2BXRA

Human monoamine oxidase a in complex with clorgyline, crystal form a
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
453
structure length
445
Chain Sequence
HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINE OXIDASE [FLAVIN-CONTAINING] A
publication title Three-Dimensional Structure of Human Monoamine Oxidase a (Mao A): Relation to the Structures of Rat Mao a and Human Mao B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 155
structure length 445
sequence length 453
chains with identical sequence B
ec nomenclature ec 1.4.3.4: Monoamine oxidase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2bxrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2bxrA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 2bxrA02
4WCTA 5JCMA 2YG3A 2YR6A 4U8LA 3AEDA 1H82A 3PO7A 3LXDA 3AE7A 1OJ9A 3DGHA 2VVMA 2ZZ0A 5BVAA 3NKSA 1H84A 1SEZA 3I6DA 4Y4NA 3NYFA 3QFAA 1LQTA 1EL5A 3CPJG 4IV9A 4TM1A 1CJCA 4APNA 4H4SA 2WDQA 2E4GA 4OPIA 3GWDA 3ICTA 1D7YA 1NHRA 3ALMA 4B66A 3CGBA 3II4A 4OPUA 2WPCA 1LPFA 2XFOA 4A7AA 2YG5A 3ZYXA 1L9EA 5HXIA 1KNRA 1RSGA 1PBBA 2OALA 4H4TA 2QA1A 3C4NA 5KOWA 2YM1A 4YTNA 3IF9A 2XLRA 2BABA 2AQJA 2VOUA 2WBAA 2O9ZA 3AEBA 2R4EA 3UKKA 4Z26A 1D5TA 2C70A 3NGCX 4U8JA 2WOVA 3GSIA 2GR2A 1LJ1A 2GRTA 3ADAB 4EQRA 3VRBA 3DJDA 3P4RA 2C7GA 4H4XA 3F8PA 5J60A 1CJ4A 3CNDA 3CN8A 4BURA 2YR4A 3FBSA 4GCMA 2C75A 1FEAA 4FK1A 3ZDNA 1COYA 1ZP0A 1O5WA 3Q9TA 4BK3A 2XFQA 3FG2P 3DA1A 3BHKA 2EQ6A 2XFNA 1Y0PA 4H7UA 3RP6A 3P4QA 5KWFA 1CBOA 2XVEA 1PBCA 3NK1X 2BCPA 5DBJA 3ISHA 1GV4A 1E1LA 2WETA 4ICYA 4CNJA 2YVJA 5KOXA 1ZMDA 2IVDA 2RGJA 2H88A 3NYCA 4Y4MA 3UOYA 1EL8A 1H83A 2OA1A 4C3YA 5EBKA 3OZ2A 4U8NA 1B5QA 4E0VA 1PJ7A 5M0ZA 4N9XA 1GT8A 2X8CA 4CNKA 3KA7A 4IA5A 4H4VA 3ATRA 3PS9A 4LIIA 1DODA 3VR9A 2RGOA 3DH9A 1MOKA 1JRZA 2XYOA 2VRLA 1VQWA 2X3NA 5BUKA 2XLPA 4X9MA 2WDVA 2R9ZA 4DSHA 1S2QA 2YR5A 1FECA 4LA1A 4A9WA 5KXJA 2RGHA 4U8IA 1QO8A 5M10A 1VDCA 2YAUA 4YTMA 1YKJA 4EMJA 4U2SA 3AYJA 1GERA 1DXLA 3UKPA 4EQSA 5HY5A 1CF3A 4JDRA 1BWCA 3UTEA 2PHHA 4Z43A 1QJDA 4EM3A 3AE6A 1DOBA 3UOVA 1N1PA 4U8KA 3FMWA 1JOAA 1GRFA 1LQUA 3SGLA 4B1BA 2YM2A 4C3XA 2IVEA 3NTDA 2QAEA 4PAAA 1H86A 3IC9A 2FBWA 2GVCA 4U2LA 3AE9A 4Z44A 1GRHA 3IHGA 1TRBA 3NK2X 3GYIA 4H2NA 4AP1A 1K0JA 1F8WA 4B69A 4PABA 3SFDA 4U8PA 4IVMB 1IUVA 2QCUA 3GD3A 4EIQA 5U63A 4A5LA 2E5VA 4YT0A 4I59A 4B63A 1E6EA 2YG6A 1GRTA 3QSMA 3UP5A 2GQFA 3NTAA 2NVKX 3ALLA 4RSLA 4FDCB 4GRTA 4K7ZA 3BHFA 3CGDA 4O5UA 4C74A 3QVPA 4KX6A 3SM8A 4NTDA 4K2XA 5BRTA 2FJAA 1GETA 1ZOYA 2YLRA 3G5QA 2GF3A 3DJGX 1PS9A 1DOEA 4UP3A 2X50A 2X99A 1E39A 4A79A 1JEHA 2YVGA 4C5OA 5J7XA 3NK0X 2WOIA 2B7RA 3G5SA 1LVLA 2GR0A 3EAOA 4FX9A 4UDQA 1TYPA 2GH5A 1LTXR 1PXCA 1YQ4A 3WE0A 2WP6A 1GREA 4NTEA 3NN0X 2XLTA 4M52A 3NIXA 2Z5XA 2GAGB 1GPEA 3K7QX 2B76A 1E1NA 2X8HA 5EOWA 4Z2UA 2APGA 1H81A 3P4PA 1D7LA 1F8RA 2JB3A 3L1RA 3T37A 3D1CA 4Z24A 2CVJA 2WESA 3CNPA 2E1MA 2JKCA 3EPTA 1L0VA 1Q1WA 1CC2A 2R45A 1H7WA 3LZWA 1TDKA 3M0OA 3GMCA 2R0CA 3UP4A 1N4VA 4WX1A 5EB5A 2TMDA 1P2EA 3K30A 2C66A 1OJCA 5FMHA 5JCKA 2VQ7A 2JBVA 4YSXA 5IQ4A 5FS8A 3K7TA 5KVHA 1NHPA 4O5QA 2FJBA 2XVIA 4JNQA 1IJHA 3H4KA 1F3PA 4YKGA 4CY6A 2WPEA 3AE2A 3NRNA 3UTGA 1S3BA 3DK8A 1W4XA 2BS4A 2CFYA 1EBDA 2YLXA 3O0HA 1PBEA 4YTPA 4FK1C 2R0PA 4OVIA 2I0ZA 3OC4A 1NG4A 3BI2A 3D8XA 2JB2A 2XCGA 2B9XA 4H4WA 1V59A 2HQMA 4K22A 3I3LA 1IUUA 3DMEA 2YLWA 3GRSA 4ZN0A 1CC6A 5JCIA 1DNCA 1S2YA 4CY8A 1GRAA 1L9DA 3LZXA 3PVCA 1NAAA 3K7MX 2YLTA 4J31A 1EL9A 1JNZA 1X31B 1ZX9A 3IHMA 3UKAA 1GRGA 2WDRA 1TYTA 1XHCA 4JQ9A 1M64A 4TM4A 4AT0A 5JCLA 4ECHA 3SFEA 4Z25A 2C65A 3AD8B 3EF6A 4K5RA 3AECA 4H4UA 3DK4A 4J33A 4OPLA 4USQA 1CC4A 1PJ5A 3LOVA 3JSKA 3R9UA 4K5SA 4USRA 3GDPA 4B68A 2YG4A 4LU6A 1GTEA 4OPTA 4XWZA 1AOGA 4JY2A 1TDEA 2BK3A 4AT2A 2BK5A 2JB1A 5C2TA 3P9UA 2XVJA 4UDPA 2R0GA 4J36A 1LV0A 3F8DA 1NPXA 4TM0A 3AD9B 3B6DA 1XDIA 1OJDA 1ELIA 2BS3A 3CPIG 1H6VA 3AEFA 2YVFA 1UKVG 5HYMA 1D4CA 3IWAA 1GSNA 1NHQA 4BK1A 3NLCA 2C3CA 1KSSA 4DSGA 1REOA 1N4WA 1ONFA 1KNPA 1GALA 2AR8A 2QA2A 4ZCDA 2VQBA 1S3EA 3RNMA 4H4PA 3GYJA 4OPDA 2Q0KA 4U8MA 5U1OA 2GAHB 3M12A 4EM4A 3GD4A 4J34A 2GR3A 1IUSA 3QFBA 4J57A 2XDOA 2TPRA 1FCDA 3L8KA 3CGCA 1GEUA 4ZCCA 3LJPA 4EQWA 2C67A 1GTHA 3QJ4A 1BGJA 4OPCA 1YQ3A 1KSUA 3NG7X 4YSYA 2Q0LA 1M6IA 1K0IA 2DKIA 5TR3A 3P4SA 1ZK7A 1K4QA 2V60A 4JY3A 2WHDA 5JCNA 1GOSA 5C3JA 2FJDA 3UTFA 2VZ2A 2V3AA 2ZBWA 2GB0A 3AE1A 3S61A 4GF7A 2C76A 2BC0A 2FJEA 1ZDLA 1PBDA 3CNTA 3KVEA 4A6NB 1FEBA 4H2PA 4A65A 4EMIA 1VRQB 4X9NA 3NT6A 4HA6A 1CJ3A 2WPFA 4YXDA 4YKFA 3AYLA 1L9CA 3G5RA 1KDGA 2V6OA 2ZZBA 4OPGA 4CBQA 3CGEA 3GWFA 3AEGA 3UOZA 1Z6LA 2B9YA 2B7SA 5FS9A 2GR1A 2OLOA 3AB1A 1B8SA 1MXTA 4A6NA 1JRYA 5GSNA 3VRDB 2XLUA 3DGZA 3DJEA 4U2TA 2XLSA 3BI4A 3KPFA 1ZKQA 3KKJA 4EIPA 1PJ6A 4P9SA 4RG3A 1E1KA 3UKLA 1PN0A 3AWIA 1CHUA 3V3NA 2JK6A 1YY5A 3FIMB 3GMBA 3AD7B 3QSEA 1NEKA 1BZLA 3SQPA 4YSZA 4J56A 5FS6A 1IUXA 3GRTA 4D04A 4OCGA 5CQFA 2A89A 1H7XA 4CCQA 1E7PA 4EMWA 3REDA 2Q6UA 2NPXA 2IIDA 4CRTA 1B37A 4B67A 1E1MA 1NDAA 1O94A 2UZZA 3ABVA 1PDHA 4GDPA 1OJTA 2EQ9A 4B64A 1NENA 2V61A 1TDOA 1DJQA 2XFPA 3F8RA 3FPZA 1TDNA 3KD9A 4MJWA 1BGNA 2H89A 4YWOA 3RHAA 2R46A 1JNRA 3UKQA 3DK9A 1OJAA 4AP3A 1TDFA 1JU2A 2X8GA 1NG3A 1DJNA 4IVOB 4NEVA 4U8OA 1KFYA 1GNDA 4NZHA 1RP0A 5GRTA 1Q9IA 2Y6QA 3NHOX 4I58A 1F6MA 3ITJA 3NN6X 2VVLG 4Z2TA 2BS2A 4YSHA 4REKA 3V3OA 1BKWA 5KRQA 4X4JA 3ICSA 1EL7A 1PXBA 3E1TA 5IPYA 5EB4A 3KLJA 1CJ2A 4TM3A 1BF3A 2BYBA 1IUTA 1ZY8A 2BK4A 1GXFA 2C64A 4H4RA 1XPQA 2J3NA 4H4ZA 2AAQA 2WOWA 1ZMCA 4GDEA 2BXSA 3NH3X 4C77A 3C4AA 4TLXA 5FS7A 2WEUA 2WP5A 1D4DA 1HYUA 2WU5A 3ATQA 3BI5A 2YLZA 3NNEA 3ICRA 4H2RA 3AYIA 2C72A 4ADWA 2V3BA 2ACZA 1QLBA 2C73A 3DJJA 2PYXA 2XFUA 4H50A 4B65A 2R4JA 2Q7VA 5ER0A 4KPRA 2A87A 4H2QA 4DGKA 5BULA 3UOXA 3QVRA 1P2HA 4H4YA 4RG4A 2ARDA 2GQWA 3GDNA 1B4VA 2BACA 1FOHA 2F5ZA 4GR1A 2CULA 4NTCA 3VQRA 2WP9A 2WU2A 1F8SA 1JRXA 3HZLA 3NYEA 1GRBA 3AE4A 3S5WA 4A99A 1K0LA 1O95A 2YWLA 4CCRA 2BXRA 3CIRA 1FL2A 1PBFA 3B3RA 3AE5A 1Y56B 4BV6A 4IA6A 2EQ8A 2B9WA 4H4QA 1MO9A 3CTYA 5IQ1A 4HB9A 2YG7A 3LADA 4XXGA 2BC1A 3AEEA 2BA9A 1Q1RA 3KU9A 5HHFA 4XWRA 3UTHA 5U25A 3BNUA 2Y6RA 3CPHG 1Y56A 4JN9A 5CKUA 3H8LA 3Q6JA 2V5ZA 4DNAA 2Z5YA 1VG0A 2YLSA 3URHA 3RP7A 3LB8A 2ZZCA 2VRMA 1NHSA 1GESA 4JNAA 4TLZA 5KVIA 2GV8A 1KF6A 2VVLA 3EANA 1VG9A 1PHHA 3AE3A 2RABA 3VRAA 2OAMA 2OLNA 4K8DA 1RYIA 4NEWA 4D03A 4GUVA 3QSSA 4UDRA 2WQYA 3UKFA 4BK2A 2JAEA 3AE8A 1YQZA 4EQXA 3BNMA 2EQ7A 1IUWA 1ZOVA 4BJYA 1XANA 1DOCA 2GMHA 3AEAA 3ALJA 4Y4LA 4AOXA 2CDUA 2GEWA 3P1WA 4J2WA 2BCGG 5L46A 1D4EA 4Z2RA 3C96A 3V76A 3H8IA 2C3DA 2XVFA 3CNJA 4AOSA 2WS3A 4BJZA 3RP8A 2W0HA 3UCLA 3AXBA 2XVHA 2DKHA 3VR8A 3M13A 3UKHA 1CL0A 1PXAA 5LV9A 2YQUA 3CNSA 1N4UA 2A8XA 2GMJA 3COXA
chains in the Genus database with same CATH superfamily
4WCTA 5JCMA 2YG3A 2YR6A 4U8LA 3AEDA 1H82A 5KMQA 3PO7A 3LXDA 3AE7A 1OJ9A 3DGHA 2VVMA 2ZZ0A 5BVAA 3NKSA 1H84A 1SEZA 3I6DA 4Y4NA 3NYFA 3QFAA 1LQTA 1EL5A 3CPJG 4IV9A 4TM1A 1CJCA 4APNA 4H4SA 2WDQA 2E4GA 4OPIA 3GWDA 3ICTA 1D7YA 1NHRA 3ALMA 4B66A 3CGBA 3II4A 4OPUA 2WPCA 1LPFA 2XFOA 4A7AA 2YG5A 3ZYXA 1L9EA 5HXIA 1KNRA 1RSGA 3SZFA 1PBBA 2OALA 4H4TA 2QA1A 3C4NA 5KOWA 2YM1A 4YTNA 3IF9A 2XLRA 2BABA 2AQJA 2VOUA 2WBAA 2O9ZA 3AEBA 2R4EA 3UKKA 4Z26A 1D5TA 2C70A 3NGCX 4II3A 4U8JA 2WOVA 3GSIA 4II2A 2GR2A 1LJ1A 2GRTA 3ADAB 4EQRA 3VRBA 3DJDA 3P4RA 2C7GA 4H4XA 3F8PA 5J60A 1CJ4A 3CNDA 3CN8A 4BURA 2YR4A 3FBSA 4GCMA 2C75A 1FEAA 4FK1A 3ZDNA 1COYA 1ZP0A 1O5WA 3Q9TA 4BK3A 2XFQA 3FG2P 3DA1A 3BHKA 2EQ6A 2XFNA 1Y0PA 4H7UA 3RP6A 3P4QA 5KWFA 1CBOA 2XVEA 1PBCA 3NK1X 3T2KA 2BCPA 5DBJA 3ISHA 1GV4A 1E1LA 2WETA 4ICYA 4CNJA 2YVJA 5KOXA 1ZMDA 2IVDA 2RGJA 2H88A 3NYCA 4Y4MA 3SZ0A 3UOYA 1EL8A 1H83A 2OA1A 4C3YA 5EBKA 3OZ2A 4U8NA 1B5QA 4E0VA 1PJ7A 5M0ZA 4N9XA 1GT8A 2X8CA 4CNKA 2BRYA 3KA7A 4IA5A 4H4VA 3ATRA 3PS9A 4LIIA 1DODA 3VR9A 2RGOA 3DH9A 1MOKA 1JRZA 2XYOA 2VRLA 4NNJA 1VQWA 2X3NA 5BUKA 2XLPA 4X9MA 2WDVA 2R9ZA 4DSHA 1S2QA 2YR5A 1FECA 4LA1A 4A9WA 5KXJA 2RGHA 4U8IA 1QO8A 5M10A 1VDCA 2YAUA 4YTMA 1YKJA 4EMJA 4U2SA 3AYJA 1GERA 1DXLA 3UKPA 2BRAA 4EQSA 5HY5A 1CF3A 4JDRA 1BWCA 3UTEA 2PHHA 4Z43A 1QJDA 4EM3A 3AE6A 1DOBA 3UOVA 1N1PA 4U8KA 3FMWA 1JOAA 1GRFA 1LQUA 3SGLA 4B1BA 2YM2A 4C3XA 2IVEA 3NTDA 2QAEA 4PAAA 1H86A 3IC9A 2FBWA 2GVCA 4U2LA 3GYXA 4NWZA 3AE9A 4G6GA 1GRHA 4Z44A 3IHGA 1TRBA 3NK2X 3GYIA 4H2NA 4AP1A 1K0JA 1F8WA 4B69A 4PABA 3SFDA 4GAVA 4U8PA 4IVMB 1IUVA 2QCUA 3GD3A 4EIQA 5U63A 4A5LA 2E5VA 4YT0A 4I59A 4B63A 1E6EA 2YG6A 1GRTA 3QSMA 3SXIA 3UP5A 2GQFA 3NTAA 2NVKX 3ALLA 4RSLA 4FDCB 4GRTA 4K7ZA 3BHFA 3CGDA 4O5UA 4C74A 3QVPA 4KX6A 3SM8A 4NTDA 4K2XA 5BRTA 2FJAA 1GETA 1ZOYA 2YLRA 3G5QA 2GF3A 3DJGX 1PS9A 1DOEA 4UP3A 2X50A 2X99A 1E39A 4A79A 1JEHA 2YVGA 4C5OA 5J7XA 3NK0X 2WOIA 2B7RA 3G5SA 1LVLA 2GR0A 3EAOA 4FX9A 4UDQA 1TYPA 3T2ZA 2GH5A 1LTXR 1PXCA 1YQ4A 3WE0A 2WP6A 1GREA 4NTEA 3NN0X 2XLTA 4M52A 3NIXA 2Z5XA 2GAGB 1GPEA 3K7QX 2B76A 1E1NA 2X8HA 5EOWA 4Z2UA 2APGA 1H81A 3CMMA 3P4PA 1D7LA 1F8RA 2JB3A 3L1RA 3T37A 3D1CA 4Z24A 2CVJA 2WESA 3CNPA 2E1MA 2JKCA 3EPTA 1L0VA 3KPKA 1Q1WA 1CC2A 2R45A 1H7WA 3LZWA 1TDKA 3M0OA 3GMCA 2R0CA 4G73A 3UP4A 3HYWA 1N4VA 4WX1A 5EB5A 2TMDA 1P2EA 3K30A 2C66A 1OJCA 5FMHA 5JCKA 2VQ7A 2JBVA 4YSXA 5IQ4A 5FS8A 3K7TA 5KVHA 1NHPA 4O5QA 2FJBA 2XVIA 4JNQA 1IJHA 3H4KA 1F3PA 4YKGA 4CY6A 2WPEA 3AE2A 3NRNA 3UTGA 1S3BA 3DK8A 1W4XA 2BS4A 2CFYA 1EBDA 2YLXA 3O0HA 4G74A 1PBEA 4YTPA 4FK1C 5KNLA 2R0PA 4OVIA 2I0ZA 3OC4A 1NG4A 3BI2A 3D8XA 2JB2A 2XCGA 2B9XA 3HYVA 4H4WA 1V59A 2HQMA 4K22A 3I3LA 1IUUA 3DMEA 2YLWA 3GRSA 4ZN0A 1CC6A 5JCIA 3T31A 1DNCA 1S2YA 4CY8A 1GRAA 1L9DA 3LZXA 3PVCA 1NAAA 3K7MX 2YLTA 4J31A 1EL9A 1JNZA 1X31B 1ZX9A 3IHMA 3UKAA 1GRGA 2WDRA 1TYTA 1XHCA 4JQ9A 1M64A 4TM4A 4AT0A 5JCLA 4ECHA 3SFEA 4Z25A 2C65A 3AD8B 3EF6A 4K5RA 3AECA 4H4UA 3DK4A 4J33A 4OPLA 4USQA 1CC4A 1PJ5A 3LOVA 3JSKA 3R9UA 4K5SA 4USRA 3GDPA 4B68A 2YG4A 4LU6A 1GTEA 4OPTA 4XWZA 3T2YA 1AOGA 4JY2A 1TDEA 2BK3A 4AT2A 2BK5A 2JB1A 5C2TA 3P9UA 2XVJA 4UDPA 2R0GA 4J36A 1LV0A 3SYIA 3F8DA 1NPXA 4TM0A 3AD9B 3B6DA 1XDIA 1OJDA 1ELIA 2BS3A 3CPIG 1H6VA 3AEFA 2YVFA 1UKVG 5HYMA 1D4CA 3IWAA 3T0KA 1GSNA 1NHQA 4BK1A 3NLCA 2C3CA 1KSSA 4DSGA 1REOA 1N4WA 1ONFA 1KNPA 1GALA 2AR8A 2QA2A 4ZCDA 2VQBA 1S3EA 3RNMA 4H4PA 3GYJA 4OPDA 2Q0KA 4U8MA 5U1OA 2GAHB 3M12A 4EM4A 3GD4A 4J34A 2GR3A 1IUSA 3QFBA 4J57A 2XDOA 2TPRA 1FCDA 3L8KA 3CGCA 1GEUA 4ZCCA 3LJPA 4EQWA 2C67A 1GTHA 3QJ4A 1BGJA 4OPCA 1YQ3A 1KSUA 3NG7X 4YSYA 2Q0LA 1M6IA 1K0IA 2DKIA 5TR3A 3P4SA 1ZK7A 1K4QA 2V60A 4JY3A 2WHDA 5JCNA 1GOSA 5C3JA 2FJDA 3UTFA 2VZ2A 2V3AA 5KMSA 2ZBWA 2GB0A 3AE1A 3S61A 4GF7A 2C76A 2BC0A 2FJEA 1ZDLA 1PBDA 3CNTA 3KVEA 4A6NB 1FEBA 4H2PA 4A65A 4EMIA 1VRQB 4X9NA 3NT6A 4HA6A 3T14A 3HYXA 1CJ3A 2WPFA 4YXDA 4YKFA 3AYLA 1L9CA 3G5RA 1KDGA 2V6OA 2ZZBA 4OPGA 4CBQA 3CGEA 3GWFA 3AEGA 3UOZA 1Z6LA 2B9YA 2B7SA 5FS9A 2GR1A 2OLOA 3AB1A 1B8SA 1MXTA 4A6NA 1JRYA 5GSNA 3VRDB 2XLUA 3DGZA 3DJEA 4G9KA 2XLSA 3BI4A 3KPFA 1ZKQA 4U2TA 3KKJA 4EIPA 1PJ6A 4P9SA 4RG3A 1E1KA 3UKLA 1PN0A 3AWIA 1CHUA 3V3NA 2JK6A 1YY5A 3FIMB 3GMBA 3AD7B 3QSEA 1NEKA 1BZLA 3SQPA 4YSZA 4GAPA 4J56A 5FS6A 1IUXA 3GRTA 4D04A 4OCGA 5CQFA 2A89A 1H7XA 4CCQA 1E7PA 4EMWA 3REDA 2Q6UA 2NPXA 2IIDA 4CRTA 1B37A 4B67A 1E1MA 1NDAA 1O94A 2UZZA 3ABVA 1PDHA 4GDPA 1OJTA 2EQ9A 4B64A 1NENA 2V61A 1TDOA 1DJQA 2XFPA 3F8RA 3FPZA 1TDNA 3KD9A 4MJWA 1BGNA 2H89A 4YWOA 3RHAA 2R46A 5KMRA 2C4CA 1JNRA 3UKQA 3DK9A 1OJAA 4AP3A 1TDFA 1JU2A 2X8GA 1NG3A 3SY4A 1DJNA 4IVOB 4NEVA 4U8OA 3SX6A 1KFYA 1GNDA 4NZHA 1RP0A 5GRTA 1Q9IA 2Y6QA 3NHOX 4I58A 1F6MA 3ITJA 3NN6X 2VVLG 4Z2TA 2BS2A 4YSHA 4REKA 3V3OA 1BKWA 5KRQA 4X4JA 3ICSA 1EL7A 1PXBA 3E1TA 5IPYA 5EB4A 3KLJA 1CJ2A 3SZCA 4TM3A 1BF3A 2BYBA 1IUTA 1ZY8A 2BK4A 1GXFA 2C64A 4H4RA 1XPQA 2J3NA 4H4ZA 2AAQA 2WOWA 1ZMCA 4GDEA 2BXSA 3NH3X 4C77A 3C4AA 4TLXA 5FS7A 2WEUA 2WP5A 1D4DA 1HYUA 2WU5A 3ATQA 3BI5A 2YLZA 3NNEA 3ICRA 4H2RA 3AYIA 2C72A 4ADWA 2V3BA 2ACZA 1QLBA 2C73A 3DJJA 2PYXA 2XFUA 4H50A 4B65A 2R4JA 2Q7VA 5ER0A 4KPRA 2A87A 4H2QA 4DGKA 5BULA 3UOXA 3QVRA 1P2HA 4H4YA 4RG4A 2ARDA 2GQWA 3GDNA 5KMPA 1B4VA 2BACA 1FOHA 2F5ZA 4GR1A 2CULA 4NTCA 3VQRA 2WP9A 2WU2A 1F8SA 1JRXA 3HZLA 3NYEA 1GRBA 3AE4A 3S5WA 4G6HA 4A99A 1K0LA 1O95A 2YWLA 4CCRA 2BXRA 3CIRA 1FL2A 1PBFA 3B3RA 3AE5A 1Y56B 4BV6A 4IA6A 2EQ8A 2B9WA 4H4QA 1MO9A 3CTYA 5IQ1A 4HB9A 2YG7A 3LADA 4XXGA 2BC1A 3AEEA 2BA9A 1Q1RA 3KU9A 5HHFA 4XWRA 3UTHA 5U25A 3BNUA 2Y6RA 3CPHG 1Y56A 4JN9A 5CKUA 3H8LA 3Q6JA 2V5ZA 4DNAA 2Z5YA 1VG0A 2YLSA 3URHA 3RP7A 3LB8A 2ZZCA 2VRMA 1NHSA 1GESA 4JNAA 4TLZA 5KVIA 2GV8A 1KF6A 2VVLA 3EANA 1VG9A 1PHHA 3AE3A 2RABA 3VRAA 2OAMA 2OLNA 4K8DA 1RYIA 4NEWA 4D03A 4GUVA 3QSSA 4UDRA 3SZWA 2WQYA 3UKFA 4BK2A 2JAEA 3AE8A 1YQZA 4EQXA 3BNMA 2EQ7A 1IUWA 1ZOVA 4BJYA 1XANA 1DOCA 2GMHA 3AEAA 3ALJA 4Y4LA 4AOXA 2CDUA 2GEWA 3P1WA 4J2WA 2BCGG 5L46A 1D4EA 4Z2RA 3C96A 3V76A 3H8IA 2C3DA 2XVFA 3CNJA 4AOSA 2WS3A 4BJZA 3RP8A 2W0HA 3UCLA 3AXBA 2XVHA 2DKHA 3VR8A 3M13A 3UKHA 1CL0A 1PXAA 5LV9A 2YQUA 3CNSA 1N4UA 2A8XA 2GMJA 3COXA
chains in the Genus database with same CATH topology
4WCTA 5JCMA 2YG3A 2YR6A 4U8LA 3AEDA 1H82A 5KMQA 3PO7A 3LXDA 3AE7A 1OJ9A 3DGHA 2VVMA 2ZZ0A 5BVAA 3NKSA 1H84A 1SEZA 3I6DA 4Y4NA 3NYFA 3QFAA 1LQTA 1EL5A 3CPJG 4IV9A 4TM1A 1CJCA 4APNA 4H4SA 2WDQA 2E4GA 4OPIA 3GWDA 3ICTA 1D7YA 1NHRA 3ALMA 4B66A 3CGBA 3II4A 4OPUA 2WPCA 1LPFA 2XFOA 4A7AA 2YG5A 3ZYXA 1L9EA 5HXIA 1KNRA 1RSGA 3SZFA 1PBBA 2OALA 4H4TA 2QA1A 3C4NA 5KOWA 2YM1A 4YTNA 3IF9A 2XLRA 2BABA 2AQJA 2VOUA 2WBAA 2O9ZA 3AEBA 2R4EA 3UKKA 4Z26A 1D5TA 2C70A 3NGCX 4II3A 4U8JA 2WOVA 3GSIA 4II2A 2GR2A 1LJ1A 2GRTA 3ADAB 4EQRA 3VRBA 3DJDA 3P4RA 2C7GA 4H4XA 3F8PA 5J60A 1CJ4A 3CNDA 3CN8A 4BURA 2YR4A 3FBSA 4GCMA 2C75A 1FEAA 4FK1A 3ZDNA 1COYA 1ZP0A 1O5WA 3Q9TA 4BK3A 2XFQA 3FG2P 3DA1A 3BHKA 2EQ6A 2XFNA 1Y0PA 4H7UA 3RP6A 3P4QA 5KWFA 1CBOA 2XVEA 1PBCA 3NK1X 3T2KA 2BCPA 5DBJA 3ISHA 1GV4A 1E1LA 2WETA 4ICYA 4CNJA 2YVJA 5KOXA 1ZMDA 2IVDA 2RGJA 2H88A 3NYCA 4Y4MA 3SZ0A 3UOYA 1EL8A 1H83A 2OA1A 4C3YA 5EBKA 3OZ2A 4U8NA 1B5QA 4E0VA 1PJ7A 5M0ZA 4N9XA 1GT8A 2X8CA 4CNKA 2BRYA 3KA7A 4IA5A 4H4VA 3ATRA 3PS9A 4LIIA 1DODA 3VR9A 2RGOA 3DH9A 1MOKA 1JRZA 2XYOA 2VRLA 4NNJA 1VQWA 2X3NA 5BUKA 2XLPA 4X9MA 2WDVA 2R9ZA 4DSHA 1S2QA 2YR5A 1FECA 4LA1A 4A9WA 5KXJA 2RGHA 4U8IA 1QO8A 5M10A 1VDCA 2YAUA 4YTMA 1YKJA 4EMJA 4U2SA 3AYJA 1GERA 1DXLA 3UKPA 2BRAA 4EQSA 5HY5A 1CF3A 4JDRA 1BWCA 3UTEA 2PHHA 4Z43A 1QJDA 4EM3A 3AE6A 1DOBA 3UOVA 1N1PA 4U8KA 3FMWA 1JOAA 1GRFA 1LQUA 3SGLA 4B1BA 2YM2A 4C3XA 2IVEA 3NTDA 2QAEA 4PAAA 1H86A 3IC9A 2FBWA 2GVCA 4U2LA 3GYXA 4NWZA 3AE9A 4G6GA 1GRHA 4Z44A 3IHGA 1TRBA 3NK2X 3GYIA 4H2NA 4AP1A 1K0JA 1F8WA 4B69A 4PABA 3SFDA 4GAVA 4U8PA 4IVMB 1IUVA 2QCUA 3GD3A 4EIQA 5U63A 4A5LA 2E5VA 4YT0A 4I59A 4B63A 1E6EA 2YG6A 1GRTA 3QSMA 3SXIA 3UP5A 2GQFA 3NTAA 2NVKX 3ALLA 4RSLA 4FDCB 4GRTA 4K7ZA 3BHFA 3CGDA 4O5UA 4C74A 3QVPA 4KX6A 3SM8A 4NTDA 4K2XA 5BRTA 2FJAA 1GETA 1ZOYA 2YLRA 3G5QA 2GF3A 3DJGX 1PS9A 1DOEA 4UP3A 2X50A 2X99A 1E39A 4A79A 1JEHA 2YVGA 4C5OA 5J7XA 3NK0X 2WOIA 2B7RA 3G5SA 1LVLA 2GR0A 3EAOA 4FX9A 4UDQA 1TYPA 3T2ZA 2GH5A 1LTXR 1PXCA 1YQ4A 3WE0A 2WP6A 1GREA 4NTEA 3NN0X 2XLTA 4M52A 3NIXA 2Z5XA 2GAGB 1GPEA 3K7QX 2B76A 1E1NA 2X8HA 5EOWA 4Z2UA 2APGA 1H81A 3CMMA 3P4PA 1D7LA 1F8RA 2JB3A 3L1RA 3T37A 3D1CA 4Z24A 2CVJA 2WESA 3CNPA 2E1MA 2JKCA 3EPTA 1L0VA 3KPKA 1Q1WA 1CC2A 2R45A 1H7WA 3LZWA 1TDKA 3M0OA 3GMCA 2R0CA 4G73A 3UP4A 3HYWA 1N4VA 4WX1A 5EB5A 2TMDA 1P2EA 3K30A 2C66A 1OJCA 5FMHA 5JCKA 2VQ7A 2JBVA 4YSXA 5IQ4A 5FS8A 3K7TA 5KVHA 1NHPA 4O5QA 2FJBA 2XVIA 4JNQA 1IJHA 3H4KA 1F3PA 4YKGA 4CY6A 2WPEA 3AE2A 3NRNA 3UTGA 1S3BA 3DK8A 1W4XA 2BS4A 2CFYA 1EBDA 2YLXA 3O0HA 4G74A 1PBEA 4YTPA 4FK1C 5KNLA 2R0PA 4OVIA 2I0ZA 3OC4A 1NG4A 3BI2A 3D8XA 2JB2A 2XCGA 2B9XA 3HYVA 4H4WA 1V59A 2HQMA 4K22A 3I3LA 1IUUA 3DMEA 2YLWA 3GRSA 4ZN0A 1CC6A 5JCIA 3T31A 1DNCA 1S2YA 4CY8A 1GRAA 1L9DA 3LZXA 3PVCA 1NAAA 3K7MX 2YLTA 4J31A 1EL9A 1JNZA 1X31B 1ZX9A 3IHMA 3UKAA 1GRGA 2WDRA 1TYTA 1XHCA 4JQ9A 1M64A 4TM4A 4AT0A 5JCLA 4ECHA 3SFEA 4Z25A 2C65A 3AD8B 3EF6A 4K5RA 3AECA 4H4UA 3DK4A 4J33A 4OPLA 4USQA 1CC4A 1PJ5A 3LOVA 3JSKA 3R9UA 4K5SA 4USRA 3GDPA 4B68A 2YG4A 4LU6A 1GTEA 4OPTA 4XWZA 3T2YA 1AOGA 4JY2A 1TDEA 2BK3A 4AT2A 2BK5A 2JB1A 5C2TA 3P9UA 2XVJA 4UDPA 2R0GA 4J36A 1LV0A 3SYIA 3F8DA 1NPXA 4TM0A 3AD9B 3B6DA 1XDIA 1OJDA 1ELIA 2BS3A 3CPIG 1H6VA 3AEFA 2YVFA 1UKVG 5HYMA 1D4CA 3IWAA 3T0KA 1GSNA 1NHQA 4BK1A 3NLCA 2C3CA 1KSSA 4DSGA 1REOA 1N4WA 1ONFA 1KNPA 1GALA 2AR8A 2QA2A 4ZCDA 2VQBA 1S3EA 3RNMA 4H4PA 3GYJA 4OPDA 2Q0KA 4U8MA 5U1OA 2GAHB 3M12A 4EM4A 3GD4A 4J34A 2GR3A 1IUSA 3QFBA 4J57A 2XDOA 2TPRA 1FCDA 3L8KA 3CGCA 1GEUA 4ZCCA 3LJPA 4EQWA 2C67A 1GTHA 3QJ4A 1BGJA 4OPCA 1YQ3A 1KSUA 3NG7X 4YSYA 2Q0LA 1M6IA 1K0IA 2DKIA 5TR3A 3P4SA 1ZK7A 1K4QA 2V60A 4JY3A 2WHDA 5JCNA 1GOSA 5C3JA 2FJDA 3UTFA 2VZ2A 2V3AA 5KMSA 2ZBWA 2GB0A 3AE1A 3S61A 4GF7A 2C76A 2BC0A 2FJEA 1ZDLA 1PBDA 3CNTA 3KVEA 4A6NB 1FEBA 4H2PA 4A65A 4EMIA 1VRQB 4X9NA 3NT6A 4HA6A 3T14A 3HYXA 1CJ3A 2WPFA 4YXDA 4YKFA 3AYLA 1L9CA 3G5RA 1KDGA 2V6OA 2ZZBA 4OPGA 4CBQA 3CGEA 3GWFA 3AEGA 3UOZA 1Z6LA 2B9YA 2B7SA 5FS9A 2GR1A 2OLOA 3AB1A 1B8SA 1MXTA 4A6NA 1JRYA 5GSNA 3VRDB 2XLUA 3DGZA 3DJEA 4G9KA 2XLSA 3BI4A 3KPFA 1ZKQA 4U2TA 3KKJA 4EIPA 1PJ6A 4P9SA 4RG3A 1E1KA 3UKLA 1PN0A 3AWIA 1CHUA 3V3NA 2JK6A 1YY5A 3FIMB 3GMBA 3AD7B 3QSEA 1NEKA 1BZLA 3SQPA 4YSZA 4GAPA 4J56A 5FS6A 1IUXA 3GRTA 4D04A 4OCGA 5CQFA 2A89A 1H7XA 4CCQA 1E7PA 4EMWA 3REDA 2Q6UA 2NPXA 2IIDA 4CRTA 1B37A 4B67A 1E1MA 1NDAA 1O94A 2UZZA 3ABVA 1PDHA 4GDPA 1OJTA 2EQ9A 4B64A 1NENA 2V61A 1TDOA 1DJQA 2XFPA 3F8RA 3FPZA 1TDNA 3KD9A 4MJWA 1BGNA 2H89A 4YWOA 3RHAA 2R46A 5KMRA 2C4CA 1JNRA 3UKQA 3DK9A 1OJAA 4AP3A 1TDFA 1JU2A 2X8GA 1NG3A 3SY4A 1DJNA 4IVOB 4NEVA 4U8OA 3SX6A 1KFYA 1GNDA 4NZHA 1RP0A 5GRTA 1Q9IA 2Y6QA 3NHOX 4I58A 1F6MA 3ITJA 3NN6X 2VVLG 4Z2TA 2BS2A 4YSHA 4REKA 3V3OA 1BKWA 5KRQA 4X4JA 3ICSA 1EL7A 1PXBA 3E1TA 5IPYA 5EB4A 3KLJA 1CJ2A 3SZCA 4TM3A 1BF3A 2BYBA 1IUTA 1ZY8A 2BK4A 1GXFA 2C64A 4H4RA 1XPQA 2J3NA 4H4ZA 2AAQA 2WOWA 1ZMCA 4GDEA 2BXSA 3NH3X 4C77A 3C4AA 4TLXA 5FS7A 2WEUA 2WP5A 1D4DA 1HYUA 2WU5A 3ATQA 3BI5A 2YLZA 3NNEA 3ICRA 4H2RA 3AYIA 2C72A 4ADWA 2V3BA 2ACZA 1QLBA 2C73A 3DJJA 2PYXA 2XFUA 4H50A 4B65A 2R4JA 2Q7VA 5ER0A 4KPRA 2A87A 4H2QA 4DGKA 5BULA 3UOXA 3QVRA 1P2HA 4H4YA 4RG4A 2ARDA 2GQWA 3GDNA 5KMPA 1B4VA 2BACA 1FOHA 2F5ZA 4GR1A 2CULA 4NTCA 3VQRA 2WP9A 2WU2A 1F8SA 1JRXA 3HZLA 3NYEA 1GRBA 3AE4A 3S5WA 4G6HA 4A99A 1K0LA 1O95A 2YWLA 4CCRA 2BXRA 3CIRA 1FL2A 1PBFA 3B3RA 3AE5A 1Y56B 4BV6A 4IA6A 2EQ8A 2B9WA 4H4QA 1MO9A 3CTYA 5IQ1A 4HB9A 2YG7A 3LADA 4XXGA 2BC1A 3AEEA 2BA9A 1Q1RA 3KU9A 5HHFA 4XWRA 3UTHA 5U25A 3BNUA 2Y6RA 3CPHG 1Y56A 4JN9A 5CKUA 3H8LA 3Q6JA 2V5ZA 4DNAA 2Z5YA 1VG0A 2YLSA 3URHA 3RP7A 3LB8A 2ZZCA 2VRMA 1NHSA 1GESA 4JNAA 4TLZA 5KVIA 2GV8A 1KF6A 2VVLA 3EANA 1VG9A 1PHHA 3AE3A 2RABA 3VRAA 2OAMA 2OLNA 4K8DA 1RYIA 4NEWA 4D03A 4GUVA 3QSSA 4UDRA 3SZWA 2WQYA 3UKFA 4BK2A 2JAEA 3AE8A 1YQZA 4EQXA 3BNMA 2EQ7A 1IUWA 1ZOVA 4BJYA 1XANA 1DOCA 2GMHA 3AEAA 3ALJA 4Y4LA 4AOXA 2CDUA 2GEWA 3P1WA 4J2WA 2BCGG 5L46A 1D4EA 4Z2RA 3C96A 3V76A 3H8IA 2C3DA 2XVFA 3CNJA 4AOSA 2WS3A 4BJZA 3RP8A 2W0HA 3UCLA 3AXBA 2XVHA 2DKHA 3VR8A 3M13A 3UKHA 1CL0A 1PXAA 5LV9A 2YQUA 3CNSA 1N4UA 2A8XA 2GMJA 3COXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCT A;  5JCM A;  2YG3 A;  2YR6 A;  4U8L A;  3AED A;  1H82 A;  3PO7 A;  3LXD A;  3AE7 A;  1OJ9 A;  3DGH A;  2VVM A;  2ZZ0 A;  5BVA A;  3NKS A;  1H84 A;  1SEZ A;  3I6D A;  4Y4N A;  3NYF A;  3QFA A;  1LQT A;  1EL5 A;  3CPJ G;  4IV9 A;  4TM1 A;  1CJC A;  4APN A;  4H4S A;  2WDQ A;  2E4G A;  4OPI A;  3GWD A;  3ICT A;  1D7Y A;  1NHR A;  3ALM A;  4B66 A;  3CGB A;  3II4 A;  4OPU A;  2WPC A;  1LPF A;  2XFO A;  4A7A A;  2YG5 A;  3ZYX A;  1L9E A;  5HXI A;  1KNR A;  1RSG A;  1PBB A;  2OAL A;  4H4T A;  2QA1 A;  3C4N A;  5KOW A;  2YM1 A;  4YTN A;  3IF9 A;  2XLR A;  2BAB A;  2AQJ A;  2VOU A;  2WBA A;  2O9Z A;  3AEB A;  2R4E A;  3UKK A;  4Z26 A;  1D5T A;  2C70 A;  3NGC X;  4U8J A;  2WOV A;  3GSI A;  2GR2 A;  1LJ1 A;  2GRT A;  3ADA B;  4EQR A;  3VRB A;  3DJD A;  3P4R A;  2C7G A;  4H4X A;  3F8P A;  5J60 A;  1CJ4 A;  3CND A;  3CN8 A;  4BUR A;  2YR4 A;  3FBS A;  4GCM A;  2C75 A;  1FEA A;  4FK1 A;  3ZDN A;  1COY A;  1ZP0 A;  1O5W A;  3Q9T A;  4BK3 A;  2XFQ A;  3FG2 P;  3DA1 A;  3BHK A;  2EQ6 A;  2XFN A;  1Y0P A;  4H7U A;  3RP6 A;  3P4Q A;  5KWF A;  1CBO A;  2XVE A;  1PBC A;  3NK1 X;  2BCP A;  5DBJ A;  3ISH A;  1GV4 A;  1E1L A;  2WET A;  4ICY A;  4CNJ A;  2YVJ A;  5KOX A;  1ZMD A;  2IVD A;  2RGJ A;  2H88 A;  3NYC A;  4Y4M A;  3UOY A;  1EL8 A;  1H83 A;  2OA1 A;  4C3Y A;  5EBK A;  3OZ2 A;  4U8N A;  1B5Q A;  4E0V A;  1PJ7 A;  5M0Z A;  4N9X A;  1GT8 A;  2X8C A;  4CNK A;  3KA7 A;  4IA5 A;  4H4V A;  3ATR A;  3PS9 A;  4LII A;  1DOD A;  3VR9 A;  2RGO A;  3DH9 A;  1MOK A;  1JRZ A;  2XYO A;  2VRL A;  1VQW A;  2X3N A;  5BUK A;  2XLP A;  4X9M A;  2WDV A;  2R9Z A;  4DSH A;  1S2Q A;  2YR5 A;  1FEC A;  4LA1 A;  4A9W A;  5KXJ A;  2RGH A;  4U8I A;  1QO8 A;  5M10 A;  1VDC A;  2YAU A;  4YTM A;  1YKJ A;  4EMJ A;  4U2S A;  3AYJ A;  1GER A;  1DXL A;  3UKP A;  4EQS A;  5HY5 A;  1CF3 A;  4JDR A;  1BWC A;  3UTE A;  2PHH A;  4Z43 A;  1QJD A;  4EM3 A;  3AE6 A;  1DOB A;  3UOV A;  1N1P A;  4U8K A;  3FMW A;  1JOA A;  1GRF A;  1LQU A;  3SGL A;  4B1B A;  2YM2 A;  4C3X A;  2IVE A;  3NTD A;  2QAE A;  4PAA A;  1H86 A;  3IC9 A;  2FBW A;  2GVC A;  4U2L A;  3AE9 A;  4Z44 A;  1GRH A;  3IHG A;  1TRB A;  3NK2 X;  3GYI A;  4H2N A;  4AP1 A;  1K0J A;  1F8W A;  4B69 A;  4PAB A;  3SFD A;  4U8P A;  4IVM B;  1IUV A;  2QCU A;  3GD3 A;  4EIQ A;  5U63 A;  4A5L A;  2E5V A;  4YT0 A;  4I59 A;  4B63 A;  1E6E A;  2YG6 A;  1GRT A;  3QSM A;  3UP5 A;  2GQF A;  3NTA A;  2NVK X;  3ALL A;  4RSL A;  4FDC B;  4GRT A;  4K7Z A;  3BHF A;  3CGD A;  4O5U A;  4C74 A;  3QVP A;  4KX6 A;  3SM8 A;  4NTD A;  4K2X A;  5BRT A;  2FJA A;  1GET A;  1ZOY A;  2YLR A;  3G5Q A;  2GF3 A;  3DJG X;  1PS9 A;  1DOE A;  4UP3 A;  2X50 A;  2X99 A;  1E39 A;  4A79 A;  1JEH A;  2YVG A;  4C5O A;  5J7X A;  3NK0 X;  2WOI A;  2B7R A;  3G5S A;  1LVL A;  2GR0 A;  3EAO A;  4FX9 A;  4UDQ A;  1TYP A;  2GH5 A;  1LTX R;  1PXC A;  1YQ4 A;  3WE0 A;  2WP6 A;  1GRE A;  4NTE A;  3NN0 X;  2XLT A;  4M52 A;  3NIX A;  2Z5X A;  2GAG B;  1GPE A;  3K7Q X;  2B76 A;  1E1N A;  2X8H A;  5EOW A;  4Z2U A;  2APG A;  1H81 A;  3P4P A;  1D7L A;  1F8R A;  2JB3 A;  3L1R A;  3T37 A;  3D1C A;  4Z24 A;  2CVJ A;  2WES A;  3CNP A;  2E1M A;  2JKC A;  3EPT A;  1L0V A;  1Q1W A;  1CC2 A;  2R45 A;  1H7W A;  3LZW A;  1TDK A;  3M0O A;  3GMC A;  2R0C A;  3UP4 A;  1N4V A;  4WX1 A;  5EB5 A;  2TMD A;  1P2E A;  3K30 A;  2C66 A;  1OJC A;  5FMH A;  5JCK A;  2VQ7 A;  2JBV A;  4YSX A;  5IQ4 A;  5FS8 A;  3K7T A;  5KVH A;  1NHP A;  4O5Q A;  2FJB A;  2XVI A;  4JNQ A;  1IJH A;  3H4K A;  1F3P A;  4YKG A;  4CY6 A;  2WPE A;  3AE2 A;  3NRN A;  3UTG A;  1S3B A;  3DK8 A;  1W4X A;  2BS4 A;  2CFY A;  1EBD A;  2YLX A;  3O0H A;  1PBE A;  4YTP A;  4FK1 C;  2R0P A;  4OVI A;  2I0Z A;  3OC4 A;  1NG4 A;  3BI2 A;  3D8X A;  2JB2 A;  2XCG A;  2B9X A;  4H4W A;  1V59 A;  2HQM A;  4K22 A;  3I3L A;  1IUU A;  3DME A;  2YLW A;  3GRS A;  4ZN0 A;  1CC6 A;  5JCI A;  1DNC A;  1S2Y A;  4CY8 A;  1GRA A;  1L9D A;  3LZX A;  3PVC A;  1NAA A;  3K7M X;  2YLT A;  4J31 A;  1EL9 A;  1JNZ A;  1X31 B;  1ZX9 A;  3IHM A;  3UKA A;  1GRG A;  2WDR A;  1TYT A;  1XHC A;  4JQ9 A;  1M64 A;  4TM4 A;  4AT0 A;  5JCL A;  4ECH A;  3SFE A;  4Z25 A;  2C65 A;  3AD8 B;  3EF6 A;  4K5R A;  3AEC A;  4H4U A;  3DK4 A;  4J33 A;  4OPL A;  4USQ A;  1CC4 A;  1PJ5 A;  3LOV A;  3JSK A;  3R9U A;  4K5S A;  4USR A;  3GDP A;  4B68 A;  2YG4 A;  4LU6 A;  1GTE A;  4OPT A;  4XWZ A;  1AOG A;  4JY2 A;  1TDE A;  2BK3 A;  4AT2 A;  2BK5 A;  2JB1 A;  5C2T A;  3P9U A;  2XVJ A;  4UDP A;  2R0G A;  4J36 A;  1LV0 A;  3F8D A;  1NPX A;  4TM0 A;  3AD9 B;  3B6D A;  1XDI A;  1OJD A;  1ELI A;  2BS3 A;  3CPI G;  1H6V A;  3AEF A;  2YVF A;  1UKV G;  5HYM A;  1D4C A;  3IWA A;  1GSN A;  1NHQ A;  4BK1 A;  3NLC A;  2C3C A;  1KSS A;  4DSG A;  1REO A;  1N4W A;  1ONF A;  1KNP A;  1GAL A;  2AR8 A;  2QA2 A;  4ZCD A;  2VQB A;  1S3E A;  3RNM A;  4H4P A;  3GYJ A;  4OPD A;  2Q0K A;  4U8M A;  5U1O A;  2GAH B;  3M12 A;  4EM4 A;  3GD4 A;  4J34 A;  2GR3 A;  1IUS A;  3QFB A;  4J57 A;  2XDO A;  2TPR A;  1FCD A;  3L8K A;  3CGC A;  1GEU A;  4ZCC A;  3LJP A;  4EQW A;  2C67 A;  1GTH A;  3QJ4 A;  1BGJ A;  4OPC A;  1YQ3 A;  1KSU A;  3NG7 X;  4YSY A;  2Q0L A;  1M6I A;  1K0I A;  2DKI A;  5TR3 A;  3P4S A;  1ZK7 A;  1K4Q A;  2V60 A;  4JY3 A;  2WHD A;  5JCN A;  1GOS A;  5C3J A;  2FJD A;  3UTF A;  2VZ2 A;  2V3A A;  2ZBW A;  2GB0 A;  3AE1 A;  3S61 A;  4GF7 A;  2C76 A;  2BC0 A;  2FJE A;  1ZDL A;  1PBD A;  3CNT A;  3KVE A;  4A6N B;  1FEB A;  4H2P A;  4A65 A;  4EMI A;  1VRQ B;  4X9N A;  3NT6 A;  4HA6 A;  1CJ3 A;  2WPF A;  4YXD A;  4YKF A;  3AYL A;  1L9C A;  3G5R A;  1KDG A;  2V6O A;  2ZZB A;  4OPG A;  4CBQ A;  3CGE A;  3GWF A;  3AEG A;  3UOZ A;  1Z6L A;  2B9Y A;  2B7S A;  5FS9 A;  2GR1 A;  2OLO A;  3AB1 A;  1B8S A;  1MXT A;  4A6N A;  1JRY A;  5GSN A;  3VRD B;  2XLU A;  3DGZ A;  3DJE A;  4U2T A;  2XLS A;  3BI4 A;  3KPF A;  1ZKQ A;  3KKJ A;  4EIP A;  1PJ6 A;  4P9S A;  4RG3 A;  1E1K A;  3UKL A;  1PN0 A;  3AWI A;  1CHU A;  3V3N A;  2JK6 A;  1YY5 A;  3FIM B;  3GMB A;  3AD7 B;  3QSE A;  1NEK A;  1BZL A;  3SQP A;  4YSZ A;  4J56 A;  5FS6 A;  1IUX A;  3GRT A;  4D04 A;  4OCG A;  5CQF A;  2A89 A;  1H7X A;  4CCQ A;  1E7P A;  4EMW A;  3RED A;  2Q6U A;  2NPX A;  2IID A;  4CRT A;  1B37 A;  4B67 A;  1E1M A;  1NDA A;  1O94 A;  2UZZ A;  3ABV A;  1PDH A;  4GDP A;  1OJT A;  2EQ9 A;  4B64 A;  1NEN A;  2V61 A;  1TDO A;  1DJQ A;  2XFP A;  3F8R A;  3FPZ A;  1TDN A;  3KD9 A;  4MJW A;  1BGN A;  2H89 A;  4YWO A;  3RHA A;  2R46 A;  1JNR A;  3UKQ A;  3DK9 A;  1OJA A;  4AP3 A;  1TDF A;  1JU2 A;  2X8G A;  1NG3 A;  1DJN A;  4IVO B;  4NEV A;  4U8O A;  1KFY A;  1GND A;  4NZH A;  1RP0 A;  5GRT A;  1Q9I A;  2Y6Q A;  3NHO X;  4I58 A;  1F6M A;  3ITJ A;  3NN6 X;  2VVL G;  4Z2T A;  2BS2 A;  4YSH A;  4REK A;  3V3O A;  1BKW A;  5KRQ A;  4X4J A;  3ICS A;  1EL7 A;  1PXB A;  3E1T A;  5IPY A;  5EB4 A;  3KLJ A;  1CJ2 A;  4TM3 A;  1BF3 A;  2BYB A;  1IUT A;  1ZY8 A;  2BK4 A;  1GXF A;  2C64 A;  4H4R A;  1XPQ A;  2J3N A;  4H4Z A;  2AAQ A;  2WOW A;  1ZMC A;  4GDE A;  2BXS A;  3NH3 X;  4C77 A;  3C4A A;  4TLX A;  5FS7 A;  2WEU A;  2WP5 A;  1D4D A;  1HYU A;  2WU5 A;  3ATQ A;  3BI5 A;  2YLZ A;  3NNE A;  3ICR A;  4H2R A;  3AYI A;  2C72 A;  4ADW A;  2V3B A;  2ACZ A;  1QLB A;  2C73 A;  3DJJ A;  2PYX A;  2XFU A;  4H50 A;  4B65 A;  2R4J A;  2Q7V A;  5ER0 A;  4KPR A;  2A87 A;  4H2Q A;  4DGK A;  5BUL A;  3UOX A;  3QVR A;  1P2H A;  4H4Y A;  4RG4 A;  2ARD A;  2GQW A;  3GDN A;  1B4V A;  2BAC A;  1FOH A;  2F5Z A;  4GR1 A;  2CUL A;  4NTC A;  3VQR A;  2WP9 A;  2WU2 A;  1F8S A;  1JRX A;  3HZL A;  3NYE A;  1GRB A;  3AE4 A;  3S5W A;  4A99 A;  1K0L A;  1O95 A;  2YWL A;  4CCR A;  2BXR A;  3CIR A;  1FL2 A;  1PBF A;  3B3R A;  3AE5 A;  1Y56 B;  4BV6 A;  4IA6 A;  2EQ8 A;  2B9W A;  4H4Q A;  1MO9 A;  3CTY A;  5IQ1 A;  4HB9 A;  2YG7 A;  3LAD A;  4XXG A;  2BC1 A;  3AEE A;  2BA9 A;  1Q1R A;  3KU9 A;  5HHF A;  4XWR A;  3UTH A;  5U25 A;  3BNU A;  2Y6R A;  3CPH G;  1Y56 A;  4JN9 A;  5CKU A;  3H8L A;  3Q6J A;  2V5Z A;  4DNA A;  2Z5Y A;  1VG0 A;  2YLS A;  3URH A;  3RP7 A;  3LB8 A;  2ZZC A;  2VRM A;  1NHS A;  1GES A;  4JNA A;  4TLZ A;  5KVI A;  2GV8 A;  1KF6 A;  2VVL A;  3EAN A;  1VG9 A;  1PHH A;  3AE3 A;  2RAB A;  3VRA A;  2OAM A;  2OLN A;  4K8D A;  1RYI A;  4NEW A;  4D03 A;  4GUV A;  3QSS A;  4UDR A;  2WQY A;  3UKF A;  4BK2 A;  2JAE A;  3AE8 A;  1YQZ A;  4EQX A;  3BNM A;  2EQ7 A;  1IUW A;  1ZOV A;  4BJY A;  1XAN A;  1DOC A;  2GMH A;  3AEA A;  3ALJ A;  4Y4L A;  4AOX A;  2CDU A;  2GEW A;  3P1W A;  4J2W A;  2BCG G;  5L46 A;  1D4E A;  4Z2R A;  3C96 A;  3V76 A;  3H8I A;  2C3D A;  2XVF A;  3CNJ A;  4AOS A;  2WS3 A;  4BJZ A;  3RP8 A;  2W0H A;  3UCL A;  3AXB A;  2XVH A;  2DKH A;  3VR8 A;  3M13 A;  3UKH A;  1CL0 A;  1PXA A;  5LV9 A;  2YQU A;  3CNS A;  1N4U A;  2A8X A;  2GMJ A;  3COX A; 
#chains in the Genus database with same CATH topology
 4WCT A;  5JCM A;  2YG3 A;  2YR6 A;  4U8L A;  3AED A;  1H82 A;  5KMQ A;  3PO7 A;  3LXD A;  3AE7 A;  1OJ9 A;  3DGH A;  2VVM A;  2ZZ0 A;  5BVA A;  3NKS A;  1H84 A;  1SEZ A;  3I6D A;  4Y4N A;  3NYF A;  3QFA A;  1LQT A;  1EL5 A;  3CPJ G;  4IV9 A;  4TM1 A;  1CJC A;  4APN A;  4H4S A;  2WDQ A;  2E4G A;  4OPI A;  3GWD A;  3ICT A;  1D7Y A;  1NHR A;  3ALM A;  4B66 A;  3CGB A;  3II4 A;  4OPU A;  2WPC A;  1LPF A;  2XFO A;  4A7A A;  2YG5 A;  3ZYX A;  1L9E A;  5HXI A;  1KNR A;  1RSG A;  3SZF A;  1PBB A;  2OAL A;  4H4T A;  2QA1 A;  3C4N A;  5KOW A;  2YM1 A;  4YTN A;  3IF9 A;  2XLR A;  2BAB A;  2AQJ A;  2VOU A;  2WBA A;  2O9Z A;  3AEB A;  2R4E A;  3UKK A;  4Z26 A;  1D5T A;  2C70 A;  3NGC X;  4II3 A;  4U8J A;  2WOV A;  3GSI A;  4II2 A;  2GR2 A;  1LJ1 A;  2GRT A;  3ADA B;  4EQR A;  3VRB A;  3DJD A;  3P4R A;  2C7G A;  4H4X A;  3F8P A;  5J60 A;  1CJ4 A;  3CND A;  3CN8 A;  4BUR A;  2YR4 A;  3FBS A;  4GCM A;  2C75 A;  1FEA A;  4FK1 A;  3ZDN A;  1COY A;  1ZP0 A;  1O5W A;  3Q9T A;  4BK3 A;  2XFQ A;  3FG2 P;  3DA1 A;  3BHK A;  2EQ6 A;  2XFN A;  1Y0P A;  4H7U A;  3RP6 A;  3P4Q A;  5KWF A;  1CBO A;  2XVE A;  1PBC A;  3NK1 X;  3T2K A;  2BCP A;  5DBJ A;  3ISH A;  1GV4 A;  1E1L A;  2WET A;  4ICY A;  4CNJ A;  2YVJ A;  5KOX A;  1ZMD A;  2IVD A;  2RGJ A;  2H88 A;  3NYC A;  4Y4M A;  3SZ0 A;  3UOY A;  1EL8 A;  1H83 A;  2OA1 A;  4C3Y A;  5EBK A;  3OZ2 A;  4U8N A;  1B5Q A;  4E0V A;  1PJ7 A;  5M0Z A;  4N9X A;  1GT8 A;  2X8C A;  4CNK A;  2BRY A;  3KA7 A;  4IA5 A;  4H4V A;  3ATR A;  3PS9 A;  4LII A;  1DOD A;  3VR9 A;  2RGO A;  3DH9 A;  1MOK A;  1JRZ A;  2XYO A;  2VRL A;  4NNJ A;  1VQW A;  2X3N A;  5BUK A;  2XLP A;  4X9M A;  2WDV A;  2R9Z A;  4DSH A;  1S2Q A;  2YR5 A;  1FEC A;  4LA1 A;  4A9W A;  5KXJ A;  2RGH A;  4U8I A;  1QO8 A;  5M10 A;  1VDC A;  2YAU A;  4YTM A;  1YKJ A;  4EMJ A;  4U2S A;  3AYJ A;  1GER A;  1DXL A;  3UKP A;  2BRA A;  4EQS A;  5HY5 A;  1CF3 A;  4JDR A;  1BWC A;  3UTE A;  2PHH A;  4Z43 A;  1QJD A;  4EM3 A;  3AE6 A;  1DOB A;  3UOV A;  1N1P A;  4U8K A;  3FMW A;  1JOA A;  1GRF A;  1LQU A;  3SGL A;  4B1B A;  2YM2 A;  4C3X A;  2IVE A;  3NTD A;  2QAE A;  4PAA A;  1H86 A;  3IC9 A;  2FBW A;  2GVC A;  4U2L A;  3GYX A;  4NWZ A;  3AE9 A;  4G6G A;  1GRH A;  4Z44 A;  3IHG A;  1TRB A;  3NK2 X;  3GYI A;  4H2N A;  4AP1 A;  1K0J A;  1F8W A;  4B69 A;  4PAB A;  3SFD A;  4GAV A;  4U8P A;  4IVM B;  1IUV A;  2QCU A;  3GD3 A;  4EIQ A;  5U63 A;  4A5L A;  2E5V A;  4YT0 A;  4I59 A;  4B63 A;  1E6E A;  2YG6 A;  1GRT A;  3QSM A;  3SXI A;  3UP5 A;  2GQF A;  3NTA A;  2NVK X;  3ALL A;  4RSL A;  4FDC B;  4GRT A;  4K7Z A;  3BHF A;  3CGD A;  4O5U A;  4C74 A;  3QVP A;  4KX6 A;  3SM8 A;  4NTD A;  4K2X A;  5BRT A;  2FJA A;  1GET A;  1ZOY A;  2YLR A;  3G5Q A;  2GF3 A;  3DJG X;  1PS9 A;  1DOE A;  4UP3 A;  2X50 A;  2X99 A;  1E39 A;  4A79 A;  1JEH A;  2YVG A;  4C5O A;  5J7X A;  3NK0 X;  2WOI A;  2B7R A;  3G5S A;  1LVL A;  2GR0 A;  3EAO A;  4FX9 A;  4UDQ A;  1TYP A;  3T2Z A;  2GH5 A;  1LTX R;  1PXC A;  1YQ4 A;  3WE0 A;  2WP6 A;  1GRE A;  4NTE A;  3NN0 X;  2XLT A;  4M52 A;  3NIX A;  2Z5X A;  2GAG B;  1GPE A;  3K7Q X;  2B76 A;  1E1N A;  2X8H A;  5EOW A;  4Z2U A;  2APG A;  1H81 A;  3CMM A;  3P4P A;  1D7L A;  1F8R A;  2JB3 A;  3L1R A;  3T37 A;  3D1C A;  4Z24 A;  2CVJ A;  2WES A;  3CNP A;  2E1M A;  2JKC A;  3EPT A;  1L0V A;  3KPK A;  1Q1W A;  1CC2 A;  2R45 A;  1H7W A;  3LZW A;  1TDK A;  3M0O A;  3GMC A;  2R0C A;  4G73 A;  3UP4 A;  3HYW A;  1N4V A;  4WX1 A;  5EB5 A;  2TMD A;  1P2E A;  3K30 A;  2C66 A;  1OJC A;  5FMH A;  5JCK A;  2VQ7 A;  2JBV A;  4YSX A;  5IQ4 A;  5FS8 A;  3K7T A;  5KVH A;  1NHP A;  4O5Q A;  2FJB A;  2XVI A;  4JNQ A;  1IJH A;  3H4K A;  1F3P A;  4YKG A;  4CY6 A;  2WPE A;  3AE2 A;  3NRN A;  3UTG A;  1S3B A;  3DK8 A;  1W4X A;  2BS4 A;  2CFY A;  1EBD A;  2YLX A;  3O0H A;  4G74 A;  1PBE A;  4YTP A;  4FK1 C;  5KNL A;  2R0P A;  4OVI A;  2I0Z A;  3OC4 A;  1NG4 A;  3BI2 A;  3D8X A;  2JB2 A;  2XCG A;  2B9X A;  3HYV A;  4H4W A;  1V59 A;  2HQM A;  4K22 A;  3I3L A;  1IUU A;  3DME A;  2YLW A;  3GRS A;  4ZN0 A;  1CC6 A;  5JCI A;  3T31 A;  1DNC A;  1S2Y A;  4CY8 A;  1GRA A;  1L9D A;  3LZX A;  3PVC A;  1NAA A;  3K7M X;  2YLT A;  4J31 A;  1EL9 A;  1JNZ A;  1X31 B;  1ZX9 A;  3IHM A;  3UKA A;  1GRG A;  2WDR A;  1TYT A;  1XHC A;  4JQ9 A;  1M64 A;  4TM4 A;  4AT0 A;  5JCL A;  4ECH A;  3SFE A;  4Z25 A;  2C65 A;  3AD8 B;  3EF6 A;  4K5R A;  3AEC A;  4H4U A;  3DK4 A;  4J33 A;  4OPL A;  4USQ A;  1CC4 A;  1PJ5 A;  3LOV A;  3JSK A;  3R9U A;  4K5S A;  4USR A;  3GDP A;  4B68 A;  2YG4 A;  4LU6 A;  1GTE A;  4OPT A;  4XWZ A;  3T2Y A;  1AOG A;  4JY2 A;  1TDE A;  2BK3 A;  4AT2 A;  2BK5 A;  2JB1 A;  5C2T A;  3P9U A;  2XVJ A;  4UDP A;  2R0G A;  4J36 A;  1LV0 A;  3SYI A;  3F8D A;  1NPX A;  4TM0 A;  3AD9 B;  3B6D A;  1XDI A;  1OJD A;  1ELI A;  2BS3 A;  3CPI G;  1H6V A;  3AEF A;  2YVF A;  1UKV G;  5HYM A;  1D4C A;  3IWA A;  3T0K A;  1GSN A;  1NHQ A;  4BK1 A;  3NLC A;  2C3C A;  1KSS A;  4DSG A;  1REO A;  1N4W A;  1ONF A;  1KNP A;  1GAL A;  2AR8 A;  2QA2 A;  4ZCD A;  2VQB A;  1S3E A;  3RNM A;  4H4P A;  3GYJ A;  4OPD A;  2Q0K A;  4U8M A;  5U1O A;  2GAH B;  3M12 A;  4EM4 A;  3GD4 A;  4J34 A;  2GR3 A;  1IUS A;  3QFB A;  4J57 A;  2XDO A;  2TPR A;  1FCD A;  3L8K A;  3CGC A;  1GEU A;  4ZCC A;  3LJP A;  4EQW A;  2C67 A;  1GTH A;  3QJ4 A;  1BGJ A;  4OPC A;  1YQ3 A;  1KSU A;  3NG7 X;  4YSY A;  2Q0L A;  1M6I A;  1K0I A;  2DKI A;  5TR3 A;  3P4S A;  1ZK7 A;  1K4Q A;  2V60 A;  4JY3 A;  2WHD A;  5JCN A;  1GOS A;  5C3J A;  2FJD A;  3UTF A;  2VZ2 A;  2V3A A;  5KMS A;  2ZBW A;  2GB0 A;  3AE1 A;  3S61 A;  4GF7 A;  2C76 A;  2BC0 A;  2FJE A;  1ZDL A;  1PBD A;  3CNT A;  3KVE A;  4A6N B;  1FEB A;  4H2P A;  4A65 A;  4EMI A;  1VRQ B;  4X9N A;  3NT6 A;  4HA6 A;  3T14 A;  3HYX A;  1CJ3 A;  2WPF A;  4YXD A;  4YKF A;  3AYL A;  1L9C A;  3G5R A;  1KDG A;  2V6O A;  2ZZB A;  4OPG A;  4CBQ A;  3CGE A;  3GWF A;  3AEG A;  3UOZ A;  1Z6L A;  2B9Y A;  2B7S A;  5FS9 A;  2GR1 A;  2OLO A;  3AB1 A;  1B8S A;  1MXT A;  4A6N A;  1JRY A;  5GSN A;  3VRD B;  2XLU A;  3DGZ A;  3DJE A;  4G9K A;  2XLS A;  3BI4 A;  3KPF A;  1ZKQ A;  4U2T A;  3KKJ A;  4EIP A;  1PJ6 A;  4P9S A;  4RG3 A;  1E1K A;  3UKL A;  1PN0 A;  3AWI A;  1CHU A;  3V3N A;  2JK6 A;  1YY5 A;  3FIM B;  3GMB A;  3AD7 B;  3QSE A;  1NEK A;  1BZL A;  3SQP A;  4YSZ A;  4GAP A;  4J56 A;  5FS6 A;  1IUX A;  3GRT A;  4D04 A;  4OCG A;  5CQF A;  2A89 A;  1H7X A;  4CCQ A;  1E7P A;  4EMW A;  3RED A;  2Q6U A;  2NPX A;  2IID A;  4CRT A;  1B37 A;  4B67 A;  1E1M A;  1NDA A;  1O94 A;  2UZZ A;  3ABV A;  1PDH A;  4GDP A;  1OJT A;  2EQ9 A;  4B64 A;  1NEN A;  2V61 A;  1TDO A;  1DJQ A;  2XFP A;  3F8R A;  3FPZ A;  1TDN A;  3KD9 A;  4MJW A;  1BGN A;  2H89 A;  4YWO A;  3RHA A;  2R46 A;  5KMR A;  2C4C A;  1JNR A;  3UKQ A;  3DK9 A;  1OJA A;  4AP3 A;  1TDF A;  1JU2 A;  2X8G A;  1NG3 A;  3SY4 A;  1DJN A;  4IVO B;  4NEV A;  4U8O A;  3SX6 A;  1KFY A;  1GND A;  4NZH A;  1RP0 A;  5GRT A;  1Q9I A;  2Y6Q A;  3NHO X;  4I58 A;  1F6M A;  3ITJ A;  3NN6 X;  2VVL G;  4Z2T A;  2BS2 A;  4YSH A;  4REK A;  3V3O A;  1BKW A;  5KRQ A;  4X4J A;  3ICS A;  1EL7 A;  1PXB A;  3E1T A;  5IPY A;  5EB4 A;  3KLJ A;  1CJ2 A;  3SZC A;  4TM3 A;  1BF3 A;  2BYB A;  1IUT A;  1ZY8 A;  2BK4 A;  1GXF A;  2C64 A;  4H4R A;  1XPQ A;  2J3N A;  4H4Z A;  2AAQ A;  2WOW A;  1ZMC A;  4GDE A;  2BXS A;  3NH3 X;  4C77 A;  3C4A A;  4TLX A;  5FS7 A;  2WEU A;  2WP5 A;  1D4D A;  1HYU A;  2WU5 A;  3ATQ A;  3BI5 A;  2YLZ A;  3NNE A;  3ICR A;  4H2R A;  3AYI A;  2C72 A;  4ADW A;  2V3B A;  2ACZ A;  1QLB A;  2C73 A;  3DJJ A;  2PYX A;  2XFU A;  4H50 A;  4B65 A;  2R4J A;  2Q7V A;  5ER0 A;  4KPR A;  2A87 A;  4H2Q A;  4DGK A;  5BUL A;  3UOX A;  3QVR A;  1P2H A;  4H4Y A;  4RG4 A;  2ARD A;  2GQW A;  3GDN A;  5KMP A;  1B4V A;  2BAC A;  1FOH A;  2F5Z A;  4GR1 A;  2CUL A;  4NTC A;  3VQR A;  2WP9 A;  2WU2 A;  1F8S A;  1JRX A;  3HZL A;  3NYE A;  1GRB A;  3AE4 A;  3S5W A;  4G6H A;  4A99 A;  1K0L A;  1O95 A;  2YWL A;  4CCR A;  2BXR A;  3CIR A;  1FL2 A;  1PBF A;  3B3R A;  3AE5 A;  1Y56 B;  4BV6 A;  4IA6 A;  2EQ8 A;  2B9W A;  4H4Q A;  1MO9 A;  3CTY A;  5IQ1 A;  4HB9 A;  2YG7 A;  3LAD A;  4XXG A;  2BC1 A;  3AEE A;  2BA9 A;  1Q1R A;  3KU9 A;  5HHF A;  4XWR A;  3UTH A;  5U25 A;  3BNU A;  2Y6R A;  3CPH G;  1Y56 A;  4JN9 A;  5CKU A;  3H8L A;  3Q6J A;  2V5Z A;  4DNA A;  2Z5Y A;  1VG0 A;  2YLS A;  3URH A;  3RP7 A;  3LB8 A;  2ZZC A;  2VRM A;  1NHS A;  1GES A;  4JNA A;  4TLZ A;  5KVI A;  2GV8 A;  1KF6 A;  2VVL A;  3EAN A;  1VG9 A;  1PHH A;  3AE3 A;  2RAB A;  3VRA A;  2OAM A;  2OLN A;  4K8D A;  1RYI A;  4NEW A;  4D03 A;  4GUV A;  3QSS A;  4UDR A;  3SZW A;  2WQY A;  3UKF A;  4BK2 A;  2JAE A;  3AE8 A;  1YQZ A;  4EQX A;  3BNM A;  2EQ7 A;  1IUW A;  1ZOV A;  4BJY A;  1XAN A;  1DOC A;  2GMH A;  3AEA A;  3ALJ A;  4Y4L A;  4AOX A;  2CDU A;  2GEW A;  3P1W A;  4J2W A;  2BCG G;  5L46 A;  1D4E A;  4Z2R A;  3C96 A;  3V76 A;  3H8I A;  2C3D A;  2XVF A;  3CNJ A;  4AOS A;  2WS3 A;  4BJZ A;  3RP8 A;  2W0H A;  3UCL A;  3AXB A;  2XVH A;  2DKH A;  3VR8 A;  3M13 A;  3UKH A;  1CL0 A;  1PXA A;  5LV9 A;  2YQU A;  3CNS A;  1N4U A;  2A8X A;  2GMJ A;  3COX A; 
#chains in the Genus database with same CATH homology
 4WCT A;  5JCM A;  2YG3 A;  2YR6 A;  4U8L A;  3AED A;  1H82 A;  5KMQ A;  3PO7 A;  3LXD A;  3AE7 A;  1OJ9 A;  3DGH A;  2VVM A;  2ZZ0 A;  5BVA A;  3NKS A;  1H84 A;  1SEZ A;  3I6D A;  4Y4N A;  3NYF A;  3QFA A;  1LQT A;  1EL5 A;  3CPJ G;  4IV9 A;  4TM1 A;  1CJC A;  4APN A;  4H4S A;  2WDQ A;  2E4G A;  4OPI A;  3GWD A;  3ICT A;  1D7Y A;  1NHR A;  3ALM A;  4B66 A;  3CGB A;  3II4 A;  4OPU A;  2WPC A;  1LPF A;  2XFO A;  4A7A A;  2YG5 A;  3ZYX A;  1L9E A;  5HXI A;  1KNR A;  1RSG A;  3SZF A;  1PBB A;  2OAL A;  4H4T A;  2QA1 A;  3C4N A;  5KOW A;  2YM1 A;  4YTN A;  3IF9 A;  2XLR A;  2BAB A;  2AQJ A;  2VOU A;  2WBA A;  2O9Z A;  3AEB A;  2R4E A;  3UKK A;  4Z26 A;  1D5T A;  2C70 A;  3NGC X;  4II3 A;  4U8J A;  2WOV A;  3GSI A;  4II2 A;  2GR2 A;  1LJ1 A;  2GRT A;  3ADA B;  4EQR A;  3VRB A;  3DJD A;  3P4R A;  2C7G A;  4H4X A;  3F8P A;  5J60 A;  1CJ4 A;  3CND A;  3CN8 A;  4BUR A;  2YR4 A;  3FBS A;  4GCM A;  2C75 A;  1FEA A;  4FK1 A;  3ZDN A;  1COY A;  1ZP0 A;  1O5W A;  3Q9T A;  4BK3 A;  2XFQ A;  3FG2 P;  3DA1 A;  3BHK A;  2EQ6 A;  2XFN A;  1Y0P A;  4H7U A;  3RP6 A;  3P4Q A;  5KWF A;  1CBO A;  2XVE A;  1PBC A;  3NK1 X;  3T2K A;  2BCP A;  5DBJ A;  3ISH A;  1GV4 A;  1E1L A;  2WET A;  4ICY A;  4CNJ A;  2YVJ A;  5KOX A;  1ZMD A;  2IVD A;  2RGJ A;  2H88 A;  3NYC A;  4Y4M A;  3SZ0 A;  3UOY A;  1EL8 A;  1H83 A;  2OA1 A;  4C3Y A;  5EBK A;  3OZ2 A;  4U8N A;  1B5Q A;  4E0V A;  1PJ7 A;  5M0Z A;  4N9X A;  1GT8 A;  2X8C A;  4CNK A;  2BRY A;  3KA7 A;  4IA5 A;  4H4V A;  3ATR A;  3PS9 A;  4LII A;  1DOD A;  3VR9 A;  2RGO A;  3DH9 A;  1MOK A;  1JRZ A;  2XYO A;  2VRL A;  4NNJ A;  1VQW A;  2X3N A;  5BUK A;  2XLP A;  4X9M A;  2WDV A;  2R9Z A;  4DSH A;  1S2Q A;  2YR5 A;  1FEC A;  4LA1 A;  4A9W A;  5KXJ A;  2RGH A;  4U8I A;  1QO8 A;  5M10 A;  1VDC A;  2YAU A;  4YTM A;  1YKJ A;  4EMJ A;  4U2S A;  3AYJ A;  1GER A;  1DXL A;  3UKP A;  2BRA A;  4EQS A;  5HY5 A;  1CF3 A;  4JDR A;  1BWC A;  3UTE A;  2PHH A;  4Z43 A;  1QJD A;  4EM3 A;  3AE6 A;  1DOB A;  3UOV A;  1N1P A;  4U8K A;  3FMW A;  1JOA A;  1GRF A;  1LQU A;  3SGL A;  4B1B A;  2YM2 A;  4C3X A;  2IVE A;  3NTD A;  2QAE A;  4PAA A;  1H86 A;  3IC9 A;  2FBW A;  2GVC A;  4U2L A;  3GYX A;  4NWZ A;  3AE9 A;  4G6G A;  1GRH A;  4Z44 A;  3IHG A;  1TRB A;  3NK2 X;  3GYI A;  4H2N A;  4AP1 A;  1K0J A;  1F8W A;  4B69 A;  4PAB A;  3SFD A;  4GAV A;  4U8P A;  4IVM B;  1IUV A;  2QCU A;  3GD3 A;  4EIQ A;  5U63 A;  4A5L A;  2E5V A;  4YT0 A;  4I59 A;  4B63 A;  1E6E A;  2YG6 A;  1GRT A;  3QSM A;  3SXI A;  3UP5 A;  2GQF A;  3NTA A;  2NVK X;  3ALL A;  4RSL A;  4FDC B;  4GRT A;  4K7Z A;  3BHF A;  3CGD A;  4O5U A;  4C74 A;  3QVP A;  4KX6 A;  3SM8 A;  4NTD A;  4K2X A;  5BRT A;  2FJA A;  1GET A;  1ZOY A;  2YLR A;  3G5Q A;  2GF3 A;  3DJG X;  1PS9 A;  1DOE A;  4UP3 A;  2X50 A;  2X99 A;  1E39 A;  4A79 A;  1JEH A;  2YVG A;  4C5O A;  5J7X A;  3NK0 X;  2WOI A;  2B7R A;  3G5S A;  1LVL A;  2GR0 A;  3EAO A;  4FX9 A;  4UDQ A;  1TYP A;  3T2Z A;  2GH5 A;  1LTX R;  1PXC A;  1YQ4 A;  3WE0 A;  2WP6 A;  1GRE A;  4NTE A;  3NN0 X;  2XLT A;  4M52 A;  3NIX A;  2Z5X A;  2GAG B;  1GPE A;  3K7Q X;  2B76 A;  1E1N A;  2X8H A;  5EOW A;  4Z2U A;  2APG A;  1H81 A;  3CMM A;  3P4P A;  1D7L A;  1F8R A;  2JB3 A;  3L1R A;  3T37 A;  3D1C A;  4Z24 A;  2CVJ A;  2WES A;  3CNP A;  2E1M A;  2JKC A;  3EPT A;  1L0V A;  3KPK A;  1Q1W A;  1CC2 A;  2R45 A;  1H7W A;  3LZW A;  1TDK A;  3M0O A;  3GMC A;  2R0C A;  4G73 A;  3UP4 A;  3HYW A;  1N4V A;  4WX1 A;  5EB5 A;  2TMD A;  1P2E A;  3K30 A;  2C66 A;  1OJC A;  5FMH A;  5JCK A;  2VQ7 A;  2JBV A;  4YSX A;  5IQ4 A;  5FS8 A;  3K7T A;  5KVH A;  1NHP A;  4O5Q A;  2FJB A;  2XVI A;  4JNQ A;  1IJH A;  3H4K A;  1F3P A;  4YKG A;  4CY6 A;  2WPE A;  3AE2 A;  3NRN A;  3UTG A;  1S3B A;  3DK8 A;  1W4X A;  2BS4 A;  2CFY A;  1EBD A;  2YLX A;  3O0H A;  4G74 A;  1PBE A;  4YTP A;  4FK1 C;  5KNL A;  2R0P A;  4OVI A;  2I0Z A;  3OC4 A;  1NG4 A;  3BI2 A;  3D8X A;  2JB2 A;  2XCG A;  2B9X A;  3HYV A;  4H4W A;  1V59 A;  2HQM A;  4K22 A;  3I3L A;  1IUU A;  3DME A;  2YLW A;  3GRS A;  4ZN0 A;  1CC6 A;  5JCI A;  3T31 A;  1DNC A;  1S2Y A;  4CY8 A;  1GRA A;  1L9D A;  3LZX A;  3PVC A;  1NAA A;  3K7M X;  2YLT A;  4J31 A;  1EL9 A;  1JNZ A;  1X31 B;  1ZX9 A;  3IHM A;  3UKA A;  1GRG A;  2WDR A;  1TYT A;  1XHC A;  4JQ9 A;  1M64 A;  4TM4 A;  4AT0 A;  5JCL A;  4ECH A;  3SFE A;  4Z25 A;  2C65 A;  3AD8 B;  3EF6 A;  4K5R A;  3AEC A;  4H4U A;  3DK4 A;  4J33 A;  4OPL A;  4USQ A;  1CC4 A;  1PJ5 A;  3LOV A;  3JSK A;  3R9U A;  4K5S A;  4USR A;  3GDP A;  4B68 A;  2YG4 A;  4LU6 A;  1GTE A;  4OPT A;  4XWZ A;  3T2Y A;  1AOG A;  4JY2 A;  1TDE A;  2BK3 A;  4AT2 A;  2BK5 A;  2JB1 A;  5C2T A;  3P9U A;  2XVJ A;  4UDP A;  2R0G A;  4J36 A;  1LV0 A;  3SYI A;  3F8D A;  1NPX A;  4TM0 A;  3AD9 B;  3B6D A;  1XDI A;  1OJD A;  1ELI A;  2BS3 A;  3CPI G;  1H6V A;  3AEF A;  2YVF A;  1UKV G;  5HYM A;  1D4C A;  3IWA A;  3T0K A;  1GSN A;  1NHQ A;  4BK1 A;  3NLC A;  2C3C A;  1KSS A;  4DSG A;  1REO A;  1N4W A;  1ONF A;  1KNP A;  1GAL A;  2AR8 A;  2QA2 A;  4ZCD A;  2VQB A;  1S3E A;  3RNM A;  4H4P A;  3GYJ A;  4OPD A;  2Q0K A;  4U8M A;  5U1O A;  2GAH B;  3M12 A;  4EM4 A;  3GD4 A;  4J34 A;  2GR3 A;  1IUS A;  3QFB A;  4J57 A;  2XDO A;  2TPR A;  1FCD A;  3L8K A;  3CGC A;  1GEU A;  4ZCC A;  3LJP A;  4EQW A;  2C67 A;  1GTH A;  3QJ4 A;  1BGJ A;  4OPC A;  1YQ3 A;  1KSU A;  3NG7 X;  4YSY A;  2Q0L A;  1M6I A;  1K0I A;  2DKI A;  5TR3 A;  3P4S A;  1ZK7 A;  1K4Q A;  2V60 A;  4JY3 A;  2WHD A;  5JCN A;  1GOS A;  5C3J A;  2FJD A;  3UTF A;  2VZ2 A;  2V3A A;  5KMS A;  2ZBW A;  2GB0 A;  3AE1 A;  3S61 A;  4GF7 A;  2C76 A;  2BC0 A;  2FJE A;  1ZDL A;  1PBD A;  3CNT A;  3KVE A;  4A6N B;  1FEB A;  4H2P A;  4A65 A;  4EMI A;  1VRQ B;  4X9N A;  3NT6 A;  4HA6 A;  3T14 A;  3HYX A;  1CJ3 A;  2WPF A;  4YXD A;  4YKF A;  3AYL A;  1L9C A;  3G5R A;  1KDG A;  2V6O A;  2ZZB A;  4OPG A;  4CBQ A;  3CGE A;  3GWF A;  3AEG A;  3UOZ A;  1Z6L A;  2B9Y A;  2B7S A;  5FS9 A;  2GR1 A;  2OLO A;  3AB1 A;  1B8S A;  1MXT A;  4A6N A;  1JRY A;  5GSN A;  3VRD B;  2XLU A;  3DGZ A;  3DJE A;  4G9K A;  2XLS A;  3BI4 A;  3KPF A;  1ZKQ A;  4U2T A;  3KKJ A;  4EIP A;  1PJ6 A;  4P9S A;  4RG3 A;  1E1K A;  3UKL A;  1PN0 A;  3AWI A;  1CHU A;  3V3N A;  2JK6 A;  1YY5 A;  3FIM B;  3GMB A;  3AD7 B;  3QSE A;  1NEK A;  1BZL A;  3SQP A;  4YSZ A;  4GAP A;  4J56 A;  5FS6 A;  1IUX A;  3GRT A;  4D04 A;  4OCG A;  5CQF A;  2A89 A;  1H7X A;  4CCQ A;  1E7P A;  4EMW A;  3RED A;  2Q6U A;  2NPX A;  2IID A;  4CRT A;  1B37 A;  4B67 A;  1E1M A;  1NDA A;  1O94 A;  2UZZ A;  3ABV A;  1PDH A;  4GDP A;  1OJT A;  2EQ9 A;  4B64 A;  1NEN A;  2V61 A;  1TDO A;  1DJQ A;  2XFP A;  3F8R A;  3FPZ A;  1TDN A;  3KD9 A;  4MJW A;  1BGN A;  2H89 A;  4YWO A;  3RHA A;  2R46 A;  5KMR A;  2C4C A;  1JNR A;  3UKQ A;  3DK9 A;  1OJA A;  4AP3 A;  1TDF A;  1JU2 A;  2X8G A;  1NG3 A;  3SY4 A;  1DJN A;  4IVO B;  4NEV A;  4U8O A;  3SX6 A;  1KFY A;  1GND A;  4NZH A;  1RP0 A;  5GRT A;  1Q9I A;  2Y6Q A;  3NHO X;  4I58 A;  1F6M A;  3ITJ A;  3NN6 X;  2VVL G;  4Z2T A;  2BS2 A;  4YSH A;  4REK A;  3V3O A;  1BKW A;  5KRQ A;  4X4J A;  3ICS A;  1EL7 A;  1PXB A;  3E1T A;  5IPY A;  5EB4 A;  3KLJ A;  1CJ2 A;  3SZC A;  4TM3 A;  1BF3 A;  2BYB A;  1IUT A;  1ZY8 A;  2BK4 A;  1GXF A;  2C64 A;  4H4R A;  1XPQ A;  2J3N A;  4H4Z A;  2AAQ A;  2WOW A;  1ZMC A;  4GDE A;  2BXS A;  3NH3 X;  4C77 A;  3C4A A;  4TLX A;  5FS7 A;  2WEU A;  2WP5 A;  1D4D A;  1HYU A;  2WU5 A;  3ATQ A;  3BI5 A;  2YLZ A;  3NNE A;  3ICR A;  4H2R A;  3AYI A;  2C72 A;  4ADW A;  2V3B A;  2ACZ A;  1QLB A;  2C73 A;  3DJJ A;  2PYX A;  2XFU A;  4H50 A;  4B65 A;  2R4J A;  2Q7V A;  5ER0 A;  4KPR A;  2A87 A;  4H2Q A;  4DGK A;  5BUL A;  3UOX A;  3QVR A;  1P2H A;  4H4Y A;  4RG4 A;  2ARD A;  2GQW A;  3GDN A;  5KMP A;  1B4V A;  2BAC A;  1FOH A;  2F5Z A;  4GR1 A;  2CUL A;  4NTC A;  3VQR A;  2WP9 A;  2WU2 A;  1F8S A;  1JRX A;  3HZL A;  3NYE A;  1GRB A;  3AE4 A;  3S5W A;  4G6H A;  4A99 A;  1K0L A;  1O95 A;  2YWL A;  4CCR A;  2BXR A;  3CIR A;  1FL2 A;  1PBF A;  3B3R A;  3AE5 A;  1Y56 B;  4BV6 A;  4IA6 A;  2EQ8 A;  2B9W A;  4H4Q A;  1MO9 A;  3CTY A;  5IQ1 A;  4HB9 A;  2YG7 A;  3LAD A;  4XXG A;  2BC1 A;  3AEE A;  2BA9 A;  1Q1R A;  3KU9 A;  5HHF A;  4XWR A;  3UTH A;  5U25 A;  3BNU A;  2Y6R A;  3CPH G;  1Y56 A;  4JN9 A;  5CKU A;  3H8L A;  3Q6J A;  2V5Z A;  4DNA A;  2Z5Y A;  1VG0 A;  2YLS A;  3URH A;  3RP7 A;  3LB8 A;  2ZZC A;  2VRM A;  1NHS A;  1GES A;  4JNA A;  4TLZ A;  5KVI A;  2GV8 A;  1KF6 A;  2VVL A;  3EAN A;  1VG9 A;  1PHH A;  3AE3 A;  2RAB A;  3VRA A;  2OAM A;  2OLN A;  4K8D A;  1RYI A;  4NEW A;  4D03 A;  4GUV A;  3QSS A;  4UDR A;  3SZW A;  2WQY A;  3UKF A;  4BK2 A;  2JAE A;  3AE8 A;  1YQZ A;  4EQX A;  3BNM A;  2EQ7 A;  1IUW A;  1ZOV A;  4BJY A;  1XAN A;  1DOC A;  2GMH A;  3AEA A;  3ALJ A;  4Y4L A;  4AOX A;  2CDU A;  2GEW A;  3P1W A;  4J2W A;  2BCG G;  5L46 A;  1D4E A;  4Z2R A;  3C96 A;  3V76 A;  3H8I A;  2C3D A;  2XVF A;  3CNJ A;  4AOS A;  2WS3 A;  4BJZ A;  3RP8 A;  2W0H A;  3UCL A;  3AXB A;  2XVH A;  2DKH A;  3VR8 A;  3M13 A;  3UKH A;  1CL0 A;  1PXA A;  5LV9 A;  2YQU A;  3CNS A;  1N4U A;  2A8X A;  2GMJ A;  3COX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...