4H2PA

Tetrameric form of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
GKTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 124
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2pA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2pA01
1ZOYA 2EQ9A 3NN0X 2AR8A 4X9NA 1D7YA 2OAMA 2QA1A 5FS6A 3FBSA 5BVAA 1IJHA 1DJQA 1E1LA 1D5TA 3QSSA 3UTEA 2XCGA 4NZHA 2WOVA 3V3NA 3CN8A 4OPDA 3RP8A 4U2LA 2GV8A 4K8DA 2XDOA 3KD9A 1OJDA 2BACA 4D04A 5M10A 4PAAA 4A9WA 2GMJA 4EIPA 1NENA 3GSIA 2VOUA 3RP7A 2ZZ0A 3FPZA 4NEVA 5JCIA 3QSEA 2YLWA 3ALJA 2GVCA 3DGHA 1OJCA 3K7QX 4Y4LA 3BHFA 4JN9A 2C67A 2TPRA 2YQUA 3KVEA 2OALA 4H4XA 2C76A 5JCMA 3LOVA 1CBOA 2C73A 2WDVA 1IUXA 4DNAA 3LJPA 4APNA 1XPQA 3QVPA 4RG3A 5KVIA 1FCDA 1TYPA 4ECHA 2R4EA 1PS9A 2YR6A 3UKPA 3UKAA 3SM8A 3VQRA 2Q7VA 3HZLA 4U8NA 3G5RA 4AOSA 2NVKX 2RGOA 3GRSA 2C66A 3KA7A 3EAOA 4OPLA 4FK1A 5HHFA 1IUUA 1X31B 3CNTA 4H2PA 4JY3A 4FK1C 2JB2A 5EB5A 5TR3A 5LV9A 2YM2A 2V3BA 3RHAA 2E4GA 1BF3A 1CF3A 1TDNA 1JOAA 1M64A 2RABA 1PN0A 2GF3A 2V5ZA 2WP9A 3H8LA 3I6DA 4A65A 3P1WA 4LIIA 1FL2A 4X4JA 4CY8A 4RSLA 4YSYA 4GRTA 1E1NA 4YKGA 1YQZA 1GPEA 2GRTA 1DOCA 2FJAA 4I58A 1H84A 5FMHA 3B6DA 4D03A 1PBEA 4IA6A 4JDRA 1JNZA 2YG3A 1F8WA 3CGCA 1K0JA 1TRBA 1CJCA 3C96A 1DNCA 3EANA 1LJ1A 2RGHA 4EQXA 1QJDA 4BK2A 5U63A 3GYJA 3BI4A 1OJTA 1FECA 3O0HA 3Q6JA 5J60A 2Q0LA 1D4DA 2DKIA 4DSGA 4HB9A 2R0CA 4B68A 2X50A 2YG7A 1KSSA 1ZMCA 3GDPA 1JNRA 3KU9A 4FX9A 3UKFA 3UOVA 5KOWA 3BI5A 4EIQA 2BC1A 5BULA 1TYTA 2EQ6A 3F8RA 3SQPA 3AE1A 3GMBA 1GRFA 3P9UA 1ZP0A 2VVMA 1VQWA 4AP1A 1BGJA 1H7XA 2BABA 2RGJA 4AT0A 3AE4A 5ER0A 3UP5A 1VG0A 3NRNA 1COYA 2E1MA 2QCUA 1JRXA 2QAEA 5GSNA 4AOXA 4LU6A 4YSHA 4C74A 5CQFA 3NHOX 4NEWA 1B4VA 2EQ7A 1CC2A 1D4CA 2GR0A 3K7TA 3REDA 4JQ9A 4H4YA 2BK4A 3AD8B 1F8RA 2YLXA 4ZCCA 3DGZA 2AQJA 2XLSA 3AE9A 2PHHA 1P2EA 5JCKA 1GT8A 2VZ2A 2YLTA 2J3NA 2IVDA 3GMCA 3NG7X 3PVCA 4J36A 3UOXA 4C3XA 4MJWA 4BK1A 1DXLA 1YQ3A 4BV6A 3AEDA 2ACZA 2Z5YA 3DK9A 5KRQA 4H4ZA 4EM3A 4EMIA 5C2TA 1PBFA 1ELIA 2YLZA 1GRAA 3FMWA 3QFBA 4U8OA 5EBKA 3V76A 3UTFA 2BXRA 5KWFA 3ZDNA 3LXDA 3Q9TA 4LA1A 4A6NB 2VRLA 3NN6X 3NYEA 4EMWA 1MO9A 3BHKA 3F8DA 2YG5A 3CGBA 1CHUA 1DJNA 3P4QA 1LQUA 4UDRA 4CNJA 2XVIA 4GUVA 1KF6A 3AWIA 2WU5A 1FOHA 2V61A 4OPUA 2OLOA 4U8KA 5BRTA 3EPTA 4B63A 2R4JA 2AAQA 2BS4A 4OVIA 1E39A 4USQA 3AEBA 4U8IA 2BA9A 2WETA 3OZ2A 1NHSA 1GESA 1TDEA 3AE6A 1GALA 2BYBA 4RG4A 3OC4A 3P4SA 2NPXA 1LPFA 1N4VA 2XLTA 2YR5A 1REOA 1XANA 2VVLG 4B64A 1KFYA 1GRHA 2Y6RA 4X9MA 5L46A 3IF9A 2XLPA 3P4PA 1GNDA 1EBDA 3KPFA 3ICSA 3NLCA 1LV0A 1QO8A 4EM4A 1IUTA 2YAUA 1KNRA 4UDPA 2EQ8A 3AE8A 2WHDA 1EL9A 3KLJA 3G5QA 3QFAA 4K5RA 4KPRA 5M0ZA 2FJBA 3CIRA 1H81A 4Z25A 3M12A 3T37A 3DJJA 1YQ4A 2Q6UA 1DODA 3AEGA 3DJDA 2YVJA 3R9UA 2ARDA 2GQFA 4UDQA 3S61A 1N1PA 1YKJA 2JBVA 2V60A 2CULA 1H83A 1AOGA 4IV9A 1DOEA 1P2HA 3AEEA 3NK1X 3ALLA 2B9XA 1NPXA 4H50A 5HYMA 4K7ZA 5GRTA 5KOXA 3II4A 3LADA 1F6MA 3FIMB 1BWCA 1CL0A 3GD4A 1LTXR 2Y6QA 2F5ZA 3VR8A 4DSHA 3NYFA 1NHRA 1GTEA 1K4QA 2WU2A 4E0VA 1NHQA 2C64A 4A99A 5JCNA 2JB3A 1O95A 2YWLA 4O5QA 3COXA 2JK6A 5U25A 4GDPA 4H2RA 3GRTA 4YWOA 2YLRA 3SGLA 3I3LA 4B66A 3G5SA 1CC4A 5HY5A 3LB8A 1B8SA 1S2YA 2XVHA 1JEHA 4GR1A 2YVFA 2R45A 2R0GA 2C65A 4A5LA 3UTHA 3DH9A 4Z2UA 3CPHG 1PDHA 3AD7B 3B3RA 4J31A 1B5QA 3S5WA 5EB4A 1E7PA 1Y56B 3AYJA 1N4WA 3C4NA 1IUVA 5U1OA 2UZZA 4YTNA 2DKHA 2WOWA 2C75A 3RP6A 1TDOA 2XFQA 2XFOA 4KX6A 3AECA 2JAEA 4A7AA 1ONFA 3NKSA 3UCLA 3LZXA 4J2WA 4OPCA 4J56A 3SFEA 4AT2A 3H8IA 4Z43A 5HXIA 1GERA 2QA2A 3ATRA 3SFDA 1JU2A 1GV4A 3NTDA 1EL5A 1GETA 4GCMA 4XWRA 3DMEA 3K30A 2X8GA 4B69A 3CPIG 2Z5XA 4HA6A 1H6VA 4BK3A 5EOWA 2YVGA 3ATQA 2YR4A 4H4WA 1GOSA 4OCGA 3BNUA 2GR1A 3BNMA 4N9XA 4XXGA 2WPCA 2BK3A 2B9YA 3D8XA 3DK8A 1ZDLA 1GRBA 4J34A 2X8HA 3CGEA 1OJAA 3UKLA 4TM1A 4EQWA 1GEUA 4JY2A 1IUWA 1O5WA 3ABVA 2WP5A 5CKUA 3V3OA 4C3YA 1VDCA 1XHCA 4Z44A 2V6OA 1KNPA 1Q9IA 1CJ3A 1EL8A 1TDKA 2C3DA 3C4AA 4M52A 1FEAA 1PBBA 1L9CA 4Y4NA 1S3EA 4H4UA 2WDQA 1ZOVA 3UOYA 3E1TA 3UP4A 2JKCA 2R9ZA 1PBCA 1PJ6A 3JSKA 3K7MX 4H2NA 3EF6A 2XVJA 4Y4MA 4YXDA 2GR2A 2B7RA 2C7GA 4H4RA 4TLZA 1FEBA 2I0ZA 2CFYA 1NHPA 1B37A 2XFNA 3IHMA 3GDNA 1CJ4A 4K22A 1BKWA 3NIXA 1GRGA 4H7UA 1F3PA 2BCGG 3GWFA 4TM4A 2BXSA 4A79A 1NDAA 4GDEA 1D7LA 3NTAA 3CNDA 1DOBA 1E1KA 2O9ZA 1L9EA 2VVLA 3NK2X 4IA5A 1EL7A 4J57A 4GF7A 3GWDA 5DBJA 1O94A 3UTGA 5IQ4A 4BJYA 4EQRA 4CCQA 4CRTA 1E1MA 2GQWA 3PO7A 3UKKA 1H7WA 1NG4A 4OPIA 4YKFA 4YTPA 4EMJA 3AXBA 3BI2A 1PXCA 2IVEA 2X99A 3M13A 3IWAA 3KKJA 1JRZA 3NGCX 4J33A 3NK0X 2R46A 4PABA 3AE5A 2GMHA 2WEUA 3VRBA 2XFUA 4ZCDA 2VQ7A 3H4KA 1PXBA 4DGKA 2CVJA 3IC9A 2WPEA 1L9DA 2A87A 3L1RA 1GSNA 2YG6A 2H88A 1RSGA 2VRMA 1ZK7A 3QSMA 3ICRA 3CNJA 3UOZA 4AP3A 2WPFA 1Q1WA 2B9WA 2H89A 3VRDB 3AE3A 4CCRA 2A89A 2BS3A 3GD3A 1GTHA 4K2XA 1SEZA 1NEKA 1HYUA 4WX1A 4JNAA 3D1CA 1PJ7A 1RYIA 2GAGB 2XVEA 4FDCB 4U2SA 2B76A 2CDUA 3AYIA 2JB1A 1H86A 5FS9A 1GRTA 1PHHA 3P4RA 4C5OA 1ZKQA 2VQBA 3LZWA 3DA1A 4USRA 2WESA 2WP6A 4BJZA 3VRAA 4H4QA 1UKVG 4OPTA 2BCPA 4U2TA 5BUKA 3CPJG 1KSUA 3URHA 4Z2TA 1PXAA 1VRQB 4C77A 4CBQA 3IHGA 1Y56A 2YLSA 2C70A 5FS7A 2XLUA 2XVFA 2YG4A 1MXTA 2IIDA 4NTCA 1VG9A 1JRYA 2OA1A 2Q0KA 2R0PA 4K5SA 2ZZCA 3GYIA 1PBDA 2WQYA 1ZMDA 4U8JA 1BZLA 1QLBA 4ZN0A 4EQSA 2B7SA 1D4EA 2E5VA 3UKHA 3L8KA 2XFPA 5IPYA 1PJ5A 3AE7A 1W4XA 2X3NA 4XWZA 1XDIA 4B1BA 4CNKA 4P9SA 4Z2RA 3CNPA 1BGNA 1OJ9A 3VR9A 2XLRA 4REKA 4O5UA 2ZZBA 1MOKA 3AEFA 4B65A 5C3JA 3QVRA 2APGA 2WBAA 4B67A 4YTMA 4I59A 3ZYXA 4TM3A 4YSZA 2WDRA 3ISHA 1LQTA 1TDFA 2WS3A 3FG2P 1S2QA 2BS2A 1CC6A 3AB1A 4TM0A 3RNMA 1H82A 1NG3A 2W0HA 4H4VA 2GB0A 4IVOB 2GAHB 2C72A 4JNQA 4Z24A 3UKQA 3WE0A 3PS9A 1IUSA 1ZX9A 1N4UA 1RP0A 2GR3A 2FJEA 4ADWA 3NYCA 1ZY8A 2BC0A 5IQ1A 2GEWA 4H4SA 4CY6A 2HQMA 3ALMA 3QJ4A 4A6NA 4NTEA 2X8CA 3DJEA 2V3AA 3CTYA 4IVMB 3ICTA 3AYLA 1V59A 1Z6LA 2YM1A 5KVHA 1GXFA 1F8SA 4NTDA 1S3BA 1CJ2A 2XYOA 1L0VA 1YY5A 2C3CA 3AD9B 2OLNA 3DK4A 1E6EA 2BK5A 2PYXA 3DJGX 4H4TA 4YSXA 5JCLA 3AEAA 3M0OA 3NH3X 3AE2A 4H4PA 4OPGA 4U8MA 2FBWA 4BURA 2A8XA 1M6IA 1Q1RA 4TLXA 3ADAB 4U8LA 5J7XA 4U8PA 4UP3A 1KDGA 4YT0A 5FS8A 2GH5A 4WCTA 2ZBWA 1LVLA 2TMDA 3CGDA 1K0IA 5KXJA 4H2QA 1Y0PA 3ITJA 3F8PA 1K0LA 1NAAA 2WOIA 4ICYA 4Z26A 3NT6A 1GREA 3NNEA 2FJDA 3CNSA
chains in the Genus database with same CATH superfamily
1ZOYA 2EQ9A 3NN0X 4X9NA 2AR8A 1D7YA 2OAMA 2QA1A 5FS6A 3FBSA 5BVAA 1IJHA 1DJQA 1E1LA 1D5TA 3QSSA 3UTEA 2XCGA 4NZHA 2WOVA 1C0LA 3V3NA 3CN8A 4OPDA 3RP8A 4U2LA 2GV8A 4K8DA 2XDOA 3KD9A 1OJDA 3CUKA 2BACA 3KPKA 4D04A 5M10A 4PAAA 3SZCA 4A9WA 2GMJA 4EIPA 1NENA 3GSIA 2VOUA 3RP7A 2ZZ0A 3FPZA 4NEVA 5JCIA 3QSEA 2YLWA 3ALJA 2GVCA 3DGHA 1OJCA 3K7QX 4Y4LA 3BHFA 4JN9A 2C67A 2TPRA 2YQUA 3KVEA 2OALA 4H4XA 2C76A 5JCMA 3LOVA 1CBOA 2C73A 2WDVA 1IUXA 4DNAA 3LJPA 4APNA 1XPQA 3QVPA 4RG3A 5KVIA 1FCDA 1TYPA 4ECHA 2R4EA 2DU8A 3VQRA 1PS9A 2YR6A 3SM8A 3UKPA 3UKAA 2Q7VA 3HZLA 4U8NA 3G5RA 3SY4A 4AOSA 2RGOA 2NVKX 3GRSA 2C66A 3KA7A 3EAOA 4OPLA 4FK1A 5HHFA 1IUUA 1X31B 3CNTA 4H2PA 4JY3A 3ZNPA 4FK1C 2JB2A 5EB5A 5TR3A 5LV9A 2YM2A 2V3BA 3RHAA 1TDNA 1BF3A 1CF3A 2E4GA 1JOAA 1M64A 2RABA 1PN0A 2GF3A 2V5ZA 2WP9A 3H8LA 3I6DA 4A65A 3P1WA 4LIIA 1FL2A 4X4JA 4CY8A 4RSLA 4YSYA 4GRTA 1E1NA 4YKGA 1YQZA 1GPEA 2GRTA 1DOCA 2FJAA 4I58A 1H84A 5FMHA 3B6DA 4D03A 1PBEA 4IA6A 4JDRA 1JNZA 2YG3A 1F8WA 3CGCA 1K0JA 1EVIA 1TRBA 1CJCA 3C96A 1DNCA 3EANA 1LJ1A 2RGHA 4EQXA 1QJDA 4BK2A 5U63A 1KIFA 3GYJA 3BI4A 1OJTA 1FECA 3O0HA 3Q6JA 5J60A 2Q0LA 1D4DA 2DKIA 4DSGA 4HB9A 2R0CA 4B68A 2X50A 2YG7A 1C0IA 1KSSA 1ZMCA 1JNRA 3GDPA 3KU9A 4FX9A 3UKFA 3UOVA 5KOWA 3BI5A 4EIQA 2BC1A 5BULA 1TYTA 2EQ6A 3F8RA 3SQPA 3AE1A 3GMBA 4YJHB 1GRFA 3HYWA 3P9UA 1ZP0A 2VVMA 1VQWA 4AP1A 1BGJA 1H7XA 2BABA 2RGJA 4GAPA 4AT0A 3AE4A 5ER0A 3UP5A 3W4KA 1VG0A 3NRNA 1COYA 2E1MA 2QCUA 1JRXA 4G6HA 2QAEA 5GSNA 4YSHA 4LU6A 4AOXA 4C74A 5CQFA 3NHOX 4NEWA 1B4VA 2EQ7A 1CC2A 1D4CA 2GR0A 4G74A 3K7TA 3REDA 4JQ9A 4H4YA 2BK4A 3AD8B 1F8RA 4Z43A 2YLXA 4ZCCA 3DGZA 2AQJA 2XLSA 3AE9A 2PHHA 2FJDA 1P2EA 3HYXA 5JCKA 1GT8A 2VZ2A 2YLTA 2J3NA 2IVDA 3GMCA 3NG7X 3PVCA 4J36A 3UOXA 4C3XA 4MJWA 4BK1A 1DXLA 1YQ3A 4BV6A 3AEDA 2ACZA 2Z5YA 3DK9A 5KRQA 4H4ZA 4EM3A 4EMIA 5C2TA 1PBFA 1ELIA 2YLZA 1GRAA 3FMWA 3QFBA 4U8OA 5EBKA 3V76A 3UTFA 2BXRA 5KWFA 3SZ0A 3ZDNA 3LXDA 3Q9TA 4LA1A 4A6NB 3NYEA 2VRLA 3NN6X 4EMWA 1MO9A 5KMSA 3BHKA 3F8DA 2YG5A 3CGBA 1CHUA 1DJNA 3P4QA 1LQUA 4UDRA 4CNJA 2XVIA 4GUVA 1KF6A 3AWIA 2WU5A 1FOHA 2V61A 4OPUA 2OLOA 4U8KA 5BRTA 3EPTA 4B63A 2R4JA 2AAQA 2BS4A 4OVIA 4YJFA 1E39A 4USQA 3AEBA 4U8IA 2BA9A 3WE0A 2WETA 3OZ2A 1NHSA 1GESA 1TDEA 3AE6A 1GALA 2BYBA 4RG4A 3OC4A 3P4SA 2NPXA 1LPFA 1N4VA 2XLTA 2YR5A 1REOA 1XANA 2VVLG 4B64A 1KFYA 5L46A 1GRHA 4X9MA 2Y6RA 3GYXA 3IF9A 2XLPA 3P4PA 1GNDA 2E49A 1EBDA 3KPFA 3ICSA 3NLCA 1LV0A 1QO8A 4EM4A 1IUTA 2YAUA 1KNRA 4UDPA 2EQ8A 3AE8A 2WHDA 1EL9A 3KLJA 3G5QA 3QFAA 4K5RA 4KPRA 5M0ZA 2FJBA 3CIRA 4G6GA 1H81A 4Z25A 3M12A 3T37A 3DJJA 1YQ4A 2Q6UA 1DODA 3DJDA 3AEGA 2YVJA 3R9UA 2ARDA 2GQFA 4UDQA 3S61A 4YJDA 1N1PA 1YKJA 2JBVA 2V60A 2CULA 1H83A 4NWZA 1AOGA 3T0KA 4IV9A 2BRAA 1DOEA 1P2HA 3AEEA 3NK1X 3ALLA 2B9XA 1NPXA 5KMPA 5HYMA 4H50A 4K7ZA 5GRTA 5KOXA 3II4A 3LADA 1F6MA 3FIMB 4YJGB 1BWCA 1CL0A 3GD4A 1LTXR 2Y6QA 2F5ZA 3VR8A 2C4CA 4DSHA 3NYFA 1NHRA 1GTEA 1K4QA 2WU2A 4E0VA 1NHQA 2C64A 4A99A 4NNJA 5JCNA 2BRYA 2JB3A 1O95A 2YWLA 4O5QA 3COXA 2JK6A 5U25A 4GDPA 4H2RA 4II2A 3GRTA 4YWOA 2YLRA 3SGLA 3I3LA 4B66A 3G5SA 1VE9A 1CC4A 5HY5A 3LB8A 1B8SA 1S2YA 2XVHA 3ZNQA 1JEHA 4GR1A 2YVFA 2R45A 2R0GA 2C65A 4A5LA 1DAOA 3UTHA 3DH9A 4Z2UA 3CPHG 1PDHA 3AD7B 3B3RA 4J31A 1B5QA 2E82A 5EB4A 1E7PA 3S5WA 5KNLA 1Y56B 3AYJA 3C4NA 1N4WA 1IUVA 5U1OA 2UZZA 4YTNA 2DKHA 3RP6A 2C75A 2WOWA 1TDOA 2XFQA 2XFOA 4KX6A 3AECA 2JAEA 4A7AA 4II3A 1ONFA 3NKSA 3UCLA 3LZXA 4J2WA 4OPCA 4QFCA 4J56A 3SFEA 3H8IA 4AT2A 5HXIA 1GERA 2QA2A 3ATRA 3SFDA 1JU2A 3SX6A 1GV4A 3NTDA 1EL5A 1GETA 4GCMA 4XWRA 3DMEA 3K30A 3W4IA 2X8GA 4B69A 3CPIG 2Z5XA 4HA6A 1H6VA 4BK3A 5EOWA 2YVGA 3ATQA 2YR4A 4H4WA 1GOSA 4OCGA 3BNUA 2GR1A 3BNMA 4N9XA 4XXGA 2WPCA 2BK3A 3W4JA 2B9YA 3D8XA 3DK8A 1ZDLA 1GRBA 4J34A 2X8HA 3CGEA 1OJAA 3UKLA 4TM1A 4EQWA 1GEUA 4JY2A 1IUWA 1O5WA 3ABVA 2WP5A 5CKUA 4G9KA 3V3OA 4C3YA 1VDCA 1XHCA 4YJGA 4Z44A 2V6OA 1KNPA 1Q9IA 1CJ3A 1EL8A 1TDKA 2C3DA 3C4AA 4M52A 1FEAA 1PBBA 1L9CA 4Y4NA 1S3EA 4H4UA 2WDQA 1ZOVA 3UOYA 3E1TA 3UP4A 2JKCA 2R9ZA 1PBCA 1PJ6A 3JSKA 3K7MX 4H2NA 3EF6A 2XVJA 3HYVA 4Y4MA 4YXDA 2GR2A 2B7RA 2C7GA 4H4RA 4TLZA 1FEBA 2I0ZA 2CFYA 1NHPA 3IHMA 1B37A 2XFNA 3GDNA 1CJ4A 1BKWA 4K22A 3NIXA 1GRGA 4H7UA 1F3PA 2BCGG 3GWFA 4TM4A 2BXSA 4A79A 1NDAA 4GDEA 3SZFA 1D7LA 3NTAA 3CNDA 1DOBA 1E1KA 2O9ZA 1L9EA 4IA5A 2VVLA 3NK2X 1EL7A 4J57A 5KMRA 4GF7A 3GWDA 5DBJA 1O94A 3T2YA 4GAVA 3UTGA 5IQ4A 4BJYA 4EQRA 4CCQA 4CRTA 1E1MA 2GQWA 3PO7A 3UKKA 1NG4A 1H7WA 4OPIA 4YKFA 4YTPA 4EMJA 3AXBA 3BI2A 1PXCA 2IVEA 3M13A 2X99A 3IWAA 3KKJA 1JRZA 3NGCX 4J33A 3NK0X 2R46A 4PABA 3AE5A 2GMHA 2WEUA 3VRBA 2XFUA 4ZCDA 2VQ7A 3H4KA 1PXBA 4DGKA 2CVJA 3IC9A 2WPEA 1L9DA 2A87A 3L1RA 1GSNA 2YG6A 2H88A 1RSGA 2VRMA 1ZK7A 3QSMA 3ICRA 3CNJA 3UOZA 4AP3A 2WPFA 1Q1WA 2B9WA 2H89A 3VRDB 3AE3A 4CCRA 2A89A 2BS3A 3GD3A 1GTHA 4K2XA 1SEZA 1NEKA 3CMMA 1DDOA 1HYUA 4WX1A 4JNAA 3T2KA 3D1CA 1PJ7A 1RYIA 2GAGB 3ZNNA 2XVEA 4FDCB 2B76A 4U2SA 2CDUA 3AYIA 2JB1A 1H86A 5FS9A 4G73A 1GRTA 3G3EA 1PHHA 3P4RA 4C5OA 1ZKQA 2VQBA 3LZWA 3DA1A 4USRA 4BJZA 2WESA 2WP6A 3VRAA 4H4QA 5KMQA 1UKVG 4OPTA 2BCPA 4U2TA 5BUKA 3CPJG 1KSUA 3URHA 4Z2TA 1PXAA 1VRQB 4C77A 4CBQA 3SYIA 3IHGA 1Y56A 2YLSA 3SXIA 2C70A 5FS7A 2XLUA 2XVFA 4YJHA 2YG4A 1MXTA 2IIDA 4NTCA 1VG9A 1JRYA 2OA1A 2E4AA 2Q0KA 2R0PA 4K5SA 2ZZCA 3GYIA 1PBDA 3T14A 2WQYA 1ZMDA 4U8JA 1BZLA 1QLBA 4ZN0A 4EQSA 2B7SA 1D4EA 3ZNOA 2E5VA 3UKHA 3L8KA 2XFPA 5IPYA 1C0PA 1PJ5A 3AE7A 1W4XA 2X3NA 4XWZA 1XDIA 4B1BA 4CNKA 4P9SA 4Z2RA 3CNPA 1BGNA 1OJ9A 3VR9A 2XLRA 4REKA 4O5UA 2ZZBA 1MOKA 3AEFA 4B65A 5C3JA 3QVRA 2APGA 2WBAA 4B67A 4YTMA 4I59A 4YJFB 3ZYXA 4TM3A 4YSZA 2WDRA 3ISHA 1LQTA 1TDFA 2WS3A 3FG2P 1S2QA 2BS2A 1CC6A 3AB1A 4TM0A 3RNMA 1H82A 1NG3A 2W0HA 4H4VA 2GB0A 4IVOB 2GAHB 2C72A 2E48A 4JNQA 4Z24A 3SZWA 3UKQA 3PS9A 1IUSA 1AN9A 1N4UA 1ZX9A 1RP0A 2FJEA 2GR3A 4ADWA 3NYCA 1ZY8A 2BC0A 5IQ1A 2GEWA 4H4SA 4CY6A 2HQMA 3ALMA 3QJ4A 4A6NA 4NTEA 2X8CA 3DJEA 2V3AA 3CTYA 4IVMB 3ICTA 3AYLA 1V59A 1Z6LA 2YM1A 5KVHA 3T2ZA 1GXFA 1F8SA 1C0KA 4NTDA 1S3BA 1CJ2A 2XYOA 1L0VA 1YY5A 2C3CA 3AD9B 2OLNA 3DK4A 1E6EA 2BK5A 2PYXA 3DJGX 4H4TA 4YSXA 5JCLA 3AEAA 3M0OA 3NH3X 3AE2A 4H4PA 4OPGA 4U8MA 2FBWA 4BURA 2A8XA 1M6IA 1Q1RA 4TLXA 3ADAB 4U8LA 5J7XA 4U8PA 4UP3A 1KDGA 4YT0A 5FS8A 3T31A 4WCTA 2GH5A 2ZBWA 1LVLA 2TMDA 3CGDA 1K0IA 4QFDA 5KXJA 4H2QA 1Y0PA 3ITJA 3F8PA 1K0LA 1NAAA 2WOIA 4ICYA 4Z26A 3NT6A 1GREA 3NNEA 3WGTA 3CNSA
chains in the Genus database with same CATH topology
1ZOYA 2EQ9A 3NN0X 2AR8A 4X9NA 1D7YA 2OAMA 2QA1A 5FS6A 3FBSA 5BVAA 1IJHA 1DJQA 1E1LA 1D5TA 3QSSA 3UTEA 2XCGA 4NZHA 2WOVA 3V3NA 3CN8A 4OPDA 3RP8A 4U2LA 2GV8A 4K8DA 2XDOA 3KD9A 1OJDA 2BACA 3KPKA 4D04A 5M10A 4PAAA 3SZCA 4A9WA 2GMJA 4EIPA 1NENA 3GSIA 2VOUA 3RP7A 2ZZ0A 3FPZA 4NEVA 5JCIA 3QSEA 2YLWA 3ALJA 2GVCA 3DGHA 1OJCA 3K7QX 4Y4LA 3BHFA 4JN9A 2C67A 2TPRA 2YQUA 3KVEA 2OALA 4H4XA 2C76A 5JCMA 3LOVA 1CBOA 2C73A 2WDVA 1IUXA 4DNAA 3LJPA 4APNA 1XPQA 3QVPA 4RG3A 5KVIA 1FCDA 1TYPA 4ECHA 2R4EA 1PS9A 2YR6A 3UKPA 3UKAA 3SM8A 3VQRA 2Q7VA 3HZLA 4U8NA 3G5RA 3SY4A 4AOSA 2NVKX 2RGOA 3GRSA 2C66A 3KA7A 3EAOA 4OPLA 4FK1A 5HHFA 1IUUA 1X31B 3CNTA 4H2PA 4JY3A 4FK1C 2JB2A 5EB5A 5TR3A 5LV9A 2YM2A 2V3BA 3RHAA 2E4GA 1BF3A 1CF3A 1TDNA 1JOAA 1M64A 2RABA 1PN0A 2GF3A 2V5ZA 2WP9A 3H8LA 3I6DA 4A65A 3P1WA 4LIIA 1FL2A 4X4JA 4CY8A 4RSLA 4YSYA 4GRTA 1E1NA 4YKGA 1YQZA 1GPEA 2GRTA 1DOCA 2FJAA 4I58A 1H84A 5FMHA 3B6DA 4D03A 4IA6A 1PBEA 4JDRA 1JNZA 2YG3A 1F8WA 3CGCA 1K0JA 1TRBA 1CJCA 3C96A 1DNCA 3EANA 1LJ1A 2RGHA 4EQXA 1QJDA 4BK2A 5U63A 3GYJA 3BI4A 1OJTA 1FECA 3O0HA 3Q6JA 5J60A 2Q0LA 1D4DA 2DKIA 4DSGA 4HB9A 2R0CA 4B68A 2X50A 2YG7A 1KSSA 1ZMCA 3GDPA 1JNRA 3KU9A 4FX9A 3UKFA 3UOVA 5KOWA 3BI5A 4EIQA 2BC1A 5BULA 1TYTA 2EQ6A 3F8RA 3SQPA 3AE1A 3GMBA 1GRFA 3HYWA 3P9UA 1ZP0A 2VVMA 1VQWA 4AP1A 1BGJA 1H7XA 2BABA 2RGJA 4GAPA 4AT0A 3AE4A 5ER0A 3UP5A 1VG0A 3NRNA 1COYA 2E1MA 2QCUA 1JRXA 4G6HA 2QAEA 5GSNA 4AOXA 4LU6A 4YSHA 4C74A 5CQFA 3NHOX 4NEWA 1B4VA 2EQ7A 1CC2A 1D4CA 2GR0A 4G74A 3K7TA 3REDA 4JQ9A 4H4YA 2BK4A 3AD8B 1F8RA 2YLXA 4ZCCA 3DGZA 2AQJA 2XLSA 3AE9A 2PHHA 3HYXA 1P2EA 5JCKA 1GT8A 2VZ2A 2YLTA 2J3NA 2IVDA 3GMCA 3NG7X 3PVCA 4J36A 3UOXA 4C3XA 4MJWA 4BK1A 1DXLA 1YQ3A 4BV6A 3AEDA 2ACZA 2Z5YA 3DK9A 5KRQA 4H4ZA 4EM3A 4EMIA 5C2TA 1PBFA 1ELIA 2YLZA 1GRAA 3FMWA 3QFBA 4U8OA 5EBKA 3V76A 3UTFA 2BXRA 5KWFA 3SZ0A 3ZDNA 3LXDA 3Q9TA 4LA1A 4A6NB 2VRLA 3NN6X 3NYEA 4EMWA 1MO9A 5KMSA 3BHKA 3F8DA 2YG5A 3CGBA 1CHUA 1DJNA 3P4QA 1LQUA 4UDRA 4CNJA 2XVIA 4GUVA 1KF6A 3AWIA 2WU5A 1FOHA 2V61A 4OPUA 2OLOA 4U8KA 5BRTA 3EPTA 4B63A 2R4JA 2AAQA 2BS4A 4OVIA 1E39A 4USQA 3AEBA 4U8IA 2BA9A 2WETA 3OZ2A 1NHSA 1GESA 1TDEA 3AE6A 1GALA 2BYBA 4RG4A 3OC4A 3P4SA 2NPXA 1LPFA 1N4VA 2XLTA 2YR5A 1REOA 1XANA 2VVLG 4B64A 1KFYA 1GRHA 2Y6RA 4X9MA 3GYXA 5L46A 3IF9A 2XLPA 3P4PA 1GNDA 1EBDA 3KPFA 3ICSA 3NLCA 1LV0A 1QO8A 4EM4A 1IUTA 2YAUA 1KNRA 4UDPA 2EQ8A 3AE8A 2WHDA 1EL9A 3KLJA 3G5QA 3QFAA 4K5RA 4KPRA 5M0ZA 2FJBA 3CIRA 4G6GA 1H81A 4Z25A 3M12A 3T37A 3DJJA 1YQ4A 2Q6UA 1DODA 3AEGA 3DJDA 2YVJA 3R9UA 2ARDA 2GQFA 4UDQA 3S61A 1N1PA 1YKJA 2JBVA 2V60A 2CULA 1H83A 4NWZA 1AOGA 3T0KA 4IV9A 2BRAA 1DOEA 1P2HA 3AEEA 3NK1X 3ALLA 2B9XA 1NPXA 5KMPA 5HYMA 4H50A 4K7ZA 5GRTA 5KOXA 3II4A 3LADA 1F6MA 3FIMB 1BWCA 1CL0A 3GD4A 1LTXR 2Y6QA 2F5ZA 3VR8A 2C4CA 4DSHA 3NYFA 1NHRA 1GTEA 1K4QA 2WU2A 4E0VA 1NHQA 2C64A 4A99A 4NNJA 5JCNA 2BRYA 2JB3A 1O95A 2YWLA 4O5QA 3COXA 2JK6A 5U25A 4GDPA 4H2RA 4II2A 3GRTA 4YWOA 2YLRA 3SGLA 3I3LA 4B66A 3G5SA 1CC4A 5HY5A 3LB8A 1B8SA 1S2YA 2XVHA 1JEHA 4GR1A 2YVFA 2R45A 2R0GA 2C65A 4A5LA 3UTHA 3DH9A 4Z2UA 3CPHG 1PDHA 3AD7B 3B3RA 4J31A 1B5QA 3S5WA 5EB4A 1E7PA 5KNLA 1Y56B 3AYJA 1N4WA 3C4NA 1IUVA 5U1OA 2UZZA 4YTNA 2DKHA 3RP6A 2C75A 2WOWA 1TDOA 2XFQA 2XFOA 4KX6A 3AECA 2JAEA 4A7AA 4II3A 1ONFA 3NKSA 3UCLA 3LZXA 4J2WA 4OPCA 4J56A 3SFEA 4AT2A 3H8IA 4Z43A 5HXIA 1GERA 2QA2A 3ATRA 3SFDA 1JU2A 3SX6A 1GV4A 3NTDA 1EL5A 1GETA 4GCMA 4XWRA 3DMEA 3K30A 2X8GA 4B69A 3CPIG 2Z5XA 4HA6A 1H6VA 4BK3A 5EOWA 2YVGA 3ATQA 2YR4A 4H4WA 1GOSA 4OCGA 3BNUA 2GR1A 3BNMA 4N9XA 4XXGA 2WPCA 2BK3A 2B9YA 3D8XA 3DK8A 1ZDLA 1GRBA 4J34A 2X8HA 3CGEA 1OJAA 3UKLA 4TM1A 4EQWA 1GEUA 4JY2A 1IUWA 1O5WA 3ABVA 2WP5A 5CKUA 4G9KA 3V3OA 4C3YA 1VDCA 1XHCA 4Z44A 2V6OA 1KNPA 1Q9IA 1CJ3A 1EL8A 1TDKA 2C3DA 3C4AA 4M52A 1FEAA 1PBBA 1L9CA 4Y4NA 1S3EA 4H4UA 2WDQA 1ZOVA 3UOYA 3E1TA 3UP4A 2JKCA 2R9ZA 1PBCA 1PJ6A 3JSKA 3K7MX 4H2NA 3EF6A 2XVJA 3HYVA 4Y4MA 4YXDA 2GR2A 2B7RA 2C7GA 4H4RA 4TLZA 1FEBA 2I0ZA 2CFYA 1NHPA 3IHMA 1B37A 2XFNA 3GDNA 1CJ4A 4K22A 1BKWA 3NIXA 1GRGA 4H7UA 1F3PA 2BCGG 3GWFA 4TM4A 2BXSA 4A79A 1NDAA 4GDEA 3SZFA 1D7LA 3NTAA 3CNDA 1DOBA 1E1KA 2O9ZA 4IA5A 1L9EA 2VVLA 3NK2X 1EL7A 4J57A 5KMRA 4GF7A 3GWDA 5DBJA 1O94A 3T2YA 4GAVA 3UTGA 5IQ4A 4BJYA 4EQRA 4CCQA 4CRTA 1E1MA 2GQWA 3PO7A 3UKKA 1H7WA 1NG4A 4OPIA 4YKFA 4YTPA 4EMJA 3AXBA 3BI2A 1PXCA 2IVEA 2X99A 3M13A 3IWAA 3KKJA 1JRZA 3NGCX 4J33A 3NK0X 2R46A 4PABA 3AE5A 2GMHA 2WEUA 3VRBA 2XFUA 4ZCDA 2VQ7A 3H4KA 1PXBA 4DGKA 2CVJA 3IC9A 2WPEA 1L9DA 2A87A 3L1RA 1GSNA 2YG6A 2H88A 1RSGA 2VRMA 1ZK7A 3QSMA 3ICRA 3CNJA 3UOZA 4AP3A 2WPFA 1Q1WA 2B9WA 2H89A 3VRDB 3AE3A 4CCRA 2A89A 2BS3A 3GD3A 1GTHA 4K2XA 1SEZA 1NEKA 3CMMA 1HYUA 4WX1A 4JNAA 3T2KA 3D1CA 1PJ7A 1RYIA 2GAGB 2XVEA 4FDCB 4U2SA 2B76A 2CDUA 3AYIA 2JB1A 1H86A 5FS9A 4G73A 1GRTA 1PHHA 3P4RA 4C5OA 1ZKQA 2VQBA 3LZWA 3DA1A 4USRA 4BJZA 2WESA 2WP6A 3VRAA 4H4QA 5KMQA 1UKVG 4OPTA 2BCPA 4U2TA 5BUKA 3CPJG 1KSUA 3URHA 4Z2TA 1PXAA 1VRQB 4C77A 4CBQA 3SYIA 3IHGA 1Y56A 2YLSA 3SXIA 2C70A 5FS7A 2XLUA 2XVFA 2YG4A 1MXTA 2IIDA 4NTCA 1VG9A 1JRYA 2OA1A 2Q0KA 2R0PA 4K5SA 2ZZCA 3GYIA 1PBDA 3T14A 2WQYA 1ZMDA 4U8JA 1BZLA 1QLBA 4ZN0A 4EQSA 2B7SA 1D4EA 2E5VA 3UKHA 3L8KA 2XFPA 5IPYA 1PJ5A 3AE7A 1W4XA 2X3NA 4XWZA 1XDIA 4B1BA 4CNKA 4P9SA 4Z2RA 3CNPA 1BGNA 1OJ9A 3VR9A 2XLRA 4REKA 4O5UA 2ZZBA 1MOKA 3AEFA 4B65A 5C3JA 3QVRA 2APGA 2WBAA 4B67A 4YTMA 4I59A 3ZYXA 4TM3A 4YSZA 2WDRA 3ISHA 1LQTA 1TDFA 2WS3A 3FG2P 1S2QA 2BS2A 1CC6A 3AB1A 4TM0A 3RNMA 1H82A 1NG3A 2W0HA 4H4VA 2GB0A 4IVOB 2GAHB 2C72A 4JNQA 4Z24A 3SZWA 3UKQA 3WE0A 3PS9A 1IUSA 1ZX9A 1N4UA 1RP0A 2FJEA 2GR3A 4ADWA 3NYCA 1ZY8A 2BC0A 5IQ1A 2GEWA 4H4SA 4CY6A 2HQMA 3ALMA 3QJ4A 4A6NA 4NTEA 2X8CA 3DJEA 2V3AA 3CTYA 4IVMB 3ICTA 3AYLA 1V59A 1Z6LA 2YM1A 5KVHA 3T2ZA 1GXFA 1F8SA 4NTDA 1S3BA 1CJ2A 2XYOA 1L0VA 1YY5A 2C3CA 3AD9B 2OLNA 3DK4A 1E6EA 2BK5A 2PYXA 3DJGX 4H4TA 4YSXA 5JCLA 3AEAA 3M0OA 3NH3X 3AE2A 4H4PA 4OPGA 4U8MA 2FBWA 4BURA 2A8XA 1M6IA 1Q1RA 4TLXA 3ADAB 4U8LA 5J7XA 4U8PA 4UP3A 1KDGA 4YT0A 5FS8A 3T31A 2GH5A 4WCTA 2ZBWA 1LVLA 2TMDA 3CGDA 1K0IA 5KXJA 4H2QA 1Y0PA 3ITJA 3F8PA 1K0LA 1NAAA 2WOIA 4ICYA 4Z26A 3NT6A 1GREA 3NNEA 2FJDA 3CNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOY A;  2EQ9 A;  3NN0 X;  2AR8 A;  4X9N A;  1D7Y A;  2OAM A;  2QA1 A;  5FS6 A;  3FBS A;  5BVA A;  1IJH A;  1DJQ A;  1E1L A;  1D5T A;  3QSS A;  3UTE A;  2XCG A;  4NZH A;  2WOV A;  3V3N A;  3CN8 A;  4OPD A;  3RP8 A;  4U2L A;  2GV8 A;  4K8D A;  2XDO A;  3KD9 A;  1OJD A;  2BAC A;  4D04 A;  5M10 A;  4PAA A;  4A9W A;  2GMJ A;  4EIP A;  1NEN A;  3GSI A;  2VOU A;  3RP7 A;  2ZZ0 A;  3FPZ A;  4NEV A;  5JCI A;  3QSE A;  2YLW A;  3ALJ A;  2GVC A;  3DGH A;  1OJC A;  3K7Q X;  4Y4L A;  3BHF A;  4JN9 A;  2C67 A;  2TPR A;  2YQU A;  3KVE A;  2OAL A;  4H4X A;  2C76 A;  5JCM A;  3LOV A;  1CBO A;  2C73 A;  2WDV A;  1IUX A;  4DNA A;  3LJP A;  4APN A;  1XPQ A;  3QVP A;  4RG3 A;  5KVI A;  1FCD A;  1TYP A;  4ECH A;  2R4E A;  1PS9 A;  2YR6 A;  3UKP A;  3UKA A;  3SM8 A;  3VQR A;  2Q7V A;  3HZL A;  4U8N A;  3G5R A;  4AOS A;  2NVK X;  2RGO A;  3GRS A;  2C66 A;  3KA7 A;  3EAO A;  4OPL A;  4FK1 A;  5HHF A;  1IUU A;  1X31 B;  3CNT A;  4H2P A;  4JY3 A;  4FK1 C;  2JB2 A;  5EB5 A;  5TR3 A;  5LV9 A;  2YM2 A;  2V3B A;  3RHA A;  2E4G A;  1BF3 A;  1CF3 A;  1TDN A;  1JOA A;  1M64 A;  2RAB A;  1PN0 A;  2GF3 A;  2V5Z A;  2WP9 A;  3H8L A;  3I6D A;  4A65 A;  3P1W A;  4LII A;  1FL2 A;  4X4J A;  4CY8 A;  4RSL A;  4YSY A;  4GRT A;  1E1N A;  4YKG A;  1YQZ A;  1GPE A;  2GRT A;  1DOC A;  2FJA A;  4I58 A;  1H84 A;  5FMH A;  3B6D A;  4D03 A;  1PBE A;  4IA6 A;  4JDR A;  1JNZ A;  2YG3 A;  1F8W A;  3CGC A;  1K0J A;  1TRB A;  1CJC A;  3C96 A;  1DNC A;  3EAN A;  1LJ1 A;  2RGH A;  4EQX A;  1QJD A;  4BK2 A;  5U63 A;  3GYJ A;  3BI4 A;  1OJT A;  1FEC A;  3O0H A;  3Q6J A;  5J60 A;  2Q0L A;  1D4D A;  2DKI A;  4DSG A;  4HB9 A;  2R0C A;  4B68 A;  2X50 A;  2YG7 A;  1KSS A;  1ZMC A;  3GDP A;  1JNR A;  3KU9 A;  4FX9 A;  3UKF A;  3UOV A;  5KOW A;  3BI5 A;  4EIQ A;  2BC1 A;  5BUL A;  1TYT A;  2EQ6 A;  3F8R A;  3SQP A;  3AE1 A;  3GMB A;  1GRF A;  3P9U A;  1ZP0 A;  2VVM A;  1VQW A;  4AP1 A;  1BGJ A;  1H7X A;  2BAB A;  2RGJ A;  4AT0 A;  3AE4 A;  5ER0 A;  3UP5 A;  1VG0 A;  3NRN A;  1COY A;  2E1M A;  2QCU A;  1JRX A;  2QAE A;  5GSN A;  4AOX A;  4LU6 A;  4YSH A;  4C74 A;  5CQF A;  3NHO X;  4NEW A;  1B4V A;  2EQ7 A;  1CC2 A;  1D4C A;  2GR0 A;  3K7T A;  3RED A;  4JQ9 A;  4H4Y A;  2BK4 A;  3AD8 B;  1F8R A;  2YLX A;  4ZCC A;  3DGZ A;  2AQJ A;  2XLS A;  3AE9 A;  2PHH A;  1P2E A;  5JCK A;  1GT8 A;  2VZ2 A;  2YLT A;  2J3N A;  2IVD A;  3GMC A;  3NG7 X;  3PVC A;  4J36 A;  3UOX A;  4C3X A;  4MJW A;  4BK1 A;  1DXL A;  1YQ3 A;  4BV6 A;  3AED A;  2ACZ A;  2Z5Y A;  3DK9 A;  5KRQ A;  4H4Z A;  4EM3 A;  4EMI A;  5C2T A;  1PBF A;  1ELI A;  2YLZ A;  1GRA A;  3FMW A;  3QFB A;  4U8O A;  5EBK A;  3V76 A;  3UTF A;  2BXR A;  5KWF A;  3ZDN A;  3LXD A;  3Q9T A;  4LA1 A;  4A6N B;  2VRL A;  3NN6 X;  3NYE A;  4EMW A;  1MO9 A;  3BHK A;  3F8D A;  2YG5 A;  3CGB A;  1CHU A;  1DJN A;  3P4Q A;  1LQU A;  4UDR A;  4CNJ A;  2XVI A;  4GUV A;  1KF6 A;  3AWI A;  2WU5 A;  1FOH A;  2V61 A;  4OPU A;  2OLO A;  4U8K A;  5BRT A;  3EPT A;  4B63 A;  2R4J A;  2AAQ A;  2BS4 A;  4OVI A;  1E39 A;  4USQ A;  3AEB A;  4U8I A;  2BA9 A;  2WET A;  3OZ2 A;  1NHS A;  1GES A;  1TDE A;  3AE6 A;  1GAL A;  2BYB A;  4RG4 A;  3OC4 A;  3P4S A;  2NPX A;  1LPF A;  1N4V A;  2XLT A;  2YR5 A;  1REO A;  1XAN A;  2VVL G;  4B64 A;  1KFY A;  1GRH A;  2Y6R A;  4X9M A;  5L46 A;  3IF9 A;  2XLP A;  3P4P A;  1GND A;  1EBD A;  3KPF A;  3ICS A;  3NLC A;  1LV0 A;  1QO8 A;  4EM4 A;  1IUT A;  2YAU A;  1KNR A;  4UDP A;  2EQ8 A;  3AE8 A;  2WHD A;  1EL9 A;  3KLJ A;  3G5Q A;  3QFA A;  4K5R A;  4KPR A;  5M0Z A;  2FJB A;  3CIR A;  1H81 A;  4Z25 A;  3M12 A;  3T37 A;  3DJJ A;  1YQ4 A;  2Q6U A;  1DOD A;  3AEG A;  3DJD A;  2YVJ A;  3R9U A;  2ARD A;  2GQF A;  4UDQ A;  3S61 A;  1N1P A;  1YKJ A;  2JBV A;  2V60 A;  2CUL A;  1H83 A;  1AOG A;  4IV9 A;  1DOE A;  1P2H A;  3AEE A;  3NK1 X;  3ALL A;  2B9X A;  1NPX A;  4H50 A;  5HYM A;  4K7Z A;  5GRT A;  5KOX A;  3II4 A;  3LAD A;  1F6M A;  3FIM B;  1BWC A;  1CL0 A;  3GD4 A;  1LTX R;  2Y6Q A;  2F5Z A;  3VR8 A;  4DSH A;  3NYF A;  1NHR A;  1GTE A;  1K4Q A;  2WU2 A;  4E0V A;  1NHQ A;  2C64 A;  4A99 A;  5JCN A;  2JB3 A;  1O95 A;  2YWL A;  4O5Q A;  3COX A;  2JK6 A;  5U25 A;  4GDP A;  4H2R A;  3GRT A;  4YWO A;  2YLR A;  3SGL A;  3I3L A;  4B66 A;  3G5S A;  1CC4 A;  5HY5 A;  3LB8 A;  1B8S A;  1S2Y A;  2XVH A;  1JEH A;  4GR1 A;  2YVF A;  2R45 A;  2R0G A;  2C65 A;  4A5L A;  3UTH A;  3DH9 A;  4Z2U A;  3CPH G;  1PDH A;  3AD7 B;  3B3R A;  4J31 A;  1B5Q A;  3S5W A;  5EB4 A;  1E7P A;  1Y56 B;  3AYJ A;  1N4W A;  3C4N A;  1IUV A;  5U1O A;  2UZZ A;  4YTN A;  2DKH A;  2WOW A;  2C75 A;  3RP6 A;  1TDO A;  2XFQ A;  2XFO A;  4KX6 A;  3AEC A;  2JAE A;  4A7A A;  1ONF A;  3NKS A;  3UCL A;  3LZX A;  4J2W A;  4OPC A;  4J56 A;  3SFE A;  4AT2 A;  3H8I A;  4Z43 A;  5HXI A;  1GER A;  2QA2 A;  3ATR A;  3SFD A;  1JU2 A;  1GV4 A;  3NTD A;  1EL5 A;  1GET A;  4GCM A;  4XWR A;  3DME A;  3K30 A;  2X8G A;  4B69 A;  3CPI G;  2Z5X A;  4HA6 A;  1H6V A;  4BK3 A;  5EOW A;  2YVG A;  3ATQ A;  2YR4 A;  4H4W A;  1GOS A;  4OCG A;  3BNU A;  2GR1 A;  3BNM A;  4N9X A;  4XXG A;  2WPC A;  2BK3 A;  2B9Y A;  3D8X A;  3DK8 A;  1ZDL A;  1GRB A;  4J34 A;  2X8H A;  3CGE A;  1OJA A;  3UKL A;  4TM1 A;  4EQW A;  1GEU A;  4JY2 A;  1IUW A;  1O5W A;  3ABV A;  2WP5 A;  5CKU A;  3V3O A;  4C3Y A;  1VDC A;  1XHC A;  4Z44 A;  2V6O A;  1KNP A;  1Q9I A;  1CJ3 A;  1EL8 A;  1TDK A;  2C3D A;  3C4A A;  4M52 A;  1FEA A;  1PBB A;  1L9C A;  4Y4N A;  1S3E A;  4H4U A;  2WDQ A;  1ZOV A;  3UOY A;  3E1T A;  3UP4 A;  2JKC A;  2R9Z A;  1PBC A;  1PJ6 A;  3JSK A;  3K7M X;  4H2N A;  3EF6 A;  2XVJ A;  4Y4M A;  4YXD A;  2GR2 A;  2B7R A;  2C7G A;  4H4R A;  4TLZ A;  1FEB A;  2I0Z A;  2CFY A;  1NHP A;  1B37 A;  2XFN A;  3IHM A;  3GDN A;  1CJ4 A;  4K22 A;  1BKW A;  3NIX A;  1GRG A;  4H7U A;  1F3P A;  2BCG G;  3GWF A;  4TM4 A;  2BXS A;  4A79 A;  1NDA A;  4GDE A;  1D7L A;  3NTA A;  3CND A;  1DOB A;  1E1K A;  2O9Z A;  1L9E A;  2VVL A;  3NK2 X;  4IA5 A;  1EL7 A;  4J57 A;  4GF7 A;  3GWD A;  5DBJ A;  1O94 A;  3UTG A;  5IQ4 A;  4BJY A;  4EQR A;  4CCQ A;  4CRT A;  1E1M A;  2GQW A;  3PO7 A;  3UKK A;  1H7W A;  1NG4 A;  4OPI A;  4YKF A;  4YTP A;  4EMJ A;  3AXB A;  3BI2 A;  1PXC A;  2IVE A;  2X99 A;  3M13 A;  3IWA A;  3KKJ A;  1JRZ A;  3NGC X;  4J33 A;  3NK0 X;  2R46 A;  4PAB A;  3AE5 A;  2GMH A;  2WEU A;  3VRB A;  2XFU A;  4ZCD A;  2VQ7 A;  3H4K A;  1PXB A;  4DGK A;  2CVJ A;  3IC9 A;  2WPE A;  1L9D A;  2A87 A;  3L1R A;  1GSN A;  2YG6 A;  2H88 A;  1RSG A;  2VRM A;  1ZK7 A;  3QSM A;  3ICR A;  3CNJ A;  3UOZ A;  4AP3 A;  2WPF A;  1Q1W A;  2B9W A;  2H89 A;  3VRD B;  3AE3 A;  4CCR A;  2A89 A;  2BS3 A;  3GD3 A;  1GTH A;  4K2X A;  1SEZ A;  1NEK A;  1HYU A;  4WX1 A;  4JNA A;  3D1C A;  1PJ7 A;  1RYI A;  2GAG B;  2XVE A;  4FDC B;  4U2S A;  2B76 A;  2CDU A;  3AYI A;  2JB1 A;  1H86 A;  5FS9 A;  1GRT A;  1PHH A;  3P4R A;  4C5O A;  1ZKQ A;  2VQB A;  3LZW A;  3DA1 A;  4USR A;  2WES A;  2WP6 A;  4BJZ A;  3VRA A;  4H4Q A;  1UKV G;  4OPT A;  2BCP A;  4U2T A;  5BUK A;  3CPJ G;  1KSU A;  3URH A;  4Z2T A;  1PXA A;  1VRQ B;  4C77 A;  4CBQ A;  3IHG A;  1Y56 A;  2YLS A;  2C70 A;  5FS7 A;  2XLU A;  2XVF A;  2YG4 A;  1MXT A;  2IID A;  4NTC A;  1VG9 A;  1JRY A;  2OA1 A;  2Q0K A;  2R0P A;  4K5S A;  2ZZC A;  3GYI A;  1PBD A;  2WQY A;  1ZMD A;  4U8J A;  1BZL A;  1QLB A;  4ZN0 A;  4EQS A;  2B7S A;  1D4E A;  2E5V A;  3UKH A;  3L8K A;  2XFP A;  5IPY A;  1PJ5 A;  3AE7 A;  1W4X A;  2X3N A;  4XWZ A;  1XDI A;  4B1B A;  4CNK A;  4P9S A;  4Z2R A;  3CNP A;  1BGN A;  1OJ9 A;  3VR9 A;  2XLR A;  4REK A;  4O5U A;  2ZZB A;  1MOK A;  3AEF A;  4B65 A;  5C3J A;  3QVR A;  2APG A;  2WBA A;  4B67 A;  4YTM A;  4I59 A;  3ZYX A;  4TM3 A;  4YSZ A;  2WDR A;  3ISH A;  1LQT A;  1TDF A;  2WS3 A;  3FG2 P;  1S2Q A;  2BS2 A;  1CC6 A;  3AB1 A;  4TM0 A;  3RNM A;  1H82 A;  1NG3 A;  2W0H A;  4H4V A;  2GB0 A;  4IVO B;  2GAH B;  2C72 A;  4JNQ A;  4Z24 A;  3UKQ A;  3WE0 A;  3PS9 A;  1IUS A;  1ZX9 A;  1N4U A;  1RP0 A;  2GR3 A;  2FJE A;  4ADW A;  3NYC A;  1ZY8 A;  2BC0 A;  5IQ1 A;  2GEW A;  4H4S A;  4CY6 A;  2HQM A;  3ALM A;  3QJ4 A;  4A6N A;  4NTE A;  2X8C A;  3DJE A;  2V3A A;  3CTY A;  4IVM B;  3ICT A;  3AYL A;  1V59 A;  1Z6L A;  2YM1 A;  5KVH A;  1GXF A;  1F8S A;  4NTD A;  1S3B A;  1CJ2 A;  2XYO A;  1L0V A;  1YY5 A;  2C3C A;  3AD9 B;  2OLN A;  3DK4 A;  1E6E A;  2BK5 A;  2PYX A;  3DJG X;  4H4T A;  4YSX A;  5JCL A;  3AEA A;  3M0O A;  3NH3 X;  3AE2 A;  4H4P A;  4OPG A;  4U8M A;  2FBW A;  4BUR A;  2A8X A;  1M6I A;  1Q1R A;  4TLX A;  3ADA B;  4U8L A;  5J7X A;  4U8P A;  4UP3 A;  1KDG A;  4YT0 A;  5FS8 A;  2GH5 A;  4WCT A;  2ZBW A;  1LVL A;  2TMD A;  3CGD A;  1K0I A;  5KXJ A;  4H2Q A;  1Y0P A;  3ITJ A;  3F8P A;  1K0L A;  1NAA A;  2WOI A;  4ICY A;  4Z26 A;  3NT6 A;  1GRE A;  3NNE A;  2FJD A;  3CNS A; 
#chains in the Genus database with same CATH topology
 1ZOY A;  2EQ9 A;  3NN0 X;  4X9N A;  2AR8 A;  1D7Y A;  2OAM A;  2QA1 A;  5FS6 A;  3FBS A;  5BVA A;  1IJH A;  1DJQ A;  1E1L A;  1D5T A;  3QSS A;  3UTE A;  2XCG A;  4NZH A;  2WOV A;  1C0L A;  3V3N A;  3CN8 A;  4OPD A;  3RP8 A;  4U2L A;  2GV8 A;  4K8D A;  2XDO A;  3KD9 A;  1OJD A;  3CUK A;  2BAC A;  3KPK A;  4D04 A;  5M10 A;  4PAA A;  3SZC A;  4A9W A;  2GMJ A;  4EIP A;  1NEN A;  3GSI A;  2VOU A;  3RP7 A;  2ZZ0 A;  3FPZ A;  4NEV A;  5JCI A;  3QSE A;  2YLW A;  3ALJ A;  2GVC A;  3DGH A;  1OJC A;  3K7Q X;  4Y4L A;  3BHF A;  4JN9 A;  2C67 A;  2TPR A;  2YQU A;  3KVE A;  2OAL A;  4H4X A;  2C76 A;  5JCM A;  3LOV A;  1CBO A;  2C73 A;  2WDV A;  1IUX A;  4DNA A;  3LJP A;  4APN A;  1XPQ A;  3QVP A;  4RG3 A;  5KVI A;  1FCD A;  1TYP A;  4ECH A;  2R4E A;  2DU8 A;  3VQR A;  1PS9 A;  2YR6 A;  3SM8 A;  3UKP A;  3UKA A;  2Q7V A;  3HZL A;  4U8N A;  3G5R A;  3SY4 A;  4AOS A;  2RGO A;  2NVK X;  3GRS A;  2C66 A;  3KA7 A;  3EAO A;  4OPL A;  4FK1 A;  5HHF A;  1IUU A;  1X31 B;  3CNT A;  4H2P A;  4JY3 A;  3ZNP A;  4FK1 C;  2JB2 A;  5EB5 A;  5TR3 A;  5LV9 A;  2YM2 A;  2V3B A;  3RHA A;  1TDN A;  1BF3 A;  1CF3 A;  2E4G A;  1JOA A;  1M64 A;  2RAB A;  1PN0 A;  2GF3 A;  2V5Z A;  2WP9 A;  3H8L A;  3I6D A;  4A65 A;  3P1W A;  4LII A;  1FL2 A;  4X4J A;  4CY8 A;  4RSL A;  4YSY A;  4GRT A;  1E1N A;  4YKG A;  1YQZ A;  1GPE A;  2GRT A;  1DOC A;  2FJA A;  4I58 A;  1H84 A;  5FMH A;  3B6D A;  4D03 A;  1PBE A;  4IA6 A;  4JDR A;  1JNZ A;  2YG3 A;  1F8W A;  3CGC A;  1K0J A;  1EVI A;  1TRB A;  1CJC A;  3C96 A;  1DNC A;  3EAN A;  1LJ1 A;  2RGH A;  4EQX A;  1QJD A;  4BK2 A;  5U63 A;  1KIF A;  3GYJ A;  3BI4 A;  1OJT A;  1FEC A;  3O0H A;  3Q6J A;  5J60 A;  2Q0L A;  1D4D A;  2DKI A;  4DSG A;  4HB9 A;  2R0C A;  4B68 A;  2X50 A;  2YG7 A;  1C0I A;  1KSS A;  1ZMC A;  1JNR A;  3GDP A;  3KU9 A;  4FX9 A;  3UKF A;  3UOV A;  5KOW A;  3BI5 A;  4EIQ A;  2BC1 A;  5BUL A;  1TYT A;  2EQ6 A;  3F8R A;  3SQP A;  3AE1 A;  3GMB A;  4YJH B;  1GRF A;  3HYW A;  3P9U A;  1ZP0 A;  2VVM A;  1VQW A;  4AP1 A;  1BGJ A;  1H7X A;  2BAB A;  2RGJ A;  4GAP A;  4AT0 A;  3AE4 A;  5ER0 A;  3UP5 A;  3W4K A;  1VG0 A;  3NRN A;  1COY A;  2E1M A;  2QCU A;  1JRX A;  4G6H A;  2QAE A;  5GSN A;  4YSH A;  4LU6 A;  4AOX A;  4C74 A;  5CQF A;  3NHO X;  4NEW A;  1B4V A;  2EQ7 A;  1CC2 A;  1D4C A;  2GR0 A;  4G74 A;  3K7T A;  3RED A;  4JQ9 A;  4H4Y A;  2BK4 A;  3AD8 B;  1F8R A;  4Z43 A;  2YLX A;  4ZCC A;  3DGZ A;  2AQJ A;  2XLS A;  3AE9 A;  2PHH A;  2FJD A;  1P2E A;  3HYX A;  5JCK A;  1GT8 A;  2VZ2 A;  2YLT A;  2J3N A;  2IVD A;  3GMC A;  3NG7 X;  3PVC A;  4J36 A;  3UOX A;  4C3X A;  4MJW A;  4BK1 A;  1DXL A;  1YQ3 A;  4BV6 A;  3AED A;  2ACZ A;  2Z5Y A;  3DK9 A;  5KRQ A;  4H4Z A;  4EM3 A;  4EMI A;  5C2T A;  1PBF A;  1ELI A;  2YLZ A;  1GRA A;  3FMW A;  3QFB A;  4U8O A;  5EBK A;  3V76 A;  3UTF A;  2BXR A;  5KWF A;  3SZ0 A;  3ZDN A;  3LXD A;  3Q9T A;  4LA1 A;  4A6N B;  3NYE A;  2VRL A;  3NN6 X;  4EMW A;  1MO9 A;  5KMS A;  3BHK A;  3F8D A;  2YG5 A;  3CGB A;  1CHU A;  1DJN A;  3P4Q A;  1LQU A;  4UDR A;  4CNJ A;  2XVI A;  4GUV A;  1KF6 A;  3AWI A;  2WU5 A;  1FOH A;  2V61 A;  4OPU A;  2OLO A;  4U8K A;  5BRT A;  3EPT A;  4B63 A;  2R4J A;  2AAQ A;  2BS4 A;  4OVI A;  4YJF A;  1E39 A;  4USQ A;  3AEB A;  4U8I A;  2BA9 A;  3WE0 A;  2WET A;  3OZ2 A;  1NHS A;  1GES A;  1TDE A;  3AE6 A;  1GAL A;  2BYB A;  4RG4 A;  3OC4 A;  3P4S A;  2NPX A;  1LPF A;  1N4V A;  2XLT A;  2YR5 A;  1REO A;  1XAN A;  2VVL G;  4B64 A;  1KFY A;  5L46 A;  1GRH A;  4X9M A;  2Y6R A;  3GYX A;  3IF9 A;  2XLP A;  3P4P A;  1GND A;  2E49 A;  1EBD A;  3KPF A;  3ICS A;  3NLC A;  1LV0 A;  1QO8 A;  4EM4 A;  1IUT A;  2YAU A;  1KNR A;  4UDP A;  2EQ8 A;  3AE8 A;  2WHD A;  1EL9 A;  3KLJ A;  3G5Q A;  3QFA A;  4K5R A;  4KPR A;  5M0Z A;  2FJB A;  3CIR A;  4G6G A;  1H81 A;  4Z25 A;  3M12 A;  3T37 A;  3DJJ A;  1YQ4 A;  2Q6U A;  1DOD A;  3DJD A;  3AEG A;  2YVJ A;  3R9U A;  2ARD A;  2GQF A;  4UDQ A;  3S61 A;  4YJD A;  1N1P A;  1YKJ A;  2JBV A;  2V60 A;  2CUL A;  1H83 A;  4NWZ A;  1AOG A;  3T0K A;  4IV9 A;  2BRA A;  1DOE A;  1P2H A;  3AEE A;  3NK1 X;  3ALL A;  2B9X A;  1NPX A;  5KMP A;  5HYM A;  4H50 A;  4K7Z A;  5GRT A;  5KOX A;  3II4 A;  3LAD A;  1F6M A;  3FIM B;  4YJG B;  1BWC A;  1CL0 A;  3GD4 A;  1LTX R;  2Y6Q A;  2F5Z A;  3VR8 A;  2C4C A;  4DSH A;  3NYF A;  1NHR A;  1GTE A;  1K4Q A;  2WU2 A;  4E0V A;  1NHQ A;  2C64 A;  4A99 A;  4NNJ A;  5JCN A;  2BRY A;  2JB3 A;  1O95 A;  2YWL A;  4O5Q A;  3COX A;  2JK6 A;  5U25 A;  4GDP A;  4H2R A;  4II2 A;  3GRT A;  4YWO A;  2YLR A;  3SGL A;  3I3L A;  4B66 A;  3G5S A;  1VE9 A;  1CC4 A;  5HY5 A;  3LB8 A;  1B8S A;  1S2Y A;  2XVH A;  3ZNQ A;  1JEH A;  4GR1 A;  2YVF A;  2R45 A;  2R0G A;  2C65 A;  4A5L A;  1DAO A;  3UTH A;  3DH9 A;  4Z2U A;  3CPH G;  1PDH A;  3AD7 B;  3B3R A;  4J31 A;  1B5Q A;  2E82 A;  5EB4 A;  1E7P A;  3S5W A;  5KNL A;  1Y56 B;  3AYJ A;  3C4N A;  1N4W A;  1IUV A;  5U1O A;  2UZZ A;  4YTN A;  2DKH A;  3RP6 A;  2C75 A;  2WOW A;  1TDO A;  2XFQ A;  2XFO A;  4KX6 A;  3AEC A;  2JAE A;  4A7A A;  4II3 A;  1ONF A;  3NKS A;  3UCL A;  3LZX A;  4J2W A;  4OPC A;  4QFC A;  4J56 A;  3SFE A;  3H8I A;  4AT2 A;  5HXI A;  1GER A;  2QA2 A;  3ATR A;  3SFD A;  1JU2 A;  3SX6 A;  1GV4 A;  3NTD A;  1EL5 A;  1GET A;  4GCM A;  4XWR A;  3DME A;  3K30 A;  3W4I A;  2X8G A;  4B69 A;  3CPI G;  2Z5X A;  4HA6 A;  1H6V A;  4BK3 A;  5EOW A;  2YVG A;  3ATQ A;  2YR4 A;  4H4W A;  1GOS A;  4OCG A;  3BNU A;  2GR1 A;  3BNM A;  4N9X A;  4XXG A;  2WPC A;  2BK3 A;  3W4J A;  2B9Y A;  3D8X A;  3DK8 A;  1ZDL A;  1GRB A;  4J34 A;  2X8H A;  3CGE A;  1OJA A;  3UKL A;  4TM1 A;  4EQW A;  1GEU A;  4JY2 A;  1IUW A;  1O5W A;  3ABV A;  2WP5 A;  5CKU A;  4G9K A;  3V3O A;  4C3Y A;  1VDC A;  1XHC A;  4YJG A;  4Z44 A;  2V6O A;  1KNP A;  1Q9I A;  1CJ3 A;  1EL8 A;  1TDK A;  2C3D A;  3C4A A;  4M52 A;  1FEA A;  1PBB A;  1L9C A;  4Y4N A;  1S3E A;  4H4U A;  2WDQ A;  1ZOV A;  3UOY A;  3E1T A;  3UP4 A;  2JKC A;  2R9Z A;  1PBC A;  1PJ6 A;  3JSK A;  3K7M X;  4H2N A;  3EF6 A;  2XVJ A;  3HYV A;  4Y4M A;  4YXD A;  2GR2 A;  2B7R A;  2C7G A;  4H4R A;  4TLZ A;  1FEB A;  2I0Z A;  2CFY A;  1NHP A;  3IHM A;  1B37 A;  2XFN A;  3GDN A;  1CJ4 A;  1BKW A;  4K22 A;  3NIX A;  1GRG A;  4H7U A;  1F3P A;  2BCG G;  3GWF A;  4TM4 A;  2BXS A;  4A79 A;  1NDA A;  4GDE A;  3SZF A;  1D7L A;  3NTA A;  3CND A;  1DOB A;  1E1K A;  2O9Z A;  1L9E A;  4IA5 A;  2VVL A;  3NK2 X;  1EL7 A;  4J57 A;  5KMR A;  4GF7 A;  3GWD A;  5DBJ A;  1O94 A;  3T2Y A;  4GAV A;  3UTG A;  5IQ4 A;  4BJY A;  4EQR A;  4CCQ A;  4CRT A;  1E1M A;  2GQW A;  3PO7 A;  3UKK A;  1NG4 A;  1H7W A;  4OPI A;  4YKF A;  4YTP A;  4EMJ A;  3AXB A;  3BI2 A;  1PXC A;  2IVE A;  3M13 A;  2X99 A;  3IWA A;  3KKJ A;  1JRZ A;  3NGC X;  4J33 A;  3NK0 X;  2R46 A;  4PAB A;  3AE5 A;  2GMH A;  2WEU A;  3VRB A;  2XFU A;  4ZCD A;  2VQ7 A;  3H4K A;  1PXB A;  4DGK A;  2CVJ A;  3IC9 A;  2WPE A;  1L9D A;  2A87 A;  3L1R A;  1GSN A;  2YG6 A;  2H88 A;  1RSG A;  2VRM A;  1ZK7 A;  3QSM A;  3ICR A;  3CNJ A;  3UOZ A;  4AP3 A;  2WPF A;  1Q1W A;  2B9W A;  2H89 A;  3VRD B;  3AE3 A;  4CCR A;  2A89 A;  2BS3 A;  3GD3 A;  1GTH A;  4K2X A;  1SEZ A;  1NEK A;  3CMM A;  1DDO A;  1HYU A;  4WX1 A;  4JNA A;  3T2K A;  3D1C A;  1PJ7 A;  1RYI A;  2GAG B;  3ZNN A;  2XVE A;  4FDC B;  2B76 A;  4U2S A;  2CDU A;  3AYI A;  2JB1 A;  1H86 A;  5FS9 A;  4G73 A;  1GRT A;  3G3E A;  1PHH A;  3P4R A;  4C5O A;  1ZKQ A;  2VQB A;  3LZW A;  3DA1 A;  4USR A;  4BJZ A;  2WES A;  2WP6 A;  3VRA A;  4H4Q A;  5KMQ A;  1UKV G;  4OPT A;  2BCP A;  4U2T A;  5BUK A;  3CPJ G;  1KSU A;  3URH A;  4Z2T A;  1PXA A;  1VRQ B;  4C77 A;  4CBQ A;  3SYI A;  3IHG A;  1Y56 A;  2YLS A;  3SXI A;  2C70 A;  5FS7 A;  2XLU A;  2XVF A;  4YJH A;  2YG4 A;  1MXT A;  2IID A;  4NTC A;  1VG9 A;  1JRY A;  2OA1 A;  2E4A A;  2Q0K A;  2R0P A;  4K5S A;  2ZZC A;  3GYI A;  1PBD A;  3T14 A;  2WQY A;  1ZMD A;  4U8J A;  1BZL A;  1QLB A;  4ZN0 A;  4EQS A;  2B7S A;  1D4E A;  3ZNO A;  2E5V A;  3UKH A;  3L8K A;  2XFP A;  5IPY A;  1C0P A;  1PJ5 A;  3AE7 A;  1W4X A;  2X3N A;  4XWZ A;  1XDI A;  4B1B A;  4CNK A;  4P9S A;  4Z2R A;  3CNP A;  1BGN A;  1OJ9 A;  3VR9 A;  2XLR A;  4REK A;  4O5U A;  2ZZB A;  1MOK A;  3AEF A;  4B65 A;  5C3J A;  3QVR A;  2APG A;  2WBA A;  4B67 A;  4YTM A;  4I59 A;  4YJF B;  3ZYX A;  4TM3 A;  4YSZ A;  2WDR A;  3ISH A;  1LQT A;  1TDF A;  2WS3 A;  3FG2 P;  1S2Q A;  2BS2 A;  1CC6 A;  3AB1 A;  4TM0 A;  3RNM A;  1H82 A;  1NG3 A;  2W0H A;  4H4V A;  2GB0 A;  4IVO B;  2GAH B;  2C72 A;  2E48 A;  4JNQ A;  4Z24 A;  3SZW A;  3UKQ A;  3PS9 A;  1IUS A;  1AN9 A;  1N4U A;  1ZX9 A;  1RP0 A;  2FJE A;  2GR3 A;  4ADW A;  3NYC A;  1ZY8 A;  2BC0 A;  5IQ1 A;  2GEW A;  4H4S A;  4CY6 A;  2HQM A;  3ALM A;  3QJ4 A;  4A6N A;  4NTE A;  2X8C A;  3DJE A;  2V3A A;  3CTY A;  4IVM B;  3ICT A;  3AYL A;  1V59 A;  1Z6L A;  2YM1 A;  5KVH A;  3T2Z A;  1GXF A;  1F8S A;  1C0K A;  4NTD A;  1S3B A;  1CJ2 A;  2XYO A;  1L0V A;  1YY5 A;  2C3C A;  3AD9 B;  2OLN A;  3DK4 A;  1E6E A;  2BK5 A;  2PYX A;  3DJG X;  4H4T A;  4YSX A;  5JCL A;  3AEA A;  3M0O A;  3NH3 X;  3AE2 A;  4H4P A;  4OPG A;  4U8M A;  2FBW A;  4BUR A;  2A8X A;  1M6I A;  1Q1R A;  4TLX A;  3ADA B;  4U8L A;  5J7X A;  4U8P A;  4UP3 A;  1KDG A;  4YT0 A;  5FS8 A;  3T31 A;  4WCT A;  2GH5 A;  2ZBW A;  1LVL A;  2TMD A;  3CGD A;  1K0I A;  4QFD A;  5KXJ A;  4H2Q A;  1Y0P A;  3ITJ A;  3F8P A;  1K0L A;  1NAA A;  2WOI A;  4ICY A;  4Z26 A;  3NT6 A;  1GRE A;  3NNE A;  3WGT A;  3CNS A; 
#chains in the Genus database with same CATH homology
 1ZOY A;  2EQ9 A;  3NN0 X;  2AR8 A;  4X9N A;  1D7Y A;  2OAM A;  2QA1 A;  5FS6 A;  3FBS A;  5BVA A;  1IJH A;  1DJQ A;  1E1L A;  1D5T A;  3QSS A;  3UTE A;  2XCG A;  4NZH A;  2WOV A;  3V3N A;  3CN8 A;  4OPD A;  3RP8 A;  4U2L A;  2GV8 A;  4K8D A;  2XDO A;  3KD9 A;  1OJD A;  2BAC A;  3KPK A;  4D04 A;  5M10 A;  4PAA A;  3SZC A;  4A9W A;  2GMJ A;  4EIP A;  1NEN A;  3GSI A;  2VOU A;  3RP7 A;  2ZZ0 A;  3FPZ A;  4NEV A;  5JCI A;  3QSE A;  2YLW A;  3ALJ A;  2GVC A;  3DGH A;  1OJC A;  3K7Q X;  4Y4L A;  3BHF A;  4JN9 A;  2C67 A;  2TPR A;  2YQU A;  3KVE A;  2OAL A;  4H4X A;  2C76 A;  5JCM A;  3LOV A;  1CBO A;  2C73 A;  2WDV A;  1IUX A;  4DNA A;  3LJP A;  4APN A;  1XPQ A;  3QVP A;  4RG3 A;  5KVI A;  1FCD A;  1TYP A;  4ECH A;  2R4E A;  1PS9 A;  2YR6 A;  3UKP A;  3UKA A;  3SM8 A;  3VQR A;  2Q7V A;  3HZL A;  4U8N A;  3G5R A;  3SY4 A;  4AOS A;  2NVK X;  2RGO A;  3GRS A;  2C66 A;  3KA7 A;  3EAO A;  4OPL A;  4FK1 A;  5HHF A;  1IUU A;  1X31 B;  3CNT A;  4H2P A;  4JY3 A;  4FK1 C;  2JB2 A;  5EB5 A;  5TR3 A;  5LV9 A;  2YM2 A;  2V3B A;  3RHA A;  2E4G A;  1BF3 A;  1CF3 A;  1TDN A;  1JOA A;  1M64 A;  2RAB A;  1PN0 A;  2GF3 A;  2V5Z A;  2WP9 A;  3H8L A;  3I6D A;  4A65 A;  3P1W A;  4LII A;  1FL2 A;  4X4J A;  4CY8 A;  4RSL A;  4YSY A;  4GRT A;  1E1N A;  4YKG A;  1YQZ A;  1GPE A;  2GRT A;  1DOC A;  2FJA A;  4I58 A;  1H84 A;  5FMH A;  3B6D A;  4D03 A;  4IA6 A;  1PBE A;  4JDR A;  1JNZ A;  2YG3 A;  1F8W A;  3CGC A;  1K0J A;  1TRB A;  1CJC A;  3C96 A;  1DNC A;  3EAN A;  1LJ1 A;  2RGH A;  4EQX A;  1QJD A;  4BK2 A;  5U63 A;  3GYJ A;  3BI4 A;  1OJT A;  1FEC A;  3O0H A;  3Q6J A;  5J60 A;  2Q0L A;  1D4D A;  2DKI A;  4DSG A;  4HB9 A;  2R0C A;  4B68 A;  2X50 A;  2YG7 A;  1KSS A;  1ZMC A;  3GDP A;  1JNR A;  3KU9 A;  4FX9 A;  3UKF A;  3UOV A;  5KOW A;  3BI5 A;  4EIQ A;  2BC1 A;  5BUL A;  1TYT A;  2EQ6 A;  3F8R A;  3SQP A;  3AE1 A;  3GMB A;  1GRF A;  3HYW A;  3P9U A;  1ZP0 A;  2VVM A;  1VQW A;  4AP1 A;  1BGJ A;  1H7X A;  2BAB A;  2RGJ A;  4GAP A;  4AT0 A;  3AE4 A;  5ER0 A;  3UP5 A;  1VG0 A;  3NRN A;  1COY A;  2E1M A;  2QCU A;  1JRX A;  4G6H A;  2QAE A;  5GSN A;  4AOX A;  4LU6 A;  4YSH A;  4C74 A;  5CQF A;  3NHO X;  4NEW A;  1B4V A;  2EQ7 A;  1CC2 A;  1D4C A;  2GR0 A;  4G74 A;  3K7T A;  3RED A;  4JQ9 A;  4H4Y A;  2BK4 A;  3AD8 B;  1F8R A;  2YLX A;  4ZCC A;  3DGZ A;  2AQJ A;  2XLS A;  3AE9 A;  2PHH A;  3HYX A;  1P2E A;  5JCK A;  1GT8 A;  2VZ2 A;  2YLT A;  2J3N A;  2IVD A;  3GMC A;  3NG7 X;  3PVC A;  4J36 A;  3UOX A;  4C3X A;  4MJW A;  4BK1 A;  1DXL A;  1YQ3 A;  4BV6 A;  3AED A;  2ACZ A;  2Z5Y A;  3DK9 A;  5KRQ A;  4H4Z A;  4EM3 A;  4EMI A;  5C2T A;  1PBF A;  1ELI A;  2YLZ A;  1GRA A;  3FMW A;  3QFB A;  4U8O A;  5EBK A;  3V76 A;  3UTF A;  2BXR A;  5KWF A;  3SZ0 A;  3ZDN A;  3LXD A;  3Q9T A;  4LA1 A;  4A6N B;  2VRL A;  3NN6 X;  3NYE A;  4EMW A;  1MO9 A;  5KMS A;  3BHK A;  3F8D A;  2YG5 A;  3CGB A;  1CHU A;  1DJN A;  3P4Q A;  1LQU A;  4UDR A;  4CNJ A;  2XVI A;  4GUV A;  1KF6 A;  3AWI A;  2WU5 A;  1FOH A;  2V61 A;  4OPU A;  2OLO A;  4U8K A;  5BRT A;  3EPT A;  4B63 A;  2R4J A;  2AAQ A;  2BS4 A;  4OVI A;  1E39 A;  4USQ A;  3AEB A;  4U8I A;  2BA9 A;  2WET A;  3OZ2 A;  1NHS A;  1GES A;  1TDE A;  3AE6 A;  1GAL A;  2BYB A;  4RG4 A;  3OC4 A;  3P4S A;  2NPX A;  1LPF A;  1N4V A;  2XLT A;  2YR5 A;  1REO A;  1XAN A;  2VVL G;  4B64 A;  1KFY A;  1GRH A;  2Y6R A;  4X9M A;  3GYX A;  5L46 A;  3IF9 A;  2XLP A;  3P4P A;  1GND A;  1EBD A;  3KPF A;  3ICS A;  3NLC A;  1LV0 A;  1QO8 A;  4EM4 A;  1IUT A;  2YAU A;  1KNR A;  4UDP A;  2EQ8 A;  3AE8 A;  2WHD A;  1EL9 A;  3KLJ A;  3G5Q A;  3QFA A;  4K5R A;  4KPR A;  5M0Z A;  2FJB A;  3CIR A;  4G6G A;  1H81 A;  4Z25 A;  3M12 A;  3T37 A;  3DJJ A;  1YQ4 A;  2Q6U A;  1DOD A;  3AEG A;  3DJD A;  2YVJ A;  3R9U A;  2ARD A;  2GQF A;  4UDQ A;  3S61 A;  1N1P A;  1YKJ A;  2JBV A;  2V60 A;  2CUL A;  1H83 A;  4NWZ A;  1AOG A;  3T0K A;  4IV9 A;  2BRA A;  1DOE A;  1P2H A;  3AEE A;  3NK1 X;  3ALL A;  2B9X A;  1NPX A;  5KMP A;  5HYM A;  4H50 A;  4K7Z A;  5GRT A;  5KOX A;  3II4 A;  3LAD A;  1F6M A;  3FIM B;  1BWC A;  1CL0 A;  3GD4 A;  1LTX R;  2Y6Q A;  2F5Z A;  3VR8 A;  2C4C A;  4DSH A;  3NYF A;  1NHR A;  1GTE A;  1K4Q A;  2WU2 A;  4E0V A;  1NHQ A;  2C64 A;  4A99 A;  4NNJ A;  5JCN A;  2BRY A;  2JB3 A;  1O95 A;  2YWL A;  4O5Q A;  3COX A;  2JK6 A;  5U25 A;  4GDP A;  4H2R A;  4II2 A;  3GRT A;  4YWO A;  2YLR A;  3SGL A;  3I3L A;  4B66 A;  3G5S A;  1CC4 A;  5HY5 A;  3LB8 A;  1B8S A;  1S2Y A;  2XVH A;  1JEH A;  4GR1 A;  2YVF A;  2R45 A;  2R0G A;  2C65 A;  4A5L A;  3UTH A;  3DH9 A;  4Z2U A;  3CPH G;  1PDH A;  3AD7 B;  3B3R A;  4J31 A;  1B5Q A;  3S5W A;  5EB4 A;  1E7P A;  5KNL A;  1Y56 B;  3AYJ A;  1N4W A;  3C4N A;  1IUV A;  5U1O A;  2UZZ A;  4YTN A;  2DKH A;  3RP6 A;  2C75 A;  2WOW A;  1TDO A;  2XFQ A;  2XFO A;  4KX6 A;  3AEC A;  2JAE A;  4A7A A;  4II3 A;  1ONF A;  3NKS A;  3UCL A;  3LZX A;  4J2W A;  4OPC A;  4J56 A;  3SFE A;  4AT2 A;  3H8I A;  4Z43 A;  5HXI A;  1GER A;  2QA2 A;  3ATR A;  3SFD A;  1JU2 A;  3SX6 A;  1GV4 A;  3NTD A;  1EL5 A;  1GET A;  4GCM A;  4XWR A;  3DME A;  3K30 A;  2X8G A;  4B69 A;  3CPI G;  2Z5X A;  4HA6 A;  1H6V A;  4BK3 A;  5EOW A;  2YVG A;  3ATQ A;  2YR4 A;  4H4W A;  1GOS A;  4OCG A;  3BNU A;  2GR1 A;  3BNM A;  4N9X A;  4XXG A;  2WPC A;  2BK3 A;  2B9Y A;  3D8X A;  3DK8 A;  1ZDL A;  1GRB A;  4J34 A;  2X8H A;  3CGE A;  1OJA A;  3UKL A;  4TM1 A;  4EQW A;  1GEU A;  4JY2 A;  1IUW A;  1O5W A;  3ABV A;  2WP5 A;  5CKU A;  4G9K A;  3V3O A;  4C3Y A;  1VDC A;  1XHC A;  4Z44 A;  2V6O A;  1KNP A;  1Q9I A;  1CJ3 A;  1EL8 A;  1TDK A;  2C3D A;  3C4A A;  4M52 A;  1FEA A;  1PBB A;  1L9C A;  4Y4N A;  1S3E A;  4H4U A;  2WDQ A;  1ZOV A;  3UOY A;  3E1T A;  3UP4 A;  2JKC A;  2R9Z A;  1PBC A;  1PJ6 A;  3JSK A;  3K7M X;  4H2N A;  3EF6 A;  2XVJ A;  3HYV A;  4Y4M A;  4YXD A;  2GR2 A;  2B7R A;  2C7G A;  4H4R A;  4TLZ A;  1FEB A;  2I0Z A;  2CFY A;  1NHP A;  3IHM A;  1B37 A;  2XFN A;  3GDN A;  1CJ4 A;  4K22 A;  1BKW A;  3NIX A;  1GRG A;  4H7U A;  1F3P A;  2BCG G;  3GWF A;  4TM4 A;  2BXS A;  4A79 A;  1NDA A;  4GDE A;  3SZF A;  1D7L A;  3NTA A;  3CND A;  1DOB A;  1E1K A;  2O9Z A;  4IA5 A;  1L9E A;  2VVL A;  3NK2 X;  1EL7 A;  4J57 A;  5KMR A;  4GF7 A;  3GWD A;  5DBJ A;  1O94 A;  3T2Y A;  4GAV A;  3UTG A;  5IQ4 A;  4BJY A;  4EQR A;  4CCQ A;  4CRT A;  1E1M A;  2GQW A;  3PO7 A;  3UKK A;  1H7W A;  1NG4 A;  4OPI A;  4YKF A;  4YTP A;  4EMJ A;  3AXB A;  3BI2 A;  1PXC A;  2IVE A;  2X99 A;  3M13 A;  3IWA A;  3KKJ A;  1JRZ A;  3NGC X;  4J33 A;  3NK0 X;  2R46 A;  4PAB A;  3AE5 A;  2GMH A;  2WEU A;  3VRB A;  2XFU A;  4ZCD A;  2VQ7 A;  3H4K A;  1PXB A;  4DGK A;  2CVJ A;  3IC9 A;  2WPE A;  1L9D A;  2A87 A;  3L1R A;  1GSN A;  2YG6 A;  2H88 A;  1RSG A;  2VRM A;  1ZK7 A;  3QSM A;  3ICR A;  3CNJ A;  3UOZ A;  4AP3 A;  2WPF A;  1Q1W A;  2B9W A;  2H89 A;  3VRD B;  3AE3 A;  4CCR A;  2A89 A;  2BS3 A;  3GD3 A;  1GTH A;  4K2X A;  1SEZ A;  1NEK A;  3CMM A;  1HYU A;  4WX1 A;  4JNA A;  3T2K A;  3D1C A;  1PJ7 A;  1RYI A;  2GAG B;  2XVE A;  4FDC B;  4U2S A;  2B76 A;  2CDU A;  3AYI A;  2JB1 A;  1H86 A;  5FS9 A;  4G73 A;  1GRT A;  1PHH A;  3P4R A;  4C5O A;  1ZKQ A;  2VQB A;  3LZW A;  3DA1 A;  4USR A;  4BJZ A;  2WES A;  2WP6 A;  3VRA A;  4H4Q A;  5KMQ A;  1UKV G;  4OPT A;  2BCP A;  4U2T A;  5BUK A;  3CPJ G;  1KSU A;  3URH A;  4Z2T A;  1PXA A;  1VRQ B;  4C77 A;  4CBQ A;  3SYI A;  3IHG A;  1Y56 A;  2YLS A;  3SXI A;  2C70 A;  5FS7 A;  2XLU A;  2XVF A;  2YG4 A;  1MXT A;  2IID A;  4NTC A;  1VG9 A;  1JRY A;  2OA1 A;  2Q0K A;  2R0P A;  4K5S A;  2ZZC A;  3GYI A;  1PBD A;  3T14 A;  2WQY A;  1ZMD A;  4U8J A;  1BZL A;  1QLB A;  4ZN0 A;  4EQS A;  2B7S A;  1D4E A;  2E5V A;  3UKH A;  3L8K A;  2XFP A;  5IPY A;  1PJ5 A;  3AE7 A;  1W4X A;  2X3N A;  4XWZ A;  1XDI A;  4B1B A;  4CNK A;  4P9S A;  4Z2R A;  3CNP A;  1BGN A;  1OJ9 A;  3VR9 A;  2XLR A;  4REK A;  4O5U A;  2ZZB A;  1MOK A;  3AEF A;  4B65 A;  5C3J A;  3QVR A;  2APG A;  2WBA A;  4B67 A;  4YTM A;  4I59 A;  3ZYX A;  4TM3 A;  4YSZ A;  2WDR A;  3ISH A;  1LQT A;  1TDF A;  2WS3 A;  3FG2 P;  1S2Q A;  2BS2 A;  1CC6 A;  3AB1 A;  4TM0 A;  3RNM A;  1H82 A;  1NG3 A;  2W0H A;  4H4V A;  2GB0 A;  4IVO B;  2GAH B;  2C72 A;  4JNQ A;  4Z24 A;  3SZW A;  3UKQ A;  3WE0 A;  3PS9 A;  1IUS A;  1ZX9 A;  1N4U A;  1RP0 A;  2FJE A;  2GR3 A;  4ADW A;  3NYC A;  1ZY8 A;  2BC0 A;  5IQ1 A;  2GEW A;  4H4S A;  4CY6 A;  2HQM A;  3ALM A;  3QJ4 A;  4A6N A;  4NTE A;  2X8C A;  3DJE A;  2V3A A;  3CTY A;  4IVM B;  3ICT A;  3AYL A;  1V59 A;  1Z6L A;  2YM1 A;  5KVH A;  3T2Z A;  1GXF A;  1F8S A;  4NTD A;  1S3B A;  1CJ2 A;  2XYO A;  1L0V A;  1YY5 A;  2C3C A;  3AD9 B;  2OLN A;  3DK4 A;  1E6E A;  2BK5 A;  2PYX A;  3DJG X;  4H4T A;  4YSX A;  5JCL A;  3AEA A;  3M0O A;  3NH3 X;  3AE2 A;  4H4P A;  4OPG A;  4U8M A;  2FBW A;  4BUR A;  2A8X A;  1M6I A;  1Q1R A;  4TLX A;  3ADA B;  4U8L A;  5J7X A;  4U8P A;  4UP3 A;  1KDG A;  4YT0 A;  5FS8 A;  3T31 A;  2GH5 A;  4WCT A;  2ZBW A;  1LVL A;  2TMD A;  3CGD A;  1K0I A;  5KXJ A;  4H2Q A;  1Y0P A;  3ITJ A;  3F8P A;  1K0L A;  1NAA A;  2WOI A;  4ICY A;  4Z26 A;  3NT6 A;  1GRE A;  3NNE A;  2FJD A;  3CNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...