4G73A

Crystal structure of ndh with nadh and quinone
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
472
structure length
472
Chain Sequence
TMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 163
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g73A00
5KMPA 3T2KA 3HYWA 3SZFA 4G6GA 5KMSA 4G6HA 3T2YA 4G73A 3SZWA 3T2ZA 4GAPA 5KMRA 4G74A 5KMQA 3SXIA 3HYXA 3SX6A 3T31A 3KPKA 3HYVA 3SZ0A 3SYIA 4GAVA 3T0KA 4NWZA 4G9KA 3T14A 3SY4A 3SZCA
chains in the Genus database with same CATH superfamily
2OLNA 3PO7A 3HYWA 1ZK7A 3SFEA 1RP0A 3VRAA 4K22A 1Y0PA 2ZBWA 3REDA 3SFDA 1KNRA 4PABA 4Y4NA 4H4PA 5GRTA 1CJ3A 4G73A 2TPRA 2GR1A 2RGJA 3I6DA 5JCKA 4H4ZA 1PJ5A 3CTYA 5U1OA 1S3EA 1HYUA 3M12A 2WP5A 4FK1A 3KPFA 1OJ9A 4Z2RA 1ZY8A 1GTHA 1O95A 1PHHA 1KNPA 4U8IA 1D4CA 1PBBA 2YVFA 2WPFA 1SEZA 4RG4A 2Y6RA 3T37A 1IUXA 2WOVA 3GYJA 2XCGA 3AECA 1D5TA 3P4SA 3QFBA 4H4TA 5KOXA 4REKA 4GAVA 1TDNA 3R9UA 4C5OA 5JCNA 4IA5A 3QFAA 3CGBA 3NKSA 4EMJA 3G5QA 5LV9A 4M52A 1EL5A 3QVPA 1TDOA 4A79A 2XLTA 1YQ3A 3H8LA 4O5QA 1IUUA 4GR1A 1TDKA 5TR3A 1N4UA 1AOGA 4NEWA 2ZZBA 3DA1A 4YKFA 3AD8B 1XPQA 4H2RA 1LQTA 2XVIA 1H84A 3NNEA 1Z6LA 4NTCA 3GD4A 4B66A 4C3YA 1TDFA 2YG7A 3SXIA 1NHRA 1NEKA 3AD7B 4A7AA 2GMJA 2QAEA 4YSHA 2R45A 2EQ9A 3HZLA 2Q7VA 3KPKA 3UCLA 1VDCA 4TM3A 3GYIA 4JY3A 3BI4A 2C64A 1B5QA 4I58A 1PBFA 3ATRA 4YTPA 2BXSA 1DJNA 3Q9TA 1TYTA 1VG9A 2WU2A 1IUWA 4TLXA 5KMPA 1F8RA 2YLSA 4G6HA 4ADWA 1GOSA 2BABA 1PXBA 1LTXR 2QA1A 1GEUA 3CNSA 3V76A 3RP8A 2V3BA 3ALMA 1FEAA 3VR8A 2WS3A 2VRLA 1CBOA 1LVLA 3ITJA 1PXAA 2BC1A 5EB4A 3UOZA 1ZDLA 3VR9A 5FS9A 2GEWA 1NPXA 1YY5A 4UP3A 1GESA 2VQBA 4U2TA 3UKAA 5M10A 2TMDA 2X99A 4N9XA 1BWCA 1IUVA 1P2HA 2WHDA 3CPJG 4BJYA 2Z5YA 2YWLA 3NYEA 3T14A 3DJDA 3FBSA 1KSUA 3RHAA 2YG4A 2BCGG 1NHSA 5KXJA 2EQ6A 1N1PA 4TM4A 1E1MA 2C73A 4X4JA 1LPFA 2WPEA 4TM0A 4B64A 2IIDA 2R4EA 2YR6A 3VRDB 4EQSA 1OJAA 3AWIA 3SGLA 3AE7A 2HQMA 1LQUA 2DKIA 3T2ZA 4Z2UA 3LADA 1KDGA 3L1RA 3JSKA 5IQ1A 3KD9A 3AEFA 2C3CA 2VVMA 1UKVG 2Y6QA 1ZP0A 4XWRA 1GT8A 3AEBA 2VZ2A 3C4NA 5U25A 1H83A 4U8KA 3K7MX 1JNZA 1RYIA 2YM1A 2V60A 2C7GA 2C67A 3NTAA 1L0VA 3SYIA 1FCDA 1IJHA 3IF9A 1Y56A 2YQUA 2E1MA 2AAQA 4H50A 2BYBA 3DK4A 4Z25A 3SZFA 1QJDA 3FPZA 5KMSA 2XDOA 3BI5A 1MO9A 4NTEA 1E39A 2BK3A 3T2YA 4C74A 4JN9A 1F8SA 1GREA 1L9EA 2C65A 3CMMA 4G74A 4CCQA 1B37A 3UKKA 3GMCA 4Z43A 2BS4A 4CCRA 4CY6A 3AE2A 4WCTA 4CY8A 3GDPA 3ZYXA 3C4AA 1GSNA 3CGCA 4GDPA 4YWOA 4BV6A 2JB2A 3HYVA 1TDEA 1EL8A 1N4VA 4O5UA 3EAOA 3NIXA 1PBEA 1H86A 3AE1A 3SZCA 4EMWA 4NNJA 1BZLA 4Z24A 1P2EA 3DH9A 4A99A 2YG3A 5JCIA 3P4PA 2WOWA 3ALJA 1GRAA 2X8HA 3DJEA 3DGZA 5IQ4A 5HHFA 1E1KA 4DNAA 5KVHA 3AE3A 4U2SA 4EMIA 2VVLG 1O5WA 3AE9A 4NZHA 3H8IA 4KX6A 4YSYA 4FK1C 1OJDA 1CJ4A 4AT0A 4PAAA 4TLZA 3UKLA 3KA7A 2V5ZA 4XWZA 1MOKA 2WP6A 2XLSA 4D03A 2H89A 1JNRA 1LV0A 3KKJA 1NHPA 2CVJA 4USQA 1DNCA 1Q1WA 2GAHB 3GDNA 1DJQA 3P1WA 4P9SA 2JB1A 5M0ZA 2DKHA 4A6NA 4C3XA 2YLWA 1ELIA 2O9ZA 1GNDA 1D4DA 3UP5A 1BKWA 4OPUA 3EF6A 3BI2A 1D7LA 1W4XA 1EL9A 1GXFA 2GH5A 1NDAA 1CHUA 1E6EA 3CNPA 1Y56B 3P4QA 3NT6A 2OALA 4B68A 5HXIA 3LOVA 4Y4LA 1S3BA 4H7UA 2VOUA 2WPCA 5EOWA 5GSNA 4EQXA 4J57A 4HB9A 1F3PA 4X9MA 2JBVA 3IHGA 3ATQA 4BURA 4FX9A 2C75A 1ZMDA 2C70A 3T31A 1QLBA 1DXLA 1H81A 5DBJA 3NN6X 3EANA 2EQ8A 1O94A 4U8NA 2B9XA 5BUKA 2EQ7A 2XFNA 2ACZA 3F8RA 3T0KA 2WQYA 4H4UA 3LB8A 5KRQA 4OPGA 3Q6JA 2UZZA 3PVCA 2XYOA 5KNLA 1E1LA 3CIRA 5KVIA 3T2KA 4CNKA 3AEDA 1KSSA 2C66A 2YAUA 3QSEA 2YG6A 3GWFA 3LXDA 4U8OA 3M13A 4IVMB 2OLOA 4YKGA 3I3LA 3UKHA 1DOBA 4JNQA 5KMQA 3AE5A 3UTGA 2Z5XA 2RABA 2AR8A 3BNMA 4HA6A 1PBDA 3DJGX 4RG3A 2OAMA 1GERA 3ADAB 2YG5A 1ZX9A 1EBDA 2APGA 2BK4A 4YTNA 1IUTA 1N4WA 1H7WA 2XVEA 3GYXA 3P4RA 4JQ9A 3AYIA 4OPIA 4A9WA 4II3A 1YQZA 5KOWA 3DK8A 4DSHA 3IHMA 3E1TA 1KFYA 2Q0LA 3FIMB 2R4JA 2VRMA 4K7ZA 3UKFA 4Y4MA 3G5SA 3ICRA 1VRQB 5ER0A 2V61A 4KPRA 3G5RA 3DK9A 4OVIA 5C3JA 4GDEA 4U2LA 3UKPA 2A8XA 3NG7X 3QSMA 3D1CA 1CJCA 1H82A 4ECHA 4IV9A 4BK3A 1D4EA 2ZZCA 2B9WA 3CNTA 2J3NA 3QJ4A 4Z26A 4Z2TA 3UOXA 1TRBA 1JU2A 2GRTA 1PXCA 4UDQA 2FJDA 3B6DA 2B76A 3BNUA 1NENA 2FJBA 4C77A 3OZ2A 3RP6A 2R0PA 4USRA 2PHHA 4YT0A 4K8DA 3ICSA 1GRFA 1GRHA 2WDQA 4EQRA 1ONFA 2XVJA 3NYFA 4AOXA 4B63A 5KMRA 3NRNA 3LJPA 1B8SA 1GRGA 3SX6A 4ZN0A 2F5ZA 3GRTA 4J33A 4CNJA 1ZOYA 1VG0A 3K7TA 2QCUA 1JRYA 1QO8A 2A89A 4II2A 4U8MA 4GUVA 2BRYA 3AYLA 3GWDA 3IC9A 5KWFA 4J34A 1PJ6A 3DMEA 2YLTA 2VQ7A 3URHA 3V3OA 2GQFA 3SY4A 4A5LA 1DOEA 2BS3A 3D8XA 3PS9A 4BK2A 2X3NA 3LZWA 2BS2A 3AEGA 3IWAA 2Q0KA 2OA1A 3BHKA 4J56A 3WE0A 2R0GA 1S2QA 3QSSA 4H4YA 5JCLA 3UP4A 2GQWA 2FJAA 4J31A 2Q6UA 3AB1A 4IA6A 4EM4A 3EPTA 4GAPA 4K5SA 5U63A 2V3AA 2XFUA 1TYPA 2GVCA 4UDPA 1V59A 4Z44A 4U8JA 4B65A 3GRSA 1NG3A 5FS7A 3NHOX 3NN0X 1CJ2A 2CFYA 2XLUA 4H4SA 1FOHA 3CGDA 1OJCA 4AOSA 1VQWA 2WBAA 5FS8A 3UTHA 3C96A 5EBKA 1K0LA 1COYA 2BC0A 4OPLA 4WX1A 3K7QX 2FJEA 2E5VA 2R0CA 1RSGA 3S61A 3FMWA 1K4QA 3UTEA 4OPCA 4AP1A 3ZDNA 2W0HA 5CQFA 5HYMA 1M64A 2YR5A 1NAAA 1H6VA 2XFQA 5EB5A 2X50A 3K30A 2R46A 5J60A 1DOCA 4JDRA 4EIPA 1PS9A 4A65A 4CBQA 4ICYA 2GB0A 4B67A 3KLJA 3L8KA 2B9YA 2XVFA 2YVJA 2WDVA 1PDHA 3CPIG 4NEVA 1X31B 2JKCA 1PN0A 2WETA 1FEBA 3CNDA 1Q1RA 2A87A 5J7XA 1GTEA 1S2YA 4D04A 1GV4A 3CN8A 2NVKX 2WP9A 4H4WA 4ZCDA 3AD9B 2CULA 1JRXA 2JK6A 4H2PA 3V3NA 1K0JA 2V6OA 1OJTA 2AQJA 4AT2A 4RSLA 2JB3A 1REOA 1ZKQA 3NH3X 3P9UA 3II4A 2IVDA 2RGHA 1KF6A 4LIIA 4B69A 1XHCA 4E0VA 1GPEA 4BJZA 2XVHA 3KVEA 1BGJA 2GAGB 2X8GA 3NK0X 3VQRA 2BACA 5BRTA 4EIQA 4H2NA 4U8PA 1GRBA 2CDUA 4APNA 4GF7A 4J36A 5C2TA 1EL7A 1XANA 4X9NA 2YM2A 4DSGA 3COXA 2X8CA 3ISHA 2YVGA 4H4XA 3UOYA 5BULA 5HY5A 3QVRA 4K5RA 2WU5A 1JEHA 3DJJA 3ICTA 3BHFA 3B3RA 1BF3A 2GR2A 3AE4A 1GALA 2IVEA 2PYXA 3LZXA 1CC4A 3NTDA 4YTMA 1K0IA 2I0ZA 3AXBA 4J2WA 1GETA 2XLRA 1CC2A 2ZZ0A 4A6NB 4JNAA 3NK2X 3SZWA 4JY2A 4I59A 1GRTA 4DGKA 1CL0A 2WOIA 4LA1A 4NTDA 4OPTA 5FS6A 3NYCA 3UTFA 1LJ1A 2E4GA 2GF3A 1E7PA 5BVAA 2C3DA 4GRTA 3ALLA 2XFPA 2FBWA 4UDRA 3CPHG 2BCPA 4H4RA 4MJWA 2NPXA 4H4VA 3RP7A 4YXDA 3FG2P 3GD3A 5CKUA 4NWZA 4G9KA 3SM8A 2WESA 4TM1A 1JOAA 4EM3A 2B7RA 1CC6A 4G6GA 3ABVA 5JCMA 2BA9A 3UKQA 1DODA 3GMBA 2R9ZA 3GSIA 1MXTA 3SQPA 4U8LA 1L9CA 2XFOA 3CNJA 4IVOB 1NHQA 1FL2A 4H4QA 3OC4A 2C4CA 4YSXA 2YLRA 3RNMA 3NLCA 4H2QA 5IPYA 1L9DA 2GR0A 2XLPA 3UOVA 1BGNA 2C76A 4OPDA 1B4VA 2GMHA 2BXRA 1M6IA 2VVLA 3H4KA 4YSZA 1F6MA 1ZMCA 1H7XA 2GV8A 3O0HA 4K2XA 1CF3A 1YKJA 3F8DA 4AP3A 3AYJA 3F8PA 3KU9A 1IUSA 5L46A 2B7SA 2YLZA 4XXGA 1XDIA 2BRAA 3AE6A 4ZCCA 3M0OA 4B1BA 3DGHA 1F8WA 1Q9IA 1PBCA 2RGOA 2GR3A 2H88A 2WDRA 1YQ4A 2BK5A 2YLXA 4BK1A 3HYXA 1PJ7A 2C72A 3VRBA 4CRTA 1D7YA 3NK1X 4LU6A 3CGEA 2QA2A 3NGCX 2ARDA 2YR4A 3AEEA 4OCGA 2WEUA 3S5WA 5FMHA 3AE8A 1E1NA 2JAEA 1ZOVA 1FECA 3SZ0A 1NG4A 4FDCB 4EQWA 4GCMA 1JRZA 3AEAA
chains in the Genus database with same CATH topology
2OLNA 3PO7A 3HYWA 1ZK7A 3SFEA 1RP0A 3VRAA 4K22A 1Y0PA 2ZBWA 3REDA 3SFDA 1KNRA 4PABA 4Y4NA 4H4PA 5GRTA 1CJ3A 4G73A 2TPRA 2GR1A 2RGJA 3I6DA 5JCKA 4H4ZA 1PJ5A 3CTYA 5U1OA 1S3EA 1HYUA 3M12A 2WP5A 4FK1A 3KPFA 1OJ9A 4Z2RA 1ZY8A 1GTHA 1O95A 1PHHA 1KNPA 4U8IA 1D4CA 1PBBA 2YVFA 2WPFA 1SEZA 4RG4A 2Y6RA 3T37A 1IUXA 2WOVA 3GYJA 2XCGA 3AECA 1D5TA 3P4SA 3QFBA 4H4TA 5KOXA 4REKA 4GAVA 1TDNA 3R9UA 4C5OA 5JCNA 4IA5A 3QFAA 3CGBA 3NKSA 4EMJA 3G5QA 5LV9A 4M52A 1EL5A 3QVPA 1TDOA 4A79A 2XLTA 1YQ3A 3H8LA 4O5QA 1IUUA 4GR1A 1TDKA 5TR3A 1N4UA 1AOGA 4NEWA 2ZZBA 3DA1A 4YKFA 3AD8B 1XPQA 4H2RA 1LQTA 2XVIA 1H84A 3NNEA 1Z6LA 4NTCA 3GD4A 4B66A 4C3YA 1TDFA 2YG7A 3SXIA 1NHRA 1NEKA 3AD7B 4A7AA 2GMJA 2QAEA 4YSHA 2R45A 2EQ9A 3HZLA 2Q7VA 3KPKA 3UCLA 1VDCA 4TM3A 3GYIA 4JY3A 3BI4A 2C64A 1B5QA 4I58A 1PBFA 3ATRA 4YTPA 2BXSA 1DJNA 3Q9TA 1TYTA 1VG9A 2WU2A 1IUWA 4TLXA 5KMPA 1F8RA 2YLSA 4G6HA 4ADWA 1GOSA 2BABA 1PXBA 1LTXR 2QA1A 1GEUA 3CNSA 3V76A 3RP8A 2V3BA 3ALMA 1FEAA 3VR8A 2WS3A 2VRLA 1CBOA 1LVLA 3ITJA 1PXAA 2BC1A 5EB4A 3UOZA 1ZDLA 3VR9A 5FS9A 2GEWA 1NPXA 1YY5A 4UP3A 1GESA 2VQBA 4U2TA 3UKAA 5M10A 2TMDA 2X99A 4N9XA 1BWCA 1IUVA 1P2HA 2WHDA 3CPJG 4BJYA 2Z5YA 2YWLA 3NYEA 3T14A 3DJDA 3FBSA 1KSUA 3RHAA 2YG4A 2BCGG 1NHSA 5KXJA 2EQ6A 1N1PA 4TM4A 1E1MA 2C73A 4X4JA 1LPFA 2WPEA 4TM0A 4B64A 2IIDA 2R4EA 2YR6A 3VRDB 4EQSA 1OJAA 3AWIA 3SGLA 3AE7A 2HQMA 1LQUA 2DKIA 3T2ZA 4Z2UA 3LADA 1KDGA 3L1RA 3JSKA 5IQ1A 3KD9A 3AEFA 2C3CA 2VVMA 1UKVG 2Y6QA 1ZP0A 4XWRA 1GT8A 3AEBA 2VZ2A 3C4NA 5U25A 1H83A 4U8KA 3K7MX 1JNZA 1RYIA 2YM1A 2V60A 2C7GA 2C67A 3NTAA 1L0VA 3SYIA 1FCDA 1IJHA 3IF9A 1Y56A 2YQUA 2E1MA 2AAQA 4H50A 2BYBA 3DK4A 4Z25A 3SZFA 1QJDA 3FPZA 5KMSA 2XDOA 3BI5A 1MO9A 4NTEA 1E39A 2BK3A 3T2YA 4C74A 4JN9A 1F8SA 1GREA 1L9EA 2C65A 3CMMA 4G74A 4CCQA 1B37A 3UKKA 3GMCA 4Z43A 2BS4A 4CCRA 4CY6A 3AE2A 4WCTA 4CY8A 3GDPA 3ZYXA 3C4AA 1GSNA 3CGCA 4GDPA 4YWOA 4BV6A 2JB2A 3HYVA 1TDEA 1EL8A 1N4VA 4O5UA 3EAOA 3NIXA 1PBEA 1H86A 3AE1A 3SZCA 4EMWA 4NNJA 1BZLA 4Z24A 1P2EA 3DH9A 4A99A 2YG3A 5JCIA 3P4PA 2WOWA 3ALJA 1GRAA 2X8HA 3DJEA 3DGZA 5IQ4A 5HHFA 1E1KA 4DNAA 5KVHA 3AE3A 4U2SA 4EMIA 2VVLG 1O5WA 3AE9A 4NZHA 3H8IA 4KX6A 4YSYA 4FK1C 1OJDA 1CJ4A 4AT0A 4PAAA 4TLZA 3UKLA 3KA7A 2V5ZA 4XWZA 1MOKA 2WP6A 2XLSA 4D03A 2H89A 1JNRA 1LV0A 3KKJA 1NHPA 2CVJA 4USQA 1DNCA 1Q1WA 2GAHB 3GDNA 1DJQA 3P1WA 4P9SA 2JB1A 5M0ZA 2DKHA 4A6NA 4C3XA 2YLWA 1ELIA 2O9ZA 1GNDA 1D4DA 3UP5A 1BKWA 4OPUA 3EF6A 3BI2A 1D7LA 1W4XA 1EL9A 1GXFA 2GH5A 1NDAA 1CHUA 1E6EA 3CNPA 1Y56B 3P4QA 3NT6A 2OALA 4B68A 5HXIA 3LOVA 4Y4LA 1S3BA 4H7UA 2VOUA 2WPCA 5EOWA 5GSNA 4EQXA 4J57A 4HB9A 1F3PA 4X9MA 2JBVA 3IHGA 3ATQA 4BURA 4FX9A 2C75A 1ZMDA 2C70A 3T31A 1QLBA 1DXLA 1H81A 5DBJA 3NN6X 3EANA 2EQ8A 1O94A 4U8NA 2B9XA 5BUKA 2EQ7A 2XFNA 2ACZA 3F8RA 3T0KA 2WQYA 4H4UA 3LB8A 5KRQA 4OPGA 3Q6JA 2UZZA 3PVCA 2XYOA 5KNLA 1E1LA 3CIRA 5KVIA 3T2KA 4CNKA 3AEDA 1KSSA 2C66A 2YAUA 3QSEA 2YG6A 3GWFA 3LXDA 4U8OA 3M13A 4IVMB 2OLOA 4YKGA 3I3LA 3UKHA 1DOBA 4JNQA 5KMQA 3AE5A 3UTGA 2Z5XA 2RABA 2AR8A 3BNMA 4HA6A 1PBDA 3DJGX 4RG3A 2OAMA 1GERA 3ADAB 2YG5A 1ZX9A 1EBDA 2APGA 2BK4A 4YTNA 1IUTA 1N4WA 1H7WA 2XVEA 3GYXA 3P4RA 4JQ9A 3AYIA 4OPIA 4A9WA 4II3A 1YQZA 5KOWA 3DK8A 4DSHA 3IHMA 3E1TA 1KFYA 2Q0LA 3FIMB 2R4JA 2VRMA 4K7ZA 3UKFA 4Y4MA 3G5SA 3ICRA 1VRQB 5ER0A 2V61A 4KPRA 3G5RA 3DK9A 4OVIA 5C3JA 4GDEA 4U2LA 3UKPA 2A8XA 3NG7X 3QSMA 3D1CA 1CJCA 1H82A 4ECHA 4IV9A 4BK3A 1D4EA 2ZZCA 2B9WA 3CNTA 2J3NA 3QJ4A 4Z26A 4Z2TA 3UOXA 1TRBA 1JU2A 2GRTA 1PXCA 4UDQA 2FJDA 3B6DA 2B76A 3BNUA 1NENA 2FJBA 4C77A 3OZ2A 3RP6A 2R0PA 4USRA 2PHHA 4YT0A 4K8DA 3ICSA 1GRFA 1GRHA 2WDQA 4EQRA 1ONFA 2XVJA 3NYFA 4AOXA 4B63A 5KMRA 3NRNA 3LJPA 1B8SA 1GRGA 3SX6A 4ZN0A 2F5ZA 3GRTA 4J33A 4CNJA 1ZOYA 1VG0A 3K7TA 2QCUA 1JRYA 1QO8A 2A89A 4II2A 4U8MA 4GUVA 2BRYA 3AYLA 3GWDA 3IC9A 5KWFA 4J34A 1PJ6A 3DMEA 2YLTA 2VQ7A 3URHA 3V3OA 2GQFA 3SY4A 4A5LA 1DOEA 2BS3A 3D8XA 3PS9A 4BK2A 2X3NA 3LZWA 2BS2A 3AEGA 3IWAA 2Q0KA 2OA1A 3BHKA 4J56A 3WE0A 2R0GA 1S2QA 3QSSA 4H4YA 5JCLA 3UP4A 2GQWA 2FJAA 4J31A 2Q6UA 3AB1A 4IA6A 4EM4A 3EPTA 4GAPA 4K5SA 5U63A 2V3AA 2XFUA 1TYPA 2GVCA 4UDPA 1V59A 4Z44A 4U8JA 4B65A 3GRSA 1NG3A 5FS7A 3NHOX 3NN0X 1CJ2A 2CFYA 2XLUA 4H4SA 1FOHA 3CGDA 1OJCA 4AOSA 1VQWA 2WBAA 5FS8A 3UTHA 3C96A 5EBKA 1K0LA 1COYA 2BC0A 4OPLA 4WX1A 3K7QX 2FJEA 2E5VA 2R0CA 1RSGA 3S61A 3FMWA 1K4QA 3UTEA 4OPCA 4AP1A 3ZDNA 2W0HA 5CQFA 5HYMA 1M64A 2YR5A 1NAAA 1H6VA 2XFQA 5EB5A 2X50A 3K30A 2R46A 5J60A 1DOCA 4JDRA 4EIPA 1PS9A 4A65A 4CBQA 4ICYA 2GB0A 4B67A 3KLJA 3L8KA 2B9YA 2XVFA 2YVJA 2WDVA 1PDHA 3CPIG 4NEVA 1X31B 2JKCA 1PN0A 2WETA 1FEBA 3CNDA 1Q1RA 2A87A 5J7XA 1GTEA 1S2YA 4D04A 1GV4A 3CN8A 2NVKX 2WP9A 4H4WA 4ZCDA 3AD9B 2CULA 1JRXA 2JK6A 4H2PA 3V3NA 1K0JA 2V6OA 1OJTA 2AQJA 4AT2A 4RSLA 2JB3A 1REOA 1ZKQA 3NH3X 3P9UA 3II4A 2IVDA 2RGHA 1KF6A 4LIIA 4B69A 1XHCA 4E0VA 1GPEA 4BJZA 2XVHA 3KVEA 1BGJA 2GAGB 2X8GA 3NK0X 3VQRA 2BACA 5BRTA 4EIQA 4H2NA 4U8PA 1GRBA 2CDUA 4APNA 4GF7A 4J36A 5C2TA 1EL7A 1XANA 4X9NA 2YM2A 4DSGA 3COXA 2X8CA 3ISHA 2YVGA 4H4XA 3UOYA 5BULA 5HY5A 3QVRA 4K5RA 2WU5A 1JEHA 3DJJA 3ICTA 3BHFA 3B3RA 1BF3A 2GR2A 3AE4A 1GALA 2IVEA 2PYXA 3LZXA 1CC4A 3NTDA 4YTMA 1K0IA 2I0ZA 3AXBA 4J2WA 1GETA 2XLRA 1CC2A 2ZZ0A 4A6NB 4JNAA 3NK2X 3SZWA 4JY2A 4I59A 1GRTA 4DGKA 1CL0A 2WOIA 4LA1A 4NTDA 4OPTA 5FS6A 3NYCA 3UTFA 1LJ1A 2E4GA 2GF3A 1E7PA 5BVAA 2C3DA 4GRTA 3ALLA 2XFPA 2FBWA 4UDRA 3CPHG 2BCPA 4H4RA 4MJWA 2NPXA 4H4VA 3RP7A 4YXDA 3FG2P 3GD3A 5CKUA 4NWZA 4G9KA 3SM8A 2WESA 4TM1A 1JOAA 4EM3A 2B7RA 1CC6A 4G6GA 3ABVA 5JCMA 2BA9A 3UKQA 1DODA 3GMBA 2R9ZA 3GSIA 1MXTA 3SQPA 4U8LA 1L9CA 2XFOA 3CNJA 4IVOB 1NHQA 1FL2A 4H4QA 3OC4A 2C4CA 4YSXA 2YLRA 3RNMA 3NLCA 4H2QA 5IPYA 1L9DA 2GR0A 2XLPA 3UOVA 1BGNA 2C76A 4OPDA 1B4VA 2GMHA 2BXRA 1M6IA 2VVLA 3H4KA 4YSZA 1F6MA 1ZMCA 1H7XA 2GV8A 3O0HA 4K2XA 1CF3A 1YKJA 3F8DA 4AP3A 3AYJA 3F8PA 3KU9A 1IUSA 5L46A 2B7SA 2YLZA 4XXGA 1XDIA 2BRAA 3AE6A 4ZCCA 3M0OA 4B1BA 3DGHA 1F8WA 1Q9IA 1PBCA 2RGOA 2GR3A 2H88A 2WDRA 1YQ4A 2BK5A 2YLXA 4BK1A 3HYXA 1PJ7A 2C72A 3VRBA 4CRTA 1D7YA 3NK1X 4LU6A 3CGEA 2QA2A 3NGCX 2ARDA 2YR4A 3AEEA 4OCGA 2WEUA 3S5WA 5FMHA 3AE8A 1E1NA 2JAEA 1ZOVA 1FECA 3SZ0A 1NG4A 4FDCB 4EQWA 4GCMA 1JRZA 3AEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMP A;  3T2K A;  3HYW A;  3SZF A;  4G6G A;  5KMS A;  4G6H A;  3T2Y A;  4G73 A;  3SZW A;  3T2Z A;  4GAP A;  5KMR A;  4G74 A;  5KMQ A;  3SXI A;  3HYX A;  3SX6 A;  3T31 A;  3KPK A;  3HYV A;  3SZ0 A;  3SYI A;  4GAV A;  3T0K A;  4NWZ A;  4G9K A;  3T14 A;  3SY4 A;  3SZC A; 
#chains in the Genus database with same CATH topology
 2OLN A;  3PO7 A;  3HYW A;  1ZK7 A;  3SFE A;  1RP0 A;  3VRA A;  4K22 A;  1Y0P A;  2ZBW A;  3RED A;  3SFD A;  1KNR A;  4PAB A;  4Y4N A;  4H4P A;  5GRT A;  1CJ3 A;  4G73 A;  2TPR A;  2GR1 A;  2RGJ A;  3I6D A;  5JCK A;  4H4Z A;  1PJ5 A;  3CTY A;  5U1O A;  1S3E A;  1HYU A;  3M12 A;  2WP5 A;  4FK1 A;  3KPF A;  1OJ9 A;  4Z2R A;  1ZY8 A;  1GTH A;  1O95 A;  1PHH A;  1KNP A;  4U8I A;  1D4C A;  1PBB A;  2YVF A;  2WPF A;  1SEZ A;  4RG4 A;  2Y6R A;  3T37 A;  1IUX A;  2WOV A;  3GYJ A;  2XCG A;  3AEC A;  1D5T A;  3P4S A;  3QFB A;  4H4T A;  5KOX A;  4REK A;  4GAV A;  1TDN A;  3R9U A;  4C5O A;  5JCN A;  4IA5 A;  3QFA A;  3CGB A;  3NKS A;  4EMJ A;  3G5Q A;  5LV9 A;  4M52 A;  1EL5 A;  3QVP A;  1TDO A;  4A79 A;  2XLT A;  1YQ3 A;  3H8L A;  4O5Q A;  1IUU A;  4GR1 A;  1TDK A;  5TR3 A;  1N4U A;  1AOG A;  4NEW A;  2ZZB A;  3DA1 A;  4YKF A;  3AD8 B;  1XPQ A;  4H2R A;  1LQT A;  2XVI A;  1H84 A;  3NNE A;  1Z6L A;  4NTC A;  3GD4 A;  4B66 A;  4C3Y A;  1TDF A;  2YG7 A;  3SXI A;  1NHR A;  1NEK A;  3AD7 B;  4A7A A;  2GMJ A;  2QAE A;  4YSH A;  2R45 A;  2EQ9 A;  3HZL A;  2Q7V A;  3KPK A;  3UCL A;  1VDC A;  4TM3 A;  3GYI A;  4JY3 A;  3BI4 A;  2C64 A;  1B5Q A;  4I58 A;  1PBF A;  3ATR A;  4YTP A;  2BXS A;  1DJN A;  3Q9T A;  1TYT A;  1VG9 A;  2WU2 A;  1IUW A;  4TLX A;  5KMP A;  1F8R A;  2YLS A;  4G6H A;  4ADW A;  1GOS A;  2BAB A;  1PXB A;  1LTX R;  2QA1 A;  1GEU A;  3CNS A;  3V76 A;  3RP8 A;  2V3B A;  3ALM A;  1FEA A;  3VR8 A;  2WS3 A;  2VRL A;  1CBO A;  1LVL A;  3ITJ A;  1PXA A;  2BC1 A;  5EB4 A;  3UOZ A;  1ZDL A;  3VR9 A;  5FS9 A;  2GEW A;  1NPX A;  1YY5 A;  4UP3 A;  1GES A;  2VQB A;  4U2T A;  3UKA A;  5M10 A;  2TMD A;  2X99 A;  4N9X A;  1BWC A;  1IUV A;  1P2H A;  2WHD A;  3CPJ G;  4BJY A;  2Z5Y A;  2YWL A;  3NYE A;  3T14 A;  3DJD A;  3FBS A;  1KSU A;  3RHA A;  2YG4 A;  2BCG G;  1NHS A;  5KXJ A;  2EQ6 A;  1N1P A;  4TM4 A;  1E1M A;  2C73 A;  4X4J A;  1LPF A;  2WPE A;  4TM0 A;  4B64 A;  2IID A;  2R4E A;  2YR6 A;  3VRD B;  4EQS A;  1OJA A;  3AWI A;  3SGL A;  3AE7 A;  2HQM A;  1LQU A;  2DKI A;  3T2Z A;  4Z2U A;  3LAD A;  1KDG A;  3L1R A;  3JSK A;  5IQ1 A;  3KD9 A;  3AEF A;  2C3C A;  2VVM A;  1UKV G;  2Y6Q A;  1ZP0 A;  4XWR A;  1GT8 A;  3AEB A;  2VZ2 A;  3C4N A;  5U25 A;  1H83 A;  4U8K A;  3K7M X;  1JNZ A;  1RYI A;  2YM1 A;  2V60 A;  2C7G A;  2C67 A;  3NTA A;  1L0V A;  3SYI A;  1FCD A;  1IJH A;  3IF9 A;  1Y56 A;  2YQU A;  2E1M A;  2AAQ A;  4H50 A;  2BYB A;  3DK4 A;  4Z25 A;  3SZF A;  1QJD A;  3FPZ A;  5KMS A;  2XDO A;  3BI5 A;  1MO9 A;  4NTE A;  1E39 A;  2BK3 A;  3T2Y A;  4C74 A;  4JN9 A;  1F8S A;  1GRE A;  1L9E A;  2C65 A;  3CMM A;  4G74 A;  4CCQ A;  1B37 A;  3UKK A;  3GMC A;  4Z43 A;  2BS4 A;  4CCR A;  4CY6 A;  3AE2 A;  4WCT A;  4CY8 A;  3GDP A;  3ZYX A;  3C4A A;  1GSN A;  3CGC A;  4GDP A;  4YWO A;  4BV6 A;  2JB2 A;  3HYV A;  1TDE A;  1EL8 A;  1N4V A;  4O5U A;  3EAO A;  3NIX A;  1PBE A;  1H86 A;  3AE1 A;  3SZC A;  4EMW A;  4NNJ A;  1BZL A;  4Z24 A;  1P2E A;  3DH9 A;  4A99 A;  2YG3 A;  5JCI A;  3P4P A;  2WOW A;  3ALJ A;  1GRA A;  2X8H A;  3DJE A;  3DGZ A;  5IQ4 A;  5HHF A;  1E1K A;  4DNA A;  5KVH A;  3AE3 A;  4U2S A;  4EMI A;  2VVL G;  1O5W A;  3AE9 A;  4NZH A;  3H8I A;  4KX6 A;  4YSY A;  4FK1 C;  1OJD A;  1CJ4 A;  4AT0 A;  4PAA A;  4TLZ A;  3UKL A;  3KA7 A;  2V5Z A;  4XWZ A;  1MOK A;  2WP6 A;  2XLS A;  4D03 A;  2H89 A;  1JNR A;  1LV0 A;  3KKJ A;  1NHP A;  2CVJ A;  4USQ A;  1DNC A;  1Q1W A;  2GAH B;  3GDN A;  1DJQ A;  3P1W A;  4P9S A;  2JB1 A;  5M0Z A;  2DKH A;  4A6N A;  4C3X A;  2YLW A;  1ELI A;  2O9Z A;  1GND A;  1D4D A;  3UP5 A;  1BKW A;  4OPU A;  3EF6 A;  3BI2 A;  1D7L A;  1W4X A;  1EL9 A;  1GXF A;  2GH5 A;  1NDA A;  1CHU A;  1E6E A;  3CNP A;  1Y56 B;  3P4Q A;  3NT6 A;  2OAL A;  4B68 A;  5HXI A;  3LOV A;  4Y4L A;  1S3B A;  4H7U A;  2VOU A;  2WPC A;  5EOW A;  5GSN A;  4EQX A;  4J57 A;  4HB9 A;  1F3P A;  4X9M A;  2JBV A;  3IHG A;  3ATQ A;  4BUR A;  4FX9 A;  2C75 A;  1ZMD A;  2C70 A;  3T31 A;  1QLB A;  1DXL A;  1H81 A;  5DBJ A;  3NN6 X;  3EAN A;  2EQ8 A;  1O94 A;  4U8N A;  2B9X A;  5BUK A;  2EQ7 A;  2XFN A;  2ACZ A;  3F8R A;  3T0K A;  2WQY A;  4H4U A;  3LB8 A;  5KRQ A;  4OPG A;  3Q6J A;  2UZZ A;  3PVC A;  2XYO A;  5KNL A;  1E1L A;  3CIR A;  5KVI A;  3T2K A;  4CNK A;  3AED A;  1KSS A;  2C66 A;  2YAU A;  3QSE A;  2YG6 A;  3GWF A;  3LXD A;  4U8O A;  3M13 A;  4IVM B;  2OLO A;  4YKG A;  3I3L A;  3UKH A;  1DOB A;  4JNQ A;  5KMQ A;  3AE5 A;  3UTG A;  2Z5X A;  2RAB A;  2AR8 A;  3BNM A;  4HA6 A;  1PBD A;  3DJG X;  4RG3 A;  2OAM A;  1GER A;  3ADA B;  2YG5 A;  1ZX9 A;  1EBD A;  2APG A;  2BK4 A;  4YTN A;  1IUT A;  1N4W A;  1H7W A;  2XVE A;  3GYX A;  3P4R A;  4JQ9 A;  3AYI A;  4OPI A;  4A9W A;  4II3 A;  1YQZ A;  5KOW A;  3DK8 A;  4DSH A;  3IHM A;  3E1T A;  1KFY A;  2Q0L A;  3FIM B;  2R4J A;  2VRM A;  4K7Z A;  3UKF A;  4Y4M A;  3G5S A;  3ICR A;  1VRQ B;  5ER0 A;  2V61 A;  4KPR A;  3G5R A;  3DK9 A;  4OVI A;  5C3J A;  4GDE A;  4U2L A;  3UKP A;  2A8X A;  3NG7 X;  3QSM A;  3D1C A;  1CJC A;  1H82 A;  4ECH A;  4IV9 A;  4BK3 A;  1D4E A;  2ZZC A;  2B9W A;  3CNT A;  2J3N A;  3QJ4 A;  4Z26 A;  4Z2T A;  3UOX A;  1TRB A;  1JU2 A;  2GRT A;  1PXC A;  4UDQ A;  2FJD A;  3B6D A;  2B76 A;  3BNU A;  1NEN A;  2FJB A;  4C77 A;  3OZ2 A;  3RP6 A;  2R0P A;  4USR A;  2PHH A;  4YT0 A;  4K8D A;  3ICS A;  1GRF A;  1GRH A;  2WDQ A;  4EQR A;  1ONF A;  2XVJ A;  3NYF A;  4AOX A;  4B63 A;  5KMR A;  3NRN A;  3LJP A;  1B8S A;  1GRG A;  3SX6 A;  4ZN0 A;  2F5Z A;  3GRT A;  4J33 A;  4CNJ A;  1ZOY A;  1VG0 A;  3K7T A;  2QCU A;  1JRY A;  1QO8 A;  2A89 A;  4II2 A;  4U8M A;  4GUV A;  2BRY A;  3AYL A;  3GWD A;  3IC9 A;  5KWF A;  4J34 A;  1PJ6 A;  3DME A;  2YLT A;  2VQ7 A;  3URH A;  3V3O A;  2GQF A;  3SY4 A;  4A5L A;  1DOE A;  2BS3 A;  3D8X A;  3PS9 A;  4BK2 A;  2X3N A;  3LZW A;  2BS2 A;  3AEG A;  3IWA A;  2Q0K A;  2OA1 A;  3BHK A;  4J56 A;  3WE0 A;  2R0G A;  1S2Q A;  3QSS A;  4H4Y A;  5JCL A;  3UP4 A;  2GQW A;  2FJA A;  4J31 A;  2Q6U A;  3AB1 A;  4IA6 A;  4EM4 A;  3EPT A;  4GAP A;  4K5S A;  5U63 A;  2V3A A;  2XFU A;  1TYP A;  2GVC A;  4UDP A;  1V59 A;  4Z44 A;  4U8J A;  4B65 A;  3GRS A;  1NG3 A;  5FS7 A;  3NHO X;  3NN0 X;  1CJ2 A;  2CFY A;  2XLU A;  4H4S A;  1FOH A;  3CGD A;  1OJC A;  4AOS A;  1VQW A;  2WBA A;  5FS8 A;  3UTH A;  3C96 A;  5EBK A;  1K0L A;  1COY A;  2BC0 A;  4OPL A;  4WX1 A;  3K7Q X;  2FJE A;  2E5V A;  2R0C A;  1RSG A;  3S61 A;  3FMW A;  1K4Q A;  3UTE A;  4OPC A;  4AP1 A;  3ZDN A;  2W0H A;  5CQF A;  5HYM A;  1M64 A;  2YR5 A;  1NAA A;  1H6V A;  2XFQ A;  5EB5 A;  2X50 A;  3K30 A;  2R46 A;  5J60 A;  1DOC A;  4JDR A;  4EIP A;  1PS9 A;  4A65 A;  4CBQ A;  4ICY A;  2GB0 A;  4B67 A;  3KLJ A;  3L8K A;  2B9Y A;  2XVF A;  2YVJ A;  2WDV A;  1PDH A;  3CPI G;  4NEV A;  1X31 B;  2JKC A;  1PN0 A;  2WET A;  1FEB A;  3CND A;  1Q1R A;  2A87 A;  5J7X A;  1GTE A;  1S2Y A;  4D04 A;  1GV4 A;  3CN8 A;  2NVK X;  2WP9 A;  4H4W A;  4ZCD A;  3AD9 B;  2CUL A;  1JRX A;  2JK6 A;  4H2P A;  3V3N A;  1K0J A;  2V6O A;  1OJT A;  2AQJ A;  4AT2 A;  4RSL A;  2JB3 A;  1REO A;  1ZKQ A;  3NH3 X;  3P9U A;  3II4 A;  2IVD A;  2RGH A;  1KF6 A;  4LII A;  4B69 A;  1XHC A;  4E0V A;  1GPE A;  4BJZ A;  2XVH A;  3KVE A;  1BGJ A;  2GAG B;  2X8G A;  3NK0 X;  3VQR A;  2BAC A;  5BRT A;  4EIQ A;  4H2N A;  4U8P A;  1GRB A;  2CDU A;  4APN A;  4GF7 A;  4J36 A;  5C2T A;  1EL7 A;  1XAN A;  4X9N A;  2YM2 A;  4DSG A;  3COX A;  2X8C A;  3ISH A;  2YVG A;  4H4X A;  3UOY A;  5BUL A;  5HY5 A;  3QVR A;  4K5R A;  2WU5 A;  1JEH A;  3DJJ A;  3ICT A;  3BHF A;  3B3R A;  1BF3 A;  2GR2 A;  3AE4 A;  1GAL A;  2IVE A;  2PYX A;  3LZX A;  1CC4 A;  3NTD A;  4YTM A;  1K0I A;  2I0Z A;  3AXB A;  4J2W A;  1GET A;  2XLR A;  1CC2 A;  2ZZ0 A;  4A6N B;  4JNA A;  3NK2 X;  3SZW A;  4JY2 A;  4I59 A;  1GRT A;  4DGK A;  1CL0 A;  2WOI A;  4LA1 A;  4NTD A;  4OPT A;  5FS6 A;  3NYC A;  3UTF A;  1LJ1 A;  2E4G A;  2GF3 A;  1E7P A;  5BVA A;  2C3D A;  4GRT A;  3ALL A;  2XFP A;  2FBW A;  4UDR A;  3CPH G;  2BCP A;  4H4R A;  4MJW A;  2NPX A;  4H4V A;  3RP7 A;  4YXD A;  3FG2 P;  3GD3 A;  5CKU A;  4NWZ A;  4G9K A;  3SM8 A;  2WES A;  4TM1 A;  1JOA A;  4EM3 A;  2B7R A;  1CC6 A;  4G6G A;  3ABV A;  5JCM A;  2BA9 A;  3UKQ A;  1DOD A;  3GMB A;  2R9Z A;  3GSI A;  1MXT A;  3SQP A;  4U8L A;  1L9C A;  2XFO A;  3CNJ A;  4IVO B;  1NHQ A;  1FL2 A;  4H4Q A;  3OC4 A;  2C4C A;  4YSX A;  2YLR A;  3RNM A;  3NLC A;  4H2Q A;  5IPY A;  1L9D A;  2GR0 A;  2XLP A;  3UOV A;  1BGN A;  2C76 A;  4OPD A;  1B4V A;  2GMH A;  2BXR A;  1M6I A;  2VVL A;  3H4K A;  4YSZ A;  1F6M A;  1ZMC A;  1H7X A;  2GV8 A;  3O0H A;  4K2X A;  1CF3 A;  1YKJ A;  3F8D A;  4AP3 A;  3AYJ A;  3F8P A;  3KU9 A;  1IUS A;  5L46 A;  2B7S A;  2YLZ A;  4XXG A;  1XDI A;  2BRA A;  3AE6 A;  4ZCC A;  3M0O A;  4B1B A;  3DGH A;  1F8W A;  1Q9I A;  1PBC A;  2RGO A;  2GR3 A;  2H88 A;  2WDR A;  1YQ4 A;  2BK5 A;  2YLX A;  4BK1 A;  3HYX A;  1PJ7 A;  2C72 A;  3VRB A;  4CRT A;  1D7Y A;  3NK1 X;  4LU6 A;  3CGE A;  2QA2 A;  3NGC X;  2ARD A;  2YR4 A;  3AEE A;  4OCG A;  2WEU A;  3S5W A;  5FMH A;  3AE8 A;  1E1N A;  2JAE A;  1ZOV A;  1FEC A;  3SZ0 A;  1NG4 A;  4FDC B;  4EQW A;  4GCM A;  1JRZ A;  3AEA A; 
#chains in the Genus database with same CATH homology
 2OLN A;  3PO7 A;  3HYW A;  1ZK7 A;  3SFE A;  1RP0 A;  3VRA A;  4K22 A;  1Y0P A;  2ZBW A;  3RED A;  3SFD A;  1KNR A;  4PAB A;  4Y4N A;  4H4P A;  5GRT A;  1CJ3 A;  4G73 A;  2TPR A;  2GR1 A;  2RGJ A;  3I6D A;  5JCK A;  4H4Z A;  1PJ5 A;  3CTY A;  5U1O A;  1S3E A;  1HYU A;  3M12 A;  2WP5 A;  4FK1 A;  3KPF A;  1OJ9 A;  4Z2R A;  1ZY8 A;  1GTH A;  1O95 A;  1PHH A;  1KNP A;  4U8I A;  1D4C A;  1PBB A;  2YVF A;  2WPF A;  1SEZ A;  4RG4 A;  2Y6R A;  3T37 A;  1IUX A;  2WOV A;  3GYJ A;  2XCG A;  3AEC A;  1D5T A;  3P4S A;  3QFB A;  4H4T A;  5KOX A;  4REK A;  4GAV A;  1TDN A;  3R9U A;  4C5O A;  5JCN A;  4IA5 A;  3QFA A;  3CGB A;  3NKS A;  4EMJ A;  3G5Q A;  5LV9 A;  4M52 A;  1EL5 A;  3QVP A;  1TDO A;  4A79 A;  2XLT A;  1YQ3 A;  3H8L A;  4O5Q A;  1IUU A;  4GR1 A;  1TDK A;  5TR3 A;  1N4U A;  1AOG A;  4NEW A;  2ZZB A;  3DA1 A;  4YKF A;  3AD8 B;  1XPQ A;  4H2R A;  1LQT A;  2XVI A;  1H84 A;  3NNE A;  1Z6L A;  4NTC A;  3GD4 A;  4B66 A;  4C3Y A;  1TDF A;  2YG7 A;  3SXI A;  1NHR A;  1NEK A;  3AD7 B;  4A7A A;  2GMJ A;  2QAE A;  4YSH A;  2R45 A;  2EQ9 A;  3HZL A;  2Q7V A;  3KPK A;  3UCL A;  1VDC A;  4TM3 A;  3GYI A;  4JY3 A;  3BI4 A;  2C64 A;  1B5Q A;  4I58 A;  1PBF A;  3ATR A;  4YTP A;  2BXS A;  1DJN A;  3Q9T A;  1TYT A;  1VG9 A;  2WU2 A;  1IUW A;  4TLX A;  5KMP A;  1F8R A;  2YLS A;  4G6H A;  4ADW A;  1GOS A;  2BAB A;  1PXB A;  1LTX R;  2QA1 A;  1GEU A;  3CNS A;  3V76 A;  3RP8 A;  2V3B A;  3ALM A;  1FEA A;  3VR8 A;  2WS3 A;  2VRL A;  1CBO A;  1LVL A;  3ITJ A;  1PXA A;  2BC1 A;  5EB4 A;  3UOZ A;  1ZDL A;  3VR9 A;  5FS9 A;  2GEW A;  1NPX A;  1YY5 A;  4UP3 A;  1GES A;  2VQB A;  4U2T A;  3UKA A;  5M10 A;  2TMD A;  2X99 A;  4N9X A;  1BWC A;  1IUV A;  1P2H A;  2WHD A;  3CPJ G;  4BJY A;  2Z5Y A;  2YWL A;  3NYE A;  3T14 A;  3DJD A;  3FBS A;  1KSU A;  3RHA A;  2YG4 A;  2BCG G;  1NHS A;  5KXJ A;  2EQ6 A;  1N1P A;  4TM4 A;  1E1M A;  2C73 A;  4X4J A;  1LPF A;  2WPE A;  4TM0 A;  4B64 A;  2IID A;  2R4E A;  2YR6 A;  3VRD B;  4EQS A;  1OJA A;  3AWI A;  3SGL A;  3AE7 A;  2HQM A;  1LQU A;  2DKI A;  3T2Z A;  4Z2U A;  3LAD A;  1KDG A;  3L1R A;  3JSK A;  5IQ1 A;  3KD9 A;  3AEF A;  2C3C A;  2VVM A;  1UKV G;  2Y6Q A;  1ZP0 A;  4XWR A;  1GT8 A;  3AEB A;  2VZ2 A;  3C4N A;  5U25 A;  1H83 A;  4U8K A;  3K7M X;  1JNZ A;  1RYI A;  2YM1 A;  2V60 A;  2C7G A;  2C67 A;  3NTA A;  1L0V A;  3SYI A;  1FCD A;  1IJH A;  3IF9 A;  1Y56 A;  2YQU A;  2E1M A;  2AAQ A;  4H50 A;  2BYB A;  3DK4 A;  4Z25 A;  3SZF A;  1QJD A;  3FPZ A;  5KMS A;  2XDO A;  3BI5 A;  1MO9 A;  4NTE A;  1E39 A;  2BK3 A;  3T2Y A;  4C74 A;  4JN9 A;  1F8S A;  1GRE A;  1L9E A;  2C65 A;  3CMM A;  4G74 A;  4CCQ A;  1B37 A;  3UKK A;  3GMC A;  4Z43 A;  2BS4 A;  4CCR A;  4CY6 A;  3AE2 A;  4WCT A;  4CY8 A;  3GDP A;  3ZYX A;  3C4A A;  1GSN A;  3CGC A;  4GDP A;  4YWO A;  4BV6 A;  2JB2 A;  3HYV A;  1TDE A;  1EL8 A;  1N4V A;  4O5U A;  3EAO A;  3NIX A;  1PBE A;  1H86 A;  3AE1 A;  3SZC A;  4EMW A;  4NNJ A;  1BZL A;  4Z24 A;  1P2E A;  3DH9 A;  4A99 A;  2YG3 A;  5JCI A;  3P4P A;  2WOW A;  3ALJ A;  1GRA A;  2X8H A;  3DJE A;  3DGZ A;  5IQ4 A;  5HHF A;  1E1K A;  4DNA A;  5KVH A;  3AE3 A;  4U2S A;  4EMI A;  2VVL G;  1O5W A;  3AE9 A;  4NZH A;  3H8I A;  4KX6 A;  4YSY A;  4FK1 C;  1OJD A;  1CJ4 A;  4AT0 A;  4PAA A;  4TLZ A;  3UKL A;  3KA7 A;  2V5Z A;  4XWZ A;  1MOK A;  2WP6 A;  2XLS A;  4D03 A;  2H89 A;  1JNR A;  1LV0 A;  3KKJ A;  1NHP A;  2CVJ A;  4USQ A;  1DNC A;  1Q1W A;  2GAH B;  3GDN A;  1DJQ A;  3P1W A;  4P9S A;  2JB1 A;  5M0Z A;  2DKH A;  4A6N A;  4C3X A;  2YLW A;  1ELI A;  2O9Z A;  1GND A;  1D4D A;  3UP5 A;  1BKW A;  4OPU A;  3EF6 A;  3BI2 A;  1D7L A;  1W4X A;  1EL9 A;  1GXF A;  2GH5 A;  1NDA A;  1CHU A;  1E6E A;  3CNP A;  1Y56 B;  3P4Q A;  3NT6 A;  2OAL A;  4B68 A;  5HXI A;  3LOV A;  4Y4L A;  1S3B A;  4H7U A;  2VOU A;  2WPC A;  5EOW A;  5GSN A;  4EQX A;  4J57 A;  4HB9 A;  1F3P A;  4X9M A;  2JBV A;  3IHG A;  3ATQ A;  4BUR A;  4FX9 A;  2C75 A;  1ZMD A;  2C70 A;  3T31 A;  1QLB A;  1DXL A;  1H81 A;  5DBJ A;  3NN6 X;  3EAN A;  2EQ8 A;  1O94 A;  4U8N A;  2B9X A;  5BUK A;  2EQ7 A;  2XFN A;  2ACZ A;  3F8R A;  3T0K A;  2WQY A;  4H4U A;  3LB8 A;  5KRQ A;  4OPG A;  3Q6J A;  2UZZ A;  3PVC A;  2XYO A;  5KNL A;  1E1L A;  3CIR A;  5KVI A;  3T2K A;  4CNK A;  3AED A;  1KSS A;  2C66 A;  2YAU A;  3QSE A;  2YG6 A;  3GWF A;  3LXD A;  4U8O A;  3M13 A;  4IVM B;  2OLO A;  4YKG A;  3I3L A;  3UKH A;  1DOB A;  4JNQ A;  5KMQ A;  3AE5 A;  3UTG A;  2Z5X A;  2RAB A;  2AR8 A;  3BNM A;  4HA6 A;  1PBD A;  3DJG X;  4RG3 A;  2OAM A;  1GER A;  3ADA B;  2YG5 A;  1ZX9 A;  1EBD A;  2APG A;  2BK4 A;  4YTN A;  1IUT A;  1N4W A;  1H7W A;  2XVE A;  3GYX A;  3P4R A;  4JQ9 A;  3AYI A;  4OPI A;  4A9W A;  4II3 A;  1YQZ A;  5KOW A;  3DK8 A;  4DSH A;  3IHM A;  3E1T A;  1KFY A;  2Q0L A;  3FIM B;  2R4J A;  2VRM A;  4K7Z A;  3UKF A;  4Y4M A;  3G5S A;  3ICR A;  1VRQ B;  5ER0 A;  2V61 A;  4KPR A;  3G5R A;  3DK9 A;  4OVI A;  5C3J A;  4GDE A;  4U2L A;  3UKP A;  2A8X A;  3NG7 X;  3QSM A;  3D1C A;  1CJC A;  1H82 A;  4ECH A;  4IV9 A;  4BK3 A;  1D4E A;  2ZZC A;  2B9W A;  3CNT A;  2J3N A;  3QJ4 A;  4Z26 A;  4Z2T A;  3UOX A;  1TRB A;  1JU2 A;  2GRT A;  1PXC A;  4UDQ A;  2FJD A;  3B6D A;  2B76 A;  3BNU A;  1NEN A;  2FJB A;  4C77 A;  3OZ2 A;  3RP6 A;  2R0P A;  4USR A;  2PHH A;  4YT0 A;  4K8D A;  3ICS A;  1GRF A;  1GRH A;  2WDQ A;  4EQR A;  1ONF A;  2XVJ A;  3NYF A;  4AOX A;  4B63 A;  5KMR A;  3NRN A;  3LJP A;  1B8S A;  1GRG A;  3SX6 A;  4ZN0 A;  2F5Z A;  3GRT A;  4J33 A;  4CNJ A;  1ZOY A;  1VG0 A;  3K7T A;  2QCU A;  1JRY A;  1QO8 A;  2A89 A;  4II2 A;  4U8M A;  4GUV A;  2BRY A;  3AYL A;  3GWD A;  3IC9 A;  5KWF A;  4J34 A;  1PJ6 A;  3DME A;  2YLT A;  2VQ7 A;  3URH A;  3V3O A;  2GQF A;  3SY4 A;  4A5L A;  1DOE A;  2BS3 A;  3D8X A;  3PS9 A;  4BK2 A;  2X3N A;  3LZW A;  2BS2 A;  3AEG A;  3IWA A;  2Q0K A;  2OA1 A;  3BHK A;  4J56 A;  3WE0 A;  2R0G A;  1S2Q A;  3QSS A;  4H4Y A;  5JCL A;  3UP4 A;  2GQW A;  2FJA A;  4J31 A;  2Q6U A;  3AB1 A;  4IA6 A;  4EM4 A;  3EPT A;  4GAP A;  4K5S A;  5U63 A;  2V3A A;  2XFU A;  1TYP A;  2GVC A;  4UDP A;  1V59 A;  4Z44 A;  4U8J A;  4B65 A;  3GRS A;  1NG3 A;  5FS7 A;  3NHO X;  3NN0 X;  1CJ2 A;  2CFY A;  2XLU A;  4H4S A;  1FOH A;  3CGD A;  1OJC A;  4AOS A;  1VQW A;  2WBA A;  5FS8 A;  3UTH A;  3C96 A;  5EBK A;  1K0L A;  1COY A;  2BC0 A;  4OPL A;  4WX1 A;  3K7Q X;  2FJE A;  2E5V A;  2R0C A;  1RSG A;  3S61 A;  3FMW A;  1K4Q A;  3UTE A;  4OPC A;  4AP1 A;  3ZDN A;  2W0H A;  5CQF A;  5HYM A;  1M64 A;  2YR5 A;  1NAA A;  1H6V A;  2XFQ A;  5EB5 A;  2X50 A;  3K30 A;  2R46 A;  5J60 A;  1DOC A;  4JDR A;  4EIP A;  1PS9 A;  4A65 A;  4CBQ A;  4ICY A;  2GB0 A;  4B67 A;  3KLJ A;  3L8K A;  2B9Y A;  2XVF A;  2YVJ A;  2WDV A;  1PDH A;  3CPI G;  4NEV A;  1X31 B;  2JKC A;  1PN0 A;  2WET A;  1FEB A;  3CND A;  1Q1R A;  2A87 A;  5J7X A;  1GTE A;  1S2Y A;  4D04 A;  1GV4 A;  3CN8 A;  2NVK X;  2WP9 A;  4H4W A;  4ZCD A;  3AD9 B;  2CUL A;  1JRX A;  2JK6 A;  4H2P A;  3V3N A;  1K0J A;  2V6O A;  1OJT A;  2AQJ A;  4AT2 A;  4RSL A;  2JB3 A;  1REO A;  1ZKQ A;  3NH3 X;  3P9U A;  3II4 A;  2IVD A;  2RGH A;  1KF6 A;  4LII A;  4B69 A;  1XHC A;  4E0V A;  1GPE A;  4BJZ A;  2XVH A;  3KVE A;  1BGJ A;  2GAG B;  2X8G A;  3NK0 X;  3VQR A;  2BAC A;  5BRT A;  4EIQ A;  4H2N A;  4U8P A;  1GRB A;  2CDU A;  4APN A;  4GF7 A;  4J36 A;  5C2T A;  1EL7 A;  1XAN A;  4X9N A;  2YM2 A;  4DSG A;  3COX A;  2X8C A;  3ISH A;  2YVG A;  4H4X A;  3UOY A;  5BUL A;  5HY5 A;  3QVR A;  4K5R A;  2WU5 A;  1JEH A;  3DJJ A;  3ICT A;  3BHF A;  3B3R A;  1BF3 A;  2GR2 A;  3AE4 A;  1GAL A;  2IVE A;  2PYX A;  3LZX A;  1CC4 A;  3NTD A;  4YTM A;  1K0I A;  2I0Z A;  3AXB A;  4J2W A;  1GET A;  2XLR A;  1CC2 A;  2ZZ0 A;  4A6N B;  4JNA A;  3NK2 X;  3SZW A;  4JY2 A;  4I59 A;  1GRT A;  4DGK A;  1CL0 A;  2WOI A;  4LA1 A;  4NTD A;  4OPT A;  5FS6 A;  3NYC A;  3UTF A;  1LJ1 A;  2E4G A;  2GF3 A;  1E7P A;  5BVA A;  2C3D A;  4GRT A;  3ALL A;  2XFP A;  2FBW A;  4UDR A;  3CPH G;  2BCP A;  4H4R A;  4MJW A;  2NPX A;  4H4V A;  3RP7 A;  4YXD A;  3FG2 P;  3GD3 A;  5CKU A;  4NWZ A;  4G9K A;  3SM8 A;  2WES A;  4TM1 A;  1JOA A;  4EM3 A;  2B7R A;  1CC6 A;  4G6G A;  3ABV A;  5JCM A;  2BA9 A;  3UKQ A;  1DOD A;  3GMB A;  2R9Z A;  3GSI A;  1MXT A;  3SQP A;  4U8L A;  1L9C A;  2XFO A;  3CNJ A;  4IVO B;  1NHQ A;  1FL2 A;  4H4Q A;  3OC4 A;  2C4C A;  4YSX A;  2YLR A;  3RNM A;  3NLC A;  4H2Q A;  5IPY A;  1L9D A;  2GR0 A;  2XLP A;  3UOV A;  1BGN A;  2C76 A;  4OPD A;  1B4V A;  2GMH A;  2BXR A;  1M6I A;  2VVL A;  3H4K A;  4YSZ A;  1F6M A;  1ZMC A;  1H7X A;  2GV8 A;  3O0H A;  4K2X A;  1CF3 A;  1YKJ A;  3F8D A;  4AP3 A;  3AYJ A;  3F8P A;  3KU9 A;  1IUS A;  5L46 A;  2B7S A;  2YLZ A;  4XXG A;  1XDI A;  2BRA A;  3AE6 A;  4ZCC A;  3M0O A;  4B1B A;  3DGH A;  1F8W A;  1Q9I A;  1PBC A;  2RGO A;  2GR3 A;  2H88 A;  2WDR A;  1YQ4 A;  2BK5 A;  2YLX A;  4BK1 A;  3HYX A;  1PJ7 A;  2C72 A;  3VRB A;  4CRT A;  1D7Y A;  3NK1 X;  4LU6 A;  3CGE A;  2QA2 A;  3NGC X;  2ARD A;  2YR4 A;  3AEE A;  4OCG A;  2WEU A;  3S5W A;  5FMH A;  3AE8 A;  1E1N A;  2JAE A;  1ZOV A;  1FEC A;  3SZ0 A;  1NG4 A;  4FDC B;  4EQW A;  4GCM A;  1JRZ A;  3AEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...