZA 2C73A 3G5QA 2C64A 3LADA 5U25A 4AT0A 4OPIA 5GSNA 3NK2X 1N1PA 4NEVA 3P4PA 3VRBA 4AP3A 3F8PA 4ZCCA 1E1NA 2BA9A 3UTFA 4Z2UA 1NG3A 1IJHA 2CVJA 4OPTA 2BK4A 2VVLA 2XLPA 2JB2A 4BV6A 3C4NA 3ITJA 1E1LA 3I6DA 3UTHA 4RG4A 4K8DA 2WPEA 1TDKA 2WBAA 3NN0X 3R9UA 2C76A 1Y0PA 3NLCA 1N4WA
chains in the Genus database with same CATH superfamily
1BWCA 2TPRA 5CKUA 1NHQA 2YLSA 3CGEA 1NHSA 3BNUA 4Z44A 3CGDA 2I0ZA 4RG3A 4U8JA 2C65A 1YKJA 3P9UA 1VG9A 4YTNA 1Q1WA 1MOKA 1MO9A 3UCLA 4B63A 4UDPA 3VR8A 1OJ9A 3D8XA 3RP7A 2BXSA 5BVAA 1L9CA 4B67A 2BS4A 1B8SA 2R0PA 4TLXA 3H4KA 4BURA 4USQA 4GCMA 2EQ8A 4OPLA 2R4JA 2E4GA 2DKHA 1AOGA 2RGOA 2VRMA 4N9XA 2BXRA 4IVOB 3AB1A 1LV0A 3QFAA 2YVGA 2XDOA 2BACA 5FS8A 1OJCA 2ZZ0A 3DGHA 1IUSA 1CJ2A 2FJBA 2GMHA 2RGHA 2YLWA 4OVIA 3SM8A 3DK4A 3AYJA 5J7XA 4E0VA 1K0IA 2A89A 5HHFA 3AECA 2WU2A 1VRQB 2YAUA 4DSGA 2IVDA 1S2YA 3CIRA 4A5LA 4YSZA 3CPIG 2BK3A 1ZKQA 3G5RA 4UP3A 2BC1A 3LOVA 5HYMA 3AYLA 4Y4LA 4Z26A 1CC4A 1MXTA 4EQSA 2Y6RA 2GEWA 3DJDA 2WDVA 4LIIA 1O5WA 1FL2A 3K30A 1DNCA 3CPHG 2RABA 2O9ZA 1H6VA 1EL5A 2BRYA 2FJDA 2YR6A 1JNZA 3UKQA 3UOVA 1D4CA 1DOEA 1PBFA 2CDUA 2X8GA 3GDPA 1CBOA 3LXDA 5DBJA 2BK5A 4C3YA 4REKA 2H89A 5C2TA 3NK0X 2A8XA 4U8IA 4BK3A 3CNSA 2OLNA 3CGBA 4Z25A 3H8LA 1E1KA 1GESA 4H4XA 1DODA 5HY5A 5KRQA 2B76A 4BK1A 1CL0A 4OPDA 3SFDA 2CULA 4HB9A 5BULA 2YLZA 1FECA 4I58A 2QCUA 3IHGA 3NT6A 4FX9A 4K5RA 5IQ4A 4B64A 3GRSA 3CTYA 4H50A 1ONFA 1FEBA 2R0CA 3GMBA 2Z5YA 3PS9A 4H7UA 1GPEA 1O94A 2FJAA 2Q0KA 2XVIA 1IUUA 3L8KA 1LJ1A 1GALA 1PBCA 2B9YA 1PJ7A 1ZDLA 4J31A 4APNA 3S61A 1JEHA 2Y6QA 4JQ9A 1O95A 2JB3A 4D04A 1TDEA 1QJDA 3BNMA 3NNEA 2F5ZA 2GQFA 2WHDA 3CGCA 1BKWA 2YVFA 3CNPA 4ZCDA 3ICTA 4EQRA 2C72A 1EL8A 1ZOVA 2IIDA 4CNKA 2XLSA 1B37A 4JDRA 4K5SA 4EM4A 2B9WA 3ALJA 3C96A 3KPFA 3AE7A 1Q9IA 4YT0A 2WOIA 2BYBA 5BUKA 2BC0A 2WPFA 1LQUA 4CCQA 3LB8A 1F8SA 3IWAA 4H4WA 1H81A 1GT8A 4WCTA 3T2KA 1EL7A 2R0GA 2V3BA 1NHRA 2WOWA 4UDRA 3AE2A 4EIQA 4YWOA 2X50A 4IVMB 2EQ9A 1N4VA 3GD3A 4HA6A 2ARDA 4AT2A 3QVRA 3AWIA 3UTGA 2GRTA 1XHCA 1ZMDA 3RP6A 3I3LA 1PBDA 1JRXA 4BJZA 2VRLA 1IUXA 2UZZA 3GDNA 3VRAA 2YG3A 3IC9A 2WOVA 1TRBA 2GR0A 1Y56B 2VVMA 3AEGA 3T2ZA 3AE4A 5BRTA 2ACZA 5J60A 1KNRA 3JSKA 1NEKA 4FDCB 2AR8A 3AEFA 3DK9A 1ELIA 1CHUA 1M6IA 5FMHA 2BCGG 1NHPA 1LQTA 4H4SA 4RSLA 1E1MA 1CJCA 4NEWA 5ER0A 4Z24A 4A9WA 1H7WA 2IVEA 4CY8A 4M52A 1ZOYA 1LTXR 3QFBA 1EBDA 2QA1A 1XDIA 2WESA 3FIMB 1DXLA 1GRGA 3M12A 2APGA 3ATQA 2B9XA 4H4YA 4LA1A 4ADWA 3QSSA 1D7LA 3COXA 3OC4A 4EMWA 4YTPA 4NTCA 2JAEA 4YKFA 4A79A 2CFYA 4B69A 4EM3A 3URHA 1TDFA 3D1CA 1IUWA 4CRTA 2GR2A 3T0KA 5KWFA 4J33A 2C70A 2XFUA 4C77A 1ZP0A 2TMDA 3REDA 1F3PA 3SXIA 1BGNA 4A6NA 4C5OA 2R9ZA 3DJJA 5U1OA 2OLOA 2DKIA 2VOUA 2WDRA 2GMJA 3GYJA 2NPXA 1PHHA 3IF9A 2X8CA 4DNAA 1EL9A 3ABVA 3SY4A 3ICRA 1HYUA 3UKKA 3KA7A 1PXBA 2WS3A 1E6EA 1NG4A 1H86A 3V3NA 4AP1A 2WQYA 4ICYA 1KSUA 3V76A 3K7MX 4Y4NA 3SX6A 2X99A 1H84A 2YLRA 1GRFA 3DJEA 3AE5A 1FCDA 3GWDA 3EF6A 3ALMA 3O0HA 4IV9A 1H7XA 2C75A 2XFNA 3AE8A 3GWFA 4H4VA 2GH5A 2E5VA 4A65A 4FK1A 4EQXA 5FS6A 1TDNA 2Z5XA 3FPZA 2ZZBA 4IA5A 1PBEA 4YTMA 3DH9A 5KVIA 2VZ2A 3P4SA 1BF3A 3ISHA 3AD7B 1OJAA 1KSSA 1ZK7A 2AQJA 2ZZCA 4B65A 2B7RA 3BI4A 3EPTA 1GTEA 4XWRA 1CF3A 1GV4A 3CNTA 3UKHA 4Z2TA 1CC2A 5KMSA 3PO7A 4H4QA 1OJDA 3P4QA 4NZHA 1QLBA 4K22A 2FBWA 1JOAA 3KU9A 1JU2A 4KX6A 3RP8A 3DK8A 3AYIA 3AE9A 4FK1C 3DGZA 1YQ4A 2XLUA 4G73A 1JRZA 3PVCA 4H2PA 4GF7A 4Z43A 3NYCA 1GOSA 5KOWA 3ICSA 3QSEA 3II4A 1VG0A 1NDAA 3K7QX 4H4RA 4B1BA 4OPUA 4X9NA 3GYIA 3NHOX 2JK6A 4TM4A 1GETA 4U8MA 1JNRA 3P1WA 1M64A 4JN9A 1GNDA 4J36A 3BHFA 1OJTA 4G6HA 5KMRA 2GAGB 3CN8A 4H2QA 5CQFA 1DJNA 2GQWA 2V6OA 1LPFA 2WP9A 2BABA 3BI2A 3F8RA 5JCKA 1JRYA 4A7AA 2FJEA 2XVHA 2X3NA 1QO8A 4K2XA 2YG5A 4GUVA 3OZ2A 3NRNA 5L46A 3UTEA 3CPJG 4ECHA 5KOXA 4JNQA 4U2SA 1L0VA 2YLTA 5LV9A 2YG7A 4H4ZA 3AEAA 3AE3A 1V59A 3SQPA 1TYTA 3NG7X 1COYA 2XLRA 2XVEA 1KDGA 2V5ZA 3K7TA 5IPYA 3CNDA 3SZFA 3EANA 3LJPA 3M0OA 2JB1A 1PN0A 3BI5A 2XFPA 2A87A 3AEBA 4Z2RA 2GV8A 2YR5A 3V3OA 4DSHA 2WDQA 5EOWA 4NWZA 2GB0A 4D03A 5M0ZA 3GSIA 4AOXA 2YG4A 1D4EA 1FEAA 2QAEA 1NPXA 3UP5A 4U8OA 1F8RA 4JY2A 4YSXA 5M10A 2GR3A 2R45A 2AAQA 2H88A 2EQ6A 4NTDA 3AEDA 3ADAB 1PBBA 3SFEA 2V60A 4I59A 2WEUA 1UKVG 3P4RA 1IUVA 4BJYA 2VQ7A 1L9DA 3B3RA 2Q6UA 1XPQA 3DMEA 3NTAA 4O5QA 1YY5A 4P9SA 4TLZA 2OALA 2HQMA 4J57A 4H4TA 2V61A 3KD9A 5JCLA 4B68A 5FS7A 3IHMA 4U2LA 1W4XA 2B7SA 3NN6X 5C3JA 2E1MA 1GRBA 1F8WA 2XCGA 1VQWA 5HXIA 5EB4A 2YLXA 3FG2P 3UP4A 1F6MA 1DOBA 4YKGA 1GEUA 1PJ6A 4U8NA 1E7PA 2YVJA 2BS2A 2GAHB 1NAAA 3DJGX 3KLJA 3VQRA 1RYIA 1S2QA 3M13A 2XVJA 1D7YA 4YSHA 2YG6A 2Q0LA 3NKSA 4J56A 2XFOA 3QVPA 3FMWA 3GYXA 4G74A 3UKPA 4WX1A 3ATRA 3Q9TA 4II2A 3GMCA 4TM3A 5KNLA 2C67A 4H2RA 1PXAA 2C66A 1BGJA 1FOHA 1H83A 2Q7VA 2VVLG 1CC6A 4GDEA 2RGJA 3UKAA 2V3AA 4OPCA 2JKCA 4EMJA 1CJ4A 4CY6A 4PABA 2GVCA 1TDOA 2BS3A 1NENA 4OPGA 3UOZA 4CCRA 1YQ3A 1BZLA 3NYEA 2BCPA 4BK2A 3S5WA 4G6GA 4TM1A 4ZN0A 4A6NB 5EBKA 1TYPA 1D4DA 1KFYA 1GREA 2R4EA 2GF3A 1K0JA 1N4UA 5GRTA 3UKFA 1GXFA 3SGLA 1XANA 1Q1RA 1PS9A 2GR1A 1DOCA 3ZYXA 2BRAA 3WE0A 2W0HA 1RP0A 3GD4A 4PAAA 3RNMA 4B66A 1KNPA 4U8LA 1PXCA 1Z6LA 4NNJA 3RHAA 3KPKA 3LZXA 3QJ4A 2PHHA 1PJ5A 3UOYA 3NK1X 3E1TA 1GTHA 3HYVA 5TR3A 1ZMCA 1ZY8A 4CBQA 3AXBA 2WPCA 3NYFA 3NTDA 2EQ7A 4NTEA 2YR4A 3DA1A 4JY3A 2R46A 3UOXA 2WU5A 2VQBA 3BHKA 4Y4MA 2PYXA 2J3NA 3ALLA 4X9MA 3SZCA 2XLTA 4O5UA 1RSGA 5JCNA 2WP5A 3UKLA 3NGCX 5KMPA 4XWZA 3GRTA 2C3CA 3AD9B 1KF6A 3EAOA 3F8DA 1E39A 4XXGA 2XVFA 5U63A 1DJQA 4EIPA 2YM2A 4J2WA 4AOSA 4C74A 4EQWA 4U2TA 4H4UA 3FBSA 4GAPA 1K4QA 4C3XA 1GRHA 3L1RA 3CNJA 4II3A 4U8KA 3T14A 4A99A 3CMMA 3VR9A 4JNAA 1REOA 2YQUA 3AE1A 3AEEA 1LVLA 1L9EA 3NH3X 3Q6JA 4J34A 1X31B 1K0LA 1ZX9A 1H82A 4GR1A 4DGKA 1P2EA 4CNJA 1IUTA 2YWLA 4MJWA 5KXJA 4OCGA 2OAMA 1GSNA 2QA2A 1VDCA 5EB5A 3LZWA 2JBVA 1S3EA 1B4VA 2ZBWA 4K7ZA 5JCIA 4U8PA 1B5QA 4GDPA 4KPRA 3SYIA 4EMIA 1CJ3A 2NVKX 3HZLA 4GRTA 4YXDA 4X4JA 4H4PA 4TM0A 3NIXA 3VRDB 5KVHA 5JCMA 3C4AA 3AD8B 3KKJA 3HYWA 2X8HA 1P2HA 2C7GA 3T37A 3B6DA 2YM1A 2OA1A 5IQ1A 3QSMA 5FS9A 3T2YA 4H2NA 4IA6A 3KVEA 4YSYA 3H8IA 1GRAA 1PDHA 2C3DA 4LU6A 4USRA 2XFQA 1YQZA 2XYOA 1GRTA 4UDQA 1S3BA 3G5SA 1D5TA 2WP6A 1Y56A 3AE6A 2WETA 1GERA 3ZDNA 1SEZA 5KMQA 4GAVA 2C73A 3G5QA 2C64A 3LADA 5U25A 4AT0A 4OPIA 5GSNA 3NK2X 1N1PA 4G9KA 3SZ0A 4NEVA 3P4PA 3VRBA 4AP3A 3F8PA 4ZCCA 2C4CA 1E1NA 2BA9A 3UTFA 4Z2UA 1NG3A 1IJHA 2CVJA 4OPTA 2BK4A 2VVLA 2XLPA 2JB2A 4BV6A 3SZWA 3C4NA 3ITJA 1E1LA 3I6DA 3UTHA 4RG4A 3HYXA 2WPEA 1TDKA 4K8DA 2WBAA 3NN0X 3R9UA 2C76A 1Y0PA 3NLCA 3T31A 1N4WA
chains in the Genus database with same CATH topology
1BWCA 2TPRA 5CKUA 1NHQA 2YLSA 3CGEA 1NHSA 3BNUA 4Z44A 3CGDA 2I0ZA 4RG3A 4U8JA 2C65A 1YKJA 3P9UA 1VG9A 4YTNA 1Q1WA 1MOKA 1MO9A 3UCLA 4B63A 4UDPA 3VR8A 1OJ9A 3D8XA 3RP7A 2BXSA 5BVAA 1L9CA 4B67A 2BS4A 1B8SA 2R0PA 4TLXA 3H4KA 4BURA 4USQA 4GCMA 2EQ8A 4OPLA 2R4JA 2E4GA 2DKHA 1AOGA 2RGOA 2VRMA 4N9XA 2BXRA 4IVOB 3AB1A 1LV0A 3QFAA 2YVGA 2XDOA 2BACA 5FS8A 1OJCA 2ZZ0A 3DGHA 1IUSA 1CJ2A 2FJBA 2GMHA 2RGHA 2YLWA 4OVIA 3SM8A 3DK4A 3AYJA 5J7XA 4E0VA 1K0IA 2A89A 5HHFA 3AECA 2WU2A 1VRQB 2YAUA 4DSGA 2IVDA 1S2YA 3CIRA 4A5LA 4YSZA 3CPIG 2BK3A 1ZKQA 3G5RA 4UP3A 2BC1A 3LOVA 5HYMA 3AYLA 4Y4LA 4Z26A 1CC4A 1MXTA 4EQSA 2Y6RA 2GEWA 3DJDA 2WDVA 4LIIA 1O5WA 1FL2A 3K30A 1DNCA 3CPHG 2RABA 2O9ZA 1H6VA 1EL5A 2BRYA 2FJDA 2YR6A 1JNZA 3UKQA 3UOVA 1D4CA 1DOEA 2CDUA 1PBFA 2X8GA 3GDPA 1CBOA 3LXDA 5DBJA 2BK5A 4C3YA 4REKA 2H89A 5C2TA 3NK0X 2A8XA 4U8IA 4BK3A 3CNSA 2OLNA 3CGBA 4Z25A 3H8LA 1E1KA 1GESA 4H4XA 1DODA 5HY5A 5KRQA 2B76A 4BK1A 1CL0A 4OPDA 3SFDA 2CULA 4HB9A 5BULA 2YLZA 1FECA 4I58A 2QCUA 3IHGA 3NT6A 4FX9A 4K5RA 5IQ4A 4B64A 3GRSA 3CTYA 4H50A 1ONFA 1FEBA 2R0CA 3GMBA 2Z5YA 3PS9A 4H7UA 1GPEA 1O94A 2FJAA 2Q0KA 2XVIA 1IUUA 3L8KA 1LJ1A 1GALA 1PBCA 2B9YA 1PJ7A 1ZDLA 4J31A 4APNA 3S61A 1JEHA 2Y6QA 4JQ9A 1O95A 2JB3A 4D04A 1TDEA 1QJDA 3BNMA 3NNEA 2F5ZA 2GQFA 2WHDA 3CGCA 1BKWA 2YVFA 3CNPA 4ZCDA 3ICTA 4EQRA 2C72A 1EL8A 1ZOVA 2IIDA 4CNKA 2XLSA 1B37A 4JDRA 4K5SA 4EM4A 2B9WA 3ALJA 3C96A 3KPFA 3AE7A 1Q9IA 4YT0A 2WOIA 2BYBA 5BUKA 2BC0A 2WPFA 1LQUA 4CCQA 3LB8A 1F8SA 3IWAA 4H4WA 1H81A 1GT8A 4WCTA 3T2KA 1EL7A 2R0GA 2V3BA 1NHRA 2WOWA 4UDRA 3AE2A 4EIQA 4YWOA 2X50A 4IVMB 2EQ9A 1N4VA 3GD3A 4HA6A 2ARDA 4AT2A 3QVRA 3AWIA 3UTGA 2GRTA 1XHCA 1ZMDA 3RP6A 3I3LA 1PBDA 1JRXA 4BJZA 2VRLA 1IUXA 2UZZA 3GDNA 3VRAA 2YG3A 3IC9A 2WOVA 1TRBA 2GR0A 1Y56B 2VVMA 3AEGA 3T2ZA 3AE4A 5BRTA 2ACZA 5J60A 1KNRA 3JSKA 1NEKA 4FDCB 2AR8A 3AEFA 3DK9A 1ELIA 1CHUA 1M6IA 5FMHA 2BCGG 1NHPA 1LQTA 4H4SA 4RSLA 1E1MA 1CJCA 4NEWA 5ER0A 4Z24A 4A9WA 1H7WA 2IVEA 4CY8A 4M52A 1ZOYA 1LTXR 3QFBA 1EBDA 2QA1A 1XDIA 2WESA 3FIMB 1DXLA 1GRGA 3M12A 2APGA 3ATQA 2B9XA 4H4YA 4LA1A 4ADWA 3QSSA 1D7LA 3COXA 3OC4A 4EMWA 4YTPA 4NTCA 2JAEA 4YKFA 4A79A 2CFYA 4B69A 4EM3A 3URHA 1TDFA 3D1CA 1IUWA 4CRTA 2GR2A 3T0KA 5KWFA 4J33A 2C70A 2XFUA 4C77A 1ZP0A 2TMDA 3REDA 1F3PA 3SXIA 1BGNA 4A6NA 4C5OA 2R9ZA 3DJJA 5U1OA 2OLOA 2DKIA 2VOUA 2WDRA 2GMJA 3GYJA 2NPXA 1PHHA 3IF9A 2X8CA 4DNAA 1EL9A 3ABVA 3SY4A 3ICRA 1HYUA 3UKKA 3KA7A 1PXBA 2WS3A 1E6EA 1NG4A 1H86A 3V3NA 4AP1A 2WQYA 4ICYA 1KSUA 3V76A 3K7MX 4Y4NA 3SX6A 2X99A 1H84A 2YLRA 1GRFA 3DJEA 3AE5A 1FCDA 3GWDA 3EF6A 3ALMA 3O0HA 4IV9A 1H7XA 2C75A 2XFNA 3AE8A 3GWFA 4H4VA 2GH5A 2E5VA 4A65A 4FK1A 4EQXA 5FS6A 1TDNA 2Z5XA 3FPZA 2ZZBA 4IA5A 1PBEA 4YTMA 3DH9A 5KVIA 2VZ2A 3P4SA 1BF3A 3ISHA 3AD7B 1OJAA 1KSSA 1ZK7A 2AQJA 2ZZCA 4B65A 2B7RA 3BI4A 3EPTA 1GTEA 4XWRA 1CF3A 1GV4A 3CNTA 3UKHA 4Z2TA 1CC2A 5KMSA 3PO7A 4H4QA 1OJDA 3P4QA 4NZHA 1QLBA 4K22A 2FBWA 1JOAA 3KU9A 1JU2A 4KX6A 3RP8A 3DK8A 3AYIA 3AE9A 4FK1C 3DGZA 1YQ4A 2XLUA 4G73A 1JRZA 3PVCA 4H2PA 4GF7A 4Z43A 3NYCA 1GOSA 5KOWA 3ICSA 3QSEA 3II4A 1VG0A 1NDAA 3K7QX 4H4RA 4B1BA 4OPUA 4X9NA 3GYIA 3NHOX 2JK6A 4TM4A 1GETA 4U8MA 1JNRA 3P1WA 1M64A 4JN9A 1GNDA 4J36A 3BHFA 1OJTA 4G6HA 5KMRA 2GAGB 3CN8A 4H2QA 5CQFA 1DJNA 2GQWA 2V6OA 1LPFA 2WP9A 2BABA 3BI2A 3F8RA 5JCKA 1JRYA 4A7AA 2FJEA 2XVHA 2X3NA 1QO8A 4K2XA 2YG5A 4GUVA 3OZ2A 3NRNA 5L46A 3UTEA 3CPJG 4ECHA 5KOXA 4JNQA 4U2SA 1L0VA 2YLTA 5LV9A 2YG7A 4H4ZA 3AEAA 3AE3A 1V59A 3SQPA 1TYTA 3NG7X 1COYA 2XLRA 2XVEA 1KDGA 2V5ZA 3K7TA 5IPYA 3CNDA 3SZFA 3EANA 3LJPA 3M0OA 2JB1A 1PN0A 3BI5A 2XFPA 2A87A 3AEBA 4Z2RA 2GV8A 2YR5A 3V3OA 4DSHA 2WDQA 5EOWA 4NWZA 2GB0A 4D03A 5M0ZA 3GSIA 4AOXA 2YG4A 1D4EA 1FEAA 2QAEA 1NPXA 3UP5A 4U8OA 1F8RA 4JY2A 4YSXA 5M10A 2GR3A 2R45A 2AAQA 2H88A 2EQ6A 4NTDA 3AEDA 3ADAB 1PBBA 3SFEA 2V60A 4I59A 2WEUA 1UKVG 3P4RA 1IUVA 4BJYA 2VQ7A 1L9DA 3B3RA 2Q6UA 1XPQA 3DMEA 3NTAA 4O5QA 1YY5A 4P9SA 4TLZA 2OALA 2HQMA 4J57A 4H4TA 2V61A 3KD9A 5JCLA 4B68A 5FS7A 3IHMA 4U2LA 1W4XA 2B7SA 3NN6X 5C3JA 2E1MA 1GRBA 1F8WA 2XCGA 1VQWA 5HXIA 5EB4A 2YLXA 3FG2P 3UP4A 1F6MA 1DOBA 4YKGA 1GEUA 1PJ6A 4U8NA 1E7PA 2YVJA 2BS2A 2GAHB 1NAAA 3DJGX 3KLJA 3VQRA 1RYIA 1S2QA 3M13A 2XVJA 1D7YA 4YSHA 2YG6A 2Q0LA 3NKSA 4J56A 2XFOA 3QVPA 3FMWA 3GYXA 4G74A 3UKPA 4WX1A 3ATRA 3Q9TA 4II2A 3GMCA 4TM3A 5KNLA 2C67A 4H2RA 1PXAA 2C66A 1BGJA 1FOHA 1H83A 2Q7VA 2VVLG 1CC6A 4GDEA 2RGJA 3UKAA 2V3AA 4OPCA 2JKCA 4EMJA 1CJ4A 4CY6A 4PABA 2GVCA 1TDOA 2BS3A 1NENA 4OPGA 3UOZA 4CCRA 1YQ3A 1BZLA 3NYEA 2BCPA 4BK2A 3S5WA 4G6GA 4TM1A 4ZN0A 4A6NB 5EBKA 1TYPA 1D4DA 1KFYA 1GREA 2R4EA 2GF3A 1K0JA 1N4UA 5GRTA 3UKFA 1GXFA 3SGLA 1XANA 1Q1RA 1PS9A 2GR1A 1DOCA 3ZYXA 2BRAA 2W0HA 3GD4A 1RP0A 4PAAA 3WE0A 3RNMA 4B66A 1KNPA 4U8LA 1PXCA 1Z6LA 4NNJA 3RHAA 3KPKA 3LZXA 3QJ4A 2PHHA 1PJ5A 3UOYA 3NK1X 3E1TA 1GTHA 3HYVA 5TR3A 1ZMCA 1ZY8A 4CBQA 3AXBA 2WPCA 3NYFA 3NTDA 2EQ7A 4NTEA 2YR4A 3DA1A 4JY3A 2R46A 3UOXA 2WU5A 2VQBA 3BHKA 4Y4MA 2PYXA 2J3NA 3ALLA 4X9MA 3SZCA 2XLTA 4O5UA 1RSGA 5JCNA 2WP5A 3UKLA 3NGCX 5KMPA 4XWZA 3GRTA 2C3CA 3AD9B 1KF6A 3EAOA 3F8DA 1E39A 4XXGA 2XVFA 5U63A 1DJQA 4EIPA 2YM2A 4J2WA 4AOSA 4C74A 4EQWA 4U2TA 4H4UA 3FBSA 4GAPA 1K4QA 4C3XA 1GRHA 3L1RA 3CNJA 4II3A 4U8KA 3T14A 4A99A 3CMMA 3VR9A 4JNAA 1REOA 2YQUA 3AE1A 3AEEA 1LVLA 1L9EA 3NH3X 3Q6JA 4J34A 1X31B 1K0LA 1ZX9A 1H82A 4GR1A 4DGKA 1P2EA 4CNJA 1IUTA 2YWLA 4MJWA 5KXJA 4OCGA 2OAMA 1GSNA 2QA2A 1VDCA 5EB5A 3LZWA 2JBVA 1S3EA 1B4VA 2ZBWA 4K7ZA 5JCIA 4U8PA 1B5QA 4GDPA 4KPRA 3SYIA 4EMIA 1CJ3A 2NVKX 3HZLA 4GRTA 4YXDA 4X4JA 4H4PA 4TM0A 3NIXA 3VRDB 5KVHA 5JCMA 3C4AA 3AD8B 3KKJA 3HYWA 2X8HA 1P2HA 2C7GA 3T37A 3B6DA 2YM1A 2OA1A 5IQ1A 3QSMA 5FS9A 3T2YA 4H2NA 4IA6A 3KVEA 4YSYA 3H8IA 1GRAA 1PDHA 2C3DA 4LU6A 4USRA 2XFQA 1YQZA 2XYOA 1GRTA 4UDQA 1S3BA 3G5SA 1D5TA 2WP6A 1Y56A 3AE6A 2WETA 1GERA 3ZDNA 1SEZA 5KMQA 4GAVA 2C73A 3G5QA 2C64A 3LADA 5U25A 4AT0A 4OPIA 5GSNA 3NK2X 1N1PA 4G9KA 3SZ0A 4NEVA 3P4PA 3VRBA 4AP3A 3F8PA 4ZCCA 2C4CA 1E1NA 2BA9A 3UTFA 4Z2UA 1NG3A 1IJHA 2CVJA 4OPTA 2BK4A 2VVLA 2XLPA 2JB2A 4BV6A 3SZWA 3C4NA 3ITJA 1E1LA 3I6DA 3UTHA 4RG4A 3HYXA 2WPEA 1TDKA 4K8DA 2WBAA 3NN0X 3R9UA 2C76A 1Y0PA 3NLCA 3T31A 1N4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BWC A;  2TPR A;  5CKU A;  1NHQ A;  2YLS A;  3CGE A;  1NHS A;  3BNU A;  4Z44 A;  3CGD A;  2I0Z A;  4RG3 A;  4U8J A;  2C65 A;  1YKJ A;  3P9U A;  1VG9 A;  4YTN A;  1Q1W A;  1MOK A;  1MO9 A;  3UCL A;  4B63 A;  4UDP A;  3VR8 A;  1OJ9 A;  3D8X A;  3RP7 A;  2BXS A;  5BVA A;  1L9C A;  4B67 A;  2BS4 A;  1B8S A;  2R0P A;  4TLX A;  3H4K A;  4BUR A;  4USQ A;  4GCM A;  2EQ8 A;  4OPL A;  2R4J A;  2E4G A;  2DKH A;  1AOG A;  2RGO A;  2VRM A;  4N9X A;  2BXR A;  4IVO B;  3AB1 A;  1LV0 A;  3QFA A;  2YVG A;  2XDO A;  2BAC A;  5FS8 A;  1OJC A;  2ZZ0 A;  3DGH A;  1IUS A;  1CJ2 A;  2FJB A;  2GMH A;  2RGH A;  2YLW A;  4OVI A;  3SM8 A;  3DK4 A;  3AYJ A;  5J7X A;  4E0V A;  1K0I A;  2A89 A;  5HHF A;  3AEC A;  2WU2 A;  1VRQ B;  2YAU A;  4DSG A;  2IVD A;  1S2Y A;  3CIR A;  4A5L A;  4YSZ A;  3CPI G;  2BK3 A;  1ZKQ A;  3G5R A;  4UP3 A;  2BC1 A;  3LOV A;  5HYM A;  3AYL A;  4Y4L A;  4Z26 A;  1CC4 A;  1MXT A;  4EQS A;  2Y6R A;  2GEW A;  3DJD A;  2WDV A;  4LII A;  1O5W A;  1FL2 A;  3K30 A;  1DNC A;  3CPH G;  2RAB A;  2O9Z A;  1H6V A;  1EL5 A;  2FJD A;  2YR6 A;  1JNZ A;  3UKQ A;  3UOV A;  1D4C A;  1DOE A;  2CDU A;  1PBF A;  2X8G A;  3GDP A;  1CBO A;  3LXD A;  5DBJ A;  2BK5 A;  4C3Y A;  4REK A;  2H89 A;  5C2T A;  3NK0 X;  2A8X A;  4U8I A;  4BK3 A;  3CNS A;  2OLN A;  3CGB A;  4Z25 A;  3H8L A;  1E1K A;  1GES A;  4H4X A;  1DOD A;  5HY5 A;  5KRQ A;  2B76 A;  4BK1 A;  1CL0 A;  4OPD A;  3SFD A;  2CUL A;  4HB9 A;  5BUL A;  2YLZ A;  1FEC A;  4I58 A;  2QCU A;  3IHG A;  3NT6 A;  4FX9 A;  4K5R A;  5IQ4 A;  4B64 A;  3GRS A;  3CTY A;  4H50 A;  1ONF A;  1FEB A;  2R0C A;  3GMB A;  2Z5Y A;  3PS9 A;  4H7U A;  1GPE A;  1O94 A;  2FJA A;  2Q0K A;  2XVI A;  1IUU A;  3L8K A;  1LJ1 A;  1GAL A;  1PBC A;  2B9Y A;  1PJ7 A;  1ZDL A;  4J31 A;  4APN A;  3S61 A;  1JEH A;  2Y6Q A;  4JQ9 A;  1O95 A;  2JB3 A;  4D04 A;  1TDE A;  1QJD A;  3BNM A;  3NNE A;  2F5Z A;  2GQF A;  2WHD A;  3CGC A;  1BKW A;  2YVF A;  3CNP A;  4ZCD A;  3ICT A;  4EQR A;  2C72 A;  1EL8 A;  1ZOV A;  2IID A;  4CNK A;  2XLS A;  1B37 A;  4JDR A;  4K5S A;  4EM4 A;  2B9W A;  3ALJ A;  3C96 A;  3KPF A;  3AE7 A;  1Q9I A;  4YT0 A;  2WOI A;  2BYB A;  5BUK A;  2BC0 A;  2WPF A;  1LQU A;  4CCQ A;  3LB8 A;  1F8S A;  3IWA A;  4H4W A;  1H81 A;  1GT8 A;  4WCT A;  1EL7 A;  2R0G A;  2V3B A;  1NHR A;  2WOW A;  4UDR A;  3AE2 A;  4EIQ A;  4YWO A;  2X50 A;  4IVM B;  2EQ9 A;  1N4V A;  3GD3 A;  4HA6 A;  2ARD A;  4AT2 A;  3QVR A;  3AWI A;  3UTG A;  2GRT A;  1XHC A;  1ZMD A;  3RP6 A;  3I3L A;  1PBD A;  1JRX A;  4BJZ A;  2VRL A;  1IUX A;  2UZZ A;  3GDN A;  3VRA A;  2YG3 A;  3IC9 A;  2WOV A;  1TRB A;  2GR0 A;  1Y56 B;  2VVM A;  3AEG A;  3AE4 A;  5BRT A;  2ACZ A;  5J60 A;  1KNR A;  3JSK A;  1NEK A;  4FDC B;  2AR8 A;  3AEF A;  3DK9 A;  1ELI A;  1CHU A;  1M6I A;  5FMH A;  2BCG G;  1NHP A;  1LQT A;  4H4S A;  4RSL A;  1E1M A;  1CJC A;  4NEW A;  5ER0 A;  4Z24 A;  4A9W A;  1H7W A;  2IVE A;  4CY8 A;  4M52 A;  1ZOY A;  1LTX R;  3QFB A;  1EBD A;  2QA1 A;  1XDI A;  2WES A;  3FIM B;  1DXL A;  1GRG A;  3M12 A;  2APG A;  3ATQ A;  2B9X A;  4H4Y A;  4LA1 A;  4ADW A;  3QSS A;  1D7L A;  3COX A;  3OC4 A;  4EMW A;  4YTP A;  4NTC A;  2JAE A;  4YKF A;  4A79 A;  2CFY A;  4B69 A;  4EM3 A;  3URH A;  1TDF A;  3D1C A;  1IUW A;  4CRT A;  2GR2 A;  5KWF A;  4J33 A;  2C70 A;  2XFU A;  4C77 A;  1ZP0 A;  2TMD A;  3RED A;  1F3P A;  4A6N A;  1BGN A;  4C5O A;  2R9Z A;  3DJJ A;  5U1O A;  2OLO A;  2DKI A;  2VOU A;  2WDR A;  2GMJ A;  3GYJ A;  2NPX A;  1PHH A;  3IF9 A;  2X8C A;  4DNA A;  1EL9 A;  3ABV A;  3ICR A;  1HYU A;  3UKK A;  3KA7 A;  1PXB A;  2WS3 A;  1E6E A;  1NG4 A;  1H86 A;  3V3N A;  4AP1 A;  2WQY A;  4ICY A;  1KSU A;  3V76 A;  3K7M X;  4Y4N A;  2X99 A;  1H84 A;  2YLR A;  1GRF A;  3DJE A;  3AE5 A;  1FCD A;  3GWD A;  3EF6 A;  3ALM A;  3O0H A;  4IV9 A;  1H7X A;  2C75 A;  2XFN A;  3AE8 A;  3GWF A;  4H4V A;  2GH5 A;  2E5V A;  4A65 A;  4FK1 A;  4EQX A;  5FS6 A;  1TDN A;  2Z5X A;  3FPZ A;  2ZZB A;  4IA5 A;  1PBE A;  4YTM A;  3DH9 A;  5KVI A;  2VZ2 A;  3P4S A;  1BF3 A;  3ISH A;  3AD7 B;  1OJA A;  1KSS A;  1ZK7 A;  2AQJ A;  2ZZC A;  4B65 A;  2B7R A;  3BI4 A;  3EPT A;  1GTE A;  4XWR A;  1CF3 A;  1GV4 A;  3CNT A;  3UKH A;  4Z2T A;  1CC2 A;  3PO7 A;  4H4Q A;  1OJD A;  3P4Q A;  4NZH A;  1QLB A;  4K22 A;  2FBW A;  1JOA A;  3KU9 A;  1JU2 A;  4KX6 A;  3RP8 A;  3DK8 A;  3AYI A;  3AE9 A;  4FK1 C;  3DGZ A;  1YQ4 A;  2XLU A;  4H2P A;  1JRZ A;  3PVC A;  4Z43 A;  4GF7 A;  3NYC A;  1GOS A;  5KOW A;  3ICS A;  3QSE A;  3II4 A;  1VG0 A;  1NDA A;  3K7Q X;  4H4R A;  4B1B A;  4OPU A;  4X9N A;  3GYI A;  3NHO X;  2JK6 A;  4TM4 A;  1GET A;  4U8M A;  1JNR A;  3P1W A;  1M64 A;  4JN9 A;  1GND A;  4J36 A;  3BHF A;  1OJT A;  2GAG B;  3CN8 A;  4H2Q A;  5CQF A;  1DJN A;  2GQW A;  2V6O A;  1LPF A;  2WP9 A;  2BAB A;  3BI2 A;  3F8R A;  5JCK A;  1JRY A;  4A7A A;  2FJE A;  2XVH A;  2X3N A;  1QO8 A;  4K2X A;  2YG5 A;  4GUV A;  3OZ2 A;  3NRN A;  5L46 A;  3UTE A;  3CPJ G;  4ECH A;  5KOX A;  4JNQ A;  4U2S A;  1L0V A;  2YLT A;  5LV9 A;  2YG7 A;  4H4Z A;  3AEA A;  3AE3 A;  1V59 A;  3SQP A;  1TYT A;  3NG7 X;  1COY A;  2XLR A;  2XVE A;  1KDG A;  2V5Z A;  3K7T A;  5IPY A;  3CND A;  3EAN A;  3LJP A;  3M0O A;  2JB1 A;  1PN0 A;  3BI5 A;  2XFP A;  2A87 A;  3AEB A;  4Z2R A;  2GV8 A;  2YR5 A;  3V3O A;  4DSH A;  2WDQ A;  5EOW A;  2GB0 A;  4D03 A;  5M0Z A;  3GSI A;  4AOX A;  2YG4 A;  1D4E A;  1FEA A;  2QAE A;  1NPX A;  3UP5 A;  4U8O A;  1F8R A;  4JY2 A;  4YSX A;  5M10 A;  2GR3 A;  2R45 A;  2AAQ A;  2H88 A;  2EQ6 A;  4NTD A;  3AED A;  3ADA B;  1PBB A;  3SFE A;  2V60 A;  4I59 A;  2WEU A;  1UKV G;  3P4R A;  1IUV A;  4BJY A;  2VQ7 A;  1L9D A;  3B3R A;  2Q6U A;  1XPQ A;  3DME A;  3NTA A;  4O5Q A;  1YY5 A;  4P9S A;  4TLZ A;  2OAL A;  2HQM A;  4J57 A;  4H4T A;  2V61 A;  3KD9 A;  5JCL A;  4B68 A;  5FS7 A;  3IHM A;  4U2L A;  1W4X A;  2B7S A;  3NN6 X;  5C3J A;  2E1M A;  1GRB A;  1F8W A;  2XCG A;  1VQW A;  5HXI A;  5EB4 A;  2YLX A;  3FG2 P;  3UP4 A;  1F6M A;  1DOB A;  4YKG A;  1GEU A;  1PJ6 A;  4U8N A;  1E7P A;  2YVJ A;  2BS2 A;  2GAH B;  1NAA A;  3DJG X;  3KLJ A;  3VQR A;  1RYI A;  1S2Q A;  3M13 A;  2XVJ A;  1D7Y A;  4YSH A;  2YG6 A;  2Q0L A;  3NKS A;  4J56 A;  2XFO A;  3QVP A;  3FMW A;  3UKP A;  4WX1 A;  3ATR A;  3Q9T A;  4TM3 A;  3GMC A;  2C67 A;  4H2R A;  1PXA A;  2C66 A;  1BGJ A;  1FOH A;  1H83 A;  2Q7V A;  2VVL G;  1CC6 A;  4GDE A;  2RGJ A;  3UKA A;  2V3A A;  4OPC A;  2JKC A;  4EMJ A;  1CJ4 A;  4CY6 A;  4PAB A;  2GVC A;  1TDO A;  2BS3 A;  1NEN A;  4OPG A;  3UOZ A;  4CCR A;  1YQ3 A;  1BZL A;  3NYE A;  2BCP A;  4BK2 A;  3S5W A;  4TM1 A;  4ZN0 A;  4A6N B;  5EBK A;  1TYP A;  1D4D A;  1KFY A;  1GRE A;  2R4E A;  2GF3 A;  1K0J A;  1N4U A;  5GRT A;  3UKF A;  1GXF A;  3SGL A;  1XAN A;  1Q1R A;  1PS9 A;  2GR1 A;  1DOC A;  3ZYX A;  2W0H A;  3GD4 A;  3WE0 A;  1RP0 A;  4PAA A;  4B66 A;  3RNM A;  1KNP A;  4U8L A;  1PXC A;  1Z6L A;  3RHA A;  3LZX A;  3QJ4 A;  2PHH A;  1PJ5 A;  3UOY A;  3NK1 X;  3E1T A;  1GTH A;  5TR3 A;  1ZMC A;  1ZY8 A;  4CBQ A;  3AXB A;  2WPC A;  3NYF A;  3NTD A;  2EQ7 A;  4NTE A;  2YR4 A;  3DA1 A;  4JY3 A;  2R46 A;  3UOX A;  2WU5 A;  2VQB A;  3BHK A;  4Y4M A;  2PYX A;  2J3N A;  3ALL A;  4X9M A;  2XLT A;  4O5U A;  1RSG A;  5JCN A;  2WP5 A;  3UKL A;  3NGC X;  4XWZ A;  3GRT A;  2C3C A;  3AD9 B;  1KF6 A;  3EAO A;  3F8D A;  1E39 A;  4XXG A;  2XVF A;  5U63 A;  1DJQ A;  4EIP A;  2YM2 A;  4J2W A;  4AOS A;  4C74 A;  4EQW A;  4U2T A;  4H4U A;  3FBS A;  1K4Q A;  4C3X A;  1GRH A;  3L1R A;  3CNJ A;  4U8K A;  4A99 A;  3VR9 A;  4JNA A;  1REO A;  2YQU A;  3AE1 A;  3AEE A;  1LVL A;  1L9E A;  3NH3 X;  3Q6J A;  4J34 A;  1X31 B;  1K0L A;  1ZX9 A;  1H82 A;  4GR1 A;  4DGK A;  1P2E A;  4CNJ A;  1IUT A;  2YWL A;  4MJW A;  5KXJ A;  4OCG A;  2OAM A;  1GSN A;  2QA2 A;  1VDC A;  5EB5 A;  3LZW A;  2JBV A;  1S3E A;  1B4V A;  2ZBW A;  4K7Z A;  5JCI A;  4U8P A;  1B5Q A;  4GDP A;  4KPR A;  4EMI A;  1CJ3 A;  2NVK X;  3HZL A;  4GRT A;  4YXD A;  4X4J A;  4H4P A;  4TM0 A;  3NIX A;  3VRD B;  5KVH A;  5JCM A;  3C4A A;  3AD8 B;  3KKJ A;  2X8H A;  1P2H A;  2C7G A;  3T37 A;  3B6D A;  2YM1 A;  2OA1 A;  5IQ1 A;  3QSM A;  5FS9 A;  4H2N A;  4IA6 A;  3KVE A;  4YSY A;  3H8I A;  1GRA A;  1PDH A;  2C3D A;  4LU6 A;  4USR A;  2XFQ A;  1YQZ A;  2XYO A;  1GRT A;  4UDQ A;  1S3B A;  3G5S A;  1D5T A;  2WP6 A;  1Y56 A;  3AE6 A;  2WET A;  1GER A;  3ZDN A;  1SEZ A;  2C73 A;  3G5Q A;  2C64 A;  3LAD A;  5U25 A;  4AT0 A;  4OPI A;  5GSN A;  3NK2 X;  1N1P A;  4NEV A;  3P4P A;  3VRB A;  4AP3 A;  3F8P A;  4ZCC A;  1E1N A;  2BA9 A;  3UTF A;  4Z2U A;  1NG3 A;  1IJH A;  2CVJ A;  4OPT A;  2BK4 A;  2VVL A;  2XLP A;  2JB2 A;  4BV6 A;  3C4N A;  3ITJ A;  1E1L A;  3I6D A;  3UTH A;  4RG4 A;  4K8D A;  2WPE A;  1TDK A;  2WBA A;  3NN0 X;  3R9U A;  2C76 A;  1Y0P A;  3NLC A;  1N4W A; 
#chains in the Genus database with same CATH topology
 1BWC A;  2TPR A;  5CKU A;  1NHQ A;  2YLS A;  3CGE A;  1NHS A;  3BNU A;  4Z44 A;  3CGD A;  2I0Z A;  4RG3 A;  4U8J A;  2C65 A;  1YKJ A;  3P9U A;  1VG9 A;  4YTN A;  1Q1W A;  1MOK A;  1MO9 A;  3UCL A;  4B63 A;  4UDP A;  3VR8 A;  1OJ9 A;  3D8X A;  3RP7 A;  2BXS A;  5BVA A;  1L9C A;  4B67 A;  2BS4 A;  1B8S A;  2R0P A;  4TLX A;  3H4K A;  4BUR A;  4USQ A;  4GCM A;  2EQ8 A;  4OPL A;  2R4J A;  2E4G A;  2DKH A;  1AOG A;  2RGO A;  2VRM A;  4N9X A;  2BXR A;  4IVO B;  3AB1 A;  1LV0 A;  3QFA A;  2YVG A;  2XDO A;  2BAC A;  5FS8 A;  1OJC A;  2ZZ0 A;  3DGH A;  1IUS A;  1CJ2 A;  2FJB A;  2GMH A;  2RGH A;  2YLW A;  4OVI A;  3SM8 A;  3DK4 A;  3AYJ A;  5J7X A;  4E0V A;  1K0I A;  2A89 A;  5HHF A;  3AEC A;  2WU2 A;  1VRQ B;  2YAU A;  4DSG A;  2IVD A;  1S2Y A;  3CIR A;  4A5L A;  4YSZ A;  3CPI G;  2BK3 A;  1ZKQ A;  3G5R A;  4UP3 A;  2BC1 A;  3LOV A;  5HYM A;  3AYL A;  4Y4L A;  4Z26 A;  1CC4 A;  1MXT A;  4EQS A;  2Y6R A;  2GEW A;  3DJD A;  2WDV A;  4LII A;  1O5W A;  1FL2 A;  3K30 A;  1DNC A;  3CPH G;  2RAB A;  2O9Z A;  1H6V A;  1EL5 A;  2BRY A;  2FJD A;  2YR6 A;  1JNZ A;  3UKQ A;  3UOV A;  1D4C A;  1DOE A;  1PBF A;  2CDU A;  2X8G A;  3GDP A;  1CBO A;  3LXD A;  5DBJ A;  2BK5 A;  4C3Y A;  4REK A;  2H89 A;  5C2T A;  3NK0 X;  2A8X A;  4U8I A;  4BK3 A;  3CNS A;  2OLN A;  3CGB A;  4Z25 A;  3H8L A;  1E1K A;  1GES A;  4H4X A;  1DOD A;  5HY5 A;  5KRQ A;  2B76 A;  4BK1 A;  1CL0 A;  4OPD A;  3SFD A;  2CUL A;  4HB9 A;  5BUL A;  2YLZ A;  1FEC A;  4I58 A;  2QCU A;  3IHG A;  3NT6 A;  4FX9 A;  4K5R A;  5IQ4 A;  4B64 A;  3GRS A;  3CTY A;  4H50 A;  1ONF A;  1FEB A;  2R0C A;  3GMB A;  2Z5Y A;  3PS9 A;  4H7U A;  1GPE A;  1O94 A;  2FJA A;  2Q0K A;  2XVI A;  1IUU A;  3L8K A;  1LJ1 A;  1GAL A;  1PBC A;  2B9Y A;  1PJ7 A;  1ZDL A;  4J31 A;  4APN A;  3S61 A;  1JEH A;  2Y6Q A;  4JQ9 A;  1O95 A;  2JB3 A;  4D04 A;  1TDE A;  1QJD A;  3BNM A;  3NNE A;  2F5Z A;  2GQF A;  2WHD A;  3CGC A;  1BKW A;  2YVF A;  3CNP A;  4ZCD A;  3ICT A;  4EQR A;  2C72 A;  1EL8 A;  1ZOV A;  2IID A;  4CNK A;  2XLS A;  1B37 A;  4JDR A;  4K5S A;  4EM4 A;  2B9W A;  3ALJ A;  3C96 A;  3KPF A;  3AE7 A;  1Q9I A;  4YT0 A;  2WOI A;  2BYB A;  5BUK A;  2BC0 A;  2WPF A;  1LQU A;  4CCQ A;  3LB8 A;  1F8S A;  3IWA A;  4H4W A;  1H81 A;  1GT8 A;  4WCT A;  3T2K A;  1EL7 A;  2R0G A;  2V3B A;  1NHR A;  2WOW A;  4UDR A;  3AE2 A;  4EIQ A;  4YWO A;  2X50 A;  4IVM B;  2EQ9 A;  1N4V A;  3GD3 A;  4HA6 A;  2ARD A;  4AT2 A;  3QVR A;  3AWI A;  3UTG A;  2GRT A;  1XHC A;  1ZMD A;  3RP6 A;  3I3L A;  1PBD A;  1JRX A;  4BJZ A;  2VRL A;  1IUX A;  2UZZ A;  3GDN A;  3VRA A;  2YG3 A;  3IC9 A;  2WOV A;  1TRB A;  2GR0 A;  1Y56 B;  2VVM A;  3AEG A;  3T2Z A;  3AE4 A;  5BRT A;  2ACZ A;  5J60 A;  1KNR A;  3JSK A;  1NEK A;  4FDC B;  2AR8 A;  3AEF A;  3DK9 A;  1ELI A;  1CHU A;  1M6I A;  5FMH A;  2BCG G;  1NHP A;  1LQT A;  4H4S A;  4RSL A;  1E1M A;  1CJC A;  4NEW A;  5ER0 A;  4Z24 A;  4A9W A;  1H7W A;  2IVE A;  4CY8 A;  4M52 A;  1ZOY A;  1LTX R;  3QFB A;  1EBD A;  2QA1 A;  1XDI A;  2WES A;  3FIM B;  1DXL A;  1GRG A;  3M12 A;  2APG A;  3ATQ A;  2B9X A;  4H4Y A;  4LA1 A;  4ADW A;  3QSS A;  1D7L A;  3COX A;  3OC4 A;  4EMW A;  4YTP A;  4NTC A;  2JAE A;  4YKF A;  4A79 A;  2CFY A;  4B69 A;  4EM3 A;  3URH A;  1TDF A;  3D1C A;  1IUW A;  4CRT A;  2GR2 A;  3T0K A;  5KWF A;  4J33 A;  2C70 A;  2XFU A;  4C77 A;  1ZP0 A;  2TMD A;  3RED A;  1F3P A;  3SXI A;  1BGN A;  4A6N A;  4C5O A;  2R9Z A;  3DJJ A;  5U1O A;  2OLO A;  2DKI A;  2VOU A;  2WDR A;  2GMJ A;  3GYJ A;  2NPX A;  1PHH A;  3IF9 A;  2X8C A;  4DNA A;  1EL9 A;  3ABV A;  3SY4 A;  3ICR A;  1HYU A;  3UKK A;  3KA7 A;  1PXB A;  2WS3 A;  1E6E A;  1NG4 A;  1H86 A;  3V3N A;  4AP1 A;  2WQY A;  4ICY A;  1KSU A;  3V76 A;  3K7M X;  4Y4N A;  3SX6 A;  2X99 A;  1H84 A;  2YLR A;  1GRF A;  3DJE A;  3AE5 A;  1FCD A;  3GWD A;  3EF6 A;  3ALM A;  3O0H A;  4IV9 A;  1H7X A;  2C75 A;  2XFN A;  3AE8 A;  3GWF A;  4H4V A;  2GH5 A;  2E5V A;  4A65 A;  4FK1 A;  4EQX A;  5FS6 A;  1TDN A;  2Z5X A;  3FPZ A;  2ZZB A;  4IA5 A;  1PBE A;  4YTM A;  3DH9 A;  5KVI A;  2VZ2 A;  3P4S A;  1BF3 A;  3ISH A;  3AD7 B;  1OJA A;  1KSS A;  1ZK7 A;  2AQJ A;  2ZZC A;  4B65 A;  2B7R A;  3BI4 A;  3EPT A;  1GTE A;  4XWR A;  1CF3 A;  1GV4 A;  3CNT A;  3UKH A;  4Z2T A;  1CC2 A;  5KMS A;  3PO7 A;  4H4Q A;  1OJD A;  3P4Q A;  4NZH A;  1QLB A;  4K22 A;  2FBW A;  1JOA A;  3KU9 A;  1JU2 A;  4KX6 A;  3RP8 A;  3DK8 A;  3AYI A;  3AE9 A;  4FK1 C;  3DGZ A;  1YQ4 A;  2XLU A;  4G73 A;  1JRZ A;  3PVC A;  4H2P A;  4GF7 A;  4Z43 A;  3NYC A;  1GOS A;  5KOW A;  3ICS A;  3QSE A;  3II4 A;  1VG0 A;  1NDA A;  3K7Q X;  4H4R A;  4B1B A;  4OPU A;  4X9N A;  3GYI A;  3NHO X;  2JK6 A;  4TM4 A;  1GET A;  4U8M A;  1JNR A;  3P1W A;  1M64 A;  4JN9 A;  1GND A;  4J36 A;  3BHF A;  1OJT A;  4G6H A;  5KMR A;  2GAG B;  3CN8 A;  4H2Q A;  5CQF A;  1DJN A;  2GQW A;  2V6O A;  1LPF A;  2WP9 A;  2BAB A;  3BI2 A;  3F8R A;  5JCK A;  1JRY A;  4A7A A;  2FJE A;  2XVH A;  2X3N A;  1QO8 A;  4K2X A;  2YG5 A;  4GUV A;  3OZ2 A;  3NRN A;  5L46 A;  3UTE A;  3CPJ G;  4ECH A;  5KOX A;  4JNQ A;  4U2S A;  1L0V A;  2YLT A;  5LV9 A;  2YG7 A;  4H4Z A;  3AEA A;  3AE3 A;  1V59 A;  3SQP A;  1TYT A;  3NG7 X;  1COY A;  2XLR A;  2XVE A;  1KDG A;  2V5Z A;  3K7T A;  5IPY A;  3CND A;  3SZF A;  3EAN A;  3LJP A;  3M0O A;  2JB1 A;  1PN0 A;  3BI5 A;  2XFP A;  2A87 A;  3AEB A;  4Z2R A;  2GV8 A;  2YR5 A;  3V3O A;  4DSH A;  2WDQ A;  5EOW A;  4NWZ A;  2GB0 A;  4D03 A;  5M0Z A;  3GSI A;  4AOX A;  2YG4 A;  1D4E A;  1FEA A;  2QAE A;  1NPX A;  3UP5 A;  4U8O A;  1F8R A;  4JY2 A;  4YSX A;  5M10 A;  2GR3 A;  2R45 A;  2AAQ A;  2H88 A;  2EQ6 A;  4NTD A;  3AED A;  3ADA B;  1PBB A;  3SFE A;  2V60 A;  4I59 A;  2WEU A;  1UKV G;  3P4R A;  1IUV A;  4BJY A;  2VQ7 A;  1L9D A;  3B3R A;  2Q6U A;  1XPQ A;  3DME A;  3NTA A;  4O5Q A;  1YY5 A;  4P9S A;  4TLZ A;  2OAL A;  2HQM A;  4J57 A;  4H4T A;  2V61 A;  3KD9 A;  5JCL A;  4B68 A;  5FS7 A;  3IHM A;  4U2L A;  1W4X A;  2B7S A;  3NN6 X;  5C3J A;  2E1M A;  1GRB A;  1F8W A;  2XCG A;  1VQW A;  5HXI A;  5EB4 A;  2YLX A;  3FG2 P;  3UP4 A;  1F6M A;  1DOB A;  4YKG A;  1GEU A;  1PJ6 A;  4U8N A;  1E7P A;  2YVJ A;  2BS2 A;  2GAH B;  1NAA A;  3DJG X;  3KLJ A;  3VQR A;  1RYI A;  1S2Q A;  3M13 A;  2XVJ A;  1D7Y A;  4YSH A;  2YG6 A;  2Q0L A;  3NKS A;  4J56 A;  2XFO A;  3QVP A;  3FMW A;  3GYX A;  4G74 A;  3UKP A;  4WX1 A;  3ATR A;  3Q9T A;  4II2 A;  3GMC A;  4TM3 A;  5KNL A;  2C67 A;  4H2R A;  1PXA A;  2C66 A;  1BGJ A;  1FOH A;  1H83 A;  2Q7V A;  2VVL G;  1CC6 A;  4GDE A;  2RGJ A;  3UKA A;  2V3A A;  4OPC A;  2JKC A;  4EMJ A;  1CJ4 A;  4CY6 A;  4PAB A;  2GVC A;  1TDO A;  2BS3 A;  1NEN A;  4OPG A;  3UOZ A;  4CCR A;  1YQ3 A;  1BZL A;  3NYE A;  2BCP A;  4BK2 A;  3S5W A;  4G6G A;  4TM1 A;  4ZN0 A;  4A6N B;  5EBK A;  1TYP A;  1D4D A;  1KFY A;  1GRE A;  2R4E A;  2GF3 A;  1K0J A;  1N4U A;  5GRT A;  3UKF A;  1GXF A;  3SGL A;  1XAN A;  1Q1R A;  1PS9 A;  2GR1 A;  1DOC A;  3ZYX A;  2BRA A;  3WE0 A;  2W0H A;  1RP0 A;  3GD4 A;  4PAA A;  3RNM A;  4B66 A;  1KNP A;  4U8L A;  1PXC A;  1Z6L A;  4NNJ A;  3RHA A;  3KPK A;  3LZX A;  3QJ4 A;  2PHH A;  1PJ5 A;  3UOY A;  3NK1 X;  3E1T A;  1GTH A;  3HYV A;  5TR3 A;  1ZMC A;  1ZY8 A;  4CBQ A;  3AXB A;  2WPC A;  3NYF A;  3NTD A;  2EQ7 A;  4NTE A;  2YR4 A;  3DA1 A;  4JY3 A;  2R46 A;  3UOX A;  2WU5 A;  2VQB A;  3BHK A;  4Y4M A;  2PYX A;  2J3N A;  3ALL A;  4X9M A;  3SZC A;  2XLT A;  4O5U A;  1RSG A;  5JCN A;  2WP5 A;  3UKL A;  3NGC X;  5KMP A;  4XWZ A;  3GRT A;  2C3C A;  3AD9 B;  1KF6 A;  3EAO A;  3F8D A;  1E39 A;  4XXG A;  2XVF A;  5U63 A;  1DJQ A;  4EIP A;  2YM2 A;  4J2W A;  4AOS A;  4C74 A;  4EQW A;  4U2T A;  4H4U A;  3FBS A;  4GAP A;  1K4Q A;  4C3X A;  1GRH A;  3L1R A;  3CNJ A;  4II3 A;  4U8K A;  3T14 A;  4A99 A;  3CMM A;  3VR9 A;  4JNA A;  1REO A;  2YQU A;  3AE1 A;  3AEE A;  1LVL A;  1L9E A;  3NH3 X;  3Q6J A;  4J34 A;  1X31 B;  1K0L A;  1ZX9 A;  1H82 A;  4GR1 A;  4DGK A;  1P2E A;  4CNJ A;  1IUT A;  2YWL A;  4MJW A;  5KXJ A;  4OCG A;  2OAM A;  1GSN A;  2QA2 A;  1VDC A;  5EB5 A;  3LZW A;  2JBV A;  1S3E A;  1B4V A;  2ZBW A;  4K7Z A;  5JCI A;  4U8P A;  1B5Q A;  4GDP A;  4KPR A;  3SYI A;  4EMI A;  1CJ3 A;  2NVK X;  3HZL A;  4GRT A;  4YXD A;  4X4J A;  4H4P A;  4TM0 A;  3NIX A;  3VRD B;  5KVH A;  5JCM A;  3C4A A;  3AD8 B;  3KKJ A;  3HYW A;  2X8H A;  1P2H A;  2C7G A;  3T37 A;  3B6D A;  2YM1 A;  2OA1 A;  5IQ1 A;  3QSM A;  5FS9 A;  3T2Y A;  4H2N A;  4IA6 A;  3KVE A;  4YSY A;  3H8I A;  1GRA A;  1PDH A;  2C3D A;  4LU6 A;  4USR A;  2XFQ A;  1YQZ A;  2XYO A;  1GRT A;  4UDQ A;  1S3B A;  3G5S A;  1D5T A;  2WP6 A;  1Y56 A;  3AE6 A;  2WET A;  1GER A;  3ZDN A;  1SEZ A;  5KMQ A;  4GAV A;  2C73 A;  3G5Q A;  2C64 A;  3LAD A;  5U25 A;  4AT0 A;  4OPI A;  5GSN A;  3NK2 X;  1N1P A;  4G9K A;  3SZ0 A;  4NEV A;  3P4P A;  3VRB A;  4AP3 A;  3F8P A;  4ZCC A;  2C4C A;  1E1N A;  2BA9 A;  3UTF A;  4Z2U A;  1NG3 A;  1IJH A;  2CVJ A;  4OPT A;  2BK4 A;  2VVL A;  2XLP A;  2JB2 A;  4BV6 A;  3SZW A;  3C4N A;  3ITJ A;  1E1L A;  3I6D A;  3UTH A;  4RG4 A;  3HYX A;  2WPE A;  1TDK A;  4K8D A;  2WBA A;  3NN0 X;  3R9U A;  2C76 A;  1Y0P A;  3NLC A;  3T31 A;  1N4W A; 
#chains in the Genus database with same CATH homology
 1BWC A;  2TPR A;  5CKU A;  1NHQ A;  2YLS A;  3CGE A;  1NHS A;  3BNU A;  4Z44 A;  3CGD A;  2I0Z A;  4RG3 A;  4U8J A;  2C65 A;  1YKJ A;  3P9U A;  1VG9 A;  4YTN A;  1Q1W A;  1MOK A;  1MO9 A;  3UCL A;  4B63 A;  4UDP A;  3VR8 A;  1OJ9 A;  3D8X A;  3RP7 A;  2BXS A;  5BVA A;  1L9C A;  4B67 A;  2BS4 A;  1B8S A;  2R0P A;  4TLX A;  3H4K A;  4BUR A;  4USQ A;  4GCM A;  2EQ8 A;  4OPL A;  2R4J A;  2E4G A;  2DKH A;  1AOG A;  2RGO A;  2VRM A;  4N9X A;  2BXR A;  4IVO B;  3AB1 A;  1LV0 A;  3QFA A;  2YVG A;  2XDO A;  2BAC A;  5FS8 A;  1OJC A;  2ZZ0 A;  3DGH A;  1IUS A;  1CJ2 A;  2FJB A;  2GMH A;  2RGH A;  2YLW A;  4OVI A;  3SM8 A;  3DK4 A;  3AYJ A;  5J7X A;  4E0V A;  1K0I A;  2A89 A;  5HHF A;  3AEC A;  2WU2 A;  1VRQ B;  2YAU A;  4DSG A;  2IVD A;  1S2Y A;  3CIR A;  4A5L A;  4YSZ A;  3CPI G;  2BK3 A;  1ZKQ A;  3G5R A;  4UP3 A;  2BC1 A;  3LOV A;  5HYM A;  3AYL A;  4Y4L A;  4Z26 A;  1CC4 A;  1MXT A;  4EQS A;  2Y6R A;  2GEW A;  3DJD A;  2WDV A;  4LII A;  1O5W A;  1FL2 A;  3K30 A;  1DNC A;  3CPH G;  2RAB A;  2O9Z A;  1H6V A;  1EL5 A;  2BRY A;  2FJD A;  2YR6 A;  1JNZ A;  3UKQ A;  3UOV A;  1D4C A;  1DOE A;  2CDU A;  1PBF A;  2X8G A;  3GDP A;  1CBO A;  3LXD A;  5DBJ A;  2BK5 A;  4C3Y A;  4REK A;  2H89 A;  5C2T A;  3NK0 X;  2A8X A;  4U8I A;  4BK3 A;  3CNS A;  2OLN A;  3CGB A;  4Z25 A;  3H8L A;  1E1K A;  1GES A;  4H4X A;  1DOD A;  5HY5 A;  5KRQ A;  2B76 A;  4BK1 A;  1CL0 A;  4OPD A;  3SFD A;  2CUL A;  4HB9 A;  5BUL A;  2YLZ A;  1FEC A;  4I58 A;  2QCU A;  3IHG A;  3NT6 A;  4FX9 A;  4K5R A;  5IQ4 A;  4B64 A;  3GRS A;  3CTY A;  4H50 A;  1ONF A;  1FEB A;  2R0C A;  3GMB A;  2Z5Y A;  3PS9 A;  4H7U A;  1GPE A;  1O94 A;  2FJA A;  2Q0K A;  2XVI A;  1IUU A;  3L8K A;  1LJ1 A;  1GAL A;  1PBC A;  2B9Y A;  1PJ7 A;  1ZDL A;  4J31 A;  4APN A;  3S61 A;  1JEH A;  2Y6Q A;  4JQ9 A;  1O95 A;  2JB3 A;  4D04 A;  1TDE A;  1QJD A;  3BNM A;  3NNE A;  2F5Z A;  2GQF A;  2WHD A;  3CGC A;  1BKW A;  2YVF A;  3CNP A;  4ZCD A;  3ICT A;  4EQR A;  2C72 A;  1EL8 A;  1ZOV A;  2IID A;  4CNK A;  2XLS A;  1B37 A;  4JDR A;  4K5S A;  4EM4 A;  2B9W A;  3ALJ A;  3C96 A;  3KPF A;  3AE7 A;  1Q9I A;  4YT0 A;  2WOI A;  2BYB A;  5BUK A;  2BC0 A;  2WPF A;  1LQU A;  4CCQ A;  3LB8 A;  1F8S A;  3IWA A;  4H4W A;  1H81 A;  1GT8 A;  4WCT A;  3T2K A;  1EL7 A;  2R0G A;  2V3B A;  1NHR A;  2WOW A;  4UDR A;  3AE2 A;  4EIQ A;  4YWO A;  2X50 A;  4IVM B;  2EQ9 A;  1N4V A;  3GD3 A;  4HA6 A;  2ARD A;  4AT2 A;  3QVR A;  3AWI A;  3UTG A;  2GRT A;  1XHC A;  1ZMD A;  3RP6 A;  3I3L A;  1PBD A;  1JRX A;  4BJZ A;  2VRL A;  1IUX A;  2UZZ A;  3GDN A;  3VRA A;  2YG3 A;  3IC9 A;  2WOV A;  1TRB A;  2GR0 A;  1Y56 B;  2VVM A;  3AEG A;  3T2Z A;  3AE4 A;  5BRT A;  2ACZ A;  5J60 A;  1KNR A;  3JSK A;  1NEK A;  4FDC B;  2AR8 A;  3AEF A;  3DK9 A;  1ELI A;  1CHU A;  1M6I A;  5FMH A;  2BCG G;  1NHP A;  1LQT A;  4H4S A;  4RSL A;  1E1M A;  1CJC A;  4NEW A;  5ER0 A;  4Z24 A;  4A9W A;  1H7W A;  2IVE A;  4CY8 A;  4M52 A;  1ZOY A;  1LTX R;  3QFB A;  1EBD A;  2QA1 A;  1XDI A;  2WES A;  3FIM B;  1DXL A;  1GRG A;  3M12 A;  2APG A;  3ATQ A;  2B9X A;  4H4Y A;  4LA1 A;  4ADW A;  3QSS A;  1D7L A;  3COX A;  3OC4 A;  4EMW A;  4YTP A;  4NTC A;  2JAE A;  4YKF A;  4A79 A;  2CFY A;  4B69 A;  4EM3 A;  3URH A;  1TDF A;  3D1C A;  1IUW A;  4CRT A;  2GR2 A;  3T0K A;  5KWF A;  4J33 A;  2C70 A;  2XFU A;  4C77 A;  1ZP0 A;  2TMD A;  3RED A;  1F3P A;  3SXI A;  1BGN A;  4A6N A;  4C5O A;  2R9Z A;  3DJJ A;  5U1O A;  2OLO A;  2DKI A;  2VOU A;  2WDR A;  2GMJ A;  3GYJ A;  2NPX A;  1PHH A;  3IF9 A;  2X8C A;  4DNA A;  1EL9 A;  3ABV A;  3SY4 A;  3ICR A;  1HYU A;  3UKK A;  3KA7 A;  1PXB A;  2WS3 A;  1E6E A;  1NG4 A;  1H86 A;  3V3N A;  4AP1 A;  2WQY A;  4ICY A;  1KSU A;  3V76 A;  3K7M X;  4Y4N A;  3SX6 A;  2X99 A;  1H84 A;  2YLR A;  1GRF A;  3DJE A;  3AE5 A;  1FCD A;  3GWD A;  3EF6 A;  3ALM A;  3O0H A;  4IV9 A;  1H7X A;  2C75 A;  2XFN A;  3AE8 A;  3GWF A;  4H4V A;  2GH5 A;  2E5V A;  4A65 A;  4FK1 A;  4EQX A;  5FS6 A;  1TDN A;  2Z5X A;  3FPZ A;  2ZZB A;  4IA5 A;  1PBE A;  4YTM A;  3DH9 A;  5KVI A;  2VZ2 A;  3P4S A;  1BF3 A;  3ISH A;  3AD7 B;  1OJA A;  1KSS A;  1ZK7 A;  2AQJ A;  2ZZC A;  4B65 A;  2B7R A;  3BI4 A;  3EPT A;  1GTE A;  4XWR A;  1CF3 A;  1GV4 A;  3CNT A;  3UKH A;  4Z2T A;  1CC2 A;  5KMS A;  3PO7 A;  4H4Q A;  1OJD A;  3P4Q A;  4NZH A;  1QLB A;  4K22 A;  2FBW A;  1JOA A;  3KU9 A;  1JU2 A;  4KX6 A;  3RP8 A;  3DK8 A;  3AYI A;  3AE9 A;  4FK1 C;  3DGZ A;  1YQ4 A;  2XLU A;  4G73 A;  1JRZ A;  3PVC A;  4H2P A;  4GF7 A;  4Z43 A;  3NYC A;  1GOS A;  5KOW A;  3ICS A;  3QSE A;  3II4 A;  1VG0 A;  1NDA A;  3K7Q X;  4H4R A;  4B1B A;  4OPU A;  4X9N A;  3GYI A;  3NHO X;  2JK6 A;  4TM4 A;  1GET A;  4U8M A;  1JNR A;  3P1W A;  1M64 A;  4JN9 A;  1GND A;  4J36 A;  3BHF A;  1OJT A;  4G6H A;  5KMR A;  2GAG B;  3CN8 A;  4H2Q A;  5CQF A;  1DJN A;  2GQW A;  2V6O A;  1LPF A;  2WP9 A;  2BAB A;  3BI2 A;  3F8R A;  5JCK A;  1JRY A;  4A7A A;  2FJE A;  2XVH A;  2X3N A;  1QO8 A;  4K2X A;  2YG5 A;  4GUV A;  3OZ2 A;  3NRN A;  5L46 A;  3UTE A;  3CPJ G;  4ECH A;  5KOX A;  4JNQ A;  4U2S A;  1L0V A;  2YLT A;  5LV9 A;  2YG7 A;  4H4Z A;  3AEA A;  3AE3 A;  1V59 A;  3SQP A;  1TYT A;  3NG7 X;  1COY A;  2XLR A;  2XVE A;  1KDG A;  2V5Z A;  3K7T A;  5IPY A;  3CND A;  3SZF A;  3EAN A;  3LJP A;  3M0O A;  2JB1 A;  1PN0 A;  3BI5 A;  2XFP A;  2A87 A;  3AEB A;  4Z2R A;  2GV8 A;  2YR5 A;  3V3O A;  4DSH A;  2WDQ A;  5EOW A;  4NWZ A;  2GB0 A;  4D03 A;  5M0Z A;  3GSI A;  4AOX A;  2YG4 A;  1D4E A;  1FEA A;  2QAE A;  1NPX A;  3UP5 A;  4U8O A;  1F8R A;  4JY2 A;  4YSX A;  5M10 A;  2GR3 A;  2R45 A;  2AAQ A;  2H88 A;  2EQ6 A;  4NTD A;  3AED A;  3ADA B;  1PBB A;  3SFE A;  2V60 A;  4I59 A;  2WEU A;  1UKV G;  3P4R A;  1IUV A;  4BJY A;  2VQ7 A;  1L9D A;  3B3R A;  2Q6U A;  1XPQ A;  3DME A;  3NTA A;  4O5Q A;  1YY5 A;  4P9S A;  4TLZ A;  2OAL A;  2HQM A;  4J57 A;  4H4T A;  2V61 A;  3KD9 A;  5JCL A;  4B68 A;  5FS7 A;  3IHM A;  4U2L A;  1W4X A;  2B7S A;  3NN6 X;  5C3J A;  2E1M A;  1GRB A;  1F8W A;  2XCG A;  1VQW A;  5HXI A;  5EB4 A;  2YLX A;  3FG2 P;  3UP4 A;  1F6M A;  1DOB A;  4YKG A;  1GEU A;  1PJ6 A;  4U8N A;  1E7P A;  2YVJ A;  2BS2 A;  2GAH B;  1NAA A;  3DJG X;  3KLJ A;  3VQR A;  1RYI A;  1S2Q A;  3M13 A;  2XVJ A;  1D7Y A;  4YSH A;  2YG6 A;  2Q0L A;  3NKS A;  4J56 A;  2XFO A;  3QVP A;  3FMW A;  3GYX A;  4G74 A;  3UKP A;  4WX1 A;  3ATR A;  3Q9T A;  4II2 A;  3GMC A;  4TM3 A;  5KNL A;  2C67 A;  4H2R A;  1PXA A;  2C66 A;  1BGJ A;  1FOH A;  1H83 A;  2Q7V A;  2VVL G;  1CC6 A;  4GDE A;  2RGJ A;  3UKA A;  2V3A A;  4OPC A;  2JKC A;  4EMJ A;  1CJ4 A;  4CY6 A;  4PAB A;  2GVC A;  1TDO A;  2BS3 A;  1NEN A;  4OPG A;  3UOZ A;  4CCR A;  1YQ3 A;  1BZL A;  3NYE A;  2BCP A;  4BK2 A;  3S5W A;  4G6G A;  4TM1 A;  4ZN0 A;  4A6N B;  5EBK A;  1TYP A;  1D4D A;  1KFY A;  1GRE A;  2R4E A;  2GF3 A;  1K0J A;  1N4U A;  5GRT A;  3UKF A;  1GXF A;  3SGL A;  1XAN A;  1Q1R A;  1PS9 A;  2GR1 A;  1DOC A;  3ZYX A;  2BRA A;  2W0H A;  3GD4 A;  1RP0 A;  4PAA A;  3WE0 A;  3RNM A;  4B66 A;  1KNP A;  4U8L A;  1PXC A;  1Z6L A;  4NNJ A;  3RHA A;  3KPK A;  3LZX A;  3QJ4 A;  2PHH A;  1PJ5 A;  3UOY A;  3NK1 X;  3E1T A;  1GTH A;  3HYV A;  5TR3 A;  1ZMC A;  1ZY8 A;  4CBQ A;  3AXB A;  2WPC A;  3NYF A;  3NTD A;  2EQ7 A;  4NTE A;  2YR4 A;  3DA1 A;  4JY3 A;  2R46 A;  3UOX A;  2WU5 A;  2VQB A;  3BHK A;  4Y4M A;  2PYX A;  2J3N A;  3ALL A;  4X9M A;  3SZC A;  2XLT A;  4O5U A;  1RSG A;  5JCN A;  2WP5 A;  3UKL A;  3NGC X;  5KMP A;  4XWZ A;  3GRT A;  2C3C A;  3AD9 B;  1KF6 A;  3EAO A;  3F8D A;  1E39 A;  4XXG A;  2XVF A;  5U63 A;  1DJQ A;  4EIP A;  2YM2 A;  4J2W A;  4AOS A;  4C74 A;  4EQW A;  4U2T A;  4H4U A;  3FBS A;  4GAP A;  1K4Q A;  4C3X A;  1GRH A;  3L1R A;  3CNJ A;  4II3 A;  4U8K A;  3T14 A;  4A99 A;  3CMM A;  3VR9 A;  4JNA A;  1REO A;  2YQU A;  3AE1 A;  3AEE A;  1LVL A;  1L9E A;  3NH3 X;  3Q6J A;  4J34 A;  1X31 B;  1K0L A;  1ZX9 A;  1H82 A;  4GR1 A;  4DGK A;  1P2E A;  4CNJ A;  1IUT A;  2YWL A;  4MJW A;  5KXJ A;  4OCG A;  2OAM A;  1GSN A;  2QA2 A;  1VDC A;  5EB5 A;  3LZW A;  2JBV A;  1S3E A;  1B4V A;  2ZBW A;  4K7Z A;  5JCI A;  4U8P A;  1B5Q A;  4GDP A;  4KPR A;  3SYI A;  4EMI A;  1CJ3 A;  2NVK X;  3HZL A;  4GRT A;  4YXD A;  4X4J A;  4H4P A;  4TM0 A;  3NIX A;  3VRD B;  5KVH A;  5JCM A;  3C4A A;  3AD8 B;  3KKJ A;  3HYW A;  2X8H A;  1P2H A;  2C7G A;  3T37 A;  3B6D A;  2YM1 A;  2OA1 A;  5IQ1 A;  3QSM A;  5FS9 A;  3T2Y A;  4H2N A;  4IA6 A;  3KVE A;  4YSY A;  3H8I A;  1GRA A;  1PDH A;  2C3D A;  4LU6 A;  4USR A;  2XFQ A;  1YQZ A;  2XYO A;  1GRT A;  4UDQ A;  1S3B A;  3G5S A;  1D5T A;  2WP6 A;  1Y56 A;  3AE6 A;  2WET A;  1GER A;  3ZDN A;  1SEZ A;  5KMQ A;  4GAV A;  2C73 A;  3G5Q A;  2C64 A;  3LAD A;  5U25 A;  4AT0 A;  4OPI A;  5GSN A;  3NK2 X;  1N1P A;  4G9K A;  3SZ0 A;  4NEV A;  3P4P A;  3VRB A;  4AP3 A;  3F8P A;  4ZCC A;  2C4C A;  1E1N A;  2BA9 A;  3UTF A;  4Z2U A;  1NG3 A;  1IJH A;  2CVJ A;  4OPT A;  2BK4 A;  2VVL A;  2XLP A;  2JB2 A;  4BV6 A;  3SZW A;  3C4N A;  3ITJ A;  1E1L A;  3I6D A;  3UTH A;  4RG4 A;  3HYX A;  2WPE A;  1TDK A;  4K8D A;  2WBA A;  3NN0 X;  3R9U A;  2C76 A;  1Y0P A;  3NLC A;  3T31 A;  1N4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...