3F8PA

Structure of sulfolobus solfataricus trxr-b3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
VKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENEFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase (TrxB-3)
publication title Structure and stability of a thioredoxin reductase from Sulfolobus solfataricus: a thermostable protein with two functions
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.6.4.5: Transferred entry: 1.8.1.9.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA02
1DOCA 3AWIA 2C65A 3ICSA 4K22A 1PN0A 2VQBA 4YKGA 4YT0A 5BRTA 1O5WA 2YM2A 1GTHA 3VR8A 3AE9A 3CNTA 5GRTA 3NHOX 2TMDA 3HZLA 4BK3A 2V3BA 3BNUA 4K8DA 1M6IA 1CC6A 4EQRA 2Q7VA 5M10A 2CULA 3FMWA 4H4YA 4TM0A 5FS9A 3LZWA 3GRTA 3NN6X 3OZ2A 4B64A 3GD3A 1S3EA 3AYJA 4J36A 1K0LA 2E1MA 1GXFA 3GSIA 4XXGA 4LIIA 1D7YA 3UKAA 1TDKA 3QVPA 1EL8A 3CGEA 4OPIA 3RP6A 3WE0A 3K7TA 3AEFA 5L46A 3NYCA 1DOEA 4CY6A 4H7UA 2VVLG 1ZOYA 2FJDA 3GDPA 2WU5A 2YLTA 4WCTA 4ZCCA 2ACZA 2QCUA 3NK1X 3VRDB 2IVDA 2YLSA 1MOKA 2TPRA 2C64A 2ZZ0A 1VG0A 2WOVA 3KA7A 2C76A 5IPYA 3QJ4A 2JAEA 1XDIA 1FL2A 3IWAA 4U8NA 3V76A 3COXA 2XVHA 3GYJA 3IF9A 3B6DA 2B7SA 3KKJA 1ZKQA 5LV9A 1ZX9A 2R0GA 4FK1C 3NYFA 2XLRA 4C74A 4A6NB 3UKKA 1UKVG 1ZK7A 4U8IA 3UOVA 1N1PA 3AEDA 5U25A 4C3YA 1F6MA 2I0ZA 1S2YA 4CY8A 4YSYA 4Z43A 2VQ7A 2YG4A 3CGBA 2Q0LA 4NTCA 4U8PA 1PS9A 3G5RA 2WOIA 3G5SA 1RP0A 2VRLA 4U8MA 3RP7A 2GRTA 2B9YA 2AR8A 5FS8A 4DGKA 3EF6A 4UDQA 3CNJA 3DK4A 2XLUA 1PBEA 1OJCA 1JU2A 1MXTA 2X8GA 1NHRA 4BURA 1BGNA 4H4TA 2EQ8A 4AOSA 3ITJA 2XFNA 3FBSA 1ZY8A 2BS3A 4UDRA 4DSHA 4Z2UA 3O0HA 4A7AA 2C7GA 2XVEA 1GRGA 5J60A 4PAAA 4REKA 1KNPA 3QVRA 5M0ZA 1DNCA 3NNEA 4OPLA 4JY2A 3M0OA 3P4PA 2GR0A 4JN9A 3DH9A 3CNPA 1REOA 1IUVA 4TM1A 1JRYA 4IA5A 4BK2A 3AE3A 4J2WA 4K5RA 3KLJA 3AECA 3CNDA 1JEHA 2WPCA 5EB4A 2V61A 2WESA 3K7QX 1TDFA 4Z2RA 2Y6RA 1GRBA 2XVIA 1D4DA 3UTGA 1FECA 3NLCA 1GEUA 1X31B 1MO9A 1RYIA 4J34A 1IJHA 3CPJG 3LOVA 5HXIA 1H6VA 1H7XA 2BABA 2EQ7A 2VVLA 3FG2P 3REDA 4H2RA 1KDGA 2QA2A 2YVJA 2YVGA 4H4QA 4EMIA 2FJEA 1W4XA 2XCGA 3AEGA 5JCLA 4CCRA 2Y6QA 4WX1A 3SFEA 1TYTA 4ZN0A 2F5ZA 1PXCA 1E1LA 1GRTA 3C96A 1DOBA 4A6NA 3SFDA 3H8LA 3ISHA 3B3RA 3AD7B 4YSZA 3UP5A 2NVKX 2YG7A 4ICYA 2YM1A 3I6DA 3R9UA 1N4WA 1FEBA 1PBCA 5EBKA 1KSSA 1ZOVA 3F8DA 1Z6LA 1CF3A 4Z2TA 2YLZA 2YVFA 1VRQB 2PHHA 4USQA 4BJZA 4XWRA 2Q0KA 3NRNA 1N4UA 3CN8A 2XFPA 1PDHA 4U8LA 5FMHA 2W0HA 2GH5A 1CBOA 1CJ3A 1M64A 2OLOA 3LB8A 3NTAA 1H82A 3II4A 3GWDA 1LQTA 4EM4A 1ZP0A 2JKCA 3GWFA 4IA6A 1RSGA 3GMCA 1CL0A 3UKHA 3LZXA 3PO7A 3Q9TA 3IC9A 5EOWA 3JSKA 2BS4A 4J33A 5KWFA 3ZYXA 4U2LA 3CIRA 1S3BA 2R0CA 4CCQA 2YLWA 3NN0X 1B37A 2C75A 4TM3A 1QO8A 4B65A 4IV9A 4N9XA 4NEWA 3ICTA 5KVHA 2YG6A 4X9MA 4H4WA 4DNAA 2BC1A 2XLTA 3D8XA 2WBAA 3UP4A 3NK0X 4UDPA 1XANA 2FJBA 1GT8A 2WP9A 4H2QA 3DGZA 1JNRA 4Y4MA 2JBVA 4Z44A 5KRQA 4B69A 2JB2A 4I59A 3KPFA 2WDQA 1CJCA 4H4XA 2OALA 1DJQA 3AE7A 2GQFA 1L9EA 3NTDA 4U8JA 1TRBA 3OC4A 3AE8A 3CGCA 5JCIA 4H4RA 1HYUA 1YKJA 4H4VA 1F3PA 2BS2A 2X50A 4JDRA 5U63A 1KF6A 1FEAA 3DK9A 3UKFA 2WDVA 1E1MA 3AE4A 2ZBWA 4KPRA 4NTEA 4GDPA 4NZHA 4A65A 1F8RA 5J7XA 4E0VA 4OPTA 5C2TA 1DJNA 2B76A 1TDOA 1CJ2A 3NGCX 4YSXA 5JCKA 2R0PA 1EL7A 4C5OA 3LXDA 2YWLA 2RGJA 2WPFA 2BCPA 2GMJA 2WS3A 4K2XA 3ALLA 3EPTA 4JQ9A 2GMHA 4CRTA 1BKWA 2XYOA 4UP3A 1GETA 1P2HA 4IVMB 3AD9B 3P9UA 3AB1A 4Z24A 5KXJA 3NIXA 1PJ7A 3NG7X 5ER0A 1KNRA 3AYIA 2R9ZA 3AE1A 2WEUA 3IHGA 3VQRA 1VQWA 3QFAA 1JRXA 3GDNA 4LU6A 1IUTA 2BK5A 4CNJA 4PABA 3AE6A 4EMWA 4U8OA 1D5TA 2JK6A 2Z5XA 2GF3A 4OVIA 1ZMCA 3AXBA 2GR3A 1LV0A 5HYMA 1GREA 2R4EA 1AOGA 4HA6A 1K0JA 1PBDA 1GRHA 1K4QA 2ZZCA 2GB0A 2V6OA 2V5ZA 3RHAA 4EIPA 4YXDA 1NG3A 1NHSA 2GAHB 4D03A 1PXBA 3EAOA 4Z25A 1H86A 3GRSA 2GQWA 4AP1A 4BV6A 1EL9A 3DJEA 1D4EA 2A89A 3AYLA 1IUSA 3D1CA 4X9NA 2VRMA 5GSNA 1NG4A 3UOXA 1ZDLA 2E4GA 1E1KA 1GTEA 5JCMA 2GVCA 3P1WA 2X3NA 1YQ4A 2RABA 1PJ5A 2BCGG 2C3CA 3UKPA 2R46A 2GAGB 2BA9A 3ALMA 1TDEA 2JB3A 3DJJA 4H4UA 4O5QA 1H83A 4M52A 4FDCB 1EL5A 1V59A 1LTXR 1L9DA 4EQXA 2CDUA 4H4ZA 1BGJA 4A5LA 1D4CA 4GCMA 2O9ZA 2A8XA 1LPFA 1QJDA 4TM4A 2HQMA 2R45A 3P4QA 3Q6JA 4Y4NA 4K7ZA 1GNDA 3LADA 4YTMA 1GRAA 2VVMA 2YG5A 2EQ6A 2XDOA 2VOUA 2XLPA 3AEAA 4B67A 2R4JA 1K0IA 3BI2A 3ADAB 4H4PA 2YR5A 1CC2A 1E6EA 5C3JA 1DXLA 3KVEA 3NKSA 5CKUA 3DMEA 3VR9A 4RG4A 2UZZA 2GR1A 3DJDA 3C4NA 2BC0A 3AE2A 3CTYA 4OPDA 4U8KA 4BJYA 5BULA 1GERA 1SEZA 1JOAA 5DBJA 1B4VA 3P4SA 3ALJA 2ZZBA 3BHKA 3QSMA 1E39A 1Y56B 3K30A 4GF7A 4B1BA 2XFOA 3F8RA 4FX9A 4U2SA 1Q1RA 5IQ1A 1KFYA 3G5QA 4A79A 3ATQA 1JRZA 3GMBA 2BK4A 2WOWA 4EQSA 1ONFA 1F8SA 4USRA 2NPXA 4AP3A 2WP5A 2WP6A 2E5VA 3UCLA 1VDCA 4ZCDA 4AOXA 1XPQA 2JB1A 3I3LA 3UTHA 1IUUA 4Z26A 2WQYA 1O94A 1H81A 4A9WA 2YG3A 2C66A 4AT2A 1GPEA 1Q9IA 5CQFA 5KVIA 2YQUA 5IQ4A 3PS9A 3UTEA 1YY5A 1N4VA 2DKHA 3BHFA 3NYEA 2YR4A 3UOYA 3C4AA 4B66A 4A99A 4C77A 1B5QA 1GALA 1H7WA 2A87A 2OAMA 4H50A 5TR3A 2X8HA 3NT6A 1YQ3A 2YLRA 1OJAA 1D7LA 1PBBA 4APNA 1XHCA 2X8CA 1NDAA 4EQWA 5JCNA 4CNKA 2WETA 2IIDA 4EMJA 2PYXA 4GR1A 2Q6UA 2X99A 3UKLA 3ICRA 3M13A 1PXAA 4D04A 5BUKA 4OCGA 3E1TA 3VRBA 1F8WA 2H88A 1VG9A 1IUWA 5HHFA 4J57A 4U2TA 2OLNA 1S2QA 3RP8A 2J3NA 2GEWA 4H4SA 3M12A 1FCDA 1YQZA 2EQ9A 1PJ6A 1LVLA 3QSEA 3CNSA 4LA1A 2IVEA 2XLSA 2WHDA 4B63A 3QFBA 3AD8B 3CPHG 4X4JA 4H2PA 2WDRA 4OPGA 5KOXA 3DJGX 3H4KA 2OA1A 1CJ4A 4GUVA 2ARDA 2YAUA 4ECHA 3AE5A 1OJDA 3LJPA 4OPUA 2AQJA 3L1RA 3SM8A 2V3AA 2B9XA 3BI4A 4YTPA 3DK8A 1BWCA 1P2EA 2BXSA 4EIQA 2APGA 2YLXA 1DODA 1H84A 3AEEA 2RGHA 3CGDA 3S61A 2WU2A 1NENA 1Y0PA 4I58A 3GD4A 1PBFA 3KU9A 5EB5A 4ADWA 2GR2A 2XFQA 1NHQA 2XVJA 4B68A 1GSNA 1L9CA 1TYPA 2YR6A 3P4RA 4C3XA 1LQUA 3BI5A 4JNQA 4JNAA 4NTDA 3UOZA 2BXRA 4GDEA 2QAEA 1BZLA 3F8PA 3AEBA 4NEVA 3CPIG 1PHHA 3URHA 2RGOA 2C3DA 4OPCA 3RNMA 1EBDA 4RSLA 4J56A 3ATRA 3FPZA 4DSGA 4GRTA 4K5SA 5KOWA 1NHPA 2AAQA 2BYBA 1LJ1A 2XFUA 3ABVA 4Y4LA 5HY5A 3BNMA 2DKIA 2H89A 1KSUA 2FJAA 1Q1WA 3DA1A 2C70A 2V60A 3QSSA 5BVAA 4O5UA 1FOHA 1CC4A 2B7RA 2C73A 2C67A 4TLZA 3S5WA 1IUXA 2BACA 2WPEA 3V3OA 1BF3A 4YTNA 3NK2X 2GV8A 3IHMA 1NPXA 3PVCA 2QA1A 4BK1A 2FBWA 1B8SA 4HB9A 4CBQA 4AT0A 3ZDNA 2C72A 1L0VA 2B9WA 1GOSA 4KX6A 1COYA 1O95A 3V3NA 4XWZA 5U1OA 2XVFA 2Z5YA 1JNZA 4RG3A 3UKQA 1NEKA 1E1NA 3DGHA 3SGLA 4EM3A 3H8IA 1QLBA 3EANA 4P9SA 4YSHA 3NH3X 4YWOA 1OJ9A 2BK3A 2VZ2A 2CVJA 3K7MX 5FS6A 3T37A 1GRFA 3GYIA 2CFYA 3UTFA 1GESA 1CHUA 3KD9A 1ZMDA 5FS7A 4H2NA 4YKFA 3VRAA 1TDNA 4IVOB 1GV4A 4TLXA 1NAAA 1E7PA 4J31A 1Y56A 3L8KA 4JY3A 1OJTA 4MJWA 3SQPA 3FIMB 4FK1A 1ELIA
chains in the Genus database with same CATH superfamily
1DOCA 3AWIA 2C65A 3ICSA 4K22A 1PN0A 2VQBA 4YKGA 4YT0A 5BRTA 1O5WA 2YM2A 1GTHA 3VR8A 3AE9A 3CNTA 5GRTA 3NHOX 2TMDA 3HZLA 4BK3A 2V3BA 3BNUA 4K8DA 1M6IA 1CC6A 4EQRA 2Q7VA 5M10A 2CULA 3FMWA 4H4YA 4TM0A 5FS9A 3LZWA 3GRTA 3NN6X 3OZ2A 4B64A 3GD3A 1S3EA 3AYJA 4J36A 1K0LA 2E1MA 1GXFA 3GSIA 4XXGA 4LIIA 1D7YA 3UKAA 1TDKA 3QVPA 1EL8A 3CGEA 4OPIA 3RP6A 3WE0A 3K7TA 3AEFA 5L46A 3NYCA 1DOEA 4CY6A 4H7UA 2VVLG 1ZOYA 2FJDA 3GDPA 2WU5A 2YLTA 4WCTA 4ZCCA 2ACZA 2QCUA 3NK1X 3VRDB 2IVDA 2YLSA 1MOKA 2TPRA 2C64A 2ZZ0A 1VG0A 2WOVA 3KA7A 2C76A 5IPYA 3QJ4A 2JAEA 1XDIA 1FL2A 3IWAA 4U8NA 3V76A 3COXA 2XVHA 3GYJA 3IF9A 3B6DA 2B7SA 3KKJA 1ZKQA 5LV9A 1ZX9A 2R0GA 4FK1C 3NYFA 3T14A 2XLRA 4C74A 4A6NB 3UKKA 1UKVG 1ZK7A 4U8IA 3UOVA 1N1PA 3AEDA 5U25A 4C3YA 1F6MA 2I0ZA 1S2YA 4CY8A 4YSYA 4Z43A 2VQ7A 2YG4A 3SZ0A 3CGBA 2Q0LA 4NTCA 4U8PA 1PS9A 3G5RA 2WOIA 3G5SA 1RP0A 2VRLA 4U8MA 3RP7A 2GRTA 2B9YA 2AR8A 5FS8A 4DGKA 3EF6A 4UDQA 3CNJA 3DK4A 3HYXA 2XLUA 1PBEA 1OJCA 1JU2A 1MXTA 2X8GA 1NHRA 4BURA 1BGNA 4H4TA 2EQ8A 4AOSA 3CMMA 3ITJA 2XFNA 3FBSA 1ZY8A 2BS3A 4UDRA 4DSHA 4Z2UA 3O0HA 4A7AA 2C7GA 2XVEA 1GRGA 5J60A 4PAAA 4REKA 1KNPA 3QVRA 5M0ZA 1DNCA 3NNEA 4OPLA 4JY2A 3M0OA 3P4PA 2GR0A 4JN9A 3DH9A 3CNPA 1REOA 1IUVA 4TM1A 1JRYA 4IA5A 4BK2A 3AE3A 4G73A 4J2WA 4K5RA 3KLJA 3AECA 3CNDA 1JEHA 2WPCA 5EB4A 2V61A 2WESA 3K7QX 1TDFA 4Z2RA 2Y6RA 1GRBA 2XVIA 1D4DA 3UTGA 1FECA 3NLCA 1GEUA 1X31B 1MO9A 1RYIA 4J34A 1IJHA 3CPJG 3LOVA 5HXIA 1H6VA 1H7XA 2BABA 2EQ7A 2VVLA 3FG2P 3REDA 4H2RA 1KDGA 2QA2A 2YVJA 2YVGA 4H4QA 4EMIA 2FJEA 1W4XA 2XCGA 3AEGA 5JCLA 4CCRA 2Y6QA 4WX1A 3SFEA 1TYTA 3SYIA 4ZN0A 2F5ZA 1PXCA 1E1LA 1GRTA 3C96A 1DOBA 4A6NA 3SFDA 3H8LA 4G6HA 3ISHA 3B3RA 3AD7B 4YSZA 3UP5A 2NVKX 2YG7A 4ICYA 2YM1A 3I6DA 3R9UA 1N4WA 1FEBA 1PBCA 5EBKA 1KSSA 1ZOVA 3F8DA 1Z6LA 1CF3A 4Z2TA 2YLZA 2YVFA 1VRQB 2PHHA 4USQA 4BJZA 4XWRA 3T2YA 2Q0KA 3NRNA 1N4UA 3CN8A 2XFPA 1PDHA 4U8LA 5FMHA 2W0HA 2GH5A 1CBOA 1CJ3A 1M64A 2OLOA 3LB8A 3NTAA 1H82A 3II4A 3GWDA 1LQTA 4EM4A 1ZP0A 2JKCA 3GWFA 4IA6A 1RSGA 3GMCA 1CL0A 3UKHA 3LZXA 3PO7A 3Q9TA 3IC9A 5EOWA 3JSKA 2BS4A 4J33A 5KWFA 3ZYXA 4U2LA 3CIRA 1S3BA 2R0CA 4CCQA 2YLWA 3NN0X 1B37A 2C75A 4TM3A 1QO8A 4B65A 4IV9A 4N9XA 4NEWA 3ICTA 5KVHA 2YG6A 4X9MA 4H4WA 4DNAA 2BC1A 2XLTA 3D8XA 2WBAA 3UP4A 3NK0X 4UDPA 1XANA 2FJBA 1GT8A 2WP9A 4H2QA 3DGZA 1JNRA 4Y4MA 2JBVA 4Z44A 5KRQA 4B69A 2JB2A 4I59A 3KPFA 2WDQA 1CJCA 4G6GA 4H4XA 2OALA 1DJQA 3AE7A 2GQFA 1L9EA 3NTDA 4U8JA 1TRBA 3OC4A 3AE8A 3CGCA 5JCIA 5KMRA 4H4RA 1HYUA 1YKJA 4H4VA 3SZCA 1F3PA 2BS2A 2X50A 4JDRA 5U63A 1KF6A 1FEAA 3DK9A 3UKFA 2WDVA 1E1MA 3AE4A 2ZBWA 4KPRA 4NTEA 4GDPA 4NZHA 4A65A 1F8RA 5J7XA 4E0VA 4OPTA 5C2TA 1DJNA 2B76A 1TDOA 1CJ2A 3NGCX 4YSXA 5JCKA 2R0PA 1EL7A 4C5OA 3LXDA 2YWLA 2RGJA 2WPFA 2BCPA 2GMJA 2WS3A 4K2XA 3ALLA 3EPTA 4JQ9A 2GMHA 4CRTA 3SZWA 1BKWA 2XYOA 4UP3A 1GETA 1P2HA 4IVMB 3AD9B 3P9UA 3AB1A 4Z24A 5KMPA 5KXJA 3NIXA 1PJ7A 3NG7X 5ER0A 1KNRA 3AYIA 4II3A 2R9ZA 3AE1A 2WEUA 3IHGA 3VQRA 1VQWA 3QFAA 1JRXA 3GDNA 4LU6A 1IUTA 2BK5A 4CNJA 4PABA 3AE6A 4EMWA 4U8OA 1D5TA 2JK6A 2Z5XA 4NNJA 2GF3A 4OVIA 1ZMCA 3AXBA 2GR3A 3HYVA 1LV0A 5HYMA 1GREA 2R4EA 1AOGA 4HA6A 1K0JA 3SX6A 1PBDA 1GRHA 1K4QA 2ZZCA 2GB0A 2V6OA 2V5ZA 3RHAA 4EIPA 4YXDA 1NG3A 1NHSA 2GAHB 4D03A 1PXBA 3EAOA 4Z25A 3T31A 1H86A 3GRSA 5KMQA 2GQWA 4AP1A 4BV6A 1EL9A 3DJEA 1D4EA 2A89A 3AYLA 1IUSA 3D1CA 4X9NA 2VRMA 5GSNA 1NG4A 3UOXA 1ZDLA 2E4GA 1E1KA 1GTEA 5JCMA 2GVCA 3P1WA 2X3NA 1YQ4A 2RABA 1PJ5A 2BCGG 2C3CA 3UKPA 5KMSA 2R46A 2GAGB 2BA9A 3ALMA 1TDEA 2JB3A 3DJJA 4H4UA 4O5QA 1H83A 4M52A 4FDCB 1EL5A 1V59A 1LTXR 1L9DA 4EQXA 2CDUA 4H4ZA 1BGJA 4A5LA 1D4CA 4GCMA 2O9ZA 2A8XA 1LPFA 1QJDA 4TM4A 2HQMA 2R45A 3P4QA 3Q6JA 4Y4NA 4K7ZA 1GNDA 3LADA 4YTMA 1GRAA 2VVMA 2YG5A 2EQ6A 2XDOA 2VOUA 2XLPA 3AEAA 4GAVA 4B67A 2R4JA 1K0IA 3BI2A 3ADAB 4H4PA 2YR5A 1CC2A 1E6EA 5C3JA 1DXLA 3KVEA 3NKSA 5CKUA 3DMEA 3VR9A 4RG4A 2UZZA 2GR1A 3DJDA 3C4NA 2BC0A 3AE2A 3CTYA 4OPDA 4U8KA 4BJYA 5BULA 1GERA 1SEZA 1JOAA 5DBJA 1B4VA 3P4SA 3ALJA 2ZZBA 3BHKA 3QSMA 1E39A 1Y56B 3K30A 4GF7A 3SZFA 4B1BA 2XFOA 3F8RA 4FX9A 4U2SA 1Q1RA 4GAPA 1KFYA 3G5QA 5IQ1A 3T2KA 4A79A 3ATQA 1JRZA 3GMBA 2BK4A 2WOWA 4EQSA 1ONFA 1F8SA 4USRA 2NPXA 4AP3A 2WP5A 2WP6A 5KNLA 2E5VA 3UCLA 1VDCA 4ZCDA 4AOXA 1XPQA 2JB1A 3I3LA 3UTHA 1IUUA 4Z26A 2WQYA 1O94A 1H81A 4A9WA 2YG3A 2C66A 4AT2A 1GPEA 2BRAA 1Q9IA 5CQFA 5KVIA 2YQUA 5IQ4A 3PS9A 3UTEA 1YY5A 1N4VA 2DKHA 3BHFA 3NYEA 2YR4A 3SXIA 3C4AA 3UOYA 4A99A 4B66A 4C77A 1B5QA 1GALA 1H7WA 2A87A 2OAMA 4H50A 5TR3A 2X8HA 3NT6A 1YQ3A 2YLRA 1OJAA 1D7LA 1PBBA 4APNA 1XHCA 2X8CA 1NDAA 4EQWA 5JCNA 4CNKA 2WETA 2IIDA 4EMJA 2PYXA 4GR1A 2Q6UA 2X99A 4G9KA 3ICRA 3M13A 1PXAA 3UKLA 4D04A 5BUKA 4OCGA 3E1TA 3VRBA 1F8WA 2H88A 1VG9A 1IUWA 5HHFA 4J57A 4U2TA 2OLNA 1S2QA 3RP8A 2J3NA 2GEWA 3T2ZA 4H4SA 3M12A 1FCDA 1YQZA 2EQ9A 1PJ6A 1LVLA 3QSEA 3CNSA 4II2A 4LA1A 2IVEA 2XLSA 2WHDA 4B63A 3QFBA 3AD8B 3CPHG 4X4JA 4H2PA 2WDRA 4OPGA 5KOXA 3DJGX 3H4KA 2OA1A 1CJ4A 4GUVA 2ARDA 2YAUA 4ECHA 3AE5A 1OJDA 3LJPA 4OPUA 2AQJA 3L1RA 3SM8A 2V3AA 2B9XA 3BI4A 4YTPA 3DK8A 1BWCA 1P2EA 2BXSA 4EIQA 2APGA 2YLXA 1DODA 1H84A 3AEEA 2RGHA 3CGDA 3S61A 2WU2A 1NENA 1Y0PA 4I58A 3GD4A 1PBFA 3KU9A 5EB5A 4ADWA 2GR2A 2XFQA 1NHQA 2XVJA 4B68A 1GSNA 1L9CA 1TYPA 2YR6A 3P4RA 4C3XA 1LQUA 3BI5A 4JNQA 4JNAA 4NTDA 3UOZA 2BXRA 4GDEA 2QAEA 1BZLA 3F8PA 3AEBA 4NEVA 3SY4A 3CPIG 1PHHA 3URHA 2RGOA 2C3DA 4OPCA 3RNMA 1EBDA 4RSLA 4J56A 3ATRA 3FPZA 4DSGA 4GRTA 4K5SA 5KOWA 1NHPA 2AAQA 2BYBA 1LJ1A 2XFUA 3ABVA 4Y4LA 5HY5A 3BNMA 2DKIA 2H89A 3T0KA 1KSUA 2FJAA 1Q1WA 3DA1A 2C70A 2V60A 3QSSA 5BVAA 4O5UA 1FOHA 1CC4A 2B7RA 2C73A 2C67A 4TLZA 3S5WA 1IUXA 2BACA 2WPEA 3V3OA 1BF3A 4YTNA 3NK2X 2GV8A 3IHMA 1NPXA 3PVCA 2QA1A 4BK1A 2FBWA 1B8SA 4HB9A 4CBQA 4G74A 4AT0A 3ZDNA 2C72A 1L0VA 2B9WA 1GOSA 2C4CA 4KX6A 1COYA 1O95A 3KPKA 4XWZA 3V3NA 2BRYA 4NWZA 5U1OA 2XVFA 2Z5YA 1JNZA 4RG3A 3UKQA 1NEKA 1E1NA 3DGHA 3SGLA 4EM3A 3H8IA 1QLBA 3EANA 4P9SA 4YSHA 3NH3X 4YWOA 1OJ9A 2BK3A 2VZ2A 3GYXA 2CVJA 3K7MX 5FS6A 3T37A 1GRFA 3GYIA 2CFYA 3UTFA 1GESA 1CHUA 3KD9A 1ZMDA 5FS7A 4H2NA 4YKFA 3VRAA 1TDNA 4IVOB 1GV4A 4TLXA 1NAAA 1E7PA 3HYWA 4J31A 1Y56A 3L8KA 4JY3A 1OJTA 4MJWA 3SQPA 3FIMB 4FK1A 1ELIA
chains in the Genus database with same CATH topology
1DOCA 3AWIA 2C65A 3ICSA 4K22A 1PN0A 2VQBA 4YKGA 4YT0A 5BRTA 1O5WA 2YM2A 1GTHA 3VR8A 3AE9A 3CNTA 5GRTA 3NHOX 2TMDA 3HZLA 4BK3A 2V3BA 3BNUA 4K8DA 1M6IA 1CC6A 4EQRA 2Q7VA 5M10A 2CULA 3FMWA 4H4YA 4TM0A 5FS9A 3LZWA 3GRTA 3NN6X 3OZ2A 4B64A 3GD3A 1S3EA 3AYJA 4J36A 1K0LA 2E1MA 1GXFA 3GSIA 4XXGA 4LIIA 1D7YA 3UKAA 1TDKA 3QVPA 1EL8A 3CGEA 4OPIA 3RP6A 3WE0A 3K7TA 3AEFA 5L46A 3NYCA 1DOEA 4CY6A 4H7UA 2VVLG 1ZOYA 2FJDA 3GDPA 2WU5A 2YLTA 4WCTA 4ZCCA 2ACZA 2QCUA 3NK1X 3VRDB 2IVDA 2YLSA 1MOKA 2TPRA 2C64A 2ZZ0A 1VG0A 2WOVA 3KA7A 2C76A 5IPYA 3QJ4A 2JAEA 1XDIA 1FL2A 3IWAA 4U8NA 3V76A 3COXA 2XVHA 3GYJA 3IF9A 3B6DA 2B7SA 3KKJA 1ZKQA 5LV9A 1ZX9A 2R0GA 4FK1C 3NYFA 3T14A 2XLRA 4C74A 4A6NB 3UKKA 1UKVG 1ZK7A 4U8IA 3UOVA 1N1PA 3AEDA 5U25A 4C3YA 1F6MA 2I0ZA 1S2YA 4CY8A 4YSYA 4Z43A 2VQ7A 2YG4A 3SZ0A 3CGBA 2Q0LA 4NTCA 4U8PA 1PS9A 3G5RA 2WOIA 3G5SA 1RP0A 2VRLA 4U8MA 3RP7A 2GRTA 2B9YA 2AR8A 5FS8A 4DGKA 3EF6A 4UDQA 3CNJA 3DK4A 3HYXA 2XLUA 1PBEA 1OJCA 1JU2A 1MXTA 2X8GA 1NHRA 4BURA 1BGNA 4H4TA 2EQ8A 4AOSA 3CMMA 3ITJA 2XFNA 3FBSA 1ZY8A 2BS3A 4UDRA 4DSHA 4Z2UA 3O0HA 4A7AA 2C7GA 2XVEA 1GRGA 5J60A 4PAAA 4REKA 1KNPA 3QVRA 5M0ZA 1DNCA 3NNEA 4OPLA 4JY2A 3M0OA 3P4PA 2GR0A 4JN9A 3DH9A 3CNPA 1REOA 1IUVA 4TM1A 1JRYA 4IA5A 4BK2A 3AE3A 4G73A 4J2WA 4K5RA 3KLJA 3AECA 3CNDA 1JEHA 2WPCA 5EB4A 2V61A 2WESA 3K7QX 1TDFA 4Z2RA 2Y6RA 1GRBA 2XVIA 1D4DA 3UTGA 1FECA 3NLCA 1GEUA 1X31B 1MO9A 1RYIA 4J34A 1IJHA 3CPJG 3LOVA 5HXIA 1H6VA 1H7XA 2BABA 2EQ7A 2VVLA 3FG2P 3REDA 4H2RA 1KDGA 2QA2A 2YVJA 2YVGA 4H4QA 4EMIA 2FJEA 1W4XA 2XCGA 3AEGA 5JCLA 4CCRA 2Y6QA 4WX1A 3SFEA 1TYTA 3SYIA 4ZN0A 2F5ZA 1PXCA 1E1LA 1GRTA 3C96A 1DOBA 4A6NA 3SFDA 3H8LA 4G6HA 3ISHA 3B3RA 3AD7B 4YSZA 3UP5A 2NVKX 2YG7A 4ICYA 2YM1A 3I6DA 3R9UA 1N4WA 1FEBA 1PBCA 5EBKA 1KSSA 1ZOVA 3F8DA 1Z6LA 1CF3A 4Z2TA 2YLZA 2YVFA 1VRQB 2PHHA 4USQA 4BJZA 4XWRA 3T2YA 2Q0KA 3NRNA 1N4UA 3CN8A 2XFPA 1PDHA 4U8LA 5FMHA 2W0HA 2GH5A 1CBOA 1CJ3A 1M64A 2OLOA 3LB8A 3NTAA 1H82A 3II4A 3GWDA 1LQTA 4EM4A 1ZP0A 2JKCA 3GWFA 4IA6A 1RSGA 3GMCA 1CL0A 3UKHA 3LZXA 3PO7A 3Q9TA 3IC9A 5EOWA 3JSKA 2BS4A 4J33A 5KWFA 3ZYXA 4U2LA 3CIRA 1S3BA 2R0CA 4CCQA 2YLWA 3NN0X 1B37A 2C75A 4TM3A 1QO8A 4B65A 4IV9A 4N9XA 4NEWA 3ICTA 5KVHA 2YG6A 4X9MA 4H4WA 4DNAA 2BC1A 2XLTA 3D8XA 2WBAA 3UP4A 3NK0X 4UDPA 1XANA 2FJBA 1GT8A 2WP9A 4H2QA 3DGZA 1JNRA 4Y4MA 2JBVA 4Z44A 5KRQA 4B69A 2JB2A 4I59A 3KPFA 2WDQA 1CJCA 4G6GA 4H4XA 2OALA 1DJQA 3AE7A 2GQFA 1L9EA 3NTDA 4U8JA 1TRBA 3OC4A 3AE8A 3CGCA 5JCIA 5KMRA 4H4RA 1HYUA 1YKJA 4H4VA 3SZCA 1F3PA 2BS2A 2X50A 4JDRA 5U63A 1KF6A 1FEAA 3DK9A 3UKFA 2WDVA 1E1MA 3AE4A 2ZBWA 4KPRA 4NTEA 4GDPA 4NZHA 4A65A 1F8RA 5J7XA 4E0VA 4OPTA 5C2TA 1DJNA 2B76A 1TDOA 1CJ2A 3NGCX 4YSXA 5JCKA 2R0PA 1EL7A 4C5OA 3LXDA 2YWLA 2RGJA 2WPFA 2BCPA 2GMJA 2WS3A 4K2XA 3ALLA 3EPTA 4JQ9A 2GMHA 4CRTA 3SZWA 1BKWA 2XYOA 4UP3A 1GETA 1P2HA 4IVMB 3AD9B 3P9UA 3AB1A 4Z24A 5KMPA 5KXJA 3NIXA 1PJ7A 3NG7X 5ER0A 1KNRA 3AYIA 4II3A 2R9ZA 3AE1A 2WEUA 3IHGA 3VQRA 1VQWA 3QFAA 1JRXA 3GDNA 4LU6A 1IUTA 2BK5A 4CNJA 4PABA 3AE6A 4EMWA 4U8OA 1D5TA 2JK6A 2Z5XA 4NNJA 2GF3A 4OVIA 1ZMCA 3AXBA 2GR3A 3HYVA 1LV0A 5HYMA 1GREA 2R4EA 1AOGA 4HA6A 1K0JA 3SX6A 1PBDA 1GRHA 1K4QA 2ZZCA 2GB0A 2V6OA 2V5ZA 3RHAA 4EIPA 4YXDA 1NG3A 1NHSA 2GAHB 4D03A 1PXBA 3EAOA 4Z25A 3T31A 1H86A 3GRSA 5KMQA 2GQWA 4AP1A 4BV6A 1EL9A 3DJEA 1D4EA 2A89A 3AYLA 1IUSA 3D1CA 4X9NA 2VRMA 5GSNA 1NG4A 3UOXA 1ZDLA 2E4GA 1E1KA 1GTEA 5JCMA 2GVCA 3P1WA 2X3NA 1YQ4A 2RABA 1PJ5A 2BCGG 2C3CA 3UKPA 5KMSA 2R46A 2GAGB 2BA9A 3ALMA 1TDEA 2JB3A 3DJJA 4H4UA 4O5QA 1H83A 4M52A 4FDCB 1EL5A 1V59A 1LTXR 1L9DA 4EQXA 2CDUA 4H4ZA 1BGJA 4A5LA 1D4CA 4GCMA 2O9ZA 2A8XA 1LPFA 1QJDA 4TM4A 2HQMA 2R45A 3P4QA 3Q6JA 4Y4NA 4K7ZA 1GNDA 3LADA 4YTMA 1GRAA 2VVMA 2YG5A 2EQ6A 2XDOA 2VOUA 2XLPA 3AEAA 4GAVA 4B67A 2R4JA 1K0IA 3BI2A 3ADAB 4H4PA 2YR5A 1CC2A 1E6EA 5C3JA 1DXLA 3KVEA 3NKSA 5CKUA 3DMEA 3VR9A 4RG4A 2UZZA 2GR1A 3DJDA 3C4NA 2BC0A 3AE2A 3CTYA 4OPDA 4U8KA 4BJYA 5BULA 1GERA 1SEZA 1JOAA 5DBJA 1B4VA 3P4SA 3ALJA 2ZZBA 3BHKA 3QSMA 1E39A 1Y56B 3K30A 4GF7A 3SZFA 4B1BA 2XFOA 3F8RA 4FX9A 4U2SA 1Q1RA 4GAPA 1KFYA 3G5QA 5IQ1A 3T2KA 4A79A 3ATQA 1JRZA 3GMBA 2BK4A 2WOWA 4EQSA 1ONFA 1F8SA 4USRA 2NPXA 4AP3A 2WP5A 2WP6A 5KNLA 2E5VA 3UCLA 1VDCA 4ZCDA 4AOXA 1XPQA 2JB1A 3I3LA 3UTHA 1IUUA 4Z26A 2WQYA 1O94A 1H81A 4A9WA 2YG3A 2C66A 4AT2A 1GPEA 2BRAA 1Q9IA 5CQFA 5KVIA 2YQUA 5IQ4A 3PS9A 3UTEA 1YY5A 1N4VA 2DKHA 3BHFA 3NYEA 2YR4A 3SXIA 3C4AA 3UOYA 4A99A 4B66A 4C77A 1B5QA 1GALA 1H7WA 2A87A 2OAMA 4H50A 5TR3A 2X8HA 3NT6A 1YQ3A 2YLRA 1OJAA 1D7LA 1PBBA 4APNA 1XHCA 2X8CA 1NDAA 4EQWA 5JCNA 4CNKA 2WETA 2IIDA 4EMJA 2PYXA 4GR1A 2Q6UA 2X99A 4G9KA 3ICRA 3M13A 1PXAA 3UKLA 4D04A 5BUKA 4OCGA 3E1TA 3VRBA 1F8WA 2H88A 1VG9A 1IUWA 5HHFA 4J57A 4U2TA 2OLNA 1S2QA 3RP8A 2J3NA 2GEWA 3T2ZA 4H4SA 3M12A 1FCDA 1YQZA 2EQ9A 1PJ6A 1LVLA 3QSEA 3CNSA 4II2A 4LA1A 2IVEA 2XLSA 2WHDA 4B63A 3QFBA 3AD8B 3CPHG 4X4JA 4H2PA 2WDRA 4OPGA 5KOXA 3DJGX 3H4KA 2OA1A 1CJ4A 4GUVA 2ARDA 2YAUA 4ECHA 3AE5A 1OJDA 3LJPA 4OPUA 2AQJA 3L1RA 3SM8A 2V3AA 2B9XA 3BI4A 4YTPA 3DK8A 1BWCA 1P2EA 2BXSA 4EIQA 2APGA 2YLXA 1DODA 1H84A 3AEEA 2RGHA 3CGDA 3S61A 2WU2A 1NENA 1Y0PA 4I58A 3GD4A 1PBFA 3KU9A 5EB5A 4ADWA 2GR2A 2XFQA 1NHQA 2XVJA 4B68A 1GSNA 1L9CA 1TYPA 2YR6A 3P4RA 4C3XA 1LQUA 3BI5A 4JNQA 4JNAA 4NTDA 3UOZA 2BXRA 4GDEA 2QAEA 1BZLA 3F8PA 3AEBA 4NEVA 3SY4A 3CPIG 1PHHA 3URHA 2RGOA 2C3DA 4OPCA 3RNMA 1EBDA 4RSLA 4J56A 3ATRA 3FPZA 4DSGA 4GRTA 4K5SA 5KOWA 1NHPA 2AAQA 2BYBA 1LJ1A 2XFUA 3ABVA 4Y4LA 5HY5A 3BNMA 2DKIA 2H89A 3T0KA 1KSUA 2FJAA 1Q1WA 3DA1A 2C70A 2V60A 3QSSA 5BVAA 4O5UA 1FOHA 1CC4A 2B7RA 2C73A 2C67A 4TLZA 3S5WA 1IUXA 2BACA 2WPEA 3V3OA 1BF3A 4YTNA 3NK2X 2GV8A 3IHMA 1NPXA 3PVCA 2QA1A 4BK1A 2FBWA 1B8SA 4HB9A 4CBQA 4G74A 4AT0A 3ZDNA 2C72A 1L0VA 2B9WA 1GOSA 2C4CA 4KX6A 1COYA 1O95A 3KPKA 4XWZA 3V3NA 2BRYA 4NWZA 5U1OA 2XVFA 2Z5YA 1JNZA 4RG3A 3UKQA 1NEKA 1E1NA 3DGHA 3SGLA 4EM3A 3H8IA 1QLBA 3EANA 4P9SA 4YSHA 3NH3X 4YWOA 1OJ9A 2BK3A 2VZ2A 3GYXA 2CVJA 3K7MX 5FS6A 3T37A 1GRFA 3GYIA 2CFYA 3UTFA 1GESA 1CHUA 3KD9A 1ZMDA 5FS7A 4H2NA 4YKFA 3VRAA 1TDNA 4IVOB 1GV4A 4TLXA 1NAAA 1E7PA 3HYWA 4J31A 1Y56A 3L8KA 4JY3A 1OJTA 4MJWA 3SQPA 3FIMB 4FK1A 1ELIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOC A;  3AWI A;  2C65 A;  3ICS A;  4K22 A;  1PN0 A;  2VQB A;  4YKG A;  4YT0 A;  5BRT A;  1O5W A;  2YM2 A;  1GTH A;  3VR8 A;  3AE9 A;  3CNT A;  5GRT A;  3NHO X;  2TMD A;  3HZL A;  4BK3 A;  2V3B A;  3BNU A;  4K8D A;  1M6I A;  1CC6 A;  4EQR A;  2Q7V A;  5M10 A;  2CUL A;  3FMW A;  4H4Y A;  4TM0 A;  5FS9 A;  3LZW A;  3GRT A;  3NN6 X;  3OZ2 A;  4B64 A;  3GD3 A;  1S3E A;  3AYJ A;  4J36 A;  1K0L A;  2E1M A;  1GXF A;  3GSI A;  4XXG A;  4LII A;  1D7Y A;  3UKA A;  1TDK A;  3QVP A;  1EL8 A;  3CGE A;  4OPI A;  3RP6 A;  3WE0 A;  3K7T A;  3AEF A;  5L46 A;  3NYC A;  1DOE A;  4CY6 A;  4H7U A;  2VVL G;  1ZOY A;  2FJD A;  3GDP A;  2WU5 A;  2YLT A;  4WCT A;  4ZCC A;  2ACZ A;  2QCU A;  3NK1 X;  3VRD B;  2IVD A;  2YLS A;  1MOK A;  2TPR A;  2C64 A;  2ZZ0 A;  1VG0 A;  2WOV A;  3KA7 A;  2C76 A;  5IPY A;  3QJ4 A;  2JAE A;  1XDI A;  1FL2 A;  3IWA A;  4U8N A;  3V76 A;  3COX A;  2XVH A;  3GYJ A;  3IF9 A;  3B6D A;  2B7S A;  3KKJ A;  1ZKQ A;  5LV9 A;  1ZX9 A;  2R0G A;  4FK1 C;  3NYF A;  2XLR A;  4C74 A;  4A6N B;  3UKK A;  1UKV G;  1ZK7 A;  4U8I A;  3UOV A;  1N1P A;  3AED A;  5U25 A;  4C3Y A;  1F6M A;  2I0Z A;  1S2Y A;  4CY8 A;  4YSY A;  4Z43 A;  2VQ7 A;  2YG4 A;  3CGB A;  2Q0L A;  4NTC A;  4U8P A;  1PS9 A;  3G5R A;  2WOI A;  3G5S A;  1RP0 A;  2VRL A;  4U8M A;  3RP7 A;  2GRT A;  2B9Y A;  2AR8 A;  5FS8 A;  4DGK A;  3EF6 A;  4UDQ A;  3CNJ A;  3DK4 A;  2XLU A;  1PBE A;  1OJC A;  1JU2 A;  1MXT A;  2X8G A;  1NHR A;  4BUR A;  1BGN A;  4H4T A;  2EQ8 A;  4AOS A;  3ITJ A;  2XFN A;  3FBS A;  1ZY8 A;  2BS3 A;  4UDR A;  4DSH A;  4Z2U A;  3O0H A;  4A7A A;  2C7G A;  2XVE A;  1GRG A;  5J60 A;  4PAA A;  4REK A;  1KNP A;  3QVR A;  5M0Z A;  1DNC A;  3NNE A;  4OPL A;  4JY2 A;  3M0O A;  3P4P A;  2GR0 A;  4JN9 A;  3DH9 A;  3CNP A;  1REO A;  1IUV A;  4TM1 A;  1JRY A;  4IA5 A;  4BK2 A;  3AE3 A;  4J2W A;  4K5R A;  3KLJ A;  3AEC A;  3CND A;  1JEH A;  2WPC A;  5EB4 A;  2V61 A;  2WES A;  3K7Q X;  1TDF A;  4Z2R A;  2Y6R A;  1GRB A;  2XVI A;  1D4D A;  3UTG A;  1FEC A;  3NLC A;  1GEU A;  1X31 B;  1MO9 A;  1RYI A;  4J34 A;  1IJH A;  3CPJ G;  3LOV A;  5HXI A;  1H6V A;  1H7X A;  2BAB A;  2EQ7 A;  2VVL A;  3FG2 P;  3RED A;  4H2R A;  1KDG A;  2QA2 A;  2YVJ A;  2YVG A;  4H4Q A;  4EMI A;  2FJE A;  1W4X A;  2XCG A;  3AEG A;  5JCL A;  4CCR A;  2Y6Q A;  4WX1 A;  3SFE A;  1TYT A;  4ZN0 A;  2F5Z A;  1PXC A;  1E1L A;  1GRT A;  3C96 A;  1DOB A;  4A6N A;  3SFD A;  3H8L A;  3ISH A;  3B3R A;  3AD7 B;  4YSZ A;  3UP5 A;  2NVK X;  2YG7 A;  4ICY A;  2YM1 A;  3I6D A;  3R9U A;  1N4W A;  1FEB A;  1PBC A;  5EBK A;  1KSS A;  1ZOV A;  3F8D A;  1Z6L A;  1CF3 A;  4Z2T A;  2YLZ A;  2YVF A;  1VRQ B;  2PHH A;  4USQ A;  4BJZ A;  4XWR A;  2Q0K A;  3NRN A;  1N4U A;  3CN8 A;  2XFP A;  1PDH A;  4U8L A;  5FMH A;  2W0H A;  2GH5 A;  1CBO A;  1CJ3 A;  1M64 A;  2OLO A;  3LB8 A;  3NTA A;  1H82 A;  3II4 A;  3GWD A;  1LQT A;  4EM4 A;  1ZP0 A;  2JKC A;  3GWF A;  4IA6 A;  1RSG A;  3GMC A;  1CL0 A;  3UKH A;  3LZX A;  3PO7 A;  3Q9T A;  3IC9 A;  5EOW A;  3JSK A;  2BS4 A;  4J33 A;  5KWF A;  3ZYX A;  4U2L A;  3CIR A;  1S3B A;  2R0C A;  4CCQ A;  2YLW A;  3NN0 X;  1B37 A;  2C75 A;  4TM3 A;  1QO8 A;  4B65 A;  4IV9 A;  4N9X A;  4NEW A;  3ICT A;  5KVH A;  2YG6 A;  4X9M A;  4H4W A;  4DNA A;  2BC1 A;  2XLT A;  3D8X A;  2WBA A;  3UP4 A;  3NK0 X;  4UDP A;  1XAN A;  2FJB A;  1GT8 A;  2WP9 A;  4H2Q A;  3DGZ A;  1JNR A;  4Y4M A;  2JBV A;  4Z44 A;  5KRQ A;  4B69 A;  2JB2 A;  4I59 A;  3KPF A;  2WDQ A;  1CJC A;  4H4X A;  2OAL A;  1DJQ A;  3AE7 A;  2GQF A;  1L9E A;  3NTD A;  4U8J A;  1TRB A;  3OC4 A;  3AE8 A;  3CGC A;  5JCI A;  4H4R A;  1HYU A;  1YKJ A;  4H4V A;  1F3P A;  2BS2 A;  2X50 A;  4JDR A;  5U63 A;  1KF6 A;  1FEA A;  3DK9 A;  3UKF A;  2WDV A;  1E1M A;  3AE4 A;  2ZBW A;  4KPR A;  4NTE A;  4GDP A;  4NZH A;  4A65 A;  1F8R A;  5J7X A;  4E0V A;  4OPT A;  5C2T A;  1DJN A;  2B76 A;  1TDO A;  1CJ2 A;  3NGC X;  4YSX A;  5JCK A;  2R0P A;  1EL7 A;  4C5O A;  3LXD A;  2YWL A;  2RGJ A;  2WPF A;  2BCP A;  2GMJ A;  2WS3 A;  4K2X A;  3ALL A;  3EPT A;  4JQ9 A;  2GMH A;  4CRT A;  1BKW A;  2XYO A;  4UP3 A;  1GET A;  1P2H A;  4IVM B;  3AD9 B;  3P9U A;  3AB1 A;  4Z24 A;  5KXJ A;  3NIX A;  1PJ7 A;  3NG7 X;  5ER0 A;  1KNR A;  3AYI A;  2R9Z A;  3AE1 A;  2WEU A;  3IHG A;  3VQR A;  1VQW A;  3QFA A;  1JRX A;  3GDN A;  4LU6 A;  1IUT A;  2BK5 A;  4CNJ A;  4PAB A;  3AE6 A;  4EMW A;  4U8O A;  1D5T A;  2JK6 A;  2Z5X A;  2GF3 A;  4OVI A;  1ZMC A;  3AXB A;  2GR3 A;  1LV0 A;  5HYM A;  1GRE A;  2R4E A;  1AOG A;  4HA6 A;  1K0J A;  1PBD A;  1GRH A;  1K4Q A;  2ZZC A;  2GB0 A;  2V6O A;  2V5Z A;  3RHA A;  4EIP A;  4YXD A;  1NG3 A;  1NHS A;  2GAH B;  4D03 A;  1PXB A;  3EAO A;  4Z25 A;  1H86 A;  3GRS A;  2GQW A;  4AP1 A;  4BV6 A;  1EL9 A;  3DJE A;  1D4E A;  2A89 A;  3AYL A;  1IUS A;  3D1C A;  4X9N A;  2VRM A;  5GSN A;  1NG4 A;  3UOX A;  1ZDL A;  2E4G A;  1E1K A;  1GTE A;  5JCM A;  2GVC A;  3P1W A;  2X3N A;  1YQ4 A;  2RAB A;  1PJ5 A;  2BCG G;  2C3C A;  3UKP A;  2R46 A;  2GAG B;  2BA9 A;  3ALM A;  1TDE A;  2JB3 A;  3DJJ A;  4H4U A;  4O5Q A;  1H83 A;  4M52 A;  4FDC B;  1EL5 A;  1V59 A;  1LTX R;  1L9D A;  4EQX A;  2CDU A;  4H4Z A;  1BGJ A;  4A5L A;  1D4C A;  4GCM A;  2O9Z A;  2A8X A;  1LPF A;  1QJD A;  4TM4 A;  2HQM A;  2R45 A;  3P4Q A;  3Q6J A;  4Y4N A;  4K7Z A;  1GND A;  3LAD A;  4YTM A;  1GRA A;  2VVM A;  2YG5 A;  2EQ6 A;  2XDO A;  2VOU A;  2XLP A;  3AEA A;  4B67 A;  2R4J A;  1K0I A;  3BI2 A;  3ADA B;  4H4P A;  2YR5 A;  1CC2 A;  1E6E A;  5C3J A;  1DXL A;  3KVE A;  3NKS A;  5CKU A;  3DME A;  3VR9 A;  4RG4 A;  2UZZ A;  2GR1 A;  3DJD A;  3C4N A;  2BC0 A;  3AE2 A;  3CTY A;  4OPD A;  4U8K A;  4BJY A;  5BUL A;  1GER A;  1SEZ A;  1JOA A;  5DBJ A;  1B4V A;  3P4S A;  3ALJ A;  2ZZB A;  3BHK A;  3QSM A;  1E39 A;  1Y56 B;  3K30 A;  4GF7 A;  4B1B A;  2XFO A;  3F8R A;  4FX9 A;  4U2S A;  1Q1R A;  5IQ1 A;  1KFY A;  3G5Q A;  4A79 A;  3ATQ A;  1JRZ A;  3GMB A;  2BK4 A;  2WOW A;  4EQS A;  1ONF A;  1F8S A;  4USR A;  2NPX A;  4AP3 A;  2WP5 A;  2WP6 A;  2E5V A;  3UCL A;  1VDC A;  4ZCD A;  4AOX A;  1XPQ A;  2JB1 A;  3I3L A;  3UTH A;  1IUU A;  4Z26 A;  2WQY A;  1O94 A;  1H81 A;  4A9W A;  2YG3 A;  2C66 A;  4AT2 A;  1GPE A;  1Q9I A;  5CQF A;  5KVI A;  2YQU A;  5IQ4 A;  3PS9 A;  3UTE A;  1YY5 A;  1N4V A;  2DKH A;  3BHF A;  3NYE A;  2YR4 A;  3UOY A;  3C4A A;  4B66 A;  4A99 A;  4C77 A;  1B5Q A;  1GAL A;  1H7W A;  2A87 A;  2OAM A;  4H50 A;  5TR3 A;  2X8H A;  3NT6 A;  1YQ3 A;  2YLR A;  1OJA A;  1D7L A;  1PBB A;  4APN A;  1XHC A;  2X8C A;  1NDA A;  4EQW A;  5JCN A;  4CNK A;  2WET A;  2IID A;  4EMJ A;  2PYX A;  4GR1 A;  2Q6U A;  2X99 A;  3UKL A;  3ICR A;  3M13 A;  1PXA A;  4D04 A;  5BUK A;  4OCG A;  3E1T A;  3VRB A;  1F8W A;  2H88 A;  1VG9 A;  1IUW A;  5HHF A;  4J57 A;  4U2T A;  2OLN A;  1S2Q A;  3RP8 A;  2J3N A;  2GEW A;  4H4S A;  3M12 A;  1FCD A;  1YQZ A;  2EQ9 A;  1PJ6 A;  1LVL A;  3QSE A;  3CNS A;  4LA1 A;  2IVE A;  2XLS A;  2WHD A;  4B63 A;  3QFB A;  3AD8 B;  3CPH G;  4X4J A;  4H2P A;  2WDR A;  4OPG A;  5KOX A;  3DJG X;  3H4K A;  2OA1 A;  1CJ4 A;  4GUV A;  2ARD A;  2YAU A;  4ECH A;  3AE5 A;  1OJD A;  3LJP A;  4OPU A;  2AQJ A;  3L1R A;  3SM8 A;  2V3A A;  2B9X A;  3BI4 A;  4YTP A;  3DK8 A;  1BWC A;  1P2E A;  2BXS A;  4EIQ A;  2APG A;  2YLX A;  1DOD A;  1H84 A;  3AEE A;  2RGH A;  3CGD A;  3S61 A;  2WU2 A;  1NEN A;  1Y0P A;  4I58 A;  3GD4 A;  1PBF A;  3KU9 A;  5EB5 A;  4ADW A;  2GR2 A;  2XFQ A;  1NHQ A;  2XVJ A;  4B68 A;  1GSN A;  1L9C A;  1TYP A;  2YR6 A;  3P4R A;  4C3X A;  1LQU A;  3BI5 A;  4JNQ A;  4JNA A;  4NTD A;  3UOZ A;  2BXR A;  4GDE A;  2QAE A;  1BZL A;  3F8P A;  3AEB A;  4NEV A;  3CPI G;  1PHH A;  3URH A;  2RGO A;  2C3D A;  4OPC A;  3RNM A;  1EBD A;  4RSL A;  4J56 A;  3ATR A;  3FPZ A;  4DSG A;  4GRT A;  4K5S A;  5KOW A;  1NHP A;  2AAQ A;  2BYB A;  1LJ1 A;  2XFU A;  3ABV A;  4Y4L A;  5HY5 A;  3BNM A;  2DKI A;  2H89 A;  1KSU A;  2FJA A;  1Q1W A;  3DA1 A;  2C70 A;  2V60 A;  3QSS A;  5BVA A;  4O5U A;  1FOH A;  1CC4 A;  2B7R A;  2C73 A;  2C67 A;  4TLZ A;  3S5W A;  1IUX A;  2BAC A;  2WPE A;  3V3O A;  1BF3 A;  4YTN A;  3NK2 X;  2GV8 A;  3IHM A;  1NPX A;  3PVC A;  2QA1 A;  4BK1 A;  2FBW A;  1B8S A;  4HB9 A;  4CBQ A;  4AT0 A;  3ZDN A;  2C72 A;  1L0V A;  2B9W A;  1GOS A;  4KX6 A;  1COY A;  1O95 A;  3V3N A;  4XWZ A;  5U1O A;  2XVF A;  2Z5Y A;  1JNZ A;  4RG3 A;  3UKQ A;  1NEK A;  1E1N A;  3DGH A;  3SGL A;  4EM3 A;  3H8I A;  1QLB A;  3EAN A;  4P9S A;  4YSH A;  3NH3 X;  4YWO A;  1OJ9 A;  2BK3 A;  2VZ2 A;  2CVJ A;  3K7M X;  5FS6 A;  3T37 A;  1GRF A;  3GYI A;  2CFY A;  3UTF A;  1GES A;  1CHU A;  3KD9 A;  1ZMD A;  5FS7 A;  4H2N A;  4YKF A;  3VRA A;  1TDN A;  4IVO B;  1GV4 A;  4TLX A;  1NAA A;  1E7P A;  4J31 A;  1Y56 A;  3L8K A;  4JY3 A;  1OJT A;  4MJW A;  3SQP A;  3FIM B;  4FK1 A;  1ELI A; 
#chains in the Genus database with same CATH topology
 1DOC A;  3AWI A;  2C65 A;  3ICS A;  4K22 A;  1PN0 A;  2VQB A;  4YKG A;  4YT0 A;  5BRT A;  1O5W A;  2YM2 A;  1GTH A;  3VR8 A;  3AE9 A;  3CNT A;  5GRT A;  3NHO X;  2TMD A;  3HZL A;  4BK3 A;  2V3B A;  3BNU A;  4K8D A;  1M6I A;  1CC6 A;  4EQR A;  2Q7V A;  5M10 A;  2CUL A;  3FMW A;  4H4Y A;  4TM0 A;  5FS9 A;  3LZW A;  3GRT A;  3NN6 X;  3OZ2 A;  4B64 A;  3GD3 A;  1S3E A;  3AYJ A;  4J36 A;  1K0L A;  2E1M A;  1GXF A;  3GSI A;  4XXG A;  4LII A;  1D7Y A;  3UKA A;  1TDK A;  3QVP A;  1EL8 A;  3CGE A;  4OPI A;  3RP6 A;  3WE0 A;  3K7T A;  3AEF A;  5L46 A;  3NYC A;  1DOE A;  4CY6 A;  4H7U A;  2VVL G;  1ZOY A;  2FJD A;  3GDP A;  2WU5 A;  2YLT A;  4WCT A;  4ZCC A;  2ACZ A;  2QCU A;  3NK1 X;  3VRD B;  2IVD A;  2YLS A;  1MOK A;  2TPR A;  2C64 A;  2ZZ0 A;  1VG0 A;  2WOV A;  3KA7 A;  2C76 A;  5IPY A;  3QJ4 A;  2JAE A;  1XDI A;  1FL2 A;  3IWA A;  4U8N A;  3V76 A;  3COX A;  2XVH A;  3GYJ A;  3IF9 A;  3B6D A;  2B7S A;  3KKJ A;  1ZKQ A;  5LV9 A;  1ZX9 A;  2R0G A;  4FK1 C;  3NYF A;  3T14 A;  2XLR A;  4C74 A;  4A6N B;  3UKK A;  1UKV G;  1ZK7 A;  4U8I A;  3UOV A;  1N1P A;  3AED A;  5U25 A;  4C3Y A;  1F6M A;  2I0Z A;  1S2Y A;  4CY8 A;  4YSY A;  4Z43 A;  2VQ7 A;  2YG4 A;  3SZ0 A;  3CGB A;  2Q0L A;  4NTC A;  4U8P A;  1PS9 A;  3G5R A;  2WOI A;  3G5S A;  1RP0 A;  2VRL A;  4U8M A;  3RP7 A;  2GRT A;  2B9Y A;  2AR8 A;  5FS8 A;  4DGK A;  3EF6 A;  4UDQ A;  3CNJ A;  3DK4 A;  3HYX A;  2XLU A;  1PBE A;  1OJC A;  1JU2 A;  1MXT A;  2X8G A;  1NHR A;  4BUR A;  1BGN A;  4H4T A;  2EQ8 A;  4AOS A;  3CMM A;  3ITJ A;  2XFN A;  3FBS A;  1ZY8 A;  2BS3 A;  4UDR A;  4DSH A;  4Z2U A;  3O0H A;  4A7A A;  2C7G A;  2XVE A;  1GRG A;  5J60 A;  4PAA A;  4REK A;  1KNP A;  3QVR A;  5M0Z A;  1DNC A;  3NNE A;  4OPL A;  4JY2 A;  3M0O A;  3P4P A;  2GR0 A;  4JN9 A;  3DH9 A;  3CNP A;  1REO A;  1IUV A;  4TM1 A;  1JRY A;  4IA5 A;  4BK2 A;  3AE3 A;  4G73 A;  4J2W A;  4K5R A;  3KLJ A;  3AEC A;  3CND A;  1JEH A;  2WPC A;  5EB4 A;  2V61 A;  2WES A;  3K7Q X;  1TDF A;  4Z2R A;  2Y6R A;  1GRB A;  2XVI A;  1D4D A;  3UTG A;  1FEC A;  3NLC A;  1GEU A;  1X31 B;  1MO9 A;  1RYI A;  4J34 A;  1IJH A;  3CPJ G;  3LOV A;  5HXI A;  1H6V A;  1H7X A;  2BAB A;  2EQ7 A;  2VVL A;  3FG2 P;  3RED A;  4H2R A;  1KDG A;  2QA2 A;  2YVJ A;  2YVG A;  4H4Q A;  4EMI A;  2FJE A;  1W4X A;  2XCG A;  3AEG A;  5JCL A;  4CCR A;  2Y6Q A;  4WX1 A;  3SFE A;  1TYT A;  3SYI A;  4ZN0 A;  2F5Z A;  1PXC A;  1E1L A;  1GRT A;  3C96 A;  1DOB A;  4A6N A;  3SFD A;  3H8L A;  4G6H A;  3ISH A;  3B3R A;  3AD7 B;  4YSZ A;  3UP5 A;  2NVK X;  2YG7 A;  4ICY A;  2YM1 A;  3I6D A;  3R9U A;  1N4W A;  1FEB A;  1PBC A;  5EBK A;  1KSS A;  1ZOV A;  3F8D A;  1Z6L A;  1CF3 A;  4Z2T A;  2YLZ A;  2YVF A;  1VRQ B;  2PHH A;  4USQ A;  4BJZ A;  4XWR A;  3T2Y A;  2Q0K A;  3NRN A;  1N4U A;  3CN8 A;  2XFP A;  1PDH A;  4U8L A;  5FMH A;  2W0H A;  2GH5 A;  1CBO A;  1CJ3 A;  1M64 A;  2OLO A;  3LB8 A;  3NTA A;  1H82 A;  3II4 A;  3GWD A;  1LQT A;  4EM4 A;  1ZP0 A;  2JKC A;  3GWF A;  4IA6 A;  1RSG A;  3GMC A;  1CL0 A;  3UKH A;  3LZX A;  3PO7 A;  3Q9T A;  3IC9 A;  5EOW A;  3JSK A;  2BS4 A;  4J33 A;  5KWF A;  3ZYX A;  4U2L A;  3CIR A;  1S3B A;  2R0C A;  4CCQ A;  2YLW A;  3NN0 X;  1B37 A;  2C75 A;  4TM3 A;  1QO8 A;  4B65 A;  4IV9 A;  4N9X A;  4NEW A;  3ICT A;  5KVH A;  2YG6 A;  4X9M A;  4H4W A;  4DNA A;  2BC1 A;  2XLT A;  3D8X A;  2WBA A;  3UP4 A;  3NK0 X;  4UDP A;  1XAN A;  2FJB A;  1GT8 A;  2WP9 A;  4H2Q A;  3DGZ A;  1JNR A;  4Y4M A;  2JBV A;  4Z44 A;  5KRQ A;  4B69 A;  2JB2 A;  4I59 A;  3KPF A;  2WDQ A;  1CJC A;  4G6G A;  4H4X A;  2OAL A;  1DJQ A;  3AE7 A;  2GQF A;  1L9E A;  3NTD A;  4U8J A;  1TRB A;  3OC4 A;  3AE8 A;  3CGC A;  5JCI A;  5KMR A;  4H4R A;  1HYU A;  1YKJ A;  4H4V A;  3SZC A;  1F3P A;  2BS2 A;  2X50 A;  4JDR A;  5U63 A;  1KF6 A;  1FEA A;  3DK9 A;  3UKF A;  2WDV A;  1E1M A;  3AE4 A;  2ZBW A;  4KPR A;  4NTE A;  4GDP A;  4NZH A;  4A65 A;  1F8R A;  5J7X A;  4E0V A;  4OPT A;  5C2T A;  1DJN A;  2B76 A;  1TDO A;  1CJ2 A;  3NGC X;  4YSX A;  5JCK A;  2R0P A;  1EL7 A;  4C5O A;  3LXD A;  2YWL A;  2RGJ A;  2WPF A;  2BCP A;  2GMJ A;  2WS3 A;  4K2X A;  3ALL A;  3EPT A;  4JQ9 A;  2GMH A;  4CRT A;  3SZW A;  1BKW A;  2XYO A;  4UP3 A;  1GET A;  1P2H A;  4IVM B;  3AD9 B;  3P9U A;  3AB1 A;  4Z24 A;  5KMP A;  5KXJ A;  3NIX A;  1PJ7 A;  3NG7 X;  5ER0 A;  1KNR A;  3AYI A;  4II3 A;  2R9Z A;  3AE1 A;  2WEU A;  3IHG A;  3VQR A;  1VQW A;  3QFA A;  1JRX A;  3GDN A;  4LU6 A;  1IUT A;  2BK5 A;  4CNJ A;  4PAB A;  3AE6 A;  4EMW A;  4U8O A;  1D5T A;  2JK6 A;  2Z5X A;  4NNJ A;  2GF3 A;  4OVI A;  1ZMC A;  3AXB A;  2GR3 A;  3HYV A;  1LV0 A;  5HYM A;  1GRE A;  2R4E A;  1AOG A;  4HA6 A;  1K0J A;  3SX6 A;  1PBD A;  1GRH A;  1K4Q A;  2ZZC A;  2GB0 A;  2V6O A;  2V5Z A;  3RHA A;  4EIP A;  4YXD A;  1NG3 A;  1NHS A;  2GAH B;  4D03 A;  1PXB A;  3EAO A;  4Z25 A;  3T31 A;  1H86 A;  3GRS A;  5KMQ A;  2GQW A;  4AP1 A;  4BV6 A;  1EL9 A;  3DJE A;  1D4E A;  2A89 A;  3AYL A;  1IUS A;  3D1C A;  4X9N A;  2VRM A;  5GSN A;  1NG4 A;  3UOX A;  1ZDL A;  2E4G A;  1E1K A;  1GTE A;  5JCM A;  2GVC A;  3P1W A;  2X3N A;  1YQ4 A;  2RAB A;  1PJ5 A;  2BCG G;  2C3C A;  3UKP A;  5KMS A;  2R46 A;  2GAG B;  2BA9 A;  3ALM A;  1TDE A;  2JB3 A;  3DJJ A;  4H4U A;  4O5Q A;  1H83 A;  4M52 A;  4FDC B;  1EL5 A;  1V59 A;  1LTX R;  1L9D A;  4EQX A;  2CDU A;  4H4Z A;  1BGJ A;  4A5L A;  1D4C A;  4GCM A;  2O9Z A;  2A8X A;  1LPF A;  1QJD A;  4TM4 A;  2HQM A;  2R45 A;  3P4Q A;  3Q6J A;  4Y4N A;  4K7Z A;  1GND A;  3LAD A;  4YTM A;  1GRA A;  2VVM A;  2YG5 A;  2EQ6 A;  2XDO A;  2VOU A;  2XLP A;  3AEA A;  4GAV A;  4B67 A;  2R4J A;  1K0I A;  3BI2 A;  3ADA B;  4H4P A;  2YR5 A;  1CC2 A;  1E6E A;  5C3J A;  1DXL A;  3KVE A;  3NKS A;  5CKU A;  3DME A;  3VR9 A;  4RG4 A;  2UZZ A;  2GR1 A;  3DJD A;  3C4N A;  2BC0 A;  3AE2 A;  3CTY A;  4OPD A;  4U8K A;  4BJY A;  5BUL A;  1GER A;  1SEZ A;  1JOA A;  5DBJ A;  1B4V A;  3P4S A;  3ALJ A;  2ZZB A;  3BHK A;  3QSM A;  1E39 A;  1Y56 B;  3K30 A;  4GF7 A;  3SZF A;  4B1B A;  2XFO A;  3F8R A;  4FX9 A;  4U2S A;  1Q1R A;  4GAP A;  1KFY A;  3G5Q A;  5IQ1 A;  3T2K A;  4A79 A;  3ATQ A;  1JRZ A;  3GMB A;  2BK4 A;  2WOW A;  4EQS A;  1ONF A;  1F8S A;  4USR A;  2NPX A;  4AP3 A;  2WP5 A;  2WP6 A;  5KNL A;  2E5V A;  3UCL A;  1VDC A;  4ZCD A;  4AOX A;  1XPQ A;  2JB1 A;  3I3L A;  3UTH A;  1IUU A;  4Z26 A;  2WQY A;  1O94 A;  1H81 A;  4A9W A;  2YG3 A;  2C66 A;  4AT2 A;  1GPE A;  2BRA A;  1Q9I A;  5CQF A;  5KVI A;  2YQU A;  5IQ4 A;  3PS9 A;  3UTE A;  1YY5 A;  1N4V A;  2DKH A;  3BHF A;  3NYE A;  2YR4 A;  3SXI A;  3C4A A;  3UOY A;  4A99 A;  4B66 A;  4C77 A;  1B5Q A;  1GAL A;  1H7W A;  2A87 A;  2OAM A;  4H50 A;  5TR3 A;  2X8H A;  3NT6 A;  1YQ3 A;  2YLR A;  1OJA A;  1D7L A;  1PBB A;  4APN A;  1XHC A;  2X8C A;  1NDA A;  4EQW A;  5JCN A;  4CNK A;  2WET A;  2IID A;  4EMJ A;  2PYX A;  4GR1 A;  2Q6U A;  2X99 A;  4G9K A;  3ICR A;  3M13 A;  1PXA A;  3UKL A;  4D04 A;  5BUK A;  4OCG A;  3E1T A;  3VRB A;  1F8W A;  2H88 A;  1VG9 A;  1IUW A;  5HHF A;  4J57 A;  4U2T A;  2OLN A;  1S2Q A;  3RP8 A;  2J3N A;  2GEW A;  3T2Z A;  4H4S A;  3M12 A;  1FCD A;  1YQZ A;  2EQ9 A;  1PJ6 A;  1LVL A;  3QSE A;  3CNS A;  4II2 A;  4LA1 A;  2IVE A;  2XLS A;  2WHD A;  4B63 A;  3QFB A;  3AD8 B;  3CPH G;  4X4J A;  4H2P A;  2WDR A;  4OPG A;  5KOX A;  3DJG X;  3H4K A;  2OA1 A;  1CJ4 A;  4GUV A;  2ARD A;  2YAU A;  4ECH A;  3AE5 A;  1OJD A;  3LJP A;  4OPU A;  2AQJ A;  3L1R A;  3SM8 A;  2V3A A;  2B9X A;  3BI4 A;  4YTP A;  3DK8 A;  1BWC A;  1P2E A;  2BXS A;  4EIQ A;  2APG A;  2YLX A;  1DOD A;  1H84 A;  3AEE A;  2RGH A;  3CGD A;  3S61 A;  2WU2 A;  1NEN A;  1Y0P A;  4I58 A;  3GD4 A;  1PBF A;  3KU9 A;  5EB5 A;  4ADW A;  2GR2 A;  2XFQ A;  1NHQ A;  2XVJ A;  4B68 A;  1GSN A;  1L9C A;  1TYP A;  2YR6 A;  3P4R A;  4C3X A;  1LQU A;  3BI5 A;  4JNQ A;  4JNA A;  4NTD A;  3UOZ A;  2BXR A;  4GDE A;  2QAE A;  1BZL A;  3F8P A;  3AEB A;  4NEV A;  3SY4 A;  3CPI G;  1PHH A;  3URH A;  2RGO A;  2C3D A;  4OPC A;  3RNM A;  1EBD A;  4RSL A;  4J56 A;  3ATR A;  3FPZ A;  4DSG A;  4GRT A;  4K5S A;  5KOW A;  1NHP A;  2AAQ A;  2BYB A;  1LJ1 A;  2XFU A;  3ABV A;  4Y4L A;  5HY5 A;  3BNM A;  2DKI A;  2H89 A;  3T0K A;  1KSU A;  2FJA A;  1Q1W A;  3DA1 A;  2C70 A;  2V60 A;  3QSS A;  5BVA A;  4O5U A;  1FOH A;  1CC4 A;  2B7R A;  2C73 A;  2C67 A;  4TLZ A;  3S5W A;  1IUX A;  2BAC A;  2WPE A;  3V3O A;  1BF3 A;  4YTN A;  3NK2 X;  2GV8 A;  3IHM A;  1NPX A;  3PVC A;  2QA1 A;  4BK1 A;  2FBW A;  1B8S A;  4HB9 A;  4CBQ A;  4G74 A;  4AT0 A;  3ZDN A;  2C72 A;  1L0V A;  2B9W A;  1GOS A;  2C4C A;  4KX6 A;  1COY A;  1O95 A;  3KPK A;  4XWZ A;  3V3N A;  2BRY A;  4NWZ A;  5U1O A;  2XVF A;  2Z5Y A;  1JNZ A;  4RG3 A;  3UKQ A;  1NEK A;  1E1N A;  3DGH A;  3SGL A;  4EM3 A;  3H8I A;  1QLB A;  3EAN A;  4P9S A;  4YSH A;  3NH3 X;  4YWO A;  1OJ9 A;  2BK3 A;  2VZ2 A;  3GYX A;  2CVJ A;  3K7M X;  5FS6 A;  3T37 A;  1GRF A;  3GYI A;  2CFY A;  3UTF A;  1GES A;  1CHU A;  3KD9 A;  1ZMD A;  5FS7 A;  4H2N A;  4YKF A;  3VRA A;  1TDN A;  4IVO B;  1GV4 A;  4TLX A;  1NAA A;  1E7P A;  3HYW A;  4J31 A;  1Y56 A;  3L8K A;  4JY3 A;  1OJT A;  4MJW A;  3SQP A;  3FIM B;  4FK1 A;  1ELI A; 
#chains in the Genus database with same CATH homology
 1DOC A;  3AWI A;  2C65 A;  3ICS A;  4K22 A;  1PN0 A;  2VQB A;  4YKG A;  4YT0 A;  5BRT A;  1O5W A;  2YM2 A;  1GTH A;  3VR8 A;  3AE9 A;  3CNT A;  5GRT A;  3NHO X;  2TMD A;  3HZL A;  4BK3 A;  2V3B A;  3BNU A;  4K8D A;  1M6I A;  1CC6 A;  4EQR A;  2Q7V A;  5M10 A;  2CUL A;  3FMW A;  4H4Y A;  4TM0 A;  5FS9 A;  3LZW A;  3GRT A;  3NN6 X;  3OZ2 A;  4B64 A;  3GD3 A;  1S3E A;  3AYJ A;  4J36 A;  1K0L A;  2E1M A;  1GXF A;  3GSI A;  4XXG A;  4LII A;  1D7Y A;  3UKA A;  1TDK A;  3QVP A;  1EL8 A;  3CGE A;  4OPI A;  3RP6 A;  3WE0 A;  3K7T A;  3AEF A;  5L46 A;  3NYC A;  1DOE A;  4CY6 A;  4H7U A;  2VVL G;  1ZOY A;  2FJD A;  3GDP A;  2WU5 A;  2YLT A;  4WCT A;  4ZCC A;  2ACZ A;  2QCU A;  3NK1 X;  3VRD B;  2IVD A;  2YLS A;  1MOK A;  2TPR A;  2C64 A;  2ZZ0 A;  1VG0 A;  2WOV A;  3KA7 A;  2C76 A;  5IPY A;  3QJ4 A;  2JAE A;  1XDI A;  1FL2 A;  3IWA A;  4U8N A;  3V76 A;  3COX A;  2XVH A;  3GYJ A;  3IF9 A;  3B6D A;  2B7S A;  3KKJ A;  1ZKQ A;  5LV9 A;  1ZX9 A;  2R0G A;  4FK1 C;  3NYF A;  3T14 A;  2XLR A;  4C74 A;  4A6N B;  3UKK A;  1UKV G;  1ZK7 A;  4U8I A;  3UOV A;  1N1P A;  3AED A;  5U25 A;  4C3Y A;  1F6M A;  2I0Z A;  1S2Y A;  4CY8 A;  4YSY A;  4Z43 A;  2VQ7 A;  2YG4 A;  3SZ0 A;  3CGB A;  2Q0L A;  4NTC A;  4U8P A;  1PS9 A;  3G5R A;  2WOI A;  3G5S A;  1RP0 A;  2VRL A;  4U8M A;  3RP7 A;  2GRT A;  2B9Y A;  2AR8 A;  5FS8 A;  4DGK A;  3EF6 A;  4UDQ A;  3CNJ A;  3DK4 A;  3HYX A;  2XLU A;  1PBE A;  1OJC A;  1JU2 A;  1MXT A;  2X8G A;  1NHR A;  4BUR A;  1BGN A;  4H4T A;  2EQ8 A;  4AOS A;  3CMM A;  3ITJ A;  2XFN A;  3FBS A;  1ZY8 A;  2BS3 A;  4UDR A;  4DSH A;  4Z2U A;  3O0H A;  4A7A A;  2C7G A;  2XVE A;  1GRG A;  5J60 A;  4PAA A;  4REK A;  1KNP A;  3QVR A;  5M0Z A;  1DNC A;  3NNE A;  4OPL A;  4JY2 A;  3M0O A;  3P4P A;  2GR0 A;  4JN9 A;  3DH9 A;  3CNP A;  1REO A;  1IUV A;  4TM1 A;  1JRY A;  4IA5 A;  4BK2 A;  3AE3 A;  4G73 A;  4J2W A;  4K5R A;  3KLJ A;  3AEC A;  3CND A;  1JEH A;  2WPC A;  5EB4 A;  2V61 A;  2WES A;  3K7Q X;  1TDF A;  4Z2R A;  2Y6R A;  1GRB A;  2XVI A;  1D4D A;  3UTG A;  1FEC A;  3NLC A;  1GEU A;  1X31 B;  1MO9 A;  1RYI A;  4J34 A;  1IJH A;  3CPJ G;  3LOV A;  5HXI A;  1H6V A;  1H7X A;  2BAB A;  2EQ7 A;  2VVL A;  3FG2 P;  3RED A;  4H2R A;  1KDG A;  2QA2 A;  2YVJ A;  2YVG A;  4H4Q A;  4EMI A;  2FJE A;  1W4X A;  2XCG A;  3AEG A;  5JCL A;  4CCR A;  2Y6Q A;  4WX1 A;  3SFE A;  1TYT A;  3SYI A;  4ZN0 A;  2F5Z A;  1PXC A;  1E1L A;  1GRT A;  3C96 A;  1DOB A;  4A6N A;  3SFD A;  3H8L A;  4G6H A;  3ISH A;  3B3R A;  3AD7 B;  4YSZ A;  3UP5 A;  2NVK X;  2YG7 A;  4ICY A;  2YM1 A;  3I6D A;  3R9U A;  1N4W A;  1FEB A;  1PBC A;  5EBK A;  1KSS A;  1ZOV A;  3F8D A;  1Z6L A;  1CF3 A;  4Z2T A;  2YLZ A;  2YVF A;  1VRQ B;  2PHH A;  4USQ A;  4BJZ A;  4XWR A;  3T2Y A;  2Q0K A;  3NRN A;  1N4U A;  3CN8 A;  2XFP A;  1PDH A;  4U8L A;  5FMH A;  2W0H A;  2GH5 A;  1CBO A;  1CJ3 A;  1M64 A;  2OLO A;  3LB8 A;  3NTA A;  1H82 A;  3II4 A;  3GWD A;  1LQT A;  4EM4 A;  1ZP0 A;  2JKC A;  3GWF A;  4IA6 A;  1RSG A;  3GMC A;  1CL0 A;  3UKH A;  3LZX A;  3PO7 A;  3Q9T A;  3IC9 A;  5EOW A;  3JSK A;  2BS4 A;  4J33 A;  5KWF A;  3ZYX A;  4U2L A;  3CIR A;  1S3B A;  2R0C A;  4CCQ A;  2YLW A;  3NN0 X;  1B37 A;  2C75 A;  4TM3 A;  1QO8 A;  4B65 A;  4IV9 A;  4N9X A;  4NEW A;  3ICT A;  5KVH A;  2YG6 A;  4X9M A;  4H4W A;  4DNA A;  2BC1 A;  2XLT A;  3D8X A;  2WBA A;  3UP4 A;  3NK0 X;  4UDP A;  1XAN A;  2FJB A;  1GT8 A;  2WP9 A;  4H2Q A;  3DGZ A;  1JNR A;  4Y4M A;  2JBV A;  4Z44 A;  5KRQ A;  4B69 A;  2JB2 A;  4I59 A;  3KPF A;  2WDQ A;  1CJC A;  4G6G A;  4H4X A;  2OAL A;  1DJQ A;  3AE7 A;  2GQF A;  1L9E A;  3NTD A;  4U8J A;  1TRB A;  3OC4 A;  3AE8 A;  3CGC A;  5JCI A;  5KMR A;  4H4R A;  1HYU A;  1YKJ A;  4H4V A;  3SZC A;  1F3P A;  2BS2 A;  2X50 A;  4JDR A;  5U63 A;  1KF6 A;  1FEA A;  3DK9 A;  3UKF A;  2WDV A;  1E1M A;  3AE4 A;  2ZBW A;  4KPR A;  4NTE A;  4GDP A;  4NZH A;  4A65 A;  1F8R A;  5J7X A;  4E0V A;  4OPT A;  5C2T A;  1DJN A;  2B76 A;  1TDO A;  1CJ2 A;  3NGC X;  4YSX A;  5JCK A;  2R0P A;  1EL7 A;  4C5O A;  3LXD A;  2YWL A;  2RGJ A;  2WPF A;  2BCP A;  2GMJ A;  2WS3 A;  4K2X A;  3ALL A;  3EPT A;  4JQ9 A;  2GMH A;  4CRT A;  3SZW A;  1BKW A;  2XYO A;  4UP3 A;  1GET A;  1P2H A;  4IVM B;  3AD9 B;  3P9U A;  3AB1 A;  4Z24 A;  5KMP A;  5KXJ A;  3NIX A;  1PJ7 A;  3NG7 X;  5ER0 A;  1KNR A;  3AYI A;  4II3 A;  2R9Z A;  3AE1 A;  2WEU A;  3IHG A;  3VQR A;  1VQW A;  3QFA A;  1JRX A;  3GDN A;  4LU6 A;  1IUT A;  2BK5 A;  4CNJ A;  4PAB A;  3AE6 A;  4EMW A;  4U8O A;  1D5T A;  2JK6 A;  2Z5X A;  4NNJ A;  2GF3 A;  4OVI A;  1ZMC A;  3AXB A;  2GR3 A;  3HYV A;  1LV0 A;  5HYM A;  1GRE A;  2R4E A;  1AOG A;  4HA6 A;  1K0J A;  3SX6 A;  1PBD A;  1GRH A;  1K4Q A;  2ZZC A;  2GB0 A;  2V6O A;  2V5Z A;  3RHA A;  4EIP A;  4YXD A;  1NG3 A;  1NHS A;  2GAH B;  4D03 A;  1PXB A;  3EAO A;  4Z25 A;  3T31 A;  1H86 A;  3GRS A;  5KMQ A;  2GQW A;  4AP1 A;  4BV6 A;  1EL9 A;  3DJE A;  1D4E A;  2A89 A;  3AYL A;  1IUS A;  3D1C A;  4X9N A;  2VRM A;  5GSN A;  1NG4 A;  3UOX A;  1ZDL A;  2E4G A;  1E1K A;  1GTE A;  5JCM A;  2GVC A;  3P1W A;  2X3N A;  1YQ4 A;  2RAB A;  1PJ5 A;  2BCG G;  2C3C A;  3UKP A;  5KMS A;  2R46 A;  2GAG B;  2BA9 A;  3ALM A;  1TDE A;  2JB3 A;  3DJJ A;  4H4U A;  4O5Q A;  1H83 A;  4M52 A;  4FDC B;  1EL5 A;  1V59 A;  1LTX R;  1L9D A;  4EQX A;  2CDU A;  4H4Z A;  1BGJ A;  4A5L A;  1D4C A;  4GCM A;  2O9Z A;  2A8X A;  1LPF A;  1QJD A;  4TM4 A;  2HQM A;  2R45 A;  3P4Q A;  3Q6J A;  4Y4N A;  4K7Z A;  1GND A;  3LAD A;  4YTM A;  1GRA A;  2VVM A;  2YG5 A;  2EQ6 A;  2XDO A;  2VOU A;  2XLP A;  3AEA A;  4GAV A;  4B67 A;  2R4J A;  1K0I A;  3BI2 A;  3ADA B;  4H4P A;  2YR5 A;  1CC2 A;  1E6E A;  5C3J A;  1DXL A;  3KVE A;  3NKS A;  5CKU A;  3DME A;  3VR9 A;  4RG4 A;  2UZZ A;  2GR1 A;  3DJD A;  3C4N A;  2BC0 A;  3AE2 A;  3CTY A;  4OPD A;  4U8K A;  4BJY A;  5BUL A;  1GER A;  1SEZ A;  1JOA A;  5DBJ A;  1B4V A;  3P4S A;  3ALJ A;  2ZZB A;  3BHK A;  3QSM A;  1E39 A;  1Y56 B;  3K30 A;  4GF7 A;  3SZF A;  4B1B A;  2XFO A;  3F8R A;  4FX9 A;  4U2S A;  1Q1R A;  4GAP A;  1KFY A;  3G5Q A;  5IQ1 A;  3T2K A;  4A79 A;  3ATQ A;  1JRZ A;  3GMB A;  2BK4 A;  2WOW A;  4EQS A;  1ONF A;  1F8S A;  4USR A;  2NPX A;  4AP3 A;  2WP5 A;  2WP6 A;  5KNL A;  2E5V A;  3UCL A;  1VDC A;  4ZCD A;  4AOX A;  1XPQ A;  2JB1 A;  3I3L A;  3UTH A;  1IUU A;  4Z26 A;  2WQY A;  1O94 A;  1H81 A;  4A9W A;  2YG3 A;  2C66 A;  4AT2 A;  1GPE A;  2BRA A;  1Q9I A;  5CQF A;  5KVI A;  2YQU A;  5IQ4 A;  3PS9 A;  3UTE A;  1YY5 A;  1N4V A;  2DKH A;  3BHF A;  3NYE A;  2YR4 A;  3SXI A;  3C4A A;  3UOY A;  4A99 A;  4B66 A;  4C77 A;  1B5Q A;  1GAL A;  1H7W A;  2A87 A;  2OAM A;  4H50 A;  5TR3 A;  2X8H A;  3NT6 A;  1YQ3 A;  2YLR A;  1OJA A;  1D7L A;  1PBB A;  4APN A;  1XHC A;  2X8C A;  1NDA A;  4EQW A;  5JCN A;  4CNK A;  2WET A;  2IID A;  4EMJ A;  2PYX A;  4GR1 A;  2Q6U A;  2X99 A;  4G9K A;  3ICR A;  3M13 A;  1PXA A;  3UKL A;  4D04 A;  5BUK A;  4OCG A;  3E1T A;  3VRB A;  1F8W A;  2H88 A;  1VG9 A;  1IUW A;  5HHF A;  4J57 A;  4U2T A;  2OLN A;  1S2Q A;  3RP8 A;  2J3N A;  2GEW A;  3T2Z A;  4H4S A;  3M12 A;  1FCD A;  1YQZ A;  2EQ9 A;  1PJ6 A;  1LVL A;  3QSE A;  3CNS A;  4II2 A;  4LA1 A;  2IVE A;  2XLS A;  2WHD A;  4B63 A;  3QFB A;  3AD8 B;  3CPH G;  4X4J A;  4H2P A;  2WDR A;  4OPG A;  5KOX A;  3DJG X;  3H4K A;  2OA1 A;  1CJ4 A;  4GUV A;  2ARD A;  2YAU A;  4ECH A;  3AE5 A;  1OJD A;  3LJP A;  4OPU A;  2AQJ A;  3L1R A;  3SM8 A;  2V3A A;  2B9X A;  3BI4 A;  4YTP A;  3DK8 A;  1BWC A;  1P2E A;  2BXS A;  4EIQ A;  2APG A;  2YLX A;  1DOD A;  1H84 A;  3AEE A;  2RGH A;  3CGD A;  3S61 A;  2WU2 A;  1NEN A;  1Y0P A;  4I58 A;  3GD4 A;  1PBF A;  3KU9 A;  5EB5 A;  4ADW A;  2GR2 A;  2XFQ A;  1NHQ A;  2XVJ A;  4B68 A;  1GSN A;  1L9C A;  1TYP A;  2YR6 A;  3P4R A;  4C3X A;  1LQU A;  3BI5 A;  4JNQ A;  4JNA A;  4NTD A;  3UOZ A;  2BXR A;  4GDE A;  2QAE A;  1BZL A;  3F8P A;  3AEB A;  4NEV A;  3SY4 A;  3CPI G;  1PHH A;  3URH A;  2RGO A;  2C3D A;  4OPC A;  3RNM A;  1EBD A;  4RSL A;  4J56 A;  3ATR A;  3FPZ A;  4DSG A;  4GRT A;  4K5S A;  5KOW A;  1NHP A;  2AAQ A;  2BYB A;  1LJ1 A;  2XFU A;  3ABV A;  4Y4L A;  5HY5 A;  3BNM A;  2DKI A;  2H89 A;  3T0K A;  1KSU A;  2FJA A;  1Q1W A;  3DA1 A;  2C70 A;  2V60 A;  3QSS A;  5BVA A;  4O5U A;  1FOH A;  1CC4 A;  2B7R A;  2C73 A;  2C67 A;  4TLZ A;  3S5W A;  1IUX A;  2BAC A;  2WPE A;  3V3O A;  1BF3 A;  4YTN A;  3NK2 X;  2GV8 A;  3IHM A;  1NPX A;  3PVC A;  2QA1 A;  4BK1 A;  2FBW A;  1B8S A;  4HB9 A;  4CBQ A;  4G74 A;  4AT0 A;  3ZDN A;  2C72 A;  1L0V A;  2B9W A;  1GOS A;  2C4C A;  4KX6 A;  1COY A;  1O95 A;  3KPK A;  4XWZ A;  3V3N A;  2BRY A;  4NWZ A;  5U1O A;  2XVF A;  2Z5Y A;  1JNZ A;  4RG3 A;  3UKQ A;  1NEK A;  1E1N A;  3DGH A;  3SGL A;  4EM3 A;  3H8I A;  1QLB A;  3EAN A;  4P9S A;  4YSH A;  3NH3 X;  4YWO A;  1OJ9 A;  2BK3 A;  2VZ2 A;  3GYX A;  2CVJ A;  3K7M X;  5FS6 A;  3T37 A;  1GRF A;  3GYI A;  2CFY A;  3UTF A;  1GES A;  1CHU A;  3KD9 A;  1ZMD A;  5FS7 A;  4H2N A;  4YKF A;  3VRA A;  1TDN A;  4IVO B;  1GV4 A;  4TLX A;  1NAA A;  1E7P A;  3HYW A;  4J31 A;  1Y56 A;  3L8K A;  4JY3 A;  1OJT A;  4MJW A;  3SQP A;  3FIM B;  4FK1 A;  1ELI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...