2BXRA

Human monoamine oxidase a in complex with clorgyline, crystal form a
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
453
structure length
445
Chain Sequence
b'HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AMINE OXIDASE [FLAVIN-CONTAINING] A
publication title Three-Dimensional Structure of Human Monoamine Oxidase a (Mao A): Relation to the Structures of Rat Mao a and Human Mao B
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 155
structure length 445
sequence length 453
chains with identical sequence B
ec nomenclature ec 1.4.3.4: Monoamine oxidase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2bxrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2bxrA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 2bxrA02
3NK0X 4H2QA 5HHFA 5KXJA 1IUSA 3CPJG 4LU6A 3DH9A 2XVEA 5M0ZA 4TLXA 4Y4NA 1GRAA 1L9EA 2JAEA 5EOWA 2R9ZA 3M12A 4IA5A 3LZXA 3H8LA 1OJDA 1XANA 2Q0KA 2WU5A 2ZZCA 4CY8A 3IF9A 3ADAB 1PDHA 3P9UA 3NNEA 3UTHA 1LJ1A 4HA6A 3GRSA 2PHHA 3M13A 3UTFA 4OPCA 2WHDA 1O95A 2VVLA 4H4QA 2E4GA 3VR8A 1TDEA 1PJ7A 2WDRA 2B9YA 3DMEA 3UKPA 4FK1A 1KSUA 2WBAA 3LJPA 5U1OA 4FX9A 2XFQA 3GD4A 3UP4A 1Q9IA 3ATQA 5CKUA 4ADWA 2Z5YA 2BS4A 2W0HA 3CGDA 1OJTA 3NTDA 4H4UA 1F3PA 1PBEA 3UP5A 5TR3A 1BGJA 2XFPA 2FJBA 5EB5A 3UKLA 2WDVA 3ABVA 3GYJA 1E1NA 2NPXA 4EQXA 1GRGA 4YKGA 2GMHA 4A65A 2YVFA 2XDOA 3S5WA 4M52A 4EQWA 2Y6QA 2JK6A 1COYA 4JY3A 5IQ1A 4EM4A 4OPDA 2XYOA 2TMDA 2X8CA 4U8MA 2WEUA 1GTHA 2QCUA 3UKQA 2BS3A 5KVHA 1IUWA 2V60A 2E5VA 1GETA 3NYEA 3ZDNA 3I3LA 1GOSA 1EL7A 2J3NA 4DSGA 2QAEA 4Z24A 1JRXA 4BJYA 3QVRA 2BC0A 1SEZA 1VRQB 2JB2A 2R0CA 3IC9A 1M64A 4CRTA 4OVIA 3NIXA 3VRAA 2WQYA 5U25A 3GMBA 1Q1RA 1TDFA 3ALLA 3QSEA 4PABA 4YSZA 4ZN0A 3KKJA 3ZYXA 4O5QA 2GR0A 2VQ7A 3ALJA 2C76A 1E1LA 1EL8A 4RG3A 1GSNA 1X31B 3I6DA 5KOXA 4H4TA 4JNAA 4JNQA 1LQTA 3LOVA 2WS3A 2AQJA 2XFUA 1ZOYA 2BS2A 1GRBA 4ECHA 2E1MA 3P4RA 1CJ3A 2WETA 4YXDA 4J33A 2C3CA 1S3BA 4JY2A 4A6NB 1HYUA 1V59A 2XFOA 1L9DA 5U63A 3FMWA 2GR3A 4JDRA 3EANA 1Z6LA 1CJ2A 2DKIA 3BI5A 5KRQA 4RSLA 4A6NA 1E1MA 4H4RA 2Z5XA 3RNMA 3NRNA 2YLWA 1LPFA 1ONFA 3II4A 1BWCA 1XHCA 2RGOA 1CF3A 1F8WA 3ISHA 1NHPA 4OPIA 3AYJA 3B6DA 5ER0A 4UP3A 1VDCA 2C65A 4ZCDA 4YSHA 3C4AA 1TRBA 1BKWA 1JU2A 3ALMA 4WCTA 4YTMA 1YQZA 3VR9A 4EMIA 4C74A 2X50A 1F8RA 5LV9A 1FEBA 2GAGB 1ELIA 2BC1A 3DJJA 1F8SA 1Y56B 1ZDLA 4H50A 4U2TA 2YWLA 1BGNA 3QVPA 4IVMB 4USQA 5EB4A 1N4WA 3RP7A 2YVGA 3UOZA 3H8IA 4Y4MA 4GR1A 1KFYA 1D4DA 1PHHA 1CBOA 2APGA 5BUKA 1RSGA 4OPUA 3AB1A 3GD3A 4O5UA 3SQPA 2C64A 1Y56A 4AOSA 4GCMA 4OPTA 1GREA 4YTNA 1GV4A 2YG7A 1IUXA 2X3NA 2YQUA 1NENA 2C3DA 3BI2A 2XLSA 3KU9A 2R46A 4Z44A 1FECA 3NTAA 4GDEA 2WPEA 3DJDA 1PJ6A 4B63A 5J60A 4EQRA 1VG9A 2WESA 4XWZA 3AE2A 2YG5A 3KLJA 1JOAA 3FIMB 4FK1C 2GH5A 3DK4A 1KNPA 4NTDA 2YR4A 2JBVA 2XLPA 3ATRA 3GWDA 3L1RA 4YKFA 3SM8A 1D7LA 4CBQA 4GUVA 2B9WA 3BNUA 3E1TA 3GDNA 5KWFA 2YLZA 3UTEA 4BK2A 4BV6A 3URHA 1Q1WA 1H7WA 1RYIA 2CDUA 5JCNA 1H7XA 1H82A 4TM1A 2VQBA 3CNSA 2AAQA 4K2XA 2VRMA 1LV0A 2B7SA 3LXDA 1BF3A 3P1WA 2YR5A 4BURA 3BHFA 1K0JA 2X8HA 3FG2P 3NN0X 2PYXA 5KVIA 1GESA 1N1PA 4U2LA 1XPQA 3CNDA 3PO7A 2ZBWA 4U8IA 4CCRA 2C75A 1GRHA 3NKSA 5FS9A 1K4QA 4AP3A 2YLTA 5BULA 3DGZA 5C2TA 1DJQA 3NG7X 2Q6UA 2X99A 1Y0PA 1N4VA 1ZMDA 4NEWA 2R45A 3NGCX 1GRFA 1ZKQA 2ZZBA 2QA1A 3CGCA 3F8RA 4CNKA 1NG4A 4J57A 5EBKA 5HXIA 2H88A 3AYIA 2BA9A 1E39A 1CC4A 2WPCA 4CNJA 2TPRA 1DOEA 2YVJA 2B7RA 1GALA 1KF6A 2EQ9A 3AE5A 3AWIA 4H4WA 3RP6A 3DA1A 2C73A 1ZMCA 3GDPA 3KPFA 3ITJA 3NK1X 5DBJA 3VRBA 1GTEA 2OLNA 4B67A 4C77A 1PBBA 4EMWA 1N4UA 3NK2X 1S2YA 5FS6A 4A99A 1KSSA 1B4VA 2XLRA 4J34A 2JB1A 4NTEA 5C3JA 4P9SA 3UKAA 4H2NA 5KOWA 1FCDA 1ZX9A 3AE8A 3AEFA 4J56A 3LB8A 1B8SA 4UDQA 2WP6A 2BXRA 3L8KA 2XVIA 5FS8A 5HY5A 3UTGA 3IHMA 2YM1A 3JSKA 2NVKX 3F8DA 4A9WA 4NEVA 3DGHA 1PXBA 4A5LA 4Z2UA 1CC6A 1KNRA 2YG4A 2ARDA 2YG6A 1CJ4A 2YLRA 4Y4LA 4YSXA 1PJ5A 4K22A 1E6EA 2IIDA 4K7ZA 4EIPA 1D4EA 3CN8A 1L0VA 3T37A 4EMJA 3S61A 4U8KA 3P4PA 4H4YA 3VQRA 1GNDA 3IWAA 4DNAA 4X4JA 1E7PA 4USRA 3QSMA 4TLZA 3ICRA 3QFAA 4H4SA 1DODA 1GRTA 2XFNA 3PVCA 4I59A 2FJAA 1LQUA 3AD9B 3WE0A 1QJDA 2WDQA 3IHGA 3CPHG 4REKA 3NLCA 1GXFA 1KDGA 4J36A 2HQMA 3FPZA 5M10A 4A7AA 3CNJA 1VG0A 4YT0A 3K30A 4AOXA 2BK5A 1GPEA 3AD7B 1LVLA 1O5WA 2XVHA 3DK9A 4H4XA 1D7YA 4LIIA 4YSYA 2RGHA 3BI4A 2YM2A 4Z2TA 1TDOA 2GV8A 2A89A 1DOCA 4JN9A 4B65A 2VZ2A 1GERA 1PXCA 1YQ4A 2WOVA 3AEGA 3UOYA 2GRTA 4EIQA 2ACZA 3DJEA 4ICYA 2R0PA 2Q7VA 4NTCA 1O94A 4ZCCA 4MJWA 3ICTA 4B1BA 4U8LA 2O9ZA 1QLBA 4KX6A 3ICSA 4HB9A 3AYLA 1S3EA 2CULA 3NH3X 4U8OA 4H7UA 3AEEA 1NG3A 2XCGA 1M6IA 4Z26A 2RGJA 1H84A 2VRLA 4NZHA 1JNZA 4BK3A 3NYCA 3PS9A 4Z2RA 1OJAA 2AR8A 1IUUA 1MXTA 4OCGA 2GQFA 2JB3A 3BNMA 4H4VA 1PBFA 4FDCB 3K7QX 2Q0LA 4TM0A 5IQ4A 3V3NA 1REOA 2GMJA 2H89A 2GF3A 3B3RA 2CFYA 2JKCA 1W4XA 2R4EA 2CVJA 2YG3A 4CY6A 3CIRA 2FJDA 4OPGA 3SFDA 5J7XA 1IUVA 1TYPA 2WOWA 3EAOA 3R9UA 2VVMA 3UKHA 2ZZ0A 2FBWA 1NHQA 4GF7A 3HZLA 4K8DA 1D5TA 2C67A 4EM3A 3G5QA 1TYTA 3OC4A 1B37A 4B64A 1PBCA 1L9CA 3KD9A 1FEAA 3CGEA 3Q6JA 1NDAA 5BRTA 4AT0A 4B68A 4PAAA 2WU2A 2XLTA 4U8JA 1F6MA 2F5ZA 1JNRA 3NYFA 3D1CA 2A8XA 5FS7A 5JCMA 3C4NA 3EPTA 4B66A 4BJZA 3G5RA 3NN6X 1NPXA 1JRZA 3AE6A 3CTYA 4WX1A 3UKKA 2IVEA 2OA1A 4U8NA 4X9MA 2YLSA 2VOUA 1K0LA 2WOIA 3GRTA 1CC2A 3AE9A 1YY5A 3AE3A 3K7TA 2A87A 4APNA 1QO8A 3AEDA 4B69A 4H4PA 3K7MX 1JEHA 2WPFA 1MO9A 1JRYA 1H86A 1DNCA 2EQ7A 1ZOVA 2OLOA 2WP5A 3D8XA 3FBSA 1FL2A 3AE7A 4I58A 2BK4A 4Z43A 2C66A 1CJCA 2X8GA 4AT2A 2BK3A 2RABA 1S2QA 3AEBA 5BVAA 2YLXA 4C3XA 5JCIA 4TM3A 3QJ4A 1NHRA 1E1KA 3AECA 5FMHA 4CCQA 2V3BA 1EL9A 2EQ6A 2Y6RA 4H2PA 5GRTA 3UCLA 1P2EA 2EQ8A 4AP1A 4C5OA 3CGBA 4J31A 4U2SA 1TDNA 4YWOA 3UKFA 3P4QA 1XDIA 3CNTA 1MOKA 4H2RA 2GR2A 2C72A 1NEKA 3OZ2A 4OPLA 1VQWA 4E0VA 2XLUA 1AOGA 2YR6A 3BHKA 4RG4A 4IVOB 1ZK7A 4X9NA 3VRDB 3AE4A 2FJEA 3UOXA 4GDPA 1PS9A 3UOVA 5GSNA 2WP9A 3KA7A 1PXAA 1PN0A 4DGKA 4DSHA 1PBDA 1CL0A 2B9XA 2OALA 3NHOX 4J2WA 1H6VA 1IUTA 2QA2A 3AE1A 5CQFA 2BACA 2YAUA 3V3OA 1DXLA 4A79A 1OJ9A 1TDKA 3P4SA 4IV9A 4K5RA 3QSSA 2DKHA 1YQ3A 5JCLA 4IA6A 3AXBA 1GT8A 3AD8B 3LZWA 4KPRA 4XWRA 5JCKA 1H83A 2GB0A 5HYMA 2B76A 2GQWA 2V61A 1DOBA 2V6OA 1BZLA 4UDRA 3KVEA 3DK8A 4U8PA 4D04A 2XVJA 1EL5A 1H81A 2C7GA 2BXSA 3H4KA 4BK1A 4H4ZA 1P2HA 3AEAA 4JQ9A 3G5SA 3GSIA 3REDA 3F8PA 4C3YA 2V3AA 4LA1A 4K5SA 4TM4A 3RP8A 3NT6A 4N9XA 2BCPA 3LADA 3SGLA 1OJCA 3GMCA 2GEWA 2GR1A 2GVCA 3RHAA 1ZP0A 2OAMA 4XXGA 1K0IA 1UKVG 1NAAA 1IJHA 1LTXR 1ZY8A 1NHSA 2V5ZA 1EBDA 2BABA 3COXA 2C70A 5IPYA 1D4CA 4Z25A 5L46A 1GEUA 3QFBA 3GYIA 3EF6A 3CNPA 1RP0A 3SFEA 2BYBA 1YKJA 2VVLG 3GWFA 2IVDA 3Q9TA 1CHUA 4EQSA 2BCGG 3CPIG 2UZZA 3V76A 2GAHB 4D03A 3DJGX 2R0GA 4GRTA 2XVFA 1DJNA 4YTPA 3M0OA 4UDPA 3O0HA 1B5QA 2I0ZA 2R4JA 3C96A 1FOHA
chains in the Genus database with same CATH superfamily
3NK0X 4H2QA 5HHFA 3T31A 1IUSA 5KXJA 3CPJG 4LU6A 3DH9A 2XVEA 5M0ZA 4TLXA 3T2ZA 4Y4NA 1GRAA 1L9EA 2JAEA 5EOWA 2R9ZA 3M12A 4IA5A 3LZXA 3H8LA 1OJDA 1XANA 2Q0KA 2WU5A 2ZZCA 4CY8A 3IF9A 5KMQA 3ADAB 1PDHA 3P9UA 3NNEA 3UTHA 1LJ1A 3HYXA 3GRSA 2PHHA 3M13A 4HA6A 4OPCA 2WHDA 3UTFA 1O95A 2VVLA 4H4QA 2E4GA 3VR8A 1TDEA 1PJ7A 2WDRA 2B9YA 3DMEA 3SZ0A 3UKPA 4FK1A 1KSUA 2WBAA 3LJPA 5U1OA 4FX9A 2XFQA 3GD4A 3UP4A 1Q9IA 3ATQA 5CKUA 4ADWA 2Z5YA 2BS4A 2W0HA 3CGDA 1OJTA 3NTDA 4H4UA 1F3PA 1PBEA 3UP5A 5TR3A 1BGJA 2XFPA 2FJBA 5EB5A 3UKLA 2WDVA 3ABVA 3GYJA 1E1NA 2NPXA 5KNLA 4EQXA 1GRGA 3SX6A 4YKGA 2GMHA 4A65A 3SZCA 2YVFA 2XDOA 3S5WA 4M52A 4EQWA 2Y6QA 2JK6A 1COYA 4JY3A 5IQ1A 4EM4A 4OPDA 2XYOA 2TMDA 2X8CA 4U8MA 2WEUA 1GTHA 2QCUA 3UKQA 2BS3A 5KVHA 1IUWA 2V60A 2E5VA 1GETA 3NYEA 3ZDNA 3I3LA 1GOSA 1EL7A 2J3NA 4DSGA 2QAEA 4Z24A 1JRXA 4BJYA 3QVRA 2BC0A 1SEZA 1VRQB 2JB2A 2R0CA 3IC9A 1M64A 4CRTA 4OVIA 3NIXA 3VRAA 2WQYA 5U25A 3GMBA 1Q1RA 1TDFA 3ALLA 3QSEA 4PABA 4YSZA 4ZN0A 3KKJA 3T2YA 3ZYXA 4O5QA 2GR0A 2VQ7A 3ALJA 2C76A 1E1LA 1EL8A 4RG3A 1GSNA 1X31B 3I6DA 5KOXA 4H4TA 4JNAA 4JNQA 1LQTA 3LOVA 2WS3A 2AQJA 2XFUA 2BRAA 1ZOYA 2BS2A 1GRBA 4ECHA 2E1MA 3P4RA 1CJ3A 4G6GA 2WETA 4YXDA 4J33A 2C3CA 1S3BA 4JY2A 4A6NB 1HYUA 1V59A 2XFOA 1L9DA 5U63A 3FMWA 2GR3A 4JDRA 3EANA 1Z6LA 1CJ2A 2DKIA 3BI5A 5KRQA 4RSLA 4A6NA 4II2A 1E1MA 4GAPA 4H4RA 2Z5XA 3RNMA 3NRNA 2YLWA 1LPFA 1ONFA 4G9KA 3II4A 1BWCA 1XHCA 2RGOA 1CF3A 1F8WA 3ISHA 1NHPA 4OPIA 3AYJA 3B6DA 5ER0A 4UP3A 1VDCA 2C65A 4ZCDA 4YSHA 3C4AA 1TRBA 1BKWA 1JU2A 3ALMA 4WCTA 4YTMA 1YQZA 3VR9A 4EMIA 4C74A 2X50A 1F8RA 5LV9A 1FEBA 2GAGB 1ELIA 2BC1A 3DJJA 1F8SA 1Y56B 1ZDLA 4H50A 4U2TA 2YWLA 1BGNA 3QVPA 4IVMB 4USQA 5EB4A 1N4WA 3RP7A 2YVGA 3UOZA 3H8IA 4Y4MA 4GR1A 1KFYA 1D4DA 1PHHA 1CBOA 2APGA 5BUKA 1RSGA 4OPUA 3AB1A 3GD3A 4O5UA 3SQPA 2C64A 1Y56A 4AOSA 4GCMA 4OPTA 1GREA 4YTNA 1GV4A 2YG7A 1IUXA 2X3NA 2YQUA 1NENA 2C3DA 3BI2A 2XLSA 3KU9A 2R46A 4Z44A 1FECA 3NTAA 4GDEA 2WPEA 3DJDA 1PJ6A 4B63A 5J60A 4EQRA 1VG9A 2WESA 4XWZA 3HYVA 3AE2A 2YG5A 3KLJA 1JOAA 3FIMB 4FK1C 4NNJA 2GH5A 3DK4A 1KNPA 4NTDA 2YR4A 2JBVA 2XLPA 3ATRA 3GWDA 3L1RA 4YKFA 3SM8A 1D7LA 3SZFA 4CBQA 4GUVA 2B9WA 3BNUA 3E1TA 3GDNA 5KWFA 2YLZA 3UTEA 4BK2A 3T2KA 4BV6A 3URHA 1Q1WA 1H7WA 1RYIA 2CDUA 5JCNA 1H7XA 1H82A 4TM1A 2VQBA 3CNSA 2AAQA 4K2XA 2BRYA 2VRMA 1LV0A 2B7SA 3LXDA 1BF3A 3P1WA 2YR5A 3SZWA 4BURA 4GAVA 3BHFA 1K0JA 3SY4A 2X8HA 3FG2P 3NN0X 2PYXA 5KVIA 1GESA 3KPKA 1N1PA 4U2LA 1XPQA 3CNDA 3PO7A 2ZBWA 4U8IA 4CCRA 2C75A 1GRHA 3NKSA 5FS9A 1K4QA 4AP3A 2YLTA 5BULA 3DGZA 5C2TA 1DJQA 3NG7X 2Q6UA 2X99A 1Y0PA 1N4VA 1ZMDA 4NEWA 2R45A 3NGCX 1GRFA 1ZKQA 2ZZBA 2QA1A 3CGCA 3F8RA 4CNKA 1NG4A 4J57A 5EBKA 5HXIA 2H88A 4G6HA 3AYIA 2BA9A 1E39A 1CC4A 2WPCA 4CNJA 2TPRA 1DOEA 2YVJA 2B7RA 1GALA 1KF6A 2EQ9A 3AE5A 3AWIA 4H4WA 3RP6A 3DA1A 2C73A 1ZMCA 3GDPA 3KPFA 3ITJA 3NK1X 5DBJA 3VRBA 1GTEA 2OLNA 4B67A 4C77A 1PBBA 4EMWA 1N4UA 3NK2X 1S2YA 5FS6A 4A99A 1KSSA 1B4VA 2XLRA 4J34A 2JB1A 4NTEA 5C3JA 4P9SA 3UKAA 4H2NA 5KOWA 1FCDA 1ZX9A 3AE8A 3AEFA 4J56A 3LB8A 1B8SA 4UDQA 2WP6A 2BXRA 3L8KA 2XVIA 5FS8A 5HY5A 3UTGA 3IHMA 2YM1A 3JSKA 2NVKX 3F8DA 4A9WA 4NEVA 3DGHA 1PXBA 4A5LA 4Z2UA 1CC6A 1KNRA 2YG4A 2ARDA 2YG6A 1CJ4A 2YLRA 4Y4LA 4YSXA 1PJ5A 4K22A 1E6EA 2IIDA 5KMRA 5KMSA 3SXIA 4K7ZA 3T0KA 1D4EA 3CN8A 1L0VA 4EIPA 3T37A 4EMJA 3S61A 4U8KA 3P4PA 4H4YA 3VQRA 1GNDA 3IWAA 4DNAA 4X4JA 1E7PA 4USRA 3QSMA 4TLZA 3ICRA 3QFAA 4H4SA 1DODA 1GRTA 2XFNA 3PVCA 4I59A 2FJAA 1LQUA 3WE0A 3AD9B 1QJDA 2WDQA 3IHGA 3CPHG 4REKA 3NLCA 1GXFA 1KDGA 4J36A 2HQMA 3FPZA 5M10A 4A7AA 3CNJA 1VG0A 4YT0A 3K30A 4AOXA 2BK5A 1GPEA 3AD7B 1LVLA 1O5WA 2XVHA 3DK9A 4H4XA 1D7YA 4LIIA 4YSYA 2RGHA 3BI4A 2YM2A 4Z2TA 1TDOA 2GV8A 2A89A 1DOCA 4JN9A 4B65A 2VZ2A 1GERA 1PXCA 1YQ4A 2WOVA 3AEGA 4II3A 3UOYA 2GRTA 4EIQA 2ACZA 3DJEA 4ICYA 2R0PA 2Q7VA 4NTCA 1O94A 4ZCCA 4MJWA 3ICTA 4B1BA 4U8LA 2O9ZA 1QLBA 4KX6A 3ICSA 4HB9A 3AYLA 1S3EA 2CULA 3NH3X 4U8OA 4H7UA 3AEEA 1NG3A 2XCGA 1M6IA 4Z26A 2RGJA 1H84A 2VRLA 4NZHA 1JNZA 4NWZA 4BK3A 3NYCA 3PS9A 4Z2RA 1OJAA 2AR8A 1IUUA 1MXTA 4OCGA 2GQFA 2JB3A 3BNMA 4H4VA 1PBFA 4FDCB 3K7QX 2Q0LA 4TM0A 5IQ4A 3V3NA 1REOA 2GMJA 2H89A 2GF3A 3B3RA 2CFYA 2JKCA 1W4XA 2R4EA 2CVJA 2YG3A 4CY6A 3CIRA 2FJDA 4OPGA 3SFDA 5J7XA 1IUVA 1TYPA 2WOWA 3EAOA 3R9UA 2VVMA 3UKHA 2ZZ0A 2FBWA 1NHQA 4GF7A 3HZLA 4K8DA 1D5TA 2C67A 4EM3A 3G5QA 1TYTA 3OC4A 1B37A 4B64A 1PBCA 3SYIA 1L9CA 3KD9A 1FEAA 3CGEA 3Q6JA 1NDAA 5BRTA 4AT0A 4B68A 4PAAA 2WU2A 2XLTA 4U8JA 1F6MA 2F5ZA 1JNRA 3NYFA 3D1CA 2A8XA 5FS7A 5JCMA 3C4NA 3EPTA 4B66A 4BJZA 3G5RA 3NN6X 1NPXA 1JRZA 3AE6A 3CTYA 4WX1A 3UKKA 2IVEA 2OA1A 4U8NA 4X9MA 2YLSA 2VOUA 1K0LA 2WOIA 3GRTA 1CC2A 3AE9A 1YY5A 3AE3A 3K7TA 3T14A 2A87A 4APNA 2C4CA 1QO8A 3AEDA 4B69A 4H4PA 3K7MX 1JEHA 2WPFA 1MO9A 1JRYA 1H86A 1DNCA 2EQ7A 1ZOVA 2OLOA 2WP5A 3D8XA 5KMPA 3FBSA 1FL2A 3AE7A 4I58A 2BK4A 4Z43A 2C66A 1CJCA 2X8GA 4AT2A 2BK3A 2RABA 1S2QA 4G73A 3AEBA 5BVAA 2YLXA 4G74A 4C3XA 5JCIA 4TM3A 3QJ4A 1NHRA 1E1KA 3AECA 5FMHA 4CCQA 2V3BA 1EL9A 2EQ6A 2Y6RA 4H2PA 5GRTA 3UCLA 1P2EA 2EQ8A 4AP1A 4C5OA 3CGBA 4J31A 4U2SA 1TDNA 4YWOA 3UKFA 3P4QA 1XDIA 3CNTA 1MOKA 4H2RA 2GR2A 3GYXA 2C72A 1NEKA 3OZ2A 4OPLA 1VQWA 4E0VA 2XLUA 1AOGA 2YR6A 3BHKA 4RG4A 4IVOB 1ZK7A 4X9NA 3VRDB 3AE4A 2FJEA 3UOXA 4GDPA 1PS9A 3CMMA 3UOVA 5GSNA 2WP9A 3KA7A 1PXAA 1PN0A 4DGKA 4DSHA 1PBDA 1CL0A 2B9XA 2OALA 3NHOX 4J2WA 1H6VA 1IUTA 2QA2A 3AE1A 5CQFA 2BACA 2YAUA 3V3OA 1DXLA 4A79A 1OJ9A 1TDKA 4IV9A 3P4SA 4K5RA 3QSSA 2DKHA 1YQ3A 5JCLA 4IA6A 3AXBA 1GT8A 3AD8B 3LZWA 4KPRA 4XWRA 5JCKA 1H83A 2GB0A 5HYMA 2B76A 2GQWA 2V61A 1DOBA 2V6OA 1BZLA 4UDRA 3KVEA 3DK8A 4U8PA 4D04A 2XVJA 1EL5A 1H81A 2C7GA 2BXSA 3H4KA 4BK1A 4H4ZA 1P2HA 3AEAA 4JQ9A 3G5SA 3GSIA 3REDA 3F8PA 4C3YA 2V3AA 4LA1A 4K5SA 4TM4A 3RP8A 3NT6A 4N9XA 2BCPA 3LADA 3SGLA 1OJCA 3GMCA 2GEWA 2GR1A 2GVCA 3RHAA 1ZP0A 2OAMA 4XXGA 1K0IA 1UKVG 1NAAA 1IJHA 1LTXR 1ZY8A 1NHSA 2V5ZA 1EBDA 2BABA 3COXA 2C70A 5IPYA 1D4CA 4Z25A 5L46A 1GEUA 3QFBA 3GYIA 3EF6A 3CNPA 1RP0A 3SFEA 2BYBA 1YKJA 2VVLG 3GWFA 2IVDA 3Q9TA 1CHUA 4EQSA 2BCGG 3CPIG 2UZZA 3V76A 3HYWA 2GAHB 4D03A 3DJGX 2R0GA 4GRTA 2XVFA 1DJNA 4YTPA 3M0OA 4UDPA 3O0HA 1B5QA 2I0ZA 2R4JA 3C96A 1FOHA
chains in the Genus database with same CATH topology
3NK0X 4H2QA 5HHFA 3T31A 1IUSA 5KXJA 3CPJG 4LU6A 3DH9A 2XVEA 5M0ZA 4TLXA 3T2ZA 4Y4NA 1GRAA 1L9EA 2JAEA 5EOWA 2R9ZA 3M12A 4IA5A 3LZXA 3H8LA 1OJDA 1XANA 2Q0KA 2WU5A 2ZZCA 4CY8A 3IF9A 5KMQA 3ADAB 1PDHA 3P9UA 3NNEA 3UTHA 1LJ1A 3HYXA 3GRSA 2PHHA 3M13A 4HA6A 4OPCA 2WHDA 3UTFA 1O95A 2VVLA 4H4QA 2E4GA 3VR8A 1TDEA 1PJ7A 2WDRA 2B9YA 3DMEA 3SZ0A 3UKPA 4FK1A 1KSUA 2WBAA 3LJPA 5U1OA 4FX9A 2XFQA 3GD4A 3UP4A 1Q9IA 3ATQA 5CKUA 4ADWA 2Z5YA 2BS4A 2W0HA 3CGDA 1OJTA 3NTDA 4H4UA 1F3PA 1PBEA 3UP5A 5TR3A 1BGJA 2XFPA 2FJBA 5EB5A 3UKLA 2WDVA 3ABVA 3GYJA 1E1NA 2NPXA 5KNLA 4EQXA 1GRGA 3SX6A 4YKGA 2GMHA 4A65A 3SZCA 2YVFA 2XDOA 3S5WA 4M52A 4EQWA 2Y6QA 2JK6A 1COYA 4JY3A 5IQ1A 4EM4A 4OPDA 2XYOA 2TMDA 2X8CA 4U8MA 2WEUA 1GTHA 2QCUA 3UKQA 2BS3A 5KVHA 1IUWA 2V60A 2E5VA 1GETA 3NYEA 3ZDNA 3I3LA 1GOSA 1EL7A 2J3NA 4DSGA 2QAEA 4Z24A 1JRXA 4BJYA 3QVRA 2BC0A 1SEZA 1VRQB 2JB2A 2R0CA 3IC9A 1M64A 4CRTA 4OVIA 3NIXA 3VRAA 2WQYA 5U25A 3GMBA 1Q1RA 1TDFA 3ALLA 3QSEA 4PABA 4YSZA 4ZN0A 3KKJA 3T2YA 3ZYXA 4O5QA 2GR0A 2VQ7A 3ALJA 2C76A 1E1LA 1EL8A 4RG3A 1GSNA 1X31B 3I6DA 5KOXA 4H4TA 4JNAA 4JNQA 1LQTA 3LOVA 2WS3A 2AQJA 2XFUA 2BRAA 1ZOYA 2BS2A 1GRBA 4ECHA 2E1MA 3P4RA 1CJ3A 4G6GA 2WETA 4YXDA 4J33A 2C3CA 1S3BA 4JY2A 4A6NB 1HYUA 1V59A 2XFOA 1L9DA 5U63A 3FMWA 2GR3A 4JDRA 3EANA 1Z6LA 1CJ2A 2DKIA 3BI5A 5KRQA 4RSLA 4A6NA 4II2A 1E1MA 4GAPA 4H4RA 2Z5XA 3RNMA 3NRNA 2YLWA 1LPFA 1ONFA 4G9KA 3II4A 1BWCA 1XHCA 2RGOA 1CF3A 1F8WA 3ISHA 1NHPA 4OPIA 3AYJA 3B6DA 5ER0A 4UP3A 1VDCA 2C65A 4ZCDA 4YSHA 3C4AA 1TRBA 1BKWA 1JU2A 3ALMA 4WCTA 4YTMA 1YQZA 3VR9A 4EMIA 4C74A 2X50A 1F8RA 5LV9A 1FEBA 2GAGB 1ELIA 2BC1A 3DJJA 1F8SA 1Y56B 1ZDLA 4H50A 4U2TA 2YWLA 1BGNA 3QVPA 4IVMB 4USQA 5EB4A 1N4WA 3RP7A 2YVGA 3UOZA 3H8IA 4Y4MA 4GR1A 1KFYA 1D4DA 1PHHA 1CBOA 2APGA 5BUKA 1RSGA 4OPUA 3AB1A 3GD3A 4O5UA 3SQPA 2C64A 1Y56A 4AOSA 4GCMA 4OPTA 1GREA 4YTNA 1GV4A 2YG7A 1IUXA 2X3NA 2YQUA 1NENA 2C3DA 3BI2A 2XLSA 3KU9A 2R46A 4Z44A 1FECA 3NTAA 4GDEA 2WPEA 3DJDA 1PJ6A 4B63A 5J60A 4EQRA 1VG9A 2WESA 4XWZA 3HYVA 3AE2A 2YG5A 3KLJA 1JOAA 3FIMB 4FK1C 4NNJA 2GH5A 3DK4A 1KNPA 4NTDA 2YR4A 2JBVA 2XLPA 3ATRA 3GWDA 3L1RA 4YKFA 3SM8A 1D7LA 3SZFA 4CBQA 4GUVA 2B9WA 3BNUA 3E1TA 3GDNA 5KWFA 2YLZA 3UTEA 4BK2A 3T2KA 4BV6A 3URHA 1Q1WA 1H7WA 1RYIA 2CDUA 5JCNA 1H7XA 1H82A 4TM1A 2VQBA 3CNSA 2AAQA 4K2XA 2BRYA 2VRMA 1LV0A 2B7SA 3LXDA 1BF3A 3P1WA 2YR5A 3SZWA 4BURA 4GAVA 3BHFA 1K0JA 3SY4A 2X8HA 3FG2P 3NN0X 2PYXA 5KVIA 1GESA 3KPKA 1N1PA 4U2LA 1XPQA 3CNDA 3PO7A 2ZBWA 4U8IA 4CCRA 2C75A 1GRHA 3NKSA 5FS9A 1K4QA 4AP3A 2YLTA 5BULA 3DGZA 5C2TA 1DJQA 3NG7X 2Q6UA 2X99A 1Y0PA 1N4VA 1ZMDA 4NEWA 2R45A 3NGCX 1GRFA 1ZKQA 2ZZBA 2QA1A 3CGCA 3F8RA 4CNKA 1NG4A 4J57A 5EBKA 5HXIA 2H88A 4G6HA 3AYIA 2BA9A 1E39A 1CC4A 2WPCA 4CNJA 2TPRA 1DOEA 2YVJA 2B7RA 1GALA 1KF6A 2EQ9A 3AE5A 3AWIA 4H4WA 3RP6A 3DA1A 2C73A 1ZMCA 3GDPA 3KPFA 3ITJA 3NK1X 5DBJA 3VRBA 1GTEA 2OLNA 4B67A 4C77A 1PBBA 4EMWA 1N4UA 3NK2X 1S2YA 5FS6A 4A99A 1KSSA 1B4VA 2XLRA 4J34A 2JB1A 4NTEA 5C3JA 4P9SA 3UKAA 4H2NA 5KOWA 1FCDA 1ZX9A 3AE8A 3AEFA 4J56A 3LB8A 1B8SA 4UDQA 2WP6A 2BXRA 3L8KA 2XVIA 5FS8A 5HY5A 3UTGA 3IHMA 2YM1A 3JSKA 2NVKX 3F8DA 4A9WA 4NEVA 3DGHA 1PXBA 4A5LA 4Z2UA 1CC6A 1KNRA 2YG4A 2ARDA 2YG6A 1CJ4A 2YLRA 4Y4LA 4YSXA 1PJ5A 4K22A 1E6EA 2IIDA 5KMRA 5KMSA 3SXIA 4K7ZA 3T0KA 1D4EA 3CN8A 1L0VA 4EIPA 3T37A 4EMJA 3S61A 4U8KA 3P4PA 4H4YA 3VQRA 1GNDA 3IWAA 4DNAA 4X4JA 1E7PA 4USRA 3QSMA 4TLZA 3ICRA 3QFAA 4H4SA 1DODA 1GRTA 2XFNA 3PVCA 4I59A 2FJAA 1LQUA 3AD9B 3WE0A 1QJDA 2WDQA 3IHGA 3CPHG 4REKA 3NLCA 1GXFA 1KDGA 4J36A 2HQMA 3FPZA 5M10A 4A7AA 3CNJA 1VG0A 4YT0A 3K30A 4AOXA 2BK5A 1GPEA 3AD7B 1LVLA 1O5WA 2XVHA 3DK9A 4H4XA 1D7YA 4LIIA 4YSYA 2RGHA 3BI4A 2YM2A 4Z2TA 1TDOA 2GV8A 2A89A 1DOCA 4JN9A 4B65A 2VZ2A 1GERA 1PXCA 1YQ4A 2WOVA 3AEGA 4II3A 3UOYA 2GRTA 4EIQA 2ACZA 3DJEA 4ICYA 2R0PA 2Q7VA 4NTCA 1O94A 4ZCCA 4MJWA 3ICTA 4B1BA 4U8LA 2O9ZA 1QLBA 4KX6A 3ICSA 4HB9A 3AYLA 1S3EA 2CULA 3NH3X 4U8OA 4H7UA 3AEEA 1NG3A 2XCGA 1M6IA 4Z26A 2RGJA 1H84A 2VRLA 4NZHA 1JNZA 4NWZA 4BK3A 3NYCA 3PS9A 4Z2RA 1OJAA 2AR8A 1IUUA 1MXTA 4OCGA 2GQFA 2JB3A 3BNMA 4H4VA 1PBFA 4FDCB 3K7QX 2Q0LA 4TM0A 5IQ4A 3V3NA 1REOA 2GMJA 2H89A 2GF3A 3B3RA 2CFYA 2JKCA 1W4XA 2R4EA 2CVJA 2YG3A 4CY6A 3CIRA 2FJDA 4OPGA 3SFDA 5J7XA 1IUVA 1TYPA 2WOWA 3EAOA 3R9UA 2VVMA 3UKHA 2ZZ0A 2FBWA 1NHQA 4GF7A 3HZLA 4K8DA 1D5TA 2C67A 4EM3A 3G5QA 1TYTA 3OC4A 1B37A 4B64A 1PBCA 3SYIA 1L9CA 3KD9A 1FEAA 3CGEA 3Q6JA 1NDAA 5BRTA 4AT0A 4B68A 4PAAA 2WU2A 2XLTA 4U8JA 1F6MA 2F5ZA 1JNRA 3NYFA 3D1CA 2A8XA 5FS7A 5JCMA 3C4NA 3EPTA 4B66A 4BJZA 3G5RA 3NN6X 1NPXA 1JRZA 3AE6A 3CTYA 4WX1A 3UKKA 2IVEA 2OA1A 4U8NA 4X9MA 2YLSA 2VOUA 1K0LA 2WOIA 3GRTA 1CC2A 3AE9A 1YY5A 3AE3A 3K7TA 3T14A 2A87A 4APNA 2C4CA 1QO8A 3AEDA 4B69A 4H4PA 3K7MX 1JEHA 2WPFA 1MO9A 1JRYA 1H86A 1DNCA 2EQ7A 1ZOVA 2OLOA 2WP5A 3D8XA 5KMPA 3FBSA 1FL2A 3AE7A 4I58A 2BK4A 4Z43A 2C66A 1CJCA 2X8GA 4AT2A 2BK3A 2RABA 1S2QA 4G73A 3AEBA 5BVAA 2YLXA 4G74A 4C3XA 5JCIA 4TM3A 3QJ4A 1NHRA 1E1KA 3AECA 5FMHA 4CCQA 2V3BA 1EL9A 2EQ6A 2Y6RA 4H2PA 5GRTA 3UCLA 1P2EA 2EQ8A 4AP1A 4C5OA 3CGBA 4J31A 4U2SA 1TDNA 4YWOA 3UKFA 3P4QA 1XDIA 3CNTA 1MOKA 4H2RA 2GR2A 3GYXA 2C72A 1NEKA 3OZ2A 4OPLA 1VQWA 4E0VA 2XLUA 1AOGA 2YR6A 3BHKA 4RG4A 4IVOB 1ZK7A 4X9NA 3VRDB 3AE4A 2FJEA 3UOXA 4GDPA 1PS9A 3CMMA 3UOVA 5GSNA 2WP9A 3KA7A 1PXAA 1PN0A 4DGKA 4DSHA 1PBDA 1CL0A 2B9XA 2OALA 3NHOX 4J2WA 1H6VA 1IUTA 2QA2A 3AE1A 5CQFA 2BACA 2YAUA 3V3OA 1DXLA 4A79A 1OJ9A 1TDKA 3P4SA 4IV9A 4K5RA 3QSSA 2DKHA 1YQ3A 5JCLA 4IA6A 3AXBA 1GT8A 3AD8B 3LZWA 4KPRA 4XWRA 5JCKA 1H83A 2GB0A 5HYMA 2B76A 2GQWA 2V61A 1DOBA 2V6OA 1BZLA 4UDRA 3KVEA 3DK8A 4U8PA 4D04A 2XVJA 1EL5A 1H81A 2C7GA 2BXSA 3H4KA 4BK1A 4H4ZA 1P2HA 3AEAA 4JQ9A 3G5SA 3GSIA 3REDA 3F8PA 4C3YA 2V3AA 4LA1A 4K5SA 4TM4A 3RP8A 3NT6A 4N9XA 2BCPA 3LADA 3SGLA 1OJCA 3GMCA 2GEWA 2GR1A 2GVCA 3RHAA 1ZP0A 2OAMA 4XXGA 1K0IA 1UKVG 1NAAA 1IJHA 1LTXR 1ZY8A 1NHSA 2V5ZA 1EBDA 2BABA 3COXA 2C70A 5IPYA 1D4CA 4Z25A 5L46A 1GEUA 3QFBA 3GYIA 3EF6A 3CNPA 1RP0A 3SFEA 2BYBA 1YKJA 2VVLG 3GWFA 2IVDA 3Q9TA 1CHUA 4EQSA 2BCGG 3CPIG 2UZZA 3V76A 3HYWA 2GAHB 4D03A 3DJGX 2R0GA 4GRTA 2XVFA 1DJNA 4YTPA 3M0OA 4UDPA 3O0HA 1B5QA 2I0ZA 2R4JA 3C96A 1FOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NK0 X;  4H2Q A;  5HHF A;  5KXJ A;  1IUS A;  3CPJ G;  4LU6 A;  3DH9 A;  2XVE A;  5M0Z A;  4TLX A;  4Y4N A;  1GRA A;  1L9E A;  2JAE A;  5EOW A;  2R9Z A;  3M12 A;  4IA5 A;  3LZX A;  3H8L A;  1OJD A;  1XAN A;  2Q0K A;  2WU5 A;  2ZZC A;  4CY8 A;  3IF9 A;  3ADA B;  1PDH A;  3P9U A;  3NNE A;  3UTH A;  1LJ1 A;  4HA6 A;  3GRS A;  2PHH A;  3M13 A;  3UTF A;  4OPC A;  2WHD A;  1O95 A;  2VVL A;  4H4Q A;  2E4G A;  3VR8 A;  1TDE A;  1PJ7 A;  2WDR A;  2B9Y A;  3DME A;  3UKP A;  4FK1 A;  1KSU A;  2WBA A;  3LJP A;  5U1O A;  4FX9 A;  2XFQ A;  3GD4 A;  3UP4 A;  1Q9I A;  3ATQ A;  5CKU A;  4ADW A;  2Z5Y A;  2BS4 A;  2W0H A;  3CGD A;  1OJT A;  3NTD A;  4H4U A;  1F3P A;  1PBE A;  3UP5 A;  5TR3 A;  1BGJ A;  2XFP A;  2FJB A;  5EB5 A;  3UKL A;  2WDV A;  3ABV A;  3GYJ A;  1E1N A;  2NPX A;  4EQX A;  1GRG A;  4YKG A;  2GMH A;  4A65 A;  2YVF A;  2XDO A;  3S5W A;  4M52 A;  4EQW A;  2Y6Q A;  2JK6 A;  1COY A;  4JY3 A;  5IQ1 A;  4EM4 A;  4OPD A;  2XYO A;  2TMD A;  2X8C A;  4U8M A;  2WEU A;  1GTH A;  2QCU A;  3UKQ A;  2BS3 A;  5KVH A;  1IUW A;  2V60 A;  2E5V A;  1GET A;  3NYE A;  3ZDN A;  3I3L A;  1GOS A;  1EL7 A;  2J3N A;  4DSG A;  2QAE A;  4Z24 A;  1JRX A;  4BJY A;  3QVR A;  2BC0 A;  1SEZ A;  1VRQ B;  2JB2 A;  2R0C A;  3IC9 A;  1M64 A;  4CRT A;  4OVI A;  3NIX A;  3VRA A;  2WQY A;  5U25 A;  3GMB A;  1Q1R A;  1TDF A;  3ALL A;  3QSE A;  4PAB A;  4YSZ A;  4ZN0 A;  3KKJ A;  3ZYX A;  4O5Q A;  2GR0 A;  2VQ7 A;  3ALJ A;  2C76 A;  1E1L A;  1EL8 A;  4RG3 A;  1GSN A;  1X31 B;  3I6D A;  5KOX A;  4H4T A;  4JNA A;  4JNQ A;  1LQT A;  3LOV A;  2WS3 A;  2AQJ A;  2XFU A;  1ZOY A;  2BS2 A;  1GRB A;  4ECH A;  2E1M A;  3P4R A;  1CJ3 A;  2WET A;  4YXD A;  4J33 A;  2C3C A;  1S3B A;  4JY2 A;  4A6N B;  1HYU A;  1V59 A;  2XFO A;  1L9D A;  5U63 A;  3FMW A;  2GR3 A;  4JDR A;  3EAN A;  1Z6L A;  1CJ2 A;  2DKI A;  3BI5 A;  5KRQ A;  4RSL A;  4A6N A;  1E1M A;  4H4R A;  2Z5X A;  3RNM A;  3NRN A;  2YLW A;  1LPF A;  1ONF A;  3II4 A;  1BWC A;  1XHC A;  2RGO A;  1CF3 A;  1F8W A;  3ISH A;  1NHP A;  4OPI A;  3AYJ A;  3B6D A;  5ER0 A;  4UP3 A;  1VDC A;  2C65 A;  4ZCD A;  4YSH A;  3C4A A;  1TRB A;  1BKW A;  1JU2 A;  3ALM A;  4WCT A;  4YTM A;  1YQZ A;  3VR9 A;  4EMI A;  4C74 A;  2X50 A;  1F8R A;  5LV9 A;  1FEB A;  2GAG B;  1ELI A;  2BC1 A;  3DJJ A;  1F8S A;  1Y56 B;  1ZDL A;  4H50 A;  4U2T A;  2YWL A;  1BGN A;  3QVP A;  4IVM B;  4USQ A;  5EB4 A;  1N4W A;  3RP7 A;  2YVG A;  3UOZ A;  3H8I A;  4Y4M A;  4GR1 A;  1KFY A;  1D4D A;  1PHH A;  1CBO A;  2APG A;  5BUK A;  1RSG A;  4OPU A;  3AB1 A;  3GD3 A;  4O5U A;  3SQP A;  2C64 A;  1Y56 A;  4AOS A;  4GCM A;  4OPT A;  1GRE A;  4YTN A;  1GV4 A;  2YG7 A;  1IUX A;  2X3N A;  2YQU A;  1NEN A;  2C3D A;  3BI2 A;  2XLS A;  3KU9 A;  2R46 A;  4Z44 A;  1FEC A;  3NTA A;  4GDE A;  2WPE A;  3DJD A;  1PJ6 A;  4B63 A;  5J60 A;  4EQR A;  1VG9 A;  2WES A;  4XWZ A;  3AE2 A;  2YG5 A;  3KLJ A;  1JOA A;  3FIM B;  4FK1 C;  2GH5 A;  3DK4 A;  1KNP A;  4NTD A;  2YR4 A;  2JBV A;  2XLP A;  3ATR A;  3GWD A;  3L1R A;  4YKF A;  3SM8 A;  1D7L A;  4CBQ A;  4GUV A;  2B9W A;  3BNU A;  3E1T A;  3GDN A;  5KWF A;  2YLZ A;  3UTE A;  4BK2 A;  4BV6 A;  3URH A;  1Q1W A;  1H7W A;  1RYI A;  2CDU A;  5JCN A;  1H7X A;  1H82 A;  4TM1 A;  2VQB A;  3CNS A;  2AAQ A;  4K2X A;  2VRM A;  1LV0 A;  2B7S A;  3LXD A;  1BF3 A;  3P1W A;  2YR5 A;  4BUR A;  3BHF A;  1K0J A;  2X8H A;  3FG2 P;  3NN0 X;  2PYX A;  5KVI A;  1GES A;  1N1P A;  4U2L A;  1XPQ A;  3CND A;  3PO7 A;  2ZBW A;  4U8I A;  4CCR A;  2C75 A;  1GRH A;  3NKS A;  5FS9 A;  1K4Q A;  4AP3 A;  2YLT A;  5BUL A;  3DGZ A;  5C2T A;  1DJQ A;  3NG7 X;  2Q6U A;  2X99 A;  1Y0P A;  1N4V A;  1ZMD A;  4NEW A;  2R45 A;  3NGC X;  1GRF A;  1ZKQ A;  2ZZB A;  2QA1 A;  3CGC A;  3F8R A;  4CNK A;  1NG4 A;  4J57 A;  5EBK A;  5HXI A;  2H88 A;  3AYI A;  2BA9 A;  1E39 A;  1CC4 A;  2WPC A;  4CNJ A;  2TPR A;  1DOE A;  2YVJ A;  2B7R A;  1GAL A;  1KF6 A;  2EQ9 A;  3AE5 A;  3AWI A;  4H4W A;  3RP6 A;  3DA1 A;  2C73 A;  1ZMC A;  3GDP A;  3KPF A;  3ITJ A;  3NK1 X;  5DBJ A;  3VRB A;  1GTE A;  2OLN A;  4B67 A;  4C77 A;  1PBB A;  4EMW A;  1N4U A;  3NK2 X;  1S2Y A;  5FS6 A;  4A99 A;  1KSS A;  1B4V A;  2XLR A;  4J34 A;  2JB1 A;  4NTE A;  5C3J A;  4P9S A;  3UKA A;  4H2N A;  5KOW A;  1FCD A;  1ZX9 A;  3AE8 A;  3AEF A;  4J56 A;  3LB8 A;  1B8S A;  4UDQ A;  2WP6 A;  2BXR A;  3L8K A;  2XVI A;  5FS8 A;  5HY5 A;  3UTG A;  3IHM A;  2YM1 A;  3JSK A;  2NVK X;  3F8D A;  4A9W A;  4NEV A;  3DGH A;  1PXB A;  4A5L A;  4Z2U A;  1CC6 A;  1KNR A;  2YG4 A;  2ARD A;  2YG6 A;  1CJ4 A;  2YLR A;  4Y4L A;  4YSX A;  1PJ5 A;  4K22 A;  1E6E A;  2IID A;  4K7Z A;  4EIP A;  1D4E A;  3CN8 A;  1L0V A;  3T37 A;  4EMJ A;  3S61 A;  4U8K A;  3P4P A;  4H4Y A;  3VQR A;  1GND A;  3IWA A;  4DNA A;  4X4J A;  1E7P A;  4USR A;  3QSM A;  4TLZ A;  3ICR A;  3QFA A;  4H4S A;  1DOD A;  1GRT A;  2XFN A;  3PVC A;  4I59 A;  2FJA A;  1LQU A;  3AD9 B;  3WE0 A;  1QJD A;  2WDQ A;  3IHG A;  3CPH G;  4REK A;  3NLC A;  1GXF A;  1KDG A;  4J36 A;  2HQM A;  3FPZ A;  5M10 A;  4A7A A;  3CNJ A;  1VG0 A;  4YT0 A;  3K30 A;  4AOX A;  2BK5 A;  1GPE A;  3AD7 B;  1LVL A;  1O5W A;  2XVH A;  3DK9 A;  4H4X A;  1D7Y A;  4LII A;  4YSY A;  2RGH A;  3BI4 A;  2YM2 A;  4Z2T A;  1TDO A;  2GV8 A;  2A89 A;  1DOC A;  4JN9 A;  4B65 A;  2VZ2 A;  1GER A;  1PXC A;  1YQ4 A;  2WOV A;  3AEG A;  3UOY A;  2GRT A;  4EIQ A;  2ACZ A;  3DJE A;  4ICY A;  2R0P A;  2Q7V A;  4NTC A;  1O94 A;  4ZCC A;  4MJW A;  3ICT A;  4B1B A;  4U8L A;  2O9Z A;  1QLB A;  4KX6 A;  3ICS A;  4HB9 A;  3AYL A;  1S3E A;  2CUL A;  3NH3 X;  4U8O A;  4H7U A;  3AEE A;  1NG3 A;  2XCG A;  1M6I A;  4Z26 A;  2RGJ A;  1H84 A;  2VRL A;  4NZH A;  1JNZ A;  4BK3 A;  3NYC A;  3PS9 A;  4Z2R A;  1OJA A;  2AR8 A;  1IUU A;  1MXT A;  4OCG A;  2GQF A;  2JB3 A;  3BNM A;  4H4V A;  1PBF A;  4FDC B;  3K7Q X;  2Q0L A;  4TM0 A;  5IQ4 A;  3V3N A;  1REO A;  2GMJ A;  2H89 A;  2GF3 A;  3B3R A;  2CFY A;  2JKC A;  1W4X A;  2R4E A;  2CVJ A;  2YG3 A;  4CY6 A;  3CIR A;  2FJD A;  4OPG A;  3SFD A;  5J7X A;  1IUV A;  1TYP A;  2WOW A;  3EAO A;  3R9U A;  2VVM A;  3UKH A;  2ZZ0 A;  2FBW A;  1NHQ A;  4GF7 A;  3HZL A;  4K8D A;  1D5T A;  2C67 A;  4EM3 A;  3G5Q A;  1TYT A;  3OC4 A;  1B37 A;  4B64 A;  1PBC A;  1L9C A;  3KD9 A;  1FEA A;  3CGE A;  3Q6J A;  1NDA A;  5BRT A;  4AT0 A;  4B68 A;  4PAA A;  2WU2 A;  2XLT A;  4U8J A;  1F6M A;  2F5Z A;  1JNR A;  3NYF A;  3D1C A;  2A8X A;  5FS7 A;  5JCM A;  3C4N A;  3EPT A;  4B66 A;  4BJZ A;  3G5R A;  3NN6 X;  1NPX A;  1JRZ A;  3AE6 A;  3CTY A;  4WX1 A;  3UKK A;  2IVE A;  2OA1 A;  4U8N A;  4X9M A;  2YLS A;  2VOU A;  1K0L A;  2WOI A;  3GRT A;  1CC2 A;  3AE9 A;  1YY5 A;  3AE3 A;  3K7T A;  2A87 A;  4APN A;  1QO8 A;  3AED A;  4B69 A;  4H4P A;  3K7M X;  1JEH A;  2WPF A;  1MO9 A;  1JRY A;  1H86 A;  1DNC A;  2EQ7 A;  1ZOV A;  2OLO A;  2WP5 A;  3D8X A;  3FBS A;  1FL2 A;  3AE7 A;  4I58 A;  2BK4 A;  4Z43 A;  2C66 A;  1CJC A;  2X8G A;  4AT2 A;  2BK3 A;  2RAB A;  1S2Q A;  3AEB A;  5BVA A;  2YLX A;  4C3X A;  5JCI A;  4TM3 A;  3QJ4 A;  1NHR A;  1E1K A;  3AEC A;  5FMH A;  4CCQ A;  2V3B A;  1EL9 A;  2EQ6 A;  2Y6R A;  4H2P A;  5GRT A;  3UCL A;  1P2E A;  2EQ8 A;  4AP1 A;  4C5O A;  3CGB A;  4J31 A;  4U2S A;  1TDN A;  4YWO A;  3UKF A;  3P4Q A;  1XDI A;  3CNT A;  1MOK A;  4H2R A;  2GR2 A;  2C72 A;  1NEK A;  3OZ2 A;  4OPL A;  1VQW A;  4E0V A;  2XLU A;  1AOG A;  2YR6 A;  3BHK A;  4RG4 A;  4IVO B;  1ZK7 A;  4X9N A;  3VRD B;  3AE4 A;  2FJE A;  3UOX A;  4GDP A;  1PS9 A;  3UOV A;  5GSN A;  2WP9 A;  3KA7 A;  1PXA A;  1PN0 A;  4DGK A;  4DSH A;  1PBD A;  1CL0 A;  2B9X A;  2OAL A;  3NHO X;  4J2W A;  1H6V A;  1IUT A;  2QA2 A;  3AE1 A;  5CQF A;  2BAC A;  2YAU A;  3V3O A;  1DXL A;  4A79 A;  1OJ9 A;  1TDK A;  3P4S A;  4IV9 A;  4K5R A;  3QSS A;  2DKH A;  1YQ3 A;  5JCL A;  4IA6 A;  3AXB A;  1GT8 A;  3AD8 B;  3LZW A;  4KPR A;  4XWR A;  5JCK A;  1H83 A;  2GB0 A;  5HYM A;  2B76 A;  2GQW A;  2V61 A;  1DOB A;  2V6O A;  1BZL A;  4UDR A;  3KVE A;  3DK8 A;  4U8P A;  4D04 A;  2XVJ A;  1EL5 A;  1H81 A;  2C7G A;  2BXS A;  3H4K A;  4BK1 A;  4H4Z A;  1P2H A;  3AEA A;  4JQ9 A;  3G5S A;  3GSI A;  3RED A;  3F8P A;  4C3Y A;  2V3A A;  4LA1 A;  4K5S A;  4TM4 A;  3RP8 A;  3NT6 A;  4N9X A;  2BCP A;  3LAD A;  3SGL A;  1OJC A;  3GMC A;  2GEW A;  2GR1 A;  2GVC A;  3RHA A;  1ZP0 A;  2OAM A;  4XXG A;  1K0I A;  1UKV G;  1NAA A;  1IJH A;  1LTX R;  1ZY8 A;  1NHS A;  2V5Z A;  1EBD A;  2BAB A;  3COX A;  2C70 A;  5IPY A;  1D4C A;  4Z25 A;  5L46 A;  1GEU A;  3QFB A;  3GYI A;  3EF6 A;  3CNP A;  1RP0 A;  3SFE A;  2BYB A;  1YKJ A;  2VVL G;  3GWF A;  2IVD A;  3Q9T A;  1CHU A;  4EQS A;  2BCG G;  3CPI G;  2UZZ A;  3V76 A;  2GAH B;  4D03 A;  3DJG X;  2R0G A;  4GRT A;  2XVF A;  1DJN A;  4YTP A;  3M0O A;  4UDP A;  3O0H A;  1B5Q A;  2I0Z A;  2R4J A;  3C96 A;  1FOH A; 
#chains in the Genus database with same CATH topology
 3NK0 X;  4H2Q A;  5HHF A;  3T31 A;  1IUS A;  5KXJ A;  3CPJ G;  4LU6 A;  3DH9 A;  2XVE A;  5M0Z A;  4TLX A;  3T2Z A;  4Y4N A;  1GRA A;  1L9E A;  2JAE A;  5EOW A;  2R9Z A;  3M12 A;  4IA5 A;  3LZX A;  3H8L A;  1OJD A;  1XAN A;  2Q0K A;  2WU5 A;  2ZZC A;  4CY8 A;  3IF9 A;  5KMQ A;  3ADA B;  1PDH A;  3P9U A;  3NNE A;  3UTH A;  1LJ1 A;  3HYX A;  3GRS A;  2PHH A;  3M13 A;  4HA6 A;  4OPC A;  2WHD A;  3UTF A;  1O95 A;  2VVL A;  4H4Q A;  2E4G A;  3VR8 A;  1TDE A;  1PJ7 A;  2WDR A;  2B9Y A;  3DME A;  3SZ0 A;  3UKP A;  4FK1 A;  1KSU A;  2WBA A;  3LJP A;  5U1O A;  4FX9 A;  2XFQ A;  3GD4 A;  3UP4 A;  1Q9I A;  3ATQ A;  5CKU A;  4ADW A;  2Z5Y A;  2BS4 A;  2W0H A;  3CGD A;  1OJT A;  3NTD A;  4H4U A;  1F3P A;  1PBE A;  3UP5 A;  5TR3 A;  1BGJ A;  2XFP A;  2FJB A;  5EB5 A;  3UKL A;  2WDV A;  3ABV A;  3GYJ A;  1E1N A;  2NPX A;  5KNL A;  4EQX A;  1GRG A;  3SX6 A;  4YKG A;  2GMH A;  4A65 A;  3SZC A;  2YVF A;  2XDO A;  3S5W A;  4M52 A;  4EQW A;  2Y6Q A;  2JK6 A;  1COY A;  4JY3 A;  5IQ1 A;  4EM4 A;  4OPD A;  2XYO A;  2TMD A;  2X8C A;  4U8M A;  2WEU A;  1GTH A;  2QCU A;  3UKQ A;  2BS3 A;  5KVH A;  1IUW A;  2V60 A;  2E5V A;  1GET A;  3NYE A;  3ZDN A;  3I3L A;  1GOS A;  1EL7 A;  2J3N A;  4DSG A;  2QAE A;  4Z24 A;  1JRX A;  4BJY A;  3QVR A;  2BC0 A;  1SEZ A;  1VRQ B;  2JB2 A;  2R0C A;  3IC9 A;  1M64 A;  4CRT A;  4OVI A;  3NIX A;  3VRA A;  2WQY A;  5U25 A;  3GMB A;  1Q1R A;  1TDF A;  3ALL A;  3QSE A;  4PAB A;  4YSZ A;  4ZN0 A;  3KKJ A;  3T2Y A;  3ZYX A;  4O5Q A;  2GR0 A;  2VQ7 A;  3ALJ A;  2C76 A;  1E1L A;  1EL8 A;  4RG3 A;  1GSN A;  1X31 B;  3I6D A;  5KOX A;  4H4T A;  4JNA A;  4JNQ A;  1LQT A;  3LOV A;  2WS3 A;  2AQJ A;  2XFU A;  2BRA A;  1ZOY A;  2BS2 A;  1GRB A;  4ECH A;  2E1M A;  3P4R A;  1CJ3 A;  4G6G A;  2WET A;  4YXD A;  4J33 A;  2C3C A;  1S3B A;  4JY2 A;  4A6N B;  1HYU A;  1V59 A;  2XFO A;  1L9D A;  5U63 A;  3FMW A;  2GR3 A;  4JDR A;  3EAN A;  1Z6L A;  1CJ2 A;  2DKI A;  3BI5 A;  5KRQ A;  4RSL A;  4A6N A;  4II2 A;  1E1M A;  4GAP A;  4H4R A;  2Z5X A;  3RNM A;  3NRN A;  2YLW A;  1LPF A;  1ONF A;  4G9K A;  3II4 A;  1BWC A;  1XHC A;  2RGO A;  1CF3 A;  1F8W A;  3ISH A;  1NHP A;  4OPI A;  3AYJ A;  3B6D A;  5ER0 A;  4UP3 A;  1VDC A;  2C65 A;  4ZCD A;  4YSH A;  3C4A A;  1TRB A;  1BKW A;  1JU2 A;  3ALM A;  4WCT A;  4YTM A;  1YQZ A;  3VR9 A;  4EMI A;  4C74 A;  2X50 A;  1F8R A;  5LV9 A;  1FEB A;  2GAG B;  1ELI A;  2BC1 A;  3DJJ A;  1F8S A;  1Y56 B;  1ZDL A;  4H50 A;  4U2T A;  2YWL A;  1BGN A;  3QVP A;  4IVM B;  4USQ A;  5EB4 A;  1N4W A;  3RP7 A;  2YVG A;  3UOZ A;  3H8I A;  4Y4M A;  4GR1 A;  1KFY A;  1D4D A;  1PHH A;  1CBO A;  2APG A;  5BUK A;  1RSG A;  4OPU A;  3AB1 A;  3GD3 A;  4O5U A;  3SQP A;  2C64 A;  1Y56 A;  4AOS A;  4GCM A;  4OPT A;  1GRE A;  4YTN A;  1GV4 A;  2YG7 A;  1IUX A;  2X3N A;  2YQU A;  1NEN A;  2C3D A;  3BI2 A;  2XLS A;  3KU9 A;  2R46 A;  4Z44 A;  1FEC A;  3NTA A;  4GDE A;  2WPE A;  3DJD A;  1PJ6 A;  4B63 A;  5J60 A;  4EQR A;  1VG9 A;  2WES A;  4XWZ A;  3HYV A;  3AE2 A;  2YG5 A;  3KLJ A;  1JOA A;  3FIM B;  4FK1 C;  4NNJ A;  2GH5 A;  3DK4 A;  1KNP A;  4NTD A;  2YR4 A;  2JBV A;  2XLP A;  3ATR A;  3GWD A;  3L1R A;  4YKF A;  3SM8 A;  1D7L A;  3SZF A;  4CBQ A;  4GUV A;  2B9W A;  3BNU A;  3E1T A;  3GDN A;  5KWF A;  2YLZ A;  3UTE A;  4BK2 A;  3T2K A;  4BV6 A;  3URH A;  1Q1W A;  1H7W A;  1RYI A;  2CDU A;  5JCN A;  1H7X A;  1H82 A;  4TM1 A;  2VQB A;  3CNS A;  2AAQ A;  4K2X A;  2BRY A;  2VRM A;  1LV0 A;  2B7S A;  3LXD A;  1BF3 A;  3P1W A;  2YR5 A;  3SZW A;  4BUR A;  4GAV A;  3BHF A;  1K0J A;  3SY4 A;  2X8H A;  3FG2 P;  3NN0 X;  2PYX A;  5KVI A;  1GES A;  3KPK A;  1N1P A;  4U2L A;  1XPQ A;  3CND A;  3PO7 A;  2ZBW A;  4U8I A;  4CCR A;  2C75 A;  1GRH A;  3NKS A;  5FS9 A;  1K4Q A;  4AP3 A;  2YLT A;  5BUL A;  3DGZ A;  5C2T A;  1DJQ A;  3NG7 X;  2Q6U A;  2X99 A;  1Y0P A;  1N4V A;  1ZMD A;  4NEW A;  2R45 A;  3NGC X;  1GRF A;  1ZKQ A;  2ZZB A;  2QA1 A;  3CGC A;  3F8R A;  4CNK A;  1NG4 A;  4J57 A;  5EBK A;  5HXI A;  2H88 A;  4G6H A;  3AYI A;  2BA9 A;  1E39 A;  1CC4 A;  2WPC A;  4CNJ A;  2TPR A;  1DOE A;  2YVJ A;  2B7R A;  1GAL A;  1KF6 A;  2EQ9 A;  3AE5 A;  3AWI A;  4H4W A;  3RP6 A;  3DA1 A;  2C73 A;  1ZMC A;  3GDP A;  3KPF A;  3ITJ A;  3NK1 X;  5DBJ A;  3VRB A;  1GTE A;  2OLN A;  4B67 A;  4C77 A;  1PBB A;  4EMW A;  1N4U A;  3NK2 X;  1S2Y A;  5FS6 A;  4A99 A;  1KSS A;  1B4V A;  2XLR A;  4J34 A;  2JB1 A;  4NTE A;  5C3J A;  4P9S A;  3UKA A;  4H2N A;  5KOW A;  1FCD A;  1ZX9 A;  3AE8 A;  3AEF A;  4J56 A;  3LB8 A;  1B8S A;  4UDQ A;  2WP6 A;  2BXR A;  3L8K A;  2XVI A;  5FS8 A;  5HY5 A;  3UTG A;  3IHM A;  2YM1 A;  3JSK A;  2NVK X;  3F8D A;  4A9W A;  4NEV A;  3DGH A;  1PXB A;  4A5L A;  4Z2U A;  1CC6 A;  1KNR A;  2YG4 A;  2ARD A;  2YG6 A;  1CJ4 A;  2YLR A;  4Y4L A;  4YSX A;  1PJ5 A;  4K22 A;  1E6E A;  2IID A;  5KMR A;  5KMS A;  3SXI A;  4K7Z A;  3T0K A;  1D4E A;  3CN8 A;  1L0V A;  4EIP A;  3T37 A;  4EMJ A;  3S61 A;  4U8K A;  3P4P A;  4H4Y A;  3VQR A;  1GND A;  3IWA A;  4DNA A;  4X4J A;  1E7P A;  4USR A;  3QSM A;  4TLZ A;  3ICR A;  3QFA A;  4H4S A;  1DOD A;  1GRT A;  2XFN A;  3PVC A;  4I59 A;  2FJA A;  1LQU A;  3WE0 A;  3AD9 B;  1QJD A;  2WDQ A;  3IHG A;  3CPH G;  4REK A;  3NLC A;  1GXF A;  1KDG A;  4J36 A;  2HQM A;  3FPZ A;  5M10 A;  4A7A A;  3CNJ A;  1VG0 A;  4YT0 A;  3K30 A;  4AOX A;  2BK5 A;  1GPE A;  3AD7 B;  1LVL A;  1O5W A;  2XVH A;  3DK9 A;  4H4X A;  1D7Y A;  4LII A;  4YSY A;  2RGH A;  3BI4 A;  2YM2 A;  4Z2T A;  1TDO A;  2GV8 A;  2A89 A;  1DOC A;  4JN9 A;  4B65 A;  2VZ2 A;  1GER A;  1PXC A;  1YQ4 A;  2WOV A;  3AEG A;  4II3 A;  3UOY A;  2GRT A;  4EIQ A;  2ACZ A;  3DJE A;  4ICY A;  2R0P A;  2Q7V A;  4NTC A;  1O94 A;  4ZCC A;  4MJW A;  3ICT A;  4B1B A;  4U8L A;  2O9Z A;  1QLB A;  4KX6 A;  3ICS A;  4HB9 A;  3AYL A;  1S3E A;  2CUL A;  3NH3 X;  4U8O A;  4H7U A;  3AEE A;  1NG3 A;  2XCG A;  1M6I A;  4Z26 A;  2RGJ A;  1H84 A;  2VRL A;  4NZH A;  1JNZ A;  4NWZ A;  4BK3 A;  3NYC A;  3PS9 A;  4Z2R A;  1OJA A;  2AR8 A;  1IUU A;  1MXT A;  4OCG A;  2GQF A;  2JB3 A;  3BNM A;  4H4V A;  1PBF A;  4FDC B;  3K7Q X;  2Q0L A;  4TM0 A;  5IQ4 A;  3V3N A;  1REO A;  2GMJ A;  2H89 A;  2GF3 A;  3B3R A;  2CFY A;  2JKC A;  1W4X A;  2R4E A;  2CVJ A;  2YG3 A;  4CY6 A;  3CIR A;  2FJD A;  4OPG A;  3SFD A;  5J7X A;  1IUV A;  1TYP A;  2WOW A;  3EAO A;  3R9U A;  2VVM A;  3UKH A;  2ZZ0 A;  2FBW A;  1NHQ A;  4GF7 A;  3HZL A;  4K8D A;  1D5T A;  2C67 A;  4EM3 A;  3G5Q A;  1TYT A;  3OC4 A;  1B37 A;  4B64 A;  1PBC A;  3SYI A;  1L9C A;  3KD9 A;  1FEA A;  3CGE A;  3Q6J A;  1NDA A;  5BRT A;  4AT0 A;  4B68 A;  4PAA A;  2WU2 A;  2XLT A;  4U8J A;  1F6M A;  2F5Z A;  1JNR A;  3NYF A;  3D1C A;  2A8X A;  5FS7 A;  5JCM A;  3C4N A;  3EPT A;  4B66 A;  4BJZ A;  3G5R A;  3NN6 X;  1NPX A;  1JRZ A;  3AE6 A;  3CTY A;  4WX1 A;  3UKK A;  2IVE A;  2OA1 A;  4U8N A;  4X9M A;  2YLS A;  2VOU A;  1K0L A;  2WOI A;  3GRT A;  1CC2 A;  3AE9 A;  1YY5 A;  3AE3 A;  3K7T A;  3T14 A;  2A87 A;  4APN A;  2C4C A;  1QO8 A;  3AED A;  4B69 A;  4H4P A;  3K7M X;  1JEH A;  2WPF A;  1MO9 A;  1JRY A;  1H86 A;  1DNC A;  2EQ7 A;  1ZOV A;  2OLO A;  2WP5 A;  3D8X A;  5KMP A;  3FBS A;  1FL2 A;  3AE7 A;  4I58 A;  2BK4 A;  4Z43 A;  2C66 A;  1CJC A;  2X8G A;  4AT2 A;  2BK3 A;  2RAB A;  1S2Q A;  4G73 A;  3AEB A;  5BVA A;  2YLX A;  4G74 A;  4C3X A;  5JCI A;  4TM3 A;  3QJ4 A;  1NHR A;  1E1K A;  3AEC A;  5FMH A;  4CCQ A;  2V3B A;  1EL9 A;  2EQ6 A;  2Y6R A;  4H2P A;  5GRT A;  3UCL A;  1P2E A;  2EQ8 A;  4AP1 A;  4C5O A;  3CGB A;  4J31 A;  4U2S A;  1TDN A;  4YWO A;  3UKF A;  3P4Q A;  1XDI A;  3CNT A;  1MOK A;  4H2R A;  2GR2 A;  3GYX A;  2C72 A;  1NEK A;  3OZ2 A;  4OPL A;  1VQW A;  4E0V A;  2XLU A;  1AOG A;  2YR6 A;  3BHK A;  4RG4 A;  4IVO B;  1ZK7 A;  4X9N A;  3VRD B;  3AE4 A;  2FJE A;  3UOX A;  4GDP A;  1PS9 A;  3CMM A;  3UOV A;  5GSN A;  2WP9 A;  3KA7 A;  1PXA A;  1PN0 A;  4DGK A;  4DSH A;  1PBD A;  1CL0 A;  2B9X A;  2OAL A;  3NHO X;  4J2W A;  1H6V A;  1IUT A;  2QA2 A;  3AE1 A;  5CQF A;  2BAC A;  2YAU A;  3V3O A;  1DXL A;  4A79 A;  1OJ9 A;  1TDK A;  4IV9 A;  3P4S A;  4K5R A;  3QSS A;  2DKH A;  1YQ3 A;  5JCL A;  4IA6 A;  3AXB A;  1GT8 A;  3AD8 B;  3LZW A;  4KPR A;  4XWR A;  5JCK A;  1H83 A;  2GB0 A;  5HYM A;  2B76 A;  2GQW A;  2V61 A;  1DOB A;  2V6O A;  1BZL A;  4UDR A;  3KVE A;  3DK8 A;  4U8P A;  4D04 A;  2XVJ A;  1EL5 A;  1H81 A;  2C7G A;  2BXS A;  3H4K A;  4BK1 A;  4H4Z A;  1P2H A;  3AEA A;  4JQ9 A;  3G5S A;  3GSI A;  3RED A;  3F8P A;  4C3Y A;  2V3A A;  4LA1 A;  4K5S A;  4TM4 A;  3RP8 A;  3NT6 A;  4N9X A;  2BCP A;  3LAD A;  3SGL A;  1OJC A;  3GMC A;  2GEW A;  2GR1 A;  2GVC A;  3RHA A;  1ZP0 A;  2OAM A;  4XXG A;  1K0I A;  1UKV G;  1NAA A;  1IJH A;  1LTX R;  1ZY8 A;  1NHS A;  2V5Z A;  1EBD A;  2BAB A;  3COX A;  2C70 A;  5IPY A;  1D4C A;  4Z25 A;  5L46 A;  1GEU A;  3QFB A;  3GYI A;  3EF6 A;  3CNP A;  1RP0 A;  3SFE A;  2BYB A;  1YKJ A;  2VVL G;  3GWF A;  2IVD A;  3Q9T A;  1CHU A;  4EQS A;  2BCG G;  3CPI G;  2UZZ A;  3V76 A;  3HYW A;  2GAH B;  4D03 A;  3DJG X;  2R0G A;  4GRT A;  2XVF A;  1DJN A;  4YTP A;  3M0O A;  4UDP A;  3O0H A;  1B5Q A;  2I0Z A;  2R4J A;  3C96 A;  1FOH A; 
#chains in the Genus database with same CATH homology
 3NK0 X;  4H2Q A;  5HHF A;  3T31 A;  1IUS A;  5KXJ A;  3CPJ G;  4LU6 A;  3DH9 A;  2XVE A;  5M0Z A;  4TLX A;  3T2Z A;  4Y4N A;  1GRA A;  1L9E A;  2JAE A;  5EOW A;  2R9Z A;  3M12 A;  4IA5 A;  3LZX A;  3H8L A;  1OJD A;  1XAN A;  2Q0K A;  2WU5 A;  2ZZC A;  4CY8 A;  3IF9 A;  5KMQ A;  3ADA B;  1PDH A;  3P9U A;  3NNE A;  3UTH A;  1LJ1 A;  3HYX A;  3GRS A;  2PHH A;  3M13 A;  4HA6 A;  4OPC A;  2WHD A;  3UTF A;  1O95 A;  2VVL A;  4H4Q A;  2E4G A;  3VR8 A;  1TDE A;  1PJ7 A;  2WDR A;  2B9Y A;  3DME A;  3SZ0 A;  3UKP A;  4FK1 A;  1KSU A;  2WBA A;  3LJP A;  5U1O A;  4FX9 A;  2XFQ A;  3GD4 A;  3UP4 A;  1Q9I A;  3ATQ A;  5CKU A;  4ADW A;  2Z5Y A;  2BS4 A;  2W0H A;  3CGD A;  1OJT A;  3NTD A;  4H4U A;  1F3P A;  1PBE A;  3UP5 A;  5TR3 A;  1BGJ A;  2XFP A;  2FJB A;  5EB5 A;  3UKL A;  2WDV A;  3ABV A;  3GYJ A;  1E1N A;  2NPX A;  5KNL A;  4EQX A;  1GRG A;  3SX6 A;  4YKG A;  2GMH A;  4A65 A;  3SZC A;  2YVF A;  2XDO A;  3S5W A;  4M52 A;  4EQW A;  2Y6Q A;  2JK6 A;  1COY A;  4JY3 A;  5IQ1 A;  4EM4 A;  4OPD A;  2XYO A;  2TMD A;  2X8C A;  4U8M A;  2WEU A;  1GTH A;  2QCU A;  3UKQ A;  2BS3 A;  5KVH A;  1IUW A;  2V60 A;  2E5V A;  1GET A;  3NYE A;  3ZDN A;  3I3L A;  1GOS A;  1EL7 A;  2J3N A;  4DSG A;  2QAE A;  4Z24 A;  1JRX A;  4BJY A;  3QVR A;  2BC0 A;  1SEZ A;  1VRQ B;  2JB2 A;  2R0C A;  3IC9 A;  1M64 A;  4CRT A;  4OVI A;  3NIX A;  3VRA A;  2WQY A;  5U25 A;  3GMB A;  1Q1R A;  1TDF A;  3ALL A;  3QSE A;  4PAB A;  4YSZ A;  4ZN0 A;  3KKJ A;  3T2Y A;  3ZYX A;  4O5Q A;  2GR0 A;  2VQ7 A;  3ALJ A;  2C76 A;  1E1L A;  1EL8 A;  4RG3 A;  1GSN A;  1X31 B;  3I6D A;  5KOX A;  4H4T A;  4JNA A;  4JNQ A;  1LQT A;  3LOV A;  2WS3 A;  2AQJ A;  2XFU A;  2BRA A;  1ZOY A;  2BS2 A;  1GRB A;  4ECH A;  2E1M A;  3P4R A;  1CJ3 A;  4G6G A;  2WET A;  4YXD A;  4J33 A;  2C3C A;  1S3B A;  4JY2 A;  4A6N B;  1HYU A;  1V59 A;  2XFO A;  1L9D A;  5U63 A;  3FMW A;  2GR3 A;  4JDR A;  3EAN A;  1Z6L A;  1CJ2 A;  2DKI A;  3BI5 A;  5KRQ A;  4RSL A;  4A6N A;  4II2 A;  1E1M A;  4GAP A;  4H4R A;  2Z5X A;  3RNM A;  3NRN A;  2YLW A;  1LPF A;  1ONF A;  4G9K A;  3II4 A;  1BWC A;  1XHC A;  2RGO A;  1CF3 A;  1F8W A;  3ISH A;  1NHP A;  4OPI A;  3AYJ A;  3B6D A;  5ER0 A;  4UP3 A;  1VDC A;  2C65 A;  4ZCD A;  4YSH A;  3C4A A;  1TRB A;  1BKW A;  1JU2 A;  3ALM A;  4WCT A;  4YTM A;  1YQZ A;  3VR9 A;  4EMI A;  4C74 A;  2X50 A;  1F8R A;  5LV9 A;  1FEB A;  2GAG B;  1ELI A;  2BC1 A;  3DJJ A;  1F8S A;  1Y56 B;  1ZDL A;  4H50 A;  4U2T A;  2YWL A;  1BGN A;  3QVP A;  4IVM B;  4USQ A;  5EB4 A;  1N4W A;  3RP7 A;  2YVG A;  3UOZ A;  3H8I A;  4Y4M A;  4GR1 A;  1KFY A;  1D4D A;  1PHH A;  1CBO A;  2APG A;  5BUK A;  1RSG A;  4OPU A;  3AB1 A;  3GD3 A;  4O5U A;  3SQP A;  2C64 A;  1Y56 A;  4AOS A;  4GCM A;  4OPT A;  1GRE A;  4YTN A;  1GV4 A;  2YG7 A;  1IUX A;  2X3N A;  2YQU A;  1NEN A;  2C3D A;  3BI2 A;  2XLS A;  3KU9 A;  2R46 A;  4Z44 A;  1FEC A;  3NTA A;  4GDE A;  2WPE A;  3DJD A;  1PJ6 A;  4B63 A;  5J60 A;  4EQR A;  1VG9 A;  2WES A;  4XWZ A;  3HYV A;  3AE2 A;  2YG5 A;  3KLJ A;  1JOA A;  3FIM B;  4FK1 C;  4NNJ A;  2GH5 A;  3DK4 A;  1KNP A;  4NTD A;  2YR4 A;  2JBV A;  2XLP A;  3ATR A;  3GWD A;  3L1R A;  4YKF A;  3SM8 A;  1D7L A;  3SZF A;  4CBQ A;  4GUV A;  2B9W A;  3BNU A;  3E1T A;  3GDN A;  5KWF A;  2YLZ A;  3UTE A;  4BK2 A;  3T2K A;  4BV6 A;  3URH A;  1Q1W A;  1H7W A;  1RYI A;  2CDU A;  5JCN A;  1H7X A;  1H82 A;  4TM1 A;  2VQB A;  3CNS A;  2AAQ A;  4K2X A;  2BRY A;  2VRM A;  1LV0 A;  2B7S A;  3LXD A;  1BF3 A;  3P1W A;  2YR5 A;  3SZW A;  4BUR A;  4GAV A;  3BHF A;  1K0J A;  3SY4 A;  2X8H A;  3FG2 P;  3NN0 X;  2PYX A;  5KVI A;  1GES A;  3KPK A;  1N1P A;  4U2L A;  1XPQ A;  3CND A;  3PO7 A;  2ZBW A;  4U8I A;  4CCR A;  2C75 A;  1GRH A;  3NKS A;  5FS9 A;  1K4Q A;  4AP3 A;  2YLT A;  5BUL A;  3DGZ A;  5C2T A;  1DJQ A;  3NG7 X;  2Q6U A;  2X99 A;  1Y0P A;  1N4V A;  1ZMD A;  4NEW A;  2R45 A;  3NGC X;  1GRF A;  1ZKQ A;  2ZZB A;  2QA1 A;  3CGC A;  3F8R A;  4CNK A;  1NG4 A;  4J57 A;  5EBK A;  5HXI A;  2H88 A;  4G6H A;  3AYI A;  2BA9 A;  1E39 A;  1CC4 A;  2WPC A;  4CNJ A;  2TPR A;  1DOE A;  2YVJ A;  2B7R A;  1GAL A;  1KF6 A;  2EQ9 A;  3AE5 A;  3AWI A;  4H4W A;  3RP6 A;  3DA1 A;  2C73 A;  1ZMC A;  3GDP A;  3KPF A;  3ITJ A;  3NK1 X;  5DBJ A;  3VRB A;  1GTE A;  2OLN A;  4B67 A;  4C77 A;  1PBB A;  4EMW A;  1N4U A;  3NK2 X;  1S2Y A;  5FS6 A;  4A99 A;  1KSS A;  1B4V A;  2XLR A;  4J34 A;  2JB1 A;  4NTE A;  5C3J A;  4P9S A;  3UKA A;  4H2N A;  5KOW A;  1FCD A;  1ZX9 A;  3AE8 A;  3AEF A;  4J56 A;  3LB8 A;  1B8S A;  4UDQ A;  2WP6 A;  2BXR A;  3L8K A;  2XVI A;  5FS8 A;  5HY5 A;  3UTG A;  3IHM A;  2YM1 A;  3JSK A;  2NVK X;  3F8D A;  4A9W A;  4NEV A;  3DGH A;  1PXB A;  4A5L A;  4Z2U A;  1CC6 A;  1KNR A;  2YG4 A;  2ARD A;  2YG6 A;  1CJ4 A;  2YLR A;  4Y4L A;  4YSX A;  1PJ5 A;  4K22 A;  1E6E A;  2IID A;  5KMR A;  5KMS A;  3SXI A;  4K7Z A;  3T0K A;  1D4E A;  3CN8 A;  1L0V A;  4EIP A;  3T37 A;  4EMJ A;  3S61 A;  4U8K A;  3P4P A;  4H4Y A;  3VQR A;  1GND A;  3IWA A;  4DNA A;  4X4J A;  1E7P A;  4USR A;  3QSM A;  4TLZ A;  3ICR A;  3QFA A;  4H4S A;  1DOD A;  1GRT A;  2XFN A;  3PVC A;  4I59 A;  2FJA A;  1LQU A;  3AD9 B;  3WE0 A;  1QJD A;  2WDQ A;  3IHG A;  3CPH G;  4REK A;  3NLC A;  1GXF A;  1KDG A;  4J36 A;  2HQM A;  3FPZ A;  5M10 A;  4A7A A;  3CNJ A;  1VG0 A;  4YT0 A;  3K30 A;  4AOX A;  2BK5 A;  1GPE A;  3AD7 B;  1LVL A;  1O5W A;  2XVH A;  3DK9 A;  4H4X A;  1D7Y A;  4LII A;  4YSY A;  2RGH A;  3BI4 A;  2YM2 A;  4Z2T A;  1TDO A;  2GV8 A;  2A89 A;  1DOC A;  4JN9 A;  4B65 A;  2VZ2 A;  1GER A;  1PXC A;  1YQ4 A;  2WOV A;  3AEG A;  4II3 A;  3UOY A;  2GRT A;  4EIQ A;  2ACZ A;  3DJE A;  4ICY A;  2R0P A;  2Q7V A;  4NTC A;  1O94 A;  4ZCC A;  4MJW A;  3ICT A;  4B1B A;  4U8L A;  2O9Z A;  1QLB A;  4KX6 A;  3ICS A;  4HB9 A;  3AYL A;  1S3E A;  2CUL A;  3NH3 X;  4U8O A;  4H7U A;  3AEE A;  1NG3 A;  2XCG A;  1M6I A;  4Z26 A;  2RGJ A;  1H84 A;  2VRL A;  4NZH A;  1JNZ A;  4NWZ A;  4BK3 A;  3NYC A;  3PS9 A;  4Z2R A;  1OJA A;  2AR8 A;  1IUU A;  1MXT A;  4OCG A;  2GQF A;  2JB3 A;  3BNM A;  4H4V A;  1PBF A;  4FDC B;  3K7Q X;  2Q0L A;  4TM0 A;  5IQ4 A;  3V3N A;  1REO A;  2GMJ A;  2H89 A;  2GF3 A;  3B3R A;  2CFY A;  2JKC A;  1W4X A;  2R4E A;  2CVJ A;  2YG3 A;  4CY6 A;  3CIR A;  2FJD A;  4OPG A;  3SFD A;  5J7X A;  1IUV A;  1TYP A;  2WOW A;  3EAO A;  3R9U A;  2VVM A;  3UKH A;  2ZZ0 A;  2FBW A;  1NHQ A;  4GF7 A;  3HZL A;  4K8D A;  1D5T A;  2C67 A;  4EM3 A;  3G5Q A;  1TYT A;  3OC4 A;  1B37 A;  4B64 A;  1PBC A;  3SYI A;  1L9C A;  3KD9 A;  1FEA A;  3CGE A;  3Q6J A;  1NDA A;  5BRT A;  4AT0 A;  4B68 A;  4PAA A;  2WU2 A;  2XLT A;  4U8J A;  1F6M A;  2F5Z A;  1JNR A;  3NYF A;  3D1C A;  2A8X A;  5FS7 A;  5JCM A;  3C4N A;  3EPT A;  4B66 A;  4BJZ A;  3G5R A;  3NN6 X;  1NPX A;  1JRZ A;  3AE6 A;  3CTY A;  4WX1 A;  3UKK A;  2IVE A;  2OA1 A;  4U8N A;  4X9M A;  2YLS A;  2VOU A;  1K0L A;  2WOI A;  3GRT A;  1CC2 A;  3AE9 A;  1YY5 A;  3AE3 A;  3K7T A;  3T14 A;  2A87 A;  4APN A;  2C4C A;  1QO8 A;  3AED A;  4B69 A;  4H4P A;  3K7M X;  1JEH A;  2WPF A;  1MO9 A;  1JRY A;  1H86 A;  1DNC A;  2EQ7 A;  1ZOV A;  2OLO A;  2WP5 A;  3D8X A;  5KMP A;  3FBS A;  1FL2 A;  3AE7 A;  4I58 A;  2BK4 A;  4Z43 A;  2C66 A;  1CJC A;  2X8G A;  4AT2 A;  2BK3 A;  2RAB A;  1S2Q A;  4G73 A;  3AEB A;  5BVA A;  2YLX A;  4G74 A;  4C3X A;  5JCI A;  4TM3 A;  3QJ4 A;  1NHR A;  1E1K A;  3AEC A;  5FMH A;  4CCQ A;  2V3B A;  1EL9 A;  2EQ6 A;  2Y6R A;  4H2P A;  5GRT A;  3UCL A;  1P2E A;  2EQ8 A;  4AP1 A;  4C5O A;  3CGB A;  4J31 A;  4U2S A;  1TDN A;  4YWO A;  3UKF A;  3P4Q A;  1XDI A;  3CNT A;  1MOK A;  4H2R A;  2GR2 A;  3GYX A;  2C72 A;  1NEK A;  3OZ2 A;  4OPL A;  1VQW A;  4E0V A;  2XLU A;  1AOG A;  2YR6 A;  3BHK A;  4RG4 A;  4IVO B;  1ZK7 A;  4X9N A;  3VRD B;  3AE4 A;  2FJE A;  3UOX A;  4GDP A;  1PS9 A;  3CMM A;  3UOV A;  5GSN A;  2WP9 A;  3KA7 A;  1PXA A;  1PN0 A;  4DGK A;  4DSH A;  1PBD A;  1CL0 A;  2B9X A;  2OAL A;  3NHO X;  4J2W A;  1H6V A;  1IUT A;  2QA2 A;  3AE1 A;  5CQF A;  2BAC A;  2YAU A;  3V3O A;  1DXL A;  4A79 A;  1OJ9 A;  1TDK A;  3P4S A;  4IV9 A;  4K5R A;  3QSS A;  2DKH A;  1YQ3 A;  5JCL A;  4IA6 A;  3AXB A;  1GT8 A;  3AD8 B;  3LZW A;  4KPR A;  4XWR A;  5JCK A;  1H83 A;  2GB0 A;  5HYM A;  2B76 A;  2GQW A;  2V61 A;  1DOB A;  2V6O A;  1BZL A;  4UDR A;  3KVE A;  3DK8 A;  4U8P A;  4D04 A;  2XVJ A;  1EL5 A;  1H81 A;  2C7G A;  2BXS A;  3H4K A;  4BK1 A;  4H4Z A;  1P2H A;  3AEA A;  4JQ9 A;  3G5S A;  3GSI A;  3RED A;  3F8P A;  4C3Y A;  2V3A A;  4LA1 A;  4K5S A;  4TM4 A;  3RP8 A;  3NT6 A;  4N9X A;  2BCP A;  3LAD A;  3SGL A;  1OJC A;  3GMC A;  2GEW A;  2GR1 A;  2GVC A;  3RHA A;  1ZP0 A;  2OAM A;  4XXG A;  1K0I A;  1UKV G;  1NAA A;  1IJH A;  1LTX R;  1ZY8 A;  1NHS A;  2V5Z A;  1EBD A;  2BAB A;  3COX A;  2C70 A;  5IPY A;  1D4C A;  4Z25 A;  5L46 A;  1GEU A;  3QFB A;  3GYI A;  3EF6 A;  3CNP A;  1RP0 A;  3SFE A;  2BYB A;  1YKJ A;  2VVL G;  3GWF A;  2IVD A;  3Q9T A;  1CHU A;  4EQS A;  2BCG G;  3CPI G;  2UZZ A;  3V76 A;  3HYW A;  2GAH B;  4D03 A;  3DJG X;  2R0G A;  4GRT A;  2XVF A;  1DJN A;  4YTP A;  3M0O A;  4UDP A;  3O0H A;  1B5Q A;  2I0Z A;  2R4J A;  3C96 A;  1FOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...