2BXRA

Human monoamine oxidase a in complex with clorgyline, crystal form a
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
453
structure length
445
Chain Sequence
HMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYVGPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGWNPIAYLDYNNLWRTIDNMGKEIPTDAPWEAQHADKWDKMTMKELIDKICWTKTARRFAYLFVNINVTSEPHEVSALWFLWYVKQCGGTTRIFSVGQERKFVGGSGQVSERIMDLLGDQVKLNHPVTHVDQSSDNIIIETLNHEHYECKYVINAIPPTLTAKIHFRPELPAERNQLIQRLPMGAVIKCMMYYKEAFWKKKDYCGCMIIEDEDAPISITLDDTKPDGSLPAIMGFILARKADRLAKLHKEIRKKKICELYAKVLGSQEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRVIRQPVGRIFFAGTETATKWSGYMEGAVEAGERAAREVLNGLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords AMINE OXIDASE [FLAVIN-CONTAINING] A
publication title Three-Dimensional Structure of Human Monoamine Oxidase a (Mao A): Relation to the Structures of Rat Mao a and Human Mao B
pubmed doi rcsb
source organism Homo sapiens
total genus 155
structure length 445
sequence length 453
chains with identical sequence B
ec nomenclature ec 1.4.3.4: Monoamine oxidase.
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 2bxrA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2bxrA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 2bxrA02
2R4EA 3UKAA 3FIMB 4C5OA 1VG9A 2WP6A 2BK3A 1PJ5A 1GOSA 3H4KA 1TDEA 1O5WA 4GRTA 5KVHA 2A8XA 1GETA 4Z25A 2ZBWA 1E6EA 2XLSA 2YLRA 2RGOA 3S61A 3II4A 2E1MA 4C3YA 3UCLA 4A9WA 1DOEA 3D8XA 2EQ7A 1EL5A 1S3BA 2ACZA 3KKJA 3VR8A 1XHCA 4EQWA 1PS9A 1Y56B 1K0JA 2C70A 3M13A 2UZZA 5ER0A 3EPTA 3GMCA 1CJ4A 3KPFA 2YLXA 2YM1A 2QCUA 3CPHG 1H86A 2VZ2A 5C2TA 1VDCA 2X99A 3UP4A 1GTEA 4PAAA 3AEBA 2Q0LA 2XFUA 3AEGA 4U2TA 1QO8A 3UKHA 1UKVG 2WOIA 3Q9TA 5M0ZA 3K7QX 5L46A 2C65A 4TLXA 1N4VA 4H7UA 4LIIA 2FJDA 1IJHA 4O5UA 3AEAA 4H4RA 2WBAA 3V76A 3G5QA 3CTYA 2B7SA 1F8SA 2H88A 4J33A 2BABA 1YY5A 1GESA 1GRAA 1NEKA 2Q6UA 3ABVA 4GUVA 4Z43A 4BV6A 3Q6JA 2QA2A 2WU5A 4OPUA 1BGNA 1TDNA 3P1WA 1DODA 1BF3A 1FEBA 1LV0A 5JCLA 1BWCA 2VVLG 4U8MA 2XFQA 4J36A 3AEFA 4A6NA 1DOCA 4K22A 4TM4A 4YKGA 3AEEA 5IQ4A 3NT6A 5KOWA 1IUSA 1KF6A 1D4DA 1B4VA 2OA1A 1ZX9A 2QAEA 3LXDA 4A65A 2GMHA 1RYIA 4H4VA 3SQPA 1E1KA 3CNDA 4U8PA 1JOAA 3DGZA 2XVFA 4NEVA 1L0VA 2WDVA 4H2PA 2JB2A 2OAMA 2VRMA 1EL7A 3LB8A 4AP1A 1XDIA 4KPRA 2B9XA 4C3XA 2R0PA 1KSUA 1QJDA 4PABA 1TDKA 2B7RA 5U25A 5KOXA 1YQ4A 2IVEA 4CY8A 4A79A 4Y4NA 2IVDA 1NHSA 1P2EA 2C3DA 3NN6X 3ALJA 5FS6A 4RSLA 1D4CA 4N9XA 1ONFA 4OPDA 4ADWA 3NGCX 3LOVA 3QFBA 2YLWA 4A99A 3DGHA 4CCRA 1GTHA 2JAEA 2VQBA 1QLBA 2C3CA 5U1OA 4X9NA 4A5LA 4ZCDA 3K30A 2IIDA 3QSMA 1M64A 2GAGB 2VOUA 2WHDA 3ATQA 3UKKA 1D4EA 1IUVA 1GEUA 3HZLA 4IV9A 4YSHA 1Q1WA 4EMWA 3NK1X 4AT2A 4TLZA 1H82A 4YTNA 1COYA 4B65A 5HY5A 1REOA 2VRLA 1LVLA 4AOSA 2EQ6A 5BRTA 2PHHA 2AQJA 2YQUA 1B5QA 4H2QA 4TM3A 3VR9A 2YM2A 2GH5A 3GDPA 4EIPA 3V3OA 1CC2A 4DSGA 4MJWA 4CRTA 1BZLA 4ECHA 1KDGA 2WP9A 3QSSA 4H4QA 3VRBA 4BURA 3IHGA 3AECA 3RP6A 4A7AA 3CGCA 3LZWA 2OLNA 4JQ9A 4UDQA 5EB5A 1Y0PA 2QA1A 2YLSA 4YT0A 5BVAA 1OJ9A 3BNMA 1PDHA 2CDUA 1CJ3A 4ICYA 1E1LA 3GWFA 1Z6LA 1IUUA 4YSYA 5M10A 1FECA 1GRFA 4B68A 3I6DA 2YG6A 2GR1A 1JRXA 2V6OA 2YG7A 2OALA 3M0OA 3O0HA 2WU2A 1DNCA 3KU9A 4JDRA 4U8IA 3VRDB 3UOVA 1S2YA 5EOWA 2X3NA 1ZY8A 1NENA 5TR3A 1ZDLA 3EANA 3QSEA 3AD9B 3ISHA 3KD9A 1BKWA 1KNRA 1GERA 4Z2RA 2R0CA 2APGA 2OLOA 4H4UA 4OCGA 3UKQA 1PXAA 1NG4A 2Q0KA 3C4AA 1E39A 2FJEA 3H8LA 3NK0X 1GSNA 2YWLA 4WCTA 2XFOA 2JK6A 3UTEA 1MOKA 4REKA 1N4WA 3IC9A 4OPLA 2ARDA 2GMJA 3FG2P 4EQSA 2BS4A 4NTCA 1GXFA 5GRTA 2V5ZA 5HHFA 4H4ZA 2HQMA 3CNJA 1GRHA 1K4QA 2AR8A 2NVKX 4JN9A 2ZZCA 1K0LA 1IUWA 3DMEA 3GMBA 3NH3X 4P9SA 1TRBA 3AE2A 1ZK7A 1FEAA 3GYIA 4LA1A 3K7MX 4YKFA 1N4UA 3AYIA 4JNQA 2DKIA 3AD8B 4H2NA 4TM1A 4Y4MA 2BXSA 2C72A 2XVEA 3KLJA 1EL8A 3AE8A 4TM0A 1AOGA 3BI2A 2TPRA 1CL0A 2CULA 3AE9A 1SEZA 4USQA 2GF3A 3KA7A 4Z44A 1XANA 2BYBA 4IA6A 4CCQA 4HB9A 4AOXA 3QVPA 5EBKA 4B69A 1PJ6A 3AE5A 3LJPA 4H4XA 1KSSA 1GRTA 1YQZA 4H50A 5U63A 1RP0A 4B1BA 3NTDA 5GSNA 4YWOA 4U2LA 3PO7A 3LZXA 2XVIA 4XWRA 4BK1A 5BUKA 1ZKQA 4Z24A 3F8PA 2H89A 4DSHA 3GRTA 3DJEA 5LV9A 1DXLA 1GT8A 1TDFA 3DJDA 2C7GA 2WQYA 1LPFA 3DA1A 3QFAA 1S3EA 3G5SA 2XVJA 3NTAA 4OVIA 1ZMDA 2XYOA 4BJYA 4H4TA 3AD7B 2WDQA 4CBQA 1F8RA 2X8CA 1DJQA 1H84A 2E5VA 1E1MA 3ZYXA 1EL9A 3NYEA 1L9EA 4J31A 4NTEA 3UKPA 4ZCCA 3SM8A 2WPFA 3P4RA 3FBSA 2BS3A 3IF9A 3CNPA 3V3NA 1JNZA 3S5WA 2X50A 1NDAA 2BACA 2CVJA 5KVIA 2GEWA 1NAAA 2XCGA 1VG0A 4Z2UA 1CJCA 1ZOYA 1YKJA 5KRQA 1TYPA 4B64A 1MXTA 3AE6A 3OZ2A 1DOBA 4JNAA 3R9UA 3UOYA 3BI4A 3PVCA 4UDPA 5J7XA 2VVMA 4GDPA 2XFPA 2YR6A 1KFYA 1RSGA 4H4PA 2WETA 1E1NA 4U8KA 2C66A 1NHRA 4UDRA 4A6NB 4Z26A 5JCMA 2C73A 2WDRA 3SGLA 1KNPA 2X8GA 2RABA 3AE1A 2Y6RA 4JY3A 3AB1A 2CFYA 1TDOA 2BCGG 1FL2A 4YXDA 3SFDA 3UTFA 2B76A 3I3LA 3CNSA 3AWIA 1ZP0A 2XLRA 4EMIA 1JU2A 1O94A 4EMJA 2GQFA 4CNKA 2WPEA 3ALLA 3UOXA 2YR4A 3AYLA 2C76A 3B6DA 2BK4A 1VRQB 2W0HA 1FCDA 5FS9A 4FDCB 2VVLA 2XLTA 3BHFA 4ZN0A 5KWFA 2YG3A 1D7LA 2WOVA 3REDA 2PYXA 3VQRA 3GD3A 3L1RA 3NN0X 1PJ7A 1GREA 1L9DA 3BNUA 3CGEA 5KXJA 4OPIA 3URHA 2Y6QA 1PBFA 3GD4A 3IWAA 2JB1A 2V60A 1GNDA 1NPXA 1Q1RA 2YVJA 3LADA 5HYMA 5JCNA 3CGDA 1PXCA 4APNA 3GRSA 4EIQA 3P4PA 3P4SA 1ELIA 3NLCA 3DH9A 2Q7VA 3WE0A 3ICTA 4EM3A 3UKLA 3BI5A 4C74A 4BK3A 2JKCA 2BC0A 2YLZA 4YTPA 1P2HA 1YQ3A 3F8RA 2FJBA 3NIXA 3PS9A 3UTHA 4CY6A 3FPZA 4IVOB 4K8DA 1D5TA 3H8IA 4USRA 1CJ2A 1IUXA 3ADAB 1NHPA 3DJGX 3NYFA 2R46A 2WEUA 1F8WA 3AYJA 4H4WA 3DK8A 3NG7X 1BGJA 4U8LA 2YAUA 2GR3A 4JY2A 1O95A 5FMHA 1CC4A 4J34A 2WESA 2YR5A 2BXRA 4B67A 2YG5A 3K7TA 2WS3A 3P4QA 4K5SA 1GPEA 2WOWA 2C75A 4IVMB 3VRAA 1Q9IA 4BJZA 3AXBA 4I59A 2GRTA 3GDNA 2FJAA 4YTMA 3RP8A 2GVCA 1PXBA 3AEDA 3CIRA 3CPJG 3C96A 2XDOA 4K2XA 1VQWA 2A87A 1H7XA 3QJ4A 2BS2A 5J60A 5FS8A 2I0ZA 2XLUA 4U8JA 1JEHA 3EF6A 1H83A 3CGBA 2YG4A 5JCIA 1V59A 1PHHA 4D03A 4D04A 4OPCA 2JB3A 3JSKA 3OC4A 2B9YA 4K7ZA 4U2SA 1F6MA 1JRYA 2J3NA 2O9ZA 2C64A 2A89A 3SFEA 2GB0A 1H7WA 3DK9A 3FMWA 3G5RA 4OPTA 2BK5A 1GRGA 1PBBA 2AAQA 2TMDA 4FX9A 4X4JA 4CNJA 1PBEA 4FK1C 4C77A 2RGJA 1EBDA 3B3RA 1GALA 1CC6A 2Z5YA 2EQ8A 3M12A 3UTGA 4GF7A 3ALMA 2BC1A 3DK4A 1OJCA 3COXA 4XXGA 2DKHA 1JRZA 1OJDA 3CPIG 5IPYA 5HXIA 4H2RA 1H81A 1K0IA 3KVEA 1PBDA 3ATRA 3CN8A 5CKUA 4U8OA 2BCPA 2YVFA 2YVGA 4YSZA 3CNTA 3ZDNA 1L9CA 3P9UA 4EQXA 2WPCA 4K5RA 5DBJA 3T37A 1LQUA 5FS7A 2GAHB 4EM4A 2GR2A 2C67A 2GQWA 4M52A 1PN0A 2YLTA 4X9MA 3UKFA 2BA9A 5C3JA 1CF3A 4XWZA 2V61A 1E7PA 1JNRA 1ZOVA 3DJJA 3NNEA 4UP3A 1LTXR 1IUTA 1GV4A 3NYCA 2X8HA 4OPGA 2ZZBA 4WX1A 3AE4A 1B37A 1XPQA 4AT0A 4J57A 1PBCA 3NRNA 1LJ1A 4RG3A 5IQ1A 2EQ9A 5CQFA 2V3BA 2Z5XA 2F5ZA 4LU6A 4NZHA 3NKSA 2JBVA 3RP7A 4Y4LA 3RNMA 3UOZA 4I58A 3ICSA 3NK2X 4GDEA 5BULA 4HA6A 4IA5A 1X31B 1ZMCA 1Y56A 1OJTA 2VQ7A 3GSIA 1HYUA 4DGKA 2B9WA 4E0VA 3GWDA 1LQTA 4AP3A 1NG3A 2E4GA 2FBWA 1W4XA 2WP5A 1TYTA 3QVRA 1S2QA 4RG4A 3D1CA 3AE7A 4NEWA 4DNAA 1F3PA 1CBOA 4NTDA 4O5QA 4EQRA 2NPXA 2R4JA 1OJAA 1M6IA 4GR1A 4FK1A 3IHMA 3C4NA 1NHQA 3NHOX 5EB4A 3GYJA 1D7YA 1DJNA 2XVHA 2XFNA 2R9ZA 1GRBA 2GV8A 3ITJA 1B8SA 4J2WA 5JCKA 3UP5A 1CHUA 3AE3A 1MO9A 4B63A 4BK2A 3EAOA 4GCMA 4J56A 3RHAA 2GR0A 3BHKA 4H4SA 3ICRA 2R0GA 2ZZ0A 4Z2TA 3L8KA 2V3AA 1H6VA 1N1PA 3F8DA 4KX6A 4U8NA 4YSXA 4H4YA 1FOHA 4B66A 2RGHA 2XLPA 3E1TA 2R45A
chains in the Genus database with same CATH superfamily
2R4EA 3UKAA 3FIMB 4C5OA 1VG9A 2WP6A 2BK3A 1PJ5A 1GOSA 3H4KA 1TDEA 1O5WA 4GRTA 5KVHA 2A8XA 1GETA 4Z25A 2ZBWA 1E6EA 2XLSA 2YLRA 2RGOA 3S61A 3II4A 2E1MA 4C3YA 3UCLA 4A9WA 1DOEA 3D8XA 2EQ7A 1EL5A 1S3BA 2ACZA 3KKJA 3VR8A 1XHCA 4EQWA 1PS9A 1Y56B 1K0JA 2C70A 3M13A 2UZZA 5ER0A 3EPTA 3GMCA 1CJ4A 3KPFA 2YLXA 2YM1A 2QCUA 3CPHG 1H86A 2VZ2A 5C2TA 1VDCA 2X99A 3UP4A 1GTEA 4PAAA 3AEBA 2Q0LA 2XFUA 3AEGA 4U2TA 1QO8A 3UKHA 1UKVG 2WOIA 3Q9TA 5M0ZA 5KMPA 3K7QX 5L46A 2C65A 4TLXA 1N4VA 4H7UA 4LIIA 2FJDA 3SZCA 1IJHA 4O5UA 3AEAA 2BRAA 2WBAA 4H4RA 3V76A 3G5QA 3CTYA 2B7SA 1F8SA 2H88A 4J33A 2BABA 1YY5A 1GESA 1GRAA 1NEKA 2Q6UA 3ABVA 4GUVA 4Z43A 3SX6A 4BV6A 3Q6JA 2QA2A 2WU5A 4OPUA 5KMRA 4II2A 1BGNA 1TDNA 3P1WA 1DODA 1BF3A 1FEBA 1LV0A 5JCLA 1BWCA 2VVLG 4U8MA 2XFQA 4J36A 3AEFA 4A6NA 1DOCA 4K22A 4TM4A 4YKGA 3AEEA 5KMSA 4G74A 5IQ4A 3NT6A 5KOWA 1IUSA 1KF6A 1D4DA 1B4VA 2OA1A 1ZX9A 2QAEA 3LXDA 4A65A 2GMHA 1RYIA 4H4VA 3SQPA 1E1KA 3CNDA 4U8PA 1JOAA 3DGZA 2XVFA 4NEVA 1L0VA 2WDVA 4H2PA 2JB2A 2OAMA 2VRMA 1EL7A 3LB8A 4AP1A 1XDIA 4KPRA 2B9XA 4C3XA 2R0PA 1KSUA 1QJDA 4PABA 1TDKA 2B7RA 5U25A 5KOXA 1YQ4A 2IVEA 4CY8A 4A79A 4Y4NA 2IVDA 1NHSA 1P2EA 2C3DA 3NN6X 3ALJA 5FS6A 4RSLA 1D4CA 4N9XA 1ONFA 4OPDA 4ADWA 3NGCX 3HYVA 3LOVA 3QFBA 2YLWA 4A99A 3DGHA 4CCRA 1GTHA 2JAEA 2VQBA 1QLBA 2C3CA 5U1OA 4X9NA 4A5LA 4ZCDA 3K30A 2IIDA 3QSMA 1M64A 2GAGB 2VOUA 2WHDA 3ATQA 3UKKA 1D4EA 1IUVA 1GEUA 3HZLA 4IV9A 4YSHA 1Q1WA 4EMWA 3NK1X 4AT2A 4TLZA 1H82A 4YTNA 1COYA 4B65A 5HY5A 1REOA 2VRLA 1LVLA 4AOSA 2EQ6A 5BRTA 2PHHA 2AQJA 2YQUA 1B5QA 4H2QA 4TM3A 3VR9A 2YM2A 2GH5A 3GDPA 4EIPA 3V3OA 1CC2A 4DSGA 4MJWA 4CRTA 1BZLA 4ECHA 1KDGA 2WP9A 3QSSA 4H4QA 3VRBA 4BURA 3IHGA 3AECA 3RP6A 4A7AA 3CGCA 3LZWA 2OLNA 4JQ9A 4UDQA 5EB5A 3HYWA 3T2ZA 1Y0PA 2QA1A 2YLSA 4YT0A 5BVAA 1OJ9A 3BNMA 1PDHA 2CDUA 1CJ3A 4ICYA 1E1LA 3GWFA 1Z6LA 1IUUA 4YSYA 5M10A 1FECA 1GRFA 4B68A 3I6DA 2YG6A 2GR1A 1JRXA 2V6OA 4GAPA 2YG7A 2OALA 3M0OA 3O0HA 2WU2A 1DNCA 3KU9A 4JDRA 4U8IA 3VRDB 3UOVA 1S2YA 5EOWA 2X3NA 1ZY8A 1NENA 5TR3A 1ZDLA 3EANA 3QSEA 3AD9B 3ISHA 3KD9A 1BKWA 1KNRA 1GERA 4Z2RA 2R0CA 2APGA 2OLOA 4H4UA 3CMMA 4OCGA 3UKQA 1PXAA 1NG4A 2Q0KA 3C4AA 1E39A 2FJEA 3H8LA 3NK0X 1GSNA 2YWLA 4WCTA 2XFOA 2JK6A 3UTEA 1MOKA 4REKA 1N4WA 3IC9A 4OPLA 2ARDA 2GMJA 3FG2P 4EQSA 4NNJA 2BS4A 4NTCA 1GXFA 5GRTA 2V5ZA 5HHFA 4H4ZA 2HQMA 3CNJA 1GRHA 1K4QA 2AR8A 2NVKX 4JN9A 2ZZCA 1K0LA 1IUWA 3DMEA 3GMBA 3NH3X 4P9SA 1TRBA 3AE2A 1ZK7A 1FEAA 3GYIA 4LA1A 3K7MX 4YKFA 1N4UA 3AYIA 4JNQA 2DKIA 3AD8B 4H2NA 4TM1A 4Y4MA 3T2KA 2BXSA 2C72A 2XVEA 3KLJA 1EL8A 3AE8A 4TM0A 1AOGA 3SXIA 3BI2A 2TPRA 1CL0A 2CULA 3AE9A 1SEZA 4USQA 2GF3A 3KA7A 4Z44A 1XANA 2BYBA 4IA6A 4CCQA 4HB9A 4G9KA 4AOXA 3QVPA 5EBKA 4B69A 1PJ6A 3AE5A 3LJPA 4H4XA 1KSSA 1GRTA 1YQZA 4GAVA 4H50A 5U63A 3KPKA 1RP0A 4B1BA 3NTDA 5GSNA 4YWOA 4U2LA 3PO7A 3LZXA 2XVIA 4XWRA 4BK1A 5BUKA 1ZKQA 4Z24A 3F8PA 2H89A 4DSHA 3GRTA 3DJEA 5LV9A 3T14A 1DXLA 1GT8A 1TDFA 3DJDA 2C7GA 2WQYA 1LPFA 3DA1A 3QFAA 1S3EA 3G5SA 2XVJA 3NTAA 4OVIA 1ZMDA 2XYOA 4BJYA 4H4TA 3AD7B 2WDQA 4CBQA 1F8RA 2X8CA 1DJQA 1H84A 2E5VA 1E1MA 3ZYXA 1EL9A 3NYEA 1L9EA 4J31A 4NTEA 3UKPA 4ZCCA 3SM8A 2WPFA 3P4RA 3FBSA 2BS3A 3IF9A 3CNPA 3V3NA 1JNZA 3S5WA 2X50A 1NDAA 2BACA 2CVJA 5KVIA 2GEWA 1NAAA 2XCGA 1VG0A 4Z2UA 1CJCA 1ZOYA 1YKJA 5KRQA 1TYPA 4B64A 1MXTA 3AE6A 3OZ2A 1DOBA 4JNAA 3R9UA 3UOYA 3BI4A 3PVCA 4UDPA 5J7XA 2VVMA 4GDPA 2XFPA 2YR6A 1KFYA 1RSGA 4H4PA 2WETA 1E1NA 4U8KA 2C66A 3SZFA 1NHRA 4UDRA 4A6NB 4Z26A 5JCMA 2C73A 2WDRA 3SGLA 1KNPA 2X8GA 2RABA 3AE1A 2Y6RA 3SYIA 4JY3A 3AB1A 2CFYA 1TDOA 2BCGG 1FL2A 4YXDA 3SFDA 3UTFA 2B76A 3I3LA 3CNSA 3AWIA 1ZP0A 2XLRA 4EMIA 1JU2A 1O94A 4EMJA 2GQFA 4CNKA 2WPEA 3ALLA 3UOXA 2YR4A 3AYLA 2C76A 3B6DA 2BK4A 1VRQB 2W0HA 4II3A 1FCDA 5FS9A 4FDCB 2VVLA 2XLTA 3BHFA 4ZN0A 5KWFA 2YG3A 1D7LA 2WOVA 3REDA 2PYXA 3VQRA 3GD3A 3L1RA 3NN0X 1PJ7A 1GREA 1L9DA 3BNUA 3CGEA 5KXJA 4OPIA 3URHA 2Y6QA 1PBFA 3GD4A 3IWAA 2JB1A 2V60A 1GNDA 1NPXA 1Q1RA 2YVJA 3LADA 5HYMA 5JCNA 3CGDA 1PXCA 4APNA 3GRSA 4EIQA 3P4PA 3P4SA 1ELIA 3NLCA 3DH9A 3WE0A 2Q7VA 3ICTA 4EM3A 3UKLA 3BI5A 4C74A 4BK3A 2JKCA 2BC0A 2YLZA 4YTPA 1P2HA 1YQ3A 3F8RA 2FJBA 3NIXA 3PS9A 3UTHA 4CY6A 3FPZA 4IVOB 4K8DA 1D5TA 3H8IA 4USRA 1CJ2A 1IUXA 3ADAB 1NHPA 3DJGX 3NYFA 2R46A 2WEUA 1F8WA 3AYJA 4G6GA 4H4WA 3T0KA 3DK8A 3NG7X 1BGJA 4U8LA 2YAUA 2GR3A 4JY2A 1O95A 5FMHA 1CC4A 4J34A 2WESA 2YR5A 2BXRA 4B67A 2YG5A 3K7TA 2WS3A 3P4QA 4K5SA 1GPEA 2WOWA 2C75A 4IVMB 3VRAA 1Q9IA 4BJZA 3AXBA 4I59A 2GRTA 3GDNA 2FJAA 3SZ0A 4YTMA 3RP8A 2GVCA 1PXBA 3AEDA 5KMQA 3CIRA 3CPJG 3C96A 2C4CA 2XDOA 4K2XA 1VQWA 2A87A 1H7XA 3QJ4A 2BS2A 5J60A 5FS8A 2I0ZA 2XLUA 4U8JA 1JEHA 3EF6A 1H83A 3CGBA 2YG4A 5JCIA 1V59A 1PHHA 4D03A 4D04A 4OPCA 2JB3A 3JSKA 3OC4A 2B9YA 4K7ZA 4U2SA 1F6MA 1JRYA 2J3NA 2O9ZA 4G73A 2C64A 2A89A 3SFEA 2GB0A 1H7WA 3DK9A 3FMWA 3G5RA 4OPTA 2BK5A 1GRGA 3T31A 1PBBA 2AAQA 2TMDA 4FX9A 4X4JA 4CNJA 1PBEA 4FK1C 3SY4A 4C77A 2RGJA 3SZWA 1EBDA 3B3RA 1GALA 1CC6A 2Z5YA 2EQ8A 3M12A 3UTGA 3HYXA 4GF7A 3ALMA 3T2YA 2BC1A 3DK4A 1OJCA 3COXA 4XXGA 2DKHA 1JRZA 1OJDA 3CPIG 4NWZA 5IPYA 5HXIA 4H2RA 1H81A 1K0IA 3KVEA 1PBDA 3ATRA 3CN8A 5CKUA 4U8OA 2BCPA 2YVFA 2YVGA 4YSZA 3CNTA 3ZDNA 1L9CA 3P9UA 4EQXA 2WPCA 4K5RA 5DBJA 3T37A 1LQUA 5FS7A 2GAHB 4EM4A 2GR2A 2C67A 2GQWA 4M52A 1PN0A 2YLTA 4X9MA 3UKFA 2BA9A 5C3JA 1CF3A 4XWZA 2V61A 1E7PA 1JNRA 1ZOVA 3DJJA 3NNEA 4UP3A 1LTXR 1IUTA 1GV4A 3NYCA 2X8HA 4OPGA 2ZZBA 4WX1A 3AE4A 1B37A 1XPQA 4AT0A 4J57A 1PBCA 3NRNA 1LJ1A 4RG3A 5IQ1A 2EQ9A 5CQFA 2V3BA 2Z5XA 2F5ZA 4LU6A 4NZHA 3NKSA 2JBVA 5KNLA 3RP7A 4Y4LA 3RNMA 3UOZA 4I58A 3ICSA 3NK2X 4GDEA 5BULA 4HA6A 4IA5A 1X31B 1ZMCA 1Y56A 1OJTA 2VQ7A 3GSIA 1HYUA 4DGKA 2B9WA 4E0VA 3GWDA 1LQTA 4AP3A 1NG3A 2E4GA 2FBWA 1W4XA 2WP5A 1TYTA 3QVRA 1S2QA 2BRYA 4RG4A 3D1CA 3AE7A 4NEWA 4DNAA 1F3PA 1CBOA 4NTDA 4O5QA 4EQRA 2NPXA 2R4JA 1OJAA 1M6IA 4GR1A 3GYXA 3IHMA 4FK1A 3C4NA 1NHQA 3NHOX 5EB4A 3GYJA 1D7YA 1DJNA 2XVHA 2XFNA 2R9ZA 1GRBA 2GV8A 3ITJA 1B8SA 4J2WA 5JCKA 3UP5A 1CHUA 3AE3A 1MO9A 4B63A 4BK2A 3EAOA 4GCMA 4J56A 3RHAA 2GR0A 3BHKA 4H4SA 3ICRA 2R0GA 2ZZ0A 4Z2TA 3L8KA 2V3AA 1H6VA 1N1PA 3F8DA 4KX6A 4G6HA 4U8NA 4YSXA 4H4YA 1FOHA 4B66A 2RGHA 2XLPA 3E1TA 2R45A
chains in the Genus database with same CATH topology
2R4EA 3UKAA 3FIMB 4C5OA 1VG9A 2WP6A 2BK3A 1PJ5A 1GOSA 3H4KA 1TDEA 1O5WA 4GRTA 5KVHA 2A8XA 1GETA 4Z25A 2ZBWA 1E6EA 2XLSA 2YLRA 2RGOA 3S61A 3II4A 2E1MA 4C3YA 3UCLA 4A9WA 1DOEA 3D8XA 2EQ7A 1EL5A 1S3BA 2ACZA 3KKJA 3VR8A 1XHCA 4EQWA 1PS9A 1Y56B 1K0JA 2C70A 3M13A 2UZZA 5ER0A 3EPTA 3GMCA 1CJ4A 3KPFA 2YLXA 2YM1A 2QCUA 3CPHG 1H86A 2VZ2A 5C2TA 1VDCA 2X99A 3UP4A 1GTEA 4PAAA 3AEBA 2Q0LA 2XFUA 3AEGA 4U2TA 1QO8A 3UKHA 1UKVG 2WOIA 3Q9TA 5M0ZA 5KMPA 3K7QX 5L46A 2C65A 4TLXA 1N4VA 4H7UA 4LIIA 2FJDA 3SZCA 1IJHA 4O5UA 3AEAA 2BRAA 2WBAA 4H4RA 3V76A 3G5QA 3CTYA 2B7SA 1F8SA 2H88A 4J33A 2BABA 1YY5A 1GESA 1GRAA 1NEKA 2Q6UA 3ABVA 4GUVA 4Z43A 3SX6A 4BV6A 3Q6JA 2QA2A 2WU5A 4OPUA 5KMRA 4II2A 1BGNA 1TDNA 3P1WA 1DODA 1BF3A 1FEBA 1LV0A 5JCLA 1BWCA 2VVLG 4U8MA 2XFQA 4J36A 3AEFA 4A6NA 1DOCA 4K22A 4TM4A 4YKGA 3AEEA 5KMSA 4G74A 5IQ4A 3NT6A 5KOWA 1IUSA 1KF6A 1D4DA 1B4VA 2OA1A 1ZX9A 2QAEA 3LXDA 4A65A 2GMHA 1RYIA 4H4VA 3SQPA 1E1KA 3CNDA 4U8PA 1JOAA 3DGZA 2XVFA 4NEVA 1L0VA 2WDVA 4H2PA 2JB2A 2OAMA 2VRMA 1EL7A 3LB8A 4AP1A 1XDIA 4KPRA 2B9XA 4C3XA 2R0PA 1KSUA 1QJDA 4PABA 1TDKA 2B7RA 5U25A 5KOXA 1YQ4A 2IVEA 4CY8A 4A79A 4Y4NA 2IVDA 1NHSA 1P2EA 2C3DA 3NN6X 3ALJA 5FS6A 4RSLA 1D4CA 4N9XA 1ONFA 4OPDA 4ADWA 3NGCX 3HYVA 3LOVA 3QFBA 2YLWA 4A99A 3DGHA 4CCRA 1GTHA 2JAEA 2VQBA 1QLBA 2C3CA 5U1OA 4X9NA 4A5LA 4ZCDA 3K30A 2IIDA 3QSMA 1M64A 2GAGB 2VOUA 2WHDA 3ATQA 3UKKA 1D4EA 1IUVA 1GEUA 3HZLA 4IV9A 4YSHA 1Q1WA 4EMWA 3NK1X 4AT2A 4TLZA 1H82A 4YTNA 1COYA 4B65A 5HY5A 1REOA 2VRLA 1LVLA 4AOSA 2EQ6A 5BRTA 2PHHA 2AQJA 2YQUA 1B5QA 4H2QA 4TM3A 3VR9A 2YM2A 2GH5A 3GDPA 4EIPA 3V3OA 1CC2A 4DSGA 4MJWA 4CRTA 1BZLA 4ECHA 1KDGA 2WP9A 3QSSA 4H4QA 3VRBA 4BURA 3IHGA 3AECA 3RP6A 4A7AA 3CGCA 3LZWA 2OLNA 4JQ9A 4UDQA 5EB5A 3HYWA 3T2ZA 1Y0PA 2QA1A 2YLSA 4YT0A 5BVAA 1OJ9A 3BNMA 1PDHA 2CDUA 1CJ3A 4ICYA 1E1LA 3GWFA 1Z6LA 1IUUA 4YSYA 5M10A 1FECA 1GRFA 4B68A 3I6DA 2YG6A 2GR1A 1JRXA 2V6OA 4GAPA 2YG7A 2OALA 3M0OA 3O0HA 2WU2A 1DNCA 3KU9A 4JDRA 4U8IA 3VRDB 3UOVA 1S2YA 5EOWA 2X3NA 1ZY8A 1NENA 5TR3A 1ZDLA 3EANA 3QSEA 3AD9B 3ISHA 3KD9A 1BKWA 1KNRA 1GERA 4Z2RA 2R0CA 2APGA 2OLOA 4H4UA 3CMMA 4OCGA 3UKQA 1PXAA 1NG4A 2Q0KA 3C4AA 1E39A 2FJEA 3H8LA 3NK0X 1GSNA 2YWLA 4WCTA 2XFOA 2JK6A 3UTEA 1MOKA 4REKA 1N4WA 3IC9A 4OPLA 2ARDA 2GMJA 3FG2P 4EQSA 4NNJA 2BS4A 4NTCA 1GXFA 5GRTA 2V5ZA 5HHFA 4H4ZA 2HQMA 3CNJA 1GRHA 1K4QA 2AR8A 2NVKX 4JN9A 2ZZCA 1K0LA 1IUWA 3DMEA 3GMBA 3NH3X 4P9SA 1TRBA 3AE2A 1ZK7A 1FEAA 3GYIA 4LA1A 3K7MX 4YKFA 1N4UA 3AYIA 4JNQA 2DKIA 3AD8B 4H2NA 4TM1A 4Y4MA 3T2KA 2BXSA 2C72A 2XVEA 3KLJA 1EL8A 3AE8A 4TM0A 1AOGA 3SXIA 3BI2A 2TPRA 1CL0A 2CULA 3AE9A 1SEZA 4USQA 2GF3A 3KA7A 4Z44A 1XANA 2BYBA 4IA6A 4CCQA 4HB9A 4G9KA 4AOXA 3QVPA 5EBKA 4B69A 1PJ6A 3AE5A 3LJPA 4H4XA 1KSSA 1GRTA 1YQZA 4GAVA 4H50A 5U63A 3KPKA 1RP0A 4B1BA 3NTDA 5GSNA 4YWOA 4U2LA 3PO7A 3LZXA 2XVIA 4XWRA 4BK1A 5BUKA 1ZKQA 4Z24A 3F8PA 2H89A 4DSHA 3GRTA 3DJEA 5LV9A 3T14A 1DXLA 1GT8A 1TDFA 3DJDA 2C7GA 2WQYA 1LPFA 3DA1A 3QFAA 1S3EA 3G5SA 2XVJA 3NTAA 4OVIA 1ZMDA 2XYOA 4BJYA 4H4TA 3AD7B 2WDQA 4CBQA 1F8RA 2X8CA 1DJQA 1H84A 2E5VA 1E1MA 3ZYXA 1EL9A 3NYEA 1L9EA 4J31A 4NTEA 3UKPA 4ZCCA 3SM8A 2WPFA 3P4RA 3FBSA 2BS3A 3IF9A 3CNPA 3V3NA 1JNZA 3S5WA 2X50A 1NDAA 2BACA 2CVJA 5KVIA 2GEWA 1NAAA 2XCGA 1VG0A 4Z2UA 1CJCA 1ZOYA 1YKJA 5KRQA 1TYPA 4B64A 1MXTA 3AE6A 3OZ2A 1DOBA 4JNAA 3R9UA 3UOYA 3BI4A 3PVCA 4UDPA 5J7XA 2VVMA 4GDPA 2XFPA 2YR6A 1KFYA 1RSGA 4H4PA 2WETA 1E1NA 4U8KA 2C66A 3SZFA 1NHRA 4UDRA 4A6NB 4Z26A 5JCMA 2C73A 2WDRA 3SGLA 1KNPA 2X8GA 2RABA 3AE1A 2Y6RA 3SYIA 4JY3A 3AB1A 2CFYA 1TDOA 2BCGG 1FL2A 4YXDA 3SFDA 3UTFA 2B76A 3I3LA 3CNSA 3AWIA 1ZP0A 2XLRA 4EMIA 1JU2A 1O94A 4EMJA 2GQFA 4CNKA 2WPEA 3ALLA 3UOXA 2YR4A 3AYLA 2C76A 3B6DA 2BK4A 1VRQB 2W0HA 4II3A 1FCDA 5FS9A 4FDCB 2VVLA 2XLTA 3BHFA 4ZN0A 5KWFA 2YG3A 1D7LA 2WOVA 3REDA 2PYXA 3VQRA 3GD3A 3L1RA 3NN0X 1PJ7A 1GREA 1L9DA 3BNUA 3CGEA 5KXJA 4OPIA 3URHA 2Y6QA 1PBFA 3GD4A 3IWAA 2JB1A 2V60A 1GNDA 1NPXA 1Q1RA 2YVJA 3LADA 5HYMA 5JCNA 3CGDA 1PXCA 4APNA 3GRSA 4EIQA 3P4PA 3P4SA 1ELIA 3NLCA 3DH9A 2Q7VA 3WE0A 3ICTA 4EM3A 3UKLA 3BI5A 4C74A 4BK3A 2JKCA 2BC0A 2YLZA 4YTPA 1P2HA 1YQ3A 3F8RA 2FJBA 3NIXA 3PS9A 3UTHA 4CY6A 3FPZA 4IVOB 4K8DA 1D5TA 3H8IA 4USRA 1CJ2A 1IUXA 3ADAB 1NHPA 3DJGX 3NYFA 2R46A 2WEUA 1F8WA 3AYJA 4G6GA 4H4WA 3T0KA 3DK8A 3NG7X 1BGJA 4U8LA 2YAUA 2GR3A 4JY2A 1O95A 5FMHA 1CC4A 4J34A 2WESA 2YR5A 2BXRA 4B67A 2YG5A 3K7TA 2WS3A 3P4QA 4K5SA 1GPEA 2WOWA 2C75A 4IVMB 3VRAA 1Q9IA 4BJZA 3AXBA 4I59A 2GRTA 3GDNA 2FJAA 3SZ0A 4YTMA 3RP8A 2GVCA 1PXBA 3AEDA 5KMQA 3CIRA 3CPJG 3C96A 2C4CA 2XDOA 4K2XA 1VQWA 2A87A 1H7XA 3QJ4A 2BS2A 5J60A 5FS8A 2I0ZA 2XLUA 4U8JA 1JEHA 3EF6A 1H83A 3CGBA 2YG4A 5JCIA 1V59A 1PHHA 4D03A 4D04A 4OPCA 2JB3A 3JSKA 3OC4A 2B9YA 4K7ZA 4U2SA 1F6MA 1JRYA 2J3NA 2O9ZA 4G73A 2C64A 2A89A 3SFEA 2GB0A 1H7WA 3DK9A 3FMWA 3G5RA 4OPTA 2BK5A 1GRGA 3T31A 1PBBA 2AAQA 2TMDA 4FX9A 4X4JA 4CNJA 1PBEA 4FK1C 3SY4A 4C77A 2RGJA 3SZWA 1EBDA 3B3RA 1GALA 1CC6A 2Z5YA 2EQ8A 3M12A 3UTGA 3HYXA 4GF7A 3ALMA 3T2YA 2BC1A 3DK4A 1OJCA 3COXA 4XXGA 2DKHA 1JRZA 1OJDA 3CPIG 4NWZA 5IPYA 5HXIA 4H2RA 1H81A 1K0IA 3KVEA 1PBDA 3ATRA 3CN8A 5CKUA 4U8OA 2BCPA 2YVFA 2YVGA 4YSZA 3CNTA 3ZDNA 1L9CA 3P9UA 4EQXA 2WPCA 4K5RA 5DBJA 3T37A 1LQUA 5FS7A 2GAHB 4EM4A 2GR2A 2C67A 2GQWA 4M52A 1PN0A 2YLTA 4X9MA 3UKFA 2BA9A 5C3JA 1CF3A 4XWZA 2V61A 1E7PA 1JNRA 1ZOVA 3DJJA 3NNEA 4UP3A 1LTXR 1IUTA 1GV4A 3NYCA 2X8HA 4OPGA 2ZZBA 4WX1A 3AE4A 1B37A 1XPQA 4AT0A 4J57A 1PBCA 3NRNA 1LJ1A 4RG3A 5IQ1A 2EQ9A 5CQFA 2V3BA 2Z5XA 2F5ZA 4LU6A 4NZHA 3NKSA 2JBVA 5KNLA 3RP7A 4Y4LA 3RNMA 3UOZA 4I58A 3ICSA 3NK2X 4GDEA 5BULA 4HA6A 4IA5A 1X31B 1ZMCA 1Y56A 1OJTA 2VQ7A 3GSIA 1HYUA 4DGKA 2B9WA 4E0VA 3GWDA 1LQTA 4AP3A 1NG3A 2E4GA 2FBWA 1W4XA 2WP5A 1TYTA 3QVRA 1S2QA 2BRYA 4RG4A 3D1CA 3AE7A 4NEWA 4DNAA 1F3PA 1CBOA 4NTDA 4O5QA 4EQRA 2NPXA 2R4JA 1OJAA 1M6IA 4GR1A 3GYXA 3IHMA 4FK1A 3C4NA 1NHQA 3NHOX 5EB4A 3GYJA 1D7YA 1DJNA 2XVHA 2XFNA 2R9ZA 1GRBA 2GV8A 3ITJA 1B8SA 4J2WA 5JCKA 3UP5A 1CHUA 3AE3A 1MO9A 4B63A 4BK2A 3EAOA 4GCMA 4J56A 3RHAA 2GR0A 3BHKA 4H4SA 3ICRA 2R0GA 2ZZ0A 4Z2TA 3L8KA 2V3AA 1H6VA 1N1PA 3F8DA 4KX6A 4G6HA 4U8NA 4YSXA 4H4YA 1FOHA 4B66A 2RGHA 2XLPA 3E1TA 2R45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R4E A;  3UKA A;  3FIM B;  4C5O A;  1VG9 A;  2WP6 A;  2BK3 A;  1PJ5 A;  1GOS A;  3H4K A;  1TDE A;  1O5W A;  4GRT A;  5KVH A;  2A8X A;  1GET A;  4Z25 A;  2ZBW A;  1E6E A;  2XLS A;  2YLR A;  2RGO A;  3S61 A;  3II4 A;  2E1M A;  4C3Y A;  3UCL A;  4A9W A;  1DOE A;  3D8X A;  2EQ7 A;  1EL5 A;  1S3B A;  2ACZ A;  3KKJ A;  3VR8 A;  1XHC A;  4EQW A;  1PS9 A;  1Y56 B;  1K0J A;  2C70 A;  3M13 A;  2UZZ A;  5ER0 A;  3EPT A;  3GMC A;  1CJ4 A;  3KPF A;  2YLX A;  2YM1 A;  2QCU A;  3CPH G;  1H86 A;  2VZ2 A;  5C2T A;  1VDC A;  2X99 A;  3UP4 A;  1GTE A;  4PAA A;  3AEB A;  2Q0L A;  2XFU A;  3AEG A;  4U2T A;  1QO8 A;  3UKH A;  1UKV G;  2WOI A;  3Q9T A;  5M0Z A;  3K7Q X;  5L46 A;  2C65 A;  4TLX A;  1N4V A;  4H7U A;  4LII A;  2FJD A;  1IJH A;  4O5U A;  3AEA A;  4H4R A;  2WBA A;  3V76 A;  3G5Q A;  3CTY A;  2B7S A;  1F8S A;  2H88 A;  4J33 A;  2BAB A;  1YY5 A;  1GES A;  1GRA A;  1NEK A;  2Q6U A;  3ABV A;  4GUV A;  4Z43 A;  4BV6 A;  3Q6J A;  2QA2 A;  2WU5 A;  4OPU A;  1BGN A;  1TDN A;  3P1W A;  1DOD A;  1BF3 A;  1FEB A;  1LV0 A;  5JCL A;  1BWC A;  2VVL G;  4U8M A;  2XFQ A;  4J36 A;  3AEF A;  4A6N A;  1DOC A;  4K22 A;  4TM4 A;  4YKG A;  3AEE A;  5IQ4 A;  3NT6 A;  5KOW A;  1IUS A;  1KF6 A;  1D4D A;  1B4V A;  2OA1 A;  1ZX9 A;  2QAE A;  3LXD A;  4A65 A;  2GMH A;  1RYI A;  4H4V A;  3SQP A;  1E1K A;  3CND A;  4U8P A;  1JOA A;  3DGZ A;  2XVF A;  4NEV A;  1L0V A;  2WDV A;  4H2P A;  2JB2 A;  2OAM A;  2VRM A;  1EL7 A;  3LB8 A;  4AP1 A;  1XDI A;  4KPR A;  2B9X A;  4C3X A;  2R0P A;  1KSU A;  1QJD A;  4PAB A;  1TDK A;  2B7R A;  5U25 A;  5KOX A;  1YQ4 A;  2IVE A;  4CY8 A;  4A79 A;  4Y4N A;  2IVD A;  1NHS A;  1P2E A;  2C3D A;  3NN6 X;  3ALJ A;  5FS6 A;  4RSL A;  1D4C A;  4N9X A;  1ONF A;  4OPD A;  4ADW A;  3NGC X;  3LOV A;  3QFB A;  2YLW A;  4A99 A;  3DGH A;  4CCR A;  1GTH A;  2JAE A;  2VQB A;  1QLB A;  2C3C A;  5U1O A;  4X9N A;  4A5L A;  4ZCD A;  3K30 A;  2IID A;  3QSM A;  1M64 A;  2GAG B;  2VOU A;  2WHD A;  3ATQ A;  3UKK A;  1D4E A;  1IUV A;  1GEU A;  3HZL A;  4IV9 A;  4YSH A;  1Q1W A;  4EMW A;  3NK1 X;  4AT2 A;  4TLZ A;  1H82 A;  4YTN A;  1COY A;  4B65 A;  5HY5 A;  1REO A;  2VRL A;  1LVL A;  4AOS A;  2EQ6 A;  5BRT A;  2PHH A;  2AQJ A;  2YQU A;  1B5Q A;  4H2Q A;  4TM3 A;  3VR9 A;  2YM2 A;  2GH5 A;  3GDP A;  4EIP A;  3V3O A;  1CC2 A;  4DSG A;  4MJW A;  4CRT A;  1BZL A;  4ECH A;  1KDG A;  2WP9 A;  3QSS A;  4H4Q A;  3VRB A;  4BUR A;  3IHG A;  3AEC A;  3RP6 A;  4A7A A;  3CGC A;  3LZW A;  2OLN A;  4JQ9 A;  4UDQ A;  5EB5 A;  1Y0P A;  2QA1 A;  2YLS A;  4YT0 A;  5BVA A;  1OJ9 A;  3BNM A;  1PDH A;  2CDU A;  1CJ3 A;  4ICY A;  1E1L A;  3GWF A;  1Z6L A;  1IUU A;  4YSY A;  5M10 A;  1FEC A;  1GRF A;  4B68 A;  3I6D A;  2YG6 A;  2GR1 A;  1JRX A;  2V6O A;  2YG7 A;  2OAL A;  3M0O A;  3O0H A;  2WU2 A;  1DNC A;  3KU9 A;  4JDR A;  4U8I A;  3VRD B;  3UOV A;  1S2Y A;  5EOW A;  2X3N A;  1ZY8 A;  1NEN A;  5TR3 A;  1ZDL A;  3EAN A;  3QSE A;  3AD9 B;  3ISH A;  3KD9 A;  1BKW A;  1KNR A;  1GER A;  4Z2R A;  2R0C A;  2APG A;  2OLO A;  4H4U A;  4OCG A;  3UKQ A;  1PXA A;  1NG4 A;  2Q0K A;  3C4A A;  1E39 A;  2FJE A;  3H8L A;  3NK0 X;  1GSN A;  2YWL A;  4WCT A;  2XFO A;  2JK6 A;  3UTE A;  1MOK A;  4REK A;  1N4W A;  3IC9 A;  4OPL A;  2ARD A;  2GMJ A;  3FG2 P;  4EQS A;  2BS4 A;  4NTC A;  1GXF A;  5GRT A;  2V5Z A;  5HHF A;  4H4Z A;  2HQM A;  3CNJ A;  1GRH A;  1K4Q A;  2AR8 A;  2NVK X;  4JN9 A;  2ZZC A;  1K0L A;  1IUW A;  3DME A;  3GMB A;  3NH3 X;  4P9S A;  1TRB A;  3AE2 A;  1ZK7 A;  1FEA A;  3GYI A;  4LA1 A;  3K7M X;  4YKF A;  1N4U A;  3AYI A;  4JNQ A;  2DKI A;  3AD8 B;  4H2N A;  4TM1 A;  4Y4M A;  2BXS A;  2C72 A;  2XVE A;  3KLJ A;  1EL8 A;  3AE8 A;  4TM0 A;  1AOG A;  3BI2 A;  2TPR A;  1CL0 A;  2CUL A;  3AE9 A;  1SEZ A;  4USQ A;  2GF3 A;  3KA7 A;  4Z44 A;  1XAN A;  2BYB A;  4IA6 A;  4CCQ A;  4HB9 A;  4AOX A;  3QVP A;  5EBK A;  4B69 A;  1PJ6 A;  3AE5 A;  3LJP A;  4H4X A;  1KSS A;  1GRT A;  1YQZ A;  4H50 A;  5U63 A;  1RP0 A;  4B1B A;  3NTD A;  5GSN A;  4YWO A;  4U2L A;  3PO7 A;  3LZX A;  2XVI A;  4XWR A;  4BK1 A;  5BUK A;  1ZKQ A;  4Z24 A;  3F8P A;  2H89 A;  4DSH A;  3GRT A;  3DJE A;  5LV9 A;  1DXL A;  1GT8 A;  1TDF A;  3DJD A;  2C7G A;  2WQY A;  1LPF A;  3DA1 A;  3QFA A;  1S3E A;  3G5S A;  2XVJ A;  3NTA A;  4OVI A;  1ZMD A;  2XYO A;  4BJY A;  4H4T A;  3AD7 B;  2WDQ A;  4CBQ A;  1F8R A;  2X8C A;  1DJQ A;  1H84 A;  2E5V A;  1E1M A;  3ZYX A;  1EL9 A;  3NYE A;  1L9E A;  4J31 A;  4NTE A;  3UKP A;  4ZCC A;  3SM8 A;  2WPF A;  3P4R A;  3FBS A;  2BS3 A;  3IF9 A;  3CNP A;  3V3N A;  1JNZ A;  3S5W A;  2X50 A;  1NDA A;  2BAC A;  2CVJ A;  5KVI A;  2GEW A;  1NAA A;  2XCG A;  1VG0 A;  4Z2U A;  1CJC A;  1ZOY A;  1YKJ A;  5KRQ A;  1TYP A;  4B64 A;  1MXT A;  3AE6 A;  3OZ2 A;  1DOB A;  4JNA A;  3R9U A;  3UOY A;  3BI4 A;  3PVC A;  4UDP A;  5J7X A;  2VVM A;  4GDP A;  2XFP A;  2YR6 A;  1KFY A;  1RSG A;  4H4P A;  2WET A;  1E1N A;  4U8K A;  2C66 A;  1NHR A;  4UDR A;  4A6N B;  4Z26 A;  5JCM A;  2C73 A;  2WDR A;  3SGL A;  1KNP A;  2X8G A;  2RAB A;  3AE1 A;  2Y6R A;  4JY3 A;  3AB1 A;  2CFY A;  1TDO A;  2BCG G;  1FL2 A;  4YXD A;  3SFD A;  3UTF A;  2B76 A;  3I3L A;  3CNS A;  3AWI A;  1ZP0 A;  2XLR A;  4EMI A;  1JU2 A;  1O94 A;  4EMJ A;  2GQF A;  4CNK A;  2WPE A;  3ALL A;  3UOX A;  2YR4 A;  3AYL A;  2C76 A;  3B6D A;  2BK4 A;  1VRQ B;  2W0H A;  1FCD A;  5FS9 A;  4FDC B;  2VVL A;  2XLT A;  3BHF A;  4ZN0 A;  5KWF A;  2YG3 A;  1D7L A;  2WOV A;  3RED A;  2PYX A;  3VQR A;  3GD3 A;  3L1R A;  3NN0 X;  1PJ7 A;  1GRE A;  1L9D A;  3BNU A;  3CGE A;  5KXJ A;  4OPI A;  3URH A;  2Y6Q A;  1PBF A;  3GD4 A;  3IWA A;  2JB1 A;  2V60 A;  1GND A;  1NPX A;  1Q1R A;  2YVJ A;  3LAD A;  5HYM A;  5JCN A;  3CGD A;  1PXC A;  4APN A;  3GRS A;  4EIQ A;  3P4P A;  3P4S A;  1ELI A;  3NLC A;  3DH9 A;  2Q7V A;  3WE0 A;  3ICT A;  4EM3 A;  3UKL A;  3BI5 A;  4C74 A;  4BK3 A;  2JKC A;  2BC0 A;  2YLZ A;  4YTP A;  1P2H A;  1YQ3 A;  3F8R A;  2FJB A;  3NIX A;  3PS9 A;  3UTH A;  4CY6 A;  3FPZ A;  4IVO B;  4K8D A;  1D5T A;  3H8I A;  4USR A;  1CJ2 A;  1IUX A;  3ADA B;  1NHP A;  3DJG X;  3NYF A;  2R46 A;  2WEU A;  1F8W A;  3AYJ A;  4H4W A;  3DK8 A;  3NG7 X;  1BGJ A;  4U8L A;  2YAU A;  2GR3 A;  4JY2 A;  1O95 A;  5FMH A;  1CC4 A;  4J34 A;  2WES A;  2YR5 A;  2BXR A;  4B67 A;  2YG5 A;  3K7T A;  2WS3 A;  3P4Q A;  4K5S A;  1GPE A;  2WOW A;  2C75 A;  4IVM B;  3VRA A;  1Q9I A;  4BJZ A;  3AXB A;  4I59 A;  2GRT A;  3GDN A;  2FJA A;  4YTM A;  3RP8 A;  2GVC A;  1PXB A;  3AED A;  3CIR A;  3CPJ G;  3C96 A;  2XDO A;  4K2X A;  1VQW A;  2A87 A;  1H7X A;  3QJ4 A;  2BS2 A;  5J60 A;  5FS8 A;  2I0Z A;  2XLU A;  4U8J A;  1JEH A;  3EF6 A;  1H83 A;  3CGB A;  2YG4 A;  5JCI A;  1V59 A;  1PHH A;  4D03 A;  4D04 A;  4OPC A;  2JB3 A;  3JSK A;  3OC4 A;  2B9Y A;  4K7Z A;  4U2S A;  1F6M A;  1JRY A;  2J3N A;  2O9Z A;  2C64 A;  2A89 A;  3SFE A;  2GB0 A;  1H7W A;  3DK9 A;  3FMW A;  3G5R A;  4OPT A;  2BK5 A;  1GRG A;  1PBB A;  2AAQ A;  2TMD A;  4FX9 A;  4X4J A;  4CNJ A;  1PBE A;  4FK1 C;  4C77 A;  2RGJ A;  1EBD A;  3B3R A;  1GAL A;  1CC6 A;  2Z5Y A;  2EQ8 A;  3M12 A;  3UTG A;  4GF7 A;  3ALM A;  2BC1 A;  3DK4 A;  1OJC A;  3COX A;  4XXG A;  2DKH A;  1JRZ A;  1OJD A;  3CPI G;  5IPY A;  5HXI A;  4H2R A;  1H81 A;  1K0I A;  3KVE A;  1PBD A;  3ATR A;  3CN8 A;  5CKU A;  4U8O A;  2BCP A;  2YVF A;  2YVG A;  4YSZ A;  3CNT A;  3ZDN A;  1L9C A;  3P9U A;  4EQX A;  2WPC A;  4K5R A;  5DBJ A;  3T37 A;  1LQU A;  5FS7 A;  2GAH B;  4EM4 A;  2GR2 A;  2C67 A;  2GQW A;  4M52 A;  1PN0 A;  2YLT A;  4X9M A;  3UKF A;  2BA9 A;  5C3J A;  1CF3 A;  4XWZ A;  2V61 A;  1E7P A;  1JNR A;  1ZOV A;  3DJJ A;  3NNE A;  4UP3 A;  1LTX R;  1IUT A;  1GV4 A;  3NYC A;  2X8H A;  4OPG A;  2ZZB A;  4WX1 A;  3AE4 A;  1B37 A;  1XPQ A;  4AT0 A;  4J57 A;  1PBC A;  3NRN A;  1LJ1 A;  4RG3 A;  5IQ1 A;  2EQ9 A;  5CQF A;  2V3B A;  2Z5X A;  2F5Z A;  4LU6 A;  4NZH A;  3NKS A;  2JBV A;  3RP7 A;  4Y4L A;  3RNM A;  3UOZ A;  4I58 A;  3ICS A;  3NK2 X;  4GDE A;  5BUL A;  4HA6 A;  4IA5 A;  1X31 B;  1ZMC A;  1Y56 A;  1OJT A;  2VQ7 A;  3GSI A;  1HYU A;  4DGK A;  2B9W A;  4E0V A;  3GWD A;  1LQT A;  4AP3 A;  1NG3 A;  2E4G A;  2FBW A;  1W4X A;  2WP5 A;  1TYT A;  3QVR A;  1S2Q A;  4RG4 A;  3D1C A;  3AE7 A;  4NEW A;  4DNA A;  1F3P A;  1CBO A;  4NTD A;  4O5Q A;  4EQR A;  2NPX A;  2R4J A;  1OJA A;  1M6I A;  4GR1 A;  4FK1 A;  3IHM A;  3C4N A;  1NHQ A;  3NHO X;  5EB4 A;  3GYJ A;  1D7Y A;  1DJN A;  2XVH A;  2XFN A;  2R9Z A;  1GRB A;  2GV8 A;  3ITJ A;  1B8S A;  4J2W A;  5JCK A;  3UP5 A;  1CHU A;  3AE3 A;  1MO9 A;  4B63 A;  4BK2 A;  3EAO A;  4GCM A;  4J56 A;  3RHA A;  2GR0 A;  3BHK A;  4H4S A;  3ICR A;  2R0G A;  2ZZ0 A;  4Z2T A;  3L8K A;  2V3A A;  1H6V A;  1N1P A;  3F8D A;  4KX6 A;  4U8N A;  4YSX A;  4H4Y A;  1FOH A;  4B66 A;  2RGH A;  2XLP A;  3E1T A;  2R45 A; 
#chains in the Genus database with same CATH topology
 2R4E A;  3UKA A;  3FIM B;  4C5O A;  1VG9 A;  2WP6 A;  2BK3 A;  1PJ5 A;  1GOS A;  3H4K A;  1TDE A;  1O5W A;  4GRT A;  5KVH A;  2A8X A;  1GET A;  4Z25 A;  2ZBW A;  1E6E A;  2XLS A;  2YLR A;  2RGO A;  3S61 A;  3II4 A;  2E1M A;  4C3Y A;  3UCL A;  4A9W A;  1DOE A;  3D8X A;  2EQ7 A;  1EL5 A;  1S3B A;  2ACZ A;  3KKJ A;  3VR8 A;  1XHC A;  4EQW A;  1PS9 A;  1Y56 B;  1K0J A;  2C70 A;  3M13 A;  2UZZ A;  5ER0 A;  3EPT A;  3GMC A;  1CJ4 A;  3KPF A;  2YLX A;  2YM1 A;  2QCU A;  3CPH G;  1H86 A;  2VZ2 A;  5C2T A;  1VDC A;  2X99 A;  3UP4 A;  1GTE A;  4PAA A;  3AEB A;  2Q0L A;  2XFU A;  3AEG A;  4U2T A;  1QO8 A;  3UKH A;  1UKV G;  2WOI A;  3Q9T A;  5M0Z A;  5KMP A;  3K7Q X;  5L46 A;  2C65 A;  4TLX A;  1N4V A;  4H7U A;  4LII A;  2FJD A;  3SZC A;  1IJH A;  4O5U A;  3AEA A;  2BRA A;  2WBA A;  4H4R A;  3V76 A;  3G5Q A;  3CTY A;  2B7S A;  1F8S A;  2H88 A;  4J33 A;  2BAB A;  1YY5 A;  1GES A;  1GRA A;  1NEK A;  2Q6U A;  3ABV A;  4GUV A;  4Z43 A;  3SX6 A;  4BV6 A;  3Q6J A;  2QA2 A;  2WU5 A;  4OPU A;  5KMR A;  4II2 A;  1BGN A;  1TDN A;  3P1W A;  1DOD A;  1BF3 A;  1FEB A;  1LV0 A;  5JCL A;  1BWC A;  2VVL G;  4U8M A;  2XFQ A;  4J36 A;  3AEF A;  4A6N A;  1DOC A;  4K22 A;  4TM4 A;  4YKG A;  3AEE A;  5KMS A;  4G74 A;  5IQ4 A;  3NT6 A;  5KOW A;  1IUS A;  1KF6 A;  1D4D A;  1B4V A;  2OA1 A;  1ZX9 A;  2QAE A;  3LXD A;  4A65 A;  2GMH A;  1RYI A;  4H4V A;  3SQP A;  1E1K A;  3CND A;  4U8P A;  1JOA A;  3DGZ A;  2XVF A;  4NEV A;  1L0V A;  2WDV A;  4H2P A;  2JB2 A;  2OAM A;  2VRM A;  1EL7 A;  3LB8 A;  4AP1 A;  1XDI A;  4KPR A;  2B9X A;  4C3X A;  2R0P A;  1KSU A;  1QJD A;  4PAB A;  1TDK A;  2B7R A;  5U25 A;  5KOX A;  1YQ4 A;  2IVE A;  4CY8 A;  4A79 A;  4Y4N A;  2IVD A;  1NHS A;  1P2E A;  2C3D A;  3NN6 X;  3ALJ A;  5FS6 A;  4RSL A;  1D4C A;  4N9X A;  1ONF A;  4OPD A;  4ADW A;  3NGC X;  3HYV A;  3LOV A;  3QFB A;  2YLW A;  4A99 A;  3DGH A;  4CCR A;  1GTH A;  2JAE A;  2VQB A;  1QLB A;  2C3C A;  5U1O A;  4X9N A;  4A5L A;  4ZCD A;  3K30 A;  2IID A;  3QSM A;  1M64 A;  2GAG B;  2VOU A;  2WHD A;  3ATQ A;  3UKK A;  1D4E A;  1IUV A;  1GEU A;  3HZL A;  4IV9 A;  4YSH A;  1Q1W A;  4EMW A;  3NK1 X;  4AT2 A;  4TLZ A;  1H82 A;  4YTN A;  1COY A;  4B65 A;  5HY5 A;  1REO A;  2VRL A;  1LVL A;  4AOS A;  2EQ6 A;  5BRT A;  2PHH A;  2AQJ A;  2YQU A;  1B5Q A;  4H2Q A;  4TM3 A;  3VR9 A;  2YM2 A;  2GH5 A;  3GDP A;  4EIP A;  3V3O A;  1CC2 A;  4DSG A;  4MJW A;  4CRT A;  1BZL A;  4ECH A;  1KDG A;  2WP9 A;  3QSS A;  4H4Q A;  3VRB A;  4BUR A;  3IHG A;  3AEC A;  3RP6 A;  4A7A A;  3CGC A;  3LZW A;  2OLN A;  4JQ9 A;  4UDQ A;  5EB5 A;  3HYW A;  3T2Z A;  1Y0P A;  2QA1 A;  2YLS A;  4YT0 A;  5BVA A;  1OJ9 A;  3BNM A;  1PDH A;  2CDU A;  1CJ3 A;  4ICY A;  1E1L A;  3GWF A;  1Z6L A;  1IUU A;  4YSY A;  5M10 A;  1FEC A;  1GRF A;  4B68 A;  3I6D A;  2YG6 A;  2GR1 A;  1JRX A;  2V6O A;  4GAP A;  2YG7 A;  2OAL A;  3M0O A;  3O0H A;  2WU2 A;  1DNC A;  3KU9 A;  4JDR A;  4U8I A;  3VRD B;  3UOV A;  1S2Y A;  5EOW A;  2X3N A;  1ZY8 A;  1NEN A;  5TR3 A;  1ZDL A;  3EAN A;  3QSE A;  3AD9 B;  3ISH A;  3KD9 A;  1BKW A;  1KNR A;  1GER A;  4Z2R A;  2R0C A;  2APG A;  2OLO A;  4H4U A;  3CMM A;  4OCG A;  3UKQ A;  1PXA A;  1NG4 A;  2Q0K A;  3C4A A;  1E39 A;  2FJE A;  3H8L A;  3NK0 X;  1GSN A;  2YWL A;  4WCT A;  2XFO A;  2JK6 A;  3UTE A;  1MOK A;  4REK A;  1N4W A;  3IC9 A;  4OPL A;  2ARD A;  2GMJ A;  3FG2 P;  4EQS A;  4NNJ A;  2BS4 A;  4NTC A;  1GXF A;  5GRT A;  2V5Z A;  5HHF A;  4H4Z A;  2HQM A;  3CNJ A;  1GRH A;  1K4Q A;  2AR8 A;  2NVK X;  4JN9 A;  2ZZC A;  1K0L A;  1IUW A;  3DME A;  3GMB A;  3NH3 X;  4P9S A;  1TRB A;  3AE2 A;  1ZK7 A;  1FEA A;  3GYI A;  4LA1 A;  3K7M X;  4YKF A;  1N4U A;  3AYI A;  4JNQ A;  2DKI A;  3AD8 B;  4H2N A;  4TM1 A;  4Y4M A;  3T2K A;  2BXS A;  2C72 A;  2XVE A;  3KLJ A;  1EL8 A;  3AE8 A;  4TM0 A;  1AOG A;  3SXI A;  3BI2 A;  2TPR A;  1CL0 A;  2CUL A;  3AE9 A;  1SEZ A;  4USQ A;  2GF3 A;  3KA7 A;  4Z44 A;  1XAN A;  2BYB A;  4IA6 A;  4CCQ A;  4HB9 A;  4G9K A;  4AOX A;  3QVP A;  5EBK A;  4B69 A;  1PJ6 A;  3AE5 A;  3LJP A;  4H4X A;  1KSS A;  1GRT A;  1YQZ A;  4GAV A;  4H50 A;  5U63 A;  3KPK A;  1RP0 A;  4B1B A;  3NTD A;  5GSN A;  4YWO A;  4U2L A;  3PO7 A;  3LZX A;  2XVI A;  4XWR A;  4BK1 A;  5BUK A;  1ZKQ A;  4Z24 A;  3F8P A;  2H89 A;  4DSH A;  3GRT A;  3DJE A;  5LV9 A;  3T14 A;  1DXL A;  1GT8 A;  1TDF A;  3DJD A;  2C7G A;  2WQY A;  1LPF A;  3DA1 A;  3QFA A;  1S3E A;  3G5S A;  2XVJ A;  3NTA A;  4OVI A;  1ZMD A;  2XYO A;  4BJY A;  4H4T A;  3AD7 B;  2WDQ A;  4CBQ A;  1F8R A;  2X8C A;  1DJQ A;  1H84 A;  2E5V A;  1E1M A;  3ZYX A;  1EL9 A;  3NYE A;  1L9E A;  4J31 A;  4NTE A;  3UKP A;  4ZCC A;  3SM8 A;  2WPF A;  3P4R A;  3FBS A;  2BS3 A;  3IF9 A;  3CNP A;  3V3N A;  1JNZ A;  3S5W A;  2X50 A;  1NDA A;  2BAC A;  2CVJ A;  5KVI A;  2GEW A;  1NAA A;  2XCG A;  1VG0 A;  4Z2U A;  1CJC A;  1ZOY A;  1YKJ A;  5KRQ A;  1TYP A;  4B64 A;  1MXT A;  3AE6 A;  3OZ2 A;  1DOB A;  4JNA A;  3R9U A;  3UOY A;  3BI4 A;  3PVC A;  4UDP A;  5J7X A;  2VVM A;  4GDP A;  2XFP A;  2YR6 A;  1KFY A;  1RSG A;  4H4P A;  2WET A;  1E1N A;  4U8K A;  2C66 A;  3SZF A;  1NHR A;  4UDR A;  4A6N B;  4Z26 A;  5JCM A;  2C73 A;  2WDR A;  3SGL A;  1KNP A;  2X8G A;  2RAB A;  3AE1 A;  2Y6R A;  3SYI A;  4JY3 A;  3AB1 A;  2CFY A;  1TDO A;  2BCG G;  1FL2 A;  4YXD A;  3SFD A;  3UTF A;  2B76 A;  3I3L A;  3CNS A;  3AWI A;  1ZP0 A;  2XLR A;  4EMI A;  1JU2 A;  1O94 A;  4EMJ A;  2GQF A;  4CNK A;  2WPE A;  3ALL A;  3UOX A;  2YR4 A;  3AYL A;  2C76 A;  3B6D A;  2BK4 A;  1VRQ B;  2W0H A;  4II3 A;  1FCD A;  5FS9 A;  4FDC B;  2VVL A;  2XLT A;  3BHF A;  4ZN0 A;  5KWF A;  2YG3 A;  1D7L A;  2WOV A;  3RED A;  2PYX A;  3VQR A;  3GD3 A;  3L1R A;  3NN0 X;  1PJ7 A;  1GRE A;  1L9D A;  3BNU A;  3CGE A;  5KXJ A;  4OPI A;  3URH A;  2Y6Q A;  1PBF A;  3GD4 A;  3IWA A;  2JB1 A;  2V60 A;  1GND A;  1NPX A;  1Q1R A;  2YVJ A;  3LAD A;  5HYM A;  5JCN A;  3CGD A;  1PXC A;  4APN A;  3GRS A;  4EIQ A;  3P4P A;  3P4S A;  1ELI A;  3NLC A;  3DH9 A;  3WE0 A;  2Q7V A;  3ICT A;  4EM3 A;  3UKL A;  3BI5 A;  4C74 A;  4BK3 A;  2JKC A;  2BC0 A;  2YLZ A;  4YTP A;  1P2H A;  1YQ3 A;  3F8R A;  2FJB A;  3NIX A;  3PS9 A;  3UTH A;  4CY6 A;  3FPZ A;  4IVO B;  4K8D A;  1D5T A;  3H8I A;  4USR A;  1CJ2 A;  1IUX A;  3ADA B;  1NHP A;  3DJG X;  3NYF A;  2R46 A;  2WEU A;  1F8W A;  3AYJ A;  4G6G A;  4H4W A;  3T0K A;  3DK8 A;  3NG7 X;  1BGJ A;  4U8L A;  2YAU A;  2GR3 A;  4JY2 A;  1O95 A;  5FMH A;  1CC4 A;  4J34 A;  2WES A;  2YR5 A;  2BXR A;  4B67 A;  2YG5 A;  3K7T A;  2WS3 A;  3P4Q A;  4K5S A;  1GPE A;  2WOW A;  2C75 A;  4IVM B;  3VRA A;  1Q9I A;  4BJZ A;  3AXB A;  4I59 A;  2GRT A;  3GDN A;  2FJA A;  3SZ0 A;  4YTM A;  3RP8 A;  2GVC A;  1PXB A;  3AED A;  5KMQ A;  3CIR A;  3CPJ G;  3C96 A;  2C4C A;  2XDO A;  4K2X A;  1VQW A;  2A87 A;  1H7X A;  3QJ4 A;  2BS2 A;  5J60 A;  5FS8 A;  2I0Z A;  2XLU A;  4U8J A;  1JEH A;  3EF6 A;  1H83 A;  3CGB A;  2YG4 A;  5JCI A;  1V59 A;  1PHH A;  4D03 A;  4D04 A;  4OPC A;  2JB3 A;  3JSK A;  3OC4 A;  2B9Y A;  4K7Z A;  4U2S A;  1F6M A;  1JRY A;  2J3N A;  2O9Z A;  4G73 A;  2C64 A;  2A89 A;  3SFE A;  2GB0 A;  1H7W A;  3DK9 A;  3FMW A;  3G5R A;  4OPT A;  2BK5 A;  1GRG A;  3T31 A;  1PBB A;  2AAQ A;  2TMD A;  4FX9 A;  4X4J A;  4CNJ A;  1PBE A;  4FK1 C;  3SY4 A;  4C77 A;  2RGJ A;  3SZW A;  1EBD A;  3B3R A;  1GAL A;  1CC6 A;  2Z5Y A;  2EQ8 A;  3M12 A;  3UTG A;  3HYX A;  4GF7 A;  3ALM A;  3T2Y A;  2BC1 A;  3DK4 A;  1OJC A;  3COX A;  4XXG A;  2DKH A;  1JRZ A;  1OJD A;  3CPI G;  4NWZ A;  5IPY A;  5HXI A;  4H2R A;  1H81 A;  1K0I A;  3KVE A;  1PBD A;  3ATR A;  3CN8 A;  5CKU A;  4U8O A;  2BCP A;  2YVF A;  2YVG A;  4YSZ A;  3CNT A;  3ZDN A;  1L9C A;  3P9U A;  4EQX A;  2WPC A;  4K5R A;  5DBJ A;  3T37 A;  1LQU A;  5FS7 A;  2GAH B;  4EM4 A;  2GR2 A;  2C67 A;  2GQW A;  4M52 A;  1PN0 A;  2YLT A;  4X9M A;  3UKF A;  2BA9 A;  5C3J A;  1CF3 A;  4XWZ A;  2V61 A;  1E7P A;  1JNR A;  1ZOV A;  3DJJ A;  3NNE A;  4UP3 A;  1LTX R;  1IUT A;  1GV4 A;  3NYC A;  2X8H A;  4OPG A;  2ZZB A;  4WX1 A;  3AE4 A;  1B37 A;  1XPQ A;  4AT0 A;  4J57 A;  1PBC A;  3NRN A;  1LJ1 A;  4RG3 A;  5IQ1 A;  2EQ9 A;  5CQF A;  2V3B A;  2Z5X A;  2F5Z A;  4LU6 A;  4NZH A;  3NKS A;  2JBV A;  5KNL A;  3RP7 A;  4Y4L A;  3RNM A;  3UOZ A;  4I58 A;  3ICS A;  3NK2 X;  4GDE A;  5BUL A;  4HA6 A;  4IA5 A;  1X31 B;  1ZMC A;  1Y56 A;  1OJT A;  2VQ7 A;  3GSI A;  1HYU A;  4DGK A;  2B9W A;  4E0V A;  3GWD A;  1LQT A;  4AP3 A;  1NG3 A;  2E4G A;  2FBW A;  1W4X A;  2WP5 A;  1TYT A;  3QVR A;  1S2Q A;  2BRY A;  4RG4 A;  3D1C A;  3AE7 A;  4NEW A;  4DNA A;  1F3P A;  1CBO A;  4NTD A;  4O5Q A;  4EQR A;  2NPX A;  2R4J A;  1OJA A;  1M6I A;  4GR1 A;  3GYX A;  3IHM A;  4FK1 A;  3C4N A;  1NHQ A;  3NHO X;  5EB4 A;  3GYJ A;  1D7Y A;  1DJN A;  2XVH A;  2XFN A;  2R9Z A;  1GRB A;  2GV8 A;  3ITJ A;  1B8S A;  4J2W A;  5JCK A;  3UP5 A;  1CHU A;  3AE3 A;  1MO9 A;  4B63 A;  4BK2 A;  3EAO A;  4GCM A;  4J56 A;  3RHA A;  2GR0 A;  3BHK A;  4H4S A;  3ICR A;  2R0G A;  2ZZ0 A;  4Z2T A;  3L8K A;  2V3A A;  1H6V A;  1N1P A;  3F8D A;  4KX6 A;  4G6H A;  4U8N A;  4YSX A;  4H4Y A;  1FOH A;  4B66 A;  2RGH A;  2XLP A;  3E1T A;  2R45 A; 
#chains in the Genus database with same CATH homology
 2R4E A;  3UKA A;  3FIM B;  4C5O A;  1VG9 A;  2WP6 A;  2BK3 A;  1PJ5 A;  1GOS A;  3H4K A;  1TDE A;  1O5W A;  4GRT A;  5KVH A;  2A8X A;  1GET A;  4Z25 A;  2ZBW A;  1E6E A;  2XLS A;  2YLR A;  2RGO A;  3S61 A;  3II4 A;  2E1M A;  4C3Y A;  3UCL A;  4A9W A;  1DOE A;  3D8X A;  2EQ7 A;  1EL5 A;  1S3B A;  2ACZ A;  3KKJ A;  3VR8 A;  1XHC A;  4EQW A;  1PS9 A;  1Y56 B;  1K0J A;  2C70 A;  3M13 A;  2UZZ A;  5ER0 A;  3EPT A;  3GMC A;  1CJ4 A;  3KPF A;  2YLX A;  2YM1 A;  2QCU A;  3CPH G;  1H86 A;  2VZ2 A;  5C2T A;  1VDC A;  2X99 A;  3UP4 A;  1GTE A;  4PAA A;  3AEB A;  2Q0L A;  2XFU A;  3AEG A;  4U2T A;  1QO8 A;  3UKH A;  1UKV G;  2WOI A;  3Q9T A;  5M0Z A;  5KMP A;  3K7Q X;  5L46 A;  2C65 A;  4TLX A;  1N4V A;  4H7U A;  4LII A;  2FJD A;  3SZC A;  1IJH A;  4O5U A;  3AEA A;  2BRA A;  2WBA A;  4H4R A;  3V76 A;  3G5Q A;  3CTY A;  2B7S A;  1F8S A;  2H88 A;  4J33 A;  2BAB A;  1YY5 A;  1GES A;  1GRA A;  1NEK A;  2Q6U A;  3ABV A;  4GUV A;  4Z43 A;  3SX6 A;  4BV6 A;  3Q6J A;  2QA2 A;  2WU5 A;  4OPU A;  5KMR A;  4II2 A;  1BGN A;  1TDN A;  3P1W A;  1DOD A;  1BF3 A;  1FEB A;  1LV0 A;  5JCL A;  1BWC A;  2VVL G;  4U8M A;  2XFQ A;  4J36 A;  3AEF A;  4A6N A;  1DOC A;  4K22 A;  4TM4 A;  4YKG A;  3AEE A;  5KMS A;  4G74 A;  5IQ4 A;  3NT6 A;  5KOW A;  1IUS A;  1KF6 A;  1D4D A;  1B4V A;  2OA1 A;  1ZX9 A;  2QAE A;  3LXD A;  4A65 A;  2GMH A;  1RYI A;  4H4V A;  3SQP A;  1E1K A;  3CND A;  4U8P A;  1JOA A;  3DGZ A;  2XVF A;  4NEV A;  1L0V A;  2WDV A;  4H2P A;  2JB2 A;  2OAM A;  2VRM A;  1EL7 A;  3LB8 A;  4AP1 A;  1XDI A;  4KPR A;  2B9X A;  4C3X A;  2R0P A;  1KSU A;  1QJD A;  4PAB A;  1TDK A;  2B7R A;  5U25 A;  5KOX A;  1YQ4 A;  2IVE A;  4CY8 A;  4A79 A;  4Y4N A;  2IVD A;  1NHS A;  1P2E A;  2C3D A;  3NN6 X;  3ALJ A;  5FS6 A;  4RSL A;  1D4C A;  4N9X A;  1ONF A;  4OPD A;  4ADW A;  3NGC X;  3HYV A;  3LOV A;  3QFB A;  2YLW A;  4A99 A;  3DGH A;  4CCR A;  1GTH A;  2JAE A;  2VQB A;  1QLB A;  2C3C A;  5U1O A;  4X9N A;  4A5L A;  4ZCD A;  3K30 A;  2IID A;  3QSM A;  1M64 A;  2GAG B;  2VOU A;  2WHD A;  3ATQ A;  3UKK A;  1D4E A;  1IUV A;  1GEU A;  3HZL A;  4IV9 A;  4YSH A;  1Q1W A;  4EMW A;  3NK1 X;  4AT2 A;  4TLZ A;  1H82 A;  4YTN A;  1COY A;  4B65 A;  5HY5 A;  1REO A;  2VRL A;  1LVL A;  4AOS A;  2EQ6 A;  5BRT A;  2PHH A;  2AQJ A;  2YQU A;  1B5Q A;  4H2Q A;  4TM3 A;  3VR9 A;  2YM2 A;  2GH5 A;  3GDP A;  4EIP A;  3V3O A;  1CC2 A;  4DSG A;  4MJW A;  4CRT A;  1BZL A;  4ECH A;  1KDG A;  2WP9 A;  3QSS A;  4H4Q A;  3VRB A;  4BUR A;  3IHG A;  3AEC A;  3RP6 A;  4A7A A;  3CGC A;  3LZW A;  2OLN A;  4JQ9 A;  4UDQ A;  5EB5 A;  3HYW A;  3T2Z A;  1Y0P A;  2QA1 A;  2YLS A;  4YT0 A;  5BVA A;  1OJ9 A;  3BNM A;  1PDH A;  2CDU A;  1CJ3 A;  4ICY A;  1E1L A;  3GWF A;  1Z6L A;  1IUU A;  4YSY A;  5M10 A;  1FEC A;  1GRF A;  4B68 A;  3I6D A;  2YG6 A;  2GR1 A;  1JRX A;  2V6O A;  4GAP A;  2YG7 A;  2OAL A;  3M0O A;  3O0H A;  2WU2 A;  1DNC A;  3KU9 A;  4JDR A;  4U8I A;  3VRD B;  3UOV A;  1S2Y A;  5EOW A;  2X3N A;  1ZY8 A;  1NEN A;  5TR3 A;  1ZDL A;  3EAN A;  3QSE A;  3AD9 B;  3ISH A;  3KD9 A;  1BKW A;  1KNR A;  1GER A;  4Z2R A;  2R0C A;  2APG A;  2OLO A;  4H4U A;  3CMM A;  4OCG A;  3UKQ A;  1PXA A;  1NG4 A;  2Q0K A;  3C4A A;  1E39 A;  2FJE A;  3H8L A;  3NK0 X;  1GSN A;  2YWL A;  4WCT A;  2XFO A;  2JK6 A;  3UTE A;  1MOK A;  4REK A;  1N4W A;  3IC9 A;  4OPL A;  2ARD A;  2GMJ A;  3FG2 P;  4EQS A;  4NNJ A;  2BS4 A;  4NTC A;  1GXF A;  5GRT A;  2V5Z A;  5HHF A;  4H4Z A;  2HQM A;  3CNJ A;  1GRH A;  1K4Q A;  2AR8 A;  2NVK X;  4JN9 A;  2ZZC A;  1K0L A;  1IUW A;  3DME A;  3GMB A;  3NH3 X;  4P9S A;  1TRB A;  3AE2 A;  1ZK7 A;  1FEA A;  3GYI A;  4LA1 A;  3K7M X;  4YKF A;  1N4U A;  3AYI A;  4JNQ A;  2DKI A;  3AD8 B;  4H2N A;  4TM1 A;  4Y4M A;  3T2K A;  2BXS A;  2C72 A;  2XVE A;  3KLJ A;  1EL8 A;  3AE8 A;  4TM0 A;  1AOG A;  3SXI A;  3BI2 A;  2TPR A;  1CL0 A;  2CUL A;  3AE9 A;  1SEZ A;  4USQ A;  2GF3 A;  3KA7 A;  4Z44 A;  1XAN A;  2BYB A;  4IA6 A;  4CCQ A;  4HB9 A;  4G9K A;  4AOX A;  3QVP A;  5EBK A;  4B69 A;  1PJ6 A;  3AE5 A;  3LJP A;  4H4X A;  1KSS A;  1GRT A;  1YQZ A;  4GAV A;  4H50 A;  5U63 A;  3KPK A;  1RP0 A;  4B1B A;  3NTD A;  5GSN A;  4YWO A;  4U2L A;  3PO7 A;  3LZX A;  2XVI A;  4XWR A;  4BK1 A;  5BUK A;  1ZKQ A;  4Z24 A;  3F8P A;  2H89 A;  4DSH A;  3GRT A;  3DJE A;  5LV9 A;  3T14 A;  1DXL A;  1GT8 A;  1TDF A;  3DJD A;  2C7G A;  2WQY A;  1LPF A;  3DA1 A;  3QFA A;  1S3E A;  3G5S A;  2XVJ A;  3NTA A;  4OVI A;  1ZMD A;  2XYO A;  4BJY A;  4H4T A;  3AD7 B;  2WDQ A;  4CBQ A;  1F8R A;  2X8C A;  1DJQ A;  1H84 A;  2E5V A;  1E1M A;  3ZYX A;  1EL9 A;  3NYE A;  1L9E A;  4J31 A;  4NTE A;  3UKP A;  4ZCC A;  3SM8 A;  2WPF A;  3P4R A;  3FBS A;  2BS3 A;  3IF9 A;  3CNP A;  3V3N A;  1JNZ A;  3S5W A;  2X50 A;  1NDA A;  2BAC A;  2CVJ A;  5KVI A;  2GEW A;  1NAA A;  2XCG A;  1VG0 A;  4Z2U A;  1CJC A;  1ZOY A;  1YKJ A;  5KRQ A;  1TYP A;  4B64 A;  1MXT A;  3AE6 A;  3OZ2 A;  1DOB A;  4JNA A;  3R9U A;  3UOY A;  3BI4 A;  3PVC A;  4UDP A;  5J7X A;  2VVM A;  4GDP A;  2XFP A;  2YR6 A;  1KFY A;  1RSG A;  4H4P A;  2WET A;  1E1N A;  4U8K A;  2C66 A;  3SZF A;  1NHR A;  4UDR A;  4A6N B;  4Z26 A;  5JCM A;  2C73 A;  2WDR A;  3SGL A;  1KNP A;  2X8G A;  2RAB A;  3AE1 A;  2Y6R A;  3SYI A;  4JY3 A;  3AB1 A;  2CFY A;  1TDO A;  2BCG G;  1FL2 A;  4YXD A;  3SFD A;  3UTF A;  2B76 A;  3I3L A;  3CNS A;  3AWI A;  1ZP0 A;  2XLR A;  4EMI A;  1JU2 A;  1O94 A;  4EMJ A;  2GQF A;  4CNK A;  2WPE A;  3ALL A;  3UOX A;  2YR4 A;  3AYL A;  2C76 A;  3B6D A;  2BK4 A;  1VRQ B;  2W0H A;  4II3 A;  1FCD A;  5FS9 A;  4FDC B;  2VVL A;  2XLT A;  3BHF A;  4ZN0 A;  5KWF A;  2YG3 A;  1D7L A;  2WOV A;  3RED A;  2PYX A;  3VQR A;  3GD3 A;  3L1R A;  3NN0 X;  1PJ7 A;  1GRE A;  1L9D A;  3BNU A;  3CGE A;  5KXJ A;  4OPI A;  3URH A;  2Y6Q A;  1PBF A;  3GD4 A;  3IWA A;  2JB1 A;  2V60 A;  1GND A;  1NPX A;  1Q1R A;  2YVJ A;  3LAD A;  5HYM A;  5JCN A;  3CGD A;  1PXC A;  4APN A;  3GRS A;  4EIQ A;  3P4P A;  3P4S A;  1ELI A;  3NLC A;  3DH9 A;  2Q7V A;  3WE0 A;  3ICT A;  4EM3 A;  3UKL A;  3BI5 A;  4C74 A;  4BK3 A;  2JKC A;  2BC0 A;  2YLZ A;  4YTP A;  1P2H A;  1YQ3 A;  3F8R A;  2FJB A;  3NIX A;  3PS9 A;  3UTH A;  4CY6 A;  3FPZ A;  4IVO B;  4K8D A;  1D5T A;  3H8I A;  4USR A;  1CJ2 A;  1IUX A;  3ADA B;  1NHP A;  3DJG X;  3NYF A;  2R46 A;  2WEU A;  1F8W A;  3AYJ A;  4G6G A;  4H4W A;  3T0K A;  3DK8 A;  3NG7 X;  1BGJ A;  4U8L A;  2YAU A;  2GR3 A;  4JY2 A;  1O95 A;  5FMH A;  1CC4 A;  4J34 A;  2WES A;  2YR5 A;  2BXR A;  4B67 A;  2YG5 A;  3K7T A;  2WS3 A;  3P4Q A;  4K5S A;  1GPE A;  2WOW A;  2C75 A;  4IVM B;  3VRA A;  1Q9I A;  4BJZ A;  3AXB A;  4I59 A;  2GRT A;  3GDN A;  2FJA A;  3SZ0 A;  4YTM A;  3RP8 A;  2GVC A;  1PXB A;  3AED A;  5KMQ A;  3CIR A;  3CPJ G;  3C96 A;  2C4C A;  2XDO A;  4K2X A;  1VQW A;  2A87 A;  1H7X A;  3QJ4 A;  2BS2 A;  5J60 A;  5FS8 A;  2I0Z A;  2XLU A;  4U8J A;  1JEH A;  3EF6 A;  1H83 A;  3CGB A;  2YG4 A;  5JCI A;  1V59 A;  1PHH A;  4D03 A;  4D04 A;  4OPC A;  2JB3 A;  3JSK A;  3OC4 A;  2B9Y A;  4K7Z A;  4U2S A;  1F6M A;  1JRY A;  2J3N A;  2O9Z A;  4G73 A;  2C64 A;  2A89 A;  3SFE A;  2GB0 A;  1H7W A;  3DK9 A;  3FMW A;  3G5R A;  4OPT A;  2BK5 A;  1GRG A;  3T31 A;  1PBB A;  2AAQ A;  2TMD A;  4FX9 A;  4X4J A;  4CNJ A;  1PBE A;  4FK1 C;  3SY4 A;  4C77 A;  2RGJ A;  3SZW A;  1EBD A;  3B3R A;  1GAL A;  1CC6 A;  2Z5Y A;  2EQ8 A;  3M12 A;  3UTG A;  3HYX A;  4GF7 A;  3ALM A;  3T2Y A;  2BC1 A;  3DK4 A;  1OJC A;  3COX A;  4XXG A;  2DKH A;  1JRZ A;  1OJD A;  3CPI G;  4NWZ A;  5IPY A;  5HXI A;  4H2R A;  1H81 A;  1K0I A;  3KVE A;  1PBD A;  3ATR A;  3CN8 A;  5CKU A;  4U8O A;  2BCP A;  2YVF A;  2YVG A;  4YSZ A;  3CNT A;  3ZDN A;  1L9C A;  3P9U A;  4EQX A;  2WPC A;  4K5R A;  5DBJ A;  3T37 A;  1LQU A;  5FS7 A;  2GAH B;  4EM4 A;  2GR2 A;  2C67 A;  2GQW A;  4M52 A;  1PN0 A;  2YLT A;  4X9M A;  3UKF A;  2BA9 A;  5C3J A;  1CF3 A;  4XWZ A;  2V61 A;  1E7P A;  1JNR A;  1ZOV A;  3DJJ A;  3NNE A;  4UP3 A;  1LTX R;  1IUT A;  1GV4 A;  3NYC A;  2X8H A;  4OPG A;  2ZZB A;  4WX1 A;  3AE4 A;  1B37 A;  1XPQ A;  4AT0 A;  4J57 A;  1PBC A;  3NRN A;  1LJ1 A;  4RG3 A;  5IQ1 A;  2EQ9 A;  5CQF A;  2V3B A;  2Z5X A;  2F5Z A;  4LU6 A;  4NZH A;  3NKS A;  2JBV A;  5KNL A;  3RP7 A;  4Y4L A;  3RNM A;  3UOZ A;  4I58 A;  3ICS A;  3NK2 X;  4GDE A;  5BUL A;  4HA6 A;  4IA5 A;  1X31 B;  1ZMC A;  1Y56 A;  1OJT A;  2VQ7 A;  3GSI A;  1HYU A;  4DGK A;  2B9W A;  4E0V A;  3GWD A;  1LQT A;  4AP3 A;  1NG3 A;  2E4G A;  2FBW A;  1W4X A;  2WP5 A;  1TYT A;  3QVR A;  1S2Q A;  2BRY A;  4RG4 A;  3D1C A;  3AE7 A;  4NEW A;  4DNA A;  1F3P A;  1CBO A;  4NTD A;  4O5Q A;  4EQR A;  2NPX A;  2R4J A;  1OJA A;  1M6I A;  4GR1 A;  3GYX A;  3IHM A;  4FK1 A;  3C4N A;  1NHQ A;  3NHO X;  5EB4 A;  3GYJ A;  1D7Y A;  1DJN A;  2XVH A;  2XFN A;  2R9Z A;  1GRB A;  2GV8 A;  3ITJ A;  1B8S A;  4J2W A;  5JCK A;  3UP5 A;  1CHU A;  3AE3 A;  1MO9 A;  4B63 A;  4BK2 A;  3EAO A;  4GCM A;  4J56 A;  3RHA A;  2GR0 A;  3BHK A;  4H4S A;  3ICR A;  2R0G A;  2ZZ0 A;  4Z2T A;  3L8K A;  2V3A A;  1H6V A;  1N1P A;  3F8D A;  4KX6 A;  4G6H A;  4U8N A;  4YSX A;  4H4Y A;  1FOH A;  4B66 A;  2RGH A;  2XLP A;  3E1T A;  2R45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...