3F8PA

Structure of sulfolobus solfataricus trxr-b3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
VKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENEFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase (TrxB-3)
publication title Structure and stability of a thioredoxin reductase from Sulfolobus solfataricus: a thermostable protein with two functions
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.6.4.5: Transferred entry: 1.8.1.9.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA02
4J33A 2WBAA 4GCMA 2BC0A 4AT2A 3LZWA 4O5QA 2GR1A 4J36A 4A6NA 3D1CA 4B63A 2YG3A 4CNJA 2GF3A 1K0LA 4EMWA 1COYA 1ZOYA 2YLXA 5KVHA 1PJ6A 2BC1A 1H6VA 4C3YA 5JCLA 1TYPA 2X99A 4U8NA 3C96A 2YWLA 1PBEA 1IUVA 2FJEA 4TM3A 5KOXA 1QJDA 3IC9A 4ADWA 5JCKA 1PDHA 2APGA 4YWOA 3ABVA 1YKJA 2XDOA 4DSGA 1NDAA 1QLBA 2BA9A 5KWFA 1JRXA 4Z24A 2B76A 1E1NA 3ICTA 2H89A 2YLWA 1FEBA 2BS2A 1SEZA 4B66A 1ONFA 1GRAA 1ZX9A 5EB4A 1O94A 3AB1A 4NTCA 3CIRA 1JU2A 2WDQA 1VQWA 2IVDA 5KRQA 3B3RA 5L46A 3KKJA 1GV4A 1GEUA 1HYUA 2EQ7A 2QAEA 2VZ2A 1DJQA 3CNDA 4P9SA 4CBQA 3NIXA 1GRGA 2R4JA 3NLCA 5C3JA 3AE1A 3IHGA 2H88A 4D03A 2GRTA 4CCQA 3EAOA 3ICSA 2B7SA 1H7XA 3I3LA 4YSZA 2FJAA 1GTEA 4XWZA 3WE0A 4EQWA 5U63A 1GT8A 1H7WA 2E5VA 5IQ1A 3NH3X 5FMHA 2R0GA 1XDIA 4Z2UA 4Z44A 1B8SA 1CJ4A 2GV8A 2B9XA 1CF3A 4JY2A 3REDA 3RP7A 4RSLA 3L8KA 2X8CA 4J2WA 3UTGA 4FK1C 2IIDA 3P9UA 1VRQB 1DNCA 2QA2A 1RP0A 3RNMA 2XVIA 2B7RA 3GD4A 2X50A 3AEGA 1JNZA 4H4TA 1CHUA 1NAAA 2BABA 3P4SA 1Y56A 3DGHA 4AP3A 4EMJA 1XHCA 2Y6RA 3IWAA 3IF9A 1OJAA 1D4CA 2Q0KA 1L0VA 2R0CA 1PBCA 3I6DA 3DK8A 4MJWA 4YXDA 4TM0A 1LPFA 3K7MX 1X31B 1PJ5A 4Y4NA 3SGLA 3GMCA 5EB5A 3M13A 4Y4LA 2BS3A 5M10A 3VRAA 4UDPA 1PXCA 3ALJA 1XANA 2XLUA 2VQ7A 2ACZA 3KU9A 4YKGA 1PN0A 2TMDA 1E7PA 2WU2A 3SQPA 2GR2A 2JBVA 4X9MA 1CC4A 2YG5A 1NPXA 4TM4A 3NKSA 4EQXA 3CTYA 5JCIA 3CGBA 3QSSA 4LIIA 4PABA 1FOHA 2V61A 3ZDNA 3FPZA 2J3NA 4H4QA 3NRNA 4YSYA 1VG9A 4BK1A 1NG4A 4TLXA 2FJBA 3NGCX 1GRHA 3AE7A 2C3CA 3BI5A 2DKIA 1NHPA 4C74A 3LB8A 4JN9A 5BULA 4AP1A 1TDKA 2YLZA 3G5RA 4A65A 4GF7A 4WCTA 1IJHA 2YG6A 3NG7X 4U8PA 2VVLA 3VR9A 3AEBA 4C3XA 5LV9A 3KA7A 2ARDA 2FBWA 3AD9B 2CFYA 4DNAA 2R4EA 2YM1A 2V3AA 2YG4A 3ATQA 2B9WA 1KDGA 1CC2A 4OPTA 3DMEA 4M52A 3AEDA 4JNAA 5KVIA 4YSHA 3DK9A 2FJDA 1ZP0A 1PBFA 1NG3A 2XFQA 4EIPA 4Z43A 3EF6A 1Z6LA 2BK3A 1VG0A 1V59A 3F8DA 1DOEA 3DJEA 2WPCA 2EQ9A 2OLNA 2WOVA 2XVEA 3VRDB 3UOYA 5FS8A 1JRZA 3S61A 1FECA 3K30A 3RP8A 3NK0X 2GVCA 1PXBA 2VRLA 2V6OA 4U8JA 4U8LA 4AOXA 4CNKA 1CBOA 1Q1WA 3AE6A 4ZCDA 3S5WA 4OPGA 3H4KA 1K0IA 2R45A 3AXBA 2C66A 3UOVA 2YR6A 3GDPA 3LZXA 3UKFA 4H4VA 4GUVA 1F8SA 2NVKX 1GOSA 4EQRA 1N4WA 3NN6X 4A6NB 2C3DA 1BKWA 4H2NA 2R46A 4CCRA 1CJ2A 2OAMA 2XLPA 3P4QA 5HHFA 1H82A 1KNRA 2XLRA 1F8WA 2GMHA 3ADAB 2YLSA 1BZLA 1L9CA 1Y0PA 2YQUA 4H50A 1EL7A 4YTPA 3NTAA 1D4EA 3NHOX 4U2TA 2WESA 1GALA 3AE4A 3DJGX 1PBBA 2GH5A 1S2YA 4H4WA 3UOXA 1NEKA 4KX6A 1D7LA 2GQWA 4H7UA 3KLJA 4REKA 1GSNA 1O5WA 1OJCA 2VOUA 3CN8A 3LOVA 1F3PA 5GRTA 2XYOA 1W4XA 4JDRA 4A79A 3D8XA 3G5SA 2YLTA 1TDOA 3AE8A 1MXTA 1ZDLA 2IVEA 1H86A 2ZBWA 3LADA 5FS9A 4EM3A 2C70A 2C76A 3ALMA 3NK2X 1B37A 3NYFA 4H4SA 2TPRA 4J57A 4U8KA 3AEFA 5CQFA 3RP6A 4YTNA 1KF6A 4ZCCA 3T37A 3KVEA 3SM8A 4NTEA 1ZMCA 3H8LA 4RG3A 3UKLA 1XPQA 2XVJA 3O0HA 2X8HA 2WDRA 4TM1A 4IA6A 2NPXA 2XFOA 4JNQA 4BV6A 4D04A 2RGJA 4EIQA 1E39A 1YY5A 3NYCA 3QJ4A 3CNPA 5DBJA 1JEHA 3PVCA 3GYIA 2A8XA 2Z5YA 1NHRA 3BI4A 4Z25A 3UKPA 2YVFA 1Q9IA 2XVHA 4GR1A 5IPYA 1EL5A 2XLSA 4CY8A 1B5QA 2AR8A 2E1MA 5ER0A 3GD3A 5BVAA 1L9EA 2VVMA 5M0ZA 1D7YA 2RGOA 1GETA 1Y56B 3P1WA 1N4UA 1GESA 2YVGA 5J60A 4OPCA 1CL0A 2GR0A 1CC6A 1LQUA 4H4ZA 4U8MA 3SFDA 3UKKA 1DXLA 2YVJA 3NNEA 4NEWA 4H4YA 2XFUA 4U2SA 4USQA 4Z2TA 4UP3A 3AYJA 1TYTA 4U8OA 5EOWA 3M12A 5JCMA 1DOCA 4NZHA 2E4GA 4NEVA 3ALLA 3QVRA 3DK4A 3GRSA 1FL2A 1O95A 1TDEA 2R0PA 2JK6A 1OJTA 2YR4A 3H8IA 4J56A 2AQJA 2JKCA 3KD9A 4LA1A 1L9DA 5U1OA 3NYEA 1IUXA 1M64A 3F8RA 1IUUA 1TDFA 2ZZBA 4JY3A 1ZK7A 2YAUA 3DJDA 3SFEA 4Z26A 3NK1X 1CJCA 4HA6A 4A5LA 1GRFA 4A7AA 1PJ7A 1F8RA 1RSGA 3GDNA 4IV9A 4EMIA 4ZN0A 5HXIA 3GMBA 1JRYA 2XCGA 4Z2RA 2RABA 2JB2A 2B9YA 5CKUA 4K5RA 4BK3A 4FX9A 2YM2A 1BWCA 2OA1A 3CGDA 3ITJA 1UKVG 1E1KA 1N4VA 1TRBA 3FIMB 3ZYXA 3QFBA 3AE2A 3FBSA 2GEWA 2EQ6A 1IUSA 3GWFA 2UZZA 4OPIA 3GWDA 3R9UA 3DH9A 5BUKA 4JQ9A 1B4VA 2BXRA 1E1MA 2CVJA 3BHKA 1IUWA 4UDQA 2AAQA 2R9ZA 2Y6QA 1BF3A 2V3BA 3GSIA 2JAEA 1IUTA 3COXA 1EBDA 4C5OA 4OPDA 3V3OA 2WOIA 4BURA 1DODA 2Q6UA 3AE9A 4IA5A 3PO7A 2W0HA 1NENA 2BCPA 3AYIA 2V60A 2OLOA 3C4NA 4EQSA 1H81A 2C73A 3UTEA 2ZZ0A 3UKAA 4A99A 3CNSA 1EL9A 3PS9A 3UTHA 1YQ4A 2XFNA 1PBDA 3BI2A 2DKHA 3E1TA 4H2PA 2QCUA 3CGCA 2XFPA 1DOBA 3C4AA 1KSUA 2XLTA 3QSMA 4K5SA 2XVFA 3AEEA 1LVLA 4H2QA 2YG7A 4J31A 1ZMDA 3BNUA 3HZLA 2WDVA 3LJPA 4AT0A 2C75A 3UOZA 3B6DA 4IVOB 2VQBA 2ZZCA 3NN0X 3OC4A 2OALA 2WETA 3EANA 1GNDA 3CPIG 2BK5A 2F5ZA 4K7ZA 1CJ3A 3Q9TA 3UP4A 1TDNA 4GRTA 1GERA 2C67A 2BACA 3DGZA 3EPTA 3GRTA 3P4RA 4ICYA 4Y4MA 2Q0LA 4O5UA 2GAHB 1LV0A 4KPRA 5KXJA 4DSHA 2RGHA 1JNRA 3AEAA 4LU6A 3ISHA 1ELIA 4K8DA 3G5QA 4BJZA 4E0VA 3BNMA 3LXDA 4ECHA 1GREA 4U2LA 2O9ZA 2WU5A 3CPJG 1LTXR 2C65A 3L1RA 2I0ZA 3CGEA 4H4PA 4HB9A 4BK2A 4PAAA 3CNJA 3F8PA 3VQRA 3II4A 4H4UA 1NHQA 1OJDA 5FS6A 3UTFA 3AD7B 2WS3A 4GDPA 3UP5A 2PYXA 4B65A 3K7QX 5FS7A 1OJ9A 4IVMB 2V5ZA 3V76A 1YQ3A 2GB0A 3K7TA 3QSEA 4YKFA 2C7GA 1GXFA 2C64A 3IHMA 5EBKA 3AE5A 1MOKA 1Q1RA 4U8IA 4APNA 3NTDA 1FEAA 4YTMA 1GRBA 2GR3A 3P4PA 4B68A 1QO8A 2BK4A 1D5TA 2JB1A 4B69A 2WP6A 5C2TA 1E1LA 1H84A 2GMJA 4GDEA 1AOGA 2WQYA 3QFAA 4RG4A 3NT6A 2BXSA 1YQZA 2GAGB 2A89A 2WOWA 5KOWA 3GYJA 4OPLA 3AWIA 2WHDA 4AOSA 1S2QA 2WP5A 1PHHA 4CRTA 1PS9A 1VDCA 2Z5XA 5JCNA 4H4RA 1M6IA 5TR3A 4C77A 1DJNA 2GQFA 2Q7VA 3FG2P 4I59A 4J34A 3AE3A 4B64A 3URHA 1F6MA 3CNTA 4DGKA 2BCGG 1REOA 3JSKA 4OCGA 3V3NA 4H4XA 4N9XA 3M0OA 3AECA 2QA1A 2C72A 5HYMA 2YLRA 1MO9A 1RYIA 2WEUA 5IQ4A 1PXAA 2CDUA 4YT0A 1P2EA 3QVPA 4B67A 3KPFA 1K0JA 2VVLG 5GSNA 2PHHA 2EQ8A 1S3EA 1LQTA 3DJJA 5U25A 1N1PA 1D4DA 1NHSA 1FCDA 2X8GA 2WPEA 4UDRA 4K22A 3DA1A 4FDCB 1GTHA 5BRTA 1H83A 3UKHA 4XWRA 4BJYA 4B1BA 3AYLA 1BGJA 1JOAA 2WPFA 3CPHG 3RHAA 1LJ1A 3VR8A 2JB3A 2BS4A 1E6EA 1GPEA 4K2XA 5J7XA 1KFYA 2WP9A 1ZY8A 2X3NA 4FK1A 4NTDA 1KSSA 3UKQA 5HY5A 1EL8A 4H2RA 4I58A 3AD8B 4OVIA 3BHFA 4WX1A 4OPUA 1P2HA 3OZ2A 2YR5A 1S3BA 4USRA 3UCLA 2VRMA 2CULA 1ZOVA 1GRTA 1BGNA 1ZKQA 1K4QA 2HQMA 3FMWA 3ATRA 3VRBA 4X4JA 4YSXA 3ICRA 2A87A 4A9WA 4EM4A 4X9NA 4CY6A 4XXGA 4TLZA 3Q6JA 2BYBA 1KNPA
chains in the Genus database with same CATH superfamily
4J33A 2WBAA 4GCMA 2BC0A 4AT2A 3LZWA 4O5QA 2GR1A 4J36A 4A6NA 4G6GA 3D1CA 4B63A 2YG3A 4CNJA 2GF3A 1K0LA 4EMWA 1COYA 1ZOYA 2BRYA 2YLXA 5KVHA 1PJ6A 2BC1A 1H6VA 4C3YA 5JCLA 1TYPA 2X99A 4U8NA 3C96A 2YWLA 1PBEA 1IUVA 2FJEA 4TM3A 5KOXA 1QJDA 3IC9A 4ADWA 5JCKA 1PDHA 2APGA 4YWOA 3ABVA 1YKJA 2XDOA 4DSGA 1NDAA 1QLBA 2BA9A 5KWFA 1JRXA 4Z24A 2B76A 1E1NA 3ICTA 2H89A 2YLWA 1FEBA 2BS2A 1SEZA 4B66A 1ONFA 1GRAA 1ZX9A 5EB4A 1O94A 3AB1A 4NTCA 3CIRA 1JU2A 2WDQA 1VQWA 2IVDA 5KMPA 5KRQA 3B3RA 5L46A 3KKJA 1GV4A 1GEUA 1HYUA 2EQ7A 2QAEA 2VZ2A 1DJQA 3CNDA 4P9SA 4CBQA 3NIXA 1GRGA 2R4JA 3NLCA 5C3JA 3AE1A 3IHGA 2H88A 4D03A 2GRTA 4CCQA 3EAOA 3ICSA 4II2A 2B7SA 1H7XA 3I3LA 4YSZA 2FJAA 1GTEA 4XWZA 3WE0A 4EQWA 5U63A 1GT8A 1H7WA 2E5VA 5IQ1A 3NH3X 5FMHA 2R0GA 1XDIA 4Z2UA 4Z44A 1B8SA 1CJ4A 2B9XA 2GV8A 1CF3A 4JY2A 3REDA 3RP7A 4RSLA 3L8KA 2X8CA 4J2WA 3UTGA 4FK1C 2IIDA 3P9UA 1VRQB 1DNCA 2QA2A 1RP0A 3RNMA 2XVIA 2B7RA 3GD4A 2X50A 3AEGA 1JNZA 4H4TA 1CHUA 1NAAA 2BABA 3P4SA 1Y56A 3DGHA 4AP3A 4EMJA 1XHCA 2Y6RA 3IWAA 3IF9A 1OJAA 1D4CA 2Q0KA 1L0VA 2R0CA 1PBCA 3I6DA 3DK8A 4MJWA 4YXDA 4TM0A 1LPFA 3K7MX 1X31B 1PJ5A 4Y4NA 3SGLA 3GMCA 5EB5A 3M13A 4Y4LA 2BS3A 4G6HA 3VRAA 4UDPA 5M10A 3SZWA 1PXCA 3ALJA 1XANA 2XLUA 2VQ7A 2ACZA 3KU9A 4YKGA 1PN0A 2TMDA 1E7PA 3T14A 2WU2A 3SQPA 2GR2A 2JBVA 4X9MA 1CC4A 2YG5A 1NPXA 4TM4A 3NKSA 4EQXA 3CTYA 5JCIA 3CGBA 3QSSA 4LIIA 4PABA 1FOHA 2V61A 3ZDNA 3FPZA 2J3NA 4H4QA 3NRNA 4YSYA 1VG9A 4BK1A 5KNLA 1NG4A 4TLXA 2FJBA 3NGCX 1GRHA 3AE7A 2C3CA 3BI5A 2DKIA 1NHPA 4C74A 3LB8A 4JN9A 5BULA 4AP1A 1TDKA 2YLZA 3G5RA 4A65A 4GF7A 4WCTA 1IJHA 2YG6A 3NG7X 4U8PA 2VVLA 3VR9A 3AEBA 4C3XA 5LV9A 3KA7A 2ARDA 2FBWA 3AD9B 2CFYA 4DNAA 2R4EA 4G9KA 2YM1A 2V3AA 2YG4A 3ATQA 2B9WA 1KDGA 1CC2A 4OPTA 3DMEA 4M52A 3AEDA 4JNAA 5KVIA 4YSHA 3DK9A 2FJDA 1ZP0A 1PBFA 1NG3A 2XFQA 4EIPA 4Z43A 3EF6A 1Z6LA 2BK3A 1VG0A 1V59A 3F8DA 1DOEA 3DJEA 2WPCA 2EQ9A 2OLNA 2WOVA 2XVEA 3VRDB 3HYVA 3UOYA 5FS8A 1JRZA 3S61A 1FECA 3K30A 3RP8A 3NK0X 2GVCA 1PXBA 2VRLA 2V6OA 4U8JA 3T0KA 4U8LA 4AOXA 4CNKA 3SZFA 1CBOA 1Q1WA 3AE6A 4ZCDA 3S5WA 4OPGA 3H4KA 1K0IA 2R45A 3AXBA 2C66A 3UOVA 2YR6A 3GDPA 3LZXA 3UKFA 4H4VA 4GUVA 1F8SA 3HYXA 2NVKX 1GOSA 4EQRA 1N4WA 3NN6X 3SY4A 4A6NB 2C3DA 1BKWA 4H2NA 5KMRA 2R46A 4CCRA 1CJ2A 2OAMA 2XLPA 3P4QA 5HHFA 1H82A 1KNRA 2XLRA 3T31A 1F8WA 2GMHA 3ADAB 2YLSA 1BZLA 1L9CA 1Y0PA 2YQUA 4H50A 1EL7A 4YTPA 3NTAA 1D4EA 3NHOX 4U2TA 2WESA 1GALA 3AE4A 3DJGX 1PBBA 2GH5A 1S2YA 4H4WA 3UOXA 1NEKA 4KX6A 1D7LA 2GQWA 4H7UA 3KLJA 4REKA 1GSNA 1O5WA 1OJCA 2VOUA 3CN8A 3LOVA 1F3PA 5GRTA 2XYOA 1W4XA 4JDRA 3KPKA 4A79A 3D8XA 3G5SA 2YLTA 1TDOA 3AE8A 1MXTA 1ZDLA 2IVEA 1H86A 2ZBWA 3LADA 5FS9A 4EM3A 2C70A 2C76A 3ALMA 3HYWA 1B37A 3NK2X 3NYFA 2TPRA 4H4SA 4J57A 3AEFA 4U8KA 3RP6A 3SX6A 1KF6A 3SYIA 4YTNA 5KMSA 4ZCCA 3T37A 3KVEA 3SM8A 4NTEA 1ZMCA 3H8LA 4RG3A 3UKLA 1XPQA 2XVJA 3O0HA 2X8HA 2WDRA 4TM1A 4IA6A 2NPXA 3SZ0A 2XFOA 4JNQA 4BV6A 4D04A 2RGJA 4EIQA 1E39A 1YY5A 3NYCA 3QJ4A 3CNPA 5DBJA 1JEHA 3PVCA 3GYIA 2A8XA 2Z5YA 1NHRA 3BI4A 4Z25A 3UKPA 2YVFA 1Q9IA 2XVHA 4GR1A 5IPYA 1EL5A 2XLSA 4CY8A 1B5QA 2AR8A 2E1MA 4GAPA 5ER0A 3GD3A 5BVAA 1L9EA 2VVMA 5M0ZA 1D7YA 2RGOA 1GETA 3SZCA 1Y56B 3P1WA 1N4UA 1GESA 2YVGA 5J60A 4OPCA 1CL0A 2GR0A 1CC6A 1LQUA 4H4ZA 4U8MA 3SFDA 3UKKA 1DXLA 2YVJA 3NNEA 4NEWA 4H4YA 2XFUA 4U2SA 4USQA 4Z2TA 4UP3A 3AYJA 1TYTA 4U8OA 5EOWA 3M12A 5JCMA 1DOCA 4NZHA 2E4GA 4NEVA 3ALLA 3QVRA 3DK4A 3GRSA 1FL2A 1O95A 1TDEA 2R0PA 2JK6A 1OJTA 2YR4A 3H8IA 4J56A 2AQJA 2JKCA 3KD9A 4LA1A 1L9DA 5U1OA 3NYEA 1IUXA 1M64A 3F8RA 1IUUA 1TDFA 2ZZBA 4JY3A 1ZK7A 2YAUA 3DJDA 3SFEA 4Z26A 3NK1X 1CJCA 4HA6A 4A5LA 1GRFA 4A7AA 1PJ7A 1F8RA 1RSGA 3GDNA 4IV9A 4EMIA 4ZN0A 5HXIA 3GMBA 1JRYA 2XCGA 4Z2RA 2RABA 2JB2A 2B9YA 5CKUA 4K5RA 4BK3A 4FX9A 2YM2A 1BWCA 2OA1A 3CGDA 3ITJA 1UKVG 1E1KA 1N4VA 1TRBA 3FIMB 3ZYXA 3QFBA 3AE2A 3FBSA 2GEWA 2EQ6A 1IUSA 3GWFA 2UZZA 4OPIA 3GWDA 3SXIA 3R9UA 3DH9A 5BUKA 4JQ9A 1B4VA 2BXRA 1E1MA 2CVJA 3BHKA 1IUWA 4UDQA 2AAQA 2R9ZA 2Y6QA 1BF3A 2V3BA 3GSIA 2JAEA 1IUTA 3COXA 1EBDA 4C5OA 4OPDA 3V3OA 2WOIA 4BURA 1DODA 2Q6UA 3AE9A 4IA5A 3T2KA 3PO7A 2W0HA 1NENA 2BCPA 3AYIA 2V60A 2OLOA 3C4NA 4EQSA 1H81A 2C73A 3UTEA 2ZZ0A 3UKAA 4A99A 3CNSA 1EL9A 3PS9A 3UTHA 1YQ4A 2XFNA 1PBDA 3BI2A 2DKHA 3E1TA 4H2PA 2QCUA 3CGCA 2XFPA 1DOBA 3C4AA 1KSUA 2XLTA 3QSMA 4K5SA 2XVFA 3AEEA 1LVLA 4H2QA 2YG7A 4J31A 1ZMDA 3BNUA 3HZLA 2WDVA 3LJPA 4AT0A 2C75A 3UOZA 3B6DA 4IVOB 2VQBA 2ZZCA 3NN0X 3OC4A 2OALA 2WETA 4G73A 3EANA 1GNDA 3CPIG 2BK5A 2F5ZA 4K7ZA 1CJ3A 3Q9TA 5KMQA 3UP4A 1TDNA 4GRTA 1GERA 2C67A 2BACA 3DGZA 3EPTA 3GRTA 3P4RA 4ICYA 4Y4MA 2Q0LA 4O5UA 2GAHB 3T2ZA 1LV0A 4KPRA 5KXJA 4DSHA 2RGHA 1JNRA 3AEAA 4LU6A 3ISHA 1ELIA 4K8DA 3G5QA 4BJZA 4E0VA 3BNMA 3LXDA 4ECHA 1GREA 4U2LA 2O9ZA 2WU5A 3CPJG 1LTXR 2C65A 3L1RA 2I0ZA 3CGEA 4H4PA 4HB9A 4BK2A 4PAAA 3CNJA 3F8PA 4GAVA 3VQRA 3II4A 4H4UA 1NHQA 1OJDA 5FS6A 3UTFA 3AD7B 2WS3A 4GDPA 3UP5A 2C4CA 2PYXA 4B65A 4G74A 3K7QX 5FS7A 4NNJA 1OJ9A 4IVMB 2V5ZA 5CQFA 3V76A 1YQ3A 2GB0A 3K7TA 3QSEA 4YKFA 2C7GA 1GXFA 2C64A 3IHMA 5EBKA 3AE5A 1MOKA 1Q1RA 4U8IA 4APNA 3NTDA 3T2YA 1FEAA 4YTMA 1GRBA 2GR3A 3P4PA 4B68A 1QO8A 2BK4A 1D5TA 2JB1A 4B69A 2WP6A 5C2TA 1E1LA 1H84A 2GMJA 4GDEA 1AOGA 2WQYA 3QFAA 4RG4A 3NT6A 2BXSA 1YQZA 2GAGB 2A89A 2WOWA 5KOWA 3GYJA 4OPLA 3AWIA 2WHDA 4AOSA 1S2QA 2WP5A 1PHHA 4CRTA 1PS9A 3GYXA 1VDCA 2Z5XA 5JCNA 4H4RA 1M6IA 5TR3A 4C77A 1DJNA 2GQFA 2Q7VA 3FG2P 4I59A 4J34A 3AE3A 4B64A 3URHA 1F6MA 3CNTA 4DGKA 2BCGG 1REOA 3JSKA 4OCGA 3V3NA 4H4XA 4N9XA 3M0OA 3AECA 2QA1A 2C72A 5HYMA 2YLRA 1MO9A 1RYIA 2WEUA 5IQ4A 1PXAA 2CDUA 4YT0A 1P2EA 3QVPA 4B67A 3KPFA 1K0JA 2VVLG 5GSNA 2PHHA 2EQ8A 1S3EA 1LQTA 3DJJA 5U25A 1N1PA 5J7XA 1D4DA 1NHSA 1FCDA 2X8GA 2WPEA 4UDRA 4K22A 3DA1A 4FDCB 1GTHA 5BRTA 1H83A 4NWZA 4XWRA 3UKHA 4BJYA 4B1BA 3AYLA 1BGJA 1JOAA 2WPFA 3CPHG 3RHAA 1LJ1A 3VR8A 2JB3A 2BS4A 1E6EA 1GPEA 4K2XA 3CMMA 1KFYA 2WP9A 1ZY8A 2X3NA 4FK1A 4II3A 1KSSA 4NTDA 3UKQA 5HY5A 1EL8A 4H2RA 4I58A 3AD8B 4OVIA 3BHFA 4WX1A 4OPUA 2BRAA 1P2HA 3OZ2A 2YR5A 1S3BA 4USRA 3UCLA 2VRMA 2CULA 1ZOVA 1GRTA 1BGNA 1ZKQA 1K4QA 2HQMA 3FMWA 3ATRA 3VRBA 4X4JA 4YSXA 3ICRA 2A87A 4A9WA 4EM4A 4X9NA 4CY6A 4XXGA 4TLZA 3Q6JA 2BYBA 1KNPA
chains in the Genus database with same CATH topology
4J33A 2WBAA 4GCMA 2BC0A 4AT2A 3LZWA 4O5QA 2GR1A 4J36A 4A6NA 4G6GA 3D1CA 4B63A 2YG3A 4CNJA 2GF3A 1K0LA 4EMWA 1COYA 1ZOYA 2BRYA 2YLXA 5KVHA 1PJ6A 2BC1A 1H6VA 4C3YA 5JCLA 1TYPA 2X99A 4U8NA 3C96A 2YWLA 1PBEA 1IUVA 2FJEA 4TM3A 5KOXA 1QJDA 3IC9A 4ADWA 5JCKA 1PDHA 2APGA 4YWOA 3ABVA 1YKJA 2XDOA 4DSGA 1NDAA 1QLBA 2BA9A 5KWFA 1JRXA 4Z24A 2B76A 1E1NA 3ICTA 2H89A 2YLWA 1FEBA 2BS2A 1SEZA 4B66A 1ONFA 1GRAA 1ZX9A 5EB4A 1O94A 3AB1A 4NTCA 3CIRA 1JU2A 2WDQA 1VQWA 2IVDA 5KMPA 5KRQA 3B3RA 5L46A 3KKJA 1GV4A 1GEUA 1HYUA 2EQ7A 2QAEA 2VZ2A 1DJQA 3CNDA 4P9SA 4CBQA 3NIXA 1GRGA 2R4JA 3NLCA 5C3JA 3AE1A 3IHGA 2H88A 4D03A 2GRTA 4CCQA 3EAOA 3ICSA 4II2A 2B7SA 1H7XA 3I3LA 4YSZA 2FJAA 1GTEA 4XWZA 3WE0A 4EQWA 5U63A 1GT8A 1H7WA 2E5VA 5IQ1A 3NH3X 5FMHA 2R0GA 1XDIA 4Z2UA 4Z44A 1B8SA 1CJ4A 2B9XA 2GV8A 1CF3A 4JY2A 3REDA 3RP7A 4RSLA 3L8KA 2X8CA 4J2WA 3UTGA 4FK1C 2IIDA 3P9UA 1VRQB 1DNCA 2QA2A 1RP0A 3RNMA 2XVIA 2B7RA 3GD4A 2X50A 3AEGA 1JNZA 4H4TA 1CHUA 1NAAA 2BABA 3P4SA 1Y56A 3DGHA 4AP3A 4EMJA 1XHCA 2Y6RA 3IWAA 3IF9A 1OJAA 1D4CA 2Q0KA 1L0VA 2R0CA 1PBCA 3I6DA 3DK8A 4MJWA 4YXDA 4TM0A 1LPFA 3K7MX 1X31B 1PJ5A 4Y4NA 3SGLA 3GMCA 5EB5A 3M13A 4Y4LA 2BS3A 4G6HA 3VRAA 4UDPA 5M10A 3SZWA 1PXCA 3ALJA 1XANA 2XLUA 2VQ7A 2ACZA 3KU9A 4YKGA 1PN0A 2TMDA 1E7PA 3T14A 2WU2A 3SQPA 2GR2A 2JBVA 4X9MA 1CC4A 2YG5A 1NPXA 4TM4A 3NKSA 4EQXA 3CTYA 5JCIA 3CGBA 3QSSA 4LIIA 4PABA 1FOHA 2V61A 3ZDNA 3FPZA 2J3NA 4H4QA 3NRNA 4YSYA 1VG9A 4BK1A 5KNLA 1NG4A 4TLXA 2FJBA 3NGCX 1GRHA 3AE7A 2C3CA 3BI5A 2DKIA 1NHPA 4C74A 3LB8A 4JN9A 5BULA 4AP1A 1TDKA 2YLZA 3G5RA 4A65A 4GF7A 4WCTA 1IJHA 2YG6A 3NG7X 4U8PA 2VVLA 3VR9A 3AEBA 4C3XA 5LV9A 3KA7A 2ARDA 2FBWA 3AD9B 2CFYA 4DNAA 2R4EA 4G9KA 2YM1A 2V3AA 2YG4A 3ATQA 2B9WA 1KDGA 1CC2A 4OPTA 3DMEA 4M52A 3AEDA 4JNAA 5KVIA 4YSHA 3DK9A 2FJDA 1ZP0A 1PBFA 1NG3A 2XFQA 4EIPA 4Z43A 3EF6A 1Z6LA 2BK3A 1VG0A 1V59A 3F8DA 1DOEA 3DJEA 2WPCA 2EQ9A 2OLNA 2WOVA 2XVEA 3VRDB 3HYVA 3UOYA 5FS8A 1JRZA 3S61A 1FECA 3K30A 3RP8A 3NK0X 2GVCA 1PXBA 2VRLA 2V6OA 4U8JA 3T0KA 4U8LA 4AOXA 4CNKA 3SZFA 1CBOA 1Q1WA 3AE6A 4ZCDA 3S5WA 4OPGA 3H4KA 1K0IA 2R45A 3AXBA 2C66A 3UOVA 2YR6A 3GDPA 3LZXA 3UKFA 4H4VA 4GUVA 1F8SA 3HYXA 2NVKX 1GOSA 4EQRA 1N4WA 3NN6X 3SY4A 4A6NB 2C3DA 1BKWA 4H2NA 5KMRA 2R46A 4CCRA 1CJ2A 2OAMA 2XLPA 3P4QA 5HHFA 1H82A 1KNRA 2XLRA 3T31A 1F8WA 2GMHA 3ADAB 2YLSA 1BZLA 1L9CA 1Y0PA 2YQUA 4H50A 1EL7A 4YTPA 3NTAA 1D4EA 3NHOX 4U2TA 2WESA 1GALA 3AE4A 3DJGX 1PBBA 2GH5A 1S2YA 4H4WA 3UOXA 1NEKA 4KX6A 1D7LA 2GQWA 4H7UA 3KLJA 4REKA 1GSNA 1O5WA 1OJCA 2VOUA 3CN8A 3LOVA 1F3PA 5GRTA 2XYOA 1W4XA 4JDRA 3KPKA 4A79A 3D8XA 3G5SA 2YLTA 1TDOA 3AE8A 1MXTA 1ZDLA 2IVEA 1H86A 2ZBWA 3LADA 5FS9A 4EM3A 2C70A 2C76A 3ALMA 3HYWA 1B37A 3NK2X 3NYFA 2TPRA 4H4SA 4J57A 3AEFA 4U8KA 3RP6A 3SX6A 1KF6A 3SYIA 4YTNA 5KMSA 4ZCCA 3T37A 3KVEA 3SM8A 4NTEA 1ZMCA 3H8LA 4RG3A 3UKLA 1XPQA 2XVJA 3O0HA 2X8HA 2WDRA 4TM1A 4IA6A 2NPXA 3SZ0A 2XFOA 4JNQA 4BV6A 4D04A 2RGJA 4EIQA 1E39A 1YY5A 3NYCA 3QJ4A 3CNPA 5DBJA 1JEHA 3PVCA 3GYIA 2A8XA 2Z5YA 1NHRA 3BI4A 4Z25A 3UKPA 2YVFA 1Q9IA 2XVHA 4GR1A 5IPYA 1EL5A 2XLSA 4CY8A 1B5QA 2AR8A 2E1MA 4GAPA 5ER0A 3GD3A 5BVAA 1L9EA 2VVMA 5M0ZA 1D7YA 2RGOA 1GETA 3SZCA 1Y56B 3P1WA 1N4UA 1GESA 2YVGA 5J60A 4OPCA 1CL0A 2GR0A 1CC6A 1LQUA 4H4ZA 4U8MA 3SFDA 3UKKA 1DXLA 2YVJA 3NNEA 4NEWA 4H4YA 2XFUA 4U2SA 4USQA 4Z2TA 4UP3A 3AYJA 1TYTA 4U8OA 5EOWA 3M12A 5JCMA 1DOCA 4NZHA 2E4GA 4NEVA 3ALLA 3QVRA 3DK4A 3GRSA 1FL2A 1O95A 1TDEA 2R0PA 2JK6A 1OJTA 2YR4A 3H8IA 4J56A 2AQJA 2JKCA 3KD9A 4LA1A 1L9DA 5U1OA 3NYEA 1IUXA 1M64A 3F8RA 1IUUA 1TDFA 2ZZBA 4JY3A 1ZK7A 2YAUA 3DJDA 3SFEA 4Z26A 3NK1X 1CJCA 4HA6A 4A5LA 1GRFA 4A7AA 1PJ7A 1F8RA 1RSGA 3GDNA 4IV9A 4EMIA 4ZN0A 5HXIA 3GMBA 1JRYA 2XCGA 4Z2RA 2RABA 2JB2A 2B9YA 5CKUA 4K5RA 4BK3A 4FX9A 2YM2A 1BWCA 2OA1A 3CGDA 3ITJA 1UKVG 1E1KA 1N4VA 1TRBA 3FIMB 3ZYXA 3QFBA 3AE2A 3FBSA 2GEWA 2EQ6A 1IUSA 3GWFA 2UZZA 4OPIA 3GWDA 3SXIA 3R9UA 3DH9A 5BUKA 4JQ9A 1B4VA 2BXRA 1E1MA 2CVJA 3BHKA 1IUWA 4UDQA 2AAQA 2R9ZA 2Y6QA 1BF3A 2V3BA 3GSIA 2JAEA 1IUTA 3COXA 1EBDA 4C5OA 4OPDA 3V3OA 2WOIA 4BURA 1DODA 2Q6UA 3AE9A 4IA5A 3T2KA 3PO7A 2W0HA 1NENA 2BCPA 3AYIA 2V60A 2OLOA 3C4NA 4EQSA 1H81A 2C73A 3UTEA 2ZZ0A 3UKAA 4A99A 3CNSA 1EL9A 3PS9A 3UTHA 1YQ4A 2XFNA 1PBDA 3BI2A 2DKHA 3E1TA 4H2PA 2QCUA 3CGCA 2XFPA 1DOBA 3C4AA 1KSUA 2XLTA 3QSMA 4K5SA 2XVFA 3AEEA 1LVLA 4H2QA 2YG7A 4J31A 1ZMDA 3BNUA 3HZLA 2WDVA 3LJPA 4AT0A 2C75A 3UOZA 3B6DA 4IVOB 2VQBA 2ZZCA 3NN0X 3OC4A 2OALA 2WETA 4G73A 3EANA 1GNDA 3CPIG 2BK5A 2F5ZA 4K7ZA 1CJ3A 3Q9TA 5KMQA 3UP4A 1TDNA 4GRTA 1GERA 2C67A 2BACA 3DGZA 3EPTA 3GRTA 3P4RA 4ICYA 4Y4MA 2Q0LA 4O5UA 2GAHB 3T2ZA 1LV0A 4KPRA 5KXJA 4DSHA 2RGHA 1JNRA 3AEAA 4LU6A 3ISHA 1ELIA 4K8DA 3G5QA 4BJZA 4E0VA 3BNMA 3LXDA 4ECHA 1GREA 4U2LA 2O9ZA 2WU5A 3CPJG 1LTXR 2C65A 3L1RA 2I0ZA 3CGEA 4H4PA 4HB9A 4BK2A 4PAAA 3CNJA 3F8PA 4GAVA 3VQRA 3II4A 4H4UA 1NHQA 1OJDA 5FS6A 3UTFA 3AD7B 2WS3A 4GDPA 3UP5A 2C4CA 2PYXA 4B65A 4G74A 3K7QX 5FS7A 4NNJA 1OJ9A 4IVMB 2V5ZA 5CQFA 3V76A 1YQ3A 2GB0A 3K7TA 3QSEA 4YKFA 2C7GA 1GXFA 2C64A 3IHMA 5EBKA 3AE5A 1MOKA 1Q1RA 4U8IA 4APNA 3NTDA 3T2YA 1FEAA 4YTMA 1GRBA 2GR3A 3P4PA 4B68A 1QO8A 2BK4A 1D5TA 2JB1A 4B69A 2WP6A 5C2TA 1E1LA 1H84A 2GMJA 4GDEA 1AOGA 2WQYA 3QFAA 4RG4A 3NT6A 2BXSA 1YQZA 2GAGB 2A89A 2WOWA 5KOWA 3GYJA 4OPLA 3AWIA 2WHDA 4AOSA 1S2QA 2WP5A 1PHHA 4CRTA 1PS9A 3GYXA 1VDCA 2Z5XA 5JCNA 4H4RA 1M6IA 5TR3A 4C77A 1DJNA 2GQFA 2Q7VA 3FG2P 4I59A 4J34A 3AE3A 4B64A 3URHA 1F6MA 3CNTA 4DGKA 2BCGG 1REOA 3JSKA 4OCGA 3V3NA 4H4XA 4N9XA 3M0OA 3AECA 2QA1A 2C72A 5HYMA 2YLRA 1MO9A 1RYIA 2WEUA 5IQ4A 1PXAA 2CDUA 4YT0A 1P2EA 3QVPA 4B67A 3KPFA 1K0JA 2VVLG 5GSNA 2PHHA 2EQ8A 1S3EA 1LQTA 3DJJA 5U25A 1N1PA 5J7XA 1D4DA 1NHSA 1FCDA 2X8GA 2WPEA 4UDRA 4K22A 3DA1A 4FDCB 1GTHA 5BRTA 1H83A 4NWZA 4XWRA 3UKHA 4BJYA 4B1BA 3AYLA 1BGJA 1JOAA 2WPFA 3CPHG 3RHAA 1LJ1A 3VR8A 2JB3A 2BS4A 1E6EA 1GPEA 4K2XA 3CMMA 1KFYA 2WP9A 1ZY8A 2X3NA 4FK1A 4II3A 1KSSA 4NTDA 3UKQA 5HY5A 1EL8A 4H2RA 4I58A 3AD8B 4OVIA 3BHFA 4WX1A 4OPUA 2BRAA 1P2HA 3OZ2A 2YR5A 1S3BA 4USRA 3UCLA 2VRMA 2CULA 1ZOVA 1GRTA 1BGNA 1ZKQA 1K4QA 2HQMA 3FMWA 3ATRA 3VRBA 4X4JA 4YSXA 3ICRA 2A87A 4A9WA 4EM4A 4X9NA 4CY6A 4XXGA 4TLZA 3Q6JA 2BYBA 1KNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J33 A;  2WBA A;  4GCM A;  2BC0 A;  4AT2 A;  3LZW A;  4O5Q A;  2GR1 A;  4J36 A;  4A6N A;  3D1C A;  4B63 A;  2YG3 A;  4CNJ A;  2GF3 A;  1K0L A;  4EMW A;  1COY A;  1ZOY A;  2YLX A;  5KVH A;  1PJ6 A;  2BC1 A;  1H6V A;  4C3Y A;  5JCL A;  1TYP A;  2X99 A;  4U8N A;  3C96 A;  2YWL A;  1PBE A;  1IUV A;  2FJE A;  4TM3 A;  5KOX A;  1QJD A;  3IC9 A;  4ADW A;  5JCK A;  1PDH A;  2APG A;  4YWO A;  3ABV A;  1YKJ A;  2XDO A;  4DSG A;  1NDA A;  1QLB A;  2BA9 A;  5KWF A;  1JRX A;  4Z24 A;  2B76 A;  1E1N A;  3ICT A;  2H89 A;  2YLW A;  1FEB A;  2BS2 A;  1SEZ A;  4B66 A;  1ONF A;  1GRA A;  1ZX9 A;  5EB4 A;  1O94 A;  3AB1 A;  4NTC A;  3CIR A;  1JU2 A;  2WDQ A;  1VQW A;  2IVD A;  5KRQ A;  3B3R A;  5L46 A;  3KKJ A;  1GV4 A;  1GEU A;  1HYU A;  2EQ7 A;  2QAE A;  2VZ2 A;  1DJQ A;  3CND A;  4P9S A;  4CBQ A;  3NIX A;  1GRG A;  2R4J A;  3NLC A;  5C3J A;  3AE1 A;  3IHG A;  2H88 A;  4D03 A;  2GRT A;  4CCQ A;  3EAO A;  3ICS A;  2B7S A;  1H7X A;  3I3L A;  4YSZ A;  2FJA A;  1GTE A;  4XWZ A;  3WE0 A;  4EQW A;  5U63 A;  1GT8 A;  1H7W A;  2E5V A;  5IQ1 A;  3NH3 X;  5FMH A;  2R0G A;  1XDI A;  4Z2U A;  4Z44 A;  1B8S A;  1CJ4 A;  2GV8 A;  2B9X A;  1CF3 A;  4JY2 A;  3RED A;  3RP7 A;  4RSL A;  3L8K A;  2X8C A;  4J2W A;  3UTG A;  4FK1 C;  2IID A;  3P9U A;  1VRQ B;  1DNC A;  2QA2 A;  1RP0 A;  3RNM A;  2XVI A;  2B7R A;  3GD4 A;  2X50 A;  3AEG A;  1JNZ A;  4H4T A;  1CHU A;  1NAA A;  2BAB A;  3P4S A;  1Y56 A;  3DGH A;  4AP3 A;  4EMJ A;  1XHC A;  2Y6R A;  3IWA A;  3IF9 A;  1OJA A;  1D4C A;  2Q0K A;  1L0V A;  2R0C A;  1PBC A;  3I6D A;  3DK8 A;  4MJW A;  4YXD A;  4TM0 A;  1LPF A;  3K7M X;  1X31 B;  1PJ5 A;  4Y4N A;  3SGL A;  3GMC A;  5EB5 A;  3M13 A;  4Y4L A;  2BS3 A;  5M10 A;  3VRA A;  4UDP A;  1PXC A;  3ALJ A;  1XAN A;  2XLU A;  2VQ7 A;  2ACZ A;  3KU9 A;  4YKG A;  1PN0 A;  2TMD A;  1E7P A;  2WU2 A;  3SQP A;  2GR2 A;  2JBV A;  4X9M A;  1CC4 A;  2YG5 A;  1NPX A;  4TM4 A;  3NKS A;  4EQX A;  3CTY A;  5JCI A;  3CGB A;  3QSS A;  4LII A;  4PAB A;  1FOH A;  2V61 A;  3ZDN A;  3FPZ A;  2J3N A;  4H4Q A;  3NRN A;  4YSY A;  1VG9 A;  4BK1 A;  1NG4 A;  4TLX A;  2FJB A;  3NGC X;  1GRH A;  3AE7 A;  2C3C A;  3BI5 A;  2DKI A;  1NHP A;  4C74 A;  3LB8 A;  4JN9 A;  5BUL A;  4AP1 A;  1TDK A;  2YLZ A;  3G5R A;  4A65 A;  4GF7 A;  4WCT A;  1IJH A;  2YG6 A;  3NG7 X;  4U8P A;  2VVL A;  3VR9 A;  3AEB A;  4C3X A;  5LV9 A;  3KA7 A;  2ARD A;  2FBW A;  3AD9 B;  2CFY A;  4DNA A;  2R4E A;  2YM1 A;  2V3A A;  2YG4 A;  3ATQ A;  2B9W A;  1KDG A;  1CC2 A;  4OPT A;  3DME A;  4M52 A;  3AED A;  4JNA A;  5KVI A;  4YSH A;  3DK9 A;  2FJD A;  1ZP0 A;  1PBF A;  1NG3 A;  2XFQ A;  4EIP A;  4Z43 A;  3EF6 A;  1Z6L A;  2BK3 A;  1VG0 A;  1V59 A;  3F8D A;  1DOE A;  3DJE A;  2WPC A;  2EQ9 A;  2OLN A;  2WOV A;  2XVE A;  3VRD B;  3UOY A;  5FS8 A;  1JRZ A;  3S61 A;  1FEC A;  3K30 A;  3RP8 A;  3NK0 X;  2GVC A;  1PXB A;  2VRL A;  2V6O A;  4U8J A;  4U8L A;  4AOX A;  4CNK A;  1CBO A;  1Q1W A;  3AE6 A;  4ZCD A;  3S5W A;  4OPG A;  3H4K A;  1K0I A;  2R45 A;  3AXB A;  2C66 A;  3UOV A;  2YR6 A;  3GDP A;  3LZX A;  3UKF A;  4H4V A;  4GUV A;  1F8S A;  2NVK X;  1GOS A;  4EQR A;  1N4W A;  3NN6 X;  4A6N B;  2C3D A;  1BKW A;  4H2N A;  2R46 A;  4CCR A;  1CJ2 A;  2OAM A;  2XLP A;  3P4Q A;  5HHF A;  1H82 A;  1KNR A;  2XLR A;  1F8W A;  2GMH A;  3ADA B;  2YLS A;  1BZL A;  1L9C A;  1Y0P A;  2YQU A;  4H50 A;  1EL7 A;  4YTP A;  3NTA A;  1D4E A;  3NHO X;  4U2T A;  2WES A;  1GAL A;  3AE4 A;  3DJG X;  1PBB A;  2GH5 A;  1S2Y A;  4H4W A;  3UOX A;  1NEK A;  4KX6 A;  1D7L A;  2GQW A;  4H7U A;  3KLJ A;  4REK A;  1GSN A;  1O5W A;  1OJC A;  2VOU A;  3CN8 A;  3LOV A;  1F3P A;  5GRT A;  2XYO A;  1W4X A;  4JDR A;  4A79 A;  3D8X A;  3G5S A;  2YLT A;  1TDO A;  3AE8 A;  1MXT A;  1ZDL A;  2IVE A;  1H86 A;  2ZBW A;  3LAD A;  5FS9 A;  4EM3 A;  2C70 A;  2C76 A;  3ALM A;  3NK2 X;  1B37 A;  3NYF A;  4H4S A;  2TPR A;  4J57 A;  4U8K A;  3AEF A;  5CQF A;  3RP6 A;  4YTN A;  1KF6 A;  4ZCC A;  3T37 A;  3KVE A;  3SM8 A;  4NTE A;  1ZMC A;  3H8L A;  4RG3 A;  3UKL A;  1XPQ A;  2XVJ A;  3O0H A;  2X8H A;  2WDR A;  4TM1 A;  4IA6 A;  2NPX A;  2XFO A;  4JNQ A;  4BV6 A;  4D04 A;  2RGJ A;  4EIQ A;  1E39 A;  1YY5 A;  3NYC A;  3QJ4 A;  3CNP A;  5DBJ A;  1JEH A;  3PVC A;  3GYI A;  2A8X A;  2Z5Y A;  1NHR A;  3BI4 A;  4Z25 A;  3UKP A;  2YVF A;  1Q9I A;  2XVH A;  4GR1 A;  5IPY A;  1EL5 A;  2XLS A;  4CY8 A;  1B5Q A;  2AR8 A;  2E1M A;  5ER0 A;  3GD3 A;  5BVA A;  1L9E A;  2VVM A;  5M0Z A;  1D7Y A;  2RGO A;  1GET A;  1Y56 B;  3P1W A;  1N4U A;  1GES A;  2YVG A;  5J60 A;  4OPC A;  1CL0 A;  2GR0 A;  1CC6 A;  1LQU A;  4H4Z A;  4U8M A;  3SFD A;  3UKK A;  1DXL A;  2YVJ A;  3NNE A;  4NEW A;  4H4Y A;  2XFU A;  4U2S A;  4USQ A;  4Z2T A;  4UP3 A;  3AYJ A;  1TYT A;  4U8O A;  5EOW A;  3M12 A;  5JCM A;  1DOC A;  4NZH A;  2E4G A;  4NEV A;  3ALL A;  3QVR A;  3DK4 A;  3GRS A;  1FL2 A;  1O95 A;  1TDE A;  2R0P A;  2JK6 A;  1OJT A;  2YR4 A;  3H8I A;  4J56 A;  2AQJ A;  2JKC A;  3KD9 A;  4LA1 A;  1L9D A;  5U1O A;  3NYE A;  1IUX A;  1M64 A;  3F8R A;  1IUU A;  1TDF A;  2ZZB A;  4JY3 A;  1ZK7 A;  2YAU A;  3DJD A;  3SFE A;  4Z26 A;  3NK1 X;  1CJC A;  4HA6 A;  4A5L A;  1GRF A;  4A7A A;  1PJ7 A;  1F8R A;  1RSG A;  3GDN A;  4IV9 A;  4EMI A;  4ZN0 A;  5HXI A;  3GMB A;  1JRY A;  2XCG A;  4Z2R A;  2RAB A;  2JB2 A;  2B9Y A;  5CKU A;  4K5R A;  4BK3 A;  4FX9 A;  2YM2 A;  1BWC A;  2OA1 A;  3CGD A;  3ITJ A;  1UKV G;  1E1K A;  1N4V A;  1TRB A;  3FIM B;  3ZYX A;  3QFB A;  3AE2 A;  3FBS A;  2GEW A;  2EQ6 A;  1IUS A;  3GWF A;  2UZZ A;  4OPI A;  3GWD A;  3R9U A;  3DH9 A;  5BUK A;  4JQ9 A;  1B4V A;  2BXR A;  1E1M A;  2CVJ A;  3BHK A;  1IUW A;  4UDQ A;  2AAQ A;  2R9Z A;  2Y6Q A;  1BF3 A;  2V3B A;  3GSI A;  2JAE A;  1IUT A;  3COX A;  1EBD A;  4C5O A;  4OPD A;  3V3O A;  2WOI A;  4BUR A;  1DOD A;  2Q6U A;  3AE9 A;  4IA5 A;  3PO7 A;  2W0H A;  1NEN A;  2BCP A;  3AYI A;  2V60 A;  2OLO A;  3C4N A;  4EQS A;  1H81 A;  2C73 A;  3UTE A;  2ZZ0 A;  3UKA A;  4A99 A;  3CNS A;  1EL9 A;  3PS9 A;  3UTH A;  1YQ4 A;  2XFN A;  1PBD A;  3BI2 A;  2DKH A;  3E1T A;  4H2P A;  2QCU A;  3CGC A;  2XFP A;  1DOB A;  3C4A A;  1KSU A;  2XLT A;  3QSM A;  4K5S A;  2XVF A;  3AEE A;  1LVL A;  4H2Q A;  2YG7 A;  4J31 A;  1ZMD A;  3BNU A;  3HZL A;  2WDV A;  3LJP A;  4AT0 A;  2C75 A;  3UOZ A;  3B6D A;  4IVO B;  2VQB A;  2ZZC A;  3NN0 X;  3OC4 A;  2OAL A;  2WET A;  3EAN A;  1GND A;  3CPI G;  2BK5 A;  2F5Z A;  4K7Z A;  1CJ3 A;  3Q9T A;  3UP4 A;  1TDN A;  4GRT A;  1GER A;  2C67 A;  2BAC A;  3DGZ A;  3EPT A;  3GRT A;  3P4R A;  4ICY A;  4Y4M A;  2Q0L A;  4O5U A;  2GAH B;  1LV0 A;  4KPR A;  5KXJ A;  4DSH A;  2RGH A;  1JNR A;  3AEA A;  4LU6 A;  3ISH A;  1ELI A;  4K8D A;  3G5Q A;  4BJZ A;  4E0V A;  3BNM A;  3LXD A;  4ECH A;  1GRE A;  4U2L A;  2O9Z A;  2WU5 A;  3CPJ G;  1LTX R;  2C65 A;  3L1R A;  2I0Z A;  3CGE A;  4H4P A;  4HB9 A;  4BK2 A;  4PAA A;  3CNJ A;  3F8P A;  3VQR A;  3II4 A;  4H4U A;  1NHQ A;  1OJD A;  5FS6 A;  3UTF A;  3AD7 B;  2WS3 A;  4GDP A;  3UP5 A;  2PYX A;  4B65 A;  3K7Q X;  5FS7 A;  1OJ9 A;  4IVM B;  2V5Z A;  3V76 A;  1YQ3 A;  2GB0 A;  3K7T A;  3QSE A;  4YKF A;  2C7G A;  1GXF A;  2C64 A;  3IHM A;  5EBK A;  3AE5 A;  1MOK A;  1Q1R A;  4U8I A;  4APN A;  3NTD A;  1FEA A;  4YTM A;  1GRB A;  2GR3 A;  3P4P A;  4B68 A;  1QO8 A;  2BK4 A;  1D5T A;  2JB1 A;  4B69 A;  2WP6 A;  5C2T A;  1E1L A;  1H84 A;  2GMJ A;  4GDE A;  1AOG A;  2WQY A;  3QFA A;  4RG4 A;  3NT6 A;  2BXS A;  1YQZ A;  2GAG B;  2A89 A;  2WOW A;  5KOW A;  3GYJ A;  4OPL A;  3AWI A;  2WHD A;  4AOS A;  1S2Q A;  2WP5 A;  1PHH A;  4CRT A;  1PS9 A;  1VDC A;  2Z5X A;  5JCN A;  4H4R A;  1M6I A;  5TR3 A;  4C77 A;  1DJN A;  2GQF A;  2Q7V A;  3FG2 P;  4I59 A;  4J34 A;  3AE3 A;  4B64 A;  3URH A;  1F6M A;  3CNT A;  4DGK A;  2BCG G;  1REO A;  3JSK A;  4OCG A;  3V3N A;  4H4X A;  4N9X A;  3M0O A;  3AEC A;  2QA1 A;  2C72 A;  5HYM A;  2YLR A;  1MO9 A;  1RYI A;  2WEU A;  5IQ4 A;  1PXA A;  2CDU A;  4YT0 A;  1P2E A;  3QVP A;  4B67 A;  3KPF A;  1K0J A;  2VVL G;  5GSN A;  2PHH A;  2EQ8 A;  1S3E A;  1LQT A;  3DJJ A;  5U25 A;  1N1P A;  1D4D A;  1NHS A;  1FCD A;  2X8G A;  2WPE A;  4UDR A;  4K22 A;  3DA1 A;  4FDC B;  1GTH A;  5BRT A;  1H83 A;  3UKH A;  4XWR A;  4BJY A;  4B1B A;  3AYL A;  1BGJ A;  1JOA A;  2WPF A;  3CPH G;  3RHA A;  1LJ1 A;  3VR8 A;  2JB3 A;  2BS4 A;  1E6E A;  1GPE A;  4K2X A;  5J7X A;  1KFY A;  2WP9 A;  1ZY8 A;  2X3N A;  4FK1 A;  4NTD A;  1KSS A;  3UKQ A;  5HY5 A;  1EL8 A;  4H2R A;  4I58 A;  3AD8 B;  4OVI A;  3BHF A;  4WX1 A;  4OPU A;  1P2H A;  3OZ2 A;  2YR5 A;  1S3B A;  4USR A;  3UCL A;  2VRM A;  2CUL A;  1ZOV A;  1GRT A;  1BGN A;  1ZKQ A;  1K4Q A;  2HQM A;  3FMW A;  3ATR A;  3VRB A;  4X4J A;  4YSX A;  3ICR A;  2A87 A;  4A9W A;  4EM4 A;  4X9N A;  4CY6 A;  4XXG A;  4TLZ A;  3Q6J A;  2BYB A;  1KNP A; 
#chains in the Genus database with same CATH topology
 4J33 A;  2WBA A;  4GCM A;  2BC0 A;  4AT2 A;  3LZW A;  4O5Q A;  2GR1 A;  4J36 A;  4A6N A;  4G6G A;  3D1C A;  4B63 A;  2YG3 A;  4CNJ A;  2GF3 A;  1K0L A;  4EMW A;  1COY A;  1ZOY A;  2BRY A;  2YLX A;  5KVH A;  1PJ6 A;  2BC1 A;  1H6V A;  4C3Y A;  5JCL A;  1TYP A;  2X99 A;  4U8N A;  3C96 A;  2YWL A;  1PBE A;  1IUV A;  2FJE A;  4TM3 A;  5KOX A;  1QJD A;  3IC9 A;  4ADW A;  5JCK A;  1PDH A;  2APG A;  4YWO A;  3ABV A;  1YKJ A;  2XDO A;  4DSG A;  1NDA A;  1QLB A;  2BA9 A;  5KWF A;  1JRX A;  4Z24 A;  2B76 A;  1E1N A;  3ICT A;  2H89 A;  2YLW A;  1FEB A;  2BS2 A;  1SEZ A;  4B66 A;  1ONF A;  1GRA A;  1ZX9 A;  5EB4 A;  1O94 A;  3AB1 A;  4NTC A;  3CIR A;  1JU2 A;  2WDQ A;  1VQW A;  2IVD A;  5KMP A;  5KRQ A;  3B3R A;  5L46 A;  3KKJ A;  1GV4 A;  1GEU A;  1HYU A;  2EQ7 A;  2QAE A;  2VZ2 A;  1DJQ A;  3CND A;  4P9S A;  4CBQ A;  3NIX A;  1GRG A;  2R4J A;  3NLC A;  5C3J A;  3AE1 A;  3IHG A;  2H88 A;  4D03 A;  2GRT A;  4CCQ A;  3EAO A;  3ICS A;  4II2 A;  2B7S A;  1H7X A;  3I3L A;  4YSZ A;  2FJA A;  1GTE A;  4XWZ A;  3WE0 A;  4EQW A;  5U63 A;  1GT8 A;  1H7W A;  2E5V A;  5IQ1 A;  3NH3 X;  5FMH A;  2R0G A;  1XDI A;  4Z2U A;  4Z44 A;  1B8S A;  1CJ4 A;  2B9X A;  2GV8 A;  1CF3 A;  4JY2 A;  3RED A;  3RP7 A;  4RSL A;  3L8K A;  2X8C A;  4J2W A;  3UTG A;  4FK1 C;  2IID A;  3P9U A;  1VRQ B;  1DNC A;  2QA2 A;  1RP0 A;  3RNM A;  2XVI A;  2B7R A;  3GD4 A;  2X50 A;  3AEG A;  1JNZ A;  4H4T A;  1CHU A;  1NAA A;  2BAB A;  3P4S A;  1Y56 A;  3DGH A;  4AP3 A;  4EMJ A;  1XHC A;  2Y6R A;  3IWA A;  3IF9 A;  1OJA A;  1D4C A;  2Q0K A;  1L0V A;  2R0C A;  1PBC A;  3I6D A;  3DK8 A;  4MJW A;  4YXD A;  4TM0 A;  1LPF A;  3K7M X;  1X31 B;  1PJ5 A;  4Y4N A;  3SGL A;  3GMC A;  5EB5 A;  3M13 A;  4Y4L A;  2BS3 A;  4G6H A;  3VRA A;  4UDP A;  5M10 A;  3SZW A;  1PXC A;  3ALJ A;  1XAN A;  2XLU A;  2VQ7 A;  2ACZ A;  3KU9 A;  4YKG A;  1PN0 A;  2TMD A;  1E7P A;  3T14 A;  2WU2 A;  3SQP A;  2GR2 A;  2JBV A;  4X9M A;  1CC4 A;  2YG5 A;  1NPX A;  4TM4 A;  3NKS A;  4EQX A;  3CTY A;  5JCI A;  3CGB A;  3QSS A;  4LII A;  4PAB A;  1FOH A;  2V61 A;  3ZDN A;  3FPZ A;  2J3N A;  4H4Q A;  3NRN A;  4YSY A;  1VG9 A;  4BK1 A;  5KNL A;  1NG4 A;  4TLX A;  2FJB A;  3NGC X;  1GRH A;  3AE7 A;  2C3C A;  3BI5 A;  2DKI A;  1NHP A;  4C74 A;  3LB8 A;  4JN9 A;  5BUL A;  4AP1 A;  1TDK A;  2YLZ A;  3G5R A;  4A65 A;  4GF7 A;  4WCT A;  1IJH A;  2YG6 A;  3NG7 X;  4U8P A;  2VVL A;  3VR9 A;  3AEB A;  4C3X A;  5LV9 A;  3KA7 A;  2ARD A;  2FBW A;  3AD9 B;  2CFY A;  4DNA A;  2R4E A;  4G9K A;  2YM1 A;  2V3A A;  2YG4 A;  3ATQ A;  2B9W A;  1KDG A;  1CC2 A;  4OPT A;  3DME A;  4M52 A;  3AED A;  4JNA A;  5KVI A;  4YSH A;  3DK9 A;  2FJD A;  1ZP0 A;  1PBF A;  1NG3 A;  2XFQ A;  4EIP A;  4Z43 A;  3EF6 A;  1Z6L A;  2BK3 A;  1VG0 A;  1V59 A;  3F8D A;  1DOE A;  3DJE A;  2WPC A;  2EQ9 A;  2OLN A;  2WOV A;  2XVE A;  3VRD B;  3HYV A;  3UOY A;  5FS8 A;  1JRZ A;  3S61 A;  1FEC A;  3K30 A;  3RP8 A;  3NK0 X;  2GVC A;  1PXB A;  2VRL A;  2V6O A;  4U8J A;  3T0K A;  4U8L A;  4AOX A;  4CNK A;  3SZF A;  1CBO A;  1Q1W A;  3AE6 A;  4ZCD A;  3S5W A;  4OPG A;  3H4K A;  1K0I A;  2R45 A;  3AXB A;  2C66 A;  3UOV A;  2YR6 A;  3GDP A;  3LZX A;  3UKF A;  4H4V A;  4GUV A;  1F8S A;  3HYX A;  2NVK X;  1GOS A;  4EQR A;  1N4W A;  3NN6 X;  3SY4 A;  4A6N B;  2C3D A;  1BKW A;  4H2N A;  5KMR A;  2R46 A;  4CCR A;  1CJ2 A;  2OAM A;  2XLP A;  3P4Q A;  5HHF A;  1H82 A;  1KNR A;  2XLR A;  3T31 A;  1F8W A;  2GMH A;  3ADA B;  2YLS A;  1BZL A;  1L9C A;  1Y0P A;  2YQU A;  4H50 A;  1EL7 A;  4YTP A;  3NTA A;  1D4E A;  3NHO X;  4U2T A;  2WES A;  1GAL A;  3AE4 A;  3DJG X;  1PBB A;  2GH5 A;  1S2Y A;  4H4W A;  3UOX A;  1NEK A;  4KX6 A;  1D7L A;  2GQW A;  4H7U A;  3KLJ A;  4REK A;  1GSN A;  1O5W A;  1OJC A;  2VOU A;  3CN8 A;  3LOV A;  1F3P A;  5GRT A;  2XYO A;  1W4X A;  4JDR A;  3KPK A;  4A79 A;  3D8X A;  3G5S A;  2YLT A;  1TDO A;  3AE8 A;  1MXT A;  1ZDL A;  2IVE A;  1H86 A;  2ZBW A;  3LAD A;  5FS9 A;  4EM3 A;  2C70 A;  2C76 A;  3ALM A;  3HYW A;  1B37 A;  3NK2 X;  3NYF A;  2TPR A;  4H4S A;  4J57 A;  3AEF A;  4U8K A;  3RP6 A;  3SX6 A;  1KF6 A;  3SYI A;  4YTN A;  5KMS A;  4ZCC A;  3T37 A;  3KVE A;  3SM8 A;  4NTE A;  1ZMC A;  3H8L A;  4RG3 A;  3UKL A;  1XPQ A;  2XVJ A;  3O0H A;  2X8H A;  2WDR A;  4TM1 A;  4IA6 A;  2NPX A;  3SZ0 A;  2XFO A;  4JNQ A;  4BV6 A;  4D04 A;  2RGJ A;  4EIQ A;  1E39 A;  1YY5 A;  3NYC A;  3QJ4 A;  3CNP A;  5DBJ A;  1JEH A;  3PVC A;  3GYI A;  2A8X A;  2Z5Y A;  1NHR A;  3BI4 A;  4Z25 A;  3UKP A;  2YVF A;  1Q9I A;  2XVH A;  4GR1 A;  5IPY A;  1EL5 A;  2XLS A;  4CY8 A;  1B5Q A;  2AR8 A;  2E1M A;  4GAP A;  5ER0 A;  3GD3 A;  5BVA A;  1L9E A;  2VVM A;  5M0Z A;  1D7Y A;  2RGO A;  1GET A;  3SZC A;  1Y56 B;  3P1W A;  1N4U A;  1GES A;  2YVG A;  5J60 A;  4OPC A;  1CL0 A;  2GR0 A;  1CC6 A;  1LQU A;  4H4Z A;  4U8M A;  3SFD A;  3UKK A;  1DXL A;  2YVJ A;  3NNE A;  4NEW A;  4H4Y A;  2XFU A;  4U2S A;  4USQ A;  4Z2T A;  4UP3 A;  3AYJ A;  1TYT A;  4U8O A;  5EOW A;  3M12 A;  5JCM A;  1DOC A;  4NZH A;  2E4G A;  4NEV A;  3ALL A;  3QVR A;  3DK4 A;  3GRS A;  1FL2 A;  1O95 A;  1TDE A;  2R0P A;  2JK6 A;  1OJT A;  2YR4 A;  3H8I A;  4J56 A;  2AQJ A;  2JKC A;  3KD9 A;  4LA1 A;  1L9D A;  5U1O A;  3NYE A;  1IUX A;  1M64 A;  3F8R A;  1IUU A;  1TDF A;  2ZZB A;  4JY3 A;  1ZK7 A;  2YAU A;  3DJD A;  3SFE A;  4Z26 A;  3NK1 X;  1CJC A;  4HA6 A;  4A5L A;  1GRF A;  4A7A A;  1PJ7 A;  1F8R A;  1RSG A;  3GDN A;  4IV9 A;  4EMI A;  4ZN0 A;  5HXI A;  3GMB A;  1JRY A;  2XCG A;  4Z2R A;  2RAB A;  2JB2 A;  2B9Y A;  5CKU A;  4K5R A;  4BK3 A;  4FX9 A;  2YM2 A;  1BWC A;  2OA1 A;  3CGD A;  3ITJ A;  1UKV G;  1E1K A;  1N4V A;  1TRB A;  3FIM B;  3ZYX A;  3QFB A;  3AE2 A;  3FBS A;  2GEW A;  2EQ6 A;  1IUS A;  3GWF A;  2UZZ A;  4OPI A;  3GWD A;  3SXI A;  3R9U A;  3DH9 A;  5BUK A;  4JQ9 A;  1B4V A;  2BXR A;  1E1M A;  2CVJ A;  3BHK A;  1IUW A;  4UDQ A;  2AAQ A;  2R9Z A;  2Y6Q A;  1BF3 A;  2V3B A;  3GSI A;  2JAE A;  1IUT A;  3COX A;  1EBD A;  4C5O A;  4OPD A;  3V3O A;  2WOI A;  4BUR A;  1DOD A;  2Q6U A;  3AE9 A;  4IA5 A;  3T2K A;  3PO7 A;  2W0H A;  1NEN A;  2BCP A;  3AYI A;  2V60 A;  2OLO A;  3C4N A;  4EQS A;  1H81 A;  2C73 A;  3UTE A;  2ZZ0 A;  3UKA A;  4A99 A;  3CNS A;  1EL9 A;  3PS9 A;  3UTH A;  1YQ4 A;  2XFN A;  1PBD A;  3BI2 A;  2DKH A;  3E1T A;  4H2P A;  2QCU A;  3CGC A;  2XFP A;  1DOB A;  3C4A A;  1KSU A;  2XLT A;  3QSM A;  4K5S A;  2XVF A;  3AEE A;  1LVL A;  4H2Q A;  2YG7 A;  4J31 A;  1ZMD A;  3BNU A;  3HZL A;  2WDV A;  3LJP A;  4AT0 A;  2C75 A;  3UOZ A;  3B6D A;  4IVO B;  2VQB A;  2ZZC A;  3NN0 X;  3OC4 A;  2OAL A;  2WET A;  4G73 A;  3EAN A;  1GND A;  3CPI G;  2BK5 A;  2F5Z A;  4K7Z A;  1CJ3 A;  3Q9T A;  5KMQ A;  3UP4 A;  1TDN A;  4GRT A;  1GER A;  2C67 A;  2BAC A;  3DGZ A;  3EPT A;  3GRT A;  3P4R A;  4ICY A;  4Y4M A;  2Q0L A;  4O5U A;  2GAH B;  3T2Z A;  1LV0 A;  4KPR A;  5KXJ A;  4DSH A;  2RGH A;  1JNR A;  3AEA A;  4LU6 A;  3ISH A;  1ELI A;  4K8D A;  3G5Q A;  4BJZ A;  4E0V A;  3BNM A;  3LXD A;  4ECH A;  1GRE A;  4U2L A;  2O9Z A;  2WU5 A;  3CPJ G;  1LTX R;  2C65 A;  3L1R A;  2I0Z A;  3CGE A;  4H4P A;  4HB9 A;  4BK2 A;  4PAA A;  3CNJ A;  3F8P A;  4GAV A;  3VQR A;  3II4 A;  4H4U A;  1NHQ A;  1OJD A;  5FS6 A;  3UTF A;  3AD7 B;  2WS3 A;  4GDP A;  3UP5 A;  2C4C A;  2PYX A;  4B65 A;  4G74 A;  3K7Q X;  5FS7 A;  4NNJ A;  1OJ9 A;  4IVM B;  2V5Z A;  5CQF A;  3V76 A;  1YQ3 A;  2GB0 A;  3K7T A;  3QSE A;  4YKF A;  2C7G A;  1GXF A;  2C64 A;  3IHM A;  5EBK A;  3AE5 A;  1MOK A;  1Q1R A;  4U8I A;  4APN A;  3NTD A;  3T2Y A;  1FEA A;  4YTM A;  1GRB A;  2GR3 A;  3P4P A;  4B68 A;  1QO8 A;  2BK4 A;  1D5T A;  2JB1 A;  4B69 A;  2WP6 A;  5C2T A;  1E1L A;  1H84 A;  2GMJ A;  4GDE A;  1AOG A;  2WQY A;  3QFA A;  4RG4 A;  3NT6 A;  2BXS A;  1YQZ A;  2GAG B;  2A89 A;  2WOW A;  5KOW A;  3GYJ A;  4OPL A;  3AWI A;  2WHD A;  4AOS A;  1S2Q A;  2WP5 A;  1PHH A;  4CRT A;  1PS9 A;  3GYX A;  1VDC A;  2Z5X A;  5JCN A;  4H4R A;  1M6I A;  5TR3 A;  4C77 A;  1DJN A;  2GQF A;  2Q7V A;  3FG2 P;  4I59 A;  4J34 A;  3AE3 A;  4B64 A;  3URH A;  1F6M A;  3CNT A;  4DGK A;  2BCG G;  1REO A;  3JSK A;  4OCG A;  3V3N A;  4H4X A;  4N9X A;  3M0O A;  3AEC A;  2QA1 A;  2C72 A;  5HYM A;  2YLR A;  1MO9 A;  1RYI A;  2WEU A;  5IQ4 A;  1PXA A;  2CDU A;  4YT0 A;  1P2E A;  3QVP A;  4B67 A;  3KPF A;  1K0J A;  2VVL G;  5GSN A;  2PHH A;  2EQ8 A;  1S3E A;  1LQT A;  3DJJ A;  5U25 A;  1N1P A;  5J7X A;  1D4D A;  1NHS A;  1FCD A;  2X8G A;  2WPE A;  4UDR A;  4K22 A;  3DA1 A;  4FDC B;  1GTH A;  5BRT A;  1H83 A;  4NWZ A;  4XWR A;  3UKH A;  4BJY A;  4B1B A;  3AYL A;  1BGJ A;  1JOA A;  2WPF A;  3CPH G;  3RHA A;  1LJ1 A;  3VR8 A;  2JB3 A;  2BS4 A;  1E6E A;  1GPE A;  4K2X A;  3CMM A;  1KFY A;  2WP9 A;  1ZY8 A;  2X3N A;  4FK1 A;  4II3 A;  1KSS A;  4NTD A;  3UKQ A;  5HY5 A;  1EL8 A;  4H2R A;  4I58 A;  3AD8 B;  4OVI A;  3BHF A;  4WX1 A;  4OPU A;  2BRA A;  1P2H A;  3OZ2 A;  2YR5 A;  1S3B A;  4USR A;  3UCL A;  2VRM A;  2CUL A;  1ZOV A;  1GRT A;  1BGN A;  1ZKQ A;  1K4Q A;  2HQM A;  3FMW A;  3ATR A;  3VRB A;  4X4J A;  4YSX A;  3ICR A;  2A87 A;  4A9W A;  4EM4 A;  4X9N A;  4CY6 A;  4XXG A;  4TLZ A;  3Q6J A;  2BYB A;  1KNP A; 
#chains in the Genus database with same CATH homology
 4J33 A;  2WBA A;  4GCM A;  2BC0 A;  4AT2 A;  3LZW A;  4O5Q A;  2GR1 A;  4J36 A;  4A6N A;  4G6G A;  3D1C A;  4B63 A;  2YG3 A;  4CNJ A;  2GF3 A;  1K0L A;  4EMW A;  1COY A;  1ZOY A;  2BRY A;  2YLX A;  5KVH A;  1PJ6 A;  2BC1 A;  1H6V A;  4C3Y A;  5JCL A;  1TYP A;  2X99 A;  4U8N A;  3C96 A;  2YWL A;  1PBE A;  1IUV A;  2FJE A;  4TM3 A;  5KOX A;  1QJD A;  3IC9 A;  4ADW A;  5JCK A;  1PDH A;  2APG A;  4YWO A;  3ABV A;  1YKJ A;  2XDO A;  4DSG A;  1NDA A;  1QLB A;  2BA9 A;  5KWF A;  1JRX A;  4Z24 A;  2B76 A;  1E1N A;  3ICT A;  2H89 A;  2YLW A;  1FEB A;  2BS2 A;  1SEZ A;  4B66 A;  1ONF A;  1GRA A;  1ZX9 A;  5EB4 A;  1O94 A;  3AB1 A;  4NTC A;  3CIR A;  1JU2 A;  2WDQ A;  1VQW A;  2IVD A;  5KMP A;  5KRQ A;  3B3R A;  5L46 A;  3KKJ A;  1GV4 A;  1GEU A;  1HYU A;  2EQ7 A;  2QAE A;  2VZ2 A;  1DJQ A;  3CND A;  4P9S A;  4CBQ A;  3NIX A;  1GRG A;  2R4J A;  3NLC A;  5C3J A;  3AE1 A;  3IHG A;  2H88 A;  4D03 A;  2GRT A;  4CCQ A;  3EAO A;  3ICS A;  4II2 A;  2B7S A;  1H7X A;  3I3L A;  4YSZ A;  2FJA A;  1GTE A;  4XWZ A;  3WE0 A;  4EQW A;  5U63 A;  1GT8 A;  1H7W A;  2E5V A;  5IQ1 A;  3NH3 X;  5FMH A;  2R0G A;  1XDI A;  4Z2U A;  4Z44 A;  1B8S A;  1CJ4 A;  2B9X A;  2GV8 A;  1CF3 A;  4JY2 A;  3RED A;  3RP7 A;  4RSL A;  3L8K A;  2X8C A;  4J2W A;  3UTG A;  4FK1 C;  2IID A;  3P9U A;  1VRQ B;  1DNC A;  2QA2 A;  1RP0 A;  3RNM A;  2XVI A;  2B7R A;  3GD4 A;  2X50 A;  3AEG A;  1JNZ A;  4H4T A;  1CHU A;  1NAA A;  2BAB A;  3P4S A;  1Y56 A;  3DGH A;  4AP3 A;  4EMJ A;  1XHC A;  2Y6R A;  3IWA A;  3IF9 A;  1OJA A;  1D4C A;  2Q0K A;  1L0V A;  2R0C A;  1PBC A;  3I6D A;  3DK8 A;  4MJW A;  4YXD A;  4TM0 A;  1LPF A;  3K7M X;  1X31 B;  1PJ5 A;  4Y4N A;  3SGL A;  3GMC A;  5EB5 A;  3M13 A;  4Y4L A;  2BS3 A;  4G6H A;  3VRA A;  4UDP A;  5M10 A;  3SZW A;  1PXC A;  3ALJ A;  1XAN A;  2XLU A;  2VQ7 A;  2ACZ A;  3KU9 A;  4YKG A;  1PN0 A;  2TMD A;  1E7P A;  3T14 A;  2WU2 A;  3SQP A;  2GR2 A;  2JBV A;  4X9M A;  1CC4 A;  2YG5 A;  1NPX A;  4TM4 A;  3NKS A;  4EQX A;  3CTY A;  5JCI A;  3CGB A;  3QSS A;  4LII A;  4PAB A;  1FOH A;  2V61 A;  3ZDN A;  3FPZ A;  2J3N A;  4H4Q A;  3NRN A;  4YSY A;  1VG9 A;  4BK1 A;  5KNL A;  1NG4 A;  4TLX A;  2FJB A;  3NGC X;  1GRH A;  3AE7 A;  2C3C A;  3BI5 A;  2DKI A;  1NHP A;  4C74 A;  3LB8 A;  4JN9 A;  5BUL A;  4AP1 A;  1TDK A;  2YLZ A;  3G5R A;  4A65 A;  4GF7 A;  4WCT A;  1IJH A;  2YG6 A;  3NG7 X;  4U8P A;  2VVL A;  3VR9 A;  3AEB A;  4C3X A;  5LV9 A;  3KA7 A;  2ARD A;  2FBW A;  3AD9 B;  2CFY A;  4DNA A;  2R4E A;  4G9K A;  2YM1 A;  2V3A A;  2YG4 A;  3ATQ A;  2B9W A;  1KDG A;  1CC2 A;  4OPT A;  3DME A;  4M52 A;  3AED A;  4JNA A;  5KVI A;  4YSH A;  3DK9 A;  2FJD A;  1ZP0 A;  1PBF A;  1NG3 A;  2XFQ A;  4EIP A;  4Z43 A;  3EF6 A;  1Z6L A;  2BK3 A;  1VG0 A;  1V59 A;  3F8D A;  1DOE A;  3DJE A;  2WPC A;  2EQ9 A;  2OLN A;  2WOV A;  2XVE A;  3VRD B;  3HYV A;  3UOY A;  5FS8 A;  1JRZ A;  3S61 A;  1FEC A;  3K30 A;  3RP8 A;  3NK0 X;  2GVC A;  1PXB A;  2VRL A;  2V6O A;  4U8J A;  3T0K A;  4U8L A;  4AOX A;  4CNK A;  3SZF A;  1CBO A;  1Q1W A;  3AE6 A;  4ZCD A;  3S5W A;  4OPG A;  3H4K A;  1K0I A;  2R45 A;  3AXB A;  2C66 A;  3UOV A;  2YR6 A;  3GDP A;  3LZX A;  3UKF A;  4H4V A;  4GUV A;  1F8S A;  3HYX A;  2NVK X;  1GOS A;  4EQR A;  1N4W A;  3NN6 X;  3SY4 A;  4A6N B;  2C3D A;  1BKW A;  4H2N A;  5KMR A;  2R46 A;  4CCR A;  1CJ2 A;  2OAM A;  2XLP A;  3P4Q A;  5HHF A;  1H82 A;  1KNR A;  2XLR A;  3T31 A;  1F8W A;  2GMH A;  3ADA B;  2YLS A;  1BZL A;  1L9C A;  1Y0P A;  2YQU A;  4H50 A;  1EL7 A;  4YTP A;  3NTA A;  1D4E A;  3NHO X;  4U2T A;  2WES A;  1GAL A;  3AE4 A;  3DJG X;  1PBB A;  2GH5 A;  1S2Y A;  4H4W A;  3UOX A;  1NEK A;  4KX6 A;  1D7L A;  2GQW A;  4H7U A;  3KLJ A;  4REK A;  1GSN A;  1O5W A;  1OJC A;  2VOU A;  3CN8 A;  3LOV A;  1F3P A;  5GRT A;  2XYO A;  1W4X A;  4JDR A;  3KPK A;  4A79 A;  3D8X A;  3G5S A;  2YLT A;  1TDO A;  3AE8 A;  1MXT A;  1ZDL A;  2IVE A;  1H86 A;  2ZBW A;  3LAD A;  5FS9 A;  4EM3 A;  2C70 A;  2C76 A;  3ALM A;  3HYW A;  1B37 A;  3NK2 X;  3NYF A;  2TPR A;  4H4S A;  4J57 A;  3AEF A;  4U8K A;  3RP6 A;  3SX6 A;  1KF6 A;  3SYI A;  4YTN A;  5KMS A;  4ZCC A;  3T37 A;  3KVE A;  3SM8 A;  4NTE A;  1ZMC A;  3H8L A;  4RG3 A;  3UKL A;  1XPQ A;  2XVJ A;  3O0H A;  2X8H A;  2WDR A;  4TM1 A;  4IA6 A;  2NPX A;  3SZ0 A;  2XFO A;  4JNQ A;  4BV6 A;  4D04 A;  2RGJ A;  4EIQ A;  1E39 A;  1YY5 A;  3NYC A;  3QJ4 A;  3CNP A;  5DBJ A;  1JEH A;  3PVC A;  3GYI A;  2A8X A;  2Z5Y A;  1NHR A;  3BI4 A;  4Z25 A;  3UKP A;  2YVF A;  1Q9I A;  2XVH A;  4GR1 A;  5IPY A;  1EL5 A;  2XLS A;  4CY8 A;  1B5Q A;  2AR8 A;  2E1M A;  4GAP A;  5ER0 A;  3GD3 A;  5BVA A;  1L9E A;  2VVM A;  5M0Z A;  1D7Y A;  2RGO A;  1GET A;  3SZC A;  1Y56 B;  3P1W A;  1N4U A;  1GES A;  2YVG A;  5J60 A;  4OPC A;  1CL0 A;  2GR0 A;  1CC6 A;  1LQU A;  4H4Z A;  4U8M A;  3SFD A;  3UKK A;  1DXL A;  2YVJ A;  3NNE A;  4NEW A;  4H4Y A;  2XFU A;  4U2S A;  4USQ A;  4Z2T A;  4UP3 A;  3AYJ A;  1TYT A;  4U8O A;  5EOW A;  3M12 A;  5JCM A;  1DOC A;  4NZH A;  2E4G A;  4NEV A;  3ALL A;  3QVR A;  3DK4 A;  3GRS A;  1FL2 A;  1O95 A;  1TDE A;  2R0P A;  2JK6 A;  1OJT A;  2YR4 A;  3H8I A;  4J56 A;  2AQJ A;  2JKC A;  3KD9 A;  4LA1 A;  1L9D A;  5U1O A;  3NYE A;  1IUX A;  1M64 A;  3F8R A;  1IUU A;  1TDF A;  2ZZB A;  4JY3 A;  1ZK7 A;  2YAU A;  3DJD A;  3SFE A;  4Z26 A;  3NK1 X;  1CJC A;  4HA6 A;  4A5L A;  1GRF A;  4A7A A;  1PJ7 A;  1F8R A;  1RSG A;  3GDN A;  4IV9 A;  4EMI A;  4ZN0 A;  5HXI A;  3GMB A;  1JRY A;  2XCG A;  4Z2R A;  2RAB A;  2JB2 A;  2B9Y A;  5CKU A;  4K5R A;  4BK3 A;  4FX9 A;  2YM2 A;  1BWC A;  2OA1 A;  3CGD A;  3ITJ A;  1UKV G;  1E1K A;  1N4V A;  1TRB A;  3FIM B;  3ZYX A;  3QFB A;  3AE2 A;  3FBS A;  2GEW A;  2EQ6 A;  1IUS A;  3GWF A;  2UZZ A;  4OPI A;  3GWD A;  3SXI A;  3R9U A;  3DH9 A;  5BUK A;  4JQ9 A;  1B4V A;  2BXR A;  1E1M A;  2CVJ A;  3BHK A;  1IUW A;  4UDQ A;  2AAQ A;  2R9Z A;  2Y6Q A;  1BF3 A;  2V3B A;  3GSI A;  2JAE A;  1IUT A;  3COX A;  1EBD A;  4C5O A;  4OPD A;  3V3O A;  2WOI A;  4BUR A;  1DOD A;  2Q6U A;  3AE9 A;  4IA5 A;  3T2K A;  3PO7 A;  2W0H A;  1NEN A;  2BCP A;  3AYI A;  2V60 A;  2OLO A;  3C4N A;  4EQS A;  1H81 A;  2C73 A;  3UTE A;  2ZZ0 A;  3UKA A;  4A99 A;  3CNS A;  1EL9 A;  3PS9 A;  3UTH A;  1YQ4 A;  2XFN A;  1PBD A;  3BI2 A;  2DKH A;  3E1T A;  4H2P A;  2QCU A;  3CGC A;  2XFP A;  1DOB A;  3C4A A;  1KSU A;  2XLT A;  3QSM A;  4K5S A;  2XVF A;  3AEE A;  1LVL A;  4H2Q A;  2YG7 A;  4J31 A;  1ZMD A;  3BNU A;  3HZL A;  2WDV A;  3LJP A;  4AT0 A;  2C75 A;  3UOZ A;  3B6D A;  4IVO B;  2VQB A;  2ZZC A;  3NN0 X;  3OC4 A;  2OAL A;  2WET A;  4G73 A;  3EAN A;  1GND A;  3CPI G;  2BK5 A;  2F5Z A;  4K7Z A;  1CJ3 A;  3Q9T A;  5KMQ A;  3UP4 A;  1TDN A;  4GRT A;  1GER A;  2C67 A;  2BAC A;  3DGZ A;  3EPT A;  3GRT A;  3P4R A;  4ICY A;  4Y4M A;  2Q0L A;  4O5U A;  2GAH B;  3T2Z A;  1LV0 A;  4KPR A;  5KXJ A;  4DSH A;  2RGH A;  1JNR A;  3AEA A;  4LU6 A;  3ISH A;  1ELI A;  4K8D A;  3G5Q A;  4BJZ A;  4E0V A;  3BNM A;  3LXD A;  4ECH A;  1GRE A;  4U2L A;  2O9Z A;  2WU5 A;  3CPJ G;  1LTX R;  2C65 A;  3L1R A;  2I0Z A;  3CGE A;  4H4P A;  4HB9 A;  4BK2 A;  4PAA A;  3CNJ A;  3F8P A;  4GAV A;  3VQR A;  3II4 A;  4H4U A;  1NHQ A;  1OJD A;  5FS6 A;  3UTF A;  3AD7 B;  2WS3 A;  4GDP A;  3UP5 A;  2C4C A;  2PYX A;  4B65 A;  4G74 A;  3K7Q X;  5FS7 A;  4NNJ A;  1OJ9 A;  4IVM B;  2V5Z A;  5CQF A;  3V76 A;  1YQ3 A;  2GB0 A;  3K7T A;  3QSE A;  4YKF A;  2C7G A;  1GXF A;  2C64 A;  3IHM A;  5EBK A;  3AE5 A;  1MOK A;  1Q1R A;  4U8I A;  4APN A;  3NTD A;  3T2Y A;  1FEA A;  4YTM A;  1GRB A;  2GR3 A;  3P4P A;  4B68 A;  1QO8 A;  2BK4 A;  1D5T A;  2JB1 A;  4B69 A;  2WP6 A;  5C2T A;  1E1L A;  1H84 A;  2GMJ A;  4GDE A;  1AOG A;  2WQY A;  3QFA A;  4RG4 A;  3NT6 A;  2BXS A;  1YQZ A;  2GAG B;  2A89 A;  2WOW A;  5KOW A;  3GYJ A;  4OPL A;  3AWI A;  2WHD A;  4AOS A;  1S2Q A;  2WP5 A;  1PHH A;  4CRT A;  1PS9 A;  3GYX A;  1VDC A;  2Z5X A;  5JCN A;  4H4R A;  1M6I A;  5TR3 A;  4C77 A;  1DJN A;  2GQF A;  2Q7V A;  3FG2 P;  4I59 A;  4J34 A;  3AE3 A;  4B64 A;  3URH A;  1F6M A;  3CNT A;  4DGK A;  2BCG G;  1REO A;  3JSK A;  4OCG A;  3V3N A;  4H4X A;  4N9X A;  3M0O A;  3AEC A;  2QA1 A;  2C72 A;  5HYM A;  2YLR A;  1MO9 A;  1RYI A;  2WEU A;  5IQ4 A;  1PXA A;  2CDU A;  4YT0 A;  1P2E A;  3QVP A;  4B67 A;  3KPF A;  1K0J A;  2VVL G;  5GSN A;  2PHH A;  2EQ8 A;  1S3E A;  1LQT A;  3DJJ A;  5U25 A;  1N1P A;  5J7X A;  1D4D A;  1NHS A;  1FCD A;  2X8G A;  2WPE A;  4UDR A;  4K22 A;  3DA1 A;  4FDC B;  1GTH A;  5BRT A;  1H83 A;  4NWZ A;  4XWR A;  3UKH A;  4BJY A;  4B1B A;  3AYL A;  1BGJ A;  1JOA A;  2WPF A;  3CPH G;  3RHA A;  1LJ1 A;  3VR8 A;  2JB3 A;  2BS4 A;  1E6E A;  1GPE A;  4K2X A;  3CMM A;  1KFY A;  2WP9 A;  1ZY8 A;  2X3N A;  4FK1 A;  4II3 A;  1KSS A;  4NTD A;  3UKQ A;  5HY5 A;  1EL8 A;  4H2R A;  4I58 A;  3AD8 B;  4OVI A;  3BHF A;  4WX1 A;  4OPU A;  2BRA A;  1P2H A;  3OZ2 A;  2YR5 A;  1S3B A;  4USR A;  3UCL A;  2VRM A;  2CUL A;  1ZOV A;  1GRT A;  1BGN A;  1ZKQ A;  1K4Q A;  2HQM A;  3FMW A;  3ATR A;  3VRB A;  4X4J A;  4YSX A;  3ICR A;  2A87 A;  4A9W A;  4EM4 A;  4X9N A;  4CY6 A;  4XXG A;  4TLZ A;  3Q6J A;  2BYB A;  1KNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...