4H2PA

Tetrameric form of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
GKTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
total genus 124
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2pA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2pA01
2W0HA 1D7YA 2VVLA 2YVFA 2J3NA 1GRFA 2PHHA 1XPQA 1LQTA 2VRLA 4ZCCA 4K8DA 3AE8A 3D1CA 3GRSA 4JN9A 2BCPA 5KRQA 5HHFA 1ZMCA 2YR4A 2YG6A 4H4TA 5J60A 3R9UA 2JB1A 4IA5A 2X50A 3KPFA 2B76A 1ZY8A 3ADAB 5FS8A 4GF7A 1ZX9A 3LOVA 2NVKX 3AE6A 1E1LA 1PJ5A 4GCMA 3ITJA 3AE7A 4BURA 4A65A 4Z43A 4H7UA 3NK2X 1EL7A 1D4DA 4TM0A 5M10A 3FPZA 2Z5YA 2XFQA 2XVIA 2Q0LA 3DJJA 1B4VA 3AE1A 4K22A 4IA6A 1COYA 1EL9A 3G5SA 5KOWA 1IJHA 1QO8A 4DGKA 1PBEA 2GR2A 5M0ZA 1GALA 1K0JA 2GAGB 3BNUA 4TM1A 1FOHA 1JRYA 4AP1A 3SGLA 4YT0A 1GRGA 1ZKQA 4C3XA 3JSKA 2EQ8A 2A87A 2V60A 1B8SA 2BYBA 2QA1A 4EMJA 2A8XA 4H2RA 1D7LA 4EQRA 1X31B 2WU5A 2ARDA 4U2LA 3AWIA 3AYLA 3ALMA 1H7XA 2XLUA 1O5WA 4M52A 1PHHA 3WE0A 3NNEA 2WDVA 1H86A 3PVCA 3ALLA 2YLWA 4TLXA 3L8KA 1PXCA 1H83A 1NHPA 3NN6X 3GYIA 2GVCA 3G5RA 3NH3X 2Z5XA 3VRDB 3BI4A 2WPEA 4H4VA 4YKFA 4YSHA 3SFEA 2A89A 4D03A 5JCLA 3COXA 4JDRA 1N1PA 2Q0KA 3KLJA 3EAOA 1OJ9A 2X8CA 5TR3A 1Y0PA 4EIQA 1BWCA 1K4QA 1LTXR 1NG4A 4U8MA 4B67A 3CNDA 2V3BA 4J34A 3V3OA 3C4NA 2YG4A 1CBOA 2XLRA 4N9XA 4OPIA 1UKVG 1KFYA 1CC4A 1FCDA 1NPXA 3UP5A 4OPLA 2C72A 1GOSA 4H4PA 2BA9A 1NENA 2QCUA 3VQRA 3NT6A 2B7SA 4J33A 2FJEA 2R9ZA 5EB5A 3GMCA 3L1RA 3DJDA 1CJ3A 2I0ZA 3EF6A 3QVRA 2YVGA 2IIDA 3ISHA 3B3RA 3QSEA 3QFAA 2BK5A 3NGCX 1SEZA 2IVEA 2YLZA 2E5VA 4CCQA 4YKGA 1VG0A 3FIMB 4YTPA 1VQWA 1RP0A 4H2PA 4FDCB 4CNKA 4USQA 1VG9A 4LA1A 3KVEA 3UCLA 4MJWA 2GR3A 2JB2A 4UDQA 1HYUA 1N4VA 2YR5A 2XLSA 5EBKA 1GNDA 4YSXA 4AT2A 1NHQA 2V3AA 3CPIG 2Y6QA 3GWDA 4GUVA 2JK6A 1CJCA 5FS9A 2WETA 1H84A 1OJCA 1ZOYA 1QLBA 3AB1A 3KU9A 1GTEA 3QFBA 3IC9A 4BK2A 2GQWA 4O5UA 3FG2P 4H2NA 3NKSA 1CJ4A 1REOA 1VRQB 4C74A 2YLXA 3DGZA 3AE3A 4BK3A 1Z6LA 1TRBA 1P2HA 2WDQA 2WP9A 3AEFA 1ZK7A 4H4RA 4HA6A 5BULA 4JNQA 1ZOVA 3UKLA 3IHGA 2FJBA 3UOZA 4X9MA 4Z2UA 3SFDA 4H4ZA 4OCGA 1XANA 2BS3A 2XCGA 5BRTA 2ZZCA 3RHAA 1E1NA 3OZ2A 4YSZA 1YQZA 4PAAA 3QJ4A 2R4EA 5FS7A 1GTHA 3K7TA 4Y4LA 2GR1A 4OPGA 2CULA 1NG3A 2VZ2A 4OPTA 4U8NA 2BS2A 4K2XA 2FJDA 3OC4A 4JY2A 1KSSA 1S2QA 2WOWA 2DKHA 4I59A 4NTCA 3GMBA 4Z24A 3AD8B 3H4KA 2OLNA 1PN0A 2C3CA 4DSHA 1TYTA 2GV8A 2RABA 4CY8A 3LB8A 1K0LA 3UP4A 2C75A 3ALJA 3ICTA 1D4EA 5U1OA 1ELIA 1FEBA 4J57A 4H4QA 4NZHA 4GR1A 3P9UA 2Q7VA 3EANA 3AE5A 2R0CA 1Y56A 4Z44A 1TDEA 4ICYA 2XVJA 1KNPA 3UTEA 3PO7A 4LU6A 4AT0A 1JNRA 1EL8A 3GYJA 4B63A 1MXTA 2WU2A 3QSSA 1GPEA 3F8RA 1NHSA 1DODA 3BHKA 4FK1A 4EQSA 4JQ9A 1K0IA 2GB0A 3I3LA 5IQ4A 4B65A 3NK1X 2R46A 3UKPA 4A6NA 1TDNA 3IWAA 2YG3A 1E1MA 1NHRA 2JKCA 3II4A 4WCTA 4Z25A 3DK8A 1GREA 3F8PA 2EQ6A 2WEUA 1DXLA 1PXBA 4AP3A 4XXGA 1CHUA 2XLTA 3M13A 3UOYA 3AEEA 3AD7B 3BNMA 2X8HA 3G5QA 5IPYA 1PXAA 1XDIA 2R4JA 2GF3A 3GD3A 3ABVA 4D04A 3CGDA 3E1TA 2YWLA 2GRTA 1GETA 3AEGA 1FL2A 2YLRA 4GRTA 1N4UA 4FK1C 4H4WA 3LJPA 4EQWA 1CC6A 5HXIA 3AYIA 3VR9A 4ZCDA 1BF3A 3K7MX 3K7QX 5KVIA 1JRXA 1NAAA 1B5QA 1JEHA 1D4CA 5JCNA 5LV9A 3GD4A 2RGJA 1Q1WA 2JBVA 4OPCA 4ADWA 3SQPA 4EMWA 2C64A 3NK0X 2QA2A 2WHDA 1E39A 3LZWA 4YXDA 2OLOA 1XHCA 2V61A 4BJYA 2YM2A 3ATRA 1H7WA 2OALA 5IQ1A 1GRAA 3LXDA 3CNJA 5EB4A 1FEAA 5J7XA 3NIXA 2VQBA 5BUKA 4H2QA 2UZZA 4U8OA 3P4SA 3ICRA 1S3BA 2WESA 2HQMA 3CIRA 4A7AA 4H4UA 5KOXA 2YG5A 2B9YA 2VQ7A 2H89A 2XYOA 2WOVA 2ZZ0A 3CGBA 3UKHA 1LVLA 1IUTA 2XVEA 3V3NA 1Y56B 4BK1A 4H4YA 4ZN0A 3GRTA 3RP7A 3DK9A 4YTNA 2AR8A 1KDGA 2XDOA 3CNTA 1B37A 2C65A 3C96A 4GDEA 3Q6JA 3NN0X 2EQ7A 4PABA 1PDHA 4YTMA 3UTGA 4A99A 1MOKA 3KD9A 3H8IA 4FX9A 3S61A 4JY3A 2JB3A 1LJ1A 2GMJA 2BCGG 4KPRA 3LADA 3P4PA 3AYJA 3CPHG 2GAHB 3T37A 3UKFA 4C3YA 1CJ2A 3ZDNA 2C3DA 4O5QA 1GV4A 2BS4A 4BV6A 2C7GA 4C77A 4P9SA 3C4AA 5FMHA 3UOXA 4EM4A 1PBDA 2C70A 2XVFA 2X3NA 2R0GA 2V6OA 3CNSA 3P4RA 3UOVA 4H4SA 3CPJG 2ZZBA 1P2EA 3GWFA 4UP3A 4Z2TA 3RNMA 3IHMA 1H81A 2XVHA 5KXJA 1RSGA 3K30A 3VRBA 4CCRA 2C76A 3IF9A 1BGJA 3ZYXA 2EQ9A 3F8DA 1GRTA 4J2WA 1F8WA 3NLCA 1DJNA 4OPDA 3NTAA 1S2YA 5GRTA 2AAQA 4NEWA 4NEVA 3NTDA 1L0VA 1O95A 1F6MA 2DKIA 1TDKA 2ACZA 4B64A 5BVAA 4X4JA 2VVLG 1GRHA 2X99A 3DGHA 4AOSA 4U8IA 4OVIA 4DNAA 3NHOX 2IVDA 2PYXA 2TMDA 4KX6A 3LZXA 3CN8A 4USRA 4RG3A 4K5SA 4C5OA 1GT8A 2VOUA 2XFOA 3DH9A 4CY6A 3DMEA 2O9ZA 2RGOA 2WPCA 3NYEA 3PS9A 1QJDA 3AD9B 3DJEA 5EOWA 1LV0A 1YQ4A 1IUVA 2BABA 2V5ZA 2YLSA 1F8SA 4IVMB 4RG4A 2CVJA 3BI2A 4X9NA 4XWZA 1M6IA 2XFUA 5HYMA 1D5TA 4EIPA 1EBDA 1PJ6A 1YQ3A 4H4XA 5JCKA 4K7ZA 1DOCA 3M12A 1H6VA 2FJAA 2BXRA 2C73A 5JCMA 1OJAA 1M64A 3FBSA 2BACA 4IV9A 1NEKA 4E0VA 4OPUA 2F5ZA 2BC0A 3GSIA 4HB9A 3CGCA 3DA1A 2FBWA 2WS3A 1L9DA 2CDUA 3RP8A 4I58A 5JCIA 1GXFA 2Y6RA 3P4QA 2APGA 3UKKA 2BK4A 2GMHA 1GSNA 1IUWA 3AXBA 3DK4A 2WQYA 5HY5A 4A9WA 1KNRA 4J31A 3Q9TA 4B1BA 1VDCA 5ER0A 1GERA 3SM8A 4U8KA 1JNZA 2BXSA 2VRMA 3UKQA 2GEWA 3AECA 1ZP0A 1IUSA 4NTDA 3AEAA 2OAMA 4LIIA 5FS6A 4BJZA 3REDA 2GQFA 3NRNA 3CNPA 3HZLA 3FMWA 1IUUA 1PBCA 1PJ7A 4U8JA 3NYCA 4J36A 4WX1A 2X8GA 4TM3A 2B9WA 4U2SA 1Q9IA 2QAEA 3AEDA 3ATQA 3URHA 4UDPA 2WP6A 2YLTA 3H8LA 1L9CA 1N4WA 1S3EA 1BGNA 1IUXA 1DNCA 3QVPA 4CRTA 1H82A 1OJDA 3P1WA 5KVHA 4EQXA 1O94A 4APNA 1Q1RA 4Y4NA 4A79A 2YR6A 5C3JA 5DBJA 4B66A 3GDPA 1E7PA 1PBBA 3QSMA 2GH5A 4U2TA 3AE9A 2NPXA 1TYPA 1BKWA 3O0HA 3KKJA 2C67A 2XLPA 5CQFA 3V76A 2OA1A 1F8RA 3B6DA 1ZMDA 3UTFA 3D8XA 1OJTA 2H88A 1V59A 2YM1A 2YG7A 3AE2A 4TLZA 4CNJA 1BZLA 2R0PA 1MO9A 3VR8A 4NTEA 3VRAA 5C2TA 2WDRA 4XWRA 3NG7X 1CL0A 1PS9A 1E1KA 2Q6UA 1ZDLA 1FECA 4IVOB 1EL5A 2TPRA 1JOAA 2B7RA 3UKAA 4A6NB 2BK3A 4TM4A 1E6EA 3I6DA 3ICSA 1F3PA 3DJGX 1PBFA 3CGEA 1ONFA 3NYFA 2R45A 1RYIA 4EM3A 5KWFA 3AE4A 4RSLA 2C66A 4YWOA 1TDFA 4U8LA 4UDRA 3GDNA 4AOXA 4B68A 2YAUA 5U63A 4ECHA 2CFYA 1AOGA 1DOEA 3EPTA 1L9EA 2GR0A 2WBAA 2XFNA 2WOIA 1KSUA 1CF3A 2VVMA 4Z26A 5GSNA 4EMIA 1GRBA 1DOBA 1JRZA 1TDOA 5U25A 5L46A 3BI5A 3UTHA 1NDAA 3S5WA 1YKJA 4A5LA 3AEBA 3BHFA 2YVJA 1CC2A 1GEUA 5CKUA 2WPFA 1JU2A 4K5RA 1DJQA 2JAEA 2RGHA 4Y4MA 1YY5A 4YSYA 4J56A 4GDPA 1GESA 2YQUA 2WP5A 3KA7A 3RP6A 2E4GA 2XFPA 2AQJA 2E1MA 4Z2RA 2B9XA 1LQUA 4B69A 3CTYA 4REKA 2ZBWA 1LPFA 4JNAA 4DSGA 4H50A 1W4XA 1KF6A 4U8PA 3M0OA 2BC1A 4CBQA
chains in the Genus database with same CATH superfamily
2W0HA 1D7YA 2VVLA 2YVFA 2J3NA 1GRFA 2PHHA 1XPQA 1LQTA 4GAPA 2VRLA 4ZCCA 4K8DA 3AE8A 3D1CA 3GRSA 4JN9A 2BCPA 5KRQA 5HHFA 1ZMCA 2YR4A 2YG6A 4H4TA 5J60A 3R9UA 2JB1A 4IA5A 2X50A 3KPFA 3ADAB 1ZY8A 2B76A 5FS8A 4GF7A 1ZX9A 3LOVA 2NVKX 3AE6A 1E1LA 1PJ5A 4GCMA 3ITJA 3AE7A 4BURA 4A65A 4Z43A 4H7UA 3NK2X 1EL7A 1D4DA 4TM0A 5M10A 3FPZA 2Z5YA 2XFQA 3SZ0A 2XVIA 2Q0LA 3DJJA 1B4VA 3AE1A 4K22A 4IA6A 1COYA 1EL9A 3G5SA 5KOWA 1IJHA 1QO8A 4DGKA 3HYVA 1PBEA 2GR2A 5M0ZA 1GALA 1K0JA 2GAGB 3BNUA 4TM1A 5KMSA 3T2KA 1FOHA 1JRYA 3KPKA 4AP1A 3ZNPA 3SGLA 3SX6A 1GRGA 1ZKQA 4C3XA 4YT0A 3JSKA 2EQ8A 2A87A 2V60A 1B8SA 2BYBA 2QA1A 4EMJA 2A8XA 4H2RA 1D7LA 4EQRA 1X31B 2WU5A 2ARDA 4U2LA 3AWIA 3AYLA 3ALMA 1H7XA 2XLUA 1O5WA 4M52A 1PHHA 3T2YA 3WE0A 3NNEA 2WDVA 1H86A 3PVCA 3ALLA 2YLWA 4TLXA 3L8KA 1PXCA 1H83A 1NHPA 3NN6X 3GYIA 2GVCA 3G5RA 3NH3X 2Z5XA 3VRDB 3BI4A 2WPEA 4H4VA 4YSHA 4YKFA 3SFEA 2A89A 4D03A 5JCLA 3COXA 4JDRA 1N1PA 2Q0KA 3KLJA 4YJFA 3EAOA 1OJ9A 2X8CA 5TR3A 4EIQA 1K4QA 1BWCA 1LTXR 1Y0PA 1NG4A 4U8MA 4B67A 3CNDA 2V3BA 4J34A 3V3OA 3C4NA 2YG4A 1CBOA 2XLRA 4N9XA 4OPIA 1UKVG 1KFYA 1CC4A 1FCDA 1NPXA 4NNJA 4OPLA 3UP5A 2C72A 1GOSA 4H4PA 2BA9A 1NENA 3SZFA 2QCUA 3VQRA 3NT6A 2B7SA 4J33A 2FJEA 2R9ZA 5EB5A 3GMCA 3L1RA 3DJDA 3SYIA 1CJ3A 2I0ZA 3EF6A 3QVRA 2YVGA 2IIDA 3ISHA 3B3RA 3QSEA 3QFAA 1EVIA 2BK5A 3NGCX 1SEZA 2IVEA 2YLZA 2E5VA 4CCQA 3W4JA 4YKGA 1VG0A 3FIMB 4YTPA 1VQWA 1RP0A 4H2PA 4YJHA 4FDCB 4CNKA 4USQA 1VG9A 4LA1A 3ZNOA 3KVEA 3T14A 3UCLA 1AN9A 4MJWA 2GR3A 2JB2A 4UDQA 1HYUA 1N4VA 2YR5A 2XLSA 5EBKA 1GNDA 4YSXA 4AT2A 1NHQA 2V3AA 3CPIG 2Y6QA 3GWDA 4GUVA 2JK6A 1CJCA 5FS9A 2WETA 1H84A 1OJCA 1ZOYA 1QLBA 3AB1A 3KU9A 1GTEA 3QFBA 3IC9A 4BK2A 2GQWA 4O5UA 3FG2P 4H2NA 3NKSA 1CJ4A 1REOA 1VRQB 4C74A 2YLXA 4BK3A 3AE3A 3DGZA 1Z6LA 1TRBA 1P2HA 2WDQA 2WP9A 3AEFA 1ZK7A 4H4RA 4HA6A 5BULA 4JNQA 1ZOVA 3UKLA 3IHGA 2FJBA 3UOZA 4X9MA 3T2ZA 4Z2UA 3SFDA 4H4ZA 4OCGA 1XANA 2BS3A 1C0KA 2XCGA 3GYXA 5BRTA 2ZZCA 3RHAA 3OZ2A 1E1NA 4YSZA 1YQZA 4PAAA 3QJ4A 2R4EA 5FS7A 1GTHA 3K7TA 4Y4LA 2GR1A 4OPGA 2CULA 1NG3A 2VZ2A 4OPTA 4U8NA 2BS2A 4K2XA 2FJDA 3HYXA 3OC4A 4JY2A 1KSSA 1S2QA 1C0LA 2DKHA 2WOWA 4G9KA 3GMBA 4I59A 4NTCA 4Z24A 3AD8B 3H4KA 2OLNA 1PN0A 2BRAA 2C3CA 4DSHA 1TYTA 2GV8A 2RABA 4CY8A 3LB8A 1K0LA 3UP4A 2C75A 3ALJA 3ICTA 3WGTA 1D4EA 5U1OA 1ELIA 1FEBA 4J57A 4H4QA 4NZHA 4GR1A 3P9UA 2E82A 2Q7VA 3EANA 3AE5A 2R0CA 1Y56A 4Z44A 1TDEA 4ICYA 2XVJA 1KNPA 3UTEA 3PO7A 4II2A 4LU6A 4AT0A 3SXIA 1JNRA 1EL8A 3GYJA 4B63A 1MXTA 2WU2A 3QSSA 1GPEA 3F8RA 1NHSA 1DODA 3BHKA 3ZNNA 4FK1A 4II3A 4EQSA 4JQ9A 1K0IA 2GB0A 3I3LA 5IQ4A 4B65A 3NK1X 2R46A 3UKPA 4A6NA 1TDNA 3IWAA 2YG3A 1E1MA 1NHRA 2JKCA 3II4A 4WCTA 4Z25A 3DK8A 1GREA 3F8PA 2EQ6A 2WEUA 1PXBA 1DXLA 4AP3A 4XXGA 1CHUA 2XLTA 3M13A 3UOYA 3AEEA 3AD7B 3BNMA 2X8HA 3G5QA 5IPYA 1PXAA 2R4JA 1XDIA 2GF3A 3W4IA 3ABVA 3GD3A 4D04A 3CGDA 3E1TA 4YJGA 2YWLA 2GRTA 1GETA 3AEGA 1FL2A 2YLRA 4GRTA 1N4UA 4FK1C 4H4WA 3LJPA 4EQWA 1CC6A 5HXIA 3AYIA 2E4AA 3VR9A 4ZCDA 1BF3A 3K7MX 3K7QX 5KVIA 2BRYA 1JRXA 1NAAA 1B5QA 1JEHA 1D4CA 5JCNA 5LV9A 3GD4A 2RGJA 1Q1WA 2JBVA 4OPCA 4ADWA 3SQPA 4EMWA 2C64A 3NK0X 2QA2A 2WHDA 1E39A 3LZWA 4YXDA 2OLOA 4BJYA 1XHCA 2V61A 2YM2A 3ATRA 3ZNQA 2E49A 1H7WA 2OALA 5IQ1A 1GRAA 3LXDA 3CNJA 5EB4A 1FEAA 5J7XA 3NIXA 2VQBA 5BUKA 5KNLA 2UZZA 4H2QA 4U8OA 2C4CA 3P4SA 3ICRA 1S3BA 2WESA 2HQMA 3CIRA 4A7AA 4H4UA 5KOXA 2YG5A 2B9YA 2VQ7A 2H89A 2XYOA 2WOVA 2ZZ0A 3CGBA 3UKHA 1LVLA 1IUTA 2XVEA 3V3NA 1Y56B 4BK1A 4H4YA 4ZN0A 3GRTA 3RP7A 3DK9A 4YTNA 2AR8A 1KDGA 2XDOA 3CNTA 1B37A 3C96A 2C65A 4GDEA 3Q6JA 3NN0X 4PABA 2EQ7A 4GAVA 1PDHA 4YTMA 3UTGA 4A99A 1MOKA 3KD9A 3H8IA 4FX9A 3S61A 4JY3A 3SY4A 2JB3A 2GMJA 1LJ1A 2BCGG 4KPRA 3LADA 3P4PA 3AYJA 4G74A 3CPHG 1VE9A 2GAHB 3T37A 3UKFA 4C3YA 1CJ2A 3ZDNA 2C3DA 4O5QA 1GV4A 2BS4A 4BV6A 2C7GA 4C77A 4P9SA 3C4AA 5FMHA 3UOXA 4EM4A 1PBDA 2C70A 2XVFA 2R0GA 2X3NA 2V6OA 3CNSA 3P4RA 3UOVA 4H4SA 3CPJG 2ZZBA 1P2EA 3GWFA 4UP3A 4Z2TA 4YJFB 3RNMA 3IHMA 1H81A 2XVHA 5KXJA 1RSGA 3K30A 3VRBA 4CCRA 4NWZA 2C76A 1DDOA 3IF9A 1BGJA 3ZYXA 2EQ9A 3F8DA 1GRTA 4J2WA 1F8WA 3NLCA 3G3EA 5KMRA 1DJNA 4OPDA 3NTAA 1S2YA 5GRTA 2AAQA 4NEWA 4NEVA 3NTDA 1L0VA 1O95A 1F6MA 2DKIA 1TDKA 2ACZA 4B64A 5BVAA 4X4JA 2VVLG 1GRHA 2X99A 3DGHA 4AOSA 4U8IA 4OVIA 4DNAA 4G73A 3NHOX 2IVDA 2PYXA 2TMDA 4KX6A 3LZXA 3CN8A 4USRA 4RG3A 4K5SA 2E48A 4C5OA 3SZWA 1GT8A 2VOUA 2XFOA 3DH9A 4CY6A 3DMEA 2RGOA 3NYEA 3PS9A 2O9ZA 4YJHB 2WPCA 1QJDA 3AD9B 3DJEA 5EOWA 2DU8A 1LV0A 4QFCA 1YQ4A 1IUVA 2BABA 2V5ZA 2YLSA 1F8SA 4IVMB 4RG4A 2CVJA 3CUKA 4X9NA 4XWZA 1M6IA 2XFUA 3BI2A 5HYMA 1D5TA 4EIPA 1PJ6A 1EBDA 1YQ3A 4H4XA 5JCKA 4K7ZA 1DOCA 3M12A 1H6VA 2FJAA 2BXRA 2C73A 5JCMA 1OJAA 1M64A 4YJDA 3FBSA 2BACA 4IV9A 1NEKA 4E0VA 4OPUA 2F5ZA 1C0IA 2BC0A 3GSIA 4HB9A 3DA1A 3CGCA 2FBWA 2WS3A 1L9DA 2CDUA 3RP8A 1DAOA 4I58A 5JCIA 1GXFA 2Y6RA 3P4QA 2APGA 3UKKA 2BK4A 2GMHA 1GSNA 1IUWA 3AXBA 3DK4A 2WQYA 5HY5A 4A9WA 1KNRA 4J31A 3Q9TA 4B1BA 1VDCA 3W4KA 5ER0A 3SM8A 1GERA 5KMQA 4U8KA 1JNZA 2BXSA 2VRMA 3UKQA 2GEWA 3AECA 1ZP0A 1IUSA 4NTDA 3AEAA 2OAMA 4LIIA 4BJZA 5FS6A 3REDA 2GQFA 3NRNA 3CNPA 3HZLA 3FMWA 1PJ7A 1IUUA 1PBCA 4U8JA 3NYCA 4J36A 4WX1A 2X8GA 4TM3A 2B9WA 4U2SA 1Q9IA 2QAEA 3AEDA 3ATQA 3URHA 4UDPA 4G6HA 2WP6A 2YLTA 3H8LA 1L9CA 1N4WA 1S3EA 1BGNA 1IUXA 1DNCA 3QVPA 4CRTA 1H82A 1OJDA 3P1WA 5KVHA 4EQXA 1O94A 3CMMA 4APNA 1Q1RA 4Y4NA 4A79A 2YR6A 4G6GA 5C3JA 5DBJA 4B66A 3GDPA 1E7PA 1PBBA 3QSMA 2GH5A 4U2TA 3AE9A 2NPXA 1TYPA 1BKWA 3O0HA 3KKJA 2C67A 2XLPA 5CQFA 3V76A 2OA1A 1F8RA 3B6DA 1ZMDA 3UTFA 3D8XA 1OJTA 2H88A 1V59A 2YM1A 2YG7A 3AE2A 4TLZA 4CNJA 1BZLA 2R0PA 1MO9A 3VR8A 4NTEA 3VRAA 5C2TA 2WDRA 4XWRA 3NG7X 1CL0A 2Q6UA 1E1KA 1PS9A 1ZDLA 1FECA 4IVOB 1EL5A 2TPRA 1JOAA 2B7RA 3UKAA 4A6NB 2BK3A 4TM4A 1E6EA 3I6DA 3ICSA 1F3PA 3DJGX 1PBFA 3CGEA 3NYFA 1ONFA 2R45A 1RYIA 4EM3A 5KWFA 3AE4A 4RSLA 2C66A 4YWOA 1TDFA 4U8LA 3HYWA 4UDRA 5KMPA 3GDNA 4AOXA 4B68A 2YAUA 5U63A 4ECHA 2CFYA 1AOGA 1DOEA 3EPTA 1L9EA 4YJGB 2GR0A 2WBAA 2XFNA 2WOIA 1KSUA 1CF3A 2VVMA 4Z26A 5GSNA 4EMIA 1GRBA 1C0PA 1DOBA 1JRZA 1TDOA 5L46A 5U25A 3BI5A 3UTHA 1NDAA 3S5WA 1YKJA 4A5LA 3AEBA 1KIFA 3BHFA 2YVJA 3T0KA 1CC2A 1GEUA 5CKUA 2WPFA 1JU2A 3SZCA 4K5RA 1DJQA 2RGHA 2JAEA 4Y4MA 1YY5A 4YSYA 4J56A 4GDPA 1GESA 3RP6A 2WP5A 2YQUA 3KA7A 2E4GA 2XFPA 2AQJA 2E1MA 4Z2RA 2B9XA 1LQUA 4B69A 3CTYA 4REKA 2ZBWA 4QFDA 1LPFA 4JNAA 3T31A 4DSGA 4H50A 1W4XA 1KF6A 4U8PA 3M0OA 2BC1A 4CBQA
chains in the Genus database with same CATH topology
2W0HA 1D7YA 2VVLA 2YVFA 2J3NA 1GRFA 2PHHA 1XPQA 1LQTA 4GAPA 2VRLA 4ZCCA 4K8DA 3AE8A 3D1CA 3GRSA 4JN9A 2BCPA 5KRQA 5HHFA 1ZMCA 2YR4A 2YG6A 4H4TA 5J60A 3R9UA 2JB1A 4IA5A 2X50A 3KPFA 2B76A 1ZY8A 3ADAB 5FS8A 4GF7A 1ZX9A 3LOVA 2NVKX 3AE6A 1E1LA 1PJ5A 4GCMA 3ITJA 3AE7A 4BURA 4A65A 4Z43A 4H7UA 3NK2X 1EL7A 1D4DA 4TM0A 5M10A 3FPZA 2Z5YA 2XFQA 3SZ0A 2XVIA 2Q0LA 3DJJA 1B4VA 3AE1A 4K22A 4IA6A 1COYA 1EL9A 3G5SA 5KOWA 1IJHA 1QO8A 4DGKA 3HYVA 1PBEA 2GR2A 5M0ZA 1GALA 1K0JA 2GAGB 3BNUA 4TM1A 5KMSA 3T2KA 1FOHA 1JRYA 3KPKA 4AP1A 3SGLA 3SX6A 1GRGA 1ZKQA 4C3XA 4YT0A 3JSKA 2EQ8A 2A87A 2V60A 1B8SA 2BYBA 2QA1A 4EMJA 2A8XA 4H2RA 1D7LA 4EQRA 1X31B 2WU5A 2ARDA 4U2LA 3AWIA 3AYLA 3ALMA 1H7XA 2XLUA 1O5WA 4M52A 1PHHA 3T2YA 3WE0A 3NNEA 2WDVA 1H86A 3PVCA 3ALLA 2YLWA 4TLXA 3L8KA 1PXCA 1H83A 1NHPA 3NN6X 3GYIA 2GVCA 3G5RA 3NH3X 2Z5XA 3VRDB 3BI4A 2WPEA 4H4VA 4YKFA 4YSHA 3SFEA 2A89A 4D03A 5JCLA 3COXA 4JDRA 1N1PA 2Q0KA 3KLJA 3EAOA 1OJ9A 2X8CA 5TR3A 1Y0PA 4EIQA 1BWCA 1K4QA 1LTXR 1NG4A 4U8MA 4B67A 3CNDA 2V3BA 4J34A 3V3OA 3C4NA 2YG4A 1CBOA 2XLRA 4N9XA 4OPIA 1UKVG 1KFYA 1CC4A 1FCDA 1NPXA 4NNJA 4OPLA 3UP5A 2C72A 1GOSA 4H4PA 2BA9A 1NENA 3SZFA 2QCUA 3VQRA 3NT6A 2B7SA 4J33A 2FJEA 2R9ZA 5EB5A 3GMCA 3L1RA 3DJDA 3SYIA 1CJ3A 2I0ZA 3EF6A 3QVRA 2YVGA 2IIDA 3ISHA 3B3RA 3QSEA 3QFAA 2BK5A 3NGCX 1SEZA 2IVEA 2YLZA 2E5VA 4CCQA 4YKGA 1VG0A 3FIMB 4YTPA 1VQWA 1RP0A 4H2PA 4FDCB 4CNKA 4USQA 1VG9A 4LA1A 3KVEA 3T14A 3UCLA 4MJWA 2GR3A 2JB2A 4UDQA 1HYUA 1N4VA 2YR5A 2XLSA 5EBKA 1GNDA 4YSXA 4AT2A 1NHQA 2V3AA 3CPIG 2Y6QA 3GWDA 4GUVA 2JK6A 1CJCA 5FS9A 2WETA 1H84A 1OJCA 1ZOYA 1QLBA 3AB1A 3KU9A 1GTEA 3QFBA 3IC9A 4BK2A 2GQWA 4O5UA 3FG2P 4H2NA 3NKSA 1CJ4A 1REOA 1VRQB 4C74A 2YLXA 4BK3A 3AE3A 3DGZA 1Z6LA 1TRBA 1P2HA 2WDQA 2WP9A 3AEFA 1ZK7A 4H4RA 4HA6A 5BULA 4JNQA 1ZOVA 3UKLA 3IHGA 2FJBA 3UOZA 4X9MA 3T2ZA 4Z2UA 3SFDA 4H4ZA 4OCGA 1XANA 2BS3A 2XCGA 3GYXA 5BRTA 2ZZCA 3RHAA 1E1NA 3OZ2A 4YSZA 1YQZA 4PAAA 3QJ4A 2R4EA 5FS7A 1GTHA 3K7TA 4Y4LA 2GR1A 4OPGA 2CULA 1NG3A 2VZ2A 4OPTA 4U8NA 2BS2A 4K2XA 2FJDA 3HYXA 3OC4A 4JY2A 1KSSA 1S2QA 2WOWA 2DKHA 4G9KA 4I59A 3GMBA 4NTCA 4Z24A 3AD8B 3H4KA 2BRAA 1PN0A 2OLNA 2C3CA 4DSHA 1TYTA 2GV8A 2RABA 4CY8A 3LB8A 1K0LA 3UP4A 2C75A 3ALJA 3ICTA 1D4EA 5U1OA 1ELIA 1FEBA 4J57A 4H4QA 4NZHA 4GR1A 3P9UA 2Q7VA 3EANA 3AE5A 2R0CA 1Y56A 4Z44A 1TDEA 4ICYA 2XVJA 1KNPA 3UTEA 3PO7A 4II2A 4LU6A 4AT0A 3SXIA 1JNRA 1EL8A 3GYJA 4B63A 1MXTA 2WU2A 3QSSA 1GPEA 3F8RA 1NHSA 1DODA 3BHKA 4II3A 4FK1A 4EQSA 4JQ9A 1K0IA 2GB0A 3I3LA 5IQ4A 4B65A 3NK1X 2R46A 3UKPA 4A6NA 1TDNA 3IWAA 2YG3A 1E1MA 1NHRA 2JKCA 3II4A 4WCTA 4Z25A 3DK8A 1GREA 3F8PA 2EQ6A 2WEUA 1DXLA 1PXBA 4AP3A 4XXGA 1CHUA 2XLTA 3M13A 3UOYA 3AEEA 3AD7B 3BNMA 2X8HA 3G5QA 5IPYA 1PXAA 1XDIA 2R4JA 2GF3A 3GD3A 3ABVA 4D04A 3CGDA 3E1TA 2YWLA 2GRTA 1GETA 3AEGA 1FL2A 2YLRA 4GRTA 1N4UA 4FK1C 4H4WA 3LJPA 4EQWA 1CC6A 5HXIA 3AYIA 3VR9A 4ZCDA 1BF3A 3K7MX 3K7QX 5KVIA 2BRYA 1JRXA 1NAAA 1B5QA 1JEHA 1D4CA 5JCNA 5LV9A 3GD4A 2RGJA 1Q1WA 2JBVA 4OPCA 4ADWA 3SQPA 4EMWA 2C64A 3NK0X 2QA2A 2WHDA 1E39A 3LZWA 4YXDA 2OLOA 4BJYA 1XHCA 2V61A 2YM2A 3ATRA 1H7WA 2OALA 5IQ1A 1GRAA 3LXDA 3CNJA 5EB4A 1FEAA 5J7XA 3NIXA 2VQBA 5BUKA 5KNLA 4H2QA 2UZZA 4U8OA 2C4CA 3P4SA 3ICRA 1S3BA 2WESA 2HQMA 3CIRA 4A7AA 4H4UA 5KOXA 2YG5A 2B9YA 2VQ7A 2H89A 2XYOA 2WOVA 2ZZ0A 3CGBA 3UKHA 1LVLA 1IUTA 2XVEA 3V3NA 1Y56B 4BK1A 4H4YA 4ZN0A 3GRTA 3RP7A 3DK9A 4YTNA 2AR8A 1KDGA 2XDOA 3CNTA 1B37A 3C96A 2C65A 4GDEA 3Q6JA 3NN0X 2EQ7A 4GAVA 4PABA 1PDHA 4YTMA 3UTGA 4A99A 1MOKA 3KD9A 3H8IA 4FX9A 3S61A 4JY3A 3SY4A 2JB3A 2GMJA 1LJ1A 2BCGG 4KPRA 3LADA 3P4PA 3AYJA 4G74A 3CPHG 2GAHB 3T37A 3UKFA 4C3YA 1CJ2A 3ZDNA 2C3DA 4O5QA 1GV4A 2BS4A 4BV6A 2C7GA 4C77A 4P9SA 3C4AA 5FMHA 3UOXA 4EM4A 1PBDA 2C70A 2XVFA 2X3NA 2R0GA 2V6OA 3CNSA 3P4RA 3UOVA 4H4SA 3CPJG 2ZZBA 1P2EA 3GWFA 4UP3A 4Z2TA 3RNMA 3IHMA 1H81A 2XVHA 5KXJA 1RSGA 3K30A 3VRBA 4CCRA 4NWZA 2C76A 3IF9A 1BGJA 3ZYXA 2EQ9A 3F8DA 1GRTA 4J2WA 1F8WA 3NLCA 5KMRA 1DJNA 4OPDA 3NTAA 1S2YA 5GRTA 2AAQA 4NEWA 4NEVA 3NTDA 1L0VA 1O95A 1F6MA 2DKIA 1TDKA 2ACZA 4B64A 5BVAA 4X4JA 2VVLG 1GRHA 2X99A 3DGHA 4AOSA 4U8IA 4OVIA 4DNAA 4G73A 3NHOX 2IVDA 2PYXA 2TMDA 4KX6A 3LZXA 3CN8A 4USRA 4RG3A 4K5SA 4C5OA 3SZWA 1GT8A 2VOUA 2XFOA 3DH9A 4CY6A 3DMEA 2O9ZA 2RGOA 2WPCA 3NYEA 3PS9A 1QJDA 3AD9B 3DJEA 5EOWA 1LV0A 1YQ4A 1IUVA 2BABA 2V5ZA 2YLSA 1F8SA 4IVMB 4RG4A 2CVJA 3BI2A 4X9NA 4XWZA 1M6IA 2XFUA 5HYMA 1D5TA 4EIPA 1EBDA 1PJ6A 1YQ3A 4H4XA 5JCKA 4K7ZA 1DOCA 3M12A 1H6VA 2FJAA 2BXRA 2C73A 5JCMA 1OJAA 1M64A 3FBSA 2BACA 4IV9A 1NEKA 4E0VA 4OPUA 2F5ZA 2BC0A 3GSIA 4HB9A 3CGCA 3DA1A 2FBWA 2WS3A 1L9DA 2CDUA 3RP8A 4I58A 5JCIA 1GXFA 2Y6RA 3P4QA 2APGA 3UKKA 2BK4A 2GMHA 1GSNA 1IUWA 3AXBA 3DK4A 2WQYA 5HY5A 4A9WA 1KNRA 4J31A 3Q9TA 4B1BA 1VDCA 5ER0A 1GERA 3SM8A 5KMQA 4U8KA 1JNZA 2BXSA 2VRMA 3UKQA 2GEWA 3AECA 1ZP0A 1IUSA 4NTDA 3AEAA 2OAMA 4LIIA 4BJZA 5FS6A 3REDA 2GQFA 3NRNA 3CNPA 3HZLA 3FMWA 1IUUA 1PBCA 1PJ7A 4U8JA 3NYCA 4J36A 4WX1A 2X8GA 4TM3A 2B9WA 4U2SA 1Q9IA 2QAEA 3AEDA 3ATQA 3URHA 4UDPA 4G6HA 2WP6A 2YLTA 3H8LA 1L9CA 1N4WA 1S3EA 1BGNA 1IUXA 1DNCA 3QVPA 4CRTA 1H82A 1OJDA 3P1WA 5KVHA 4EQXA 1O94A 3CMMA 4APNA 1Q1RA 4Y4NA 4A79A 2YR6A 4G6GA 5C3JA 5DBJA 4B66A 3GDPA 1E7PA 1PBBA 3QSMA 2GH5A 4U2TA 3AE9A 2NPXA 1TYPA 1BKWA 3O0HA 3KKJA 2C67A 2XLPA 5CQFA 3V76A 2OA1A 1F8RA 3B6DA 1ZMDA 3UTFA 3D8XA 1OJTA 2H88A 1V59A 2YM1A 2YG7A 3AE2A 4TLZA 4CNJA 1BZLA 2R0PA 1MO9A 3VR8A 4NTEA 3VRAA 5C2TA 2WDRA 4XWRA 3NG7X 1CL0A 1PS9A 1E1KA 2Q6UA 1ZDLA 1FECA 4IVOB 1EL5A 2TPRA 1JOAA 2B7RA 3UKAA 4A6NB 2BK3A 4TM4A 1E6EA 3I6DA 3ICSA 1F3PA 3DJGX 1PBFA 3CGEA 1ONFA 3NYFA 2R45A 1RYIA 4EM3A 5KWFA 3AE4A 4RSLA 2C66A 4YWOA 1TDFA 4U8LA 3HYWA 4UDRA 5KMPA 3GDNA 4AOXA 4B68A 2YAUA 5U63A 4ECHA 2CFYA 1AOGA 1DOEA 3EPTA 1L9EA 2GR0A 2WBAA 2XFNA 2WOIA 1KSUA 1CF3A 2VVMA 4Z26A 5GSNA 4EMIA 1GRBA 1DOBA 1JRZA 1TDOA 5U25A 5L46A 3BI5A 3UTHA 1NDAA 3S5WA 1YKJA 4A5LA 3AEBA 3T0KA 3BHFA 2YVJA 1CC2A 1GEUA 5CKUA 2WPFA 1JU2A 3SZCA 4K5RA 1DJQA 2JAEA 2RGHA 4Y4MA 1YY5A 4YSYA 4J56A 4GDPA 1GESA 3RP6A 2WP5A 2YQUA 3KA7A 2E4GA 2XFPA 2AQJA 2E1MA 4Z2RA 2B9XA 1LQUA 4B69A 3CTYA 4REKA 2ZBWA 1LPFA 4JNAA 3T31A 4DSGA 4H50A 1W4XA 1KF6A 4U8PA 3M0OA 2BC1A 4CBQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0H A;  1D7Y A;  2VVL A;  2YVF A;  2J3N A;  1GRF A;  2PHH A;  1XPQ A;  1LQT A;  2VRL A;  4ZCC A;  4K8D A;  3AE8 A;  3D1C A;  3GRS A;  4JN9 A;  2BCP A;  5KRQ A;  5HHF A;  1ZMC A;  2YR4 A;  2YG6 A;  4H4T A;  5J60 A;  3R9U A;  2JB1 A;  4IA5 A;  2X50 A;  3KPF A;  2B76 A;  1ZY8 A;  3ADA B;  5FS8 A;  4GF7 A;  1ZX9 A;  3LOV A;  2NVK X;  3AE6 A;  1E1L A;  1PJ5 A;  4GCM A;  3ITJ A;  3AE7 A;  4BUR A;  4A65 A;  4Z43 A;  4H7U A;  3NK2 X;  1EL7 A;  1D4D A;  4TM0 A;  5M10 A;  3FPZ A;  2Z5Y A;  2XFQ A;  2XVI A;  2Q0L A;  3DJJ A;  1B4V A;  3AE1 A;  4K22 A;  4IA6 A;  1COY A;  1EL9 A;  3G5S A;  5KOW A;  1IJH A;  1QO8 A;  4DGK A;  1PBE A;  2GR2 A;  5M0Z A;  1GAL A;  1K0J A;  2GAG B;  3BNU A;  4TM1 A;  1FOH A;  1JRY A;  4AP1 A;  3SGL A;  4YT0 A;  1GRG A;  1ZKQ A;  4C3X A;  3JSK A;  2EQ8 A;  2A87 A;  2V60 A;  1B8S A;  2BYB A;  2QA1 A;  4EMJ A;  2A8X A;  4H2R A;  1D7L A;  4EQR A;  1X31 B;  2WU5 A;  2ARD A;  4U2L A;  3AWI A;  3AYL A;  3ALM A;  1H7X A;  2XLU A;  1O5W A;  4M52 A;  1PHH A;  3WE0 A;  3NNE A;  2WDV A;  1H86 A;  3PVC A;  3ALL A;  2YLW A;  4TLX A;  3L8K A;  1PXC A;  1H83 A;  1NHP A;  3NN6 X;  3GYI A;  2GVC A;  3G5R A;  3NH3 X;  2Z5X A;  3VRD B;  3BI4 A;  2WPE A;  4H4V A;  4YKF A;  4YSH A;  3SFE A;  2A89 A;  4D03 A;  5JCL A;  3COX A;  4JDR A;  1N1P A;  2Q0K A;  3KLJ A;  3EAO A;  1OJ9 A;  2X8C A;  5TR3 A;  1Y0P A;  4EIQ A;  1BWC A;  1K4Q A;  1LTX R;  1NG4 A;  4U8M A;  4B67 A;  3CND A;  2V3B A;  4J34 A;  3V3O A;  3C4N A;  2YG4 A;  1CBO A;  2XLR A;  4N9X A;  4OPI A;  1UKV G;  1KFY A;  1CC4 A;  1FCD A;  1NPX A;  3UP5 A;  4OPL A;  2C72 A;  1GOS A;  4H4P A;  2BA9 A;  1NEN A;  2QCU A;  3VQR A;  3NT6 A;  2B7S A;  4J33 A;  2FJE A;  2R9Z A;  5EB5 A;  3GMC A;  3L1R A;  3DJD A;  1CJ3 A;  2I0Z A;  3EF6 A;  3QVR A;  2YVG A;  2IID A;  3ISH A;  3B3R A;  3QSE A;  3QFA A;  2BK5 A;  3NGC X;  1SEZ A;  2IVE A;  2YLZ A;  2E5V A;  4CCQ A;  4YKG A;  1VG0 A;  3FIM B;  4YTP A;  1VQW A;  1RP0 A;  4H2P A;  4FDC B;  4CNK A;  4USQ A;  1VG9 A;  4LA1 A;  3KVE A;  3UCL A;  4MJW A;  2GR3 A;  2JB2 A;  4UDQ A;  1HYU A;  1N4V A;  2YR5 A;  2XLS A;  5EBK A;  1GND A;  4YSX A;  4AT2 A;  1NHQ A;  2V3A A;  3CPI G;  2Y6Q A;  3GWD A;  4GUV A;  2JK6 A;  1CJC A;  5FS9 A;  2WET A;  1H84 A;  1OJC A;  1ZOY A;  1QLB A;  3AB1 A;  3KU9 A;  1GTE A;  3QFB A;  3IC9 A;  4BK2 A;  2GQW A;  4O5U A;  3FG2 P;  4H2N A;  3NKS A;  1CJ4 A;  1REO A;  1VRQ B;  4C74 A;  2YLX A;  3DGZ A;  3AE3 A;  4BK3 A;  1Z6L A;  1TRB A;  1P2H A;  2WDQ A;  2WP9 A;  3AEF A;  1ZK7 A;  4H4R A;  4HA6 A;  5BUL A;  4JNQ A;  1ZOV A;  3UKL A;  3IHG A;  2FJB A;  3UOZ A;  4X9M A;  4Z2U A;  3SFD A;  4H4Z A;  4OCG A;  1XAN A;  2BS3 A;  2XCG A;  5BRT A;  2ZZC A;  3RHA A;  1E1N A;  3OZ2 A;  4YSZ A;  1YQZ A;  4PAA A;  3QJ4 A;  2R4E A;  5FS7 A;  1GTH A;  3K7T A;  4Y4L A;  2GR1 A;  4OPG A;  2CUL A;  1NG3 A;  2VZ2 A;  4OPT A;  4U8N A;  2BS2 A;  4K2X A;  2FJD A;  3OC4 A;  4JY2 A;  1KSS A;  1S2Q A;  2WOW A;  2DKH A;  4I59 A;  4NTC A;  3GMB A;  4Z24 A;  3AD8 B;  3H4K A;  2OLN A;  1PN0 A;  2C3C A;  4DSH A;  1TYT A;  2GV8 A;  2RAB A;  4CY8 A;  3LB8 A;  1K0L A;  3UP4 A;  2C75 A;  3ALJ A;  3ICT A;  1D4E A;  5U1O A;  1ELI A;  1FEB A;  4J57 A;  4H4Q A;  4NZH A;  4GR1 A;  3P9U A;  2Q7V A;  3EAN A;  3AE5 A;  2R0C A;  1Y56 A;  4Z44 A;  1TDE A;  4ICY A;  2XVJ A;  1KNP A;  3UTE A;  3PO7 A;  4LU6 A;  4AT0 A;  1JNR A;  1EL8 A;  3GYJ A;  4B63 A;  1MXT A;  2WU2 A;  3QSS A;  1GPE A;  3F8R A;  1NHS A;  1DOD A;  3BHK A;  4FK1 A;  4EQS A;  4JQ9 A;  1K0I A;  2GB0 A;  3I3L A;  5IQ4 A;  4B65 A;  3NK1 X;  2R46 A;  3UKP A;  4A6N A;  1TDN A;  3IWA A;  2YG3 A;  1E1M A;  1NHR A;  2JKC A;  3II4 A;  4WCT A;  4Z25 A;  3DK8 A;  1GRE A;  3F8P A;  2EQ6 A;  2WEU A;  1DXL A;  1PXB A;  4AP3 A;  4XXG A;  1CHU A;  2XLT A;  3M13 A;  3UOY A;  3AEE A;  3AD7 B;  3BNM A;  2X8H A;  3G5Q A;  5IPY A;  1PXA A;  1XDI A;  2R4J A;  2GF3 A;  3GD3 A;  3ABV A;  4D04 A;  3CGD A;  3E1T A;  2YWL A;  2GRT A;  1GET A;  3AEG A;  1FL2 A;  2YLR A;  4GRT A;  1N4U A;  4FK1 C;  4H4W A;  3LJP A;  4EQW A;  1CC6 A;  5HXI A;  3AYI A;  3VR9 A;  4ZCD A;  1BF3 A;  3K7M X;  3K7Q X;  5KVI A;  1JRX A;  1NAA A;  1B5Q A;  1JEH A;  1D4C A;  5JCN A;  5LV9 A;  3GD4 A;  2RGJ A;  1Q1W A;  2JBV A;  4OPC A;  4ADW A;  3SQP A;  4EMW A;  2C64 A;  3NK0 X;  2QA2 A;  2WHD A;  1E39 A;  3LZW A;  4YXD A;  2OLO A;  1XHC A;  2V61 A;  4BJY A;  2YM2 A;  3ATR A;  1H7W A;  2OAL A;  5IQ1 A;  1GRA A;  3LXD A;  3CNJ A;  5EB4 A;  1FEA A;  5J7X A;  3NIX A;  2VQB A;  5BUK A;  4H2Q A;  2UZZ A;  4U8O A;  3P4S A;  3ICR A;  1S3B A;  2WES A;  2HQM A;  3CIR A;  4A7A A;  4H4U A;  5KOX A;  2YG5 A;  2B9Y A;  2VQ7 A;  2H89 A;  2XYO A;  2WOV A;  2ZZ0 A;  3CGB A;  3UKH A;  1LVL A;  1IUT A;  2XVE A;  3V3N A;  1Y56 B;  4BK1 A;  4H4Y A;  4ZN0 A;  3GRT A;  3RP7 A;  3DK9 A;  4YTN A;  2AR8 A;  1KDG A;  2XDO A;  3CNT A;  1B37 A;  2C65 A;  3C96 A;  4GDE A;  3Q6J A;  3NN0 X;  2EQ7 A;  4PAB A;  1PDH A;  4YTM A;  3UTG A;  4A99 A;  1MOK A;  3KD9 A;  3H8I A;  4FX9 A;  3S61 A;  4JY3 A;  2JB3 A;  1LJ1 A;  2GMJ A;  2BCG G;  4KPR A;  3LAD A;  3P4P A;  3AYJ A;  3CPH G;  2GAH B;  3T37 A;  3UKF A;  4C3Y A;  1CJ2 A;  3ZDN A;  2C3D A;  4O5Q A;  1GV4 A;  2BS4 A;  4BV6 A;  2C7G A;  4C77 A;  4P9S A;  3C4A A;  5FMH A;  3UOX A;  4EM4 A;  1PBD A;  2C70 A;  2XVF A;  2X3N A;  2R0G A;  2V6O A;  3CNS A;  3P4R A;  3UOV A;  4H4S A;  3CPJ G;  2ZZB A;  1P2E A;  3GWF A;  4UP3 A;  4Z2T A;  3RNM A;  3IHM A;  1H81 A;  2XVH A;  5KXJ A;  1RSG A;  3K30 A;  3VRB A;  4CCR A;  2C76 A;  3IF9 A;  1BGJ A;  3ZYX A;  2EQ9 A;  3F8D A;  1GRT A;  4J2W A;  1F8W A;  3NLC A;  1DJN A;  4OPD A;  3NTA A;  1S2Y A;  5GRT A;  2AAQ A;  4NEW A;  4NEV A;  3NTD A;  1L0V A;  1O95 A;  1F6M A;  2DKI A;  1TDK A;  2ACZ A;  4B64 A;  5BVA A;  4X4J A;  2VVL G;  1GRH A;  2X99 A;  3DGH A;  4AOS A;  4U8I A;  4OVI A;  4DNA A;  3NHO X;  2IVD A;  2PYX A;  2TMD A;  4KX6 A;  3LZX A;  3CN8 A;  4USR A;  4RG3 A;  4K5S A;  4C5O A;  1GT8 A;  2VOU A;  2XFO A;  3DH9 A;  4CY6 A;  3DME A;  2O9Z A;  2RGO A;  2WPC A;  3NYE A;  3PS9 A;  1QJD A;  3AD9 B;  3DJE A;  5EOW A;  1LV0 A;  1YQ4 A;  1IUV A;  2BAB A;  2V5Z A;  2YLS A;  1F8S A;  4IVM B;  4RG4 A;  2CVJ A;  3BI2 A;  4X9N A;  4XWZ A;  1M6I A;  2XFU A;  5HYM A;  1D5T A;  4EIP A;  1EBD A;  1PJ6 A;  1YQ3 A;  4H4X A;  5JCK A;  4K7Z A;  1DOC A;  3M12 A;  1H6V A;  2FJA A;  2BXR A;  2C73 A;  5JCM A;  1OJA A;  1M64 A;  3FBS A;  2BAC A;  4IV9 A;  1NEK A;  4E0V A;  4OPU A;  2F5Z A;  2BC0 A;  3GSI A;  4HB9 A;  3CGC A;  3DA1 A;  2FBW A;  2WS3 A;  1L9D A;  2CDU A;  3RP8 A;  4I58 A;  5JCI A;  1GXF A;  2Y6R A;  3P4Q A;  2APG A;  3UKK A;  2BK4 A;  2GMH A;  1GSN A;  1IUW A;  3AXB A;  3DK4 A;  2WQY A;  5HY5 A;  4A9W A;  1KNR A;  4J31 A;  3Q9T A;  4B1B A;  1VDC A;  5ER0 A;  1GER A;  3SM8 A;  4U8K A;  1JNZ A;  2BXS A;  2VRM A;  3UKQ A;  2GEW A;  3AEC A;  1ZP0 A;  1IUS A;  4NTD A;  3AEA A;  2OAM A;  4LII A;  5FS6 A;  4BJZ A;  3RED A;  2GQF A;  3NRN A;  3CNP A;  3HZL A;  3FMW A;  1IUU A;  1PBC A;  1PJ7 A;  4U8J A;  3NYC A;  4J36 A;  4WX1 A;  2X8G A;  4TM3 A;  2B9W A;  4U2S A;  1Q9I A;  2QAE A;  3AED A;  3ATQ A;  3URH A;  4UDP A;  2WP6 A;  2YLT A;  3H8L A;  1L9C A;  1N4W A;  1S3E A;  1BGN A;  1IUX A;  1DNC A;  3QVP A;  4CRT A;  1H82 A;  1OJD A;  3P1W A;  5KVH A;  4EQX A;  1O94 A;  4APN A;  1Q1R A;  4Y4N A;  4A79 A;  2YR6 A;  5C3J A;  5DBJ A;  4B66 A;  3GDP A;  1E7P A;  1PBB A;  3QSM A;  2GH5 A;  4U2T A;  3AE9 A;  2NPX A;  1TYP A;  1BKW A;  3O0H A;  3KKJ A;  2C67 A;  2XLP A;  5CQF A;  3V76 A;  2OA1 A;  1F8R A;  3B6D A;  1ZMD A;  3UTF A;  3D8X A;  1OJT A;  2H88 A;  1V59 A;  2YM1 A;  2YG7 A;  3AE2 A;  4TLZ A;  4CNJ A;  1BZL A;  2R0P A;  1MO9 A;  3VR8 A;  4NTE A;  3VRA A;  5C2T A;  2WDR A;  4XWR A;  3NG7 X;  1CL0 A;  1PS9 A;  1E1K A;  2Q6U A;  1ZDL A;  1FEC A;  4IVO B;  1EL5 A;  2TPR A;  1JOA A;  2B7R A;  3UKA A;  4A6N B;  2BK3 A;  4TM4 A;  1E6E A;  3I6D A;  3ICS A;  1F3P A;  3DJG X;  1PBF A;  3CGE A;  1ONF A;  3NYF A;  2R45 A;  1RYI A;  4EM3 A;  5KWF A;  3AE4 A;  4RSL A;  2C66 A;  4YWO A;  1TDF A;  4U8L A;  4UDR A;  3GDN A;  4AOX A;  4B68 A;  2YAU A;  5U63 A;  4ECH A;  2CFY A;  1AOG A;  1DOE A;  3EPT A;  1L9E A;  2GR0 A;  2WBA A;  2XFN A;  2WOI A;  1KSU A;  1CF3 A;  2VVM A;  4Z26 A;  5GSN A;  4EMI A;  1GRB A;  1DOB A;  1JRZ A;  1TDO A;  5U25 A;  5L46 A;  3BI5 A;  3UTH A;  1NDA A;  3S5W A;  1YKJ A;  4A5L A;  3AEB A;  3BHF A;  2YVJ A;  1CC2 A;  1GEU A;  5CKU A;  2WPF A;  1JU2 A;  4K5R A;  1DJQ A;  2JAE A;  2RGH A;  4Y4M A;  1YY5 A;  4YSY A;  4J56 A;  4GDP A;  1GES A;  2YQU A;  2WP5 A;  3KA7 A;  3RP6 A;  2E4G A;  2XFP A;  2AQJ A;  2E1M A;  4Z2R A;  2B9X A;  1LQU A;  4B69 A;  3CTY A;  4REK A;  2ZBW A;  1LPF A;  4JNA A;  4DSG A;  4H50 A;  1W4X A;  1KF6 A;  4U8P A;  3M0O A;  2BC1 A;  4CBQ A; 
#chains in the Genus database with same CATH topology
 2W0H A;  1D7Y A;  2VVL A;  2YVF A;  2J3N A;  1GRF A;  2PHH A;  1XPQ A;  1LQT A;  4GAP A;  2VRL A;  4ZCC A;  4K8D A;  3AE8 A;  3D1C A;  3GRS A;  4JN9 A;  2BCP A;  5KRQ A;  5HHF A;  1ZMC A;  2YR4 A;  2YG6 A;  4H4T A;  5J60 A;  3R9U A;  2JB1 A;  4IA5 A;  2X50 A;  3KPF A;  3ADA B;  1ZY8 A;  2B76 A;  5FS8 A;  4GF7 A;  1ZX9 A;  3LOV A;  2NVK X;  3AE6 A;  1E1L A;  1PJ5 A;  4GCM A;  3ITJ A;  3AE7 A;  4BUR A;  4A65 A;  4Z43 A;  4H7U A;  3NK2 X;  1EL7 A;  1D4D A;  4TM0 A;  5M10 A;  3FPZ A;  2Z5Y A;  2XFQ A;  3SZ0 A;  2XVI A;  2Q0L A;  3DJJ A;  1B4V A;  3AE1 A;  4K22 A;  4IA6 A;  1COY A;  1EL9 A;  3G5S A;  5KOW A;  1IJH A;  1QO8 A;  4DGK A;  3HYV A;  1PBE A;  2GR2 A;  5M0Z A;  1GAL A;  1K0J A;  2GAG B;  3BNU A;  4TM1 A;  5KMS A;  3T2K A;  1FOH A;  1JRY A;  3KPK A;  4AP1 A;  3ZNP A;  3SGL A;  3SX6 A;  1GRG A;  1ZKQ A;  4C3X A;  4YT0 A;  3JSK A;  2EQ8 A;  2A87 A;  2V60 A;  1B8S A;  2BYB A;  2QA1 A;  4EMJ A;  2A8X A;  4H2R A;  1D7L A;  4EQR A;  1X31 B;  2WU5 A;  2ARD A;  4U2L A;  3AWI A;  3AYL A;  3ALM A;  1H7X A;  2XLU A;  1O5W A;  4M52 A;  1PHH A;  3T2Y A;  3WE0 A;  3NNE A;  2WDV A;  1H86 A;  3PVC A;  3ALL A;  2YLW A;  4TLX A;  3L8K A;  1PXC A;  1H83 A;  1NHP A;  3NN6 X;  3GYI A;  2GVC A;  3G5R A;  3NH3 X;  2Z5X A;  3VRD B;  3BI4 A;  2WPE A;  4H4V A;  4YSH A;  4YKF A;  3SFE A;  2A89 A;  4D03 A;  5JCL A;  3COX A;  4JDR A;  1N1P A;  2Q0K A;  3KLJ A;  4YJF A;  3EAO A;  1OJ9 A;  2X8C A;  5TR3 A;  4EIQ A;  1K4Q A;  1BWC A;  1LTX R;  1Y0P A;  1NG4 A;  4U8M A;  4B67 A;  3CND A;  2V3B A;  4J34 A;  3V3O A;  3C4N A;  2YG4 A;  1CBO A;  2XLR A;  4N9X A;  4OPI A;  1UKV G;  1KFY A;  1CC4 A;  1FCD A;  1NPX A;  4NNJ A;  4OPL A;  3UP5 A;  2C72 A;  1GOS A;  4H4P A;  2BA9 A;  1NEN A;  3SZF A;  2QCU A;  3VQR A;  3NT6 A;  2B7S A;  4J33 A;  2FJE A;  2R9Z A;  5EB5 A;  3GMC A;  3L1R A;  3DJD A;  3SYI A;  1CJ3 A;  2I0Z A;  3EF6 A;  3QVR A;  2YVG A;  2IID A;  3ISH A;  3B3R A;  3QSE A;  3QFA A;  1EVI A;  2BK5 A;  3NGC X;  1SEZ A;  2IVE A;  2YLZ A;  2E5V A;  4CCQ A;  3W4J A;  4YKG A;  1VG0 A;  3FIM B;  4YTP A;  1VQW A;  1RP0 A;  4H2P A;  4YJH A;  4FDC B;  4CNK A;  4USQ A;  1VG9 A;  4LA1 A;  3ZNO A;  3KVE A;  3T14 A;  3UCL A;  1AN9 A;  4MJW A;  2GR3 A;  2JB2 A;  4UDQ A;  1HYU A;  1N4V A;  2YR5 A;  2XLS A;  5EBK A;  1GND A;  4YSX A;  4AT2 A;  1NHQ A;  2V3A A;  3CPI G;  2Y6Q A;  3GWD A;  4GUV A;  2JK6 A;  1CJC A;  5FS9 A;  2WET A;  1H84 A;  1OJC A;  1ZOY A;  1QLB A;  3AB1 A;  3KU9 A;  1GTE A;  3QFB A;  3IC9 A;  4BK2 A;  2GQW A;  4O5U A;  3FG2 P;  4H2N A;  3NKS A;  1CJ4 A;  1REO A;  1VRQ B;  4C74 A;  2YLX A;  4BK3 A;  3AE3 A;  3DGZ A;  1Z6L A;  1TRB A;  1P2H A;  2WDQ A;  2WP9 A;  3AEF A;  1ZK7 A;  4H4R A;  4HA6 A;  5BUL A;  4JNQ A;  1ZOV A;  3UKL A;  3IHG A;  2FJB A;  3UOZ A;  4X9M A;  3T2Z A;  4Z2U A;  3SFD A;  4H4Z A;  4OCG A;  1XAN A;  2BS3 A;  1C0K A;  2XCG A;  3GYX A;  5BRT A;  2ZZC A;  3RHA A;  3OZ2 A;  1E1N A;  4YSZ A;  1YQZ A;  4PAA A;  3QJ4 A;  2R4E A;  5FS7 A;  1GTH A;  3K7T A;  4Y4L A;  2GR1 A;  4OPG A;  2CUL A;  1NG3 A;  2VZ2 A;  4OPT A;  4U8N A;  2BS2 A;  4K2X A;  2FJD A;  3HYX A;  3OC4 A;  4JY2 A;  1KSS A;  1S2Q A;  1C0L A;  2DKH A;  2WOW A;  4G9K A;  3GMB A;  4I59 A;  4NTC A;  4Z24 A;  3AD8 B;  3H4K A;  2OLN A;  1PN0 A;  2BRA A;  2C3C A;  4DSH A;  1TYT A;  2GV8 A;  2RAB A;  4CY8 A;  3LB8 A;  1K0L A;  3UP4 A;  2C75 A;  3ALJ A;  3ICT A;  3WGT A;  1D4E A;  5U1O A;  1ELI A;  1FEB A;  4J57 A;  4H4Q A;  4NZH A;  4GR1 A;  3P9U A;  2E82 A;  2Q7V A;  3EAN A;  3AE5 A;  2R0C A;  1Y56 A;  4Z44 A;  1TDE A;  4ICY A;  2XVJ A;  1KNP A;  3UTE A;  3PO7 A;  4II2 A;  4LU6 A;  4AT0 A;  3SXI A;  1JNR A;  1EL8 A;  3GYJ A;  4B63 A;  1MXT A;  2WU2 A;  3QSS A;  1GPE A;  3F8R A;  1NHS A;  1DOD A;  3BHK A;  3ZNN A;  4FK1 A;  4II3 A;  4EQS A;  4JQ9 A;  1K0I A;  2GB0 A;  3I3L A;  5IQ4 A;  4B65 A;  3NK1 X;  2R46 A;  3UKP A;  4A6N A;  1TDN A;  3IWA A;  2YG3 A;  1E1M A;  1NHR A;  2JKC A;  3II4 A;  4WCT A;  4Z25 A;  3DK8 A;  1GRE A;  3F8P A;  2EQ6 A;  2WEU A;  1PXB A;  1DXL A;  4AP3 A;  4XXG A;  1CHU A;  2XLT A;  3M13 A;  3UOY A;  3AEE A;  3AD7 B;  3BNM A;  2X8H A;  3G5Q A;  5IPY A;  1PXA A;  2R4J A;  1XDI A;  2GF3 A;  3W4I A;  3ABV A;  3GD3 A;  4D04 A;  3CGD A;  3E1T A;  4YJG A;  2YWL A;  2GRT A;  1GET A;  3AEG A;  1FL2 A;  2YLR A;  4GRT A;  1N4U A;  4FK1 C;  4H4W A;  3LJP A;  4EQW A;  1CC6 A;  5HXI A;  3AYI A;  2E4A A;  3VR9 A;  4ZCD A;  1BF3 A;  3K7M X;  3K7Q X;  5KVI A;  2BRY A;  1JRX A;  1NAA A;  1B5Q A;  1JEH A;  1D4C A;  5JCN A;  5LV9 A;  3GD4 A;  2RGJ A;  1Q1W A;  2JBV A;  4OPC A;  4ADW A;  3SQP A;  4EMW A;  2C64 A;  3NK0 X;  2QA2 A;  2WHD A;  1E39 A;  3LZW A;  4YXD A;  2OLO A;  4BJY A;  1XHC A;  2V61 A;  2YM2 A;  3ATR A;  3ZNQ A;  2E49 A;  1H7W A;  2OAL A;  5IQ1 A;  1GRA A;  3LXD A;  3CNJ A;  5EB4 A;  1FEA A;  5J7X A;  3NIX A;  2VQB A;  5BUK A;  5KNL A;  2UZZ A;  4H2Q A;  4U8O A;  2C4C A;  3P4S A;  3ICR A;  1S3B A;  2WES A;  2HQM A;  3CIR A;  4A7A A;  4H4U A;  5KOX A;  2YG5 A;  2B9Y A;  2VQ7 A;  2H89 A;  2XYO A;  2WOV A;  2ZZ0 A;  3CGB A;  3UKH A;  1LVL A;  1IUT A;  2XVE A;  3V3N A;  1Y56 B;  4BK1 A;  4H4Y A;  4ZN0 A;  3GRT A;  3RP7 A;  3DK9 A;  4YTN A;  2AR8 A;  1KDG A;  2XDO A;  3CNT A;  1B37 A;  3C96 A;  2C65 A;  4GDE A;  3Q6J A;  3NN0 X;  4PAB A;  2EQ7 A;  4GAV A;  1PDH A;  4YTM A;  3UTG A;  4A99 A;  1MOK A;  3KD9 A;  3H8I A;  4FX9 A;  3S61 A;  4JY3 A;  3SY4 A;  2JB3 A;  2GMJ A;  1LJ1 A;  2BCG G;  4KPR A;  3LAD A;  3P4P A;  3AYJ A;  4G74 A;  3CPH G;  1VE9 A;  2GAH B;  3T37 A;  3UKF A;  4C3Y A;  1CJ2 A;  3ZDN A;  2C3D A;  4O5Q A;  1GV4 A;  2BS4 A;  4BV6 A;  2C7G A;  4C77 A;  4P9S A;  3C4A A;  5FMH A;  3UOX A;  4EM4 A;  1PBD A;  2C70 A;  2XVF A;  2R0G A;  2X3N A;  2V6O A;  3CNS A;  3P4R A;  3UOV A;  4H4S A;  3CPJ G;  2ZZB A;  1P2E A;  3GWF A;  4UP3 A;  4Z2T A;  4YJF B;  3RNM A;  3IHM A;  1H81 A;  2XVH A;  5KXJ A;  1RSG A;  3K30 A;  3VRB A;  4CCR A;  4NWZ A;  2C76 A;  1DDO A;  3IF9 A;  1BGJ A;  3ZYX A;  2EQ9 A;  3F8D A;  1GRT A;  4J2W A;  1F8W A;  3NLC A;  3G3E A;  5KMR A;  1DJN A;  4OPD A;  3NTA A;  1S2Y A;  5GRT A;  2AAQ A;  4NEW A;  4NEV A;  3NTD A;  1L0V A;  1O95 A;  1F6M A;  2DKI A;  1TDK A;  2ACZ A;  4B64 A;  5BVA A;  4X4J A;  2VVL G;  1GRH A;  2X99 A;  3DGH A;  4AOS A;  4U8I A;  4OVI A;  4DNA A;  4G73 A;  3NHO X;  2IVD A;  2PYX A;  2TMD A;  4KX6 A;  3LZX A;  3CN8 A;  4USR A;  4RG3 A;  4K5S A;  2E48 A;  4C5O A;  3SZW A;  1GT8 A;  2VOU A;  2XFO A;  3DH9 A;  4CY6 A;  3DME A;  2RGO A;  3NYE A;  3PS9 A;  2O9Z A;  4YJH B;  2WPC A;  1QJD A;  3AD9 B;  3DJE A;  5EOW A;  2DU8 A;  1LV0 A;  4QFC A;  1YQ4 A;  1IUV A;  2BAB A;  2V5Z A;  2YLS A;  1F8S A;  4IVM B;  4RG4 A;  2CVJ A;  3CUK A;  4X9N A;  4XWZ A;  1M6I A;  2XFU A;  3BI2 A;  5HYM A;  1D5T A;  4EIP A;  1PJ6 A;  1EBD A;  1YQ3 A;  4H4X A;  5JCK A;  4K7Z A;  1DOC A;  3M12 A;  1H6V A;  2FJA A;  2BXR A;  2C73 A;  5JCM A;  1OJA A;  1M64 A;  4YJD A;  3FBS A;  2BAC A;  4IV9 A;  1NEK A;  4E0V A;  4OPU A;  2F5Z A;  1C0I A;  2BC0 A;  3GSI A;  4HB9 A;  3DA1 A;  3CGC A;  2FBW A;  2WS3 A;  1L9D A;  2CDU A;  3RP8 A;  1DAO A;  4I58 A;  5JCI A;  1GXF A;  2Y6R A;  3P4Q A;  2APG A;  3UKK A;  2BK4 A;  2GMH A;  1GSN A;  1IUW A;  3AXB A;  3DK4 A;  2WQY A;  5HY5 A;  4A9W A;  1KNR A;  4J31 A;  3Q9T A;  4B1B A;  1VDC A;  3W4K A;  5ER0 A;  3SM8 A;  1GER A;  5KMQ A;  4U8K A;  1JNZ A;  2BXS A;  2VRM A;  3UKQ A;  2GEW A;  3AEC A;  1ZP0 A;  1IUS A;  4NTD A;  3AEA A;  2OAM A;  4LII A;  4BJZ A;  5FS6 A;  3RED A;  2GQF A;  3NRN A;  3CNP A;  3HZL A;  3FMW A;  1PJ7 A;  1IUU A;  1PBC A;  4U8J A;  3NYC A;  4J36 A;  4WX1 A;  2X8G A;  4TM3 A;  2B9W A;  4U2S A;  1Q9I A;  2QAE A;  3AED A;  3ATQ A;  3URH A;  4UDP A;  4G6H A;  2WP6 A;  2YLT A;  3H8L A;  1L9C A;  1N4W A;  1S3E A;  1BGN A;  1IUX A;  1DNC A;  3QVP A;  4CRT A;  1H82 A;  1OJD A;  3P1W A;  5KVH A;  4EQX A;  1O94 A;  3CMM A;  4APN A;  1Q1R A;  4Y4N A;  4A79 A;  2YR6 A;  4G6G A;  5C3J A;  5DBJ A;  4B66 A;  3GDP A;  1E7P A;  1PBB A;  3QSM A;  2GH5 A;  4U2T A;  3AE9 A;  2NPX A;  1TYP A;  1BKW A;  3O0H A;  3KKJ A;  2C67 A;  2XLP A;  5CQF A;  3V76 A;  2OA1 A;  1F8R A;  3B6D A;  1ZMD A;  3UTF A;  3D8X A;  1OJT A;  2H88 A;  1V59 A;  2YM1 A;  2YG7 A;  3AE2 A;  4TLZ A;  4CNJ A;  1BZL A;  2R0P A;  1MO9 A;  3VR8 A;  4NTE A;  3VRA A;  5C2T A;  2WDR A;  4XWR A;  3NG7 X;  1CL0 A;  2Q6U A;  1E1K A;  1PS9 A;  1ZDL A;  1FEC A;  4IVO B;  1EL5 A;  2TPR A;  1JOA A;  2B7R A;  3UKA A;  4A6N B;  2BK3 A;  4TM4 A;  1E6E A;  3I6D A;  3ICS A;  1F3P A;  3DJG X;  1PBF A;  3CGE A;  3NYF A;  1ONF A;  2R45 A;  1RYI A;  4EM3 A;  5KWF A;  3AE4 A;  4RSL A;  2C66 A;  4YWO A;  1TDF A;  4U8L A;  3HYW A;  4UDR A;  5KMP A;  3GDN A;  4AOX A;  4B68 A;  2YAU A;  5U63 A;  4ECH A;  2CFY A;  1AOG A;  1DOE A;  3EPT A;  1L9E A;  4YJG B;  2GR0 A;  2WBA A;  2XFN A;  2WOI A;  1KSU A;  1CF3 A;  2VVM A;  4Z26 A;  5GSN A;  4EMI A;  1GRB A;  1C0P A;  1DOB A;  1JRZ A;  1TDO A;  5L46 A;  5U25 A;  3BI5 A;  3UTH A;  1NDA A;  3S5W A;  1YKJ A;  4A5L A;  3AEB A;  1KIF A;  3BHF A;  2YVJ A;  3T0K A;  1CC2 A;  1GEU A;  5CKU A;  2WPF A;  1JU2 A;  3SZC A;  4K5R A;  1DJQ A;  2RGH A;  2JAE A;  4Y4M A;  1YY5 A;  4YSY A;  4J56 A;  4GDP A;  1GES A;  3RP6 A;  2WP5 A;  2YQU A;  3KA7 A;  2E4G A;  2XFP A;  2AQJ A;  2E1M A;  4Z2R A;  2B9X A;  1LQU A;  4B69 A;  3CTY A;  4REK A;  2ZBW A;  4QFD A;  1LPF A;  4JNA A;  3T31 A;  4DSG A;  4H50 A;  1W4X A;  1KF6 A;  4U8P A;  3M0O A;  2BC1 A;  4CBQ A; 
#chains in the Genus database with same CATH homology
 2W0H A;  1D7Y A;  2VVL A;  2YVF A;  2J3N A;  1GRF A;  2PHH A;  1XPQ A;  1LQT A;  4GAP A;  2VRL A;  4ZCC A;  4K8D A;  3AE8 A;  3D1C A;  3GRS A;  4JN9 A;  2BCP A;  5KRQ A;  5HHF A;  1ZMC A;  2YR4 A;  2YG6 A;  4H4T A;  5J60 A;  3R9U A;  2JB1 A;  4IA5 A;  2X50 A;  3KPF A;  2B76 A;  1ZY8 A;  3ADA B;  5FS8 A;  4GF7 A;  1ZX9 A;  3LOV A;  2NVK X;  3AE6 A;  1E1L A;  1PJ5 A;  4GCM A;  3ITJ A;  3AE7 A;  4BUR A;  4A65 A;  4Z43 A;  4H7U A;  3NK2 X;  1EL7 A;  1D4D A;  4TM0 A;  5M10 A;  3FPZ A;  2Z5Y A;  2XFQ A;  3SZ0 A;  2XVI A;  2Q0L A;  3DJJ A;  1B4V A;  3AE1 A;  4K22 A;  4IA6 A;  1COY A;  1EL9 A;  3G5S A;  5KOW A;  1IJH A;  1QO8 A;  4DGK A;  3HYV A;  1PBE A;  2GR2 A;  5M0Z A;  1GAL A;  1K0J A;  2GAG B;  3BNU A;  4TM1 A;  5KMS A;  3T2K A;  1FOH A;  1JRY A;  3KPK A;  4AP1 A;  3SGL A;  3SX6 A;  1GRG A;  1ZKQ A;  4C3X A;  4YT0 A;  3JSK A;  2EQ8 A;  2A87 A;  2V60 A;  1B8S A;  2BYB A;  2QA1 A;  4EMJ A;  2A8X A;  4H2R A;  1D7L A;  4EQR A;  1X31 B;  2WU5 A;  2ARD A;  4U2L A;  3AWI A;  3AYL A;  3ALM A;  1H7X A;  2XLU A;  1O5W A;  4M52 A;  1PHH A;  3T2Y A;  3WE0 A;  3NNE A;  2WDV A;  1H86 A;  3PVC A;  3ALL A;  2YLW A;  4TLX A;  3L8K A;  1PXC A;  1H83 A;  1NHP A;  3NN6 X;  3GYI A;  2GVC A;  3G5R A;  3NH3 X;  2Z5X A;  3VRD B;  3BI4 A;  2WPE A;  4H4V A;  4YKF A;  4YSH A;  3SFE A;  2A89 A;  4D03 A;  5JCL A;  3COX A;  4JDR A;  1N1P A;  2Q0K A;  3KLJ A;  3EAO A;  1OJ9 A;  2X8C A;  5TR3 A;  1Y0P A;  4EIQ A;  1BWC A;  1K4Q A;  1LTX R;  1NG4 A;  4U8M A;  4B67 A;  3CND A;  2V3B A;  4J34 A;  3V3O A;  3C4N A;  2YG4 A;  1CBO A;  2XLR A;  4N9X A;  4OPI A;  1UKV G;  1KFY A;  1CC4 A;  1FCD A;  1NPX A;  4NNJ A;  4OPL A;  3UP5 A;  2C72 A;  1GOS A;  4H4P A;  2BA9 A;  1NEN A;  3SZF A;  2QCU A;  3VQR A;  3NT6 A;  2B7S A;  4J33 A;  2FJE A;  2R9Z A;  5EB5 A;  3GMC A;  3L1R A;  3DJD A;  3SYI A;  1CJ3 A;  2I0Z A;  3EF6 A;  3QVR A;  2YVG A;  2IID A;  3ISH A;  3B3R A;  3QSE A;  3QFA A;  2BK5 A;  3NGC X;  1SEZ A;  2IVE A;  2YLZ A;  2E5V A;  4CCQ A;  4YKG A;  1VG0 A;  3FIM B;  4YTP A;  1VQW A;  1RP0 A;  4H2P A;  4FDC B;  4CNK A;  4USQ A;  1VG9 A;  4LA1 A;  3KVE A;  3T14 A;  3UCL A;  4MJW A;  2GR3 A;  2JB2 A;  4UDQ A;  1HYU A;  1N4V A;  2YR5 A;  2XLS A;  5EBK A;  1GND A;  4YSX A;  4AT2 A;  1NHQ A;  2V3A A;  3CPI G;  2Y6Q A;  3GWD A;  4GUV A;  2JK6 A;  1CJC A;  5FS9 A;  2WET A;  1H84 A;  1OJC A;  1ZOY A;  1QLB A;  3AB1 A;  3KU9 A;  1GTE A;  3QFB A;  3IC9 A;  4BK2 A;  2GQW A;  4O5U A;  3FG2 P;  4H2N A;  3NKS A;  1CJ4 A;  1REO A;  1VRQ B;  4C74 A;  2YLX A;  4BK3 A;  3AE3 A;  3DGZ A;  1Z6L A;  1TRB A;  1P2H A;  2WDQ A;  2WP9 A;  3AEF A;  1ZK7 A;  4H4R A;  4HA6 A;  5BUL A;  4JNQ A;  1ZOV A;  3UKL A;  3IHG A;  2FJB A;  3UOZ A;  4X9M A;  3T2Z A;  4Z2U A;  3SFD A;  4H4Z A;  4OCG A;  1XAN A;  2BS3 A;  2XCG A;  3GYX A;  5BRT A;  2ZZC A;  3RHA A;  1E1N A;  3OZ2 A;  4YSZ A;  1YQZ A;  4PAA A;  3QJ4 A;  2R4E A;  5FS7 A;  1GTH A;  3K7T A;  4Y4L A;  2GR1 A;  4OPG A;  2CUL A;  1NG3 A;  2VZ2 A;  4OPT A;  4U8N A;  2BS2 A;  4K2X A;  2FJD A;  3HYX A;  3OC4 A;  4JY2 A;  1KSS A;  1S2Q A;  2WOW A;  2DKH A;  4G9K A;  4I59 A;  3GMB A;  4NTC A;  4Z24 A;  3AD8 B;  3H4K A;  2BRA A;  1PN0 A;  2OLN A;  2C3C A;  4DSH A;  1TYT A;  2GV8 A;  2RAB A;  4CY8 A;  3LB8 A;  1K0L A;  3UP4 A;  2C75 A;  3ALJ A;  3ICT A;  1D4E A;  5U1O A;  1ELI A;  1FEB A;  4J57 A;  4H4Q A;  4NZH A;  4GR1 A;  3P9U A;  2Q7V A;  3EAN A;  3AE5 A;  2R0C A;  1Y56 A;  4Z44 A;  1TDE A;  4ICY A;  2XVJ A;  1KNP A;  3UTE A;  3PO7 A;  4II2 A;  4LU6 A;  4AT0 A;  3SXI A;  1JNR A;  1EL8 A;  3GYJ A;  4B63 A;  1MXT A;  2WU2 A;  3QSS A;  1GPE A;  3F8R A;  1NHS A;  1DOD A;  3BHK A;  4II3 A;  4FK1 A;  4EQS A;  4JQ9 A;  1K0I A;  2GB0 A;  3I3L A;  5IQ4 A;  4B65 A;  3NK1 X;  2R46 A;  3UKP A;  4A6N A;  1TDN A;  3IWA A;  2YG3 A;  1E1M A;  1NHR A;  2JKC A;  3II4 A;  4WCT A;  4Z25 A;  3DK8 A;  1GRE A;  3F8P A;  2EQ6 A;  2WEU A;  1DXL A;  1PXB A;  4AP3 A;  4XXG A;  1CHU A;  2XLT A;  3M13 A;  3UOY A;  3AEE A;  3AD7 B;  3BNM A;  2X8H A;  3G5Q A;  5IPY A;  1PXA A;  1XDI A;  2R4J A;  2GF3 A;  3GD3 A;  3ABV A;  4D04 A;  3CGD A;  3E1T A;  2YWL A;  2GRT A;  1GET A;  3AEG A;  1FL2 A;  2YLR A;  4GRT A;  1N4U A;  4FK1 C;  4H4W A;  3LJP A;  4EQW A;  1CC6 A;  5HXI A;  3AYI A;  3VR9 A;  4ZCD A;  1BF3 A;  3K7M X;  3K7Q X;  5KVI A;  2BRY A;  1JRX A;  1NAA A;  1B5Q A;  1JEH A;  1D4C A;  5JCN A;  5LV9 A;  3GD4 A;  2RGJ A;  1Q1W A;  2JBV A;  4OPC A;  4ADW A;  3SQP A;  4EMW A;  2C64 A;  3NK0 X;  2QA2 A;  2WHD A;  1E39 A;  3LZW A;  4YXD A;  2OLO A;  4BJY A;  1XHC A;  2V61 A;  2YM2 A;  3ATR A;  1H7W A;  2OAL A;  5IQ1 A;  1GRA A;  3LXD A;  3CNJ A;  5EB4 A;  1FEA A;  5J7X A;  3NIX A;  2VQB A;  5BUK A;  5KNL A;  4H2Q A;  2UZZ A;  4U8O A;  2C4C A;  3P4S A;  3ICR A;  1S3B A;  2WES A;  2HQM A;  3CIR A;  4A7A A;  4H4U A;  5KOX A;  2YG5 A;  2B9Y A;  2VQ7 A;  2H89 A;  2XYO A;  2WOV A;  2ZZ0 A;  3CGB A;  3UKH A;  1LVL A;  1IUT A;  2XVE A;  3V3N A;  1Y56 B;  4BK1 A;  4H4Y A;  4ZN0 A;  3GRT A;  3RP7 A;  3DK9 A;  4YTN A;  2AR8 A;  1KDG A;  2XDO A;  3CNT A;  1B37 A;  3C96 A;  2C65 A;  4GDE A;  3Q6J A;  3NN0 X;  2EQ7 A;  4GAV A;  4PAB A;  1PDH A;  4YTM A;  3UTG A;  4A99 A;  1MOK A;  3KD9 A;  3H8I A;  4FX9 A;  3S61 A;  4JY3 A;  3SY4 A;  2JB3 A;  2GMJ A;  1LJ1 A;  2BCG G;  4KPR A;  3LAD A;  3P4P A;  3AYJ A;  4G74 A;  3CPH G;  2GAH B;  3T37 A;  3UKF A;  4C3Y A;  1CJ2 A;  3ZDN A;  2C3D A;  4O5Q A;  1GV4 A;  2BS4 A;  4BV6 A;  2C7G A;  4C77 A;  4P9S A;  3C4A A;  5FMH A;  3UOX A;  4EM4 A;  1PBD A;  2C70 A;  2XVF A;  2X3N A;  2R0G A;  2V6O A;  3CNS A;  3P4R A;  3UOV A;  4H4S A;  3CPJ G;  2ZZB A;  1P2E A;  3GWF A;  4UP3 A;  4Z2T A;  3RNM A;  3IHM A;  1H81 A;  2XVH A;  5KXJ A;  1RSG A;  3K30 A;  3VRB A;  4CCR A;  4NWZ A;  2C76 A;  3IF9 A;  1BGJ A;  3ZYX A;  2EQ9 A;  3F8D A;  1GRT A;  4J2W A;  1F8W A;  3NLC A;  5KMR A;  1DJN A;  4OPD A;  3NTA A;  1S2Y A;  5GRT A;  2AAQ A;  4NEW A;  4NEV A;  3NTD A;  1L0V A;  1O95 A;  1F6M A;  2DKI A;  1TDK A;  2ACZ A;  4B64 A;  5BVA A;  4X4J A;  2VVL G;  1GRH A;  2X99 A;  3DGH A;  4AOS A;  4U8I A;  4OVI A;  4DNA A;  4G73 A;  3NHO X;  2IVD A;  2PYX A;  2TMD A;  4KX6 A;  3LZX A;  3CN8 A;  4USR A;  4RG3 A;  4K5S A;  4C5O A;  3SZW A;  1GT8 A;  2VOU A;  2XFO A;  3DH9 A;  4CY6 A;  3DME A;  2O9Z A;  2RGO A;  2WPC A;  3NYE A;  3PS9 A;  1QJD A;  3AD9 B;  3DJE A;  5EOW A;  1LV0 A;  1YQ4 A;  1IUV A;  2BAB A;  2V5Z A;  2YLS A;  1F8S A;  4IVM B;  4RG4 A;  2CVJ A;  3BI2 A;  4X9N A;  4XWZ A;  1M6I A;  2XFU A;  5HYM A;  1D5T A;  4EIP A;  1EBD A;  1PJ6 A;  1YQ3 A;  4H4X A;  5JCK A;  4K7Z A;  1DOC A;  3M12 A;  1H6V A;  2FJA A;  2BXR A;  2C73 A;  5JCM A;  1OJA A;  1M64 A;  3FBS A;  2BAC A;  4IV9 A;  1NEK A;  4E0V A;  4OPU A;  2F5Z A;  2BC0 A;  3GSI A;  4HB9 A;  3CGC A;  3DA1 A;  2FBW A;  2WS3 A;  1L9D A;  2CDU A;  3RP8 A;  4I58 A;  5JCI A;  1GXF A;  2Y6R A;  3P4Q A;  2APG A;  3UKK A;  2BK4 A;  2GMH A;  1GSN A;  1IUW A;  3AXB A;  3DK4 A;  2WQY A;  5HY5 A;  4A9W A;  1KNR A;  4J31 A;  3Q9T A;  4B1B A;  1VDC A;  5ER0 A;  1GER A;  3SM8 A;  5KMQ A;  4U8K A;  1JNZ A;  2BXS A;  2VRM A;  3UKQ A;  2GEW A;  3AEC A;  1ZP0 A;  1IUS A;  4NTD A;  3AEA A;  2OAM A;  4LII A;  4BJZ A;  5FS6 A;  3RED A;  2GQF A;  3NRN A;  3CNP A;  3HZL A;  3FMW A;  1IUU A;  1PBC A;  1PJ7 A;  4U8J A;  3NYC A;  4J36 A;  4WX1 A;  2X8G A;  4TM3 A;  2B9W A;  4U2S A;  1Q9I A;  2QAE A;  3AED A;  3ATQ A;  3URH A;  4UDP A;  4G6H A;  2WP6 A;  2YLT A;  3H8L A;  1L9C A;  1N4W A;  1S3E A;  1BGN A;  1IUX A;  1DNC A;  3QVP A;  4CRT A;  1H82 A;  1OJD A;  3P1W A;  5KVH A;  4EQX A;  1O94 A;  3CMM A;  4APN A;  1Q1R A;  4Y4N A;  4A79 A;  2YR6 A;  4G6G A;  5C3J A;  5DBJ A;  4B66 A;  3GDP A;  1E7P A;  1PBB A;  3QSM A;  2GH5 A;  4U2T A;  3AE9 A;  2NPX A;  1TYP A;  1BKW A;  3O0H A;  3KKJ A;  2C67 A;  2XLP A;  5CQF A;  3V76 A;  2OA1 A;  1F8R A;  3B6D A;  1ZMD A;  3UTF A;  3D8X A;  1OJT A;  2H88 A;  1V59 A;  2YM1 A;  2YG7 A;  3AE2 A;  4TLZ A;  4CNJ A;  1BZL A;  2R0P A;  1MO9 A;  3VR8 A;  4NTE A;  3VRA A;  5C2T A;  2WDR A;  4XWR A;  3NG7 X;  1CL0 A;  1PS9 A;  1E1K A;  2Q6U A;  1ZDL A;  1FEC A;  4IVO B;  1EL5 A;  2TPR A;  1JOA A;  2B7R A;  3UKA A;  4A6N B;  2BK3 A;  4TM4 A;  1E6E A;  3I6D A;  3ICS A;  1F3P A;  3DJG X;  1PBF A;  3CGE A;  1ONF A;  3NYF A;  2R45 A;  1RYI A;  4EM3 A;  5KWF A;  3AE4 A;  4RSL A;  2C66 A;  4YWO A;  1TDF A;  4U8L A;  3HYW A;  4UDR A;  5KMP A;  3GDN A;  4AOX A;  4B68 A;  2YAU A;  5U63 A;  4ECH A;  2CFY A;  1AOG A;  1DOE A;  3EPT A;  1L9E A;  2GR0 A;  2WBA A;  2XFN A;  2WOI A;  1KSU A;  1CF3 A;  2VVM A;  4Z26 A;  5GSN A;  4EMI A;  1GRB A;  1DOB A;  1JRZ A;  1TDO A;  5U25 A;  5L46 A;  3BI5 A;  3UTH A;  1NDA A;  3S5W A;  1YKJ A;  4A5L A;  3AEB A;  3T0K A;  3BHF A;  2YVJ A;  1CC2 A;  1GEU A;  5CKU A;  2WPF A;  1JU2 A;  3SZC A;  4K5R A;  1DJQ A;  2JAE A;  2RGH A;  4Y4M A;  1YY5 A;  4YSY A;  4J56 A;  4GDP A;  1GES A;  3RP6 A;  2WP5 A;  2YQU A;  3KA7 A;  2E4G A;  2XFP A;  2AQJ A;  2E1M A;  4Z2R A;  2B9X A;  1LQU A;  4B69 A;  3CTY A;  4REK A;  2ZBW A;  1LPF A;  4JNA A;  3T31 A;  4DSG A;  4H50 A;  1W4X A;  1KF6 A;  4U8P A;  3M0O A;  2BC1 A;  4CBQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...