3F8PA

Structure of sulfolobus solfataricus trxr-b3
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
307
Chain Sequence
VKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENEFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVCDAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase (TrxB-3)
publication title Structure and stability of a thioredoxin reductase from Sulfolobus solfataricus: a thermostable protein with two functions
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 102
structure length 307
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.6.4.5: Transferred entry: 1.8.1.9.
pdb deposition date 2008-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8pA02
3ZYXA 2RGOA 1NG3A 1FCDA 2GAGB 1IUVA 1DOBA 1EL5A 4EQRA 2WP5A 3ALLA 3P4SA 4A6NA 3NYEA 3F8RA 1NHRA 1HYUA 2YG3A 2XVIA 2C75A 2VRLA 1AOGA 2JKCA 3NKSA 1TDOA 3B3RA 5JCKA 3QVPA 5KWFA 3V76A 1B37A 4BJYA 2B9YA 2R0CA 4JQ9A 2BK3A 4C3XA 2VZ2A 1QJDA 2WU5A 4TM0A 2XVFA 3UKFA 1LVLA 3GD3A 3AEDA 5EBKA 4KPRA 3QSSA 1L9EA 4IA5A 2XYOA 3AWIA 3ABVA 2WETA 5IQ1A 4IVOB 4YTPA 1E1LA 3NHOX 1EL9A 2YLTA 3S5WA 4CBQA 5FS9A 3NH3X 4EMWA 4H4RA 1BGNA 3AE2A 1GRAA 1YQ4A 1K0IA 1Y56A 2APGA 2ZBWA 2BK4A 3ZDNA 1N1PA 4C5OA 2WU2A 1COYA 2RGJA 3ALMA 3CGEA 4Z2TA 1QO8A 5GRTA 5BUKA 1PBEA 3P4RA 4U2SA 3K7QX 2VVLA 1GEUA 2XVHA 4J33A 4RG4A 1JRYA 3CNDA 1ZP0A 3AD7B 5EOWA 3RP8A 1CHUA 3AE4A 4ADWA 3BI5A 4P9SA 2H88A 2BC1A 4O5UA 1ZMCA 1GXFA 4EIQA 1E1NA 3CNTA 1REOA 4A9WA 1H83A 2X50A 3NTAA 2JBVA 2WDRA 1ONFA 2GVCA 4DNAA 2GMJA 2YAUA 4B67A 1D7LA 3DGHA 4UDQA 2XFUA 4UP3A 1EBDA 1CC6A 1BWCA 3UOZA 2EQ7A 1S3EA 4CY6A 2YG7A 2GV8A 4NTEA 5IQ4A 1JOAA 3PS9A 2A8XA 4NZHA 4U8MA 2YLRA 3QJ4A 1KNPA 4X9MA 2FJDA 2Z5XA 2GMHA 1OJAA 4H4SA 4OPLA 3FBSA 2WDVA 2YLZA 5JCLA 3II4A 2BXSA 5C3JA 2CULA 3ITJA 2O9ZA 2WQYA 4YSHA 1O95A 2BYBA 1RSGA 1DOEA 2GR2A 2WEUA 2XVJA 2BK5A 3GYIA 4GDPA 4H4QA 4JN9A 3RHAA 3SM8A 1H6VA 2B7RA 2GR1A 3FIMB 1K0LA 2XLPA 3UKAA 1FEAA 2ACZA 3GSIA 1Q1WA 1H81A 4MJWA 4WX1A 1GRFA 3JSKA 3CPHG 1ZKQA 3IHGA 5KVIA 1IUXA 1BF3A 2C72A 2QA2A 2WPEA 1QLBA 2YLSA 2YVFA 2GQFA 1TYPA 4M52A 4A7AA 2ZZ0A 3VRAA 1DODA 4CNJA 2WHDA 2PYXA 4USQA 2YVGA 1E1MA 4K22A 5JCNA 2XLSA 3NT6A 1DNCA 1KSSA 1E1KA 3DK4A 3I3LA 4AP1A 2FJEA 3DGZA 4HA6A 4AOXA 1ZY8A 4AOSA 1GRBA 3QFBA 4H7UA 5KOXA 2XDOA 2H89A 3UCLA 4C74A 2BS4A 3P1WA 4U8IA 1GT8A 4A65A 2AQJA 3NTDA 1VG0A 1DOCA 3C96A 1Z6LA 1NHSA 5CQFA 4C3YA 4IA6A 3UOVA 1GPEA 2WP6A 2B7SA 3NK0X 3RP7A 1TDEA 2IIDA 2CDUA 2XLTA 2V5ZA 2VQBA 3GMBA 4B64A 3G5QA 4BK1A 3BI4A 4NTDA 2YR4A 4CNKA 4XWRA 4Z24A 1F6MA 4AP3A 3I6DA 1IUTA 3DJJA 2E1MA 4OVIA 1N4WA 4YKFA 2AR8A 4APNA 4YWOA 2C3CA 4D04A 1TYTA 3COXA 3FMWA 3CGBA 2C67A 4WCTA 1NAAA 4CCRA 2IVDA 1EL7A 2JB2A 4U2LA 1UKVG 2V3AA 5KVHA 1GERA 4OCGA 4GUVA 2GEWA 1X31B 2NVKX 3ISHA 5FMHA 1GNDA 3QSEA 3VRBA 4A5LA 4ECHA 3AEEA 1N4UA 2TMDA 4JY2A 4X9NA 1N4VA 4XXGA 2B76A 2ZZBA 3LZWA 2YQUA 1D5TA 1DJNA 4YTMA 4YSXA 4UDRA 2JAEA 1GOSA 4CRTA 3UOXA 4OPTA 3V3NA 1Q9IA 2XFOA 4NTCA 4TM4A 4PAAA 3SFEA 2GH5A 3DH9A 4K7ZA 2R9ZA 3PO7A 4TM1A 2WP9A 2VOUA 4K5SA 1D7YA 1CBOA 4Z26A 1IJHA 1YY5A 2R46A 4B63A 4ZCCA 1E7PA 2W0HA 1D4EA 3KA7A 2WPFA 2WDQA 4GF7A 3VRDB 3ATQA 2GQWA 1CC2A 3UKPA 1JRXA 1NDAA 2YWLA 3NN6X 3KPFA 4N9XA 4H4PA 3BNMA 1PXCA 3C4AA 4ZCDA 3OC4A 4UDPA 1E39A 2JB1A 2RABA 1GRTA 1EL8A 1IUUA 2X8GA 3ICTA 1DJQA 1MXTA 1W4XA 3P9UA 4X4JA 3M12A 2B9WA 3EF6A 3UTHA 4U8LA 4Z2RA 3AECA 3CN8A 3VQRA 2OALA 3R9UA 2R45A 3E1TA 4TLXA 1B8SA 4USRA 3UTEA 3DJGX 5FS7A 3RNMA 2JK6A 4U8JA 3CNSA 1NPXA 4JDRA 4H4YA 4AT0A 1VQWA 4H4WA 2V6OA 3GYJA 2CFYA 2RGHA 2YR6A 3BI2A 5J7XA 1GTHA 1PBBA 3AXBA 1B5QA 4Z43A 2XFNA 2X3NA 1B4VA 2YVJA 3GRTA 4J2WA 3S61A 2FJBA 1TDNA 3Q6JA 3UKHA 1JNRA 4HB9A 2YG6A 4J56A 1Y0PA 2BACA 2GF3A 4Y4NA 4YKGA 2QCUA 1XPQA 3AE1A 2XLUA 4A99A 2J3NA 5FS6A 1FEBA 3RP6A 4J34A 1JEHA 3GWFA 4CCQA 2R4JA 4EQXA 1FOHA 2V61A 1M6IA 3AYJA 1F8SA 4OPIA 3V3OA 1L0VA 1P2EA 5KOWA 4FX9A 5EB4A 1H82A 4JNQA 2OLOA 4U8KA 4A79A 4B68A 1PJ7A 1XDIA 1H84A 3H8IA 4REKA 3K7TA 4D03A 2BA9A 3T37A 2Q0KA 1PBFA 1TDKA 1KNRA 2F5ZA 2VVMA 1O94A 5TR3A 1ZK7A 4JNAA 3NG7X 4OPCA 1BKWA 4U2TA 2YM1A 2JB3A 3ICSA 3CGCA 3M13A 5GSNA 1H86A 3GDPA 4H4XA 3UKLA 1GRHA 4DGKA 4Y4MA 3KU9A 5LV9A 4TM3A 1CL0A 1LTXR 4J31A 4YSZA 1NG4A 1BGJA 2WBAA 2YG5A 3F8DA 5HYMA 4BURA 5JCIA 1GRGA 1Q1RA 3CNJA 2WESA 3CGDA 4O5QA 2YLXA 1GESA 4GRTA 5IPYA 2BCGG 3CPJG 1H7XA 3CPIG 1D4CA 3DMEA 3LOVA 2Y6QA 1F8WA 4EMIA 3IWAA 4YT0A 5L46A 4AT2A 3LB8A 2GRTA 5ER0A 3H8LA 2GR0A 3UP4A 3EANA 3UTGA 4BK3A 1K4QA 1V59A 4H2PA 3KVEA 2OAMA 5JCMA 4LU6A 1PBDA 4U8NA 3NNEA 2C7GA 4NEWA 4EM3A 4I59A 1LJ1A 1OJCA 3GDNA 4Y4LA 2TPRA 3KKJA 3NK2X 1TRBA 4CY8A 3SFDA 1H7WA 3L8KA 2YG4A 3F8PA 2C70A 2ZZCA 2BXRA 3PVCA 4H4VA 1O5WA 4I58A 4TLZA 4IV9A 3IC9A 1FL2A 1ZMDA 1VRQB 2FJAA 2OA1A 3L1RA 5U25A 4A6NB 4B66A 1NHPA 3IHMA 3CNPA 1E6EA 3NYFA 3DJDA 3UTFA 3FG2P 4H2QA 1SEZA 5EB5A 3VR8A 2C64A 4U8OA 2C66A 1S3BA 3REDA 5HXIA 2GB0A 4Z25A 4Z2UA 4FK1A 1NHQA 4KX6A 2E4GA 2QAEA 3K30A 1M64A 2AAQA 2Q6UA 3URHA 5U63A 3SQPA 2WOIA 1XANA 2NPXA 1PXBA 1ZX9A 1KSUA 4ZN0A 2XCGA 1LV0A 1PJ6A 1F8RA 2R0PA 4EMJA 3HZLA 1JU2A 2C76A 2DKIA 3AEBA 1Y56B 4EQSA 2YLWA 2EQ8A 4NEVA 2BS3A 3OZ2A 3AYIA 1CJ2A 3G5RA 2A87A 4BJZA 2Q0LA 2XVEA 3H4KA 3NGCX 1GALA 2WOVA 1ELIA 2XFQA 2Z5YA 1GTEA 4BK2A 4GR1A 5M10A 4YSYA 1ZOVA 4DSHA 5KRQA 4H2NA 1NEKA 4PABA 1RYIA 4FDCB 2WOWA 1LQUA 3Q9TA 1PXAA 1S2YA 2Y6RA 1PHHA 5DBJA 1FECA 2VQ7A 1F3PA 1IUSA 3ICRA 4OPGA 4C77A 4GCMA 1JRZA 1NENA 2X8CA 1S2QA 2E5VA 1MO9A 3K7MX 2C73A 3ATRA 4LA1A 4U8PA 3VR9A 3P4QA 3AD9B 4OPUA 3CIRA 3NLCA 3UOYA 3QSMA 5BRTA 4H50A 3GMCA 5CKUA 2XLRA 1CF3A 2V60A 3AE5A 3M0OA 3O0HA 2HQMA 4H2RA 1GSNA 3D8XA 1YQZA 1IUWA 3DK9A 1KFYA 3LJPA 3AE9A 1LQTA 3IF9A 4K8DA 2PHHA 2EQ6A 4B69A 1K0JA 1KDGA 2FBWA 4GDEA 4BV6A 2C3DA 5J60A 4RSLA 5M0ZA 3LXDA 2ARDA 4H4UA 3P4PA 3BHKA 4RG3A 3NIXA 3SGLA 1PS9A 2BS2A 4Z44A 2YM2A 3NRNA 3DJEA 1ZDLA 5HY5A 3DK8A 3GWDA 3AE3A 5BVAA 2B9XA 1L9CA 1D4DA 3UKKA 4LIIA 3AB1A 4H4ZA 3ADAB 2DKHA 2R4EA 1OJ9A 3KLJA 4EQWA 2Q7VA 2VVLG 2EQ9A 3G5SA 5FS8A 4JY3A 2WPCA 4EM4A 4K2XA 1CJ4A 3QVRA 3AYLA 3KD9A 1CJCA 1XHCA 2R0GA 3QFAA 4DSGA 1CC4A 1OJTA 3LADA 5U1OA 3DA1A 3B6DA 1BZLA 2I0ZA 2UZZA 3BNUA 1GV4A 3GD4A 4H4TA 4OPDA 2XFPA 2BCPA 3EPTA 1GETA 5KXJA 2IVEA 2OLNA 1LPFA 5HHFA 2X8HA 4J36A 4FK1C 2GR3A 1PDHA 1PJ5A 4ICYA 1OJDA 1TDFA 3C4NA 4EIPA 1RP0A 4XWZA 2GAHB 1MOKA 4YXDA 3NK1X 3AEFA 1GREA 2C65A 2BC0A 1L9DA 3CTYA 3NYCA 3GRSA 3FPZA 3UP5A 3AE7A 3WE0A 3AE8A 3EAOA 1CJ3A 4B1BA 1DXLA 1YKJA 4IVMB 5C2TA 2YR5A 3AEGA 3BHFA 2WS3A 4K5RA 4B65A 2A89A 1VG9A 4J57A 4E0VA 1YQ3A 1KF6A 2QA1A 2VRMA 2CVJA 4YTNA 1P2HA 2V3BA 3UKQA 3AEAA 2X99A 3LZXA 1ZOYA 5BULA 3ALJA 2BABA 1PBCA 3NN0X 1PN0A 3D1CA 3AD8B 1JNZA 1VDCA 3AE6A
chains in the Genus database with same CATH superfamily
3ZYXA 2RGOA 1NG3A 1FCDA 2GAGB 1IUVA 1DOBA 1EL5A 4EQRA 2WP5A 3SZWA 3ALLA 3P4SA 4A6NA 3NYEA 4GAPA 3F8RA 1NHRA 1HYUA 2YG3A 2XVIA 2C75A 2VRLA 1AOGA 2JKCA 3NKSA 1TDOA 3B3RA 5JCKA 3QVPA 5KWFA 3V76A 1B37A 4BJYA 2B9YA 2R0CA 4JQ9A 2BK3A 4C3XA 2VZ2A 1QJDA 2WU5A 4TM0A 2XVFA 3UKFA 1LVLA 3GD3A 3AEDA 5EBKA 4KPRA 3QSSA 1L9EA 4NWZA 4IA5A 2XYOA 3AWIA 3ABVA 2WETA 5IQ1A 4IVOB 4YTPA 1E1LA 3NHOX 1EL9A 2YLTA 3S5WA 4CBQA 5FS9A 3NH3X 4EMWA 4H4RA 1BGNA 3AE2A 1GRAA 1YQ4A 1K0IA 1Y56A 2APGA 2ZBWA 2BK4A 3ZDNA 1N1PA 4C5OA 2WU2A 1COYA 2RGJA 3ALMA 3CGEA 4Z2TA 1QO8A 5GRTA 5BUKA 1PBEA 3P4RA 4U2SA 3K7QX 2VVLA 1GEUA 2XVHA 4J33A 4RG4A 1JRYA 3CNDA 1ZP0A 3AD7B 5EOWA 3RP8A 1CHUA 3AE4A 4ADWA 3BI5A 4P9SA 2H88A 2BC1A 4O5UA 1ZMCA 1GXFA 4EIQA 1E1NA 3CNTA 1REOA 4A9WA 1H83A 2X50A 3NTAA 2JBVA 3T2YA 2WDRA 1ONFA 2GVCA 4DNAA 2GMJA 2YAUA 4B67A 1D7LA 3DGHA 4UDQA 2XFUA 4UP3A 1EBDA 1CC6A 1BWCA 3UOZA 2EQ7A 1S3EA 4CY6A 2YG7A 2GV8A 4NTEA 5IQ4A 1JOAA 3PS9A 2A8XA 4NZHA 4U8MA 2YLRA 3QJ4A 1KNPA 4X9MA 2FJDA 2Z5XA 2GMHA 1OJAA 4H4SA 4OPLA 3FBSA 2WDVA 2YLZA 5JCLA 3II4A 2BXSA 5C3JA 2CULA 3ITJA 2O9ZA 2WQYA 4YSHA 1O95A 2BYBA 2GR2A 1RSGA 1DOEA 2WEUA 2XVJA 2BK5A 3GYIA 4GDPA 4H4QA 4JN9A 3RHAA 3SM8A 1H6VA 2B7RA 2GR1A 3FIMB 1K0LA 2XLPA 3UKAA 1FEAA 2ACZA 3GSIA 1Q1WA 1H81A 4MJWA 4WX1A 1GRFA 3JSKA 3CPHG 1ZKQA 3IHGA 5KVIA 1IUXA 1BF3A 2C72A 2QA2A 2WPEA 1QLBA 2YLSA 2YVFA 2GQFA 1TYPA 4M52A 4A7AA 2ZZ0A 3VRAA 1DODA 4CNJA 2WHDA 2PYXA 4USQA 2YVGA 1E1MA 4K22A 5JCNA 2XLSA 3NT6A 1DNCA 1KSSA 1E1KA 3DK4A 3I3LA 4AP1A 2FJEA 3DGZA 4HA6A 4AOXA 1ZY8A 4AOSA 1GRBA 3QFBA 4H7UA 5KOXA 2XDOA 2H89A 3UCLA 4C74A 2BS4A 3P1WA 4U8IA 1GT8A 4A65A 2AQJA 3NTDA 1VG0A 1DOCA 3C96A 1Z6LA 1NHSA 5CQFA 4C3YA 4IA6A 3UOVA 1GPEA 2WP6A 2B7SA 3NK0X 3RP7A 1TDEA 2IIDA 2CDUA 2XLTA 2V5ZA 2VQBA 3GMBA 4B64A 3G5QA 4BK1A 3BI4A 4NTDA 2YR4A 4CNKA 4XWRA 4Z24A 1F6MA 4AP3A 3I6DA 1IUTA 3DJJA 2E1MA 4OVIA 1N4WA 4YKFA 2AR8A 4APNA 4YWOA 2C3CA 4D04A 1TYTA 3COXA 3FMWA 3CGBA 2C67A 4WCTA 1NAAA 4CCRA 2IVDA 1EL7A 2JB2A 4U2LA 1UKVG 2V3AA 5KVHA 3T0KA 1GERA 4OCGA 4GUVA 2GEWA 1X31B 2NVKX 3ISHA 5FMHA 1GNDA 3QSEA 3VRBA 4A5LA 4ECHA 3AEEA 1N4UA 2TMDA 4JY2A 4X9NA 1N4VA 4XXGA 2B76A 2ZZBA 3LZWA 2YQUA 1D5TA 1DJNA 4YTMA 4YSXA 3SY4A 4UDRA 2JAEA 1GOSA 4CRTA 3UOXA 5KMRA 4OPTA 3V3NA 1Q9IA 2XFOA 4NTCA 4TM4A 4PAAA 3SFEA 2GH5A 3DH9A 4K7ZA 2R9ZA 3PO7A 4TM1A 2WP9A 2VOUA 4K5SA 1D7YA 1CBOA 4Z26A 1IJHA 1YY5A 2R46A 4B63A 4ZCCA 1E7PA 2W0HA 1D4EA 3KA7A 2WPFA 2WDQA 4GF7A 3VRDB 3ATQA 2GQWA 1CC2A 3UKPA 1JRXA 1NDAA 2YWLA 3NN6X 3KPFA 4N9XA 4H4PA 3BNMA 1PXCA 3C4AA 4ZCDA 3OC4A 4G6GA 4UDPA 1E39A 2JB1A 2RABA 1GRTA 1EL8A 1IUUA 2X8GA 3ICTA 1DJQA 1MXTA 1W4XA 3P9UA 4X4JA 3M12A 2B9WA 3EF6A 3UTHA 4U8LA 4Z2RA 3AECA 3CN8A 3VQRA 2OALA 3R9UA 2R45A 3E1TA 4TLXA 1B8SA 4USRA 3UTEA 3DJGX 5FS7A 3RNMA 2JK6A 4U8JA 3CNSA 1NPXA 4JDRA 4H4YA 4AT0A 1VQWA 4H4WA 2V6OA 3GYJA 2CFYA 2BRYA 2RGHA 2YR6A 3BI2A 5J7XA 5BRTA 3GYXA 1GTHA 1PBBA 3AXBA 1B5QA 4Z43A 2XFNA 2X3NA 1B4VA 2YVJA 3GRTA 4J2WA 3S61A 2FJBA 1TDNA 3Q6JA 3UKHA 1JNRA 4G6HA 5KNLA 4HB9A 2YG6A 4J56A 1Y0PA 2BACA 2GF3A 3HYWA 4Y4NA 4YKGA 2QCUA 1XPQA 3AE1A 2XLUA 4A99A 2J3NA 5FS6A 1FEBA 3RP6A 4J34A 1JEHA 3GWFA 4CCQA 2R4JA 4EQXA 1FOHA 2V61A 1M6IA 3AYJA 1F8SA 4OPIA 3V3OA 1L0VA 1P2EA 5KOWA 4FX9A 5EB4A 1H82A 4JNQA 2OLOA 4U8KA 4A79A 4B68A 1PJ7A 1XDIA 1H84A 3H8IA 4REKA 3K7TA 4D03A 2BA9A 3T37A 2Q0KA 1PBFA 1TDKA 1KNRA 2F5ZA 2VVMA 1O94A 5TR3A 1ZK7A 4JNAA 3NG7X 4GAVA 4OPCA 1BKWA 4U2TA 2YM1A 2JB3A 3ICSA 3CGCA 3M13A 5GSNA 1H86A 3GDPA 4G74A 4H4XA 3UKLA 1GRHA 4DGKA 4Y4MA 3KU9A 5LV9A 4TM3A 1CL0A 1LTXR 3HYXA 4J31A 4YSZA 1NG4A 1BGJA 2WBAA 2YG5A 3F8DA 5HYMA 4BURA 5JCIA 1GRGA 1Q1RA 3CNJA 2WESA 3CGDA 4O5QA 2YLXA 1GESA 4GRTA 5IPYA 2BCGG 3CPJG 3SZFA 1H7XA 3CPIG 1D4CA 3DMEA 3LOVA 2Y6QA 1F8WA 4EMIA 3IWAA 4YT0A 5L46A 4AT2A 3LB8A 2GRTA 5ER0A 3H8LA 3HYVA 2GR0A 3UP4A 3EANA 3UTGA 4BK3A 1K4QA 1V59A 4H2PA 3KVEA 2OAMA 3T31A 5JCMA 4LU6A 1PBDA 4U8NA 3NNEA 3SX6A 2C7GA 4NEWA 4EM3A 4I59A 1LJ1A 1OJCA 3GDNA 4Y4LA 2TPRA 3KKJA 3NK2X 1TRBA 4CY8A 3SFDA 1H7WA 3L8KA 2YG4A 3F8PA 2C70A 2ZZCA 2BXRA 3PVCA 4H4VA 1O5WA 4I58A 4TLZA 4IV9A 3IC9A 1FL2A 1ZMDA 1VRQB 2FJAA 2OA1A 3L1RA 5U25A 4A6NB 4B66A 1NHPA 3IHMA 3CNPA 1E6EA 3NYFA 3DJDA 3UTFA 3FG2P 4H2QA 1SEZA 5EB5A 3VR8A 2C64A 3T2ZA 4U8OA 2C66A 1S3BA 3REDA 5HXIA 2GB0A 4Z25A 4Z2UA 4FK1A 1NHQA 4KX6A 2E4GA 2QAEA 3K30A 1M64A 2AAQA 2Q6UA 3URHA 5U63A 3SQPA 2WOIA 1XANA 2NPXA 1PXBA 1ZX9A 1KSUA 4ZN0A 2XCGA 1LV0A 1PJ6A 5KMPA 1F8RA 3CMMA 2R0PA 4EMJA 3HZLA 1JU2A 2C76A 2DKIA 3AEBA 1Y56B 4EQSA 4II3A 2YLWA 2EQ8A 4NEVA 3SZCA 2BS3A 3OZ2A 3AYIA 1CJ2A 3G5RA 2A87A 4BJZA 2Q0LA 2XVEA 2BRAA 3H4KA 1GALA 3NGCX 2WOVA 1ELIA 2XFQA 2Z5YA 1GTEA 4BK2A 4GR1A 5M10A 4YSYA 1ZOVA 4DSHA 5KRQA 4H2NA 1NEKA 4PABA 1RYIA 4FDCB 2WOWA 1LQUA 3Q9TA 1PXAA 1S2YA 2Y6RA 1PHHA 5DBJA 1FECA 2VQ7A 1F3PA 1IUSA 3ICRA 4OPGA 4C77A 4GCMA 1JRZA 1NENA 2X8CA 1S2QA 2E5VA 1MO9A 3K7MX 2C73A 3ATRA 4LA1A 4U8PA 3SYIA 3P4QA 3AD9B 4OPUA 3CIRA 3NLCA 3UOYA 3QSMA 4II2A 4H50A 3GMCA 5CKUA 2XLRA 1CF3A 2V60A 3AE5A 3M0OA 3O0HA 2HQMA 4H2RA 1GSNA 3D8XA 1YQZA 1IUWA 3DK9A 1KFYA 3LJPA 3AE9A 1LQTA 3IF9A 4K8DA 2PHHA 2EQ6A 5KMQA 3SZ0A 4B69A 1K0JA 1KDGA 2FBWA 4GDEA 4BV6A 2C3DA 5J60A 4RSLA 5M0ZA 3LXDA 2ARDA 4H4UA 3P4PA 3BHKA 4RG3A 3VR9A 3NIXA 3SGLA 1PS9A 2BS2A 4Z44A 2YM2A 3NRNA 3DJEA 1ZDLA 3T2KA 5HY5A 3DK8A 3GWDA 3AE3A 5BVAA 2B9XA 1L9CA 1D4DA 3SXIA 4LIIA 3AB1A 3UKKA 4H4ZA 4G73A 3ADAB 3T14A 2DKHA 2R4EA 1OJ9A 3KLJA 4EQWA 2Q7VA 2VVLG 2EQ9A 3G5SA 5FS8A 4JY3A 2WPCA 4EM4A 4K2XA 1CJ4A 3QVRA 3AYLA 3KD9A 1CJCA 1XHCA 2R0GA 3QFAA 4DSGA 1CC4A 1OJTA 3LADA 5U1OA 3DA1A 3B6DA 1BZLA 2I0ZA 2UZZA 3BNUA 1GV4A 3GD4A 4H4TA 4OPDA 2XFPA 2BCPA 3EPTA 1GETA 5KXJA 2IVEA 2OLNA 1LPFA 5HHFA 4NNJA 2X8HA 4J36A 4FK1C 2GR3A 1PDHA 5KMSA 1PJ5A 4ICYA 1OJDA 1TDFA 3C4NA 4EIPA 1RP0A 4XWZA 2GAHB 1MOKA 4YXDA 2C4CA 3NK1X 3AEFA 1GREA 2C65A 2BC0A 1L9DA 3CTYA 3NYCA 3GRSA 3FPZA 3UP5A 3AE7A 3WE0A 3AE8A 4G9KA 3EAOA 1CJ3A 4B1BA 1DXLA 1YKJA 4IVMB 5C2TA 2YR5A 3AEGA 3BHFA 2WS3A 4K5RA 4B65A 2A89A 1VG9A 4J57A 4E0VA 1YQ3A 1KF6A 2QA1A 2VRMA 2CVJA 4YTNA 1P2HA 2V3BA 3KPKA 3AEAA 3UKQA 2X99A 3LZXA 1ZOYA 5BULA 3ALJA 2BABA 1PBCA 3NN0X 1PN0A 3D1CA 3AD8B 1JNZA 1VDCA 3AE6A
chains in the Genus database with same CATH topology
3ZYXA 2RGOA 1NG3A 1FCDA 2GAGB 1IUVA 1DOBA 1EL5A 4EQRA 2WP5A 3SZWA 3ALLA 3P4SA 4A6NA 3NYEA 4GAPA 3F8RA 1NHRA 1HYUA 2YG3A 2XVIA 2C75A 2VRLA 1AOGA 2JKCA 3NKSA 1TDOA 3B3RA 5JCKA 3QVPA 5KWFA 3V76A 1B37A 4BJYA 2B9YA 2R0CA 4JQ9A 2BK3A 4C3XA 2VZ2A 1QJDA 2WU5A 4TM0A 2XVFA 3UKFA 1LVLA 3GD3A 3AEDA 5EBKA 4KPRA 3QSSA 1L9EA 4NWZA 4IA5A 2XYOA 3AWIA 3ABVA 2WETA 5IQ1A 4IVOB 4YTPA 1E1LA 3NHOX 1EL9A 2YLTA 3S5WA 4CBQA 5FS9A 3NH3X 4EMWA 4H4RA 1BGNA 3AE2A 1GRAA 1YQ4A 1K0IA 1Y56A 2APGA 2ZBWA 2BK4A 3ZDNA 1N1PA 4C5OA 2WU2A 1COYA 2RGJA 3ALMA 3CGEA 4Z2TA 1QO8A 5GRTA 5BUKA 1PBEA 3P4RA 4U2SA 3K7QX 2VVLA 1GEUA 2XVHA 4J33A 4RG4A 1JRYA 3CNDA 1ZP0A 3AD7B 5EOWA 3RP8A 1CHUA 3AE4A 4ADWA 3BI5A 4P9SA 2H88A 2BC1A 4O5UA 1ZMCA 1GXFA 4EIQA 1E1NA 3CNTA 1REOA 4A9WA 1H83A 2X50A 3NTAA 2JBVA 3T2YA 2WDRA 1ONFA 2GVCA 4DNAA 2GMJA 2YAUA 4B67A 1D7LA 3DGHA 4UDQA 2XFUA 4UP3A 1EBDA 1CC6A 1BWCA 3UOZA 2EQ7A 1S3EA 4CY6A 2YG7A 2GV8A 4NTEA 5IQ4A 1JOAA 3PS9A 2A8XA 4NZHA 4U8MA 2YLRA 3QJ4A 1KNPA 4X9MA 2FJDA 2Z5XA 2GMHA 1OJAA 4H4SA 4OPLA 3FBSA 2WDVA 2YLZA 5JCLA 3II4A 2BXSA 5C3JA 2CULA 3ITJA 2O9ZA 2WQYA 4YSHA 1O95A 2BYBA 2GR2A 1RSGA 1DOEA 2WEUA 2XVJA 2BK5A 3GYIA 4GDPA 4H4QA 4JN9A 3RHAA 3SM8A 1H6VA 2B7RA 2GR1A 3FIMB 1K0LA 2XLPA 3UKAA 1FEAA 2ACZA 3GSIA 1Q1WA 1H81A 4MJWA 4WX1A 1GRFA 3JSKA 3CPHG 1ZKQA 3IHGA 5KVIA 1IUXA 1BF3A 2C72A 2QA2A 2WPEA 1QLBA 2YLSA 2YVFA 2GQFA 1TYPA 4M52A 4A7AA 2ZZ0A 3VRAA 1DODA 4CNJA 2WHDA 2PYXA 4USQA 2YVGA 1E1MA 4K22A 5JCNA 2XLSA 3NT6A 1DNCA 1KSSA 1E1KA 3DK4A 3I3LA 4AP1A 2FJEA 3DGZA 4HA6A 4AOXA 1ZY8A 4AOSA 1GRBA 3QFBA 4H7UA 5KOXA 2XDOA 2H89A 3UCLA 4C74A 2BS4A 3P1WA 4U8IA 1GT8A 4A65A 2AQJA 3NTDA 1VG0A 1DOCA 3C96A 1Z6LA 1NHSA 5CQFA 4C3YA 4IA6A 3UOVA 1GPEA 2WP6A 2B7SA 3NK0X 3RP7A 1TDEA 2IIDA 2CDUA 2XLTA 2V5ZA 2VQBA 3GMBA 4B64A 3G5QA 4BK1A 3BI4A 4NTDA 2YR4A 4CNKA 4XWRA 4Z24A 1F6MA 4AP3A 3I6DA 1IUTA 3DJJA 2E1MA 4OVIA 1N4WA 4YKFA 2AR8A 4APNA 4YWOA 2C3CA 4D04A 1TYTA 3COXA 3FMWA 3CGBA 2C67A 4WCTA 1NAAA 4CCRA 2IVDA 1EL7A 2JB2A 4U2LA 1UKVG 2V3AA 5KVHA 3T0KA 1GERA 4OCGA 4GUVA 2GEWA 1X31B 2NVKX 3ISHA 5FMHA 1GNDA 3QSEA 3VRBA 4A5LA 4ECHA 3AEEA 1N4UA 2TMDA 4JY2A 4X9NA 1N4VA 4XXGA 2B76A 2ZZBA 3LZWA 2YQUA 1D5TA 1DJNA 4YTMA 4YSXA 3SY4A 4UDRA 2JAEA 1GOSA 4CRTA 3UOXA 5KMRA 4OPTA 3V3NA 1Q9IA 2XFOA 4NTCA 4TM4A 4PAAA 3SFEA 2GH5A 3DH9A 4K7ZA 2R9ZA 3PO7A 4TM1A 2WP9A 2VOUA 4K5SA 1D7YA 1CBOA 4Z26A 1IJHA 1YY5A 2R46A 4B63A 4ZCCA 1E7PA 2W0HA 1D4EA 3KA7A 2WPFA 2WDQA 4GF7A 3VRDB 3ATQA 2GQWA 1CC2A 3UKPA 1JRXA 1NDAA 2YWLA 3NN6X 3KPFA 4N9XA 4H4PA 3BNMA 1PXCA 3C4AA 4ZCDA 3OC4A 4G6GA 4UDPA 1E39A 2JB1A 2RABA 1GRTA 1EL8A 1IUUA 2X8GA 3ICTA 1DJQA 1MXTA 1W4XA 3P9UA 4X4JA 3M12A 2B9WA 3EF6A 3UTHA 4U8LA 4Z2RA 3AECA 3CN8A 3VQRA 2OALA 3R9UA 2R45A 3E1TA 4TLXA 1B8SA 4USRA 3UTEA 3DJGX 5FS7A 3RNMA 2JK6A 4U8JA 3CNSA 1NPXA 4JDRA 4H4YA 4AT0A 1VQWA 4H4WA 2V6OA 3GYJA 2CFYA 2BRYA 2RGHA 2YR6A 3BI2A 5J7XA 5BRTA 3GYXA 1GTHA 1PBBA 3AXBA 1B5QA 4Z43A 2XFNA 2X3NA 1B4VA 2YVJA 3GRTA 4J2WA 3S61A 2FJBA 1TDNA 3Q6JA 3UKHA 1JNRA 4G6HA 5KNLA 4HB9A 2YG6A 4J56A 1Y0PA 2BACA 2GF3A 3HYWA 4Y4NA 4YKGA 2QCUA 1XPQA 3AE1A 2XLUA 4A99A 2J3NA 5FS6A 1FEBA 3RP6A 4J34A 1JEHA 3GWFA 4CCQA 2R4JA 4EQXA 1FOHA 2V61A 1M6IA 3AYJA 1F8SA 4OPIA 3V3OA 1L0VA 1P2EA 5KOWA 4FX9A 5EB4A 1H82A 4JNQA 2OLOA 4U8KA 4A79A 4B68A 1PJ7A 1XDIA 1H84A 3H8IA 4REKA 3K7TA 4D03A 2BA9A 3T37A 2Q0KA 1PBFA 1TDKA 1KNRA 2F5ZA 2VVMA 1O94A 5TR3A 1ZK7A 4JNAA 3NG7X 4GAVA 4OPCA 1BKWA 4U2TA 2YM1A 2JB3A 3ICSA 3CGCA 3M13A 5GSNA 1H86A 3GDPA 4G74A 4H4XA 3UKLA 1GRHA 4DGKA 4Y4MA 3KU9A 5LV9A 4TM3A 1CL0A 1LTXR 3HYXA 4J31A 4YSZA 1NG4A 1BGJA 2WBAA 2YG5A 3F8DA 5HYMA 4BURA 5JCIA 1GRGA 1Q1RA 3CNJA 2WESA 3CGDA 4O5QA 2YLXA 1GESA 4GRTA 5IPYA 2BCGG 3CPJG 3SZFA 1H7XA 3CPIG 1D4CA 3DMEA 3LOVA 2Y6QA 1F8WA 4EMIA 3IWAA 4YT0A 5L46A 4AT2A 3LB8A 2GRTA 5ER0A 3H8LA 3HYVA 2GR0A 3UP4A 3EANA 3UTGA 4BK3A 1K4QA 1V59A 4H2PA 3KVEA 2OAMA 3T31A 5JCMA 4LU6A 1PBDA 4U8NA 3NNEA 3SX6A 2C7GA 4NEWA 4EM3A 4I59A 1LJ1A 1OJCA 3GDNA 4Y4LA 2TPRA 3KKJA 3NK2X 1TRBA 4CY8A 3SFDA 1H7WA 3L8KA 2YG4A 3F8PA 2C70A 2ZZCA 2BXRA 3PVCA 4H4VA 1O5WA 4I58A 4TLZA 4IV9A 3IC9A 1FL2A 1ZMDA 1VRQB 2FJAA 2OA1A 3L1RA 5U25A 4A6NB 4B66A 1NHPA 3IHMA 3CNPA 1E6EA 3NYFA 3DJDA 3UTFA 3FG2P 4H2QA 1SEZA 5EB5A 3VR8A 2C64A 3T2ZA 4U8OA 2C66A 1S3BA 3REDA 5HXIA 2GB0A 4Z25A 4Z2UA 4FK1A 1NHQA 4KX6A 2E4GA 2QAEA 3K30A 1M64A 2AAQA 2Q6UA 3URHA 5U63A 3SQPA 2WOIA 1XANA 2NPXA 1PXBA 1ZX9A 1KSUA 4ZN0A 2XCGA 1LV0A 1PJ6A 5KMPA 1F8RA 3CMMA 2R0PA 4EMJA 3HZLA 1JU2A 2C76A 2DKIA 3AEBA 1Y56B 4EQSA 4II3A 2YLWA 2EQ8A 4NEVA 3SZCA 2BS3A 3OZ2A 3AYIA 1CJ2A 3G5RA 2A87A 4BJZA 2Q0LA 2XVEA 2BRAA 3H4KA 1GALA 3NGCX 2WOVA 1ELIA 2XFQA 2Z5YA 1GTEA 4BK2A 4GR1A 5M10A 4YSYA 1ZOVA 4DSHA 5KRQA 4H2NA 1NEKA 4PABA 1RYIA 4FDCB 2WOWA 1LQUA 3Q9TA 1PXAA 1S2YA 2Y6RA 1PHHA 5DBJA 1FECA 2VQ7A 1F3PA 1IUSA 3ICRA 4OPGA 4C77A 4GCMA 1JRZA 1NENA 2X8CA 1S2QA 2E5VA 1MO9A 3K7MX 2C73A 3ATRA 4LA1A 4U8PA 3SYIA 3P4QA 3AD9B 4OPUA 3CIRA 3NLCA 3UOYA 3QSMA 4II2A 4H50A 3GMCA 5CKUA 2XLRA 1CF3A 2V60A 3AE5A 3M0OA 3O0HA 2HQMA 4H2RA 1GSNA 3D8XA 1YQZA 1IUWA 3DK9A 1KFYA 3LJPA 3AE9A 1LQTA 3IF9A 4K8DA 2PHHA 2EQ6A 5KMQA 3SZ0A 4B69A 1K0JA 1KDGA 2FBWA 4GDEA 4BV6A 2C3DA 5J60A 4RSLA 5M0ZA 3LXDA 2ARDA 4H4UA 3P4PA 3BHKA 4RG3A 3VR9A 3NIXA 3SGLA 1PS9A 2BS2A 4Z44A 2YM2A 3NRNA 3DJEA 1ZDLA 3T2KA 5HY5A 3DK8A 3GWDA 3AE3A 5BVAA 2B9XA 1L9CA 1D4DA 3SXIA 4LIIA 3AB1A 3UKKA 4H4ZA 4G73A 3ADAB 3T14A 2DKHA 2R4EA 1OJ9A 3KLJA 4EQWA 2Q7VA 2VVLG 2EQ9A 3G5SA 5FS8A 4JY3A 2WPCA 4EM4A 4K2XA 1CJ4A 3QVRA 3AYLA 3KD9A 1CJCA 1XHCA 2R0GA 3QFAA 4DSGA 1CC4A 1OJTA 3LADA 5U1OA 3DA1A 3B6DA 1BZLA 2I0ZA 2UZZA 3BNUA 1GV4A 3GD4A 4H4TA 4OPDA 2XFPA 2BCPA 3EPTA 1GETA 5KXJA 2IVEA 2OLNA 1LPFA 5HHFA 4NNJA 2X8HA 4J36A 4FK1C 2GR3A 1PDHA 5KMSA 1PJ5A 4ICYA 1OJDA 1TDFA 3C4NA 4EIPA 1RP0A 4XWZA 2GAHB 1MOKA 4YXDA 2C4CA 3NK1X 3AEFA 1GREA 2C65A 2BC0A 1L9DA 3CTYA 3NYCA 3GRSA 3FPZA 3UP5A 3AE7A 3WE0A 3AE8A 4G9KA 3EAOA 1CJ3A 4B1BA 1DXLA 1YKJA 4IVMB 5C2TA 2YR5A 3AEGA 3BHFA 2WS3A 4K5RA 4B65A 2A89A 1VG9A 4J57A 4E0VA 1YQ3A 1KF6A 2QA1A 2VRMA 2CVJA 4YTNA 1P2HA 2V3BA 3KPKA 3AEAA 3UKQA 2X99A 3LZXA 1ZOYA 5BULA 3ALJA 2BABA 1PBCA 3NN0X 1PN0A 3D1CA 3AD8B 1JNZA 1VDCA 3AE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYX A;  2RGO A;  1NG3 A;  1FCD A;  2GAG B;  1IUV A;  1DOB A;  1EL5 A;  4EQR A;  2WP5 A;  3ALL A;  3P4S A;  4A6N A;  3NYE A;  3F8R A;  1NHR A;  1HYU A;  2YG3 A;  2XVI A;  2C75 A;  2VRL A;  1AOG A;  2JKC A;  3NKS A;  1TDO A;  3B3R A;  5JCK A;  3QVP A;  5KWF A;  3V76 A;  1B37 A;  4BJY A;  2B9Y A;  2R0C A;  4JQ9 A;  2BK3 A;  4C3X A;  2VZ2 A;  1QJD A;  2WU5 A;  4TM0 A;  2XVF A;  3UKF A;  1LVL A;  3GD3 A;  3AED A;  5EBK A;  4KPR A;  3QSS A;  1L9E A;  4IA5 A;  2XYO A;  3AWI A;  3ABV A;  2WET A;  5IQ1 A;  4IVO B;  4YTP A;  1E1L A;  3NHO X;  1EL9 A;  2YLT A;  3S5W A;  4CBQ A;  5FS9 A;  3NH3 X;  4EMW A;  4H4R A;  1BGN A;  3AE2 A;  1GRA A;  1YQ4 A;  1K0I A;  1Y56 A;  2APG A;  2ZBW A;  2BK4 A;  3ZDN A;  1N1P A;  4C5O A;  2WU2 A;  1COY A;  2RGJ A;  3ALM A;  3CGE A;  4Z2T A;  1QO8 A;  5GRT A;  5BUK A;  1PBE A;  3P4R A;  4U2S A;  3K7Q X;  2VVL A;  1GEU A;  2XVH A;  4J33 A;  4RG4 A;  1JRY A;  3CND A;  1ZP0 A;  3AD7 B;  5EOW A;  3RP8 A;  1CHU A;  3AE4 A;  4ADW A;  3BI5 A;  4P9S A;  2H88 A;  2BC1 A;  4O5U A;  1ZMC A;  1GXF A;  4EIQ A;  1E1N A;  3CNT A;  1REO A;  4A9W A;  1H83 A;  2X50 A;  3NTA A;  2JBV A;  2WDR A;  1ONF A;  2GVC A;  4DNA A;  2GMJ A;  2YAU A;  4B67 A;  1D7L A;  3DGH A;  4UDQ A;  2XFU A;  4UP3 A;  1EBD A;  1CC6 A;  1BWC A;  3UOZ A;  2EQ7 A;  1S3E A;  4CY6 A;  2YG7 A;  2GV8 A;  4NTE A;  5IQ4 A;  1JOA A;  3PS9 A;  2A8X A;  4NZH A;  4U8M A;  2YLR A;  3QJ4 A;  1KNP A;  4X9M A;  2FJD A;  2Z5X A;  2GMH A;  1OJA A;  4H4S A;  4OPL A;  3FBS A;  2WDV A;  2YLZ A;  5JCL A;  3II4 A;  2BXS A;  5C3J A;  2CUL A;  3ITJ A;  2O9Z A;  2WQY A;  4YSH A;  1O95 A;  2BYB A;  1RSG A;  1DOE A;  2GR2 A;  2WEU A;  2XVJ A;  2BK5 A;  3GYI A;  4GDP A;  4H4Q A;  4JN9 A;  3RHA A;  3SM8 A;  1H6V A;  2B7R A;  2GR1 A;  3FIM B;  1K0L A;  2XLP A;  3UKA A;  1FEA A;  2ACZ A;  3GSI A;  1Q1W A;  1H81 A;  4MJW A;  4WX1 A;  1GRF A;  3JSK A;  3CPH G;  1ZKQ A;  3IHG A;  5KVI A;  1IUX A;  1BF3 A;  2C72 A;  2QA2 A;  2WPE A;  1QLB A;  2YLS A;  2YVF A;  2GQF A;  1TYP A;  4M52 A;  4A7A A;  2ZZ0 A;  3VRA A;  1DOD A;  4CNJ A;  2WHD A;  2PYX A;  4USQ A;  2YVG A;  1E1M A;  4K22 A;  5JCN A;  2XLS A;  3NT6 A;  1DNC A;  1KSS A;  1E1K A;  3DK4 A;  3I3L A;  4AP1 A;  2FJE A;  3DGZ A;  4HA6 A;  4AOX A;  1ZY8 A;  4AOS A;  1GRB A;  3QFB A;  4H7U A;  5KOX A;  2XDO A;  2H89 A;  3UCL A;  4C74 A;  2BS4 A;  3P1W A;  4U8I A;  1GT8 A;  4A65 A;  2AQJ A;  3NTD A;  1VG0 A;  1DOC A;  3C96 A;  1Z6L A;  1NHS A;  5CQF A;  4C3Y A;  4IA6 A;  3UOV A;  1GPE A;  2WP6 A;  2B7S A;  3NK0 X;  3RP7 A;  1TDE A;  2IID A;  2CDU A;  2XLT A;  2V5Z A;  2VQB A;  3GMB A;  4B64 A;  3G5Q A;  4BK1 A;  3BI4 A;  4NTD A;  2YR4 A;  4CNK A;  4XWR A;  4Z24 A;  1F6M A;  4AP3 A;  3I6D A;  1IUT A;  3DJJ A;  2E1M A;  4OVI A;  1N4W A;  4YKF A;  2AR8 A;  4APN A;  4YWO A;  2C3C A;  4D04 A;  1TYT A;  3COX A;  3FMW A;  3CGB A;  2C67 A;  4WCT A;  1NAA A;  4CCR A;  2IVD A;  1EL7 A;  2JB2 A;  4U2L A;  1UKV G;  2V3A A;  5KVH A;  1GER A;  4OCG A;  4GUV A;  2GEW A;  1X31 B;  2NVK X;  3ISH A;  5FMH A;  1GND A;  3QSE A;  3VRB A;  4A5L A;  4ECH A;  3AEE A;  1N4U A;  2TMD A;  4JY2 A;  4X9N A;  1N4V A;  4XXG A;  2B76 A;  2ZZB A;  3LZW A;  2YQU A;  1D5T A;  1DJN A;  4YTM A;  4YSX A;  4UDR A;  2JAE A;  1GOS A;  4CRT A;  3UOX A;  4OPT A;  3V3N A;  1Q9I A;  2XFO A;  4NTC A;  4TM4 A;  4PAA A;  3SFE A;  2GH5 A;  3DH9 A;  4K7Z A;  2R9Z A;  3PO7 A;  4TM1 A;  2WP9 A;  2VOU A;  4K5S A;  1D7Y A;  1CBO A;  4Z26 A;  1IJH A;  1YY5 A;  2R46 A;  4B63 A;  4ZCC A;  1E7P A;  2W0H A;  1D4E A;  3KA7 A;  2WPF A;  2WDQ A;  4GF7 A;  3VRD B;  3ATQ A;  2GQW A;  1CC2 A;  3UKP A;  1JRX A;  1NDA A;  2YWL A;  3NN6 X;  3KPF A;  4N9X A;  4H4P A;  3BNM A;  1PXC A;  3C4A A;  4ZCD A;  3OC4 A;  4UDP A;  1E39 A;  2JB1 A;  2RAB A;  1GRT A;  1EL8 A;  1IUU A;  2X8G A;  3ICT A;  1DJQ A;  1MXT A;  1W4X A;  3P9U A;  4X4J A;  3M12 A;  2B9W A;  3EF6 A;  3UTH A;  4U8L A;  4Z2R A;  3AEC A;  3CN8 A;  3VQR A;  2OAL A;  3R9U A;  2R45 A;  3E1T A;  4TLX A;  1B8S A;  4USR A;  3UTE A;  3DJG X;  5FS7 A;  3RNM A;  2JK6 A;  4U8J A;  3CNS A;  1NPX A;  4JDR A;  4H4Y A;  4AT0 A;  1VQW A;  4H4W A;  2V6O A;  3GYJ A;  2CFY A;  2RGH A;  2YR6 A;  3BI2 A;  5J7X A;  1GTH A;  1PBB A;  3AXB A;  1B5Q A;  4Z43 A;  2XFN A;  2X3N A;  1B4V A;  2YVJ A;  3GRT A;  4J2W A;  3S61 A;  2FJB A;  1TDN A;  3Q6J A;  3UKH A;  1JNR A;  4HB9 A;  2YG6 A;  4J56 A;  1Y0P A;  2BAC A;  2GF3 A;  4Y4N A;  4YKG A;  2QCU A;  1XPQ A;  3AE1 A;  2XLU A;  4A99 A;  2J3N A;  5FS6 A;  1FEB A;  3RP6 A;  4J34 A;  1JEH A;  3GWF A;  4CCQ A;  2R4J A;  4EQX A;  1FOH A;  2V61 A;  1M6I A;  3AYJ A;  1F8S A;  4OPI A;  3V3O A;  1L0V A;  1P2E A;  5KOW A;  4FX9 A;  5EB4 A;  1H82 A;  4JNQ A;  2OLO A;  4U8K A;  4A79 A;  4B68 A;  1PJ7 A;  1XDI A;  1H84 A;  3H8I A;  4REK A;  3K7T A;  4D03 A;  2BA9 A;  3T37 A;  2Q0K A;  1PBF A;  1TDK A;  1KNR A;  2F5Z A;  2VVM A;  1O94 A;  5TR3 A;  1ZK7 A;  4JNA A;  3NG7 X;  4OPC A;  1BKW A;  4U2T A;  2YM1 A;  2JB3 A;  3ICS A;  3CGC A;  3M13 A;  5GSN A;  1H86 A;  3GDP A;  4H4X A;  3UKL A;  1GRH A;  4DGK A;  4Y4M A;  3KU9 A;  5LV9 A;  4TM3 A;  1CL0 A;  1LTX R;  4J31 A;  4YSZ A;  1NG4 A;  1BGJ A;  2WBA A;  2YG5 A;  3F8D A;  5HYM A;  4BUR A;  5JCI A;  1GRG A;  1Q1R A;  3CNJ A;  2WES A;  3CGD A;  4O5Q A;  2YLX A;  1GES A;  4GRT A;  5IPY A;  2BCG G;  3CPJ G;  1H7X A;  3CPI G;  1D4C A;  3DME A;  3LOV A;  2Y6Q A;  1F8W A;  4EMI A;  3IWA A;  4YT0 A;  5L46 A;  4AT2 A;  3LB8 A;  2GRT A;  5ER0 A;  3H8L A;  2GR0 A;  3UP4 A;  3EAN A;  3UTG A;  4BK3 A;  1K4Q A;  1V59 A;  4H2P A;  3KVE A;  2OAM A;  5JCM A;  4LU6 A;  1PBD A;  4U8N A;  3NNE A;  2C7G A;  4NEW A;  4EM3 A;  4I59 A;  1LJ1 A;  1OJC A;  3GDN A;  4Y4L A;  2TPR A;  3KKJ A;  3NK2 X;  1TRB A;  4CY8 A;  3SFD A;  1H7W A;  3L8K A;  2YG4 A;  3F8P A;  2C70 A;  2ZZC A;  2BXR A;  3PVC A;  4H4V A;  1O5W A;  4I58 A;  4TLZ A;  4IV9 A;  3IC9 A;  1FL2 A;  1ZMD A;  1VRQ B;  2FJA A;  2OA1 A;  3L1R A;  5U25 A;  4A6N B;  4B66 A;  1NHP A;  3IHM A;  3CNP A;  1E6E A;  3NYF A;  3DJD A;  3UTF A;  3FG2 P;  4H2Q A;  1SEZ A;  5EB5 A;  3VR8 A;  2C64 A;  4U8O A;  2C66 A;  1S3B A;  3RED A;  5HXI A;  2GB0 A;  4Z25 A;  4Z2U A;  4FK1 A;  1NHQ A;  4KX6 A;  2E4G A;  2QAE A;  3K30 A;  1M64 A;  2AAQ A;  2Q6U A;  3URH A;  5U63 A;  3SQP A;  2WOI A;  1XAN A;  2NPX A;  1PXB A;  1ZX9 A;  1KSU A;  4ZN0 A;  2XCG A;  1LV0 A;  1PJ6 A;  1F8R A;  2R0P A;  4EMJ A;  3HZL A;  1JU2 A;  2C76 A;  2DKI A;  3AEB A;  1Y56 B;  4EQS A;  2YLW A;  2EQ8 A;  4NEV A;  2BS3 A;  3OZ2 A;  3AYI A;  1CJ2 A;  3G5R A;  2A87 A;  4BJZ A;  2Q0L A;  2XVE A;  3H4K A;  3NGC X;  1GAL A;  2WOV A;  1ELI A;  2XFQ A;  2Z5Y A;  1GTE A;  4BK2 A;  4GR1 A;  5M10 A;  4YSY A;  1ZOV A;  4DSH A;  5KRQ A;  4H2N A;  1NEK A;  4PAB A;  1RYI A;  4FDC B;  2WOW A;  1LQU A;  3Q9T A;  1PXA A;  1S2Y A;  2Y6R A;  1PHH A;  5DBJ A;  1FEC A;  2VQ7 A;  1F3P A;  1IUS A;  3ICR A;  4OPG A;  4C77 A;  4GCM A;  1JRZ A;  1NEN A;  2X8C A;  1S2Q A;  2E5V A;  1MO9 A;  3K7M X;  2C73 A;  3ATR A;  4LA1 A;  4U8P A;  3VR9 A;  3P4Q A;  3AD9 B;  4OPU A;  3CIR A;  3NLC A;  3UOY A;  3QSM A;  5BRT A;  4H50 A;  3GMC A;  5CKU A;  2XLR A;  1CF3 A;  2V60 A;  3AE5 A;  3M0O A;  3O0H A;  2HQM A;  4H2R A;  1GSN A;  3D8X A;  1YQZ A;  1IUW A;  3DK9 A;  1KFY A;  3LJP A;  3AE9 A;  1LQT A;  3IF9 A;  4K8D A;  2PHH A;  2EQ6 A;  4B69 A;  1K0J A;  1KDG A;  2FBW A;  4GDE A;  4BV6 A;  2C3D A;  5J60 A;  4RSL A;  5M0Z A;  3LXD A;  2ARD A;  4H4U A;  3P4P A;  3BHK A;  4RG3 A;  3NIX A;  3SGL A;  1PS9 A;  2BS2 A;  4Z44 A;  2YM2 A;  3NRN A;  3DJE A;  1ZDL A;  5HY5 A;  3DK8 A;  3GWD A;  3AE3 A;  5BVA A;  2B9X A;  1L9C A;  1D4D A;  3UKK A;  4LII A;  3AB1 A;  4H4Z A;  3ADA B;  2DKH A;  2R4E A;  1OJ9 A;  3KLJ A;  4EQW A;  2Q7V A;  2VVL G;  2EQ9 A;  3G5S A;  5FS8 A;  4JY3 A;  2WPC A;  4EM4 A;  4K2X A;  1CJ4 A;  3QVR A;  3AYL A;  3KD9 A;  1CJC A;  1XHC A;  2R0G A;  3QFA A;  4DSG A;  1CC4 A;  1OJT A;  3LAD A;  5U1O A;  3DA1 A;  3B6D A;  1BZL A;  2I0Z A;  2UZZ A;  3BNU A;  1GV4 A;  3GD4 A;  4H4T A;  4OPD A;  2XFP A;  2BCP A;  3EPT A;  1GET A;  5KXJ A;  2IVE A;  2OLN A;  1LPF A;  5HHF A;  2X8H A;  4J36 A;  4FK1 C;  2GR3 A;  1PDH A;  1PJ5 A;  4ICY A;  1OJD A;  1TDF A;  3C4N A;  4EIP A;  1RP0 A;  4XWZ A;  2GAH B;  1MOK A;  4YXD A;  3NK1 X;  3AEF A;  1GRE A;  2C65 A;  2BC0 A;  1L9D A;  3CTY A;  3NYC A;  3GRS A;  3FPZ A;  3UP5 A;  3AE7 A;  3WE0 A;  3AE8 A;  3EAO A;  1CJ3 A;  4B1B A;  1DXL A;  1YKJ A;  4IVM B;  5C2T A;  2YR5 A;  3AEG A;  3BHF A;  2WS3 A;  4K5R A;  4B65 A;  2A89 A;  1VG9 A;  4J57 A;  4E0V A;  1YQ3 A;  1KF6 A;  2QA1 A;  2VRM A;  2CVJ A;  4YTN A;  1P2H A;  2V3B A;  3UKQ A;  3AEA A;  2X99 A;  3LZX A;  1ZOY A;  5BUL A;  3ALJ A;  2BAB A;  1PBC A;  3NN0 X;  1PN0 A;  3D1C A;  3AD8 B;  1JNZ A;  1VDC A;  3AE6 A; 
#chains in the Genus database with same CATH topology
 3ZYX A;  2RGO A;  1NG3 A;  1FCD A;  2GAG B;  1IUV A;  1DOB A;  1EL5 A;  4EQR A;  2WP5 A;  3SZW A;  3ALL A;  3P4S A;  4A6N A;  3NYE A;  4GAP A;  3F8R A;  1NHR A;  1HYU A;  2YG3 A;  2XVI A;  2C75 A;  2VRL A;  1AOG A;  2JKC A;  3NKS A;  1TDO A;  3B3R A;  5JCK A;  3QVP A;  5KWF A;  3V76 A;  1B37 A;  4BJY A;  2B9Y A;  2R0C A;  4JQ9 A;  2BK3 A;  4C3X A;  2VZ2 A;  1QJD A;  2WU5 A;  4TM0 A;  2XVF A;  3UKF A;  1LVL A;  3GD3 A;  3AED A;  5EBK A;  4KPR A;  3QSS A;  1L9E A;  4NWZ A;  4IA5 A;  2XYO A;  3AWI A;  3ABV A;  2WET A;  5IQ1 A;  4IVO B;  4YTP A;  1E1L A;  3NHO X;  1EL9 A;  2YLT A;  3S5W A;  4CBQ A;  5FS9 A;  3NH3 X;  4EMW A;  4H4R A;  1BGN A;  3AE2 A;  1GRA A;  1YQ4 A;  1K0I A;  1Y56 A;  2APG A;  2ZBW A;  2BK4 A;  3ZDN A;  1N1P A;  4C5O A;  2WU2 A;  1COY A;  2RGJ A;  3ALM A;  3CGE A;  4Z2T A;  1QO8 A;  5GRT A;  5BUK A;  1PBE A;  3P4R A;  4U2S A;  3K7Q X;  2VVL A;  1GEU A;  2XVH A;  4J33 A;  4RG4 A;  1JRY A;  3CND A;  1ZP0 A;  3AD7 B;  5EOW A;  3RP8 A;  1CHU A;  3AE4 A;  4ADW A;  3BI5 A;  4P9S A;  2H88 A;  2BC1 A;  4O5U A;  1ZMC A;  1GXF A;  4EIQ A;  1E1N A;  3CNT A;  1REO A;  4A9W A;  1H83 A;  2X50 A;  3NTA A;  2JBV A;  3T2Y A;  2WDR A;  1ONF A;  2GVC A;  4DNA A;  2GMJ A;  2YAU A;  4B67 A;  1D7L A;  3DGH A;  4UDQ A;  2XFU A;  4UP3 A;  1EBD A;  1CC6 A;  1BWC A;  3UOZ A;  2EQ7 A;  1S3E A;  4CY6 A;  2YG7 A;  2GV8 A;  4NTE A;  5IQ4 A;  1JOA A;  3PS9 A;  2A8X A;  4NZH A;  4U8M A;  2YLR A;  3QJ4 A;  1KNP A;  4X9M A;  2FJD A;  2Z5X A;  2GMH A;  1OJA A;  4H4S A;  4OPL A;  3FBS A;  2WDV A;  2YLZ A;  5JCL A;  3II4 A;  2BXS A;  5C3J A;  2CUL A;  3ITJ A;  2O9Z A;  2WQY A;  4YSH A;  1O95 A;  2BYB A;  2GR2 A;  1RSG A;  1DOE A;  2WEU A;  2XVJ A;  2BK5 A;  3GYI A;  4GDP A;  4H4Q A;  4JN9 A;  3RHA A;  3SM8 A;  1H6V A;  2B7R A;  2GR1 A;  3FIM B;  1K0L A;  2XLP A;  3UKA A;  1FEA A;  2ACZ A;  3GSI A;  1Q1W A;  1H81 A;  4MJW A;  4WX1 A;  1GRF A;  3JSK A;  3CPH G;  1ZKQ A;  3IHG A;  5KVI A;  1IUX A;  1BF3 A;  2C72 A;  2QA2 A;  2WPE A;  1QLB A;  2YLS A;  2YVF A;  2GQF A;  1TYP A;  4M52 A;  4A7A A;  2ZZ0 A;  3VRA A;  1DOD A;  4CNJ A;  2WHD A;  2PYX A;  4USQ A;  2YVG A;  1E1M A;  4K22 A;  5JCN A;  2XLS A;  3NT6 A;  1DNC A;  1KSS A;  1E1K A;  3DK4 A;  3I3L A;  4AP1 A;  2FJE A;  3DGZ A;  4HA6 A;  4AOX A;  1ZY8 A;  4AOS A;  1GRB A;  3QFB A;  4H7U A;  5KOX A;  2XDO A;  2H89 A;  3UCL A;  4C74 A;  2BS4 A;  3P1W A;  4U8I A;  1GT8 A;  4A65 A;  2AQJ A;  3NTD A;  1VG0 A;  1DOC A;  3C96 A;  1Z6L A;  1NHS A;  5CQF A;  4C3Y A;  4IA6 A;  3UOV A;  1GPE A;  2WP6 A;  2B7S A;  3NK0 X;  3RP7 A;  1TDE A;  2IID A;  2CDU A;  2XLT A;  2V5Z A;  2VQB A;  3GMB A;  4B64 A;  3G5Q A;  4BK1 A;  3BI4 A;  4NTD A;  2YR4 A;  4CNK A;  4XWR A;  4Z24 A;  1F6M A;  4AP3 A;  3I6D A;  1IUT A;  3DJJ A;  2E1M A;  4OVI A;  1N4W A;  4YKF A;  2AR8 A;  4APN A;  4YWO A;  2C3C A;  4D04 A;  1TYT A;  3COX A;  3FMW A;  3CGB A;  2C67 A;  4WCT A;  1NAA A;  4CCR A;  2IVD A;  1EL7 A;  2JB2 A;  4U2L A;  1UKV G;  2V3A A;  5KVH A;  3T0K A;  1GER A;  4OCG A;  4GUV A;  2GEW A;  1X31 B;  2NVK X;  3ISH A;  5FMH A;  1GND A;  3QSE A;  3VRB A;  4A5L A;  4ECH A;  3AEE A;  1N4U A;  2TMD A;  4JY2 A;  4X9N A;  1N4V A;  4XXG A;  2B76 A;  2ZZB A;  3LZW A;  2YQU A;  1D5T A;  1DJN A;  4YTM A;  4YSX A;  3SY4 A;  4UDR A;  2JAE A;  1GOS A;  4CRT A;  3UOX A;  5KMR A;  4OPT A;  3V3N A;  1Q9I A;  2XFO A;  4NTC A;  4TM4 A;  4PAA A;  3SFE A;  2GH5 A;  3DH9 A;  4K7Z A;  2R9Z A;  3PO7 A;  4TM1 A;  2WP9 A;  2VOU A;  4K5S A;  1D7Y A;  1CBO A;  4Z26 A;  1IJH A;  1YY5 A;  2R46 A;  4B63 A;  4ZCC A;  1E7P A;  2W0H A;  1D4E A;  3KA7 A;  2WPF A;  2WDQ A;  4GF7 A;  3VRD B;  3ATQ A;  2GQW A;  1CC2 A;  3UKP A;  1JRX A;  1NDA A;  2YWL A;  3NN6 X;  3KPF A;  4N9X A;  4H4P A;  3BNM A;  1PXC A;  3C4A A;  4ZCD A;  3OC4 A;  4G6G A;  4UDP A;  1E39 A;  2JB1 A;  2RAB A;  1GRT A;  1EL8 A;  1IUU A;  2X8G A;  3ICT A;  1DJQ A;  1MXT A;  1W4X A;  3P9U A;  4X4J A;  3M12 A;  2B9W A;  3EF6 A;  3UTH A;  4U8L A;  4Z2R A;  3AEC A;  3CN8 A;  3VQR A;  2OAL A;  3R9U A;  2R45 A;  3E1T A;  4TLX A;  1B8S A;  4USR A;  3UTE A;  3DJG X;  5FS7 A;  3RNM A;  2JK6 A;  4U8J A;  3CNS A;  1NPX A;  4JDR A;  4H4Y A;  4AT0 A;  1VQW A;  4H4W A;  2V6O A;  3GYJ A;  2CFY A;  2BRY A;  2RGH A;  2YR6 A;  3BI2 A;  5J7X A;  5BRT A;  3GYX A;  1GTH A;  1PBB A;  3AXB A;  1B5Q A;  4Z43 A;  2XFN A;  2X3N A;  1B4V A;  2YVJ A;  3GRT A;  4J2W A;  3S61 A;  2FJB A;  1TDN A;  3Q6J A;  3UKH A;  1JNR A;  4G6H A;  5KNL A;  4HB9 A;  2YG6 A;  4J56 A;  1Y0P A;  2BAC A;  2GF3 A;  3HYW A;  4Y4N A;  4YKG A;  2QCU A;  1XPQ A;  3AE1 A;  2XLU A;  4A99 A;  2J3N A;  5FS6 A;  1FEB A;  3RP6 A;  4J34 A;  1JEH A;  3GWF A;  4CCQ A;  2R4J A;  4EQX A;  1FOH A;  2V61 A;  1M6I A;  3AYJ A;  1F8S A;  4OPI A;  3V3O A;  1L0V A;  1P2E A;  5KOW A;  4FX9 A;  5EB4 A;  1H82 A;  4JNQ A;  2OLO A;  4U8K A;  4A79 A;  4B68 A;  1PJ7 A;  1XDI A;  1H84 A;  3H8I A;  4REK A;  3K7T A;  4D03 A;  2BA9 A;  3T37 A;  2Q0K A;  1PBF A;  1TDK A;  1KNR A;  2F5Z A;  2VVM A;  1O94 A;  5TR3 A;  1ZK7 A;  4JNA A;  3NG7 X;  4GAV A;  4OPC A;  1BKW A;  4U2T A;  2YM1 A;  2JB3 A;  3ICS A;  3CGC A;  3M13 A;  5GSN A;  1H86 A;  3GDP A;  4G74 A;  4H4X A;  3UKL A;  1GRH A;  4DGK A;  4Y4M A;  3KU9 A;  5LV9 A;  4TM3 A;  1CL0 A;  1LTX R;  3HYX A;  4J31 A;  4YSZ A;  1NG4 A;  1BGJ A;  2WBA A;  2YG5 A;  3F8D A;  5HYM A;  4BUR A;  5JCI A;  1GRG A;  1Q1R A;  3CNJ A;  2WES A;  3CGD A;  4O5Q A;  2YLX A;  1GES A;  4GRT A;  5IPY A;  2BCG G;  3CPJ G;  3SZF A;  1H7X A;  3CPI G;  1D4C A;  3DME A;  3LOV A;  2Y6Q A;  1F8W A;  4EMI A;  3IWA A;  4YT0 A;  5L46 A;  4AT2 A;  3LB8 A;  2GRT A;  5ER0 A;  3H8L A;  3HYV A;  2GR0 A;  3UP4 A;  3EAN A;  3UTG A;  4BK3 A;  1K4Q A;  1V59 A;  4H2P A;  3KVE A;  2OAM A;  3T31 A;  5JCM A;  4LU6 A;  1PBD A;  4U8N A;  3NNE A;  3SX6 A;  2C7G A;  4NEW A;  4EM3 A;  4I59 A;  1LJ1 A;  1OJC A;  3GDN A;  4Y4L A;  2TPR A;  3KKJ A;  3NK2 X;  1TRB A;  4CY8 A;  3SFD A;  1H7W A;  3L8K A;  2YG4 A;  3F8P A;  2C70 A;  2ZZC A;  2BXR A;  3PVC A;  4H4V A;  1O5W A;  4I58 A;  4TLZ A;  4IV9 A;  3IC9 A;  1FL2 A;  1ZMD A;  1VRQ B;  2FJA A;  2OA1 A;  3L1R A;  5U25 A;  4A6N B;  4B66 A;  1NHP A;  3IHM A;  3CNP A;  1E6E A;  3NYF A;  3DJD A;  3UTF A;  3FG2 P;  4H2Q A;  1SEZ A;  5EB5 A;  3VR8 A;  2C64 A;  3T2Z A;  4U8O A;  2C66 A;  1S3B A;  3RED A;  5HXI A;  2GB0 A;  4Z25 A;  4Z2U A;  4FK1 A;  1NHQ A;  4KX6 A;  2E4G A;  2QAE A;  3K30 A;  1M64 A;  2AAQ A;  2Q6U A;  3URH A;  5U63 A;  3SQP A;  2WOI A;  1XAN A;  2NPX A;  1PXB A;  1ZX9 A;  1KSU A;  4ZN0 A;  2XCG A;  1LV0 A;  1PJ6 A;  5KMP A;  1F8R A;  3CMM A;  2R0P A;  4EMJ A;  3HZL A;  1JU2 A;  2C76 A;  2DKI A;  3AEB A;  1Y56 B;  4EQS A;  4II3 A;  2YLW A;  2EQ8 A;  4NEV A;  3SZC A;  2BS3 A;  3OZ2 A;  3AYI A;  1CJ2 A;  3G5R A;  2A87 A;  4BJZ A;  2Q0L A;  2XVE A;  2BRA A;  3H4K A;  1GAL A;  3NGC X;  2WOV A;  1ELI A;  2XFQ A;  2Z5Y A;  1GTE A;  4BK2 A;  4GR1 A;  5M10 A;  4YSY A;  1ZOV A;  4DSH A;  5KRQ A;  4H2N A;  1NEK A;  4PAB A;  1RYI A;  4FDC B;  2WOW A;  1LQU A;  3Q9T A;  1PXA A;  1S2Y A;  2Y6R A;  1PHH A;  5DBJ A;  1FEC A;  2VQ7 A;  1F3P A;  1IUS A;  3ICR A;  4OPG A;  4C77 A;  4GCM A;  1JRZ A;  1NEN A;  2X8C A;  1S2Q A;  2E5V A;  1MO9 A;  3K7M X;  2C73 A;  3ATR A;  4LA1 A;  4U8P A;  3SYI A;  3P4Q A;  3AD9 B;  4OPU A;  3CIR A;  3NLC A;  3UOY A;  3QSM A;  4II2 A;  4H50 A;  3GMC A;  5CKU A;  2XLR A;  1CF3 A;  2V60 A;  3AE5 A;  3M0O A;  3O0H A;  2HQM A;  4H2R A;  1GSN A;  3D8X A;  1YQZ A;  1IUW A;  3DK9 A;  1KFY A;  3LJP A;  3AE9 A;  1LQT A;  3IF9 A;  4K8D A;  2PHH A;  2EQ6 A;  5KMQ A;  3SZ0 A;  4B69 A;  1K0J A;  1KDG A;  2FBW A;  4GDE A;  4BV6 A;  2C3D A;  5J60 A;  4RSL A;  5M0Z A;  3LXD A;  2ARD A;  4H4U A;  3P4P A;  3BHK A;  4RG3 A;  3VR9 A;  3NIX A;  3SGL A;  1PS9 A;  2BS2 A;  4Z44 A;  2YM2 A;  3NRN A;  3DJE A;  1ZDL A;  3T2K A;  5HY5 A;  3DK8 A;  3GWD A;  3AE3 A;  5BVA A;  2B9X A;  1L9C A;  1D4D A;  3SXI A;  4LII A;  3AB1 A;  3UKK A;  4H4Z A;  4G73 A;  3ADA B;  3T14 A;  2DKH A;  2R4E A;  1OJ9 A;  3KLJ A;  4EQW A;  2Q7V A;  2VVL G;  2EQ9 A;  3G5S A;  5FS8 A;  4JY3 A;  2WPC A;  4EM4 A;  4K2X A;  1CJ4 A;  3QVR A;  3AYL A;  3KD9 A;  1CJC A;  1XHC A;  2R0G A;  3QFA A;  4DSG A;  1CC4 A;  1OJT A;  3LAD A;  5U1O A;  3DA1 A;  3B6D A;  1BZL A;  2I0Z A;  2UZZ A;  3BNU A;  1GV4 A;  3GD4 A;  4H4T A;  4OPD A;  2XFP A;  2BCP A;  3EPT A;  1GET A;  5KXJ A;  2IVE A;  2OLN A;  1LPF A;  5HHF A;  4NNJ A;  2X8H A;  4J36 A;  4FK1 C;  2GR3 A;  1PDH A;  5KMS A;  1PJ5 A;  4ICY A;  1OJD A;  1TDF A;  3C4N A;  4EIP A;  1RP0 A;  4XWZ A;  2GAH B;  1MOK A;  4YXD A;  2C4C A;  3NK1 X;  3AEF A;  1GRE A;  2C65 A;  2BC0 A;  1L9D A;  3CTY A;  3NYC A;  3GRS A;  3FPZ A;  3UP5 A;  3AE7 A;  3WE0 A;  3AE8 A;  4G9K A;  3EAO A;  1CJ3 A;  4B1B A;  1DXL A;  1YKJ A;  4IVM B;  5C2T A;  2YR5 A;  3AEG A;  3BHF A;  2WS3 A;  4K5R A;  4B65 A;  2A89 A;  1VG9 A;  4J57 A;  4E0V A;  1YQ3 A;  1KF6 A;  2QA1 A;  2VRM A;  2CVJ A;  4YTN A;  1P2H A;  2V3B A;  3KPK A;  3AEA A;  3UKQ A;  2X99 A;  3LZX A;  1ZOY A;  5BUL A;  3ALJ A;  2BAB A;  1PBC A;  3NN0 X;  1PN0 A;  3D1C A;  3AD8 B;  1JNZ A;  1VDC A;  3AE6 A; 
#chains in the Genus database with same CATH homology
 3ZYX A;  2RGO A;  1NG3 A;  1FCD A;  2GAG B;  1IUV A;  1DOB A;  1EL5 A;  4EQR A;  2WP5 A;  3SZW A;  3ALL A;  3P4S A;  4A6N A;  3NYE A;  4GAP A;  3F8R A;  1NHR A;  1HYU A;  2YG3 A;  2XVI A;  2C75 A;  2VRL A;  1AOG A;  2JKC A;  3NKS A;  1TDO A;  3B3R A;  5JCK A;  3QVP A;  5KWF A;  3V76 A;  1B37 A;  4BJY A;  2B9Y A;  2R0C A;  4JQ9 A;  2BK3 A;  4C3X A;  2VZ2 A;  1QJD A;  2WU5 A;  4TM0 A;  2XVF A;  3UKF A;  1LVL A;  3GD3 A;  3AED A;  5EBK A;  4KPR A;  3QSS A;  1L9E A;  4NWZ A;  4IA5 A;  2XYO A;  3AWI A;  3ABV A;  2WET A;  5IQ1 A;  4IVO B;  4YTP A;  1E1L A;  3NHO X;  1EL9 A;  2YLT A;  3S5W A;  4CBQ A;  5FS9 A;  3NH3 X;  4EMW A;  4H4R A;  1BGN A;  3AE2 A;  1GRA A;  1YQ4 A;  1K0I A;  1Y56 A;  2APG A;  2ZBW A;  2BK4 A;  3ZDN A;  1N1P A;  4C5O A;  2WU2 A;  1COY A;  2RGJ A;  3ALM A;  3CGE A;  4Z2T A;  1QO8 A;  5GRT A;  5BUK A;  1PBE A;  3P4R A;  4U2S A;  3K7Q X;  2VVL A;  1GEU A;  2XVH A;  4J33 A;  4RG4 A;  1JRY A;  3CND A;  1ZP0 A;  3AD7 B;  5EOW A;  3RP8 A;  1CHU A;  3AE4 A;  4ADW A;  3BI5 A;  4P9S A;  2H88 A;  2BC1 A;  4O5U A;  1ZMC A;  1GXF A;  4EIQ A;  1E1N A;  3CNT A;  1REO A;  4A9W A;  1H83 A;  2X50 A;  3NTA A;  2JBV A;  3T2Y A;  2WDR A;  1ONF A;  2GVC A;  4DNA A;  2GMJ A;  2YAU A;  4B67 A;  1D7L A;  3DGH A;  4UDQ A;  2XFU A;  4UP3 A;  1EBD A;  1CC6 A;  1BWC A;  3UOZ A;  2EQ7 A;  1S3E A;  4CY6 A;  2YG7 A;  2GV8 A;  4NTE A;  5IQ4 A;  1JOA A;  3PS9 A;  2A8X A;  4NZH A;  4U8M A;  2YLR A;  3QJ4 A;  1KNP A;  4X9M A;  2FJD A;  2Z5X A;  2GMH A;  1OJA A;  4H4S A;  4OPL A;  3FBS A;  2WDV A;  2YLZ A;  5JCL A;  3II4 A;  2BXS A;  5C3J A;  2CUL A;  3ITJ A;  2O9Z A;  2WQY A;  4YSH A;  1O95 A;  2BYB A;  2GR2 A;  1RSG A;  1DOE A;  2WEU A;  2XVJ A;  2BK5 A;  3GYI A;  4GDP A;  4H4Q A;  4JN9 A;  3RHA A;  3SM8 A;  1H6V A;  2B7R A;  2GR1 A;  3FIM B;  1K0L A;  2XLP A;  3UKA A;  1FEA A;  2ACZ A;  3GSI A;  1Q1W A;  1H81 A;  4MJW A;  4WX1 A;  1GRF A;  3JSK A;  3CPH G;  1ZKQ A;  3IHG A;  5KVI A;  1IUX A;  1BF3 A;  2C72 A;  2QA2 A;  2WPE A;  1QLB A;  2YLS A;  2YVF A;  2GQF A;  1TYP A;  4M52 A;  4A7A A;  2ZZ0 A;  3VRA A;  1DOD A;  4CNJ A;  2WHD A;  2PYX A;  4USQ A;  2YVG A;  1E1M A;  4K22 A;  5JCN A;  2XLS A;  3NT6 A;  1DNC A;  1KSS A;  1E1K A;  3DK4 A;  3I3L A;  4AP1 A;  2FJE A;  3DGZ A;  4HA6 A;  4AOX A;  1ZY8 A;  4AOS A;  1GRB A;  3QFB A;  4H7U A;  5KOX A;  2XDO A;  2H89 A;  3UCL A;  4C74 A;  2BS4 A;  3P1W A;  4U8I A;  1GT8 A;  4A65 A;  2AQJ A;  3NTD A;  1VG0 A;  1DOC A;  3C96 A;  1Z6L A;  1NHS A;  5CQF A;  4C3Y A;  4IA6 A;  3UOV A;  1GPE A;  2WP6 A;  2B7S A;  3NK0 X;  3RP7 A;  1TDE A;  2IID A;  2CDU A;  2XLT A;  2V5Z A;  2VQB A;  3GMB A;  4B64 A;  3G5Q A;  4BK1 A;  3BI4 A;  4NTD A;  2YR4 A;  4CNK A;  4XWR A;  4Z24 A;  1F6M A;  4AP3 A;  3I6D A;  1IUT A;  3DJJ A;  2E1M A;  4OVI A;  1N4W A;  4YKF A;  2AR8 A;  4APN A;  4YWO A;  2C3C A;  4D04 A;  1TYT A;  3COX A;  3FMW A;  3CGB A;  2C67 A;  4WCT A;  1NAA A;  4CCR A;  2IVD A;  1EL7 A;  2JB2 A;  4U2L A;  1UKV G;  2V3A A;  5KVH A;  3T0K A;  1GER A;  4OCG A;  4GUV A;  2GEW A;  1X31 B;  2NVK X;  3ISH A;  5FMH A;  1GND A;  3QSE A;  3VRB A;  4A5L A;  4ECH A;  3AEE A;  1N4U A;  2TMD A;  4JY2 A;  4X9N A;  1N4V A;  4XXG A;  2B76 A;  2ZZB A;  3LZW A;  2YQU A;  1D5T A;  1DJN A;  4YTM A;  4YSX A;  3SY4 A;  4UDR A;  2JAE A;  1GOS A;  4CRT A;  3UOX A;  5KMR A;  4OPT A;  3V3N A;  1Q9I A;  2XFO A;  4NTC A;  4TM4 A;  4PAA A;  3SFE A;  2GH5 A;  3DH9 A;  4K7Z A;  2R9Z A;  3PO7 A;  4TM1 A;  2WP9 A;  2VOU A;  4K5S A;  1D7Y A;  1CBO A;  4Z26 A;  1IJH A;  1YY5 A;  2R46 A;  4B63 A;  4ZCC A;  1E7P A;  2W0H A;  1D4E A;  3KA7 A;  2WPF A;  2WDQ A;  4GF7 A;  3VRD B;  3ATQ A;  2GQW A;  1CC2 A;  3UKP A;  1JRX A;  1NDA A;  2YWL A;  3NN6 X;  3KPF A;  4N9X A;  4H4P A;  3BNM A;  1PXC A;  3C4A A;  4ZCD A;  3OC4 A;  4G6G A;  4UDP A;  1E39 A;  2JB1 A;  2RAB A;  1GRT A;  1EL8 A;  1IUU A;  2X8G A;  3ICT A;  1DJQ A;  1MXT A;  1W4X A;  3P9U A;  4X4J A;  3M12 A;  2B9W A;  3EF6 A;  3UTH A;  4U8L A;  4Z2R A;  3AEC A;  3CN8 A;  3VQR A;  2OAL A;  3R9U A;  2R45 A;  3E1T A;  4TLX A;  1B8S A;  4USR A;  3UTE A;  3DJG X;  5FS7 A;  3RNM A;  2JK6 A;  4U8J A;  3CNS A;  1NPX A;  4JDR A;  4H4Y A;  4AT0 A;  1VQW A;  4H4W A;  2V6O A;  3GYJ A;  2CFY A;  2BRY A;  2RGH A;  2YR6 A;  3BI2 A;  5J7X A;  5BRT A;  3GYX A;  1GTH A;  1PBB A;  3AXB A;  1B5Q A;  4Z43 A;  2XFN A;  2X3N A;  1B4V A;  2YVJ A;  3GRT A;  4J2W A;  3S61 A;  2FJB A;  1TDN A;  3Q6J A;  3UKH A;  1JNR A;  4G6H A;  5KNL A;  4HB9 A;  2YG6 A;  4J56 A;  1Y0P A;  2BAC A;  2GF3 A;  3HYW A;  4Y4N A;  4YKG A;  2QCU A;  1XPQ A;  3AE1 A;  2XLU A;  4A99 A;  2J3N A;  5FS6 A;  1FEB A;  3RP6 A;  4J34 A;  1JEH A;  3GWF A;  4CCQ A;  2R4J A;  4EQX A;  1FOH A;  2V61 A;  1M6I A;  3AYJ A;  1F8S A;  4OPI A;  3V3O A;  1L0V A;  1P2E A;  5KOW A;  4FX9 A;  5EB4 A;  1H82 A;  4JNQ A;  2OLO A;  4U8K A;  4A79 A;  4B68 A;  1PJ7 A;  1XDI A;  1H84 A;  3H8I A;  4REK A;  3K7T A;  4D03 A;  2BA9 A;  3T37 A;  2Q0K A;  1PBF A;  1TDK A;  1KNR A;  2F5Z A;  2VVM A;  1O94 A;  5TR3 A;  1ZK7 A;  4JNA A;  3NG7 X;  4GAV A;  4OPC A;  1BKW A;  4U2T A;  2YM1 A;  2JB3 A;  3ICS A;  3CGC A;  3M13 A;  5GSN A;  1H86 A;  3GDP A;  4G74 A;  4H4X A;  3UKL A;  1GRH A;  4DGK A;  4Y4M A;  3KU9 A;  5LV9 A;  4TM3 A;  1CL0 A;  1LTX R;  3HYX A;  4J31 A;  4YSZ A;  1NG4 A;  1BGJ A;  2WBA A;  2YG5 A;  3F8D A;  5HYM A;  4BUR A;  5JCI A;  1GRG A;  1Q1R A;  3CNJ A;  2WES A;  3CGD A;  4O5Q A;  2YLX A;  1GES A;  4GRT A;  5IPY A;  2BCG G;  3CPJ G;  3SZF A;  1H7X A;  3CPI G;  1D4C A;  3DME A;  3LOV A;  2Y6Q A;  1F8W A;  4EMI A;  3IWA A;  4YT0 A;  5L46 A;  4AT2 A;  3LB8 A;  2GRT A;  5ER0 A;  3H8L A;  3HYV A;  2GR0 A;  3UP4 A;  3EAN A;  3UTG A;  4BK3 A;  1K4Q A;  1V59 A;  4H2P A;  3KVE A;  2OAM A;  3T31 A;  5JCM A;  4LU6 A;  1PBD A;  4U8N A;  3NNE A;  3SX6 A;  2C7G A;  4NEW A;  4EM3 A;  4I59 A;  1LJ1 A;  1OJC A;  3GDN A;  4Y4L A;  2TPR A;  3KKJ A;  3NK2 X;  1TRB A;  4CY8 A;  3SFD A;  1H7W A;  3L8K A;  2YG4 A;  3F8P A;  2C70 A;  2ZZC A;  2BXR A;  3PVC A;  4H4V A;  1O5W A;  4I58 A;  4TLZ A;  4IV9 A;  3IC9 A;  1FL2 A;  1ZMD A;  1VRQ B;  2FJA A;  2OA1 A;  3L1R A;  5U25 A;  4A6N B;  4B66 A;  1NHP A;  3IHM A;  3CNP A;  1E6E A;  3NYF A;  3DJD A;  3UTF A;  3FG2 P;  4H2Q A;  1SEZ A;  5EB5 A;  3VR8 A;  2C64 A;  3T2Z A;  4U8O A;  2C66 A;  1S3B A;  3RED A;  5HXI A;  2GB0 A;  4Z25 A;  4Z2U A;  4FK1 A;  1NHQ A;  4KX6 A;  2E4G A;  2QAE A;  3K30 A;  1M64 A;  2AAQ A;  2Q6U A;  3URH A;  5U63 A;  3SQP A;  2WOI A;  1XAN A;  2NPX A;  1PXB A;  1ZX9 A;  1KSU A;  4ZN0 A;  2XCG A;  1LV0 A;  1PJ6 A;  5KMP A;  1F8R A;  3CMM A;  2R0P A;  4EMJ A;  3HZL A;  1JU2 A;  2C76 A;  2DKI A;  3AEB A;  1Y56 B;  4EQS A;  4II3 A;  2YLW A;  2EQ8 A;  4NEV A;  3SZC A;  2BS3 A;  3OZ2 A;  3AYI A;  1CJ2 A;  3G5R A;  2A87 A;  4BJZ A;  2Q0L A;  2XVE A;  2BRA A;  3H4K A;  1GAL A;  3NGC X;  2WOV A;  1ELI A;  2XFQ A;  2Z5Y A;  1GTE A;  4BK2 A;  4GR1 A;  5M10 A;  4YSY A;  1ZOV A;  4DSH A;  5KRQ A;  4H2N A;  1NEK A;  4PAB A;  1RYI A;  4FDC B;  2WOW A;  1LQU A;  3Q9T A;  1PXA A;  1S2Y A;  2Y6R A;  1PHH A;  5DBJ A;  1FEC A;  2VQ7 A;  1F3P A;  1IUS A;  3ICR A;  4OPG A;  4C77 A;  4GCM A;  1JRZ A;  1NEN A;  2X8C A;  1S2Q A;  2E5V A;  1MO9 A;  3K7M X;  2C73 A;  3ATR A;  4LA1 A;  4U8P A;  3SYI A;  3P4Q A;  3AD9 B;  4OPU A;  3CIR A;  3NLC A;  3UOY A;  3QSM A;  4II2 A;  4H50 A;  3GMC A;  5CKU A;  2XLR A;  1CF3 A;  2V60 A;  3AE5 A;  3M0O A;  3O0H A;  2HQM A;  4H2R A;  1GSN A;  3D8X A;  1YQZ A;  1IUW A;  3DK9 A;  1KFY A;  3LJP A;  3AE9 A;  1LQT A;  3IF9 A;  4K8D A;  2PHH A;  2EQ6 A;  5KMQ A;  3SZ0 A;  4B69 A;  1K0J A;  1KDG A;  2FBW A;  4GDE A;  4BV6 A;  2C3D A;  5J60 A;  4RSL A;  5M0Z A;  3LXD A;  2ARD A;  4H4U A;  3P4P A;  3BHK A;  4RG3 A;  3VR9 A;  3NIX A;  3SGL A;  1PS9 A;  2BS2 A;  4Z44 A;  2YM2 A;  3NRN A;  3DJE A;  1ZDL A;  3T2K A;  5HY5 A;  3DK8 A;  3GWD A;  3AE3 A;  5BVA A;  2B9X A;  1L9C A;  1D4D A;  3SXI A;  4LII A;  3AB1 A;  3UKK A;  4H4Z A;  4G73 A;  3ADA B;  3T14 A;  2DKH A;  2R4E A;  1OJ9 A;  3KLJ A;  4EQW A;  2Q7V A;  2VVL G;  2EQ9 A;  3G5S A;  5FS8 A;  4JY3 A;  2WPC A;  4EM4 A;  4K2X A;  1CJ4 A;  3QVR A;  3AYL A;  3KD9 A;  1CJC A;  1XHC A;  2R0G A;  3QFA A;  4DSG A;  1CC4 A;  1OJT A;  3LAD A;  5U1O A;  3DA1 A;  3B6D A;  1BZL A;  2I0Z A;  2UZZ A;  3BNU A;  1GV4 A;  3GD4 A;  4H4T A;  4OPD A;  2XFP A;  2BCP A;  3EPT A;  1GET A;  5KXJ A;  2IVE A;  2OLN A;  1LPF A;  5HHF A;  4NNJ A;  2X8H A;  4J36 A;  4FK1 C;  2GR3 A;  1PDH A;  5KMS A;  1PJ5 A;  4ICY A;  1OJD A;  1TDF A;  3C4N A;  4EIP A;  1RP0 A;  4XWZ A;  2GAH B;  1MOK A;  4YXD A;  2C4C A;  3NK1 X;  3AEF A;  1GRE A;  2C65 A;  2BC0 A;  1L9D A;  3CTY A;  3NYC A;  3GRS A;  3FPZ A;  3UP5 A;  3AE7 A;  3WE0 A;  3AE8 A;  4G9K A;  3EAO A;  1CJ3 A;  4B1B A;  1DXL A;  1YKJ A;  4IVM B;  5C2T A;  2YR5 A;  3AEG A;  3BHF A;  2WS3 A;  4K5R A;  4B65 A;  2A89 A;  1VG9 A;  4J57 A;  4E0V A;  1YQ3 A;  1KF6 A;  2QA1 A;  2VRM A;  2CVJ A;  4YTN A;  1P2H A;  2V3B A;  3KPK A;  3AEA A;  3UKQ A;  2X99 A;  3LZX A;  1ZOY A;  5BUL A;  3ALJ A;  2BAB A;  1PBC A;  3NN0 X;  1PN0 A;  3D1C A;  3AD8 B;  1JNZ A;  1VDC A;  3AE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...