4G73A

Crystal structure of ndh with nadh and quinone
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
472
structure length
472
Chain Sequence
TMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
total genus 163
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g73A00
4G74A 3HYXA 4NWZA 3SYIA 3SX6A 3SZ0A 4G73A 4GAPA 3T2YA 3T14A 4G6GA 3SZWA 3T2KA 4G6HA 3SZFA 4GAVA 5KMSA 3KPKA 4G9KA 3HYVA 5KMQA 3SZCA 3T31A 5KMPA 3T0KA 3HYWA 3SXIA 5KMRA 3T2ZA 3SY4A
chains in the Genus database with same CATH superfamily
3I3LA 2JKCA 4TM0A 5M0ZA 1N4VA 5LV9A 1CC6A 2GF3A 4H4ZA 3CNSA 3GD3A 1VG0A 3L8KA 3UOZA 4A7AA 4YTMA 3SZ0A 2EQ7A 1D7LA 4GAPA 3LB8A 4U8KA 3UKPA 1AOGA 3P9UA 4H7UA 2YG3A 2WDVA 3GRTA 5BULA 2B76A 2C64A 4OPGA 1ZMCA 1VQWA 3QJ4A 1RP0A 2CDUA 4GF7A 1JOAA 3KPKA 1PN0A 1CJCA 3HYVA 2W0HA 4K5RA 4ZN0A 4YSYA 5KMPA 1FOHA 1EBDA 3FIMB 3HYWA 3EPTA 5JCIA 2H88A 2WP5A 1ONFA 5HYMA 1TDOA 4NEWA 3KPFA 5KVIA 4IV9A 1GEUA 2YR4A 3AE8A 1DODA 1JNRA 1Y56A 3F8PA 5EB5A 1EL5A 4CCRA 2TPRA 3FG2P 2C4CA 4HB9A 1IJHA 1Y0PA 1F6MA 1NHQA 1E1NA 1H7XA 2ARDA 2GAHB 1ZDLA 2X8GA 4J2WA 4GUVA 1XPQA 4YSZA 4J36A 3NYCA 4WCTA 3NGCX 1DOCA 3GMCA 4O5UA 1P2EA 4AP3A 1TRBA 3DK4A 3LZXA 3NK0X 3RNMA 2BK4A 2V60A 4U8PA 3NIXA 3AEFA 4AP1A 3KU9A 1XDIA 2B7RA 2WPFA 3GYXA 1BGNA 1JRYA 3AEGA 3D1CA 4C5OA 3LZWA 1CC2A 1ZY8A 4EQSA 5EB4A 4DNAA 1L9EA 2B9WA 2BXSA 3UTGA 2C3DA 4D04A 1Z6LA 2BK5A 2EQ6A 4OPCA 4CBQA 4Z44A 2IIDA 1M64A 5FMHA 4N9XA 3AB1A 3CPIG 2GEWA 3T2YA 3JSKA 1IUXA 1JEHA 2RGHA 2BABA 2Q7VA 3DJGX 4M52A 1NG3A 2GR2A 1GT8A 2JAEA 1NHSA 2XFNA 3NRNA 1JU2A 5CQFA 1PHHA 1XANA 4AOSA 3F8RA 4REKA 5KNLA 1NG4A 2R4JA 1M6IA 4K5SA 4O5QA 4UDRA 1E39A 1PBCA 3QSMA 3T0KA 4Y4MA 4RSLA 2R9ZA 1E1KA 2XVFA 4G74A 3NH3X 3AD9B 1CC4A 3G5RA 1IUUA 1F3PA 2WHDA 1N4WA 3E1TA 3KVEA 1EL9A 4TLZA 1CHUA 4GDPA 3AYIA 1DXLA 3NTAA 4OPTA 4OPDA 1QLBA 5HXIA 3GMBA 3SM8A 2GAGB 2XVEA 2WQYA 3AEBA 3DGHA 2XLPA 4CRTA 1GREA 4H4XA 3UKLA 4U8LA 4USRA 2GQWA 3I6DA 3AECA 2R0PA 5GRTA 1YQ4A 5KMRA 1IUVA 1K4QA 1CJ3A 3ISHA 4EQXA 3P4RA 3HYXA 3CNDA 5KXJA 2C75A 5J7XA 1XHCA 2JBVA 4OPIA 3SGLA 3NNEA 5BVAA 2IVEA 2BACA 1ZKQA 2R46A 1NHRA 3SQPA 4Z25A 4USQA 2ZZCA 5KOWA 1H81A 1DJNA 2VQ7A 2Y6RA 1LJ1A 4DSGA 5U63A 3T2KA 1X31B 4GCMA 1NAAA 3GSIA 1TDEA 4H4SA 4YT0A 5C2TA 5HHFA 3CPHG 1PBEA 2BYBA 3AE7A 1S3BA 4JDRA 5KOXA 2GMJA 3ATQA 4APNA 1O94A 1H84A 1PXCA 1CJ4A 2YLWA 3HZLA 3KA7A 1GRHA 2FBWA 4K22A 3SFDA 4YXDA 4EIQA 4Y4LA 1B4VA 3T2ZA 3NKSA 4BURA 4IA6A 2WOWA 1VG9A 2C7GA 1W4XA 4B1BA 3NG7X 1GNDA 2E1MA 2YG4A 4OPUA 1OJ9A 2APGA 3DGZA 3K7MX 4YWOA 3SX6A 2XDOA 3AE2A 5JCNA 3O0HA 3H8IA 2C67A 2Z5YA 2Q0KA 3T14A 3UKKA 3V3OA 4C3XA 3PO7A 1D4EA 1YQ3A 3VRAA 4H4QA 2V61A 4TM3A 3VR9A 4U8NA 4FK1C 3F8DA 3NK2X 4BJYA 3DMEA 2WS3A 1Q1WA 2Q6UA 1CL0A 3QSSA 2WU5A 4UDQA 2RGOA 3RP6A 3ITJA 4U8OA 5FS8A 1FCDA 3CGEA 3UOYA 1D4DA 1LPFA 1REOA 3NN6X 4E0VA 4OPLA 4CNJA 4H4YA 3VRBA 2BA9A 1TYTA 2JB2A 1KSSA 1YKJA 4NWZA 5U25A 5IQ4A 4K7ZA 2PYXA 3GWDA 3AE4A 3ALLA 4TM1A 4GRTA 3QFBA 3BI4A 1TDNA 2VRMA 2V3AA 4I58A 1QJDA 4U2SA 2GB0A 2YG7A 4U2LA 1H86A 1NEKA 2B9YA 2I0ZA 3NHOX 2V5ZA 5EOWA 2HQMA 4A79A 3AE5A 2X8CA 4II3A 2FJAA 1DOEA 2UZZA 4K2XA 4Y4NA 2QAEA 1OJDA 1KNRA 1Q9IA 5U1OA 3CPJG 3GD4A 2GR3A 1KFYA 2F5ZA 3P4PA 3SXIA 4JNQA 1BGJA 4A6NB 2BS4A 4AT0A 2C76A 3DA1A 4BV6A 3K7TA 3ICTA 3GWFA 3NTDA 3GDPA 2R4EA 4TM4A 3CIRA 5L46A 3PS9A 2FJEA 1LVLA 1ZP0A 3NYFA 4BK1A 4CY6A 4H4TA 1ZK7A 4PABA 2WOVA 3H8LA 3CGDA 2XFPA 1H7WA 2WDRA 4YSXA 2GVCA 1YY5A 2YVJA 1PXAA 4YTPA 1TYPA 2VVMA 1PBBA 1CF3A 2XFQA 4PAAA 1H82A 3QVPA 4U8JA 1RYIA 1GRTA 2YG6A 4J57A 4H50A 3WE0A 2JB1A 3NT6A 4A6NA 4JY2A 2AR8A 4H2NA 3VR8A 2GR1A 3BI2A 1PJ6A 3C4NA 2GR0A 3IF9A 5IQ1A 4Z2TA 1MXTA 4IA5A 5HY5A 1O95A 1S2YA 3BHKA 3CGBA 1DNCA 4HA6A 4LIIA 2QA2A 4H2RA 2XLSA 1F8SA 3AE9A 2XVIA 1IUWA 4WX1A 1B37A 3G5SA 2YVGA 2OLOA 4H4UA 5BRTA 5KVHA 1E6EA 5M10A 1HYUA 2BCGG 1FECA 4NTDA 3CGCA 3G5QA 1UKVG 2R0GA 4B64A 2Q0LA 5KMQA 3D8XA 3ABVA 1L0VA 3RP8A 1NHPA 4K8DA 4Z2UA 2C73A 2OA1A 3FMWA 4B66A 1CBOA 1TDKA 3ADAB 1GETA 4NTCA 3AEDA 4RG4A 4KPRA 1TDFA 3ICRA 5CKUA 2DKHA 4Z26A 1NPXA 2BK3A 3SYIA 1IUSA 3DK9A 2NPXA 4AT2A 4Z43A 4YSHA 3B6DA 4NTEA 1JRZA 1ZMDA 4XWRA 1GSNA 2R0CA 4Z24A 4Z2RA 1KSUA 3KLJA 2B7SA 1BZLA 1JNZA 2WOIA 4ZCCA 4EIPA 5KMSA 2WETA 1PJ5A 3NK1X 4XXGA 3VRDB 1F8WA 2VRLA 4FX9A 3RP7A 4ZCDA 4BK3A 2V3BA 2ZZBA 3AE1A 2XVHA 3P4SA 2YM2A 1E1MA 2JB3A 4I59A 1BF3A 3ICSA 1L9CA 2WP6A 3AYLA 2FJBA 2GQFA 2X50A 4MJWA 3Q6JA 2V6OA 4CY8A 5JCKA 2C66A 5J60A 2YLSA 1VDCA 3GDNA 3CNJA 4JY3A 2BC1A 4BJZA 5KWFA 1PDHA 1GRFA 1SEZA 3DK8A 4GR1A 4YTNA 2BCPA 3ATRA 3QFAA 4U2TA 2YM1A 4J34A 4IVOB 3FPZA 3QVRA 3ZDNA 2BXRA 3VQRA 4KX6A 1BWCA 1QO8A 2C72A 2XLUA 2CULA 3LJPA 5FS9A 2VZ2A 2R45A 2WPCA 2CVJA 2J3NA 3AD8B 3RHAA 4AOXA 1VRQB 3IHMA 1COYA 1D7YA 2YLTA 1GALA 1Q1RA 2PHHA 1K0LA 1YQZA 3GRSA 3C4AA 2XYOA 2X3NA 4GDEA 2H89A 4G6GA 4YKGA 1H83A 2BRAA 1PBDA 1F8RA 4G6HA 3SZFA 3V76A 3H4KA 2XLRA 1FEAA 4FK1A 5C3JA 2VQBA 2EQ8A 1GRGA 2YQUA 2ZBWA 3CNPA 3T37A 2X8HA 3V3NA 1EL8A 1LQTA 2XFUA 4A99A 1PS9A 3COXA 2YLXA 3UKAA 1GXFA 2YLRA 3LADA 4EM4A 1FL2A 4EQRA 3QSEA 3UTHA 3R9UA 3M13A 1K0JA 4B68A 1KF6A 3KKJA 4IVMB 1DOBA 3LXDA 3UCLA 2EQ9A 4B67A 2WU2A 3Q9TA 4OCGA 5GSNA 4J31A 1LV0A 3S5WA 1N1PA 3S61A 2XVJA 3EANA 3IHGA 3AWIA 1L9DA 4NZHA 2XCGA 3NN0X 4X9MA 2QCUA 4YKFA 2YR6A 3UTFA 1GESA 4DSHA 3GYIA 2Y6QA 2BS3A 4UDPA 5FS7A 2WDQA 4UP3A 3UKHA 2YWLA 1KNPA 3UKQA 4DGKA 4G9KA 4LA1A 2A8XA 5JCMA 3KD9A 1O5WA 4J33A 4A9WA 4ECHA 1N4UA 1PXBA 3EAOA 2YLZA 2YR5A 4FDCB 3P1WA 3CTYA 3SY4A 3DJJA 2X99A 4RG3A 2C70A 4ICYA 4D03A 3UP5A 1OJTA 3BNUA 2A89A 3CN8A 1BKWA 1S3EA 2VVLG 2E4GA 1GRAA 3NYEA 1ZOVA 5ER0A 5FS6A 2BS2A 3UP4A 3CNTA 2XLTA 3AE3A 3SZWA 3URHA 2CFYA 3B3RA 3UKFA 1E1LA 5EBKA 4C77A 5BUKA 3DH9A 4GAVA 1D5TA 3FBSA 4JN9A 4NNJA 1D4CA 1GOSA 1PBFA 1ZOYA 4H4WA 3AYJA 4H4PA 1Y56B 4H4RA 4EMJA 3K30A 1GTEA 3SZCA 2IVDA 4JNAA 2WESA 2XFOA 4B63A 3OZ2A 4BK2A 2FJDA 4A65A 4H4VA 1E7PA 2TMDA 4B69A 5IPYA 3K7QX 4ADWA 4U8IA 4X4JA 4EQWA 1GV4A 2A87A 2BC0A 2AQJA 2RABA 4U8MA 2RGJA 1NDAA 4EMWA 3M0OA 1K0IA 1KDGA 2B9XA 4II2A 2OLNA 1EL7A 3BI5A 1DJQA 2AAQA 4H2QA 1OJAA 2WBAA 2Z5XA 4OVIA 2E5VA 3AXBA 4XWZA 2GRTA 1MO9A 3L1RA 1JRXA 3BHFA 2C65A 4C3YA 2GMHA 3BNMA 4TLXA 5KRQA 2DKIA 4H2PA 2WPEA 2YG5A 2BRYA 3AD7B 3T31A 3DJDA 4LU6A 3II4A 3ALJA 1ZX9A 1H6VA 3UOVA 2NVKX 3ALMA 4EMIA 2ZZ0A 4JQ9A 2YVFA 2JK6A 2VOUA 3C96A 3UOXA 3P4QA 5DBJA 4B65A 5TR3A 1LTXR 1FEBA 3AE6A 3M12A 4P9SA 3AEAA 2ACZA 3ZYXA 4A5LA 3UTEA 2WEUA 3LOVA 2OALA 2OAMA 1PJ7A 2VVLA 4G73A 4NEVA 1B8SA 5JCLA 1MOKA 2C3CA 4CNKA 2GV8A 2QA1A 3AEEA 4CCQA 4EM3A 1B5QA 1RSGA 2GH5A 3DJEA 1CJ2A 2O9ZA 3CMMA 3SFEA 3EF6A 3IC9A 3IWAA 4J56A 1GPEA 2YAUA 3REDA 3OC4A 4C74A 1GERA 2WP9A 1IUTA 3PVCA 3GYJA 1P2HA 1GTHA 1GRBA 4X9NA 1LQUA 1NENA 1V59A 1OJCA 3NLCA 1ELIA 1S2QA
chains in the Genus database with same CATH topology
3I3LA 2JKCA 4TM0A 5M0ZA 1N4VA 5LV9A 1CC6A 2GF3A 4H4ZA 3CNSA 3GD3A 1VG0A 3L8KA 3UOZA 4A7AA 4YTMA 3SZ0A 2EQ7A 1D7LA 4GAPA 3LB8A 4U8KA 3UKPA 1AOGA 3P9UA 4H7UA 2YG3A 2WDVA 3GRTA 5BULA 2B76A 2C64A 4OPGA 1ZMCA 1VQWA 3QJ4A 1RP0A 2CDUA 4GF7A 1JOAA 3KPKA 1PN0A 1CJCA 3HYVA 2W0HA 4K5RA 4ZN0A 4YSYA 5KMPA 1FOHA 1EBDA 3FIMB 3HYWA 3EPTA 5JCIA 2H88A 2WP5A 1ONFA 5HYMA 1TDOA 4NEWA 3KPFA 5KVIA 4IV9A 1GEUA 2YR4A 3AE8A 1DODA 1JNRA 1Y56A 3F8PA 5EB5A 1EL5A 4CCRA 2TPRA 3FG2P 2C4CA 4HB9A 1IJHA 1Y0PA 1F6MA 1NHQA 1E1NA 1H7XA 2ARDA 2GAHB 1ZDLA 2X8GA 4J2WA 4GUVA 1XPQA 4YSZA 4J36A 3NYCA 4WCTA 3NGCX 1DOCA 3GMCA 4O5UA 1P2EA 4AP3A 1TRBA 3DK4A 3LZXA 3NK0X 3RNMA 2BK4A 2V60A 4U8PA 3NIXA 3AEFA 4AP1A 3KU9A 1XDIA 2B7RA 2WPFA 3GYXA 1BGNA 1JRYA 3AEGA 3D1CA 4C5OA 3LZWA 1CC2A 1ZY8A 4EQSA 5EB4A 4DNAA 1L9EA 2B9WA 2BXSA 3UTGA 2C3DA 4D04A 1Z6LA 2BK5A 2EQ6A 4OPCA 4CBQA 4Z44A 2IIDA 1M64A 5FMHA 4N9XA 3AB1A 3CPIG 2GEWA 3T2YA 3JSKA 1IUXA 1JEHA 2RGHA 2BABA 2Q7VA 3DJGX 4M52A 1NG3A 2GR2A 1GT8A 2JAEA 1NHSA 2XFNA 3NRNA 1JU2A 5CQFA 1PHHA 1XANA 4AOSA 3F8RA 4REKA 5KNLA 1NG4A 2R4JA 1M6IA 4K5SA 4O5QA 4UDRA 1E39A 1PBCA 3QSMA 3T0KA 4Y4MA 4RSLA 2R9ZA 1E1KA 2XVFA 4G74A 3NH3X 3AD9B 1CC4A 3G5RA 1IUUA 1F3PA 2WHDA 1N4WA 3E1TA 3KVEA 1EL9A 4TLZA 1CHUA 4GDPA 3AYIA 1DXLA 3NTAA 4OPTA 4OPDA 1QLBA 5HXIA 3GMBA 3SM8A 2GAGB 2XVEA 2WQYA 3AEBA 3DGHA 2XLPA 4CRTA 1GREA 4H4XA 3UKLA 4U8LA 4USRA 2GQWA 3I6DA 3AECA 2R0PA 5GRTA 1YQ4A 5KMRA 1IUVA 1K4QA 1CJ3A 3ISHA 4EQXA 3P4RA 3HYXA 3CNDA 5KXJA 2C75A 5J7XA 1XHCA 2JBVA 4OPIA 3SGLA 3NNEA 5BVAA 2IVEA 2BACA 1ZKQA 2R46A 1NHRA 3SQPA 4Z25A 4USQA 2ZZCA 5KOWA 1H81A 1DJNA 2VQ7A 2Y6RA 1LJ1A 4DSGA 5U63A 3T2KA 1X31B 4GCMA 1NAAA 3GSIA 1TDEA 4H4SA 4YT0A 5C2TA 5HHFA 3CPHG 1PBEA 2BYBA 3AE7A 1S3BA 4JDRA 5KOXA 2GMJA 3ATQA 4APNA 1O94A 1H84A 1PXCA 1CJ4A 2YLWA 3HZLA 3KA7A 1GRHA 2FBWA 4K22A 3SFDA 4YXDA 4EIQA 4Y4LA 1B4VA 3T2ZA 3NKSA 4BURA 4IA6A 2WOWA 1VG9A 2C7GA 1W4XA 4B1BA 3NG7X 1GNDA 2E1MA 2YG4A 4OPUA 1OJ9A 2APGA 3DGZA 3K7MX 4YWOA 3SX6A 2XDOA 3AE2A 5JCNA 3O0HA 3H8IA 2C67A 2Z5YA 2Q0KA 3T14A 3UKKA 3V3OA 4C3XA 3PO7A 1D4EA 1YQ3A 3VRAA 4H4QA 2V61A 4TM3A 3VR9A 4U8NA 4FK1C 3F8DA 3NK2X 4BJYA 3DMEA 2WS3A 1Q1WA 2Q6UA 1CL0A 3QSSA 2WU5A 4UDQA 2RGOA 3RP6A 3ITJA 4U8OA 5FS8A 1FCDA 3CGEA 3UOYA 1D4DA 1LPFA 1REOA 3NN6X 4E0VA 4OPLA 4CNJA 4H4YA 3VRBA 2BA9A 1TYTA 2JB2A 1KSSA 1YKJA 4NWZA 5U25A 5IQ4A 4K7ZA 2PYXA 3GWDA 3AE4A 3ALLA 4TM1A 4GRTA 3QFBA 3BI4A 1TDNA 2VRMA 2V3AA 4I58A 1QJDA 4U2SA 2GB0A 2YG7A 4U2LA 1H86A 1NEKA 2B9YA 2I0ZA 3NHOX 2V5ZA 5EOWA 2HQMA 4A79A 3AE5A 2X8CA 4II3A 2FJAA 1DOEA 2UZZA 4K2XA 4Y4NA 2QAEA 1OJDA 1KNRA 1Q9IA 5U1OA 3CPJG 3GD4A 2GR3A 1KFYA 2F5ZA 3P4PA 3SXIA 4JNQA 1BGJA 4A6NB 2BS4A 4AT0A 2C76A 3DA1A 4BV6A 3K7TA 3ICTA 3GWFA 3NTDA 3GDPA 2R4EA 4TM4A 3CIRA 5L46A 3PS9A 2FJEA 1LVLA 1ZP0A 3NYFA 4BK1A 4CY6A 4H4TA 1ZK7A 4PABA 2WOVA 3H8LA 3CGDA 2XFPA 1H7WA 2WDRA 4YSXA 2GVCA 1YY5A 2YVJA 1PXAA 4YTPA 1TYPA 2VVMA 1PBBA 1CF3A 2XFQA 4PAAA 1H82A 3QVPA 4U8JA 1RYIA 1GRTA 2YG6A 4J57A 4H50A 3WE0A 2JB1A 3NT6A 4A6NA 4JY2A 2AR8A 4H2NA 3VR8A 2GR1A 3BI2A 1PJ6A 3C4NA 2GR0A 3IF9A 5IQ1A 4Z2TA 1MXTA 4IA5A 5HY5A 1O95A 1S2YA 3BHKA 3CGBA 1DNCA 4HA6A 4LIIA 2QA2A 4H2RA 2XLSA 1F8SA 3AE9A 2XVIA 1IUWA 4WX1A 1B37A 3G5SA 2YVGA 2OLOA 4H4UA 5BRTA 5KVHA 1E6EA 5M10A 1HYUA 2BCGG 1FECA 4NTDA 3CGCA 3G5QA 1UKVG 2R0GA 4B64A 2Q0LA 5KMQA 3D8XA 3ABVA 1L0VA 3RP8A 1NHPA 4K8DA 4Z2UA 2C73A 2OA1A 3FMWA 4B66A 1CBOA 1TDKA 3ADAB 1GETA 4NTCA 3AEDA 4RG4A 4KPRA 1TDFA 3ICRA 5CKUA 2DKHA 4Z26A 1NPXA 2BK3A 3SYIA 1IUSA 3DK9A 2NPXA 4AT2A 4Z43A 4YSHA 3B6DA 4NTEA 1JRZA 1ZMDA 4XWRA 1GSNA 2R0CA 4Z24A 4Z2RA 1KSUA 3KLJA 2B7SA 1BZLA 1JNZA 2WOIA 4ZCCA 4EIPA 5KMSA 2WETA 1PJ5A 3NK1X 4XXGA 3VRDB 1F8WA 2VRLA 4FX9A 3RP7A 4ZCDA 4BK3A 2V3BA 2ZZBA 3AE1A 2XVHA 3P4SA 2YM2A 1E1MA 2JB3A 4I59A 1BF3A 3ICSA 1L9CA 2WP6A 3AYLA 2FJBA 2GQFA 2X50A 4MJWA 3Q6JA 2V6OA 4CY8A 5JCKA 2C66A 5J60A 2YLSA 1VDCA 3GDNA 3CNJA 4JY3A 2BC1A 4BJZA 5KWFA 1PDHA 1GRFA 1SEZA 3DK8A 4GR1A 4YTNA 2BCPA 3ATRA 3QFAA 4U2TA 2YM1A 4J34A 4IVOB 3FPZA 3QVRA 3ZDNA 2BXRA 3VQRA 4KX6A 1BWCA 1QO8A 2C72A 2XLUA 2CULA 3LJPA 5FS9A 2VZ2A 2R45A 2WPCA 2CVJA 2J3NA 3AD8B 3RHAA 4AOXA 1VRQB 3IHMA 1COYA 1D7YA 2YLTA 1GALA 1Q1RA 2PHHA 1K0LA 1YQZA 3GRSA 3C4AA 2XYOA 2X3NA 4GDEA 2H89A 4G6GA 4YKGA 1H83A 2BRAA 1PBDA 1F8RA 4G6HA 3SZFA 3V76A 3H4KA 2XLRA 1FEAA 4FK1A 5C3JA 2VQBA 2EQ8A 1GRGA 2YQUA 2ZBWA 3CNPA 3T37A 2X8HA 3V3NA 1EL8A 1LQTA 2XFUA 4A99A 1PS9A 3COXA 2YLXA 3UKAA 1GXFA 2YLRA 3LADA 4EM4A 1FL2A 4EQRA 3QSEA 3UTHA 3R9UA 3M13A 1K0JA 4B68A 1KF6A 3KKJA 4IVMB 1DOBA 3LXDA 3UCLA 2EQ9A 4B67A 2WU2A 3Q9TA 4OCGA 5GSNA 4J31A 1LV0A 3S5WA 1N1PA 3S61A 2XVJA 3EANA 3IHGA 3AWIA 1L9DA 4NZHA 2XCGA 3NN0X 4X9MA 2QCUA 4YKFA 2YR6A 3UTFA 1GESA 4DSHA 3GYIA 2Y6QA 2BS3A 4UDPA 5FS7A 2WDQA 4UP3A 3UKHA 2YWLA 1KNPA 3UKQA 4DGKA 4G9KA 4LA1A 2A8XA 5JCMA 3KD9A 1O5WA 4J33A 4A9WA 4ECHA 1N4UA 1PXBA 3EAOA 2YLZA 2YR5A 4FDCB 3P1WA 3CTYA 3SY4A 3DJJA 2X99A 4RG3A 2C70A 4ICYA 4D03A 3UP5A 1OJTA 3BNUA 2A89A 3CN8A 1BKWA 1S3EA 2VVLG 2E4GA 1GRAA 3NYEA 1ZOVA 5ER0A 5FS6A 2BS2A 3UP4A 3CNTA 2XLTA 3AE3A 3SZWA 3URHA 2CFYA 3B3RA 3UKFA 1E1LA 5EBKA 4C77A 5BUKA 3DH9A 4GAVA 1D5TA 3FBSA 4JN9A 4NNJA 1D4CA 1GOSA 1PBFA 1ZOYA 4H4WA 3AYJA 4H4PA 1Y56B 4H4RA 4EMJA 3K30A 1GTEA 3SZCA 2IVDA 4JNAA 2WESA 2XFOA 4B63A 3OZ2A 4BK2A 2FJDA 4A65A 4H4VA 1E7PA 2TMDA 4B69A 5IPYA 3K7QX 4ADWA 4U8IA 4X4JA 4EQWA 1GV4A 2A87A 2BC0A 2AQJA 2RABA 4U8MA 2RGJA 1NDAA 4EMWA 3M0OA 1K0IA 1KDGA 2B9XA 4II2A 2OLNA 1EL7A 3BI5A 1DJQA 2AAQA 4H2QA 1OJAA 2WBAA 2Z5XA 4OVIA 2E5VA 3AXBA 4XWZA 2GRTA 1MO9A 3L1RA 1JRXA 3BHFA 2C65A 4C3YA 2GMHA 3BNMA 4TLXA 5KRQA 2DKIA 4H2PA 2WPEA 2YG5A 2BRYA 3AD7B 3T31A 3DJDA 4LU6A 3II4A 3ALJA 1ZX9A 1H6VA 3UOVA 2NVKX 3ALMA 4EMIA 2ZZ0A 4JQ9A 2YVFA 2JK6A 2VOUA 3C96A 3UOXA 3P4QA 5DBJA 4B65A 5TR3A 1LTXR 1FEBA 3AE6A 3M12A 4P9SA 3AEAA 2ACZA 3ZYXA 4A5LA 3UTEA 2WEUA 3LOVA 2OALA 2OAMA 1PJ7A 2VVLA 4G73A 4NEVA 1B8SA 5JCLA 1MOKA 2C3CA 4CNKA 2GV8A 2QA1A 3AEEA 4CCQA 4EM3A 1B5QA 1RSGA 2GH5A 3DJEA 1CJ2A 2O9ZA 3CMMA 3SFEA 3EF6A 3IC9A 3IWAA 4J56A 1GPEA 2YAUA 3REDA 3OC4A 4C74A 1GERA 2WP9A 1IUTA 3PVCA 3GYJA 1P2HA 1GTHA 1GRBA 4X9NA 1LQUA 1NENA 1V59A 1OJCA 3NLCA 1ELIA 1S2QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G74 A;  3HYX A;  4NWZ A;  3SYI A;  3SX6 A;  3SZ0 A;  4G73 A;  4GAP A;  3T2Y A;  3T14 A;  4G6G A;  3SZW A;  3T2K A;  4G6H A;  3SZF A;  4GAV A;  5KMS A;  3KPK A;  4G9K A;  3HYV A;  5KMQ A;  3SZC A;  3T31 A;  5KMP A;  3T0K A;  3HYW A;  3SXI A;  5KMR A;  3T2Z A;  3SY4 A; 
#chains in the Genus database with same CATH topology
 3I3L A;  2JKC A;  4TM0 A;  5M0Z A;  1N4V A;  5LV9 A;  1CC6 A;  2GF3 A;  4H4Z A;  3CNS A;  3GD3 A;  1VG0 A;  3L8K A;  3UOZ A;  4A7A A;  4YTM A;  3SZ0 A;  2EQ7 A;  1D7L A;  4GAP A;  3LB8 A;  4U8K A;  3UKP A;  1AOG A;  3P9U A;  4H7U A;  2YG3 A;  2WDV A;  3GRT A;  5BUL A;  2B76 A;  2C64 A;  4OPG A;  1ZMC A;  1VQW A;  3QJ4 A;  1RP0 A;  2CDU A;  4GF7 A;  1JOA A;  3KPK A;  1PN0 A;  1CJC A;  3HYV A;  2W0H A;  4K5R A;  4ZN0 A;  4YSY A;  5KMP A;  1FOH A;  1EBD A;  3FIM B;  3HYW A;  3EPT A;  5JCI A;  2H88 A;  2WP5 A;  1ONF A;  5HYM A;  1TDO A;  4NEW A;  3KPF A;  5KVI A;  4IV9 A;  1GEU A;  2YR4 A;  3AE8 A;  1DOD A;  1JNR A;  1Y56 A;  3F8P A;  5EB5 A;  1EL5 A;  4CCR A;  2TPR A;  3FG2 P;  2C4C A;  4HB9 A;  1IJH A;  1Y0P A;  1F6M A;  1NHQ A;  1E1N A;  1H7X A;  2ARD A;  2GAH B;  1ZDL A;  2X8G A;  4J2W A;  4GUV A;  1XPQ A;  4YSZ A;  4J36 A;  3NYC A;  4WCT A;  3NGC X;  1DOC A;  3GMC A;  4O5U A;  1P2E A;  4AP3 A;  1TRB A;  3DK4 A;  3LZX A;  3NK0 X;  3RNM A;  2BK4 A;  2V60 A;  4U8P A;  3NIX A;  3AEF A;  4AP1 A;  3KU9 A;  1XDI A;  2B7R A;  2WPF A;  3GYX A;  1BGN A;  1JRY A;  3AEG A;  3D1C A;  4C5O A;  3LZW A;  1CC2 A;  1ZY8 A;  4EQS A;  5EB4 A;  4DNA A;  1L9E A;  2B9W A;  2BXS A;  3UTG A;  2C3D A;  4D04 A;  1Z6L A;  2BK5 A;  2EQ6 A;  4OPC A;  4CBQ A;  4Z44 A;  2IID A;  1M64 A;  5FMH A;  4N9X A;  3AB1 A;  3CPI G;  2GEW A;  3T2Y A;  3JSK A;  1IUX A;  1JEH A;  2RGH A;  2BAB A;  2Q7V A;  3DJG X;  4M52 A;  1NG3 A;  2GR2 A;  1GT8 A;  2JAE A;  1NHS A;  2XFN A;  3NRN A;  1JU2 A;  5CQF A;  1PHH A;  1XAN A;  4AOS A;  3F8R A;  4REK A;  5KNL A;  1NG4 A;  2R4J A;  1M6I A;  4K5S A;  4O5Q A;  4UDR A;  1E39 A;  1PBC A;  3QSM A;  3T0K A;  4Y4M A;  4RSL A;  2R9Z A;  1E1K A;  2XVF A;  4G74 A;  3NH3 X;  3AD9 B;  1CC4 A;  3G5R A;  1IUU A;  1F3P A;  2WHD A;  1N4W A;  3E1T A;  3KVE A;  1EL9 A;  4TLZ A;  1CHU A;  4GDP A;  3AYI A;  1DXL A;  3NTA A;  4OPT A;  4OPD A;  1QLB A;  5HXI A;  3GMB A;  3SM8 A;  2GAG B;  2XVE A;  2WQY A;  3AEB A;  3DGH A;  2XLP A;  4CRT A;  1GRE A;  4H4X A;  3UKL A;  4U8L A;  4USR A;  2GQW A;  3I6D A;  3AEC A;  2R0P A;  5GRT A;  1YQ4 A;  5KMR A;  1IUV A;  1K4Q A;  1CJ3 A;  3ISH A;  4EQX A;  3P4R A;  3HYX A;  3CND A;  5KXJ A;  2C75 A;  5J7X A;  1XHC A;  2JBV A;  4OPI A;  3SGL A;  3NNE A;  5BVA A;  2IVE A;  2BAC A;  1ZKQ A;  2R46 A;  1NHR A;  3SQP A;  4Z25 A;  4USQ A;  2ZZC A;  5KOW A;  1H81 A;  1DJN A;  2VQ7 A;  2Y6R A;  1LJ1 A;  4DSG A;  5U63 A;  3T2K A;  1X31 B;  4GCM A;  1NAA A;  3GSI A;  1TDE A;  4H4S A;  4YT0 A;  5C2T A;  5HHF A;  3CPH G;  1PBE A;  2BYB A;  3AE7 A;  1S3B A;  4JDR A;  5KOX A;  2GMJ A;  3ATQ A;  4APN A;  1O94 A;  1H84 A;  1PXC A;  1CJ4 A;  2YLW A;  3HZL A;  3KA7 A;  1GRH A;  2FBW A;  4K22 A;  3SFD A;  4YXD A;  4EIQ A;  4Y4L A;  1B4V A;  3T2Z A;  3NKS A;  4BUR A;  4IA6 A;  2WOW A;  1VG9 A;  2C7G A;  1W4X A;  4B1B A;  3NG7 X;  1GND A;  2E1M A;  2YG4 A;  4OPU A;  1OJ9 A;  2APG A;  3DGZ A;  3K7M X;  4YWO A;  3SX6 A;  2XDO A;  3AE2 A;  5JCN A;  3O0H A;  3H8I A;  2C67 A;  2Z5Y A;  2Q0K A;  3T14 A;  3UKK A;  3V3O A;  4C3X A;  3PO7 A;  1D4E A;  1YQ3 A;  3VRA A;  4H4Q A;  2V61 A;  4TM3 A;  3VR9 A;  4U8N A;  4FK1 C;  3F8D A;  3NK2 X;  4BJY A;  3DME A;  2WS3 A;  1Q1W A;  2Q6U A;  1CL0 A;  3QSS A;  2WU5 A;  4UDQ A;  2RGO A;  3RP6 A;  3ITJ A;  4U8O A;  5FS8 A;  1FCD A;  3CGE A;  3UOY A;  1D4D A;  1LPF A;  1REO A;  3NN6 X;  4E0V A;  4OPL A;  4CNJ A;  4H4Y A;  3VRB A;  2BA9 A;  1TYT A;  2JB2 A;  1KSS A;  1YKJ A;  4NWZ A;  5U25 A;  5IQ4 A;  4K7Z A;  2PYX A;  3GWD A;  3AE4 A;  3ALL A;  4TM1 A;  4GRT A;  3QFB A;  3BI4 A;  1TDN A;  2VRM A;  2V3A A;  4I58 A;  1QJD A;  4U2S A;  2GB0 A;  2YG7 A;  4U2L A;  1H86 A;  1NEK A;  2B9Y A;  2I0Z A;  3NHO X;  2V5Z A;  5EOW A;  2HQM A;  4A79 A;  3AE5 A;  2X8C A;  4II3 A;  2FJA A;  1DOE A;  2UZZ A;  4K2X A;  4Y4N A;  2QAE A;  1OJD A;  1KNR A;  1Q9I A;  5U1O A;  3CPJ G;  3GD4 A;  2GR3 A;  1KFY A;  2F5Z A;  3P4P A;  3SXI A;  4JNQ A;  1BGJ A;  4A6N B;  2BS4 A;  4AT0 A;  2C76 A;  3DA1 A;  4BV6 A;  3K7T A;  3ICT A;  3GWF A;  3NTD A;  3GDP A;  2R4E A;  4TM4 A;  3CIR A;  5L46 A;  3PS9 A;  2FJE A;  1LVL A;  1ZP0 A;  3NYF A;  4BK1 A;  4CY6 A;  4H4T A;  1ZK7 A;  4PAB A;  2WOV A;  3H8L A;  3CGD A;  2XFP A;  1H7W A;  2WDR A;  4YSX A;  2GVC A;  1YY5 A;  2YVJ A;  1PXA A;  4YTP A;  1TYP A;  2VVM A;  1PBB A;  1CF3 A;  2XFQ A;  4PAA A;  1H82 A;  3QVP A;  4U8J A;  1RYI A;  1GRT A;  2YG6 A;  4J57 A;  4H50 A;  3WE0 A;  2JB1 A;  3NT6 A;  4A6N A;  4JY2 A;  2AR8 A;  4H2N A;  3VR8 A;  2GR1 A;  3BI2 A;  1PJ6 A;  3C4N A;  2GR0 A;  3IF9 A;  5IQ1 A;  4Z2T A;  1MXT A;  4IA5 A;  5HY5 A;  1O95 A;  1S2Y A;  3BHK A;  3CGB A;  1DNC A;  4HA6 A;  4LII A;  2QA2 A;  4H2R A;  2XLS A;  1F8S A;  3AE9 A;  2XVI A;  1IUW A;  4WX1 A;  1B37 A;  3G5S A;  2YVG A;  2OLO A;  4H4U A;  5BRT A;  5KVH A;  1E6E A;  5M10 A;  1HYU A;  2BCG G;  1FEC A;  4NTD A;  3CGC A;  3G5Q A;  1UKV G;  2R0G A;  4B64 A;  2Q0L A;  5KMQ A;  3D8X A;  3ABV A;  1L0V A;  3RP8 A;  1NHP A;  4K8D A;  4Z2U A;  2C73 A;  2OA1 A;  3FMW A;  4B66 A;  1CBO A;  1TDK A;  3ADA B;  1GET A;  4NTC A;  3AED A;  4RG4 A;  4KPR A;  1TDF A;  3ICR A;  5CKU A;  2DKH A;  4Z26 A;  1NPX A;  2BK3 A;  3SYI A;  1IUS A;  3DK9 A;  2NPX A;  4AT2 A;  4Z43 A;  4YSH A;  3B6D A;  4NTE A;  1JRZ A;  1ZMD A;  4XWR A;  1GSN A;  2R0C A;  4Z24 A;  4Z2R A;  1KSU A;  3KLJ A;  2B7S A;  1BZL A;  1JNZ A;  2WOI A;  4ZCC A;  4EIP A;  5KMS A;  2WET A;  1PJ5 A;  3NK1 X;  4XXG A;  3VRD B;  1F8W A;  2VRL A;  4FX9 A;  3RP7 A;  4ZCD A;  4BK3 A;  2V3B A;  2ZZB A;  3AE1 A;  2XVH A;  3P4S A;  2YM2 A;  1E1M A;  2JB3 A;  4I59 A;  1BF3 A;  3ICS A;  1L9C A;  2WP6 A;  3AYL A;  2FJB A;  2GQF A;  2X50 A;  4MJW A;  3Q6J A;  2V6O A;  4CY8 A;  5JCK A;  2C66 A;  5J60 A;  2YLS A;  1VDC A;  3GDN A;  3CNJ A;  4JY3 A;  2BC1 A;  4BJZ A;  5KWF A;  1PDH A;  1GRF A;  1SEZ A;  3DK8 A;  4GR1 A;  4YTN A;  2BCP A;  3ATR A;  3QFA A;  4U2T A;  2YM1 A;  4J34 A;  4IVO B;  3FPZ A;  3QVR A;  3ZDN A;  2BXR A;  3VQR A;  4KX6 A;  1BWC A;  1QO8 A;  2C72 A;  2XLU A;  2CUL A;  3LJP A;  5FS9 A;  2VZ2 A;  2R45 A;  2WPC A;  2CVJ A;  2J3N A;  3AD8 B;  3RHA A;  4AOX A;  1VRQ B;  3IHM A;  1COY A;  1D7Y A;  2YLT A;  1GAL A;  1Q1R A;  2PHH A;  1K0L A;  1YQZ A;  3GRS A;  3C4A A;  2XYO A;  2X3N A;  4GDE A;  2H89 A;  4G6G A;  4YKG A;  1H83 A;  2BRA A;  1PBD A;  1F8R A;  4G6H A;  3SZF A;  3V76 A;  3H4K A;  2XLR A;  1FEA A;  4FK1 A;  5C3J A;  2VQB A;  2EQ8 A;  1GRG A;  2YQU A;  2ZBW A;  3CNP A;  3T37 A;  2X8H A;  3V3N A;  1EL8 A;  1LQT A;  2XFU A;  4A99 A;  1PS9 A;  3COX A;  2YLX A;  3UKA A;  1GXF A;  2YLR A;  3LAD A;  4EM4 A;  1FL2 A;  4EQR A;  3QSE A;  3UTH A;  3R9U A;  3M13 A;  1K0J A;  4B68 A;  1KF6 A;  3KKJ A;  4IVM B;  1DOB A;  3LXD A;  3UCL A;  2EQ9 A;  4B67 A;  2WU2 A;  3Q9T A;  4OCG A;  5GSN A;  4J31 A;  1LV0 A;  3S5W A;  1N1P A;  3S61 A;  2XVJ A;  3EAN A;  3IHG A;  3AWI A;  1L9D A;  4NZH A;  2XCG A;  3NN0 X;  4X9M A;  2QCU A;  4YKF A;  2YR6 A;  3UTF A;  1GES A;  4DSH A;  3GYI A;  2Y6Q A;  2BS3 A;  4UDP A;  5FS7 A;  2WDQ A;  4UP3 A;  3UKH A;  2YWL A;  1KNP A;  3UKQ A;  4DGK A;  4G9K A;  4LA1 A;  2A8X A;  5JCM A;  3KD9 A;  1O5W A;  4J33 A;  4A9W A;  4ECH A;  1N4U A;  1PXB A;  3EAO A;  2YLZ A;  2YR5 A;  4FDC B;  3P1W A;  3CTY A;  3SY4 A;  3DJJ A;  2X99 A;  4RG3 A;  2C70 A;  4ICY A;  4D03 A;  3UP5 A;  1OJT A;  3BNU A;  2A89 A;  3CN8 A;  1BKW A;  1S3E A;  2VVL G;  2E4G A;  1GRA A;  3NYE A;  1ZOV A;  5ER0 A;  5FS6 A;  2BS2 A;  3UP4 A;  3CNT A;  2XLT A;  3AE3 A;  3SZW A;  3URH A;  2CFY A;  3B3R A;  3UKF A;  1E1L A;  5EBK A;  4C77 A;  5BUK A;  3DH9 A;  4GAV A;  1D5T A;  3FBS A;  4JN9 A;  4NNJ A;  1D4C A;  1GOS A;  1PBF A;  1ZOY A;  4H4W A;  3AYJ A;  4H4P A;  1Y56 B;  4H4R A;  4EMJ A;  3K30 A;  1GTE A;  3SZC A;  2IVD A;  4JNA A;  2WES A;  2XFO A;  4B63 A;  3OZ2 A;  4BK2 A;  2FJD A;  4A65 A;  4H4V A;  1E7P A;  2TMD A;  4B69 A;  5IPY A;  3K7Q X;  4ADW A;  4U8I A;  4X4J A;  4EQW A;  1GV4 A;  2A87 A;  2BC0 A;  2AQJ A;  2RAB A;  4U8M A;  2RGJ A;  1NDA A;  4EMW A;  3M0O A;  1K0I A;  1KDG A;  2B9X A;  4II2 A;  2OLN A;  1EL7 A;  3BI5 A;  1DJQ A;  2AAQ A;  4H2Q A;  1OJA A;  2WBA A;  2Z5X A;  4OVI A;  2E5V A;  3AXB A;  4XWZ A;  2GRT A;  1MO9 A;  3L1R A;  1JRX A;  3BHF A;  2C65 A;  4C3Y A;  2GMH A;  3BNM A;  4TLX A;  5KRQ A;  2DKI A;  4H2P A;  2WPE A;  2YG5 A;  2BRY A;  3AD7 B;  3T31 A;  3DJD A;  4LU6 A;  3II4 A;  3ALJ A;  1ZX9 A;  1H6V A;  3UOV A;  2NVK X;  3ALM A;  4EMI A;  2ZZ0 A;  4JQ9 A;  2YVF A;  2JK6 A;  2VOU A;  3C96 A;  3UOX A;  3P4Q A;  5DBJ A;  4B65 A;  5TR3 A;  1LTX R;  1FEB A;  3AE6 A;  3M12 A;  4P9S A;  3AEA A;  2ACZ A;  3ZYX A;  4A5L A;  3UTE A;  2WEU A;  3LOV A;  2OAL A;  2OAM A;  1PJ7 A;  2VVL A;  4G73 A;  4NEV A;  1B8S A;  5JCL A;  1MOK A;  2C3C A;  4CNK A;  2GV8 A;  2QA1 A;  3AEE A;  4CCQ A;  4EM3 A;  1B5Q A;  1RSG A;  2GH5 A;  3DJE A;  1CJ2 A;  2O9Z A;  3CMM A;  3SFE A;  3EF6 A;  3IC9 A;  3IWA A;  4J56 A;  1GPE A;  2YAU A;  3RED A;  3OC4 A;  4C74 A;  1GER A;  2WP9 A;  1IUT A;  3PVC A;  3GYJ A;  1P2H A;  1GTH A;  1GRB A;  4X9N A;  1LQU A;  1NEN A;  1V59 A;  1OJC A;  3NLC A;  1ELI A;  1S2Q A; 
#chains in the Genus database with same CATH homology
 3I3L A;  2JKC A;  4TM0 A;  5M0Z A;  1N4V A;  5LV9 A;  1CC6 A;  2GF3 A;  4H4Z A;  3CNS A;  3GD3 A;  1VG0 A;  3L8K A;  3UOZ A;  4A7A A;  4YTM A;  3SZ0 A;  2EQ7 A;  1D7L A;  4GAP A;  3LB8 A;  4U8K A;  3UKP A;  1AOG A;  3P9U A;  4H7U A;  2YG3 A;  2WDV A;  3GRT A;  5BUL A;  2B76 A;  2C64 A;  4OPG A;  1ZMC A;  1VQW A;  3QJ4 A;  1RP0 A;  2CDU A;  4GF7 A;  1JOA A;  3KPK A;  1PN0 A;  1CJC A;  3HYV A;  2W0H A;  4K5R A;  4ZN0 A;  4YSY A;  5KMP A;  1FOH A;  1EBD A;  3FIM B;  3HYW A;  3EPT A;  5JCI A;  2H88 A;  2WP5 A;  1ONF A;  5HYM A;  1TDO A;  4NEW A;  3KPF A;  5KVI A;  4IV9 A;  1GEU A;  2YR4 A;  3AE8 A;  1DOD A;  1JNR A;  1Y56 A;  3F8P A;  5EB5 A;  1EL5 A;  4CCR A;  2TPR A;  3FG2 P;  2C4C A;  4HB9 A;  1IJH A;  1Y0P A;  1F6M A;  1NHQ A;  1E1N A;  1H7X A;  2ARD A;  2GAH B;  1ZDL A;  2X8G A;  4J2W A;  4GUV A;  1XPQ A;  4YSZ A;  4J36 A;  3NYC A;  4WCT A;  3NGC X;  1DOC A;  3GMC A;  4O5U A;  1P2E A;  4AP3 A;  1TRB A;  3DK4 A;  3LZX A;  3NK0 X;  3RNM A;  2BK4 A;  2V60 A;  4U8P A;  3NIX A;  3AEF A;  4AP1 A;  3KU9 A;  1XDI A;  2B7R A;  2WPF A;  3GYX A;  1BGN A;  1JRY A;  3AEG A;  3D1C A;  4C5O A;  3LZW A;  1CC2 A;  1ZY8 A;  4EQS A;  5EB4 A;  4DNA A;  1L9E A;  2B9W A;  2BXS A;  3UTG A;  2C3D A;  4D04 A;  1Z6L A;  2BK5 A;  2EQ6 A;  4OPC A;  4CBQ A;  4Z44 A;  2IID A;  1M64 A;  5FMH A;  4N9X A;  3AB1 A;  3CPI G;  2GEW A;  3T2Y A;  3JSK A;  1IUX A;  1JEH A;  2RGH A;  2BAB A;  2Q7V A;  3DJG X;  4M52 A;  1NG3 A;  2GR2 A;  1GT8 A;  2JAE A;  1NHS A;  2XFN A;  3NRN A;  1JU2 A;  5CQF A;  1PHH A;  1XAN A;  4AOS A;  3F8R A;  4REK A;  5KNL A;  1NG4 A;  2R4J A;  1M6I A;  4K5S A;  4O5Q A;  4UDR A;  1E39 A;  1PBC A;  3QSM A;  3T0K A;  4Y4M A;  4RSL A;  2R9Z A;  1E1K A;  2XVF A;  4G74 A;  3NH3 X;  3AD9 B;  1CC4 A;  3G5R A;  1IUU A;  1F3P A;  2WHD A;  1N4W A;  3E1T A;  3KVE A;  1EL9 A;  4TLZ A;  1CHU A;  4GDP A;  3AYI A;  1DXL A;  3NTA A;  4OPT A;  4OPD A;  1QLB A;  5HXI A;  3GMB A;  3SM8 A;  2GAG B;  2XVE A;  2WQY A;  3AEB A;  3DGH A;  2XLP A;  4CRT A;  1GRE A;  4H4X A;  3UKL A;  4U8L A;  4USR A;  2GQW A;  3I6D A;  3AEC A;  2R0P A;  5GRT A;  1YQ4 A;  5KMR A;  1IUV A;  1K4Q A;  1CJ3 A;  3ISH A;  4EQX A;  3P4R A;  3HYX A;  3CND A;  5KXJ A;  2C75 A;  5J7X A;  1XHC A;  2JBV A;  4OPI A;  3SGL A;  3NNE A;  5BVA A;  2IVE A;  2BAC A;  1ZKQ A;  2R46 A;  1NHR A;  3SQP A;  4Z25 A;  4USQ A;  2ZZC A;  5KOW A;  1H81 A;  1DJN A;  2VQ7 A;  2Y6R A;  1LJ1 A;  4DSG A;  5U63 A;  3T2K A;  1X31 B;  4GCM A;  1NAA A;  3GSI A;  1TDE A;  4H4S A;  4YT0 A;  5C2T A;  5HHF A;  3CPH G;  1PBE A;  2BYB A;  3AE7 A;  1S3B A;  4JDR A;  5KOX A;  2GMJ A;  3ATQ A;  4APN A;  1O94 A;  1H84 A;  1PXC A;  1CJ4 A;  2YLW A;  3HZL A;  3KA7 A;  1GRH A;  2FBW A;  4K22 A;  3SFD A;  4YXD A;  4EIQ A;  4Y4L A;  1B4V A;  3T2Z A;  3NKS A;  4BUR A;  4IA6 A;  2WOW A;  1VG9 A;  2C7G A;  1W4X A;  4B1B A;  3NG7 X;  1GND A;  2E1M A;  2YG4 A;  4OPU A;  1OJ9 A;  2APG A;  3DGZ A;  3K7M X;  4YWO A;  3SX6 A;  2XDO A;  3AE2 A;  5JCN A;  3O0H A;  3H8I A;  2C67 A;  2Z5Y A;  2Q0K A;  3T14 A;  3UKK A;  3V3O A;  4C3X A;  3PO7 A;  1D4E A;  1YQ3 A;  3VRA A;  4H4Q A;  2V61 A;  4TM3 A;  3VR9 A;  4U8N A;  4FK1 C;  3F8D A;  3NK2 X;  4BJY A;  3DME A;  2WS3 A;  1Q1W A;  2Q6U A;  1CL0 A;  3QSS A;  2WU5 A;  4UDQ A;  2RGO A;  3RP6 A;  3ITJ A;  4U8O A;  5FS8 A;  1FCD A;  3CGE A;  3UOY A;  1D4D A;  1LPF A;  1REO A;  3NN6 X;  4E0V A;  4OPL A;  4CNJ A;  4H4Y A;  3VRB A;  2BA9 A;  1TYT A;  2JB2 A;  1KSS A;  1YKJ A;  4NWZ A;  5U25 A;  5IQ4 A;  4K7Z A;  2PYX A;  3GWD A;  3AE4 A;  3ALL A;  4TM1 A;  4GRT A;  3QFB A;  3BI4 A;  1TDN A;  2VRM A;  2V3A A;  4I58 A;  1QJD A;  4U2S A;  2GB0 A;  2YG7 A;  4U2L A;  1H86 A;  1NEK A;  2B9Y A;  2I0Z A;  3NHO X;  2V5Z A;  5EOW A;  2HQM A;  4A79 A;  3AE5 A;  2X8C A;  4II3 A;  2FJA A;  1DOE A;  2UZZ A;  4K2X A;  4Y4N A;  2QAE A;  1OJD A;  1KNR A;  1Q9I A;  5U1O A;  3CPJ G;  3GD4 A;  2GR3 A;  1KFY A;  2F5Z A;  3P4P A;  3SXI A;  4JNQ A;  1BGJ A;  4A6N B;  2BS4 A;  4AT0 A;  2C76 A;  3DA1 A;  4BV6 A;  3K7T A;  3ICT A;  3GWF A;  3NTD A;  3GDP A;  2R4E A;  4TM4 A;  3CIR A;  5L46 A;  3PS9 A;  2FJE A;  1LVL A;  1ZP0 A;  3NYF A;  4BK1 A;  4CY6 A;  4H4T A;  1ZK7 A;  4PAB A;  2WOV A;  3H8L A;  3CGD A;  2XFP A;  1H7W A;  2WDR A;  4YSX A;  2GVC A;  1YY5 A;  2YVJ A;  1PXA A;  4YTP A;  1TYP A;  2VVM A;  1PBB A;  1CF3 A;  2XFQ A;  4PAA A;  1H82 A;  3QVP A;  4U8J A;  1RYI A;  1GRT A;  2YG6 A;  4J57 A;  4H50 A;  3WE0 A;  2JB1 A;  3NT6 A;  4A6N A;  4JY2 A;  2AR8 A;  4H2N A;  3VR8 A;  2GR1 A;  3BI2 A;  1PJ6 A;  3C4N A;  2GR0 A;  3IF9 A;  5IQ1 A;  4Z2T A;  1MXT A;  4IA5 A;  5HY5 A;  1O95 A;  1S2Y A;  3BHK A;  3CGB A;  1DNC A;  4HA6 A;  4LII A;  2QA2 A;  4H2R A;  2XLS A;  1F8S A;  3AE9 A;  2XVI A;  1IUW A;  4WX1 A;  1B37 A;  3G5S A;  2YVG A;  2OLO A;  4H4U A;  5BRT A;  5KVH A;  1E6E A;  5M10 A;  1HYU A;  2BCG G;  1FEC A;  4NTD A;  3CGC A;  3G5Q A;  1UKV G;  2R0G A;  4B64 A;  2Q0L A;  5KMQ A;  3D8X A;  3ABV A;  1L0V A;  3RP8 A;  1NHP A;  4K8D A;  4Z2U A;  2C73 A;  2OA1 A;  3FMW A;  4B66 A;  1CBO A;  1TDK A;  3ADA B;  1GET A;  4NTC A;  3AED A;  4RG4 A;  4KPR A;  1TDF A;  3ICR A;  5CKU A;  2DKH A;  4Z26 A;  1NPX A;  2BK3 A;  3SYI A;  1IUS A;  3DK9 A;  2NPX A;  4AT2 A;  4Z43 A;  4YSH A;  3B6D A;  4NTE A;  1JRZ A;  1ZMD A;  4XWR A;  1GSN A;  2R0C A;  4Z24 A;  4Z2R A;  1KSU A;  3KLJ A;  2B7S A;  1BZL A;  1JNZ A;  2WOI A;  4ZCC A;  4EIP A;  5KMS A;  2WET A;  1PJ5 A;  3NK1 X;  4XXG A;  3VRD B;  1F8W A;  2VRL A;  4FX9 A;  3RP7 A;  4ZCD A;  4BK3 A;  2V3B A;  2ZZB A;  3AE1 A;  2XVH A;  3P4S A;  2YM2 A;  1E1M A;  2JB3 A;  4I59 A;  1BF3 A;  3ICS A;  1L9C A;  2WP6 A;  3AYL A;  2FJB A;  2GQF A;  2X50 A;  4MJW A;  3Q6J A;  2V6O A;  4CY8 A;  5JCK A;  2C66 A;  5J60 A;  2YLS A;  1VDC A;  3GDN A;  3CNJ A;  4JY3 A;  2BC1 A;  4BJZ A;  5KWF A;  1PDH A;  1GRF A;  1SEZ A;  3DK8 A;  4GR1 A;  4YTN A;  2BCP A;  3ATR A;  3QFA A;  4U2T A;  2YM1 A;  4J34 A;  4IVO B;  3FPZ A;  3QVR A;  3ZDN A;  2BXR A;  3VQR A;  4KX6 A;  1BWC A;  1QO8 A;  2C72 A;  2XLU A;  2CUL A;  3LJP A;  5FS9 A;  2VZ2 A;  2R45 A;  2WPC A;  2CVJ A;  2J3N A;  3AD8 B;  3RHA A;  4AOX A;  1VRQ B;  3IHM A;  1COY A;  1D7Y A;  2YLT A;  1GAL A;  1Q1R A;  2PHH A;  1K0L A;  1YQZ A;  3GRS A;  3C4A A;  2XYO A;  2X3N A;  4GDE A;  2H89 A;  4G6G A;  4YKG A;  1H83 A;  2BRA A;  1PBD A;  1F8R A;  4G6H A;  3SZF A;  3V76 A;  3H4K A;  2XLR A;  1FEA A;  4FK1 A;  5C3J A;  2VQB A;  2EQ8 A;  1GRG A;  2YQU A;  2ZBW A;  3CNP A;  3T37 A;  2X8H A;  3V3N A;  1EL8 A;  1LQT A;  2XFU A;  4A99 A;  1PS9 A;  3COX A;  2YLX A;  3UKA A;  1GXF A;  2YLR A;  3LAD A;  4EM4 A;  1FL2 A;  4EQR A;  3QSE A;  3UTH A;  3R9U A;  3M13 A;  1K0J A;  4B68 A;  1KF6 A;  3KKJ A;  4IVM B;  1DOB A;  3LXD A;  3UCL A;  2EQ9 A;  4B67 A;  2WU2 A;  3Q9T A;  4OCG A;  5GSN A;  4J31 A;  1LV0 A;  3S5W A;  1N1P A;  3S61 A;  2XVJ A;  3EAN A;  3IHG A;  3AWI A;  1L9D A;  4NZH A;  2XCG A;  3NN0 X;  4X9M A;  2QCU A;  4YKF A;  2YR6 A;  3UTF A;  1GES A;  4DSH A;  3GYI A;  2Y6Q A;  2BS3 A;  4UDP A;  5FS7 A;  2WDQ A;  4UP3 A;  3UKH A;  2YWL A;  1KNP A;  3UKQ A;  4DGK A;  4G9K A;  4LA1 A;  2A8X A;  5JCM A;  3KD9 A;  1O5W A;  4J33 A;  4A9W A;  4ECH A;  1N4U A;  1PXB A;  3EAO A;  2YLZ A;  2YR5 A;  4FDC B;  3P1W A;  3CTY A;  3SY4 A;  3DJJ A;  2X99 A;  4RG3 A;  2C70 A;  4ICY A;  4D03 A;  3UP5 A;  1OJT A;  3BNU A;  2A89 A;  3CN8 A;  1BKW A;  1S3E A;  2VVL G;  2E4G A;  1GRA A;  3NYE A;  1ZOV A;  5ER0 A;  5FS6 A;  2BS2 A;  3UP4 A;  3CNT A;  2XLT A;  3AE3 A;  3SZW A;  3URH A;  2CFY A;  3B3R A;  3UKF A;  1E1L A;  5EBK A;  4C77 A;  5BUK A;  3DH9 A;  4GAV A;  1D5T A;  3FBS A;  4JN9 A;  4NNJ A;  1D4C A;  1GOS A;  1PBF A;  1ZOY A;  4H4W A;  3AYJ A;  4H4P A;  1Y56 B;  4H4R A;  4EMJ A;  3K30 A;  1GTE A;  3SZC A;  2IVD A;  4JNA A;  2WES A;  2XFO A;  4B63 A;  3OZ2 A;  4BK2 A;  2FJD A;  4A65 A;  4H4V A;  1E7P A;  2TMD A;  4B69 A;  5IPY A;  3K7Q X;  4ADW A;  4U8I A;  4X4J A;  4EQW A;  1GV4 A;  2A87 A;  2BC0 A;  2AQJ A;  2RAB A;  4U8M A;  2RGJ A;  1NDA A;  4EMW A;  3M0O A;  1K0I A;  1KDG A;  2B9X A;  4II2 A;  2OLN A;  1EL7 A;  3BI5 A;  1DJQ A;  2AAQ A;  4H2Q A;  1OJA A;  2WBA A;  2Z5X A;  4OVI A;  2E5V A;  3AXB A;  4XWZ A;  2GRT A;  1MO9 A;  3L1R A;  1JRX A;  3BHF A;  2C65 A;  4C3Y A;  2GMH A;  3BNM A;  4TLX A;  5KRQ A;  2DKI A;  4H2P A;  2WPE A;  2YG5 A;  2BRY A;  3AD7 B;  3T31 A;  3DJD A;  4LU6 A;  3II4 A;  3ALJ A;  1ZX9 A;  1H6V A;  3UOV A;  2NVK X;  3ALM A;  4EMI A;  2ZZ0 A;  4JQ9 A;  2YVF A;  2JK6 A;  2VOU A;  3C96 A;  3UOX A;  3P4Q A;  5DBJ A;  4B65 A;  5TR3 A;  1LTX R;  1FEB A;  3AE6 A;  3M12 A;  4P9S A;  3AEA A;  2ACZ A;  3ZYX A;  4A5L A;  3UTE A;  2WEU A;  3LOV A;  2OAL A;  2OAM A;  1PJ7 A;  2VVL A;  4G73 A;  4NEV A;  1B8S A;  5JCL A;  1MOK A;  2C3C A;  4CNK A;  2GV8 A;  2QA1 A;  3AEE A;  4CCQ A;  4EM3 A;  1B5Q A;  1RSG A;  2GH5 A;  3DJE A;  1CJ2 A;  2O9Z A;  3CMM A;  3SFE A;  3EF6 A;  3IC9 A;  3IWA A;  4J56 A;  1GPE A;  2YAU A;  3RED A;  3OC4 A;  4C74 A;  1GER A;  2WP9 A;  1IUT A;  3PVC A;  3GYJ A;  1P2H A;  1GTH A;  1GRB A;  4X9N A;  1LQU A;  1NEN A;  1V59 A;  1OJC A;  3NLC A;  1ELI A;  1S2Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...