3F8PA

Structure of sulfolobus solfataricus trxr-b3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
b'VKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENEFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase (TrxB-3)
publication title Structure and stability of a thioredoxin reductase from Sulfolobus solfataricus: a thermostable protein with two functions
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Oxidoreductase
total genus 102
structure length 307
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.6.4.5: Transferred entry: 1.8.1.9.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA02
4OPGA 1DJNA 3AWIA 1NG4A 1PBDA 1PBCA 3DMEA 2VRLA 1N4UA 3AD7B 4A6NB 3NRNA 2HQMA 3SFDA 1PXCA 4IA5A 4YWOA 2FJBA 1OJTA 1ZKQA 5BRTA 4ZCCA 3ZYXA 1DJQA 2OA1A 4YTMA 2R0PA 3BHFA 3S5WA 4EQWA 4E0VA 3AXBA 1VDCA 4K7ZA 2V61A 1BZLA 4KX6A 2XFNA 4H4XA 4USQA 1EL9A 4A6NA 2C65A 3RP7A 3CNJA 1EL8A 1Y56A 3IWAA 3CPJG 4H4TA 4J56A 1GRBA 3BNMA 1D4DA 1GTHA 1GEUA 1IUUA 4AT0A 1E1NA 3DH9A 1KNRA 1NAAA 4AOSA 2RABA 2V3AA 4K2XA 2B9WA 2X99A 4C3YA 5JCLA 1NHPA 3UKLA 1PBEA 1W4XA 2C7GA 2GEWA 3IF9A 1GPEA 4J57A 4MJWA 1LTXR 1UKVG 2GR2A 4CBQA 4FK1C 4JN9A 3NN6X 3KKJA 2YG7A 2JBVA 4BK2A 3VRDB 3VR8A 3QVRA 4B66A 5HHFA 2C75A 3M13A 1D4EA 3UTHA 3AE9A 3AE8A 1BKWA 2Q6UA 1LQTA 2EQ8A 2YG6A 3CPHG 3FG2P 3SFEA 2F5ZA 4H2NA 5FS8A 3NK1X 3SM8A 1IUTA 1K4QA 1XPQA 3AECA 3CN8A 4K22A 3SQPA 4YSYA 1RYIA 4D04A 2JB1A 1FL2A 2ZZCA 2WDQA 3NNEA 2WPCA 3VQRA 3G5SA 1ZY8A 4CCRA 2XYOA 4IA6A 2R4JA 4B68A 3KPFA 3GSIA 2B76A 3PVCA 3UTFA 4GDPA 2YR6A 2B7RA 5FMHA 4XXGA 1GESA 1RSGA 5IPYA 1YQ4A 2BXRA 3AE5A 1FEBA 2BCPA 2WDVA 1IUWA 3D8XA 3QJ4A 1K0JA 1L0VA 3C4AA 4OPDA 3UOXA 5KOWA 2V60A 4M52A 1B37A 1IUVA 2VRMA 2WP6A 2O9ZA 1NENA 1CF3A 4XWRA 2BC1A 3RNMA 3RHAA 1F6MA 1JRYA 4BURA 4U2LA 4U2TA 4OPUA 3UKKA 2Q0KA 2BCGG 3ISHA 2PYXA 2Z5XA 4GR1A 1LPFA 4EM3A 5EBKA 1X31B 1TDEA 1TDNA 4YSHA 2E1MA 4Z25A 1CC2A 4Z2TA 2A8XA 3HZLA 2JB2A 2GF3A 1PJ7A 3CPIG 1ZX9A 1GRHA 1K0LA 1PHHA 4IVOB 2IVEA 1TRBA 2YLSA 2VOUA 1OJDA 4OPIA 5CKUA 4J2WA 4JNQA 4KPRA 4C74A 5KOXA 1JNRA 1N4WA 2GV8A 2GRTA 1GALA 4Y4LA 3EPTA 4O5UA 1B8SA 1PXBA 1Q1WA 4EM4A 2BS2A 1D5TA 5KVIA 4CCQA 5IQ4A 3P4QA 1ZK7A 1GRFA 4LU6A 4FK1A 1E1MA 5JCKA 1YY5A 1CJ3A 2NPXA 3UKHA 2GB0A 3B3RA 2WOWA 3DK9A 1H81A 3KVEA 3NIXA 3PO7A 2GR1A 3AE6A 2X3NA 2I0ZA 1KNPA 3BI2A 2YVFA 4K5RA 1E1KA 1PDHA 3IHMA 1B5QA 1H84A 1S2QA 4XWZA 3EANA 4ZCDA 1RP0A 4EIPA 4OPLA 4B69A 4B64A 3NK0X 4Z26A 1GV4A 3AE1A 1ZOYA 3ALJA 4A99A 4D03A 3M12A 3ADAB 3KD9A 3P1WA 3UTEA 4EQXA 1ZMCA 2H89A 4YSXA 1KSSA 4B65A 3UKPA 2YG5A 4X9NA 2YLRA 1NEKA 4OPTA 1N4VA 5J7XA 3QSEA 4Z2RA 3ATQA 3GYIA 3KA7A 3AE3A 2ZZ0A 3QSMA 1TYTA 2WBAA 4U8JA 1ZMDA 2YG4A 2WQYA 1EL7A 1KFYA 1HYUA 1GERA 1Y56B 2E4GA 3GMCA 4U8LA 4AOXA 3ITJA 1F8RA 4WCTA 4EIQA 2XCGA 2GH5A 3PS9A 1ZDLA 2DKHA 3LXDA 1H83A 1S3EA 3C4NA 2TMDA 3CGDA 4H4UA 4H4QA 5JCNA 1QLBA 3CGCA 4USRA 1EBDA 4YKGA 4ECHA 2YG3A 2XVFA 1AOGA 3AYLA 4EMIA 2FJAA 4JY3A 2VZ2A 2R4EA 4U8MA 1ELIA 3GWFA 2J3NA 1P2EA 3CIRA 1GT8A 3NH3X 3DGZA 4Z44A 4UDRA 1D4CA 1TYPA 4NTDA 3IHGA 4CRTA 2JB3A 3AB1A 2B9XA 4ICYA 1KSUA 2C64A 3DGHA 3UOZA 1PXAA 2GR3A 2X8CA 1FOHA 1GNDA 2YLTA 3JSKA 1LV0A 2WP9A 2XLRA 3BI5A 3FIMB 4AT2A 3FBSA 2ZBWA 2VVMA 5HY5A 5ER0A 3C96A 1L9CA 2R9ZA 5EB5A 5KWFA 1IUSA 1VQWA 2VVLA 4PAAA 4TM0A 1GXFA 3ATRA 4GRTA 4LIIA 2C3DA 3NYCA 1MO9A 4YTNA 1H82A 1KF6A 5U25A 5FS6A 1QO8A 2AR8A 2QA2A 3FPZA 4JDRA 1JRXA 5U1OA 2YQUA 2BXSA 2BK3A 2A87A 2E5VA 1NHRA 2WETA 4WX1A 2GMJA 1FCDA 1ZOVA 3S61A 2OALA 2RGJA 3ICTA 3VRAA 3Q6JA 2XLPA 3BI4A 1Q1RA 2OLNA 2VQ7A 3QVPA 1PBBA 4Z24A 3ALLA 1FEAA 1LJ1A 3NKSA 1NDAA 3Q9TA 1NHQA 2DKIA 3AYJA 2JK6A 4U8KA 4RG3A 4Z43A 3LB8A 4GF7A 5JCIA 1EL5A 2FJEA 2XFQA 1V59A 2AQJA 3GD4A 3COXA 1FECA 4YXDA 4Z2UA 1Y0PA 2R45A 4EMJA 3UCLA 5J60A 1IUXA 2YM1A 1DOEA 1OJ9A 3NN0X 3NYEA 2R0CA 5JCMA 5M10A 4H2RA 4J33A 1K0IA 2XVEA 2C73A 2ACZA 2GMHA 1BGNA 2WESA 1XDIA 2YR5A 3I6DA 4RG4A 5EB4A 2V6OA 5FS9A 2XFPA 3UKQA 5LV9A 2BA9A 3K7MX 1B4VA 4RSLA 3REDA 2YWLA 2BACA 1M6IA 4JY2A 4C77A 2YM2A 2H88A 4Y4NA 3DA1A 1H7WA 4BJYA 2BABA 2V5ZA 4OCGA 3EF6A 1GRTA 1PS9A 1H6VA 2Z5YA 3ZDNA 2X50A 3AEGA 3URHA 4A7AA 4YT0A 2Q7VA 4REKA 3KLJA 1TDOA 2XDOA 3DK4A 5KXJA 5GRTA 3GWDA 4U2SA 2FJDA 5U63A 3H8IA 1NHSA 3NGCX 2IVDA 3V3NA 2Q0LA 3UTGA 1PN0A 4LA1A 3RP8A 2JKCA 3GMBA 4GDEA 4HB9A 1GRAA 3M0OA 4DNAA 4BK3A 1DODA 1F8SA 1E1LA 2C67A 4P9SA 5C3JA 2APGA 4HA6A 2UZZA 4C5OA 5BUKA 4H4WA 3QFBA 2GQFA 1GETA 3SGLA 1E39A 1CJ4A 1YKJA 4H2PA 1MXTA 2CFYA 3K7QX 1BF3A 2X8HA 4H4RA 3P9UA 4J34A 1CJ2A 3CNSA 2WHDA 5KRQA 4O5QA 1GTEA 4YSZA 4AP1A 3L8KA 1VG9A 1XANA 3DJDA 3ALMA 3NTDA 1LVLA 4CY8A 3DJEA 1REOA 3LADA 1JU2A 3BNUA 3CNPA 4H4ZA 3ICSA 5KVHA 3UKFA 4U8OA 3UP5A 2OLOA 2XLTA 4NEVA 1Z6LA 1O94A 5C2TA 3DJJA 3NLCA 1NG3A 2XVHA 1PBFA 3E1TA 1OJCA 2GAHB 4B1BA 4A5LA 1E7PA 3F8PA 3FMWA 1CC6A 4X9MA 3IC9A 4U8NA 4C3XA 2C70A 5FS7A 4N9XA 1Q9IA 2BS4A 2YAUA 4A65A 4DSGA 1JEHA 2CDUA 4YKFA 2OAMA 2PHHA 4IVMB 4UDPA 5EOWA 4APNA 1S3BA 2GAGB 2WU2A 3GDNA 4GCMA 1SEZA 4FDCB 2Y6RA 3NTAA 2B9YA 1ONFA 2WS3A 3OC4A 2XLSA 4OPCA 2YVGA 1NPXA 2GQWA 2NVKX 2WEUA 4JNAA 1DOCA 1N1PA 3AE7A 3KU9A 4H4YA 4EQRA 2BK4A 3WE0A 4I59A 2R46A 1GRGA 2W0HA 4B67A 3V76A 3LOVA 3D1CA 1H86A 3AD8B 3EAOA 3GRTA 2ARDA 2Y6QA 3ABVA 3NHOX 4K8DA 2XVJA 5BULA 2WPEA 2CULA 1ZP0A 4BJZA 1TDKA 2EQ9A 1O5WA 3P4RA 2C72A 3CGEA 4H4VA 5TR3A 2WP5A 4PABA 3DJGX 4AP3A 1PJ5A 1CHUA 3VRBA 2YVJA 3NG7X 3K30A 2C76A 3AEDA 4H4SA 1GOSA 4I58A 1QJDA 2BS3A 3L1RA 3NT6A 3NK2X 3G5RA 4JQ9A 1CL0A 3GYJA 4CY6A 1BGJA 4H2QA 3VR9A 1DOBA 4H4PA 3CGBA 4H7UA 2C3CA 1JRZA 3CNDA 4ADWA 4BK1A 4IV9A 4DGKA 3O0HA 4TM3A 1CC4A 5GSNA 4NTCA 4H50A 1VG0A 3GD3A 1L9EA 2QA1A 5DBJA 2JAEA 4FX9A 2IIDA 4K5SA 2RGOA 3CNTA 2YLWA 4A79A 2GVCA 3F8RA 4DSHA 3AD9B 1XHCA 2WDRA 3F8DA 1E6EA 2XFUA 4TLXA 3I3LA 5M0ZA 3T37A 2FBWA 3BHKA 5CQFA 3QFAA 3NYFA 3II4A 5HXIA 2RGHA 1L9DA 1S2YA 3UOYA 4Y4MA 3V3OA 1CJCA 2A89A 4B63A 1JNZA 3GRSA 1BWCA 4CNKA 5L46A 2AAQA 3AYIA 1TDFA 4TM4A 4U8PA 2X8GA 2BYBA 4CNJA 3UKAA 3QSSA 1H7XA 2EQ6A 2QAEA 4UDQA 3H8LA 3ICRA 2BC0A 3UOVA 3P4PA 3R9UA 4NTEA 2R0GA 1MOKA 2WOVA 3DK8A 4A9WA 1D7YA 2V3BA 4NEWA 4TLZA 2BK5A 3RP6A 2B7SA 2QCUA 4NZHA 5HYMA 1COYA 2YLZA 1KDGA 3AEFA 3CTYA 3OZ2A 4GUVA 1IJHA 3P4SA 2CVJA 1YQ3A 1PJ6A 3GDPA 5BVAA 3AEBA 3LJPA 2YLXA 4U8IA 1GREA 4X4JA 4YTPA 4UP3A 1OJAA 2VQBA 2XLUA 5IQ1A 4EQSA 1LQUA 2TPRA 1O95A 4OVIA 1YQZA 2YR4A 4J36A 1GSNA 3UP4A 3B6DA 4ZN0A 2ZZBA 3AE4A 1DXLA 3G5QA 3AE2A 3H4KA 1CBOA 1F3PA 3AEAA 1M64A 4J31A 1DNCA 2VVLG 1D7LA 3LZWA 2XFOA 2WU5A 1VRQB 2WPFA 1F8WA 2EQ7A 3K7TA 4BV6A 1JOAA 1P2HA 3AEEA 2XVIA 2C66A 3LZXA 4TM1A 2WOIA 4EMWA 2GR0A
chains in the Genus database with same CATH superfamily
4OPGA 2C4CA 1DJNA 3AWIA 4G6HA 1NG4A 1PBDA 1PBCA 3DMEA 2VRLA 1N4UA 3AD7B 4A6NB 3NRNA 2HQMA 3SFDA 1PXCA 4IA5A 4YWOA 2FJBA 1OJTA 1ZKQA 5BRTA 4ZCCA 3ZYXA 1DJQA 2OA1A 4G6GA 4YTMA 2R0PA 3BHFA 3S5WA 4EQWA 4E0VA 3AXBA 1VDCA 4K7ZA 2V61A 1BZLA 4KX6A 2XFNA 4H4XA 4USQA 1EL9A 4A6NA 2C65A 3RP7A 3CNJA 1EL8A 1Y56A 3IWAA 3CPJG 4H4TA 4J56A 1GRBA 3BNMA 4II2A 1D4DA 1GTHA 1GEUA 1IUUA 4AT0A 1E1NA 3DH9A 1KNRA 1NAAA 4AOSA 2RABA 2V3AA 4K2XA 2B9WA 2X99A 4C3YA 5JCLA 1NHPA 3UKLA 1PBEA 1W4XA 2C7GA 2GEWA 3IF9A 1GPEA 4J57A 4MJWA 1LTXR 1UKVG 2GR2A 4CBQA 4FK1C 4JN9A 3NN6X 3KKJA 2YG7A 2JBVA 4BK2A 3VRDB 3VR8A 3QVRA 4B66A 5HHFA 2C75A 3M13A 1D4EA 3UTHA 3AE9A 3AE8A 1BKWA 2Q6UA 1LQTA 2EQ8A 2YG6A 3CPHG 3FG2P 3SFEA 2F5ZA 4H2NA 5FS8A 3NK1X 3SM8A 1IUTA 1K4QA 1XPQA 3AECA 3CN8A 4K22A 3SQPA 4YSYA 1RYIA 4D04A 2JB1A 1FL2A 2ZZCA 2WDQA 3NNEA 2WPCA 3VQRA 3G5SA 1ZY8A 4CCRA 2XYOA 4IA6A 2R4JA 4B68A 3KPFA 3GSIA 2B76A 3PVCA 3UTFA 4GDPA 2YR6A 2B7RA 5FMHA 4XXGA 1GESA 1RSGA 5IPYA 3T2KA 1YQ4A 2BXRA 3AE5A 1FEBA 2BCPA 2WDVA 1IUWA 3D8XA 3QJ4A 1K0JA 4G9KA 1L0VA 3C4AA 4OPDA 3SX6A 3SXIA 3UOXA 5KOWA 2V60A 4M52A 1B37A 1IUVA 2VRMA 2WP6A 2O9ZA 1NENA 1CF3A 4XWRA 2BC1A 3RNMA 3RHAA 1F6MA 1JRYA 4BURA 4U2LA 4U2TA 4OPUA 3UKKA 2Q0KA 2BCGG 3ISHA 2PYXA 2Z5XA 4GR1A 1LPFA 3SZWA 4EM3A 5EBKA 1X31B 1TDEA 1TDNA 4YSHA 2E1MA 4Z25A 1CC2A 4Z2TA 2A8XA 3HZLA 2JB2A 3T14A 2GF3A 1PJ7A 3CPIG 1ZX9A 1GRHA 1K0LA 1PHHA 4IVOB 2IVEA 1TRBA 2YLSA 2VOUA 1OJDA 4OPIA 5CKUA 4J2WA 4JNQA 4KPRA 4C74A 5KOXA 1JNRA 1N4WA 2GV8A 2GRTA 1GALA 4Y4LA 3EPTA 4O5UA 1B8SA 1PXBA 1Q1WA 4EM4A 2BS2A 1D5TA 5KVIA 4CCQA 5IQ4A 3P4QA 1ZK7A 1GRFA 4LU6A 4FK1A 1E1MA 5JCKA 1YY5A 1CJ3A 2NPXA 3HYXA 3UKHA 2GB0A 3B3RA 2WOWA 3DK9A 1H81A 3KVEA 3NIXA 3PO7A 2GR1A 3AE6A 2X3NA 2I0ZA 4NNJA 1KNPA 3BI2A 2YVFA 4K5RA 1E1KA 1PDHA 3IHMA 5KMQA 1B5QA 1H84A 1S2QA 4XWZA 3EANA 4ZCDA 1RP0A 4EIPA 4OPLA 3T2ZA 4B69A 4B64A 3NK0X 4Z26A 1GV4A 3AE1A 1ZOYA 3ALJA 4A99A 4D03A 3M12A 3ADAB 3KD9A 3P1WA 3UTEA 4EQXA 1ZMCA 2H89A 4YSXA 1KSSA 4B65A 3UKPA 2YG5A 4X9NA 2YLRA 1NEKA 4OPTA 1N4VA 5J7XA 3T0KA 3QSEA 4Z2RA 4NWZA 3ATQA 3GYIA 3KA7A 3AE3A 2ZZ0A 3QSMA 1TYTA 2WBAA 4U8JA 1ZMDA 2YG4A 2WQYA 1EL7A 1KFYA 1HYUA 1GERA 1Y56B 2E4GA 3GMCA 4U8LA 4G74A 4AOXA 3ITJA 1F8RA 4WCTA 4EIQA 2XCGA 2GH5A 3PS9A 1ZDLA 2DKHA 3LXDA 1H83A 1S3EA 3SY4A 3C4NA 2TMDA 3CGDA 4H4UA 4H4QA 5JCNA 1QLBA 3CGCA 4USRA 1EBDA 4YKGA 4ECHA 2YG3A 2XVFA 1AOGA 3AYLA 4EMIA 2FJAA 4JY3A 2VZ2A 2R4EA 4U8MA 5KMPA 1ELIA 3GWFA 2J3NA 1P2EA 3CIRA 1GT8A 3NH3X 3DGZA 4Z44A 4UDRA 1D4CA 1TYPA 4NTDA 3IHGA 4CRTA 2JB3A 3AB1A 2B9XA 4ICYA 1KSUA 2C64A 3DGHA 3UOZA 1PXAA 2GR3A 2X8CA 1FOHA 1GNDA 2YLTA 3JSKA 1LV0A 2WP9A 2XLRA 3BI5A 3FIMB 4AT2A 3FBSA 2ZBWA 2VVMA 5HY5A 5ER0A 3C96A 1L9CA 2R9ZA 5EB5A 5KWFA 1IUSA 1VQWA 2VVLA 4PAAA 4TM0A 1GXFA 3ATRA 4GRTA 4LIIA 2C3DA 3NYCA 1MO9A 4YTNA 1H82A 1KF6A 5U25A 5FS6A 1QO8A 2AR8A 2QA2A 3FPZA 4JDRA 1JRXA 5U1OA 2YQUA 2BXSA 2BK3A 2A87A 2E5VA 1NHRA 2WETA 4WX1A 2GMJA 1FCDA 1ZOVA 3S61A 2OALA 2RGJA 3ICTA 3VRAA 3Q6JA 2XLPA 3BI4A 1Q1RA 2OLNA 2VQ7A 3QVPA 1PBBA 4Z24A 3ALLA 1FEAA 1LJ1A 3NKSA 1NDAA 3Q9TA 1NHQA 2DKIA 3AYJA 2JK6A 4U8KA 4RG3A 4Z43A 3LB8A 4GF7A 5JCIA 1EL5A 2FJEA 2XFQA 1V59A 2AQJA 3GD4A 3COXA 1FECA 4YXDA 4Z2UA 1Y0PA 2R45A 3KPKA 3UCLA 4EMJA 5J60A 1IUXA 2YM1A 3T2YA 1DOEA 1OJ9A 3NN0X 3NYEA 2R0CA 5JCMA 5M10A 4H2RA 4J33A 1K0IA 2XVEA 2BRYA 2C73A 2ACZA 2GMHA 1BGNA 2WESA 1XDIA 2YR5A 3I6DA 4RG4A 5EB4A 2V6OA 5FS9A 2XFPA 3UKQA 5LV9A 2BA9A 3K7MX 1B4VA 4RSLA 3REDA 2YWLA 5KNLA 2BACA 1M6IA 4JY2A 4C77A 2YM2A 2H88A 3GYXA 4Y4NA 3DA1A 1H7WA 4BJYA 2BABA 2V5ZA 4OCGA 3EF6A 1GRTA 1PS9A 1H6VA 2Z5YA 3SZFA 3ZDNA 2X50A 3AEGA 3URHA 4A7AA 4YT0A 2Q7VA 4REKA 3KLJA 1TDOA 2XDOA 3DK4A 5KXJA 5GRTA 3GWDA 4U2SA 2FJDA 3HYWA 3H8IA 1NHSA 3NGCX 5U63A 2IVDA 2Q0LA 3V3NA 3UTGA 1PN0A 4LA1A 3RP8A 2JKCA 3GMBA 4GDEA 4HB9A 1GRAA 3M0OA 4DNAA 4BK3A 1DODA 3SZCA 1F8SA 1E1LA 2C67A 4P9SA 5C3JA 2APGA 4HA6A 2UZZA 4C5OA 5BUKA 4H4WA 3QFBA 2GQFA 1GETA 3SGLA 1E39A 1CJ4A 1YKJA 4H2PA 1MXTA 2CFYA 3K7QX 1BF3A 2X8HA 4H4RA 3P9UA 4J34A 1CJ2A 3CNSA 2WHDA 5KRQA 4O5QA 1GTEA 3HYVA 4YSZA 4AP1A 3L8KA 1VG9A 1XANA 3DJDA 3ALMA 3NTDA 1LVLA 4CY8A 3DJEA 1REOA 3LADA 1JU2A 3BNUA 3CNPA 4H4ZA 3ICSA 5KVHA 3UKFA 4U8OA 3UP5A 2OLOA 2XLTA 4NEVA 3SZ0A 1Z6LA 1O94A 5C2TA 3DJJA 3NLCA 1NG3A 2XVHA 1PBFA 3E1TA 1OJCA 2GAHB 4B1BA 4A5LA 5KMRA 1E7PA 3F8PA 3FMWA 1CC6A 4X9MA 3IC9A 4U8NA 4C3XA 2C70A 5FS7A 4N9XA 1Q9IA 2BS4A 2YAUA 4A65A 4DSGA 1JEHA 2CDUA 4YKFA 2OAMA 2PHHA 4IVMB 4UDPA 5EOWA 4APNA 1S3BA 2GAGB 2WU2A 3GDNA 4GCMA 1SEZA 4FDCB 2Y6RA 3NTAA 2B9YA 1ONFA 2WS3A 3OC4A 2XLSA 4OPCA 2YVGA 1NPXA 2GQWA 2NVKX 2WEUA 4G73A 4JNAA 1DOCA 1N1PA 3T31A 3AE7A 3KU9A 4H4YA 4EQRA 2BK4A 3WE0A 4I59A 2R46A 1GRGA 2W0HA 4B67A 3V76A 3LOVA 3D1CA 1H86A 3AD8B 3EAOA 3GRTA 2ARDA 2Y6QA 3ABVA 3NHOX 4K8DA 2XVJA 5BULA 2WPEA 2CULA 1ZP0A 4BJZA 1TDKA 2EQ9A 1O5WA 3P4RA 2C72A 3CGEA 4H4VA 5TR3A 2WP5A 4PABA 3DJGX 4AP3A 1PJ5A 1CHUA 3VRBA 2YVJA 3NG7X 3K30A 2C76A 3AEDA 4H4SA 1GOSA 4I58A 1QJDA 2BS3A 3L1RA 3NT6A 3NK2X 3G5RA 4JQ9A 1CL0A 3GYJA 4CY6A 1BGJA 4H2QA 3VR9A 1DOBA 4H4PA 3CGBA 4H7UA 2C3CA 1JRZA 3CNDA 4ADWA 4BK1A 4IV9A 4DGKA 3O0HA 4TM3A 1CC4A 5GSNA 4NTCA 4H50A 1VG0A 3GD3A 1L9EA 2QA1A 5DBJA 2JAEA 4FX9A 2IIDA 4K5SA 2RGOA 3CNTA 2YLWA 4A79A 2GVCA 5KMSA 3F8RA 4DSHA 2BRAA 3AD9B 1XHCA 2WDRA 3F8DA 1E6EA 2XFUA 4TLXA 3I3LA 5M0ZA 3T37A 2FBWA 3BHKA 5CQFA 3QFAA 3NYFA 3II4A 5HXIA 2RGHA 1L9DA 1S2YA 3UOYA 4Y4MA 3V3OA 1CJCA 2A89A 4B63A 1JNZA 3GRSA 1BWCA 4CNKA 5L46A 2AAQA 3AYIA 1TDFA 4TM4A 4U8PA 2X8GA 2BYBA 4CNJA 3SYIA 3UKAA 3QSSA 1H7XA 2EQ6A 2QAEA 4UDQA 3H8LA 3ICRA 2BC0A 3UOVA 3P4PA 3R9UA 4NTEA 4GAVA 2R0GA 1MOKA 2WOVA 3DK8A 4A9WA 1D7YA 2V3BA 4GAPA 4NEWA 4TLZA 2BK5A 3RP6A 2B7SA 2QCUA 4NZHA 5HYMA 1COYA 2YLZA 1KDGA 3AEFA 3CTYA 3OZ2A 4GUVA 4II3A 1IJHA 3P4SA 2CVJA 1YQ3A 1PJ6A 3CMMA 3GDPA 5BVAA 3AEBA 3LJPA 2YLXA 4U8IA 1GREA 4X4JA 4YTPA 4UP3A 1OJAA 2VQBA 2XLUA 5IQ1A 4EQSA 1LQUA 2TPRA 1O95A 4OVIA 1YQZA 2YR4A 4J36A 1GSNA 3UP4A 3B6DA 4ZN0A 2ZZBA 3AE4A 1DXLA 3G5QA 3AE2A 3H4KA 1CBOA 1F3PA 3AEAA 1M64A 4J31A 1DNCA 2VVLG 1D7LA 3LZWA 2XFOA 2WU5A 1VRQB 2WPFA 1F8WA 2EQ7A 3K7TA 4BV6A 1JOAA 1P2HA 3AEEA 2XVIA 2C66A 3LZXA 4TM1A 2WOIA 4EMWA 2GR0A
chains in the Genus database with same CATH topology
4OPGA 2C4CA 1DJNA 3AWIA 4G6HA 1NG4A 1PBDA 1PBCA 3DMEA 2VRLA 1N4UA 3AD7B 4A6NB 3NRNA 2HQMA 3SFDA 1PXCA 4IA5A 4YWOA 2FJBA 1OJTA 1ZKQA 5BRTA 4ZCCA 3ZYXA 1DJQA 2OA1A 4G6GA 4YTMA 2R0PA 3BHFA 3S5WA 4EQWA 4E0VA 3AXBA 1VDCA 4K7ZA 2V61A 1BZLA 4KX6A 2XFNA 4H4XA 4USQA 1EL9A 4A6NA 2C65A 3RP7A 3CNJA 1EL8A 1Y56A 3IWAA 3CPJG 4H4TA 4J56A 1GRBA 3BNMA 4II2A 1D4DA 1GTHA 1GEUA 1IUUA 4AT0A 1E1NA 3DH9A 1KNRA 1NAAA 4AOSA 2RABA 2V3AA 4K2XA 2B9WA 2X99A 4C3YA 5JCLA 1NHPA 3UKLA 1PBEA 1W4XA 2C7GA 2GEWA 3IF9A 1GPEA 4J57A 4MJWA 1LTXR 1UKVG 2GR2A 4CBQA 4FK1C 4JN9A 3NN6X 3KKJA 2YG7A 2JBVA 4BK2A 3VRDB 3VR8A 3QVRA 4B66A 5HHFA 2C75A 3M13A 1D4EA 3UTHA 3AE9A 3AE8A 1BKWA 2Q6UA 1LQTA 2EQ8A 2YG6A 3CPHG 3FG2P 3SFEA 2F5ZA 4H2NA 5FS8A 3NK1X 3SM8A 1IUTA 1K4QA 1XPQA 3AECA 3CN8A 4K22A 3SQPA 4YSYA 1RYIA 4D04A 2JB1A 1FL2A 2ZZCA 2WDQA 3NNEA 2WPCA 3VQRA 3G5SA 1ZY8A 4CCRA 2XYOA 4IA6A 2R4JA 4B68A 3KPFA 3GSIA 2B76A 3PVCA 3UTFA 4GDPA 2YR6A 2B7RA 5FMHA 4XXGA 1GESA 1RSGA 5IPYA 3T2KA 1YQ4A 2BXRA 3AE5A 1FEBA 2BCPA 2WDVA 1IUWA 3D8XA 3QJ4A 1K0JA 4G9KA 1L0VA 3C4AA 4OPDA 3SX6A 3SXIA 3UOXA 5KOWA 2V60A 4M52A 1B37A 1IUVA 2VRMA 2WP6A 2O9ZA 1NENA 1CF3A 4XWRA 2BC1A 3RNMA 3RHAA 1F6MA 1JRYA 4BURA 4U2LA 4U2TA 4OPUA 3UKKA 2Q0KA 2BCGG 3ISHA 2PYXA 2Z5XA 4GR1A 1LPFA 3SZWA 4EM3A 5EBKA 1X31B 1TDEA 1TDNA 4YSHA 2E1MA 4Z25A 1CC2A 4Z2TA 2A8XA 3HZLA 2JB2A 3T14A 2GF3A 1PJ7A 3CPIG 1ZX9A 1GRHA 1K0LA 1PHHA 4IVOB 2IVEA 1TRBA 2YLSA 2VOUA 1OJDA 4OPIA 5CKUA 4J2WA 4JNQA 4KPRA 4C74A 5KOXA 1JNRA 1N4WA 2GV8A 2GRTA 1GALA 4Y4LA 3EPTA 4O5UA 1B8SA 1PXBA 1Q1WA 4EM4A 2BS2A 1D5TA 5KVIA 4CCQA 5IQ4A 3P4QA 1ZK7A 1GRFA 4LU6A 4FK1A 1E1MA 5JCKA 1YY5A 1CJ3A 2NPXA 3HYXA 3UKHA 2GB0A 3B3RA 2WOWA 3DK9A 1H81A 3KVEA 3NIXA 3PO7A 2GR1A 3AE6A 2X3NA 2I0ZA 4NNJA 1KNPA 3BI2A 2YVFA 4K5RA 1E1KA 1PDHA 3IHMA 5KMQA 1B5QA 1H84A 1S2QA 4XWZA 3EANA 4ZCDA 1RP0A 4EIPA 4OPLA 3T2ZA 4B69A 4B64A 3NK0X 4Z26A 1GV4A 3AE1A 1ZOYA 3ALJA 4A99A 4D03A 3M12A 3ADAB 3KD9A 3P1WA 3UTEA 4EQXA 1ZMCA 2H89A 4YSXA 1KSSA 4B65A 3UKPA 2YG5A 4X9NA 2YLRA 1NEKA 4OPTA 1N4VA 5J7XA 3T0KA 3QSEA 4Z2RA 4NWZA 3ATQA 3GYIA 3KA7A 3AE3A 2ZZ0A 3QSMA 1TYTA 2WBAA 4U8JA 1ZMDA 2YG4A 2WQYA 1EL7A 1KFYA 1HYUA 1GERA 1Y56B 2E4GA 3GMCA 4U8LA 4G74A 4AOXA 3ITJA 1F8RA 4WCTA 4EIQA 2XCGA 2GH5A 3PS9A 1ZDLA 2DKHA 3LXDA 1H83A 1S3EA 3SY4A 3C4NA 2TMDA 3CGDA 4H4UA 4H4QA 5JCNA 1QLBA 3CGCA 4USRA 1EBDA 4YKGA 4ECHA 2YG3A 2XVFA 1AOGA 3AYLA 4EMIA 2FJAA 4JY3A 2VZ2A 2R4EA 4U8MA 5KMPA 1ELIA 3GWFA 2J3NA 1P2EA 3CIRA 1GT8A 3NH3X 3DGZA 4Z44A 4UDRA 1D4CA 1TYPA 4NTDA 3IHGA 4CRTA 2JB3A 3AB1A 2B9XA 4ICYA 1KSUA 2C64A 3DGHA 3UOZA 1PXAA 2GR3A 2X8CA 1FOHA 1GNDA 2YLTA 3JSKA 1LV0A 2WP9A 2XLRA 3BI5A 3FIMB 4AT2A 3FBSA 2ZBWA 2VVMA 5HY5A 5ER0A 3C96A 1L9CA 2R9ZA 5EB5A 5KWFA 1IUSA 1VQWA 2VVLA 4PAAA 4TM0A 1GXFA 3ATRA 4GRTA 4LIIA 2C3DA 3NYCA 1MO9A 4YTNA 1H82A 1KF6A 5U25A 5FS6A 1QO8A 2AR8A 2QA2A 3FPZA 4JDRA 1JRXA 5U1OA 2YQUA 2BXSA 2BK3A 2A87A 2E5VA 1NHRA 2WETA 4WX1A 2GMJA 1FCDA 1ZOVA 3S61A 2OALA 2RGJA 3ICTA 3VRAA 3Q6JA 2XLPA 3BI4A 1Q1RA 2OLNA 2VQ7A 3QVPA 1PBBA 4Z24A 3ALLA 1FEAA 1LJ1A 3NKSA 1NDAA 3Q9TA 1NHQA 2DKIA 3AYJA 2JK6A 4U8KA 4RG3A 4Z43A 3LB8A 4GF7A 5JCIA 1EL5A 2FJEA 2XFQA 1V59A 2AQJA 3GD4A 3COXA 1FECA 4YXDA 4Z2UA 1Y0PA 2R45A 3KPKA 3UCLA 4EMJA 5J60A 1IUXA 2YM1A 3T2YA 1DOEA 1OJ9A 3NN0X 3NYEA 2R0CA 5JCMA 5M10A 4H2RA 4J33A 1K0IA 2XVEA 2BRYA 2C73A 2ACZA 2GMHA 1BGNA 2WESA 1XDIA 2YR5A 3I6DA 4RG4A 5EB4A 2V6OA 5FS9A 2XFPA 3UKQA 5LV9A 2BA9A 3K7MX 1B4VA 4RSLA 3REDA 2YWLA 5KNLA 2BACA 1M6IA 4JY2A 4C77A 2YM2A 2H88A 3GYXA 4Y4NA 3DA1A 1H7WA 4BJYA 2BABA 2V5ZA 4OCGA 3EF6A 1GRTA 1PS9A 1H6VA 2Z5YA 3SZFA 3ZDNA 2X50A 3AEGA 3URHA 4A7AA 4YT0A 2Q7VA 4REKA 3KLJA 1TDOA 2XDOA 3DK4A 5KXJA 5GRTA 3GWDA 4U2SA 2FJDA 3HYWA 3H8IA 1NHSA 3NGCX 5U63A 2IVDA 2Q0LA 3V3NA 3UTGA 1PN0A 4LA1A 3RP8A 2JKCA 3GMBA 4GDEA 4HB9A 1GRAA 3M0OA 4DNAA 4BK3A 1DODA 3SZCA 1F8SA 1E1LA 2C67A 4P9SA 5C3JA 2APGA 4HA6A 2UZZA 4C5OA 5BUKA 4H4WA 3QFBA 2GQFA 1GETA 3SGLA 1E39A 1CJ4A 1YKJA 4H2PA 1MXTA 2CFYA 3K7QX 1BF3A 2X8HA 4H4RA 3P9UA 4J34A 1CJ2A 3CNSA 2WHDA 5KRQA 4O5QA 1GTEA 3HYVA 4YSZA 4AP1A 3L8KA 1VG9A 1XANA 3DJDA 3ALMA 3NTDA 1LVLA 4CY8A 3DJEA 1REOA 3LADA 1JU2A 3BNUA 3CNPA 4H4ZA 3ICSA 5KVHA 3UKFA 4U8OA 3UP5A 2OLOA 2XLTA 4NEVA 3SZ0A 1Z6LA 1O94A 5C2TA 3DJJA 3NLCA 1NG3A 2XVHA 1PBFA 3E1TA 1OJCA 2GAHB 4B1BA 4A5LA 5KMRA 1E7PA 3F8PA 3FMWA 1CC6A 4X9MA 3IC9A 4U8NA 4C3XA 2C70A 5FS7A 4N9XA 1Q9IA 2BS4A 2YAUA 4A65A 4DSGA 1JEHA 2CDUA 4YKFA 2OAMA 2PHHA 4IVMB 4UDPA 5EOWA 4APNA 1S3BA 2GAGB 2WU2A 3GDNA 4GCMA 1SEZA 4FDCB 2Y6RA 3NTAA 2B9YA 1ONFA 2WS3A 3OC4A 2XLSA 4OPCA 2YVGA 1NPXA 2GQWA 2NVKX 2WEUA 4G73A 4JNAA 1DOCA 1N1PA 3T31A 3AE7A 3KU9A 4H4YA 4EQRA 2BK4A 3WE0A 4I59A 2R46A 1GRGA 2W0HA 4B67A 3V76A 3LOVA 3D1CA 1H86A 3AD8B 3EAOA 3GRTA 2ARDA 2Y6QA 3ABVA 3NHOX 4K8DA 2XVJA 5BULA 2WPEA 2CULA 1ZP0A 4BJZA 1TDKA 2EQ9A 1O5WA 3P4RA 2C72A 3CGEA 4H4VA 5TR3A 2WP5A 4PABA 3DJGX 4AP3A 1PJ5A 1CHUA 3VRBA 2YVJA 3NG7X 3K30A 2C76A 3AEDA 4H4SA 1GOSA 4I58A 1QJDA 2BS3A 3L1RA 3NT6A 3NK2X 3G5RA 4JQ9A 1CL0A 3GYJA 4CY6A 1BGJA 4H2QA 3VR9A 1DOBA 4H4PA 3CGBA 4H7UA 2C3CA 1JRZA 3CNDA 4ADWA 4BK1A 4IV9A 4DGKA 3O0HA 4TM3A 1CC4A 5GSNA 4NTCA 4H50A 1VG0A 3GD3A 1L9EA 2QA1A 5DBJA 2JAEA 4FX9A 2IIDA 4K5SA 2RGOA 3CNTA 2YLWA 4A79A 2GVCA 5KMSA 3F8RA 4DSHA 2BRAA 3AD9B 1XHCA 2WDRA 3F8DA 1E6EA 2XFUA 4TLXA 3I3LA 5M0ZA 3T37A 2FBWA 3BHKA 5CQFA 3QFAA 3NYFA 3II4A 5HXIA 2RGHA 1L9DA 1S2YA 3UOYA 4Y4MA 3V3OA 1CJCA 2A89A 4B63A 1JNZA 3GRSA 1BWCA 4CNKA 5L46A 2AAQA 3AYIA 1TDFA 4TM4A 4U8PA 2X8GA 2BYBA 4CNJA 3SYIA 3UKAA 3QSSA 1H7XA 2EQ6A 2QAEA 4UDQA 3H8LA 3ICRA 2BC0A 3UOVA 3P4PA 3R9UA 4NTEA 4GAVA 2R0GA 1MOKA 2WOVA 3DK8A 4A9WA 1D7YA 2V3BA 4GAPA 4NEWA 4TLZA 2BK5A 3RP6A 2B7SA 2QCUA 4NZHA 5HYMA 1COYA 2YLZA 1KDGA 3AEFA 3CTYA 3OZ2A 4GUVA 4II3A 1IJHA 3P4SA 2CVJA 1YQ3A 1PJ6A 3CMMA 3GDPA 5BVAA 3AEBA 3LJPA 2YLXA 4U8IA 1GREA 4X4JA 4YTPA 4UP3A 1OJAA 2VQBA 2XLUA 5IQ1A 4EQSA 1LQUA 2TPRA 1O95A 4OVIA 1YQZA 2YR4A 4J36A 1GSNA 3UP4A 3B6DA 4ZN0A 2ZZBA 3AE4A 1DXLA 3G5QA 3AE2A 3H4KA 1CBOA 1F3PA 3AEAA 1M64A 4J31A 1DNCA 2VVLG 1D7LA 3LZWA 2XFOA 2WU5A 1VRQB 2WPFA 1F8WA 2EQ7A 3K7TA 4BV6A 1JOAA 1P2HA 3AEEA 2XVIA 2C66A 3LZXA 4TM1A 2WOIA 4EMWA 2GR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OPG A;  1DJN A;  3AWI A;  1NG4 A;  1PBD A;  1PBC A;  3DME A;  2VRL A;  1N4U A;  3AD7 B;  4A6N B;  3NRN A;  2HQM A;  3SFD A;  1PXC A;  4IA5 A;  4YWO A;  2FJB A;  1OJT A;  1ZKQ A;  5BRT A;  4ZCC A;  3ZYX A;  1DJQ A;  2OA1 A;  4YTM A;  2R0P A;  3BHF A;  3S5W A;  4EQW A;  4E0V A;  3AXB A;  1VDC A;  4K7Z A;  2V61 A;  1BZL A;  4KX6 A;  2XFN A;  4H4X A;  4USQ A;  1EL9 A;  4A6N A;  2C65 A;  3RP7 A;  3CNJ A;  1EL8 A;  1Y56 A;  3IWA A;  3CPJ G;  4H4T A;  4J56 A;  1GRB A;  3BNM A;  1D4D A;  1GTH A;  1GEU A;  1IUU A;  4AT0 A;  1E1N A;  3DH9 A;  1KNR A;  1NAA A;  4AOS A;  2RAB A;  2V3A A;  4K2X A;  2B9W A;  2X99 A;  4C3Y A;  5JCL A;  1NHP A;  3UKL A;  1PBE A;  1W4X A;  2C7G A;  2GEW A;  3IF9 A;  1GPE A;  4J57 A;  4MJW A;  1LTX R;  1UKV G;  2GR2 A;  4CBQ A;  4FK1 C;  4JN9 A;  3NN6 X;  3KKJ A;  2YG7 A;  2JBV A;  4BK2 A;  3VRD B;  3VR8 A;  3QVR A;  4B66 A;  5HHF A;  2C75 A;  3M13 A;  1D4E A;  3UTH A;  3AE9 A;  3AE8 A;  1BKW A;  2Q6U A;  1LQT A;  2EQ8 A;  2YG6 A;  3CPH G;  3FG2 P;  3SFE A;  2F5Z A;  4H2N A;  5FS8 A;  3NK1 X;  3SM8 A;  1IUT A;  1K4Q A;  1XPQ A;  3AEC A;  3CN8 A;  4K22 A;  3SQP A;  4YSY A;  1RYI A;  4D04 A;  2JB1 A;  1FL2 A;  2ZZC A;  2WDQ A;  3NNE A;  2WPC A;  3VQR A;  3G5S A;  1ZY8 A;  4CCR A;  2XYO A;  4IA6 A;  2R4J A;  4B68 A;  3KPF A;  3GSI A;  2B76 A;  3PVC A;  3UTF A;  4GDP A;  2YR6 A;  2B7R A;  5FMH A;  4XXG A;  1GES A;  1RSG A;  5IPY A;  1YQ4 A;  2BXR A;  3AE5 A;  1FEB A;  2BCP A;  2WDV A;  1IUW A;  3D8X A;  3QJ4 A;  1K0J A;  1L0V A;  3C4A A;  4OPD A;  3UOX A;  5KOW A;  2V60 A;  4M52 A;  1B37 A;  1IUV A;  2VRM A;  2WP6 A;  2O9Z A;  1NEN A;  1CF3 A;  4XWR A;  2BC1 A;  3RNM A;  3RHA A;  1F6M A;  1JRY A;  4BUR A;  4U2L A;  4U2T A;  4OPU A;  3UKK A;  2Q0K A;  2BCG G;  3ISH A;  2PYX A;  2Z5X A;  4GR1 A;  1LPF A;  4EM3 A;  5EBK A;  1X31 B;  1TDE A;  1TDN A;  4YSH A;  2E1M A;  4Z25 A;  1CC2 A;  4Z2T A;  2A8X A;  3HZL A;  2JB2 A;  2GF3 A;  1PJ7 A;  3CPI G;  1ZX9 A;  1GRH A;  1K0L A;  1PHH A;  4IVO B;  2IVE A;  1TRB A;  2YLS A;  2VOU A;  1OJD A;  4OPI A;  5CKU A;  4J2W A;  4JNQ A;  4KPR A;  4C74 A;  5KOX A;  1JNR A;  1N4W A;  2GV8 A;  2GRT A;  1GAL A;  4Y4L A;  3EPT A;  4O5U A;  1B8S A;  1PXB A;  1Q1W A;  4EM4 A;  2BS2 A;  1D5T A;  5KVI A;  4CCQ A;  5IQ4 A;  3P4Q A;  1ZK7 A;  1GRF A;  4LU6 A;  4FK1 A;  1E1M A;  5JCK A;  1YY5 A;  1CJ3 A;  2NPX A;  3UKH A;  2GB0 A;  3B3R A;  2WOW A;  3DK9 A;  1H81 A;  3KVE A;  3NIX A;  3PO7 A;  2GR1 A;  3AE6 A;  2X3N A;  2I0Z A;  1KNP A;  3BI2 A;  2YVF A;  4K5R A;  1E1K A;  1PDH A;  3IHM A;  1B5Q A;  1H84 A;  1S2Q A;  4XWZ A;  3EAN A;  4ZCD A;  1RP0 A;  4EIP A;  4OPL A;  4B69 A;  4B64 A;  3NK0 X;  4Z26 A;  1GV4 A;  3AE1 A;  1ZOY A;  3ALJ A;  4A99 A;  4D03 A;  3M12 A;  3ADA B;  3KD9 A;  3P1W A;  3UTE A;  4EQX A;  1ZMC A;  2H89 A;  4YSX A;  1KSS A;  4B65 A;  3UKP A;  2YG5 A;  4X9N A;  2YLR A;  1NEK A;  4OPT A;  1N4V A;  5J7X A;  3QSE A;  4Z2R A;  3ATQ A;  3GYI A;  3KA7 A;  3AE3 A;  2ZZ0 A;  3QSM A;  1TYT A;  2WBA A;  4U8J A;  1ZMD A;  2YG4 A;  2WQY A;  1EL7 A;  1KFY A;  1HYU A;  1GER A;  1Y56 B;  2E4G A;  3GMC A;  4U8L A;  4AOX A;  3ITJ A;  1F8R A;  4WCT A;  4EIQ A;  2XCG A;  2GH5 A;  3PS9 A;  1ZDL A;  2DKH A;  3LXD A;  1H83 A;  1S3E A;  3C4N A;  2TMD A;  3CGD A;  4H4U A;  4H4Q A;  5JCN A;  1QLB A;  3CGC A;  4USR A;  1EBD A;  4YKG A;  4ECH A;  2YG3 A;  2XVF A;  1AOG A;  3AYL A;  4EMI A;  2FJA A;  4JY3 A;  2VZ2 A;  2R4E A;  4U8M A;  1ELI A;  3GWF A;  2J3N A;  1P2E A;  3CIR A;  1GT8 A;  3NH3 X;  3DGZ A;  4Z44 A;  4UDR A;  1D4C A;  1TYP A;  4NTD A;  3IHG A;  4CRT A;  2JB3 A;  3AB1 A;  2B9X A;  4ICY A;  1KSU A;  2C64 A;  3DGH A;  3UOZ A;  1PXA A;  2GR3 A;  2X8C A;  1FOH A;  1GND A;  2YLT A;  3JSK A;  1LV0 A;  2WP9 A;  2XLR A;  3BI5 A;  3FIM B;  4AT2 A;  3FBS A;  2ZBW A;  2VVM A;  5HY5 A;  5ER0 A;  3C96 A;  1L9C A;  2R9Z A;  5EB5 A;  5KWF A;  1IUS A;  1VQW A;  2VVL A;  4PAA A;  4TM0 A;  1GXF A;  3ATR A;  4GRT A;  4LII A;  2C3D A;  3NYC A;  1MO9 A;  4YTN A;  1H82 A;  1KF6 A;  5U25 A;  5FS6 A;  1QO8 A;  2AR8 A;  2QA2 A;  3FPZ A;  4JDR A;  1JRX A;  5U1O A;  2YQU A;  2BXS A;  2BK3 A;  2A87 A;  2E5V A;  1NHR A;  2WET A;  4WX1 A;  2GMJ A;  1FCD A;  1ZOV A;  3S61 A;  2OAL A;  2RGJ A;  3ICT A;  3VRA A;  3Q6J A;  2XLP A;  3BI4 A;  1Q1R A;  2OLN A;  2VQ7 A;  3QVP A;  1PBB A;  4Z24 A;  3ALL A;  1FEA A;  1LJ1 A;  3NKS A;  1NDA A;  3Q9T A;  1NHQ A;  2DKI A;  3AYJ A;  2JK6 A;  4U8K A;  4RG3 A;  4Z43 A;  3LB8 A;  4GF7 A;  5JCI A;  1EL5 A;  2FJE A;  2XFQ A;  1V59 A;  2AQJ A;  3GD4 A;  3COX A;  1FEC A;  4YXD A;  4Z2U A;  1Y0P A;  2R45 A;  4EMJ A;  3UCL A;  5J60 A;  1IUX A;  2YM1 A;  1DOE A;  1OJ9 A;  3NN0 X;  3NYE A;  2R0C A;  5JCM A;  5M10 A;  4H2R A;  4J33 A;  1K0I A;  2XVE A;  2C73 A;  2ACZ A;  2GMH A;  1BGN A;  2WES A;  1XDI A;  2YR5 A;  3I6D A;  4RG4 A;  5EB4 A;  2V6O A;  5FS9 A;  2XFP A;  3UKQ A;  5LV9 A;  2BA9 A;  3K7M X;  1B4V A;  4RSL A;  3RED A;  2YWL A;  2BAC A;  1M6I A;  4JY2 A;  4C77 A;  2YM2 A;  2H88 A;  4Y4N A;  3DA1 A;  1H7W A;  4BJY A;  2BAB A;  2V5Z A;  4OCG A;  3EF6 A;  1GRT A;  1PS9 A;  1H6V A;  2Z5Y A;  3ZDN A;  2X50 A;  3AEG A;  3URH A;  4A7A A;  4YT0 A;  2Q7V A;  4REK A;  3KLJ A;  1TDO A;  2XDO A;  3DK4 A;  5KXJ A;  5GRT A;  3GWD A;  4U2S A;  2FJD A;  5U63 A;  3H8I A;  1NHS A;  3NGC X;  2IVD A;  3V3N A;  2Q0L A;  3UTG A;  1PN0 A;  4LA1 A;  3RP8 A;  2JKC A;  3GMB A;  4GDE A;  4HB9 A;  1GRA A;  3M0O A;  4DNA A;  4BK3 A;  1DOD A;  1F8S A;  1E1L A;  2C67 A;  4P9S A;  5C3J A;  2APG A;  4HA6 A;  2UZZ A;  4C5O A;  5BUK A;  4H4W A;  3QFB A;  2GQF A;  1GET A;  3SGL A;  1E39 A;  1CJ4 A;  1YKJ A;  4H2P A;  1MXT A;  2CFY A;  3K7Q X;  1BF3 A;  2X8H A;  4H4R A;  3P9U A;  4J34 A;  1CJ2 A;  3CNS A;  2WHD A;  5KRQ A;  4O5Q A;  1GTE A;  4YSZ A;  4AP1 A;  3L8K A;  1VG9 A;  1XAN A;  3DJD A;  3ALM A;  3NTD A;  1LVL A;  4CY8 A;  3DJE A;  1REO A;  3LAD A;  1JU2 A;  3BNU A;  3CNP A;  4H4Z A;  3ICS A;  5KVH A;  3UKF A;  4U8O A;  3UP5 A;  2OLO A;  2XLT A;  4NEV A;  1Z6L A;  1O94 A;  5C2T A;  3DJJ A;  3NLC A;  1NG3 A;  2XVH A;  1PBF A;  3E1T A;  1OJC A;  2GAH B;  4B1B A;  4A5L A;  1E7P A;  3F8P A;  3FMW A;  1CC6 A;  4X9M A;  3IC9 A;  4U8N A;  4C3X A;  2C70 A;  5FS7 A;  4N9X A;  1Q9I A;  2BS4 A;  2YAU A;  4A65 A;  4DSG A;  1JEH A;  2CDU A;  4YKF A;  2OAM A;  2PHH A;  4IVM B;  4UDP A;  5EOW A;  4APN A;  1S3B A;  2GAG B;  2WU2 A;  3GDN A;  4GCM A;  1SEZ A;  4FDC B;  2Y6R A;  3NTA A;  2B9Y A;  1ONF A;  2WS3 A;  3OC4 A;  2XLS A;  4OPC A;  2YVG A;  1NPX A;  2GQW A;  2NVK X;  2WEU A;  4JNA A;  1DOC A;  1N1P A;  3AE7 A;  3KU9 A;  4H4Y A;  4EQR A;  2BK4 A;  3WE0 A;  4I59 A;  2R46 A;  1GRG A;  2W0H A;  4B67 A;  3V76 A;  3LOV A;  3D1C A;  1H86 A;  3AD8 B;  3EAO A;  3GRT A;  2ARD A;  2Y6Q A;  3ABV A;  3NHO X;  4K8D A;  2XVJ A;  5BUL A;  2WPE A;  2CUL A;  1ZP0 A;  4BJZ A;  1TDK A;  2EQ9 A;  1O5W A;  3P4R A;  2C72 A;  3CGE A;  4H4V A;  5TR3 A;  2WP5 A;  4PAB A;  3DJG X;  4AP3 A;  1PJ5 A;  1CHU A;  3VRB A;  2YVJ A;  3NG7 X;  3K30 A;  2C76 A;  3AED A;  4H4S A;  1GOS A;  4I58 A;  1QJD A;  2BS3 A;  3L1R A;  3NT6 A;  3NK2 X;  3G5R A;  4JQ9 A;  1CL0 A;  3GYJ A;  4CY6 A;  1BGJ A;  4H2Q A;  3VR9 A;  1DOB A;  4H4P A;  3CGB A;  4H7U A;  2C3C A;  1JRZ A;  3CND A;  4ADW A;  4BK1 A;  4IV9 A;  4DGK A;  3O0H A;  4TM3 A;  1CC4 A;  5GSN A;  4NTC A;  4H50 A;  1VG0 A;  3GD3 A;  1L9E A;  2QA1 A;  5DBJ A;  2JAE A;  4FX9 A;  2IID A;  4K5S A;  2RGO A;  3CNT A;  2YLW A;  4A79 A;  2GVC A;  3F8R A;  4DSH A;  3AD9 B;  1XHC A;  2WDR A;  3F8D A;  1E6E A;  2XFU A;  4TLX A;  3I3L A;  5M0Z A;  3T37 A;  2FBW A;  3BHK A;  5CQF A;  3QFA A;  3NYF A;  3II4 A;  5HXI A;  2RGH A;  1L9D A;  1S2Y A;  3UOY A;  4Y4M A;  3V3O A;  1CJC A;  2A89 A;  4B63 A;  1JNZ A;  3GRS A;  1BWC A;  4CNK A;  5L46 A;  2AAQ A;  3AYI A;  1TDF A;  4TM4 A;  4U8P A;  2X8G A;  2BYB A;  4CNJ A;  3UKA A;  3QSS A;  1H7X A;  2EQ6 A;  2QAE A;  4UDQ A;  3H8L A;  3ICR A;  2BC0 A;  3UOV A;  3P4P A;  3R9U A;  4NTE A;  2R0G A;  1MOK A;  2WOV A;  3DK8 A;  4A9W A;  1D7Y A;  2V3B A;  4NEW A;  4TLZ A;  2BK5 A;  3RP6 A;  2B7S A;  2QCU A;  4NZH A;  5HYM A;  1COY A;  2YLZ A;  1KDG A;  3AEF A;  3CTY A;  3OZ2 A;  4GUV A;  1IJH A;  3P4S A;  2CVJ A;  1YQ3 A;  1PJ6 A;  3GDP A;  5BVA A;  3AEB A;  3LJP A;  2YLX A;  4U8I A;  1GRE A;  4X4J A;  4YTP A;  4UP3 A;  1OJA A;  2VQB A;  2XLU A;  5IQ1 A;  4EQS A;  1LQU A;  2TPR A;  1O95 A;  4OVI A;  1YQZ A;  2YR4 A;  4J36 A;  1GSN A;  3UP4 A;  3B6D A;  4ZN0 A;  2ZZB A;  3AE4 A;  1DXL A;  3G5Q A;  3AE2 A;  3H4K A;  1CBO A;  1F3P A;  3AEA A;  1M64 A;  4J31 A;  1DNC A;  2VVL G;  1D7L A;  3LZW A;  2XFO A;  2WU5 A;  1VRQ B;  2WPF A;  1F8W A;  2EQ7 A;  3K7T A;  4BV6 A;  1JOA A;  1P2H A;  3AEE A;  2XVI A;  2C66 A;  3LZX A;  4TM1 A;  2WOI A;  4EMW A;  2GR0 A; 
#chains in the Genus database with same CATH topology
 4OPG A;  2C4C A;  1DJN A;  3AWI A;  4G6H A;  1NG4 A;  1PBD A;  1PBC A;  3DME A;  2VRL A;  1N4U A;  3AD7 B;  4A6N B;  3NRN A;  2HQM A;  3SFD A;  1PXC A;  4IA5 A;  4YWO A;  2FJB A;  1OJT A;  1ZKQ A;  5BRT A;  4ZCC A;  3ZYX A;  1DJQ A;  2OA1 A;  4G6G A;  4YTM A;  2R0P A;  3BHF A;  3S5W A;  4EQW A;  4E0V A;  3AXB A;  1VDC A;  4K7Z A;  2V61 A;  1BZL A;  4KX6 A;  2XFN A;  4H4X A;  4USQ A;  1EL9 A;  4A6N A;  2C65 A;  3RP7 A;  3CNJ A;  1EL8 A;  1Y56 A;  3IWA A;  3CPJ G;  4H4T A;  4J56 A;  1GRB A;  3BNM A;  4II2 A;  1D4D A;  1GTH A;  1GEU A;  1IUU A;  4AT0 A;  1E1N A;  3DH9 A;  1KNR A;  1NAA A;  4AOS A;  2RAB A;  2V3A A;  4K2X A;  2B9W A;  2X99 A;  4C3Y A;  5JCL A;  1NHP A;  3UKL A;  1PBE A;  1W4X A;  2C7G A;  2GEW A;  3IF9 A;  1GPE A;  4J57 A;  4MJW A;  1LTX R;  1UKV G;  2GR2 A;  4CBQ A;  4FK1 C;  4JN9 A;  3NN6 X;  3KKJ A;  2YG7 A;  2JBV A;  4BK2 A;  3VRD B;  3VR8 A;  3QVR A;  4B66 A;  5HHF A;  2C75 A;  3M13 A;  1D4E A;  3UTH A;  3AE9 A;  3AE8 A;  1BKW A;  2Q6U A;  1LQT A;  2EQ8 A;  2YG6 A;  3CPH G;  3FG2 P;  3SFE A;  2F5Z A;  4H2N A;  5FS8 A;  3NK1 X;  3SM8 A;  1IUT A;  1K4Q A;  1XPQ A;  3AEC A;  3CN8 A;  4K22 A;  3SQP A;  4YSY A;  1RYI A;  4D04 A;  2JB1 A;  1FL2 A;  2ZZC A;  2WDQ A;  3NNE A;  2WPC A;  3VQR A;  3G5S A;  1ZY8 A;  4CCR A;  2XYO A;  4IA6 A;  2R4J A;  4B68 A;  3KPF A;  3GSI A;  2B76 A;  3PVC A;  3UTF A;  4GDP A;  2YR6 A;  2B7R A;  5FMH A;  4XXG A;  1GES A;  1RSG A;  5IPY A;  3T2K A;  1YQ4 A;  2BXR A;  3AE5 A;  1FEB A;  2BCP A;  2WDV A;  1IUW A;  3D8X A;  3QJ4 A;  1K0J A;  4G9K A;  1L0V A;  3C4A A;  4OPD A;  3SX6 A;  3SXI A;  3UOX A;  5KOW A;  2V60 A;  4M52 A;  1B37 A;  1IUV A;  2VRM A;  2WP6 A;  2O9Z A;  1NEN A;  1CF3 A;  4XWR A;  2BC1 A;  3RNM A;  3RHA A;  1F6M A;  1JRY A;  4BUR A;  4U2L A;  4U2T A;  4OPU A;  3UKK A;  2Q0K A;  2BCG G;  3ISH A;  2PYX A;  2Z5X A;  4GR1 A;  1LPF A;  3SZW A;  4EM3 A;  5EBK A;  1X31 B;  1TDE A;  1TDN A;  4YSH A;  2E1M A;  4Z25 A;  1CC2 A;  4Z2T A;  2A8X A;  3HZL A;  2JB2 A;  3T14 A;  2GF3 A;  1PJ7 A;  3CPI G;  1ZX9 A;  1GRH A;  1K0L A;  1PHH A;  4IVO B;  2IVE A;  1TRB A;  2YLS A;  2VOU A;  1OJD A;  4OPI A;  5CKU A;  4J2W A;  4JNQ A;  4KPR A;  4C74 A;  5KOX A;  1JNR A;  1N4W A;  2GV8 A;  2GRT A;  1GAL A;  4Y4L A;  3EPT A;  4O5U A;  1B8S A;  1PXB A;  1Q1W A;  4EM4 A;  2BS2 A;  1D5T A;  5KVI A;  4CCQ A;  5IQ4 A;  3P4Q A;  1ZK7 A;  1GRF A;  4LU6 A;  4FK1 A;  1E1M A;  5JCK A;  1YY5 A;  1CJ3 A;  2NPX A;  3HYX A;  3UKH A;  2GB0 A;  3B3R A;  2WOW A;  3DK9 A;  1H81 A;  3KVE A;  3NIX A;  3PO7 A;  2GR1 A;  3AE6 A;  2X3N A;  2I0Z A;  4NNJ A;  1KNP A;  3BI2 A;  2YVF A;  4K5R A;  1E1K A;  1PDH A;  3IHM A;  5KMQ A;  1B5Q A;  1H84 A;  1S2Q A;  4XWZ A;  3EAN A;  4ZCD A;  1RP0 A;  4EIP A;  4OPL A;  3T2Z A;  4B69 A;  4B64 A;  3NK0 X;  4Z26 A;  1GV4 A;  3AE1 A;  1ZOY A;  3ALJ A;  4A99 A;  4D03 A;  3M12 A;  3ADA B;  3KD9 A;  3P1W A;  3UTE A;  4EQX A;  1ZMC A;  2H89 A;  4YSX A;  1KSS A;  4B65 A;  3UKP A;  2YG5 A;  4X9N A;  2YLR A;  1NEK A;  4OPT A;  1N4V A;  5J7X A;  3T0K A;  3QSE A;  4Z2R A;  4NWZ A;  3ATQ A;  3GYI A;  3KA7 A;  3AE3 A;  2ZZ0 A;  3QSM A;  1TYT A;  2WBA A;  4U8J A;  1ZMD A;  2YG4 A;  2WQY A;  1EL7 A;  1KFY A;  1HYU A;  1GER A;  1Y56 B;  2E4G A;  3GMC A;  4U8L A;  4G74 A;  4AOX A;  3ITJ A;  1F8R A;  4WCT A;  4EIQ A;  2XCG A;  2GH5 A;  3PS9 A;  1ZDL A;  2DKH A;  3LXD A;  1H83 A;  1S3E A;  3SY4 A;  3C4N A;  2TMD A;  3CGD A;  4H4U A;  4H4Q A;  5JCN A;  1QLB A;  3CGC A;  4USR A;  1EBD A;  4YKG A;  4ECH A;  2YG3 A;  2XVF A;  1AOG A;  3AYL A;  4EMI A;  2FJA A;  4JY3 A;  2VZ2 A;  2R4E A;  4U8M A;  5KMP A;  1ELI A;  3GWF A;  2J3N A;  1P2E A;  3CIR A;  1GT8 A;  3NH3 X;  3DGZ A;  4Z44 A;  4UDR A;  1D4C A;  1TYP A;  4NTD A;  3IHG A;  4CRT A;  2JB3 A;  3AB1 A;  2B9X A;  4ICY A;  1KSU A;  2C64 A;  3DGH A;  3UOZ A;  1PXA A;  2GR3 A;  2X8C A;  1FOH A;  1GND A;  2YLT A;  3JSK A;  1LV0 A;  2WP9 A;  2XLR A;  3BI5 A;  3FIM B;  4AT2 A;  3FBS A;  2ZBW A;  2VVM A;  5HY5 A;  5ER0 A;  3C96 A;  1L9C A;  2R9Z A;  5EB5 A;  5KWF A;  1IUS A;  1VQW A;  2VVL A;  4PAA A;  4TM0 A;  1GXF A;  3ATR A;  4GRT A;  4LII A;  2C3D A;  3NYC A;  1MO9 A;  4YTN A;  1H82 A;  1KF6 A;  5U25 A;  5FS6 A;  1QO8 A;  2AR8 A;  2QA2 A;  3FPZ A;  4JDR A;  1JRX A;  5U1O A;  2YQU A;  2BXS A;  2BK3 A;  2A87 A;  2E5V A;  1NHR A;  2WET A;  4WX1 A;  2GMJ A;  1FCD A;  1ZOV A;  3S61 A;  2OAL A;  2RGJ A;  3ICT A;  3VRA A;  3Q6J A;  2XLP A;  3BI4 A;  1Q1R A;  2OLN A;  2VQ7 A;  3QVP A;  1PBB A;  4Z24 A;  3ALL A;  1FEA A;  1LJ1 A;  3NKS A;  1NDA A;  3Q9T A;  1NHQ A;  2DKI A;  3AYJ A;  2JK6 A;  4U8K A;  4RG3 A;  4Z43 A;  3LB8 A;  4GF7 A;  5JCI A;  1EL5 A;  2FJE A;  2XFQ A;  1V59 A;  2AQJ A;  3GD4 A;  3COX A;  1FEC A;  4YXD A;  4Z2U A;  1Y0P A;  2R45 A;  3KPK A;  3UCL A;  4EMJ A;  5J60 A;  1IUX A;  2YM1 A;  3T2Y A;  1DOE A;  1OJ9 A;  3NN0 X;  3NYE A;  2R0C A;  5JCM A;  5M10 A;  4H2R A;  4J33 A;  1K0I A;  2XVE A;  2BRY A;  2C73 A;  2ACZ A;  2GMH A;  1BGN A;  2WES A;  1XDI A;  2YR5 A;  3I6D A;  4RG4 A;  5EB4 A;  2V6O A;  5FS9 A;  2XFP A;  3UKQ A;  5LV9 A;  2BA9 A;  3K7M X;  1B4V A;  4RSL A;  3RED A;  2YWL A;  5KNL A;  2BAC A;  1M6I A;  4JY2 A;  4C77 A;  2YM2 A;  2H88 A;  3GYX A;  4Y4N A;  3DA1 A;  1H7W A;  4BJY A;  2BAB A;  2V5Z A;  4OCG A;  3EF6 A;  1GRT A;  1PS9 A;  1H6V A;  2Z5Y A;  3SZF A;  3ZDN A;  2X50 A;  3AEG A;  3URH A;  4A7A A;  4YT0 A;  2Q7V A;  4REK A;  3KLJ A;  1TDO A;  2XDO A;  3DK4 A;  5KXJ A;  5GRT A;  3GWD A;  4U2S A;  2FJD A;  3HYW A;  3H8I A;  1NHS A;  3NGC X;  5U63 A;  2IVD A;  2Q0L A;  3V3N A;  3UTG A;  1PN0 A;  4LA1 A;  3RP8 A;  2JKC A;  3GMB A;  4GDE A;  4HB9 A;  1GRA A;  3M0O A;  4DNA A;  4BK3 A;  1DOD A;  3SZC A;  1F8S A;  1E1L A;  2C67 A;  4P9S A;  5C3J A;  2APG A;  4HA6 A;  2UZZ A;  4C5O A;  5BUK A;  4H4W A;  3QFB A;  2GQF A;  1GET A;  3SGL A;  1E39 A;  1CJ4 A;  1YKJ A;  4H2P A;  1MXT A;  2CFY A;  3K7Q X;  1BF3 A;  2X8H A;  4H4R A;  3P9U A;  4J34 A;  1CJ2 A;  3CNS A;  2WHD A;  5KRQ A;  4O5Q A;  1GTE A;  3HYV A;  4YSZ A;  4AP1 A;  3L8K A;  1VG9 A;  1XAN A;  3DJD A;  3ALM A;  3NTD A;  1LVL A;  4CY8 A;  3DJE A;  1REO A;  3LAD A;  1JU2 A;  3BNU A;  3CNP A;  4H4Z A;  3ICS A;  5KVH A;  3UKF A;  4U8O A;  3UP5 A;  2OLO A;  2XLT A;  4NEV A;  3SZ0 A;  1Z6L A;  1O94 A;  5C2T A;  3DJJ A;  3NLC A;  1NG3 A;  2XVH A;  1PBF A;  3E1T A;  1OJC A;  2GAH B;  4B1B A;  4A5L A;  5KMR A;  1E7P A;  3F8P A;  3FMW A;  1CC6 A;  4X9M A;  3IC9 A;  4U8N A;  4C3X A;  2C70 A;  5FS7 A;  4N9X A;  1Q9I A;  2BS4 A;  2YAU A;  4A65 A;  4DSG A;  1JEH A;  2CDU A;  4YKF A;  2OAM A;  2PHH A;  4IVM B;  4UDP A;  5EOW A;  4APN A;  1S3B A;  2GAG B;  2WU2 A;  3GDN A;  4GCM A;  1SEZ A;  4FDC B;  2Y6R A;  3NTA A;  2B9Y A;  1ONF A;  2WS3 A;  3OC4 A;  2XLS A;  4OPC A;  2YVG A;  1NPX A;  2GQW A;  2NVK X;  2WEU A;  4G73 A;  4JNA A;  1DOC A;  1N1P A;  3T31 A;  3AE7 A;  3KU9 A;  4H4Y A;  4EQR A;  2BK4 A;  3WE0 A;  4I59 A;  2R46 A;  1GRG A;  2W0H A;  4B67 A;  3V76 A;  3LOV A;  3D1C A;  1H86 A;  3AD8 B;  3EAO A;  3GRT A;  2ARD A;  2Y6Q A;  3ABV A;  3NHO X;  4K8D A;  2XVJ A;  5BUL A;  2WPE A;  2CUL A;  1ZP0 A;  4BJZ A;  1TDK A;  2EQ9 A;  1O5W A;  3P4R A;  2C72 A;  3CGE A;  4H4V A;  5TR3 A;  2WP5 A;  4PAB A;  3DJG X;  4AP3 A;  1PJ5 A;  1CHU A;  3VRB A;  2YVJ A;  3NG7 X;  3K30 A;  2C76 A;  3AED A;  4H4S A;  1GOS A;  4I58 A;  1QJD A;  2BS3 A;  3L1R A;  3NT6 A;  3NK2 X;  3G5R A;  4JQ9 A;  1CL0 A;  3GYJ A;  4CY6 A;  1BGJ A;  4H2Q A;  3VR9 A;  1DOB A;  4H4P A;  3CGB A;  4H7U A;  2C3C A;  1JRZ A;  3CND A;  4ADW A;  4BK1 A;  4IV9 A;  4DGK A;  3O0H A;  4TM3 A;  1CC4 A;  5GSN A;  4NTC A;  4H50 A;  1VG0 A;  3GD3 A;  1L9E A;  2QA1 A;  5DBJ A;  2JAE A;  4FX9 A;  2IID A;  4K5S A;  2RGO A;  3CNT A;  2YLW A;  4A79 A;  2GVC A;  5KMS A;  3F8R A;  4DSH A;  2BRA A;  3AD9 B;  1XHC A;  2WDR A;  3F8D A;  1E6E A;  2XFU A;  4TLX A;  3I3L A;  5M0Z A;  3T37 A;  2FBW A;  3BHK A;  5CQF A;  3QFA A;  3NYF A;  3II4 A;  5HXI A;  2RGH A;  1L9D A;  1S2Y A;  3UOY A;  4Y4M A;  3V3O A;  1CJC A;  2A89 A;  4B63 A;  1JNZ A;  3GRS A;  1BWC A;  4CNK A;  5L46 A;  2AAQ A;  3AYI A;  1TDF A;  4TM4 A;  4U8P A;  2X8G A;  2BYB A;  4CNJ A;  3SYI A;  3UKA A;  3QSS A;  1H7X A;  2EQ6 A;  2QAE A;  4UDQ A;  3H8L A;  3ICR A;  2BC0 A;  3UOV A;  3P4P A;  3R9U A;  4NTE A;  4GAV A;  2R0G A;  1MOK A;  2WOV A;  3DK8 A;  4A9W A;  1D7Y A;  2V3B A;  4GAP A;  4NEW A;  4TLZ A;  2BK5 A;  3RP6 A;  2B7S A;  2QCU A;  4NZH A;  5HYM A;  1COY A;  2YLZ A;  1KDG A;  3AEF A;  3CTY A;  3OZ2 A;  4GUV A;  4II3 A;  1IJH A;  3P4S A;  2CVJ A;  1YQ3 A;  1PJ6 A;  3CMM A;  3GDP A;  5BVA A;  3AEB A;  3LJP A;  2YLX A;  4U8I A;  1GRE A;  4X4J A;  4YTP A;  4UP3 A;  1OJA A;  2VQB A;  2XLU A;  5IQ1 A;  4EQS A;  1LQU A;  2TPR A;  1O95 A;  4OVI A;  1YQZ A;  2YR4 A;  4J36 A;  1GSN A;  3UP4 A;  3B6D A;  4ZN0 A;  2ZZB A;  3AE4 A;  1DXL A;  3G5Q A;  3AE2 A;  3H4K A;  1CBO A;  1F3P A;  3AEA A;  1M64 A;  4J31 A;  1DNC A;  2VVL G;  1D7L A;  3LZW A;  2XFO A;  2WU5 A;  1VRQ B;  2WPF A;  1F8W A;  2EQ7 A;  3K7T A;  4BV6 A;  1JOA A;  1P2H A;  3AEE A;  2XVI A;  2C66 A;  3LZX A;  4TM1 A;  2WOI A;  4EMW A;  2GR0 A; 
#chains in the Genus database with same CATH homology
 4OPG A;  2C4C A;  1DJN A;  3AWI A;  4G6H A;  1NG4 A;  1PBD A;  1PBC A;  3DME A;  2VRL A;  1N4U A;  3AD7 B;  4A6N B;  3NRN A;  2HQM A;  3SFD A;  1PXC A;  4IA5 A;  4YWO A;  2FJB A;  1OJT A;  1ZKQ A;  5BRT A;  4ZCC A;  3ZYX A;  1DJQ A;  2OA1 A;  4G6G A;  4YTM A;  2R0P A;  3BHF A;  3S5W A;  4EQW A;  4E0V A;  3AXB A;  1VDC A;  4K7Z A;  2V61 A;  1BZL A;  4KX6 A;  2XFN A;  4H4X A;  4USQ A;  1EL9 A;  4A6N A;  2C65 A;  3RP7 A;  3CNJ A;  1EL8 A;  1Y56 A;  3IWA A;  3CPJ G;  4H4T A;  4J56 A;  1GRB A;  3BNM A;  4II2 A;  1D4D A;  1GTH A;  1GEU A;  1IUU A;  4AT0 A;  1E1N A;  3DH9 A;  1KNR A;  1NAA A;  4AOS A;  2RAB A;  2V3A A;  4K2X A;  2B9W A;  2X99 A;  4C3Y A;  5JCL A;  1NHP A;  3UKL A;  1PBE A;  1W4X A;  2C7G A;  2GEW A;  3IF9 A;  1GPE A;  4J57 A;  4MJW A;  1LTX R;  1UKV G;  2GR2 A;  4CBQ A;  4FK1 C;  4JN9 A;  3NN6 X;  3KKJ A;  2YG7 A;  2JBV A;  4BK2 A;  3VRD B;  3VR8 A;  3QVR A;  4B66 A;  5HHF A;  2C75 A;  3M13 A;  1D4E A;  3UTH A;  3AE9 A;  3AE8 A;  1BKW A;  2Q6U A;  1LQT A;  2EQ8 A;  2YG6 A;  3CPH G;  3FG2 P;  3SFE A;  2F5Z A;  4H2N A;  5FS8 A;  3NK1 X;  3SM8 A;  1IUT A;  1K4Q A;  1XPQ A;  3AEC A;  3CN8 A;  4K22 A;  3SQP A;  4YSY A;  1RYI A;  4D04 A;  2JB1 A;  1FL2 A;  2ZZC A;  2WDQ A;  3NNE A;  2WPC A;  3VQR A;  3G5S A;  1ZY8 A;  4CCR A;  2XYO A;  4IA6 A;  2R4J A;  4B68 A;  3KPF A;  3GSI A;  2B76 A;  3PVC A;  3UTF A;  4GDP A;  2YR6 A;  2B7R A;  5FMH A;  4XXG A;  1GES A;  1RSG A;  5IPY A;  3T2K A;  1YQ4 A;  2BXR A;  3AE5 A;  1FEB A;  2BCP A;  2WDV A;  1IUW A;  3D8X A;  3QJ4 A;  1K0J A;  4G9K A;  1L0V A;  3C4A A;  4OPD A;  3SX6 A;  3SXI A;  3UOX A;  5KOW A;  2V60 A;  4M52 A;  1B37 A;  1IUV A;  2VRM A;  2WP6 A;  2O9Z A;  1NEN A;  1CF3 A;  4XWR A;  2BC1 A;  3RNM A;  3RHA A;  1F6M A;  1JRY A;  4BUR A;  4U2L A;  4U2T A;  4OPU A;  3UKK A;  2Q0K A;  2BCG G;  3ISH A;  2PYX A;  2Z5X A;  4GR1 A;  1LPF A;  3SZW A;  4EM3 A;  5EBK A;  1X31 B;  1TDE A;  1TDN A;  4YSH A;  2E1M A;  4Z25 A;  1CC2 A;  4Z2T A;  2A8X A;  3HZL A;  2JB2 A;  3T14 A;  2GF3 A;  1PJ7 A;  3CPI G;  1ZX9 A;  1GRH A;  1K0L A;  1PHH A;  4IVO B;  2IVE A;  1TRB A;  2YLS A;  2VOU A;  1OJD A;  4OPI A;  5CKU A;  4J2W A;  4JNQ A;  4KPR A;  4C74 A;  5KOX A;  1JNR A;  1N4W A;  2GV8 A;  2GRT A;  1GAL A;  4Y4L A;  3EPT A;  4O5U A;  1B8S A;  1PXB A;  1Q1W A;  4EM4 A;  2BS2 A;  1D5T A;  5KVI A;  4CCQ A;  5IQ4 A;  3P4Q A;  1ZK7 A;  1GRF A;  4LU6 A;  4FK1 A;  1E1M A;  5JCK A;  1YY5 A;  1CJ3 A;  2NPX A;  3HYX A;  3UKH A;  2GB0 A;  3B3R A;  2WOW A;  3DK9 A;  1H81 A;  3KVE A;  3NIX A;  3PO7 A;  2GR1 A;  3AE6 A;  2X3N A;  2I0Z A;  4NNJ A;  1KNP A;  3BI2 A;  2YVF A;  4K5R A;  1E1K A;  1PDH A;  3IHM A;  5KMQ A;  1B5Q A;  1H84 A;  1S2Q A;  4XWZ A;  3EAN A;  4ZCD A;  1RP0 A;  4EIP A;  4OPL A;  3T2Z A;  4B69 A;  4B64 A;  3NK0 X;  4Z26 A;  1GV4 A;  3AE1 A;  1ZOY A;  3ALJ A;  4A99 A;  4D03 A;  3M12 A;  3ADA B;  3KD9 A;  3P1W A;  3UTE A;  4EQX A;  1ZMC A;  2H89 A;  4YSX A;  1KSS A;  4B65 A;  3UKP A;  2YG5 A;  4X9N A;  2YLR A;  1NEK A;  4OPT A;  1N4V A;  5J7X A;  3T0K A;  3QSE A;  4Z2R A;  4NWZ A;  3ATQ A;  3GYI A;  3KA7 A;  3AE3 A;  2ZZ0 A;  3QSM A;  1TYT A;  2WBA A;  4U8J A;  1ZMD A;  2YG4 A;  2WQY A;  1EL7 A;  1KFY A;  1HYU A;  1GER A;  1Y56 B;  2E4G A;  3GMC A;  4U8L A;  4G74 A;  4AOX A;  3ITJ A;  1F8R A;  4WCT A;  4EIQ A;  2XCG A;  2GH5 A;  3PS9 A;  1ZDL A;  2DKH A;  3LXD A;  1H83 A;  1S3E A;  3SY4 A;  3C4N A;  2TMD A;  3CGD A;  4H4U A;  4H4Q A;  5JCN A;  1QLB A;  3CGC A;  4USR A;  1EBD A;  4YKG A;  4ECH A;  2YG3 A;  2XVF A;  1AOG A;  3AYL A;  4EMI A;  2FJA A;  4JY3 A;  2VZ2 A;  2R4E A;  4U8M A;  5KMP A;  1ELI A;  3GWF A;  2J3N A;  1P2E A;  3CIR A;  1GT8 A;  3NH3 X;  3DGZ A;  4Z44 A;  4UDR A;  1D4C A;  1TYP A;  4NTD A;  3IHG A;  4CRT A;  2JB3 A;  3AB1 A;  2B9X A;  4ICY A;  1KSU A;  2C64 A;  3DGH A;  3UOZ A;  1PXA A;  2GR3 A;  2X8C A;  1FOH A;  1GND A;  2YLT A;  3JSK A;  1LV0 A;  2WP9 A;  2XLR A;  3BI5 A;  3FIM B;  4AT2 A;  3FBS A;  2ZBW A;  2VVM A;  5HY5 A;  5ER0 A;  3C96 A;  1L9C A;  2R9Z A;  5EB5 A;  5KWF A;  1IUS A;  1VQW A;  2VVL A;  4PAA A;  4TM0 A;  1GXF A;  3ATR A;  4GRT A;  4LII A;  2C3D A;  3NYC A;  1MO9 A;  4YTN A;  1H82 A;  1KF6 A;  5U25 A;  5FS6 A;  1QO8 A;  2AR8 A;  2QA2 A;  3FPZ A;  4JDR A;  1JRX A;  5U1O A;  2YQU A;  2BXS A;  2BK3 A;  2A87 A;  2E5V A;  1NHR A;  2WET A;  4WX1 A;  2GMJ A;  1FCD A;  1ZOV A;  3S61 A;  2OAL A;  2RGJ A;  3ICT A;  3VRA A;  3Q6J A;  2XLP A;  3BI4 A;  1Q1R A;  2OLN A;  2VQ7 A;  3QVP A;  1PBB A;  4Z24 A;  3ALL A;  1FEA A;  1LJ1 A;  3NKS A;  1NDA A;  3Q9T A;  1NHQ A;  2DKI A;  3AYJ A;  2JK6 A;  4U8K A;  4RG3 A;  4Z43 A;  3LB8 A;  4GF7 A;  5JCI A;  1EL5 A;  2FJE A;  2XFQ A;  1V59 A;  2AQJ A;  3GD4 A;  3COX A;  1FEC A;  4YXD A;  4Z2U A;  1Y0P A;  2R45 A;  3KPK A;  3UCL A;  4EMJ A;  5J60 A;  1IUX A;  2YM1 A;  3T2Y A;  1DOE A;  1OJ9 A;  3NN0 X;  3NYE A;  2R0C A;  5JCM A;  5M10 A;  4H2R A;  4J33 A;  1K0I A;  2XVE A;  2BRY A;  2C73 A;  2ACZ A;  2GMH A;  1BGN A;  2WES A;  1XDI A;  2YR5 A;  3I6D A;  4RG4 A;  5EB4 A;  2V6O A;  5FS9 A;  2XFP A;  3UKQ A;  5LV9 A;  2BA9 A;  3K7M X;  1B4V A;  4RSL A;  3RED A;  2YWL A;  5KNL A;  2BAC A;  1M6I A;  4JY2 A;  4C77 A;  2YM2 A;  2H88 A;  3GYX A;  4Y4N A;  3DA1 A;  1H7W A;  4BJY A;  2BAB A;  2V5Z A;  4OCG A;  3EF6 A;  1GRT A;  1PS9 A;  1H6V A;  2Z5Y A;  3SZF A;  3ZDN A;  2X50 A;  3AEG A;  3URH A;  4A7A A;  4YT0 A;  2Q7V A;  4REK A;  3KLJ A;  1TDO A;  2XDO A;  3DK4 A;  5KXJ A;  5GRT A;  3GWD A;  4U2S A;  2FJD A;  3HYW A;  3H8I A;  1NHS A;  3NGC X;  5U63 A;  2IVD A;  2Q0L A;  3V3N A;  3UTG A;  1PN0 A;  4LA1 A;  3RP8 A;  2JKC A;  3GMB A;  4GDE A;  4HB9 A;  1GRA A;  3M0O A;  4DNA A;  4BK3 A;  1DOD A;  3SZC A;  1F8S A;  1E1L A;  2C67 A;  4P9S A;  5C3J A;  2APG A;  4HA6 A;  2UZZ A;  4C5O A;  5BUK A;  4H4W A;  3QFB A;  2GQF A;  1GET A;  3SGL A;  1E39 A;  1CJ4 A;  1YKJ A;  4H2P A;  1MXT A;  2CFY A;  3K7Q X;  1BF3 A;  2X8H A;  4H4R A;  3P9U A;  4J34 A;  1CJ2 A;  3CNS A;  2WHD A;  5KRQ A;  4O5Q A;  1GTE A;  3HYV A;  4YSZ A;  4AP1 A;  3L8K A;  1VG9 A;  1XAN A;  3DJD A;  3ALM A;  3NTD A;  1LVL A;  4CY8 A;  3DJE A;  1REO A;  3LAD A;  1JU2 A;  3BNU A;  3CNP A;  4H4Z A;  3ICS A;  5KVH A;  3UKF A;  4U8O A;  3UP5 A;  2OLO A;  2XLT A;  4NEV A;  3SZ0 A;  1Z6L A;  1O94 A;  5C2T A;  3DJJ A;  3NLC A;  1NG3 A;  2XVH A;  1PBF A;  3E1T A;  1OJC A;  2GAH B;  4B1B A;  4A5L A;  5KMR A;  1E7P A;  3F8P A;  3FMW A;  1CC6 A;  4X9M A;  3IC9 A;  4U8N A;  4C3X A;  2C70 A;  5FS7 A;  4N9X A;  1Q9I A;  2BS4 A;  2YAU A;  4A65 A;  4DSG A;  1JEH A;  2CDU A;  4YKF A;  2OAM A;  2PHH A;  4IVM B;  4UDP A;  5EOW A;  4APN A;  1S3B A;  2GAG B;  2WU2 A;  3GDN A;  4GCM A;  1SEZ A;  4FDC B;  2Y6R A;  3NTA A;  2B9Y A;  1ONF A;  2WS3 A;  3OC4 A;  2XLS A;  4OPC A;  2YVG A;  1NPX A;  2GQW A;  2NVK X;  2WEU A;  4G73 A;  4JNA A;  1DOC A;  1N1P A;  3T31 A;  3AE7 A;  3KU9 A;  4H4Y A;  4EQR A;  2BK4 A;  3WE0 A;  4I59 A;  2R46 A;  1GRG A;  2W0H A;  4B67 A;  3V76 A;  3LOV A;  3D1C A;  1H86 A;  3AD8 B;  3EAO A;  3GRT A;  2ARD A;  2Y6Q A;  3ABV A;  3NHO X;  4K8D A;  2XVJ A;  5BUL A;  2WPE A;  2CUL A;  1ZP0 A;  4BJZ A;  1TDK A;  2EQ9 A;  1O5W A;  3P4R A;  2C72 A;  3CGE A;  4H4V A;  5TR3 A;  2WP5 A;  4PAB A;  3DJG X;  4AP3 A;  1PJ5 A;  1CHU A;  3VRB A;  2YVJ A;  3NG7 X;  3K30 A;  2C76 A;  3AED A;  4H4S A;  1GOS A;  4I58 A;  1QJD A;  2BS3 A;  3L1R A;  3NT6 A;  3NK2 X;  3G5R A;  4JQ9 A;  1CL0 A;  3GYJ A;  4CY6 A;  1BGJ A;  4H2Q A;  3VR9 A;  1DOB A;  4H4P A;  3CGB A;  4H7U A;  2C3C A;  1JRZ A;  3CND A;  4ADW A;  4BK1 A;  4IV9 A;  4DGK A;  3O0H A;  4TM3 A;  1CC4 A;  5GSN A;  4NTC A;  4H50 A;  1VG0 A;  3GD3 A;  1L9E A;  2QA1 A;  5DBJ A;  2JAE A;  4FX9 A;  2IID A;  4K5S A;  2RGO A;  3CNT A;  2YLW A;  4A79 A;  2GVC A;  5KMS A;  3F8R A;  4DSH A;  2BRA A;  3AD9 B;  1XHC A;  2WDR A;  3F8D A;  1E6E A;  2XFU A;  4TLX A;  3I3L A;  5M0Z A;  3T37 A;  2FBW A;  3BHK A;  5CQF A;  3QFA A;  3NYF A;  3II4 A;  5HXI A;  2RGH A;  1L9D A;  1S2Y A;  3UOY A;  4Y4M A;  3V3O A;  1CJC A;  2A89 A;  4B63 A;  1JNZ A;  3GRS A;  1BWC A;  4CNK A;  5L46 A;  2AAQ A;  3AYI A;  1TDF A;  4TM4 A;  4U8P A;  2X8G A;  2BYB A;  4CNJ A;  3SYI A;  3UKA A;  3QSS A;  1H7X A;  2EQ6 A;  2QAE A;  4UDQ A;  3H8L A;  3ICR A;  2BC0 A;  3UOV A;  3P4P A;  3R9U A;  4NTE A;  4GAV A;  2R0G A;  1MOK A;  2WOV A;  3DK8 A;  4A9W A;  1D7Y A;  2V3B A;  4GAP A;  4NEW A;  4TLZ A;  2BK5 A;  3RP6 A;  2B7S A;  2QCU A;  4NZH A;  5HYM A;  1COY A;  2YLZ A;  1KDG A;  3AEF A;  3CTY A;  3OZ2 A;  4GUV A;  4II3 A;  1IJH A;  3P4S A;  2CVJ A;  1YQ3 A;  1PJ6 A;  3CMM A;  3GDP A;  5BVA A;  3AEB A;  3LJP A;  2YLX A;  4U8I A;  1GRE A;  4X4J A;  4YTP A;  4UP3 A;  1OJA A;  2VQB A;  2XLU A;  5IQ1 A;  4EQS A;  1LQU A;  2TPR A;  1O95 A;  4OVI A;  1YQZ A;  2YR4 A;  4J36 A;  1GSN A;  3UP4 A;  3B6D A;  4ZN0 A;  2ZZB A;  3AE4 A;  1DXL A;  3G5Q A;  3AE2 A;  3H4K A;  1CBO A;  1F3P A;  3AEA A;  1M64 A;  4J31 A;  1DNC A;  2VVL G;  1D7L A;  3LZW A;  2XFO A;  2WU5 A;  1VRQ B;  2WPF A;  1F8W A;  2EQ7 A;  3K7T A;  4BV6 A;  1JOA A;  1P2H A;  3AEE A;  2XVI A;  2C66 A;  3LZX A;  4TM1 A;  2WOI A;  4EMW A;  2GR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...