2IIDA

Structure of l-amino acid oxidase from calloselasma rhodostoma in complex with l-phenylalanine
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
483
structure length
483
Chain Sequence
RNPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of LAAO from Calloselasma rhodostoma with an L-Phenylalanine Substrate: Insights into Structure and Mechanism
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords L-amino-acid oxidase
total genus 179
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2006-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2iidA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2iidA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 2iidA01
2A89A 4KX6A 4BK1A 2V3BA 4FX9A 1CL0A 2ARDA 4Z43A 4CBQA 1BGJA 1EBDA 2GR1A 2YG3A 1ZX9A 3LJPA 1LV0A 4X9NA 1ZOYA 3ADAB 3GYIA 4U8NA 3GYJA 2BS2A 4YTNA 1CC4A 4O5UA 1ELIA 2QCUA 3DJGX 2CDUA 3UTEA 3VR8A 1O5WA 2XLSA 2V61A 3DGHA 5KVIA 3O0HA 1N1PA 4JN9A 4D03A 3H8LA 4GF7A 4C77A 2BK3A 1KDGA 2GQWA 3GD4A 5ER0A 2YG5A 5HHFA 3QVPA 3K30A 3UOYA 3D8XA 5FS6A 2FJDA 1PXAA 4K2XA 4B63A 1BZLA 1GESA 4NTCA 1H7WA 3AXBA 3M0OA 2C70A 4KPRA 2Q7VA 4A99A 4ICYA 4K22A 1O95A 4DGKA 2BA9A 1F6MA 2YVGA 4H7UA 4EMWA 2Q0KA 3OC4A 2QA2A 3QSMA 1PBDA 1NPXA 4O5QA 3NK2X 5BULA 4J31A 3DMEA 3ZDNA 4FDCB 1CJCA 3RP6A 4YSYA 1ZY8A 4X4JA 1H81A 2GAHB 2WETA 2FBWA 3SM8A 3ABVA 1M64A 2R4JA 2FJAA 4J36A 2C7GA 3UKQA 2HQMA 1PBCA 2OALA 2GQFA 3NT6A 1L9EA 1NAAA 1TDEA 3BI5A 4A7AA 2B76A 2E1MA 2AR8A 3L1RA 1Y0PA 1IUVA 3AE3A 1QO8A 2ZZBA 3NK0X 2X3NA 1LQTA 3ATQA 3NTAA 4BK2A 3ZYXA 3KLJA 3CNTA 2BCPA 3BNUA 1CJ2A 4AP1A 3ICSA 3CPIG 1PDHA 3NHOX 1H84A 1GRGA 2I0ZA 2AAQA 4J57A 3AD8B 1DOEA 4BURA 3S61A 1YQZA 1OJ9A 5EB5A 1PJ6A 3UKPA 3I6DA 3KVEA 4A5LA 4BV6A 3AE7A 2QA1A 1GXFA 2RGJA 3P4PA 3P1WA 4K7ZA 2C76A 2IVEA 3SFDA 1LPFA 3UCLA 2ZBWA 2GEWA 1NHRA 4EQRA 1OJTA 2XCGA 4H4TA 1GPEA 4M52A 2APGA 4GUVA 3G5SA 2BCGG 1VRQB 2JB3A 5JCIA 3CGEA 3GRSA 3C96A 2YLRA 2BXRA 2UZZA 4LA1A 3GMBA 4B69A 3ITJA 4OPDA 1GSNA 3KKJA 1JOAA 4JY3A 3COXA 3CTYA 3PO7A 2VVLG 4A6NA 2EQ7A 1FEBA 3C4NA 1S2QA 2DKHA 4NZHA 4DNAA 4YTPA 1X31B 2Y6RA 2R9ZA 2YQUA 4H4RA 4YT0A 4YKFA 3GMCA 1IUXA 2XVFA 1EL7A 2R0CA 4AOXA 2W0HA 3CGCA 2XFPA 5CQFA 1PHHA 1PN0A 1CJ4A 2C64A 3FBSA 5KWFA 1DODA 1N4VA 3QJ4A 3VRBA 2CVJA 4EM4A 3QSSA 4H2RA 4J34A 1ZP0A 2BS3A 2BC0A 4OPLA 5J7XA 2XLRA 3UKKA 1KSUA 4U2TA 4WCTA 4PABA 2BYBA 2YVFA 5JCMA 2YWLA 5C2TA 1L0VA 4USRA 2TPRA 4N9XA 3UKFA 3V76A 2YG4A 4GDPA 2WP5A 2NVKX 5LV9A 5FS7A 4J2WA 2J3NA 1ZKQA 1NHPA 1XPQA 4DSGA 1Y56A 3KA7A 4PAAA 1M6IA 1K0JA 2AQJA 3DH9A 3NRNA 3VRAA 1OJCA 1EL5A 2GR0A 2YM1A 1PXCA 2YR4A 2XFNA 2WS3A 4EIQA 1L9DA 2VQ7A 3NYCA 1FL2A 5KOWA 3CNPA 3AEFA 4A79A 4AOSA 4U2SA 4U8IA 2WU5A 3AYLA 3B3RA 4H2NA 3CPHG 2X8HA 3CN8A 1B8SA 2B9WA 1JNRA 2DKIA 3ICTA 2EQ9A 4CNJA 4NTDA 4BJYA 1H6VA 3ISHA 2YLTA 3NK1X 5M0ZA 3WE0A 1NG3A 3II4A 1CBOA 1Y56B 1N4UA 4JQ9A 2R4EA 2WPFA 5KVHA 4C5OA 4J33A 5FS9A 1D5TA 1GTHA 3JSKA 2C73A 3IHGA 4UDPA 3KPFA 2R45A 4JY2A 2Z5XA 1DXLA 1V59A 3CPJG 3BI4A 3AE1A 2XVHA 3BHKA 1H83A 1DOCA 2GR2A 1ZOVA 2B9XA 3GD3A 3LB8A 5FMHA 1CHUA 1H82A 2JK6A 1VQWA 3UOVA 4EM3A 3ALLA 4EIPA 2WDVA 1REOA 3NH3X 3BHFA 1FOHA 3NN0X 4IVMB 5HYMA 3UOXA 2XFUA 3AEGA 3AE9A 3F8RA 4RG4A 4H4SA 2IIDA 1GRTA 2X50A 1L9CA 3OZ2A 1ONFA 1GRFA 1F8WA 2BS4A 2WOIA 2OA1A 3M12A 1PS9A 3AEDA 4REKA 2Q0LA 2Z5YA 5U63A 4CY6A 4D04A 4C74A 1D7LA 2O9ZA 2C75A 2R0PA 2E4GA 3E1TA 5TR3A 4YSZA 4ECHA 1GV4A 1S3EA 1GT8A 2BACA 3LZWA 1KFYA 3RP7A 2OLNA 4YSXA 2R0GA 1E6EA 2V6OA 2YLZA 4GCMA 3HZLA 2E5VA 1GREA 2OLOA 3I3LA 2GMHA 4JNAA 5IPYA 4NEVA 1BKWA 4H4PA 3UOZA 1CJ3A 2WPEA 3Q6JA 3QVRA 3NTDA 3DGZA 1GNDA 1MO9A 5EB4A 5C3JA 3EF6A 4UP3A 2NPXA 3UKLA 2YR6A 2WU2A 2GB0A 3P4RA 1PBFA 5IQ4A 3NG7X 1D7YA 5U1OA 1E1NA 4B1BA 4OPCA 4P9SA 3PS9A 3REDA 4EQSA 2GV8A 1VG0A 1OJAA 4NEWA 2X8CA 3LADA 4U8PA 1LVLA 4A65A 2YLSA 3SQPA 1D4DA 2VVLA 2YVJA 2B7RA 4Z2TA 1RP0A 2C67A 2WP6A 2XFOA 2RABA 3VQRA 2Q6UA 3F8PA 4B67A 5BVAA 4E0VA 2X99A 5HXIA 2WDQA 1KNPA 4U2LA 3GDNA 1GOSA 3QSEA 4IV9A 2GRTA 1Q1RA 3AD9B 1EL8A 1JRXA 2VQBA 1VG9A 3EAOA 3GWFA 1FECA 1XANA 4IVOB 1COYA 4ZCDA 2CFYA 3GWDA 4H4XA 4TLZA 2WOVA 5J60A 1QLBA 1IUWA 1Q9IA 3CNDA 2XDOA 3BNMA 1Q1WA 1PBEA 2XYOA 3CGDA 5BRTA 1BWCA 1E39A 3AE2A 3FPZA 3RHAA 1O94A 4CCQA 1S2YA 1TYTA 4H4VA 3F8DA 3AEBA 3LXDA 4OPIA 1NENA 1IUTA 3B6DA 4USQA 1BGNA 1RSGA 2WBAA 1DJNA 3LZXA 3NKSA 4OCGA 4LIIA 2A8XA 1TYPA 3NLCA 5JCKA 3M13A 3P9UA 3EPTA 5KRQA 2WEUA 4B65A 3LOVA 4I59A 4K5RA 4CRTA 3CIRA 4I58A 1B5QA 4Y4LA 4Z2UA 2XLTA 1MXTA 2IVDA 3NYFA 3NGCX 4U8OA 1DNCA 2GF3A 3C4AA 3AYJA 3S5WA 2WQYA 4U8LA 4BK3A 1PJ5A 4YXDA 2FJBA 1GRAA 3ALMA 3G5QA 3PVCA 5CKUA 4Z44A 1K4QA 2JBVA 1JEHA 1NG4A 2XVJA 4TLXA 4U8JA 1ZMCA 2BXSA 1ZK7A 1GETA 1KNRA 5FS8A 2YM2A 1TDOA 4B68A 1P2EA 1XHCA 1H7XA 4U8KA 5DBJA 2PHHA 4C3XA 4OPTA 1GALA 1F8RA 2WPCA 2RGOA 3G5RA 1TDNA 3VRDB 3AE4A 1TRBA 1TDFA 2QAEA 2GMJA 1NHSA 4XWZA 1PBBA 2H89A 4H4WA 2VVMA 1YQ3A 3AECA 2A87A 3AE6A 4Z26A 4H50A 2XLUA 4TM3A 4LU6A 1GRHA 4OPGA 3ATRA 4Y4NA 1K0LA 2JAEA 3KD9A 3RP8A 3CNJA 3DA1A 4RSLA 4EMJA 1B37A 3IHMA 3AYIA 2GAGB 4A6NB 5JCNA 4AP3A 4HB9A 1GRBA 1F3PA 1XDIA 2XFQA 3FIMB 4EQWA 1PJ7A 1YQ4A 3AE5A 2OAMA 2YLWA 3ALJA 1P2HA 4DSHA 2WOWA 3KU9A 2BK4A 3AB1A 2JKCA 2VZ2A 4UDRA 4ZCCA 4HA6A 3UTHA 5JCLA 3UKAA 4H2QA 4GDEA 4K8DA 4B66A 4H2PA 1B4VA 2WHDA 3UP4A 3AD7B 4AT2A 4ZN0A 1S3BA 1CF3A 1CC2A 3IWAA 2B7SA 2WESA 5BUKA 4H4ZA 4Y4MA 2V60A 2Y6QA 4J56A 1YY5A 2PYXA 4B64A 1DJQA 2XVEA 2X8GA 4OVIA 4H4YA 3T37A 1GERA 2C3DA 4AT0A 2EQ6A 3UTGA 3K7MX 2ACZA 4H4UA 4YKGA 4IA6A 1BF3A 5GRTA 1D4CA 1E1LA 4YWOA 3CGBA 1GEUA 3DJEA 3BI2A 3FG2P 4IA5A 4JNQA 1AOGA 2BK5A 2YG6A 2WP9A 1N4WA 1IUSA 1YKJA 3UKHA 2YR5A 4RG3A 1DOBA 1CC6A 2C65A 4UDQA 1JRZA 4TM4A 4Z24A 5M10A 1FEAA 2RGHA 3DK8A 1IJHA 3NIXA 2B9YA 2FJEA 2VOUA 1F8SA 1OJDA 3GDPA 3QFBA 1LTXR 2C66A 4K5SA 3IF9A 2YG7A 4CY8A 1JRYA 5EOWA 3UTFA 1E7PA 1Z6LA 2V3AA 4BJZA 2R46A 2YLXA 4WX1A 4YSHA 2JB1A 3IC9A 1VDCA 4NTEA 3RNMA 2CULA 4XXGA 3URHA 1D4EA 4GRTA 3K7QX 1TDKA 3H4KA 2GVCA 4U8MA 4Z25A 1IUUA 3UP5A 5GSNA 4Z2RA 3ICRA 3CNSA 1QJDA 3Q9TA 4X9MA 2BC1A 2XVIA 3D1CA 2WDRA 3DK9A 3L8KA 1UKVG 4TM0A 4XWRA 2GH5A 3NNEA 2XLPA 1KF6A 1ZMDA 3DJJA 1GTEA 1KSSA 3AE8A 1RYIA 3H8IA 2TMDA 5L46A 4JDRA 2BABA 1K0IA 1JU2A 1W4XA 4TM1A 3V3NA 5EBKA 3VR9A 4C3YA 2H88A 2C72A 2V5ZA 4FK1C 4GR1A 3EANA 3NN6X 3P4QA 2GR3A 4APNA 3SFEA 3AEAA 5HY5A 3P4SA 4CNKA 1H86A 2VRMA 2EQ8A 2VRLA 4EQXA 4A9WA 3GRTA 3QFAA 3R9UA 3FMWA 4EMIA 3SGLA 1LQUA 1JNZA 2C3CA 2ZZCA 1E1KA 1EL9A 1E1MA 3K7TA 4YTMA 1NDAA 1ZDLA 3AEEA 5KOXA 1PXBA 3GSIA 3DK4A 3NYEA 4ADWA 2JB2A 3AWIA 1SEZA 4MJWA 4OPUA 1NEKA 5IQ1A 5U25A 1LJ1A 3V3OA 3DJDA 2ZZ0A 1MOKA 1HYUA 2F5ZA 2YAUA 1FCDA 4H4QA 5KXJA 4FK1A 1NHQA 4CCRA
chains in the Genus database with same CATH superfamily
2A89A 4KX6A 4BK1A 2V3BA 3HYWA 4FX9A 1CL0A 4II3A 2ARDA 4Z43A 4CBQA 1BGJA 1EBDA 2GR1A 2YG3A 1ZX9A 3LJPA 1LV0A 4X9NA 1ZOYA 3ADAB 3GYIA 3T31A 4U8NA 3GYJA 2BS2A 4YTNA 1CC4A 4O5UA 1ELIA 2QCUA 3DJGX 2CDUA 3UTEA 3VR8A 1O5WA 2XLSA 2V61A 3DGHA 5KVIA 3O0HA 1N1PA 4JN9A 4D03A 3H8LA 4GF7A 4C77A 2BK3A 1KDGA 2GQWA 3GD4A 5ER0A 2YG5A 5HHFA 3QVPA 3K30A 3UOYA 3D8XA 5FS6A 2FJDA 1PXAA 4K2XA 4B63A 1BZLA 1GESA 4NTCA 1H7WA 3AXBA 3M0OA 2C70A 4KPRA 2Q7VA 4A99A 4ICYA 4K22A 1O95A 4DGKA 2BA9A 3SZ0A 1F6MA 3T2ZA 2YVGA 4H7UA 4EMWA 2Q0KA 3OC4A 2QA2A 3QSMA 1PBDA 1NPXA 4O5QA 3NK2X 5BULA 4J31A 3DMEA 3ZDNA 4FDCB 1CJCA 3CMMA 3RP6A 4YSYA 1ZY8A 4X4JA 1H81A 2GAHB 2WETA 2FBWA 3SM8A 3ABVA 1M64A 2R4JA 2FJAA 4J36A 2C7GA 4G6HA 2HQMA 3UKQA 1PBCA 2OALA 2GQFA 3NT6A 1L9EA 1NAAA 1TDEA 3BI5A 4A7AA 2B76A 2E1MA 2AR8A 3L1RA 1Y0PA 1IUVA 3AE3A 1QO8A 2ZZBA 3NK0X 2X3NA 1LQTA 3ATQA 3NTAA 4BK2A 3ZYXA 3KLJA 3CNTA 2BCPA 3BNUA 1CJ2A 4AP1A 3ICSA 3CPIG 1PDHA 3NHOX 1H84A 1GRGA 2I0ZA 2AAQA 4J57A 3AD8B 1DOEA 4BURA 3S61A 1YQZA 1OJ9A 5EB5A 1PJ6A 3UKPA 3I6DA 3KVEA 4A5LA 4BV6A 3AE7A 2QA1A 1GXFA 2RGJA 3P4PA 3P1WA 4K7ZA 2C76A 2IVEA 3SFDA 1LPFA 3UCLA 2ZBWA 2GEWA 1NHRA 4EQRA 1OJTA 2XCGA 4H4TA 1GPEA 4M52A 2APGA 4GUVA 3G5SA 2BCGG 1VRQB 2JB3A 5JCIA 3CGEA 3GRSA 3C96A 2YLRA 2BXRA 2UZZA 4LA1A 3GMBA 4B69A 3ITJA 4OPDA 1GSNA 3KKJA 1JOAA 4JY3A 3COXA 3CTYA 3PO7A 2BRAA 2VVLG 4A6NA 2EQ7A 1FEBA 3C4NA 1S2QA 2DKHA 4NZHA 4DNAA 4YTPA 1X31B 2Y6RA 2R9ZA 2C4CA 2YQUA 4H4RA 4YKFA 3GMCA 4YT0A 1IUXA 2XVFA 1EL7A 2R0CA 4AOXA 2W0HA 3CGCA 4NWZA 2XFPA 5CQFA 1PHHA 1PN0A 1CJ4A 2C64A 3FBSA 5KWFA 1DODA 3T0KA 1N4VA 3QJ4A 3VRBA 2CVJA 4EM4A 3QSSA 4H2RA 4J34A 1ZP0A 2BS3A 2BC0A 4OPLA 5J7XA 2XLRA 3UKKA 1KSUA 4U2TA 4WCTA 4NNJA 2BYBA 2YVFA 4PABA 5JCMA 2YWLA 5C2TA 1L0VA 4USRA 2TPRA 4N9XA 3UKFA 3GYXA 3V76A 2YG4A 4GDPA 2WP5A 2NVKX 5LV9A 5FS7A 4J2WA 2J3NA 1ZKQA 1NHPA 1XPQA 4DSGA 1Y56A 3KA7A 4PAAA 1M6IA 1K0JA 2AQJA 3DH9A 3NRNA 3VRAA 1OJCA 1EL5A 2GR0A 2YM1A 4G9KA 1PXCA 2YR4A 4G6GA 2BRYA 2XFNA 2WS3A 4EIQA 1L9DA 2VQ7A 3NYCA 1FL2A 5KOWA 3CNPA 3AEFA 4A79A 4AOSA 4U2SA 4U8IA 2WU5A 3AYLA 3B3RA 4H2NA 5KNLA 3CPHG 2X8HA 3CN8A 3T14A 1B8SA 2B9WA 1JNRA 2DKIA 3ICTA 2EQ9A 4CNJA 4NTDA 4BJYA 1H6VA 3ISHA 3WE0A 2YLTA 3NK1X 5M0ZA 1NG3A 3II4A 1CBOA 1Y56B 1N4UA 4JQ9A 2R4EA 2WPFA 5KVHA 4C5OA 4J33A 5FS9A 1D5TA 1GTHA 3JSKA 2C73A 3IHGA 4UDPA 3KPFA 2R45A 4JY2A 2Z5XA 1DXLA 1V59A 3CPJG 3BI4A 3AE1A 2XVHA 3SX6A 3BHKA 1H83A 1DOCA 2GR2A 2B9XA 1ZOVA 3GD3A 3LB8A 5FMHA 1CHUA 1H82A 2JK6A 1VQWA 3UOVA 4EM3A 3ALLA 4EIPA 2WDVA 1REOA 3NH3X 3BHFA 1FOHA 3NN0X 4IVMB 5HYMA 3UOXA 2XFUA 3AEGA 3AE9A 3F8RA 4RG4A 4H4SA 2IIDA 1GRTA 2X50A 1L9CA 3SY4A 3OZ2A 1ONFA 1GRFA 1F8WA 2BS4A 2WOIA 2OA1A 3M12A 1PS9A 3AEDA 4REKA 2Q0LA 2Z5YA 5U63A 4CY6A 4D04A 4C74A 1D7LA 2O9ZA 2C75A 2R0PA 2E4GA 3E1TA 5TR3A 4YSZA 4ECHA 1GV4A 1S3EA 1GT8A 2BACA 3LZWA 1KFYA 3RP7A 2OLNA 4YSXA 2R0GA 1E6EA 2V6OA 2YLZA 4GCMA 3HZLA 2E5VA 1GREA 2OLOA 3I3LA 2GMHA 4JNAA 5IPYA 4NEVA 1BKWA 4H4PA 3UOZA 1CJ3A 2WPEA 4G73A 3Q6JA 3QVRA 3NTDA 3DGZA 1GNDA 1MO9A 5EB4A 5C3JA 3EF6A 4UP3A 2NPXA 3UKLA 2YR6A 2WU2A 2GB0A 3P4RA 1PBFA 5IQ4A 5KMRA 3NG7X 1D7YA 5U1OA 1E1NA 4B1BA 4OPCA 4P9SA 3PS9A 3REDA 4EQSA 2GV8A 1VG0A 1OJAA 4NEWA 5KMSA 2X8CA 3LADA 4U8PA 1LVLA 4A65A 2YLSA 3SQPA 1D4DA 2VVLA 2YVJA 2B7RA 3SZFA 4Z2TA 1RP0A 2C67A 2WP6A 2XFOA 2RABA 3VQRA 2Q6UA 3F8PA 4B67A 5BVAA 4E0VA 2X99A 5HXIA 2WDQA 1KNPA 4U2LA 3GDNA 1GOSA 3QSEA 4IV9A 2GRTA 1Q1RA 3AD9B 1EL8A 1JRXA 2VQBA 1VG9A 3EAOA 3GWFA 1FECA 1XANA 4IVOB 1COYA 4ZCDA 2CFYA 3GWDA 4H4XA 4TLZA 2WOVA 5J60A 1QLBA 4GAVA 1IUWA 1Q9IA 3CNDA 2XDOA 3BNMA 1Q1WA 1PBEA 2XYOA 3CGDA 5BRTA 1BWCA 1E39A 3AE2A 3FPZA 3RHAA 1O94A 4CCQA 1S2YA 1TYTA 4H4VA 3F8DA 3AEBA 3LXDA 4OPIA 1NENA 1IUTA 3B6DA 4USQA 1BGNA 1RSGA 2WBAA 1DJNA 3LZXA 3NKSA 4OCGA 4LIIA 2A8XA 1TYPA 3NLCA 5JCKA 3M13A 3P9UA 3EPTA 5KRQA 2WEUA 4B65A 3LOVA 4I59A 4K5RA 4CRTA 3CIRA 4I58A 1B5QA 4Y4LA 4Z2UA 2XLTA 1MXTA 2IVDA 3NYFA 3NGCX 4U8OA 1DNCA 2GF3A 3C4AA 3AYJA 3S5WA 2WQYA 4U8LA 4BK3A 1PJ5A 4YXDA 2FJBA 1GRAA 3ALMA 3G5QA 3PVCA 5CKUA 4Z44A 1K4QA 2JBVA 1JEHA 1NG4A 2XVJA 4TLXA 4U8JA 1ZMCA 2BXSA 1ZK7A 1GETA 1KNRA 5FS8A 2YM2A 1TDOA 4B68A 1P2EA 1XHCA 1H7XA 4U8KA 5DBJA 2PHHA 4C3XA 4OPTA 1GALA 1F8RA 2WPCA 2RGOA 3G5RA 1TDNA 3VRDB 3AE4A 1TRBA 1TDFA 2QAEA 2GMJA 1NHSA 4XWZA 1PBBA 2H89A 4H4WA 2VVMA 1YQ3A 3AECA 2A87A 3AE6A 3HYVA 4Z26A 4H50A 2XLUA 4TM3A 4LU6A 1GRHA 4OPGA 3ATRA 4Y4NA 1K0LA 2JAEA 3KD9A 3RP8A 3CNJA 3DA1A 4RSLA 4EMJA 1B37A 3IHMA 3AYIA 2GAGB 4G74A 4A6NB 5JCNA 4AP3A 4HB9A 1GRBA 1F3PA 1XDIA 2XFQA 3FIMB 4EQWA 1PJ7A 1YQ4A 3AE5A 2OAMA 2YLWA 3ALJA 1P2HA 4DSHA 2WOWA 3KU9A 2BK4A 3AB1A 2JKCA 3SZCA 2VZ2A 4UDRA 4ZCCA 4HA6A 3UTHA 5JCLA 3UKAA 4H2QA 4GDEA 4K8DA 4B66A 4H2PA 1B4VA 2WHDA 3UP4A 3AD7B 3T2YA 4AT2A 4ZN0A 1S3BA 1CF3A 1CC2A 3IWAA 2B7SA 2WESA 5BUKA 4H4ZA 4Y4MA 2V60A 2Y6QA 4J56A 1YY5A 2PYXA 4B64A 1DJQA 2XVEA 2X8GA 4OVIA 4H4YA 3T37A 1GERA 2C3DA 4AT0A 2EQ6A 3UTGA 3K7MX 2ACZA 4H4UA 4YKGA 4IA6A 1BF3A 5GRTA 1D4CA 1E1LA 3KPKA 3CGBA 4YWOA 1GEUA 3DJEA 3BI2A 3FG2P 4IA5A 4JNQA 1AOGA 2BK5A 2YG6A 2WP9A 1N4WA 1IUSA 1YKJA 3UKHA 2YR5A 4RG3A 1DOBA 1CC6A 2C65A 4UDQA 1JRZA 4TM4A 4Z24A 5M10A 1FEAA 2RGHA 3DK8A 1IJHA 3NIXA 2B9YA 2FJEA 2VOUA 1F8SA 1OJDA 3GDPA 3QFBA 1LTXR 2C66A 4K5SA 3IF9A 2YG7A 4CY8A 1JRYA 5EOWA 3UTFA 5KMQA 1E7PA 1Z6LA 5KMPA 2V3AA 4BJZA 4GAPA 2R46A 2YLXA 4WX1A 3SXIA 4YSHA 2JB1A 3IC9A 1VDCA 4NTEA 3RNMA 2CULA 4XXGA 3URHA 1D4EA 4GRTA 3K7QX 1TDKA 3H4KA 2GVCA 3HYXA 4U8MA 4Z25A 1IUUA 3UP5A 5GSNA 4Z2RA 3ICRA 3CNSA 1QJDA 3Q9TA 4X9MA 2BC1A 2XVIA 3D1CA 2WDRA 3DK9A 3L8KA 1UKVG 4TM0A 4XWRA 2GH5A 3NNEA 2XLPA 1KF6A 1ZMDA 3DJJA 1GTEA 1KSSA 3AE8A 1RYIA 3H8IA 2TMDA 5L46A 4JDRA 2BABA 1K0IA 1JU2A 1W4XA 4TM1A 3V3NA 5EBKA 3VR9A 4C3YA 2H88A 2C72A 2V5ZA 4FK1C 4GR1A 3EANA 3NN6X 3P4QA 2GR3A 3T2KA 4APNA 3SFEA 3AEAA 5HY5A 3P4SA 4CNKA 1H86A 2VRMA 2EQ8A 3SYIA 2VRLA 4EQXA 5KOXA 4A9WA 3GRTA 3QFAA 3R9UA 3FMWA 4EMIA 3SGLA 1LQUA 1JNZA 2C3CA 2ZZCA 1E1KA 1EL9A 1E1MA 3K7TA 4YTMA 1NDAA 1ZDLA 3AEEA 3SZWA 1PXBA 3GSIA 3DK4A 3NYEA 4ADWA 2JB2A 3AWIA 1SEZA 4MJWA 4OPUA 1NEKA 5IQ1A 5U25A 1LJ1A 3V3OA 3DJDA 2ZZ0A 1MOKA 1HYUA 2F5ZA 2YAUA 1FCDA 4H4QA 4II2A 4FK1A 5KXJA 1NHQA 4CCRA
chains in the Genus database with same CATH topology
2A89A 4KX6A 4BK1A 2V3BA 3HYWA 4FX9A 1CL0A 4II3A 2ARDA 4Z43A 4CBQA 1BGJA 1EBDA 2GR1A 2YG3A 1ZX9A 3LJPA 1LV0A 4X9NA 1ZOYA 3ADAB 3GYIA 3T31A 4U8NA 3GYJA 2BS2A 4YTNA 1CC4A 4O5UA 1ELIA 2QCUA 3DJGX 2CDUA 3UTEA 3VR8A 1O5WA 2XLSA 2V61A 3DGHA 5KVIA 3O0HA 1N1PA 4JN9A 4D03A 3H8LA 4GF7A 4C77A 2BK3A 1KDGA 2GQWA 3GD4A 5ER0A 2YG5A 5HHFA 3QVPA 3K30A 3UOYA 3D8XA 5FS6A 2FJDA 1PXAA 4K2XA 4B63A 1BZLA 1GESA 4NTCA 1H7WA 3AXBA 3M0OA 2C70A 4KPRA 2Q7VA 4A99A 4ICYA 4K22A 1O95A 4DGKA 2BA9A 3SZ0A 1F6MA 3T2ZA 2YVGA 4H7UA 4EMWA 2Q0KA 3OC4A 2QA2A 3QSMA 1PBDA 1NPXA 4O5QA 3NK2X 5BULA 4J31A 3DMEA 3ZDNA 4FDCB 1CJCA 3CMMA 3RP6A 4YSYA 1ZY8A 4X4JA 1H81A 2GAHB 2WETA 2FBWA 3SM8A 3ABVA 1M64A 2R4JA 2FJAA 4J36A 2C7GA 4G6HA 2HQMA 3UKQA 1PBCA 2OALA 2GQFA 3NT6A 1L9EA 1NAAA 1TDEA 3BI5A 4A7AA 2B76A 2E1MA 2AR8A 3L1RA 1Y0PA 1IUVA 3AE3A 1QO8A 2ZZBA 3NK0X 2X3NA 1LQTA 3ATQA 3NTAA 4BK2A 3ZYXA 3KLJA 3CNTA 2BCPA 3BNUA 1CJ2A 4AP1A 3ICSA 3CPIG 1PDHA 3NHOX 1H84A 1GRGA 2I0ZA 2AAQA 4J57A 3AD8B 1DOEA 4BURA 3S61A 1YQZA 1OJ9A 5EB5A 1PJ6A 3UKPA 3I6DA 3KVEA 4A5LA 4BV6A 3AE7A 2QA1A 1GXFA 2RGJA 3P4PA 3P1WA 4K7ZA 2C76A 2IVEA 3SFDA 1LPFA 3UCLA 2ZBWA 2GEWA 1NHRA 4EQRA 1OJTA 2XCGA 4H4TA 1GPEA 4M52A 2APGA 4GUVA 3G5SA 2BCGG 1VRQB 2JB3A 5JCIA 3CGEA 3GRSA 3C96A 2YLRA 2BXRA 2UZZA 4LA1A 3GMBA 4B69A 3ITJA 4OPDA 1GSNA 3KKJA 1JOAA 4JY3A 3COXA 3CTYA 3PO7A 2BRAA 2VVLG 4A6NA 2EQ7A 1FEBA 3C4NA 1S2QA 2DKHA 4NZHA 4DNAA 4YTPA 1X31B 2Y6RA 2R9ZA 2C4CA 2YQUA 4H4RA 4YKFA 3GMCA 4YT0A 1IUXA 2XVFA 1EL7A 2R0CA 4AOXA 2W0HA 3CGCA 4NWZA 2XFPA 5CQFA 1PHHA 1PN0A 1CJ4A 2C64A 3FBSA 5KWFA 1DODA 3T0KA 1N4VA 3QJ4A 3VRBA 2CVJA 4EM4A 3QSSA 4H2RA 4J34A 1ZP0A 2BS3A 2BC0A 4OPLA 5J7XA 2XLRA 3UKKA 1KSUA 4U2TA 4WCTA 4NNJA 2BYBA 2YVFA 4PABA 5JCMA 2YWLA 5C2TA 1L0VA 4USRA 2TPRA 4N9XA 3UKFA 3GYXA 3V76A 2YG4A 4GDPA 2WP5A 2NVKX 5LV9A 5FS7A 4J2WA 2J3NA 1ZKQA 1NHPA 1XPQA 4DSGA 1Y56A 3KA7A 4PAAA 1M6IA 1K0JA 2AQJA 3DH9A 3NRNA 3VRAA 1OJCA 1EL5A 2GR0A 2YM1A 4G9KA 1PXCA 2YR4A 4G6GA 2BRYA 2XFNA 2WS3A 4EIQA 1L9DA 2VQ7A 3NYCA 1FL2A 5KOWA 3CNPA 3AEFA 4A79A 4AOSA 4U2SA 4U8IA 2WU5A 3AYLA 3B3RA 4H2NA 5KNLA 3CPHG 2X8HA 3CN8A 3T14A 1B8SA 2B9WA 1JNRA 2DKIA 3ICTA 2EQ9A 4CNJA 4NTDA 4BJYA 1H6VA 3ISHA 2YLTA 3NK1X 5M0ZA 3WE0A 1NG3A 3II4A 1CBOA 1Y56B 1N4UA 4JQ9A 2R4EA 2WPFA 5KVHA 4C5OA 4J33A 5FS9A 1D5TA 1GTHA 3JSKA 2C73A 3IHGA 4UDPA 3KPFA 2R45A 4JY2A 2Z5XA 1DXLA 1V59A 3CPJG 3BI4A 3AE1A 2XVHA 3SX6A 3BHKA 1H83A 1DOCA 2GR2A 1ZOVA 2B9XA 3GD3A 3LB8A 5FMHA 1CHUA 1H82A 2JK6A 1VQWA 3UOVA 4EM3A 3ALLA 4EIPA 2WDVA 1REOA 3NH3X 3BHFA 1FOHA 3NN0X 4IVMB 5HYMA 3UOXA 2XFUA 3AEGA 3AE9A 3F8RA 4RG4A 4H4SA 2IIDA 1GRTA 2X50A 1L9CA 3SY4A 3OZ2A 1ONFA 1GRFA 1F8WA 2BS4A 2WOIA 2OA1A 3M12A 1PS9A 3AEDA 4REKA 2Q0LA 2Z5YA 5U63A 4CY6A 4D04A 4C74A 1D7LA 2O9ZA 2C75A 2R0PA 2E4GA 3E1TA 5TR3A 4YSZA 4ECHA 1GV4A 1S3EA 1GT8A 2BACA 3LZWA 1KFYA 3RP7A 2OLNA 4YSXA 2R0GA 1E6EA 2V6OA 2YLZA 4GCMA 3HZLA 2E5VA 1GREA 2OLOA 3I3LA 2GMHA 4JNAA 5IPYA 4NEVA 1BKWA 4H4PA 3UOZA 1CJ3A 2WPEA 4G73A 3Q6JA 3QVRA 3NTDA 3DGZA 1GNDA 1MO9A 5EB4A 5C3JA 3EF6A 4UP3A 2NPXA 3UKLA 2YR6A 2WU2A 2GB0A 3P4RA 1PBFA 5IQ4A 5KMRA 3NG7X 1D7YA 5U1OA 1E1NA 4B1BA 4OPCA 4P9SA 3PS9A 3REDA 4EQSA 2GV8A 1VG0A 1OJAA 4NEWA 5KMSA 2X8CA 3LADA 4U8PA 1LVLA 4A65A 2YLSA 3SQPA 1D4DA 2VVLA 2YVJA 2B7RA 3SZFA 4Z2TA 1RP0A 2C67A 2WP6A 2XFOA 2RABA 3VQRA 2Q6UA 3F8PA 4B67A 5BVAA 4E0VA 2X99A 5HXIA 2WDQA 1KNPA 4U2LA 3GDNA 1GOSA 3QSEA 4IV9A 2GRTA 1Q1RA 3AD9B 1EL8A 1JRXA 2VQBA 1VG9A 3EAOA 3GWFA 1FECA 1XANA 4IVOB 1COYA 4ZCDA 2CFYA 3GWDA 4H4XA 4TLZA 2WOVA 5J60A 1QLBA 4GAVA 1IUWA 1Q9IA 3CNDA 2XDOA 3BNMA 1Q1WA 1PBEA 2XYOA 3CGDA 5BRTA 1BWCA 1E39A 3AE2A 3FPZA 3RHAA 1O94A 4CCQA 1S2YA 1TYTA 4H4VA 3F8DA 3AEBA 3LXDA 4OPIA 1NENA 1IUTA 3B6DA 4USQA 1BGNA 1RSGA 2WBAA 1DJNA 3LZXA 3NKSA 4OCGA 4LIIA 2A8XA 1TYPA 3NLCA 5JCKA 3M13A 3P9UA 3EPTA 5KRQA 2WEUA 4B65A 3LOVA 4I59A 4K5RA 4CRTA 3CIRA 4I58A 1B5QA 4Y4LA 4Z2UA 2XLTA 1MXTA 2IVDA 3NYFA 3NGCX 4U8OA 1DNCA 2GF3A 3C4AA 3AYJA 3S5WA 2WQYA 4U8LA 4BK3A 1PJ5A 4YXDA 2FJBA 1GRAA 3ALMA 3G5QA 3PVCA 5CKUA 4Z44A 1K4QA 2JBVA 1JEHA 1NG4A 2XVJA 4TLXA 4U8JA 1ZMCA 2BXSA 1ZK7A 1GETA 1KNRA 5FS8A 2YM2A 1TDOA 4B68A 1P2EA 1XHCA 1H7XA 4U8KA 5DBJA 2PHHA 4C3XA 4OPTA 1GALA 1F8RA 2WPCA 2RGOA 3G5RA 1TDNA 3VRDB 3AE4A 1TRBA 1TDFA 2QAEA 2GMJA 1NHSA 4XWZA 1PBBA 2H89A 4H4WA 2VVMA 1YQ3A 3AECA 2A87A 3AE6A 3HYVA 4Z26A 4H50A 2XLUA 4TM3A 4LU6A 1GRHA 4OPGA 3ATRA 4Y4NA 1K0LA 2JAEA 3KD9A 3RP8A 3CNJA 3DA1A 4RSLA 4EMJA 1B37A 3IHMA 3AYIA 2GAGB 4G74A 4A6NB 5JCNA 4AP3A 4HB9A 1GRBA 1F3PA 1XDIA 2XFQA 3FIMB 4EQWA 1PJ7A 1YQ4A 3AE5A 2OAMA 2YLWA 3ALJA 1P2HA 4DSHA 2WOWA 3KU9A 2BK4A 3AB1A 2JKCA 3SZCA 2VZ2A 4UDRA 4ZCCA 4HA6A 3UTHA 5JCLA 3UKAA 4H2QA 4GDEA 4K8DA 4B66A 4H2PA 1B4VA 2WHDA 3UP4A 3AD7B 3T2YA 4AT2A 4ZN0A 1S3BA 1CF3A 1CC2A 3IWAA 2B7SA 2WESA 5BUKA 4H4ZA 4Y4MA 2V60A 2Y6QA 4J56A 1YY5A 2PYXA 4B64A 1DJQA 2XVEA 2X8GA 4OVIA 4H4YA 3T37A 1GERA 2C3DA 4AT0A 2EQ6A 3UTGA 3K7MX 2ACZA 4H4UA 4YKGA 4IA6A 1BF3A 5GRTA 1D4CA 1E1LA 3KPKA 3CGBA 4YWOA 1GEUA 3DJEA 3BI2A 3FG2P 4IA5A 4JNQA 1AOGA 2BK5A 2YG6A 2WP9A 1N4WA 1IUSA 1YKJA 3UKHA 2YR5A 4RG3A 1DOBA 1CC6A 2C65A 4UDQA 1JRZA 4TM4A 4Z24A 5M10A 1FEAA 2RGHA 3DK8A 1IJHA 3NIXA 2B9YA 2FJEA 2VOUA 1F8SA 1OJDA 3GDPA 3QFBA 1LTXR 2C66A 4K5SA 3IF9A 2YG7A 4CY8A 1JRYA 5EOWA 3UTFA 5KMQA 1E7PA 1Z6LA 5KMPA 2V3AA 4BJZA 4GAPA 2R46A 2YLXA 4WX1A 3SXIA 4YSHA 2JB1A 3IC9A 1VDCA 4NTEA 3RNMA 2CULA 4XXGA 3URHA 1D4EA 4GRTA 3K7QX 1TDKA 3H4KA 2GVCA 3HYXA 4U8MA 4Z25A 1IUUA 3UP5A 5GSNA 4Z2RA 3ICRA 3CNSA 1QJDA 3Q9TA 4X9MA 2BC1A 2XVIA 3D1CA 2WDRA 3DK9A 3L8KA 1UKVG 4TM0A 4XWRA 2GH5A 3NNEA 2XLPA 1KF6A 1ZMDA 3DJJA 1GTEA 1KSSA 3AE8A 1RYIA 3H8IA 2TMDA 5L46A 4JDRA 2BABA 1K0IA 1JU2A 1W4XA 4TM1A 3V3NA 5EBKA 3VR9A 4C3YA 2H88A 2C72A 2V5ZA 4FK1C 4GR1A 3EANA 3NN6X 3P4QA 2GR3A 3T2KA 4APNA 3SFEA 3AEAA 5HY5A 3P4SA 4CNKA 1H86A 2VRMA 2EQ8A 3SYIA 2VRLA 4EQXA 5KOXA 4A9WA 3GRTA 3QFAA 3R9UA 3FMWA 4EMIA 3SGLA 1LQUA 1JNZA 2C3CA 2ZZCA 1E1KA 1EL9A 1E1MA 3K7TA 4YTMA 1NDAA 1ZDLA 3AEEA 3SZWA 1PXBA 3GSIA 3DK4A 3NYEA 4ADWA 2JB2A 3AWIA 1SEZA 4MJWA 4OPUA 1NEKA 5IQ1A 5U25A 1LJ1A 3V3OA 3DJDA 2ZZ0A 1MOKA 1HYUA 2F5ZA 2YAUA 1FCDA 4H4QA 4II2A 4FK1A 5KXJA 1NHQA 4CCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A89 A;  4KX6 A;  4BK1 A;  2V3B A;  4FX9 A;  1CL0 A;  2ARD A;  4Z43 A;  4CBQ A;  1BGJ A;  1EBD A;  2GR1 A;  2YG3 A;  1ZX9 A;  3LJP A;  1LV0 A;  4X9N A;  1ZOY A;  3ADA B;  3GYI A;  4U8N A;  3GYJ A;  2BS2 A;  4YTN A;  1CC4 A;  4O5U A;  1ELI A;  2QCU A;  3DJG X;  2CDU A;  3UTE A;  3VR8 A;  1O5W A;  2XLS A;  2V61 A;  3DGH A;  5KVI A;  3O0H A;  1N1P A;  4JN9 A;  4D03 A;  3H8L A;  4GF7 A;  4C77 A;  2BK3 A;  1KDG A;  2GQW A;  3GD4 A;  5ER0 A;  2YG5 A;  5HHF A;  3QVP A;  3K30 A;  3UOY A;  3D8X A;  5FS6 A;  2FJD A;  1PXA A;  4K2X A;  4B63 A;  1BZL A;  1GES A;  4NTC A;  1H7W A;  3AXB A;  3M0O A;  2C70 A;  4KPR A;  2Q7V A;  4A99 A;  4ICY A;  4K22 A;  1O95 A;  4DGK A;  2BA9 A;  1F6M A;  2YVG A;  4H7U A;  4EMW A;  2Q0K A;  3OC4 A;  2QA2 A;  3QSM A;  1PBD A;  1NPX A;  4O5Q A;  3NK2 X;  5BUL A;  4J31 A;  3DME A;  3ZDN A;  4FDC B;  1CJC A;  3RP6 A;  4YSY A;  1ZY8 A;  4X4J A;  1H81 A;  2GAH B;  2WET A;  2FBW A;  3SM8 A;  3ABV A;  1M64 A;  2R4J A;  2FJA A;  4J36 A;  2C7G A;  3UKQ A;  2HQM A;  1PBC A;  2OAL A;  2GQF A;  3NT6 A;  1L9E A;  1NAA A;  1TDE A;  3BI5 A;  4A7A A;  2B76 A;  2E1M A;  2AR8 A;  3L1R A;  1Y0P A;  1IUV A;  3AE3 A;  1QO8 A;  2ZZB A;  3NK0 X;  2X3N A;  1LQT A;  3ATQ A;  3NTA A;  4BK2 A;  3ZYX A;  3KLJ A;  3CNT A;  2BCP A;  3BNU A;  1CJ2 A;  4AP1 A;  3ICS A;  3CPI G;  1PDH A;  3NHO X;  1H84 A;  1GRG A;  2I0Z A;  2AAQ A;  4J57 A;  3AD8 B;  1DOE A;  4BUR A;  3S61 A;  1YQZ A;  1OJ9 A;  5EB5 A;  1PJ6 A;  3UKP A;  3I6D A;  3KVE A;  4A5L A;  4BV6 A;  3AE7 A;  2QA1 A;  1GXF A;  2RGJ A;  3P4P A;  3P1W A;  4K7Z A;  2C76 A;  2IVE A;  3SFD A;  1LPF A;  3UCL A;  2ZBW A;  2GEW A;  1NHR A;  4EQR A;  1OJT A;  2XCG A;  4H4T A;  1GPE A;  4M52 A;  2APG A;  4GUV A;  3G5S A;  2BCG G;  1VRQ B;  2JB3 A;  5JCI A;  3CGE A;  3GRS A;  3C96 A;  2YLR A;  2BXR A;  2UZZ A;  4LA1 A;  3GMB A;  4B69 A;  3ITJ A;  4OPD A;  1GSN A;  3KKJ A;  1JOA A;  4JY3 A;  3COX A;  3CTY A;  3PO7 A;  2VVL G;  4A6N A;  2EQ7 A;  1FEB A;  3C4N A;  1S2Q A;  2DKH A;  4NZH A;  4DNA A;  4YTP A;  1X31 B;  2Y6R A;  2R9Z A;  2YQU A;  4H4R A;  4YT0 A;  4YKF A;  3GMC A;  1IUX A;  2XVF A;  1EL7 A;  2R0C A;  4AOX A;  2W0H A;  3CGC A;  2XFP A;  5CQF A;  1PHH A;  1PN0 A;  1CJ4 A;  2C64 A;  3FBS A;  5KWF A;  1DOD A;  1N4V A;  3QJ4 A;  3VRB A;  2CVJ A;  4EM4 A;  3QSS A;  4H2R A;  4J34 A;  1ZP0 A;  2BS3 A;  2BC0 A;  4OPL A;  5J7X A;  2XLR A;  3UKK A;  1KSU A;  4U2T A;  4WCT A;  4PAB A;  2BYB A;  2YVF A;  5JCM A;  2YWL A;  5C2T A;  1L0V A;  4USR A;  2TPR A;  4N9X A;  3UKF A;  3V76 A;  2YG4 A;  4GDP A;  2WP5 A;  2NVK X;  5LV9 A;  5FS7 A;  4J2W A;  2J3N A;  1ZKQ A;  1NHP A;  1XPQ A;  4DSG A;  1Y56 A;  3KA7 A;  4PAA A;  1M6I A;  1K0J A;  2AQJ A;  3DH9 A;  3NRN A;  3VRA A;  1OJC A;  1EL5 A;  2GR0 A;  2YM1 A;  1PXC A;  2YR4 A;  2XFN A;  2WS3 A;  4EIQ A;  1L9D A;  2VQ7 A;  3NYC A;  1FL2 A;  5KOW A;  3CNP A;  3AEF A;  4A79 A;  4AOS A;  4U2S A;  4U8I A;  2WU5 A;  3AYL A;  3B3R A;  4H2N A;  3CPH G;  2X8H A;  3CN8 A;  1B8S A;  2B9W A;  1JNR A;  2DKI A;  3ICT A;  2EQ9 A;  4CNJ A;  4NTD A;  4BJY A;  1H6V A;  3ISH A;  2YLT A;  3NK1 X;  5M0Z A;  3WE0 A;  1NG3 A;  3II4 A;  1CBO A;  1Y56 B;  1N4U A;  4JQ9 A;  2R4E A;  2WPF A;  5KVH A;  4C5O A;  4J33 A;  5FS9 A;  1D5T A;  1GTH A;  3JSK A;  2C73 A;  3IHG A;  4UDP A;  3KPF A;  2R45 A;  4JY2 A;  2Z5X A;  1DXL A;  1V59 A;  3CPJ G;  3BI4 A;  3AE1 A;  2XVH A;  3BHK A;  1H83 A;  1DOC A;  2GR2 A;  1ZOV A;  2B9X A;  3GD3 A;  3LB8 A;  5FMH A;  1CHU A;  1H82 A;  2JK6 A;  1VQW A;  3UOV A;  4EM3 A;  3ALL A;  4EIP A;  2WDV A;  1REO A;  3NH3 X;  3BHF A;  1FOH A;  3NN0 X;  4IVM B;  5HYM A;  3UOX A;  2XFU A;  3AEG A;  3AE9 A;  3F8R A;  4RG4 A;  4H4S A;  2IID A;  1GRT A;  2X50 A;  1L9C A;  3OZ2 A;  1ONF A;  1GRF A;  1F8W A;  2BS4 A;  2WOI A;  2OA1 A;  3M12 A;  1PS9 A;  3AED A;  4REK A;  2Q0L A;  2Z5Y A;  5U63 A;  4CY6 A;  4D04 A;  4C74 A;  1D7L A;  2O9Z A;  2C75 A;  2R0P A;  2E4G A;  3E1T A;  5TR3 A;  4YSZ A;  4ECH A;  1GV4 A;  1S3E A;  1GT8 A;  2BAC A;  3LZW A;  1KFY A;  3RP7 A;  2OLN A;  4YSX A;  2R0G A;  1E6E A;  2V6O A;  2YLZ A;  4GCM A;  3HZL A;  2E5V A;  1GRE A;  2OLO A;  3I3L A;  2GMH A;  4JNA A;  5IPY A;  4NEV A;  1BKW A;  4H4P A;  3UOZ A;  1CJ3 A;  2WPE A;  3Q6J A;  3QVR A;  3NTD A;  3DGZ A;  1GND A;  1MO9 A;  5EB4 A;  5C3J A;  3EF6 A;  4UP3 A;  2NPX A;  3UKL A;  2YR6 A;  2WU2 A;  2GB0 A;  3P4R A;  1PBF A;  5IQ4 A;  3NG7 X;  1D7Y A;  5U1O A;  1E1N A;  4B1B A;  4OPC A;  4P9S A;  3PS9 A;  3RED A;  4EQS A;  2GV8 A;  1VG0 A;  1OJA A;  4NEW A;  2X8C A;  3LAD A;  4U8P A;  1LVL A;  4A65 A;  2YLS A;  3SQP A;  1D4D A;  2VVL A;  2YVJ A;  2B7R A;  4Z2T A;  1RP0 A;  2C67 A;  2WP6 A;  2XFO A;  2RAB A;  3VQR A;  2Q6U A;  3F8P A;  4B67 A;  5BVA A;  4E0V A;  2X99 A;  5HXI A;  2WDQ A;  1KNP A;  4U2L A;  3GDN A;  1GOS A;  3QSE A;  4IV9 A;  2GRT A;  1Q1R A;  3AD9 B;  1EL8 A;  1JRX A;  2VQB A;  1VG9 A;  3EAO A;  3GWF A;  1FEC A;  1XAN A;  4IVO B;  1COY A;  4ZCD A;  2CFY A;  3GWD A;  4H4X A;  4TLZ A;  2WOV A;  5J60 A;  1QLB A;  1IUW A;  1Q9I A;  3CND A;  2XDO A;  3BNM A;  1Q1W A;  1PBE A;  2XYO A;  3CGD A;  5BRT A;  1BWC A;  1E39 A;  3AE2 A;  3FPZ A;  3RHA A;  1O94 A;  4CCQ A;  1S2Y A;  1TYT A;  4H4V A;  3F8D A;  3AEB A;  3LXD A;  4OPI A;  1NEN A;  1IUT A;  3B6D A;  4USQ A;  1BGN A;  1RSG A;  2WBA A;  1DJN A;  3LZX A;  3NKS A;  4OCG A;  4LII A;  2A8X A;  1TYP A;  3NLC A;  5JCK A;  3M13 A;  3P9U A;  3EPT A;  5KRQ A;  2WEU A;  4B65 A;  3LOV A;  4I59 A;  4K5R A;  4CRT A;  3CIR A;  4I58 A;  1B5Q A;  4Y4L A;  4Z2U A;  2XLT A;  1MXT A;  2IVD A;  3NYF A;  3NGC X;  4U8O A;  1DNC A;  2GF3 A;  3C4A A;  3AYJ A;  3S5W A;  2WQY A;  4U8L A;  4BK3 A;  1PJ5 A;  4YXD A;  2FJB A;  1GRA A;  3ALM A;  3G5Q A;  3PVC A;  5CKU A;  4Z44 A;  1K4Q A;  2JBV A;  1JEH A;  1NG4 A;  2XVJ A;  4TLX A;  4U8J A;  1ZMC A;  2BXS A;  1ZK7 A;  1GET A;  1KNR A;  5FS8 A;  2YM2 A;  1TDO A;  4B68 A;  1P2E A;  1XHC A;  1H7X A;  4U8K A;  5DBJ A;  2PHH A;  4C3X A;  4OPT A;  1GAL A;  1F8R A;  2WPC A;  2RGO A;  3G5R A;  1TDN A;  3VRD B;  3AE4 A;  1TRB A;  1TDF A;  2QAE A;  2GMJ A;  1NHS A;  4XWZ A;  1PBB A;  2H89 A;  4H4W A;  2VVM A;  1YQ3 A;  3AEC A;  2A87 A;  3AE6 A;  4Z26 A;  4H50 A;  2XLU A;  4TM3 A;  4LU6 A;  1GRH A;  4OPG A;  3ATR A;  4Y4N A;  1K0L A;  2JAE A;  3KD9 A;  3RP8 A;  3CNJ A;  3DA1 A;  4RSL A;  4EMJ A;  1B37 A;  3IHM A;  3AYI A;  2GAG B;  4A6N B;  5JCN A;  4AP3 A;  4HB9 A;  1GRB A;  1F3P A;  1XDI A;  2XFQ A;  3FIM B;  4EQW A;  1PJ7 A;  1YQ4 A;  3AE5 A;  2OAM A;  2YLW A;  3ALJ A;  1P2H A;  4DSH A;  2WOW A;  3KU9 A;  2BK4 A;  3AB1 A;  2JKC A;  2VZ2 A;  4UDR A;  4ZCC A;  4HA6 A;  3UTH A;  5JCL A;  3UKA A;  4H2Q A;  4GDE A;  4K8D A;  4B66 A;  4H2P A;  1B4V A;  2WHD A;  3UP4 A;  3AD7 B;  4AT2 A;  4ZN0 A;  1S3B A;  1CF3 A;  1CC2 A;  3IWA A;  2B7S A;  2WES A;  5BUK A;  4H4Z A;  4Y4M A;  2V60 A;  2Y6Q A;  4J56 A;  1YY5 A;  2PYX A;  4B64 A;  1DJQ A;  2XVE A;  2X8G A;  4OVI A;  4H4Y A;  3T37 A;  1GER A;  2C3D A;  4AT0 A;  2EQ6 A;  3UTG A;  3K7M X;  2ACZ A;  4H4U A;  4YKG A;  4IA6 A;  1BF3 A;  5GRT A;  1D4C A;  1E1L A;  4YWO A;  3CGB A;  1GEU A;  3DJE A;  3BI2 A;  3FG2 P;  4IA5 A;  4JNQ A;  1AOG A;  2BK5 A;  2YG6 A;  2WP9 A;  1N4W A;  1IUS A;  1YKJ A;  3UKH A;  2YR5 A;  4RG3 A;  1DOB A;  1CC6 A;  2C65 A;  4UDQ A;  1JRZ A;  4TM4 A;  4Z24 A;  5M10 A;  1FEA A;  2RGH A;  3DK8 A;  1IJH A;  3NIX A;  2B9Y A;  2FJE A;  2VOU A;  1F8S A;  1OJD A;  3GDP A;  3QFB A;  1LTX R;  2C66 A;  4K5S A;  3IF9 A;  2YG7 A;  4CY8 A;  1JRY A;  5EOW A;  3UTF A;  1E7P A;  1Z6L A;  2V3A A;  4BJZ A;  2R46 A;  2YLX A;  4WX1 A;  4YSH A;  2JB1 A;  3IC9 A;  1VDC A;  4NTE A;  3RNM A;  2CUL A;  4XXG A;  3URH A;  1D4E A;  4GRT A;  3K7Q X;  1TDK A;  3H4K A;  2GVC A;  4U8M A;  4Z25 A;  1IUU A;  3UP5 A;  5GSN A;  4Z2R A;  3ICR A;  3CNS A;  1QJD A;  3Q9T A;  4X9M A;  2BC1 A;  2XVI A;  3D1C A;  2WDR A;  3DK9 A;  3L8K A;  1UKV G;  4TM0 A;  4XWR A;  2GH5 A;  3NNE A;  2XLP A;  1KF6 A;  1ZMD A;  3DJJ A;  1GTE A;  1KSS A;  3AE8 A;  1RYI A;  3H8I A;  2TMD A;  5L46 A;  4JDR A;  2BAB A;  1K0I A;  1JU2 A;  1W4X A;  4TM1 A;  3V3N A;  5EBK A;  3VR9 A;  4C3Y A;  2H88 A;  2C72 A;  2V5Z A;  4FK1 C;  4GR1 A;  3EAN A;  3NN6 X;  3P4Q A;  2GR3 A;  4APN A;  3SFE A;  3AEA A;  5HY5 A;  3P4S A;  4CNK A;  1H86 A;  2VRM A;  2EQ8 A;  2VRL A;  4EQX A;  4A9W A;  3GRT A;  3QFA A;  3R9U A;  3FMW A;  4EMI A;  3SGL A;  1LQU A;  1JNZ A;  2C3C A;  2ZZC A;  1E1K A;  1EL9 A;  1E1M A;  3K7T A;  4YTM A;  1NDA A;  1ZDL A;  3AEE A;  5KOX A;  1PXB A;  3GSI A;  3DK4 A;  3NYE A;  4ADW A;  2JB2 A;  3AWI A;  1SEZ A;  4MJW A;  4OPU A;  1NEK A;  5IQ1 A;  5U25 A;  1LJ1 A;  3V3O A;  3DJD A;  2ZZ0 A;  1MOK A;  1HYU A;  2F5Z A;  2YAU A;  1FCD A;  4H4Q A;  5KXJ A;  4FK1 A;  1NHQ A;  4CCR A; 
#chains in the Genus database with same CATH topology
 2A89 A;  4KX6 A;  4BK1 A;  2V3B A;  3HYW A;  4FX9 A;  1CL0 A;  4II3 A;  2ARD A;  4Z43 A;  4CBQ A;  1BGJ A;  1EBD A;  2GR1 A;  2YG3 A;  1ZX9 A;  3LJP A;  1LV0 A;  4X9N A;  1ZOY A;  3ADA B;  3GYI A;  3T31 A;  4U8N A;  3GYJ A;  2BS2 A;  4YTN A;  1CC4 A;  4O5U A;  1ELI A;  2QCU A;  3DJG X;  2CDU A;  3UTE A;  3VR8 A;  1O5W A;  2XLS A;  2V61 A;  3DGH A;  5KVI A;  3O0H A;  1N1P A;  4JN9 A;  4D03 A;  3H8L A;  4GF7 A;  4C77 A;  2BK3 A;  1KDG A;  2GQW A;  3GD4 A;  5ER0 A;  2YG5 A;  5HHF A;  3QVP A;  3K30 A;  3UOY A;  3D8X A;  5FS6 A;  2FJD A;  1PXA A;  4K2X A;  4B63 A;  1BZL A;  1GES A;  4NTC A;  1H7W A;  3AXB A;  3M0O A;  2C70 A;  4KPR A;  2Q7V A;  4A99 A;  4ICY A;  4K22 A;  1O95 A;  4DGK A;  2BA9 A;  3SZ0 A;  1F6M A;  3T2Z A;  2YVG A;  4H7U A;  4EMW A;  2Q0K A;  3OC4 A;  2QA2 A;  3QSM A;  1PBD A;  1NPX A;  4O5Q A;  3NK2 X;  5BUL A;  4J31 A;  3DME A;  3ZDN A;  4FDC B;  1CJC A;  3CMM A;  3RP6 A;  4YSY A;  1ZY8 A;  4X4J A;  1H81 A;  2GAH B;  2WET A;  2FBW A;  3SM8 A;  3ABV A;  1M64 A;  2R4J A;  2FJA A;  4J36 A;  2C7G A;  4G6H A;  2HQM A;  3UKQ A;  1PBC A;  2OAL A;  2GQF A;  3NT6 A;  1L9E A;  1NAA A;  1TDE A;  3BI5 A;  4A7A A;  2B76 A;  2E1M A;  2AR8 A;  3L1R A;  1Y0P A;  1IUV A;  3AE3 A;  1QO8 A;  2ZZB A;  3NK0 X;  2X3N A;  1LQT A;  3ATQ A;  3NTA A;  4BK2 A;  3ZYX A;  3KLJ A;  3CNT A;  2BCP A;  3BNU A;  1CJ2 A;  4AP1 A;  3ICS A;  3CPI G;  1PDH A;  3NHO X;  1H84 A;  1GRG A;  2I0Z A;  2AAQ A;  4J57 A;  3AD8 B;  1DOE A;  4BUR A;  3S61 A;  1YQZ A;  1OJ9 A;  5EB5 A;  1PJ6 A;  3UKP A;  3I6D A;  3KVE A;  4A5L A;  4BV6 A;  3AE7 A;  2QA1 A;  1GXF A;  2RGJ A;  3P4P A;  3P1W A;  4K7Z A;  2C76 A;  2IVE A;  3SFD A;  1LPF A;  3UCL A;  2ZBW A;  2GEW A;  1NHR A;  4EQR A;  1OJT A;  2XCG A;  4H4T A;  1GPE A;  4M52 A;  2APG A;  4GUV A;  3G5S A;  2BCG G;  1VRQ B;  2JB3 A;  5JCI A;  3CGE A;  3GRS A;  3C96 A;  2YLR A;  2BXR A;  2UZZ A;  4LA1 A;  3GMB A;  4B69 A;  3ITJ A;  4OPD A;  1GSN A;  3KKJ A;  1JOA A;  4JY3 A;  3COX A;  3CTY A;  3PO7 A;  2BRA A;  2VVL G;  4A6N A;  2EQ7 A;  1FEB A;  3C4N A;  1S2Q A;  2DKH A;  4NZH A;  4DNA A;  4YTP A;  1X31 B;  2Y6R A;  2R9Z A;  2C4C A;  2YQU A;  4H4R A;  4YKF A;  3GMC A;  4YT0 A;  1IUX A;  2XVF A;  1EL7 A;  2R0C A;  4AOX A;  2W0H A;  3CGC A;  4NWZ A;  2XFP A;  5CQF A;  1PHH A;  1PN0 A;  1CJ4 A;  2C64 A;  3FBS A;  5KWF A;  1DOD A;  3T0K A;  1N4V A;  3QJ4 A;  3VRB A;  2CVJ A;  4EM4 A;  3QSS A;  4H2R A;  4J34 A;  1ZP0 A;  2BS3 A;  2BC0 A;  4OPL A;  5J7X A;  2XLR A;  3UKK A;  1KSU A;  4U2T A;  4WCT A;  4NNJ A;  2BYB A;  2YVF A;  4PAB A;  5JCM A;  2YWL A;  5C2T A;  1L0V A;  4USR A;  2TPR A;  4N9X A;  3UKF A;  3GYX A;  3V76 A;  2YG4 A;  4GDP A;  2WP5 A;  2NVK X;  5LV9 A;  5FS7 A;  4J2W A;  2J3N A;  1ZKQ A;  1NHP A;  1XPQ A;  4DSG A;  1Y56 A;  3KA7 A;  4PAA A;  1M6I A;  1K0J A;  2AQJ A;  3DH9 A;  3NRN A;  3VRA A;  1OJC A;  1EL5 A;  2GR0 A;  2YM1 A;  4G9K A;  1PXC A;  2YR4 A;  4G6G A;  2BRY A;  2XFN A;  2WS3 A;  4EIQ A;  1L9D A;  2VQ7 A;  3NYC A;  1FL2 A;  5KOW A;  3CNP A;  3AEF A;  4A79 A;  4AOS A;  4U2S A;  4U8I A;  2WU5 A;  3AYL A;  3B3R A;  4H2N A;  5KNL A;  3CPH G;  2X8H A;  3CN8 A;  3T14 A;  1B8S A;  2B9W A;  1JNR A;  2DKI A;  3ICT A;  2EQ9 A;  4CNJ A;  4NTD A;  4BJY A;  1H6V A;  3ISH A;  3WE0 A;  2YLT A;  3NK1 X;  5M0Z A;  1NG3 A;  3II4 A;  1CBO A;  1Y56 B;  1N4U A;  4JQ9 A;  2R4E A;  2WPF A;  5KVH A;  4C5O A;  4J33 A;  5FS9 A;  1D5T A;  1GTH A;  3JSK A;  2C73 A;  3IHG A;  4UDP A;  3KPF A;  2R45 A;  4JY2 A;  2Z5X A;  1DXL A;  1V59 A;  3CPJ G;  3BI4 A;  3AE1 A;  2XVH A;  3SX6 A;  3BHK A;  1H83 A;  1DOC A;  2GR2 A;  2B9X A;  1ZOV A;  3GD3 A;  3LB8 A;  5FMH A;  1CHU A;  1H82 A;  2JK6 A;  1VQW A;  3UOV A;  4EM3 A;  3ALL A;  4EIP A;  2WDV A;  1REO A;  3NH3 X;  3BHF A;  1FOH A;  3NN0 X;  4IVM B;  5HYM A;  3UOX A;  2XFU A;  3AEG A;  3AE9 A;  3F8R A;  4RG4 A;  4H4S A;  2IID A;  1GRT A;  2X50 A;  1L9C A;  3SY4 A;  3OZ2 A;  1ONF A;  1GRF A;  1F8W A;  2BS4 A;  2WOI A;  2OA1 A;  3M12 A;  1PS9 A;  3AED A;  4REK A;  2Q0L A;  2Z5Y A;  5U63 A;  4CY6 A;  4D04 A;  4C74 A;  1D7L A;  2O9Z A;  2C75 A;  2R0P A;  2E4G A;  3E1T A;  5TR3 A;  4YSZ A;  4ECH A;  1GV4 A;  1S3E A;  1GT8 A;  2BAC A;  3LZW A;  1KFY A;  3RP7 A;  2OLN A;  4YSX A;  2R0G A;  1E6E A;  2V6O A;  2YLZ A;  4GCM A;  3HZL A;  2E5V A;  1GRE A;  2OLO A;  3I3L A;  2GMH A;  4JNA A;  5IPY A;  4NEV A;  1BKW A;  4H4P A;  3UOZ A;  1CJ3 A;  2WPE A;  4G73 A;  3Q6J A;  3QVR A;  3NTD A;  3DGZ A;  1GND A;  1MO9 A;  5EB4 A;  5C3J A;  3EF6 A;  4UP3 A;  2NPX A;  3UKL A;  2YR6 A;  2WU2 A;  2GB0 A;  3P4R A;  1PBF A;  5IQ4 A;  5KMR A;  3NG7 X;  1D7Y A;  5U1O A;  1E1N A;  4B1B A;  4OPC A;  4P9S A;  3PS9 A;  3RED A;  4EQS A;  2GV8 A;  1VG0 A;  1OJA A;  4NEW A;  5KMS A;  2X8C A;  3LAD A;  4U8P A;  1LVL A;  4A65 A;  2YLS A;  3SQP A;  1D4D A;  2VVL A;  2YVJ A;  2B7R A;  3SZF A;  4Z2T A;  1RP0 A;  2C67 A;  2WP6 A;  2XFO A;  2RAB A;  3VQR A;  2Q6U A;  3F8P A;  4B67 A;  5BVA A;  4E0V A;  2X99 A;  5HXI A;  2WDQ A;  1KNP A;  4U2L A;  3GDN A;  1GOS A;  3QSE A;  4IV9 A;  2GRT A;  1Q1R A;  3AD9 B;  1EL8 A;  1JRX A;  2VQB A;  1VG9 A;  3EAO A;  3GWF A;  1FEC A;  1XAN A;  4IVO B;  1COY A;  4ZCD A;  2CFY A;  3GWD A;  4H4X A;  4TLZ A;  2WOV A;  5J60 A;  1QLB A;  4GAV A;  1IUW A;  1Q9I A;  3CND A;  2XDO A;  3BNM A;  1Q1W A;  1PBE A;  2XYO A;  3CGD A;  5BRT A;  1BWC A;  1E39 A;  3AE2 A;  3FPZ A;  3RHA A;  1O94 A;  4CCQ A;  1S2Y A;  1TYT A;  4H4V A;  3F8D A;  3AEB A;  3LXD A;  4OPI A;  1NEN A;  1IUT A;  3B6D A;  4USQ A;  1BGN A;  1RSG A;  2WBA A;  1DJN A;  3LZX A;  3NKS A;  4OCG A;  4LII A;  2A8X A;  1TYP A;  3NLC A;  5JCK A;  3M13 A;  3P9U A;  3EPT A;  5KRQ A;  2WEU A;  4B65 A;  3LOV A;  4I59 A;  4K5R A;  4CRT A;  3CIR A;  4I58 A;  1B5Q A;  4Y4L A;  4Z2U A;  2XLT A;  1MXT A;  2IVD A;  3NYF A;  3NGC X;  4U8O A;  1DNC A;  2GF3 A;  3C4A A;  3AYJ A;  3S5W A;  2WQY A;  4U8L A;  4BK3 A;  1PJ5 A;  4YXD A;  2FJB A;  1GRA A;  3ALM A;  3G5Q A;  3PVC A;  5CKU A;  4Z44 A;  1K4Q A;  2JBV A;  1JEH A;  1NG4 A;  2XVJ A;  4TLX A;  4U8J A;  1ZMC A;  2BXS A;  1ZK7 A;  1GET A;  1KNR A;  5FS8 A;  2YM2 A;  1TDO A;  4B68 A;  1P2E A;  1XHC A;  1H7X A;  4U8K A;  5DBJ A;  2PHH A;  4C3X A;  4OPT A;  1GAL A;  1F8R A;  2WPC A;  2RGO A;  3G5R A;  1TDN A;  3VRD B;  3AE4 A;  1TRB A;  1TDF A;  2QAE A;  2GMJ A;  1NHS A;  4XWZ A;  1PBB A;  2H89 A;  4H4W A;  2VVM A;  1YQ3 A;  3AEC A;  2A87 A;  3AE6 A;  3HYV A;  4Z26 A;  4H50 A;  2XLU A;  4TM3 A;  4LU6 A;  1GRH A;  4OPG A;  3ATR A;  4Y4N A;  1K0L A;  2JAE A;  3KD9 A;  3RP8 A;  3CNJ A;  3DA1 A;  4RSL A;  4EMJ A;  1B37 A;  3IHM A;  3AYI A;  2GAG B;  4G74 A;  4A6N B;  5JCN A;  4AP3 A;  4HB9 A;  1GRB A;  1F3P A;  1XDI A;  2XFQ A;  3FIM B;  4EQW A;  1PJ7 A;  1YQ4 A;  3AE5 A;  2OAM A;  2YLW A;  3ALJ A;  1P2H A;  4DSH A;  2WOW A;  3KU9 A;  2BK4 A;  3AB1 A;  2JKC A;  3SZC A;  2VZ2 A;  4UDR A;  4ZCC A;  4HA6 A;  3UTH A;  5JCL A;  3UKA A;  4H2Q A;  4GDE A;  4K8D A;  4B66 A;  4H2P A;  1B4V A;  2WHD A;  3UP4 A;  3AD7 B;  3T2Y A;  4AT2 A;  4ZN0 A;  1S3B A;  1CF3 A;  1CC2 A;  3IWA A;  2B7S A;  2WES A;  5BUK A;  4H4Z A;  4Y4M A;  2V60 A;  2Y6Q A;  4J56 A;  1YY5 A;  2PYX A;  4B64 A;  1DJQ A;  2XVE A;  2X8G A;  4OVI A;  4H4Y A;  3T37 A;  1GER A;  2C3D A;  4AT0 A;  2EQ6 A;  3UTG A;  3K7M X;  2ACZ A;  4H4U A;  4YKG A;  4IA6 A;  1BF3 A;  5GRT A;  1D4C A;  1E1L A;  3KPK A;  3CGB A;  4YWO A;  1GEU A;  3DJE A;  3BI2 A;  3FG2 P;  4IA5 A;  4JNQ A;  1AOG A;  2BK5 A;  2YG6 A;  2WP9 A;  1N4W A;  1IUS A;  1YKJ A;  3UKH A;  2YR5 A;  4RG3 A;  1DOB A;  1CC6 A;  2C65 A;  4UDQ A;  1JRZ A;  4TM4 A;  4Z24 A;  5M10 A;  1FEA A;  2RGH A;  3DK8 A;  1IJH A;  3NIX A;  2B9Y A;  2FJE A;  2VOU A;  1F8S A;  1OJD A;  3GDP A;  3QFB A;  1LTX R;  2C66 A;  4K5S A;  3IF9 A;  2YG7 A;  4CY8 A;  1JRY A;  5EOW A;  3UTF A;  5KMQ A;  1E7P A;  1Z6L A;  5KMP A;  2V3A A;  4BJZ A;  4GAP A;  2R46 A;  2YLX A;  4WX1 A;  3SXI A;  4YSH A;  2JB1 A;  3IC9 A;  1VDC A;  4NTE A;  3RNM A;  2CUL A;  4XXG A;  3URH A;  1D4E A;  4GRT A;  3K7Q X;  1TDK A;  3H4K A;  2GVC A;  3HYX A;  4U8M A;  4Z25 A;  1IUU A;  3UP5 A;  5GSN A;  4Z2R A;  3ICR A;  3CNS A;  1QJD A;  3Q9T A;  4X9M A;  2BC1 A;  2XVI A;  3D1C A;  2WDR A;  3DK9 A;  3L8K A;  1UKV G;  4TM0 A;  4XWR A;  2GH5 A;  3NNE A;  2XLP A;  1KF6 A;  1ZMD A;  3DJJ A;  1GTE A;  1KSS A;  3AE8 A;  1RYI A;  3H8I A;  2TMD A;  5L46 A;  4JDR A;  2BAB A;  1K0I A;  1JU2 A;  1W4X A;  4TM1 A;  3V3N A;  5EBK A;  3VR9 A;  4C3Y A;  2H88 A;  2C72 A;  2V5Z A;  4FK1 C;  4GR1 A;  3EAN A;  3NN6 X;  3P4Q A;  2GR3 A;  3T2K A;  4APN A;  3SFE A;  3AEA A;  5HY5 A;  3P4S A;  4CNK A;  1H86 A;  2VRM A;  2EQ8 A;  3SYI A;  2VRL A;  4EQX A;  5KOX A;  4A9W A;  3GRT A;  3QFA A;  3R9U A;  3FMW A;  4EMI A;  3SGL A;  1LQU A;  1JNZ A;  2C3C A;  2ZZC A;  1E1K A;  1EL9 A;  1E1M A;  3K7T A;  4YTM A;  1NDA A;  1ZDL A;  3AEE A;  3SZW A;  1PXB A;  3GSI A;  3DK4 A;  3NYE A;  4ADW A;  2JB2 A;  3AWI A;  1SEZ A;  4MJW A;  4OPU A;  1NEK A;  5IQ1 A;  5U25 A;  1LJ1 A;  3V3O A;  3DJD A;  2ZZ0 A;  1MOK A;  1HYU A;  2F5Z A;  2YAU A;  1FCD A;  4H4Q A;  4II2 A;  4FK1 A;  5KXJ A;  1NHQ A;  4CCR A; 
#chains in the Genus database with same CATH homology
 2A89 A;  4KX6 A;  4BK1 A;  2V3B A;  3HYW A;  4FX9 A;  1CL0 A;  4II3 A;  2ARD A;  4Z43 A;  4CBQ A;  1BGJ A;  1EBD A;  2GR1 A;  2YG3 A;  1ZX9 A;  3LJP A;  1LV0 A;  4X9N A;  1ZOY A;  3ADA B;  3GYI A;  3T31 A;  4U8N A;  3GYJ A;  2BS2 A;  4YTN A;  1CC4 A;  4O5U A;  1ELI A;  2QCU A;  3DJG X;  2CDU A;  3UTE A;  3VR8 A;  1O5W A;  2XLS A;  2V61 A;  3DGH A;  5KVI A;  3O0H A;  1N1P A;  4JN9 A;  4D03 A;  3H8L A;  4GF7 A;  4C77 A;  2BK3 A;  1KDG A;  2GQW A;  3GD4 A;  5ER0 A;  2YG5 A;  5HHF A;  3QVP A;  3K30 A;  3UOY A;  3D8X A;  5FS6 A;  2FJD A;  1PXA A;  4K2X A;  4B63 A;  1BZL A;  1GES A;  4NTC A;  1H7W A;  3AXB A;  3M0O A;  2C70 A;  4KPR A;  2Q7V A;  4A99 A;  4ICY A;  4K22 A;  1O95 A;  4DGK A;  2BA9 A;  3SZ0 A;  1F6M A;  3T2Z A;  2YVG A;  4H7U A;  4EMW A;  2Q0K A;  3OC4 A;  2QA2 A;  3QSM A;  1PBD A;  1NPX A;  4O5Q A;  3NK2 X;  5BUL A;  4J31 A;  3DME A;  3ZDN A;  4FDC B;  1CJC A;  3CMM A;  3RP6 A;  4YSY A;  1ZY8 A;  4X4J A;  1H81 A;  2GAH B;  2WET A;  2FBW A;  3SM8 A;  3ABV A;  1M64 A;  2R4J A;  2FJA A;  4J36 A;  2C7G A;  4G6H A;  2HQM A;  3UKQ A;  1PBC A;  2OAL A;  2GQF A;  3NT6 A;  1L9E A;  1NAA A;  1TDE A;  3BI5 A;  4A7A A;  2B76 A;  2E1M A;  2AR8 A;  3L1R A;  1Y0P A;  1IUV A;  3AE3 A;  1QO8 A;  2ZZB A;  3NK0 X;  2X3N A;  1LQT A;  3ATQ A;  3NTA A;  4BK2 A;  3ZYX A;  3KLJ A;  3CNT A;  2BCP A;  3BNU A;  1CJ2 A;  4AP1 A;  3ICS A;  3CPI G;  1PDH A;  3NHO X;  1H84 A;  1GRG A;  2I0Z A;  2AAQ A;  4J57 A;  3AD8 B;  1DOE A;  4BUR A;  3S61 A;  1YQZ A;  1OJ9 A;  5EB5 A;  1PJ6 A;  3UKP A;  3I6D A;  3KVE A;  4A5L A;  4BV6 A;  3AE7 A;  2QA1 A;  1GXF A;  2RGJ A;  3P4P A;  3P1W A;  4K7Z A;  2C76 A;  2IVE A;  3SFD A;  1LPF A;  3UCL A;  2ZBW A;  2GEW A;  1NHR A;  4EQR A;  1OJT A;  2XCG A;  4H4T A;  1GPE A;  4M52 A;  2APG A;  4GUV A;  3G5S A;  2BCG G;  1VRQ B;  2JB3 A;  5JCI A;  3CGE A;  3GRS A;  3C96 A;  2YLR A;  2BXR A;  2UZZ A;  4LA1 A;  3GMB A;  4B69 A;  3ITJ A;  4OPD A;  1GSN A;  3KKJ A;  1JOA A;  4JY3 A;  3COX A;  3CTY A;  3PO7 A;  2BRA A;  2VVL G;  4A6N A;  2EQ7 A;  1FEB A;  3C4N A;  1S2Q A;  2DKH A;  4NZH A;  4DNA A;  4YTP A;  1X31 B;  2Y6R A;  2R9Z A;  2C4C A;  2YQU A;  4H4R A;  4YKF A;  3GMC A;  4YT0 A;  1IUX A;  2XVF A;  1EL7 A;  2R0C A;  4AOX A;  2W0H A;  3CGC A;  4NWZ A;  2XFP A;  5CQF A;  1PHH A;  1PN0 A;  1CJ4 A;  2C64 A;  3FBS A;  5KWF A;  1DOD A;  3T0K A;  1N4V A;  3QJ4 A;  3VRB A;  2CVJ A;  4EM4 A;  3QSS A;  4H2R A;  4J34 A;  1ZP0 A;  2BS3 A;  2BC0 A;  4OPL A;  5J7X A;  2XLR A;  3UKK A;  1KSU A;  4U2T A;  4WCT A;  4NNJ A;  2BYB A;  2YVF A;  4PAB A;  5JCM A;  2YWL A;  5C2T A;  1L0V A;  4USR A;  2TPR A;  4N9X A;  3UKF A;  3GYX A;  3V76 A;  2YG4 A;  4GDP A;  2WP5 A;  2NVK X;  5LV9 A;  5FS7 A;  4J2W A;  2J3N A;  1ZKQ A;  1NHP A;  1XPQ A;  4DSG A;  1Y56 A;  3KA7 A;  4PAA A;  1M6I A;  1K0J A;  2AQJ A;  3DH9 A;  3NRN A;  3VRA A;  1OJC A;  1EL5 A;  2GR0 A;  2YM1 A;  4G9K A;  1PXC A;  2YR4 A;  4G6G A;  2BRY A;  2XFN A;  2WS3 A;  4EIQ A;  1L9D A;  2VQ7 A;  3NYC A;  1FL2 A;  5KOW A;  3CNP A;  3AEF A;  4A79 A;  4AOS A;  4U2S A;  4U8I A;  2WU5 A;  3AYL A;  3B3R A;  4H2N A;  5KNL A;  3CPH G;  2X8H A;  3CN8 A;  3T14 A;  1B8S A;  2B9W A;  1JNR A;  2DKI A;  3ICT A;  2EQ9 A;  4CNJ A;  4NTD A;  4BJY A;  1H6V A;  3ISH A;  2YLT A;  3NK1 X;  5M0Z A;  3WE0 A;  1NG3 A;  3II4 A;  1CBO A;  1Y56 B;  1N4U A;  4JQ9 A;  2R4E A;  2WPF A;  5KVH A;  4C5O A;  4J33 A;  5FS9 A;  1D5T A;  1GTH A;  3JSK A;  2C73 A;  3IHG A;  4UDP A;  3KPF A;  2R45 A;  4JY2 A;  2Z5X A;  1DXL A;  1V59 A;  3CPJ G;  3BI4 A;  3AE1 A;  2XVH A;  3SX6 A;  3BHK A;  1H83 A;  1DOC A;  2GR2 A;  1ZOV A;  2B9X A;  3GD3 A;  3LB8 A;  5FMH A;  1CHU A;  1H82 A;  2JK6 A;  1VQW A;  3UOV A;  4EM3 A;  3ALL A;  4EIP A;  2WDV A;  1REO A;  3NH3 X;  3BHF A;  1FOH A;  3NN0 X;  4IVM B;  5HYM A;  3UOX A;  2XFU A;  3AEG A;  3AE9 A;  3F8R A;  4RG4 A;  4H4S A;  2IID A;  1GRT A;  2X50 A;  1L9C A;  3SY4 A;  3OZ2 A;  1ONF A;  1GRF A;  1F8W A;  2BS4 A;  2WOI A;  2OA1 A;  3M12 A;  1PS9 A;  3AED A;  4REK A;  2Q0L A;  2Z5Y A;  5U63 A;  4CY6 A;  4D04 A;  4C74 A;  1D7L A;  2O9Z A;  2C75 A;  2R0P A;  2E4G A;  3E1T A;  5TR3 A;  4YSZ A;  4ECH A;  1GV4 A;  1S3E A;  1GT8 A;  2BAC A;  3LZW A;  1KFY A;  3RP7 A;  2OLN A;  4YSX A;  2R0G A;  1E6E A;  2V6O A;  2YLZ A;  4GCM A;  3HZL A;  2E5V A;  1GRE A;  2OLO A;  3I3L A;  2GMH A;  4JNA A;  5IPY A;  4NEV A;  1BKW A;  4H4P A;  3UOZ A;  1CJ3 A;  2WPE A;  4G73 A;  3Q6J A;  3QVR A;  3NTD A;  3DGZ A;  1GND A;  1MO9 A;  5EB4 A;  5C3J A;  3EF6 A;  4UP3 A;  2NPX A;  3UKL A;  2YR6 A;  2WU2 A;  2GB0 A;  3P4R A;  1PBF A;  5IQ4 A;  5KMR A;  3NG7 X;  1D7Y A;  5U1O A;  1E1N A;  4B1B A;  4OPC A;  4P9S A;  3PS9 A;  3RED A;  4EQS A;  2GV8 A;  1VG0 A;  1OJA A;  4NEW A;  5KMS A;  2X8C A;  3LAD A;  4U8P A;  1LVL A;  4A65 A;  2YLS A;  3SQP A;  1D4D A;  2VVL A;  2YVJ A;  2B7R A;  3SZF A;  4Z2T A;  1RP0 A;  2C67 A;  2WP6 A;  2XFO A;  2RAB A;  3VQR A;  2Q6U A;  3F8P A;  4B67 A;  5BVA A;  4E0V A;  2X99 A;  5HXI A;  2WDQ A;  1KNP A;  4U2L A;  3GDN A;  1GOS A;  3QSE A;  4IV9 A;  2GRT A;  1Q1R A;  3AD9 B;  1EL8 A;  1JRX A;  2VQB A;  1VG9 A;  3EAO A;  3GWF A;  1FEC A;  1XAN A;  4IVO B;  1COY A;  4ZCD A;  2CFY A;  3GWD A;  4H4X A;  4TLZ A;  2WOV A;  5J60 A;  1QLB A;  4GAV A;  1IUW A;  1Q9I A;  3CND A;  2XDO A;  3BNM A;  1Q1W A;  1PBE A;  2XYO A;  3CGD A;  5BRT A;  1BWC A;  1E39 A;  3AE2 A;  3FPZ A;  3RHA A;  1O94 A;  4CCQ A;  1S2Y A;  1TYT A;  4H4V A;  3F8D A;  3AEB A;  3LXD A;  4OPI A;  1NEN A;  1IUT A;  3B6D A;  4USQ A;  1BGN A;  1RSG A;  2WBA A;  1DJN A;  3LZX A;  3NKS A;  4OCG A;  4LII A;  2A8X A;  1TYP A;  3NLC A;  5JCK A;  3M13 A;  3P9U A;  3EPT A;  5KRQ A;  2WEU A;  4B65 A;  3LOV A;  4I59 A;  4K5R A;  4CRT A;  3CIR A;  4I58 A;  1B5Q A;  4Y4L A;  4Z2U A;  2XLT A;  1MXT A;  2IVD A;  3NYF A;  3NGC X;  4U8O A;  1DNC A;  2GF3 A;  3C4A A;  3AYJ A;  3S5W A;  2WQY A;  4U8L A;  4BK3 A;  1PJ5 A;  4YXD A;  2FJB A;  1GRA A;  3ALM A;  3G5Q A;  3PVC A;  5CKU A;  4Z44 A;  1K4Q A;  2JBV A;  1JEH A;  1NG4 A;  2XVJ A;  4TLX A;  4U8J A;  1ZMC A;  2BXS A;  1ZK7 A;  1GET A;  1KNR A;  5FS8 A;  2YM2 A;  1TDO A;  4B68 A;  1P2E A;  1XHC A;  1H7X A;  4U8K A;  5DBJ A;  2PHH A;  4C3X A;  4OPT A;  1GAL A;  1F8R A;  2WPC A;  2RGO A;  3G5R A;  1TDN A;  3VRD B;  3AE4 A;  1TRB A;  1TDF A;  2QAE A;  2GMJ A;  1NHS A;  4XWZ A;  1PBB A;  2H89 A;  4H4W A;  2VVM A;  1YQ3 A;  3AEC A;  2A87 A;  3AE6 A;  3HYV A;  4Z26 A;  4H50 A;  2XLU A;  4TM3 A;  4LU6 A;  1GRH A;  4OPG A;  3ATR A;  4Y4N A;  1K0L A;  2JAE A;  3KD9 A;  3RP8 A;  3CNJ A;  3DA1 A;  4RSL A;  4EMJ A;  1B37 A;  3IHM A;  3AYI A;  2GAG B;  4G74 A;  4A6N B;  5JCN A;  4AP3 A;  4HB9 A;  1GRB A;  1F3P A;  1XDI A;  2XFQ A;  3FIM B;  4EQW A;  1PJ7 A;  1YQ4 A;  3AE5 A;  2OAM A;  2YLW A;  3ALJ A;  1P2H A;  4DSH A;  2WOW A;  3KU9 A;  2BK4 A;  3AB1 A;  2JKC A;  3SZC A;  2VZ2 A;  4UDR A;  4ZCC A;  4HA6 A;  3UTH A;  5JCL A;  3UKA A;  4H2Q A;  4GDE A;  4K8D A;  4B66 A;  4H2P A;  1B4V A;  2WHD A;  3UP4 A;  3AD7 B;  3T2Y A;  4AT2 A;  4ZN0 A;  1S3B A;  1CF3 A;  1CC2 A;  3IWA A;  2B7S A;  2WES A;  5BUK A;  4H4Z A;  4Y4M A;  2V60 A;  2Y6Q A;  4J56 A;  1YY5 A;  2PYX A;  4B64 A;  1DJQ A;  2XVE A;  2X8G A;  4OVI A;  4H4Y A;  3T37 A;  1GER A;  2C3D A;  4AT0 A;  2EQ6 A;  3UTG A;  3K7M X;  2ACZ A;  4H4U A;  4YKG A;  4IA6 A;  1BF3 A;  5GRT A;  1D4C A;  1E1L A;  3KPK A;  3CGB A;  4YWO A;  1GEU A;  3DJE A;  3BI2 A;  3FG2 P;  4IA5 A;  4JNQ A;  1AOG A;  2BK5 A;  2YG6 A;  2WP9 A;  1N4W A;  1IUS A;  1YKJ A;  3UKH A;  2YR5 A;  4RG3 A;  1DOB A;  1CC6 A;  2C65 A;  4UDQ A;  1JRZ A;  4TM4 A;  4Z24 A;  5M10 A;  1FEA A;  2RGH A;  3DK8 A;  1IJH A;  3NIX A;  2B9Y A;  2FJE A;  2VOU A;  1F8S A;  1OJD A;  3GDP A;  3QFB A;  1LTX R;  2C66 A;  4K5S A;  3IF9 A;  2YG7 A;  4CY8 A;  1JRY A;  5EOW A;  3UTF A;  5KMQ A;  1E7P A;  1Z6L A;  5KMP A;  2V3A A;  4BJZ A;  4GAP A;  2R46 A;  2YLX A;  4WX1 A;  3SXI A;  4YSH A;  2JB1 A;  3IC9 A;  1VDC A;  4NTE A;  3RNM A;  2CUL A;  4XXG A;  3URH A;  1D4E A;  4GRT A;  3K7Q X;  1TDK A;  3H4K A;  2GVC A;  3HYX A;  4U8M A;  4Z25 A;  1IUU A;  3UP5 A;  5GSN A;  4Z2R A;  3ICR A;  3CNS A;  1QJD A;  3Q9T A;  4X9M A;  2BC1 A;  2XVI A;  3D1C A;  2WDR A;  3DK9 A;  3L8K A;  1UKV G;  4TM0 A;  4XWR A;  2GH5 A;  3NNE A;  2XLP A;  1KF6 A;  1ZMD A;  3DJJ A;  1GTE A;  1KSS A;  3AE8 A;  1RYI A;  3H8I A;  2TMD A;  5L46 A;  4JDR A;  2BAB A;  1K0I A;  1JU2 A;  1W4X A;  4TM1 A;  3V3N A;  5EBK A;  3VR9 A;  4C3Y A;  2H88 A;  2C72 A;  2V5Z A;  4FK1 C;  4GR1 A;  3EAN A;  3NN6 X;  3P4Q A;  2GR3 A;  3T2K A;  4APN A;  3SFE A;  3AEA A;  5HY5 A;  3P4S A;  4CNK A;  1H86 A;  2VRM A;  2EQ8 A;  3SYI A;  2VRL A;  4EQX A;  5KOX A;  4A9W A;  3GRT A;  3QFA A;  3R9U A;  3FMW A;  4EMI A;  3SGL A;  1LQU A;  1JNZ A;  2C3C A;  2ZZC A;  1E1K A;  1EL9 A;  1E1M A;  3K7T A;  4YTM A;  1NDA A;  1ZDL A;  3AEE A;  3SZW A;  1PXB A;  3GSI A;  3DK4 A;  3NYE A;  4ADW A;  2JB2 A;  3AWI A;  1SEZ A;  4MJW A;  4OPU A;  1NEK A;  5IQ1 A;  5U25 A;  1LJ1 A;  3V3O A;  3DJD A;  2ZZ0 A;  1MOK A;  1HYU A;  2F5Z A;  2YAU A;  1FCD A;  4H4Q A;  4II2 A;  4FK1 A;  5KXJ A;  1NHQ A;  4CCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...