4H2PA

Tetrameric form of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase (mhpco)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
371
structure length
371
Chain Sequence
b'GKTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Rhizobium loti
molecule tags Oxidoreductase
total genus 124
structure length 371
sequence length 371
chains with identical sequence B, C, D
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2012-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4h2pA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4h2pA01
4EM4A 1M64A 4H4ZA 2BABA 1L9CA 3IC9A 3RP6A 1ZOYA 2C66A 1P2EA 4BURA 2C65A 1VDCA 4GRTA 2C76A 3GDPA 1BZLA 1O95A 1RP0A 4A99A 3P1WA 4YT0A 1KSSA 2GV8A 2YLTA 1PXAA 3K30A 2JKCA 4DNAA 3BHFA 3REDA 2AAQA 4Z24A 1W4XA 1XPQA 3DK8A 4EQXA 1XHCA 2EQ8A 3NN6X 5HY5A 3IHGA 2BK5A 3NYCA 5CKUA 2ZZ0A 3QFBA 2XLPA 4USQA 4JNAA 4RG3A 2FJAA 4K5RA 3AE2A 5FS6A 3T37A 1D5TA 1PBCA 2GQWA 4JY3A 3CN8A 4H2QA 3GRTA 4U8KA 4H2NA 1GSNA 5BULA 3QSEA 3AXBA 2BCPA 4X9NA 2X3NA 4Z43A 1TDKA 3AE6A 1GOSA 2X8GA 4BV6A 4CY8A 4B64A 4NTDA 4Z44A 3F8DA 1K0IA 4ZCCA 1TYPA 1DOCA 3GDNA 2JAEA 4OVIA 3ZDNA 3ABVA 3NLCA 4WCTA 4TM4A 1NENA 1B37A 3ATQA 4KPRA 4ZCDA 4A6NB 3BI5A 3AE3A 5U1OA 1F8WA 3UOXA 5IPYA 4IA5A 4AOXA 3AE8A 1KFYA 1YQZA 4C3XA 2VRMA 1EL9A 4A5LA 1KDGA 1NG3A 3UP4A 1FL2A 2HQMA 1E1NA 3CPIG 4HB9A 5M10A 3IF9A 1L9EA 4EMWA 4A65A 2DKHA 2TMDA 2WPEA 2WDRA 2YLRA 1CL0A 3UP5A 4DSHA 2AR8A 2EQ9A 1GRGA 1ZOVA 3AEAA 5EBKA 1S2YA 2RABA 1FOHA 2O9ZA 2X8HA 4EIQA 2XFPA 3K7TA 4I59A 3UOVA 2QA1A 4MJWA 1FECA 2XFQA 4A6NA 5JCNA 3EANA 2WDQA 1DOBA 4K22A 1N4UA 1JU2A 2BXSA 2XVHA 4IA6A 1BF3A 2BS4A 1B5QA 1DJQA 3AEGA 3QVRA 4H4UA 4J33A 2NVKX 4EIPA 1B8SA 3NTAA 3BHKA 2R4JA 2OLNA 1K0LA 1TDNA 3DGHA 1OJDA 3DH9A 3NNEA 3S61A 4CBQA 5JCLA 2EQ6A 1ZK7A 3CPHG 3NGCX 4X4JA 3V76A 1GT8A 3UTGA 3LZWA 1O5WA 2QAEA 1MXTA 5IQ1A 4DGKA 5C3JA 1JRYA 4YXDA 4YTMA 3H8IA 2XCGA 4OPGA 4GR1A 4B1BA 1N4VA 3DJEA 3UTEA 2R0CA 2E5VA 3GD3A 4H4VA 3BNMA 4TM0A 2OA1A 1KNPA 1CC2A 4H50A 4A9WA 2QA2A 2WHDA 1YQ3A 4ECHA 1F3PA 4UDPA 1OJAA 2VQBA 3GWDA 2JBVA 1KSUA 1ZY8A 1Q1WA 3COXA 3CTYA 1Y0PA 2WU2A 4K5SA 5KVIA 4B65A 5HYMA 3VRDB 1GRBA 1CJ3A 1IUTA 4PAAA 3S5WA 3QSMA 4U8NA 2V3BA 3NK1X 4N9XA 1D4CA 1H7XA 4B66A 3DJDA 1NAAA 1H6VA 2C3DA 2A89A 4TLXA 1HYUA 5IQ4A 4WX1A 3PS9A 2WBAA 2X99A 1GRFA 2GR0A 3AE5A 4B69A 3CGEA 3ADAB 2YQUA 1LTXR 3AD7B 4UDQA 3IWAA 2ZBWA 3NYFA 2YWLA 4YSZA 3HZLA 4O5QA 1M6IA 4FX9A 1ONFA 1RSGA 2C73A 2GMJA 2R9ZA 3P4QA 3I6DA 4BK3A 3GSIA 4BJZA 2YVJA 4YSYA 2GMHA 1E7PA 1PBFA 3GWFA 3NTDA 4U2LA 4XXGA 4YSHA 5JCKA 5KVHA 4C77A 1JNRA 3AE4A 2BK3A 2ZZCA 3QSSA 1DOEA 3CIRA 1EL8A 2CVJA 3DJGX 4O5UA 3PVCA 2AQJA 2YVFA 2BC0A 4C3YA 2Z5XA 2BA9A 4H4QA 3WE0A 3LZXA 4J2WA 2GVCA 3Q6JA 3RHAA 2B9XA 1AOGA 1BWCA 1IUUA 2V6OA 2VQ7A 4GUVA 3P4RA 2OLOA 4JY2A 1VQWA 2Q0LA 3UKKA 1IUVA 3AEDA 3L8KA 5U25A 1GTEA 2R0GA 4H4PA 2B9YA 1DJNA 1DXLA 3PO7A 1QO8A 2YLXA 2YAUA 2GF3A 2FBWA 3NIXA 4YTNA 2YR4A 1PJ6A 3FBSA 1XDIA 3LOVA 3NK2X 5EB4A 3ALMA 1JNZA 1PBEA 4OCGA 4Z2UA 2V5ZA 2E4GA 4A79A 1PJ7A 2B9WA 2C75A 3G5RA 3GYJA 3NYEA 2XLRA 4UDRA 2C3CA 1TRBA 3VQRA 1S3EA 2YG4A 3K7MX 4B63A 3C96A 4NZHA 1DNCA 5TR3A 2UZZA 2BXRA 1GERA 3BI4A 1IUSA 5C2TA 2GR1A 1SEZA 3D1CA 2BACA 4JQ9A 4M52A 1BGJA 2YM2A 3RNMA 3NG7X 5J7XA 1PS9A 2GRTA 2V61A 3DA1A 4REKA 3LADA 3QFAA 4TM1A 1N4WA 3GRSA 4K2XA 2BC1A 1CC4A 2H89A 4J36A 1B4VA 1GETA 1K0JA 3GYIA 2Z5YA 4LIIA 4RSLA 3GMBA 1QLBA 1ZX9A 4Z2TA 1PJ5A 3UKLA 5CQFA 1CC6A 1VRQB 2CULA 2WP6A 3UKFA 1F8SA 4GDEA 5EB5A 4AP3A 1L9DA 1GESA 3CNSA 2BCGG 3SFEA 3B6DA 2GB0A 1LJ1A 3CNTA 1K4QA 4IVMB 4H4SA 5JCMA 1GREA 4OPDA 1L0VA 1PBDA 2YLZA 2C67A 2XLSA 2VRLA 1S2QA 4XWZA 2BS3A 4RG4A 2C72A 3EAOA 1Z6LA 2ACZA 2XDOA 2XFOA 4U8OA 3AE9A 5L46A 1NHPA 3IHMA 4APNA 1EL5A 5BRTA 1QJDA 3DK4A 3VRAA 1ZKQA 1ZP0A 4CY6A 3AEEA 1REOA 3FG2P 4YSXA 3G5SA 3KLJA 5KOXA 2VOUA 2XVIA 4U8MA 3ICTA 5KXJA 2A8XA 1TDFA 2C70A 3CNJA 2XFUA 4K8DA 1GNDA 1NDAA 5GRTA 2V60A 1P2HA 2YM1A 3AB1A 1D7LA 1V59A 3GMCA 1IUXA 3M12A 4CCRA 1NEKA 3SM8A 4LA1A 1GV4A 1YKJA 1GTHA 1H82A 1JEHA 2VVLA 4PABA 4CRTA 3G5QA 2TPRA 4EQRA 1EBDA 2YR5A 1COYA 4H2PA 1E6EA 1YY5A 1O94A 2VVMA 2W0HA 2ARDA 3FMWA 2WU5A 4TM3A 4YWOA 3UOYA 4EMJA 3CNPA 3M0OA 1DODA 4FK1C 4X9MA 1LPFA 1IUWA 3F8RA 1ELIA 1VG9A 2OALA 4KX6A 3ZYXA 2R45A 4J31A 4OPTA 2JK6A 5LV9A 2VZ2A 3AYJA 4B68A 2A87A 2X8CA 4H4TA 5KRQA 4J56A 2E1MA 3P9UA 3ALLA 1D4DA 1NPXA 1GRHA 4U8IA 4J57A 3VR9A 3AECA 1LQTA 1MO9A 3AD9B 1CJCA 1CHUA 1UKVG 4A7AA 2CDUA 4TLZA 3AEFA 2FJEA 2H88A 1ZMDA 2YLWA 1PN0A 3ITJA 3UKPA 1Q9IA 2GR3A 3SGLA 3NHOX 2VVLG 2R4EA 3EPTA 4EQSA 2WEUA 1E1MA 5FS8A 3AE1A 5U63A 4C5OA 1TDOA 4BK1A 2R46A 3DGZA 1KF6A 4BK2A 2ZZBA 5FS9A 1TDEA 3RP7A 4AT2A 4LU6A 1FEBA 3B3RA 3BNUA 1OJCA 1OJ9A 4EM3A 4USRA 2CFYA 3KVEA 1IJHA 4J34A 4OPLA 1D4EA 2C64A 1CJ4A 3AE7A 4Y4MA 4NEWA 3H4KA 4UP3A 2XLUA 2YVGA 4IV9A 2BK4A 1ZMCA 3L1RA 1F6MA 2I0ZA 1FEAA 3VR8A 4GF7A 1S3BA 2JB3A 4CNJA 1OJTA 2WQYA 3QJ4A 4BJYA 3II4A 2WP9A 4H2RA 2IVDA 1ZDLA 2GAGB 4K7ZA 1MOKA 3CPJG 5BUKA 1F8RA 1LQUA 4JNQA 2RGOA 1H81A 3H8LA 2WOWA 4OPUA 4U2SA 1GEUA 1X31B 2J3NA 4Y4LA 3AYIA 4Y4NA 2YG7A 2XVJA 2WESA 2GQFA 1BKWA 3ALJA 4GCMA 4NTEA 1BGNA 2B7SA 1EL7A 3BI2A 3KU9A 3NT6A 1GPEA 2RGJA 2APGA 3O0HA 1E1KA 5DBJA 3DJJA 4JN9A 1JOAA 1JRZA 1PXCA 3GD4A 1E39A 3KA7A 2BYBA 5KWFA 2WPFA 4FK1A 3LXDA 3AEBA 3ICRA 1KNRA 3Q9TA 1XANA 2GH5A 3VRBA 1NG4A 2JB2A 3UKQA 1Y56B 2FJBA 2PYXA 5FMHA 4AT0A 2WDVA 4I58A 2R0PA 3CNDA 4XWRA 4JDRA 4ZN0A 2EQ7A 1CBOA 3AD8B 4D03A 2WETA 4DSGA 1GALA 3OZ2A 1GXFA 2XFNA 3RP8A 4CCQA 3ICSA 2PHHA 3KKJA 3I3LA 1PBBA 2WPCA 4GDPA 3V3OA 4EQWA 3LB8A 4U8JA 1JRXA 2XVEA 4P9SA 5BVAA 4YKFA 3NH3X 2FJDA 4Z2RA 4HA6A 4H4YA 4D04A 2YG6A 3DK9A 2BS2A 2OAMA 3D8XA 3URHA 2V3AA 1E1LA 4H7UA 3NK0X 1H84A 2C7GA 4H4WA 2DKIA 3M13A 3K7QX 3KD9A 3UCLA 5HHFA 4AOSA 3FPZA 3UKAA 3P4SA 1GRTA 3AWIA 4OPCA 3UKHA 4H4RA 1H83A 4AP1A 3NRNA 1NHRA 1Y56A 1CJ2A 2YG5A 3SFDA 3OC4A 2XYOA 4U8LA 2IVEA 4ICYA 3SQPA 1CF3A 2WOIA 3R9UA 5GSNA 2Y6QA 3E1TA 1Q1RA 1LV0A 4E0VA 3C4NA 3UOZA 2YG3A 2IIDA 5JCIA 4NTCA 2YR6A 3AYLA 3P4PA 5KOWA 4H4XA 1N1PA 1LVLA 3QVPA 3C4AA 5ER0A 5M0ZA 4U2TA 2WS3A 3LJPA 4OPIA 1GRAA 1H86A 2B7RA 2GEWA 5FS7A 2XLTA 3DMEA 1VG0A 1NHQA 1TYTA 2Q6UA 2NPXA 4FDCB 5J60A 4ADWA 2QCUA 1H7WA 3FIMB 3NKSA 2F5ZA 3KPFA 3NN0X 3V3NA 3ATRA 2WP5A 4Z26A 3F8PA 1D7YA 4NEVA 3CGCA 3JSKA 4YKGA 2WOVA 2GR2A 4C74A 5HXIA 1NHSA 1PDHA 3CGBA 3UTHA 4YTPA 4U8PA 5EOWA 2YLSA 4Z25A 4EMIA 3UTFA 2X50A 2Y6RA 1RYIA 2Q7VA 4B67A 1YQ4A 3EF6A 1PHHA 2B76A 3CGDA 1FCDA 1PXBA 2JB1A 2Q0KA 2RGHA 2XVFA 4IVOB 3ISHA 4CNKA 2GAHB
chains in the Genus database with same CATH superfamily
4YJGA 1M64A 4EM4A 4YJHA 4H4ZA 2BABA 1L9CA 3IC9A 1ZOYA 3W4JA 2C66A 1P2EA 4BURA 2C65A 1VDCA 4GRTA 2C76A 3GDPA 1BZLA 1O95A 3W4KA 1RP0A 4A99A 1C0KA 3P1WA 4YT0A 1KSSA 2GV8A 2YLTA 1PXAA 3K30A 4G6GA 3T2ZA 2JKCA 4DNAA 3BHFA 3REDA 2AAQA 4Z24A 3SXIA 1W4XA 1XPQA 3DK8A 4EQXA 1XHCA 2EQ8A 3NN6X 5HY5A 3IHGA 2BK5A 3NYCA 5CKUA 2ZZ0A 3QFBA 2XLPA 4USQA 4JNAA 4RG3A 2FJAA 4K5RA 3AE2A 5FS6A 3T37A 1PBCA 1D5TA 2GQWA 4JY3A 3CN8A 4H2QA 3GRTA 4U8KA 4H2NA 1GSNA 5BULA 3QSEA 3AXBA 2BCPA 4X9NA 2X3NA 4Z43A 1TDKA 3AE6A 1GOSA 2X8GA 4BV6A 4CY8A 4B64A 4NTDA 3ZNQA 3F8DA 1K0IA 4ZCCA 4Z44A 1TYPA 1DOCA 3GDNA 2JAEA 4OVIA 3ZDNA 3ABVA 4WCTA 3NLCA 4TM4A 1DDOA 1NENA 1B37A 3ATQA 4KPRA 4ZCDA 4A6NB 3BI5A 3AE3A 5U1OA 1F8WA 3UOXA 5IPYA 4IA5A 4AOXA 3AE8A 1KFYA 1YQZA 3KPKA 4C3XA 2VRMA 1EL9A 4A5LA 1KDGA 1NG3A 3UP4A 1FL2A 2HQMA 1E1NA 3CPIG 4HB9A 5M10A 3IF9A 1L9EA 4EMWA 1AN9A 4A65A 2DKHA 2TMDA 2WPEA 2WDRA 2YLRA 1CL0A 3UP5A 4DSHA 2AR8A 2EQ9A 1ZOVA 1GRGA 3AEAA 5EBKA 1S2YA 2RABA 1FOHA 2O9ZA 2X8HA 4EIQA 2XFPA 3K7TA 4I59A 3UOVA 2QA1A 4MJWA 1FECA 2XFQA 4A6NA 5JCNA 3EANA 2WDQA 1DOBA 4K22A 1N4UA 1JU2A 2BXSA 2C4CA 2XVHA 4IA6A 1BF3A 2BS4A 1B5QA 1DJQA 3AEGA 3QVRA 4H4UA 4J33A 2NVKX 4EIPA 1B8SA 3NTAA 3BHKA 2R4JA 2OLNA 1K0LA 1TDNA 3DGHA 1OJDA 3DH9A 3NNEA 3S61A 4II2A 4CBQA 5JCLA 2EQ6A 1ZK7A 3CPHG 3NGCX 4X4JA 3V76A 1GT8A 3UTGA 3LZWA 1O5WA 2QAEA 1MXTA 5IQ1A 4DGKA 5C3JA 1JRYA 4YXDA 4YTMA 3H8IA 2XCGA 4OPGA 4GR1A 4B1BA 3DJEA 1N4VA 3UTEA 2R0CA 2E5VA 3GD3A 4H4VA 3BNMA 3CMMA 4TM0A 2OA1A 1KNPA 1CC2A 4H50A 4A9WA 2QA2A 2WHDA 1YQ3A 4ECHA 1F3PA 4UDPA 1OJAA 2VQBA 3GWDA 2JBVA 1KSUA 3SYIA 1ZY8A 1Q1WA 3COXA 3CTYA 1Y0PA 2WU2A 4K5SA 5KVIA 4B65A 5HYMA 3VRDB 1GRBA 1CJ3A 1IUTA 4PAAA 3S5WA 3QSMA 4U8NA 2V3BA 3NK1X 4N9XA 1D4CA 1H7XA 4B66A 3DJDA 1NAAA 1H6VA 2C3DA 2A89A 4TLXA 1HYUA 2BRYA 5IQ4A 4WX1A 1C0PA 3PS9A 2WBAA 2X99A 1GRFA 2GR0A 2E49A 3AE5A 4B69A 3CGEA 3ADAB 2YQUA 3AD7B 1LTXR 4UDQA 3IWAA 2ZBWA 3NYFA 2YWLA 4YSZA 3HZLA 5KMRA 4O5QA 1M6IA 4FX9A 1ONFA 1RSGA 2C73A 2GMJA 2R9ZA 3P4QA 4BK3A 3I6DA 3GSIA 2E48A 4BJZA 2YVJA 4YSYA 2GMHA 1PBFA 4YSHA 1E7PA 3GWFA 3NTDA 4U2LA 4XXGA 2E82A 5JCKA 5KVHA 4C77A 1JNRA 3AE4A 2BK3A 2ZZCA 3QSSA 1DOEA 3CIRA 1EL8A 2CVJA 3DJGX 4O5UA 3PVCA 2AQJA 2YVFA 2BC0A 4C3YA 2Z5XA 2BA9A 4H4QA 3SZ0A 3T31A 3LZXA 3WE0A 4J36A 4J2WA 2GVCA 3Q6JA 3RHAA 2B9XA 1AOGA 1BWCA 1IUUA 2V6OA 2VQ7A 4GUVA 3P4RA 2OLOA 4JY2A 1VQWA 2Q0LA 3UKKA 1IUVA 3AEDA 3L8KA 5U25A 1GTEA 2R0GA 4H4PA 2B9YA 1DJNA 1DXLA 3PO7A 1QO8A 2YLXA 2YAUA 2GF3A 2FBWA 3NIXA 4YTNA 2YR4A 1PJ6A 3FBSA 1XDIA 3LOVA 3NK2X 5EB4A 3ALMA 1JNZA 1PBEA 4OCGA 4Z2UA 2V5ZA 2E4GA 4A79A 1PJ7A 2B9WA 2C75A 3G5RA 3GYJA 3NYEA 2XLRA 4UDRA 2C3CA 1TRBA 3VQRA 1S3EA 2YG4A 3K7MX 4B63A 3C96A 4NZHA 1DNCA 5TR3A 2UZZA 2BXRA 1GERA 3BI4A 1IUSA 5C2TA 2GR1A 1C0IA 1SEZA 3D1CA 2BACA 4JQ9A 4M52A 4YJFB 1BGJA 2YM2A 4GAPA 3RNMA 3NG7X 5J7XA 1PS9A 2GRTA 3DA1A 2V61A 4REKA 3LADA 3QFAA 4TM1A 1N4WA 3GRSA 4K2XA 1CC4A 3RP6A 3ZNPA 4RSLA 1B4VA 1K0JA 1GETA 2BC1A 2H89A 2Z5YA 3GYIA 3GMBA 4LIIA 1QLBA 1ZX9A 4Z2TA 1PJ5A 3UKLA 5CQFA 1CC6A 1VRQB 2CULA 2WP6A 3UKFA 1F8SA 4GDEA 5EB5A 4AP3A 1L9DA 1GESA 3CNSA 2BCGG 3SFEA 3B6DA 2GB0A 1LJ1A 3CNTA 1K4QA 4IVMB 4H4SA 5JCMA 1GREA 4OPDA 1L0VA 1PBDA 2YLZA 4II3A 2C67A 2XLSA 4XWZA 1S2QA 2VRLA 2BS3A 4GAVA 4RG4A 2C72A 3EAOA 1Z6LA 2ACZA 2XDOA 2XFOA 4U8OA 5L46A 3AE9A 3IHMA 4YJFA 1NHPA 1EL5A 2DU8A 3T2KA 4APNA 1QJDA 5BRTA 3DK4A 3VRAA 1ZKQA 1ZP0A 4CY6A 3AEEA 1REOA 3FG2P 4YSXA 3G5SA 3KLJA 5KOXA 2VOUA 2XVIA 4U8MA 3ICTA 5KXJA 2A8XA 1TDFA 2C70A 3CNJA 2XFUA 4K8DA 1GNDA 1NDAA 5GRTA 4QFCA 2V60A 3M12A 1P2HA 2YM1A 1D7LA 1V59A 3GMCA 1IUXA 3AB1A 4CCRA 1NEKA 3SM8A 4LA1A 1GV4A 1YKJA 1GTHA 4PABA 1JEHA 3CUKA 1H82A 2BRAA 2VVLA 3G5QA 2TPRA 3SX6A 3T14A 4CRTA 5KNLA 4EQRA 1EBDA 4G74A 2YR5A 1COYA 4H2PA 3T0KA 1E6EA 1YY5A 1O94A 2VVMA 2W0HA 2ARDA 3FMWA 4QFDA 2WU5A 4TM3A 4YWOA 3UOYA 4EMJA 3M0OA 3CNPA 1DODA 4FK1C 4X9MA 1LPFA 1IUWA 3F8RA 1ELIA 1VG9A 2OALA 4KX6A 3ZYXA 3SZWA 2R45A 4J31A 4OPTA 2JK6A 3WGTA 5LV9A 2VZ2A 3AYJA 4B68A 2A87A 5KMSA 3HYXA 2X8CA 4H4TA 5KRQA 4J56A 2E1MA 3P9UA 3ALLA 1D4DA 1NPXA 1GRHA 4U8IA 4J57A 3VR9A 3AECA 1LQTA 1MO9A 3AD9B 1CJCA 1CHUA 1UKVG 4A7AA 2CDUA 4TLZA 3AEFA 2FJEA 2H88A 1ZMDA 2YLWA 1PN0A 3ITJA 3UKPA 3ZNNA 1Q9IA 2GR3A 3SGLA 3NHOX 1VE9A 2VVLG 2R4EA 3EPTA 4EQSA 2WEUA 1E1MA 5FS8A 4NNJA 3AE1A 5U63A 4C5OA 3G3EA 2E4AA 1TDOA 4BK1A 2R46A 3DGZA 1KF6A 4BK2A 2ZZBA 5FS9A 1TDEA 3RP7A 4AT2A 4LU6A 1FEBA 3B3RA 3BNUA 1EVIA 1OJCA 1OJ9A 3T2YA 4USRA 2CFYA 4EM3A 3HYWA 1IJHA 3KVEA 4J34A 4OPLA 1D4EA 2C64A 1CJ4A 3AE7A 4Y4MA 4NEWA 3H4KA 4UP3A 2XLUA 2YVGA 4IV9A 1DAOA 2BK4A 1ZMCA 3W4IA 3L1RA 1F6MA 2I0ZA 3SY4A 1FEAA 3VR8A 4GF7A 1S3BA 2JB3A 4CNJA 1OJTA 2WQYA 3QJ4A 4BJYA 3II4A 3SZCA 2WP9A 4H2RA 2IVDA 2GAGB 1ZDLA 4K7ZA 1MOKA 3CPJG 5BUKA 1F8RA 1LQUA 4JNQA 3SZFA 2RGOA 1H81A 3H8LA 2WOWA 4OPUA 4U2SA 1GEUA 1X31B 2J3NA 4Y4LA 3AYIA 4Y4NA 2YG7A 2XVJA 2WESA 2GQFA 4NWZA 1BKWA 3ALJA 4GCMA 1KIFA 4NTEA 1BGNA 2B7SA 1EL7A 3BI2A 3KU9A 3NT6A 2RGJA 1GPEA 2APGA 3O0HA 5KMQA 1E1KA 5DBJA 3DJJA 4JN9A 1JOAA 1PXCA 1JRZA 3GD4A 1E39A 3KA7A 2BYBA 5KWFA 2WPFA 4FK1A 3LXDA 3AEBA 3ICRA 1KNRA 3Q9TA 1XANA 4YJDA 2GH5A 3VRBA 1NG4A 2JB2A 3UKQA 1Y56B 2FJBA 2PYXA 5FMHA 4AT0A 2WDVA 4I58A 2R0PA 3CNDA 4XWRA 4JDRA 4ZN0A 3AD8B 1CBOA 2EQ7A 4D03A 2WETA 4DSGA 1GALA 3OZ2A 3RP8A 1GXFA 2XFNA 4CCQA 3ICSA 2PHHA 3KKJA 3I3LA 1PBBA 2WPCA 4GDPA 3V3OA 4EQWA 3LB8A 3ZNOA 4U8JA 1JRXA 4P9SA 2XVEA 5BVAA 4YKFA 3NH3X 2FJDA 4Z2RA 4HA6A 4H4YA 4D04A 2YG6A 3DK9A 2BS2A 2OAMA 3D8XA 3URHA 2V3AA 1E1LA 4H7UA 3NK0X 1H84A 2C7GA 4H4WA 2DKIA 3M13A 3K7QX 3KD9A 3UCLA 5HHFA 4AOSA 3FPZA 4G6HA 3UKAA 3P4SA 1GRTA 3AWIA 4G9KA 4OPCA 3UKHA 4H4RA 1H83A 4AP1A 3NRNA 1NHRA 1Y56A 1CJ2A 2YG5A 3SFDA 3OC4A 2XYOA 4U8LA 2IVEA 4ICYA 3SQPA 1CF3A 2WOIA 3R9UA 5GSNA 2Y6QA 3E1TA 1Q1RA 1LV0A 4E0VA 5KMPA 3C4NA 3UOZA 2YG3A 2IIDA 5JCIA 4NTCA 2YR6A 3AYLA 3P4PA 5KOWA 4H4XA 1N1PA 1LVLA 4YJGB 3C4AA 3QVPA 5ER0A 4YJHB 5M0ZA 4U2TA 2WS3A 3LJPA 4OPIA 1GRAA 1H86A 2B7RA 2GEWA 5FS7A 2XLTA 3DMEA 4G73A 1VG0A 1NHQA 2Q6UA 1TYTA 1C0LA 2NPXA 4FDCB 5J60A 4ADWA 2QCUA 1H7WA 3FIMB 3NKSA 2F5ZA 3KPFA 3NN0X 3V3NA 3ATRA 2WP5A 3HYVA 4Z26A 3F8PA 1D7YA 4NEVA 3CGCA 3JSKA 3GYXA 4YKGA 2WOVA 2GR2A 4C74A 5HXIA 1PDHA 1NHSA 3CGBA 3UTHA 4YTPA 4U8PA 5EOWA 2YLSA 4Z25A 4EMIA 3UTFA 2X50A 2Y6RA 1RYIA 2Q7VA 4B67A 1YQ4A 3EF6A 1PHHA 2B76A 3CGDA 2RGHA 1PXBA 1FCDA 2JB1A 2Q0KA 2XVFA 4IVOB 3ISHA 4CNKA 2GAHB
chains in the Genus database with same CATH topology
4EM4A 1M64A 4H4ZA 2BABA 1L9CA 3IC9A 1ZOYA 2C66A 1P2EA 4BURA 2C65A 1VDCA 4GRTA 2C76A 3GDPA 1BZLA 1O95A 1RP0A 4A99A 3P1WA 4YT0A 1KSSA 2GV8A 2YLTA 1PXAA 3K30A 4G6GA 3T2ZA 2JKCA 4DNAA 3BHFA 3REDA 2AAQA 4Z24A 3SXIA 1W4XA 1XPQA 3DK8A 4EQXA 1XHCA 2EQ8A 3NN6X 5HY5A 3IHGA 2BK5A 3NYCA 5CKUA 2ZZ0A 3QFBA 2XLPA 4USQA 4JNAA 4RG3A 2FJAA 4K5RA 3AE2A 5FS6A 3T37A 1D5TA 1PBCA 2GQWA 4JY3A 3CN8A 4H2QA 3GRTA 4U8KA 4H2NA 1GSNA 5BULA 3QSEA 3AXBA 2BCPA 4X9NA 2X3NA 4Z43A 1TDKA 3AE6A 1GOSA 2X8GA 4BV6A 4CY8A 4B64A 4NTDA 4Z44A 3F8DA 1K0IA 4ZCCA 1TYPA 1DOCA 3GDNA 2JAEA 4OVIA 3ZDNA 3ABVA 3NLCA 4WCTA 4TM4A 1NENA 1B37A 3ATQA 4KPRA 4ZCDA 4A6NB 3BI5A 3AE3A 5U1OA 1F8WA 3UOXA 5IPYA 4IA5A 4AOXA 3AE8A 1KFYA 1YQZA 3KPKA 4C3XA 2VRMA 1EL9A 4A5LA 1KDGA 1NG3A 3UP4A 1FL2A 2HQMA 1E1NA 3CPIG 4HB9A 5M10A 3IF9A 1L9EA 4EMWA 4A65A 2DKHA 2TMDA 2WPEA 2WDRA 2YLRA 1CL0A 3UP5A 4DSHA 2AR8A 2EQ9A 1GRGA 1ZOVA 3AEAA 5EBKA 1S2YA 2RABA 1FOHA 2O9ZA 2X8HA 4EIQA 2XFPA 3K7TA 4I59A 3UOVA 2QA1A 4MJWA 1FECA 2XFQA 4A6NA 5JCNA 3EANA 2WDQA 1DOBA 4K22A 1N4UA 1JU2A 2BXSA 2C4CA 2XVHA 4IA6A 1BF3A 2BS4A 1B5QA 1DJQA 3AEGA 3QVRA 4H4UA 4J33A 2NVKX 4EIPA 1B8SA 3NTAA 3BHKA 2R4JA 2OLNA 1K0LA 1TDNA 3DGHA 1OJDA 3DH9A 3NNEA 3S61A 4II2A 4CBQA 5JCLA 2EQ6A 1ZK7A 3CPHG 3NGCX 4X4JA 3V76A 1GT8A 3UTGA 3LZWA 1O5WA 2QAEA 1MXTA 5IQ1A 4DGKA 5C3JA 1JRYA 4YXDA 4YTMA 3H8IA 2XCGA 4OPGA 4GR1A 4B1BA 1N4VA 3DJEA 3UTEA 2R0CA 2E5VA 3GD3A 4H4VA 3BNMA 3CMMA 4TM0A 2OA1A 1KNPA 1CC2A 4H50A 4A9WA 2QA2A 2WHDA 1YQ3A 4ECHA 1F3PA 4UDPA 1OJAA 2VQBA 3GWDA 2JBVA 1KSUA 3SYIA 1ZY8A 1Q1WA 3COXA 3CTYA 1Y0PA 2WU2A 4K5SA 5KVIA 4B65A 5HYMA 3VRDB 1GRBA 1CJ3A 1IUTA 4PAAA 3S5WA 3QSMA 4U8NA 2V3BA 3NK1X 4N9XA 1D4CA 1H7XA 4B66A 3DJDA 1NAAA 1H6VA 2C3DA 2A89A 4TLXA 1HYUA 2BRYA 5IQ4A 4WX1A 3PS9A 2WBAA 2X99A 1GRFA 2GR0A 3AE5A 4B69A 3CGEA 3ADAB 2YQUA 1LTXR 3AD7B 4UDQA 3IWAA 2ZBWA 3NYFA 2YWLA 4YSZA 3HZLA 5KMRA 4O5QA 1M6IA 4FX9A 1ONFA 1RSGA 2C73A 2GMJA 2R9ZA 3P4QA 4BK3A 3I6DA 3GSIA 4BJZA 2YVJA 4YSYA 2GMHA 1E7PA 1PBFA 3GWFA 3NTDA 4U2LA 4XXGA 4YSHA 5JCKA 5KVHA 4C77A 1JNRA 3AE4A 2BK3A 2ZZCA 3QSSA 1DOEA 3CIRA 1EL8A 2CVJA 3DJGX 4O5UA 3PVCA 2AQJA 2YVFA 2BC0A 4C3YA 2Z5XA 2BA9A 4H4QA 3SZ0A 3T31A 3LZXA 3WE0A 4J2WA 2GVCA 3Q6JA 3RHAA 2B9XA 1AOGA 1BWCA 1IUUA 2V6OA 2VQ7A 4GUVA 3P4RA 2OLOA 4JY2A 1VQWA 2Q0LA 3UKKA 1IUVA 3AEDA 3L8KA 5U25A 1GTEA 2R0GA 4H4PA 2B9YA 1DJNA 1DXLA 3PO7A 1QO8A 2YLXA 2YAUA 2GF3A 2FBWA 3NIXA 4YTNA 2YR4A 1PJ6A 3FBSA 1XDIA 3LOVA 3NK2X 5EB4A 3ALMA 1JNZA 1PBEA 4OCGA 4Z2UA 2V5ZA 2E4GA 4A79A 1PJ7A 2B9WA 2C75A 3G5RA 3GYJA 3NYEA 2XLRA 4UDRA 2C3CA 1TRBA 3VQRA 1S3EA 2YG4A 3K7MX 4B63A 3C96A 4NZHA 1DNCA 5TR3A 2UZZA 2BXRA 1GERA 3BI4A 1IUSA 5C2TA 2GR1A 1SEZA 3D1CA 2BACA 4JQ9A 4M52A 1BGJA 2YM2A 4GAPA 3RNMA 3NG7X 5J7XA 1PS9A 2GRTA 2V61A 3DA1A 4REKA 3LADA 3QFAA 4TM1A 1N4WA 3GRSA 4K2XA 2BC1A 3RP6A 1CC4A 2H89A 1B4VA 1GETA 1K0JA 3GYIA 2Z5YA 4J36A 4LIIA 3GMBA 4RSLA 1QLBA 1ZX9A 4Z2TA 1PJ5A 3UKLA 5CQFA 1CC6A 1VRQB 2CULA 2WP6A 3UKFA 1F8SA 4GDEA 5EB5A 4AP3A 1L9DA 1GESA 3CNSA 2BCGG 3SFEA 3B6DA 2GB0A 1LJ1A 3CNTA 1K4QA 4IVMB 4H4SA 5JCMA 1GREA 4OPDA 1L0VA 1PBDA 2YLZA 4II3A 2C67A 2XLSA 2VRLA 1S2QA 4XWZA 2BS3A 4GAVA 4RG4A 2C72A 3EAOA 1Z6LA 2ACZA 2XDOA 2XFOA 4U8OA 3AE9A 5L46A 3IHMA 1NHPA 3T2KA 1EL5A 4APNA 5BRTA 1QJDA 3DK4A 3VRAA 1ZKQA 1ZP0A 4CY6A 3AEEA 1REOA 3FG2P 4YSXA 3G5SA 3KLJA 5KOXA 2VOUA 2XVIA 4U8MA 3ICTA 5KXJA 2A8XA 1TDFA 2C70A 3CNJA 2XFUA 4K8DA 1GNDA 1NDAA 5GRTA 2V60A 1P2HA 2YM1A 3AB1A 1D7LA 1V59A 3GMCA 1IUXA 3M12A 4CCRA 1NEKA 3SM8A 4LA1A 1GV4A 1YKJA 1GTHA 1H82A 1JEHA 2BRAA 2VVLA 4PABA 3T14A 3G5QA 2TPRA 3SX6A 4CRTA 5KNLA 4EQRA 1EBDA 4G74A 2YR5A 1COYA 4H2PA 3T0KA 1E6EA 1YY5A 1O94A 2VVMA 2W0HA 2ARDA 3FMWA 2WU5A 4TM3A 4YWOA 3UOYA 4EMJA 3CNPA 3M0OA 1DODA 4FK1C 4X9MA 1LPFA 1IUWA 3F8RA 1ELIA 1VG9A 2OALA 4KX6A 3ZYXA 3SZWA 2R45A 4J31A 4OPTA 2JK6A 5LV9A 2VZ2A 3AYJA 4B68A 2A87A 5KMSA 3HYXA 2X8CA 4H4TA 5KRQA 4J56A 2E1MA 3P9UA 3ALLA 1D4DA 1NPXA 1GRHA 4U8IA 4J57A 3VR9A 3AECA 1LQTA 1MO9A 3AD9B 1CJCA 1CHUA 1UKVG 4A7AA 2CDUA 4TLZA 3AEFA 2FJEA 2H88A 1ZMDA 2YLWA 1PN0A 3ITJA 3UKPA 1Q9IA 2GR3A 3SGLA 3NHOX 2VVLG 2R4EA 3EPTA 4EQSA 2WEUA 1E1MA 5FS8A 4NNJA 3AE1A 5U63A 4C5OA 1TDOA 4BK1A 2R46A 3DGZA 1KF6A 4BK2A 2ZZBA 5FS9A 1TDEA 3RP7A 4AT2A 4LU6A 1FEBA 3B3RA 3BNUA 1OJCA 1OJ9A 3T2YA 4USRA 2CFYA 4EM3A 3HYWA 1IJHA 3KVEA 4J34A 4OPLA 1D4EA 2C64A 1CJ4A 3AE7A 4Y4MA 4NEWA 3H4KA 4UP3A 2XLUA 2YVGA 4IV9A 2BK4A 1ZMCA 3L1RA 1F6MA 2I0ZA 3SY4A 1FEAA 3VR8A 4GF7A 1S3BA 2JB3A 4CNJA 1OJTA 2WQYA 3QJ4A 4BJYA 3II4A 3SZCA 2WP9A 4H2RA 2IVDA 1ZDLA 2GAGB 4K7ZA 1MOKA 3CPJG 5BUKA 1F8RA 1LQUA 4JNQA 3SZFA 2RGOA 1H81A 3H8LA 2WOWA 4OPUA 4U2SA 1GEUA 1X31B 2J3NA 4Y4LA 3AYIA 4Y4NA 2YG7A 2XVJA 2WESA 2GQFA 4NWZA 1BKWA 3ALJA 4GCMA 4NTEA 1BGNA 2B7SA 1EL7A 3BI2A 3KU9A 3NT6A 2RGJA 1GPEA 2APGA 3O0HA 5KMQA 1E1KA 5DBJA 3DJJA 4JN9A 1JOAA 1JRZA 1PXCA 3GD4A 1E39A 3KA7A 2BYBA 5KWFA 2WPFA 4FK1A 3LXDA 3AEBA 3ICRA 1KNRA 3Q9TA 1XANA 2GH5A 3VRBA 1NG4A 2JB2A 3UKQA 1Y56B 2FJBA 2PYXA 5FMHA 4AT0A 2WDVA 4I58A 2R0PA 3CNDA 4XWRA 4JDRA 4ZN0A 2EQ7A 1CBOA 3AD8B 4D03A 2WETA 4DSGA 1GALA 3OZ2A 3RP8A 1GXFA 2XFNA 4CCQA 3ICSA 2PHHA 3KKJA 3I3LA 1PBBA 2WPCA 4GDPA 3V3OA 4EQWA 3LB8A 4U8JA 1JRXA 2XVEA 4P9SA 5BVAA 4YKFA 3NH3X 2FJDA 4Z2RA 4HA6A 4H4YA 4D04A 2YG6A 3DK9A 2BS2A 2OAMA 3D8XA 3URHA 2V3AA 1E1LA 4H7UA 3NK0X 1H84A 2C7GA 4H4WA 2DKIA 3M13A 3K7QX 3KD9A 3UCLA 5HHFA 4AOSA 3FPZA 4G6HA 3UKAA 3P4SA 1GRTA 3AWIA 4G9KA 4OPCA 3UKHA 4H4RA 1H83A 4AP1A 3NRNA 1NHRA 1Y56A 1CJ2A 2YG5A 3SFDA 3OC4A 2XYOA 4U8LA 2IVEA 4ICYA 3SQPA 1CF3A 2WOIA 3R9UA 5GSNA 2Y6QA 3E1TA 1Q1RA 1LV0A 4E0VA 5KMPA 3C4NA 3UOZA 2YG3A 2IIDA 5JCIA 4NTCA 2YR6A 3AYLA 3P4PA 5KOWA 4H4XA 1N1PA 1LVLA 3QVPA 3C4AA 5ER0A 5M0ZA 4U2TA 2WS3A 3LJPA 4OPIA 1GRAA 1H86A 2B7RA 2GEWA 5FS7A 2XLTA 3DMEA 4G73A 1VG0A 1NHQA 1TYTA 2Q6UA 2NPXA 4FDCB 5J60A 4ADWA 2QCUA 1H7WA 3FIMB 3NKSA 2F5ZA 3KPFA 3NN0X 3V3NA 3ATRA 2WP5A 3HYVA 4Z26A 3F8PA 1D7YA 4NEVA 3CGCA 3JSKA 3GYXA 4YKGA 2WOVA 2GR2A 4C74A 5HXIA 1NHSA 1PDHA 3CGBA 3UTHA 4YTPA 4U8PA 5EOWA 2YLSA 4Z25A 4EMIA 3UTFA 2X50A 2Y6RA 1RYIA 2Q7VA 4B67A 1YQ4A 3EF6A 1PHHA 2B76A 3CGDA 1FCDA 1PXBA 2JB1A 2Q0KA 2RGHA 2XVFA 4IVOB 3ISHA 4CNKA 2GAHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EM4 A;  1M64 A;  4H4Z A;  2BAB A;  1L9C A;  3IC9 A;  3RP6 A;  1ZOY A;  2C66 A;  1P2E A;  4BUR A;  2C65 A;  1VDC A;  4GRT A;  2C76 A;  3GDP A;  1BZL A;  1O95 A;  1RP0 A;  4A99 A;  3P1W A;  4YT0 A;  1KSS A;  2GV8 A;  2YLT A;  1PXA A;  3K30 A;  2JKC A;  4DNA A;  3BHF A;  3RED A;  2AAQ A;  4Z24 A;  1W4X A;  1XPQ A;  3DK8 A;  4EQX A;  1XHC A;  2EQ8 A;  3NN6 X;  5HY5 A;  3IHG A;  2BK5 A;  3NYC A;  5CKU A;  2ZZ0 A;  3QFB A;  2XLP A;  4USQ A;  4JNA A;  4RG3 A;  2FJA A;  4K5R A;  3AE2 A;  5FS6 A;  3T37 A;  1D5T A;  1PBC A;  2GQW A;  4JY3 A;  3CN8 A;  4H2Q A;  3GRT A;  4U8K A;  4H2N A;  1GSN A;  5BUL A;  3QSE A;  3AXB A;  2BCP A;  4X9N A;  2X3N A;  4Z43 A;  1TDK A;  3AE6 A;  1GOS A;  2X8G A;  4BV6 A;  4CY8 A;  4B64 A;  4NTD A;  4Z44 A;  3F8D A;  1K0I A;  4ZCC A;  1TYP A;  1DOC A;  3GDN A;  2JAE A;  4OVI A;  3ZDN A;  3ABV A;  3NLC A;  4WCT A;  4TM4 A;  1NEN A;  1B37 A;  3ATQ A;  4KPR A;  4ZCD A;  4A6N B;  3BI5 A;  3AE3 A;  5U1O A;  1F8W A;  3UOX A;  5IPY A;  4IA5 A;  4AOX A;  3AE8 A;  1KFY A;  1YQZ A;  4C3X A;  2VRM A;  1EL9 A;  4A5L A;  1KDG A;  1NG3 A;  3UP4 A;  1FL2 A;  2HQM A;  1E1N A;  3CPI G;  4HB9 A;  5M10 A;  3IF9 A;  1L9E A;  4EMW A;  4A65 A;  2DKH A;  2TMD A;  2WPE A;  2WDR A;  2YLR A;  1CL0 A;  3UP5 A;  4DSH A;  2AR8 A;  2EQ9 A;  1GRG A;  1ZOV A;  3AEA A;  5EBK A;  1S2Y A;  2RAB A;  1FOH A;  2O9Z A;  2X8H A;  4EIQ A;  2XFP A;  3K7T A;  4I59 A;  3UOV A;  2QA1 A;  4MJW A;  1FEC A;  2XFQ A;  4A6N A;  5JCN A;  3EAN A;  2WDQ A;  1DOB A;  4K22 A;  1N4U A;  1JU2 A;  2BXS A;  2XVH A;  4IA6 A;  1BF3 A;  2BS4 A;  1B5Q A;  1DJQ A;  3AEG A;  3QVR A;  4H4U A;  4J33 A;  2NVK X;  4EIP A;  1B8S A;  3NTA A;  3BHK A;  2R4J A;  2OLN A;  1K0L A;  1TDN A;  3DGH A;  1OJD A;  3DH9 A;  3NNE A;  3S61 A;  4CBQ A;  5JCL A;  2EQ6 A;  1ZK7 A;  3CPH G;  3NGC X;  4X4J A;  3V76 A;  1GT8 A;  3UTG A;  3LZW A;  1O5W A;  2QAE A;  1MXT A;  5IQ1 A;  4DGK A;  5C3J A;  1JRY A;  4YXD A;  4YTM A;  3H8I A;  2XCG A;  4OPG A;  4GR1 A;  4B1B A;  1N4V A;  3DJE A;  3UTE A;  2R0C A;  2E5V A;  3GD3 A;  4H4V A;  3BNM A;  4TM0 A;  2OA1 A;  1KNP A;  1CC2 A;  4H50 A;  4A9W A;  2QA2 A;  2WHD A;  1YQ3 A;  4ECH A;  1F3P A;  4UDP A;  1OJA A;  2VQB A;  3GWD A;  2JBV A;  1KSU A;  1ZY8 A;  1Q1W A;  3COX A;  3CTY A;  1Y0P A;  2WU2 A;  4K5S A;  5KVI A;  4B65 A;  5HYM A;  3VRD B;  1GRB A;  1CJ3 A;  1IUT A;  4PAA A;  3S5W A;  3QSM A;  4U8N A;  2V3B A;  3NK1 X;  4N9X A;  1D4C A;  1H7X A;  4B66 A;  3DJD A;  1NAA A;  1H6V A;  2C3D A;  2A89 A;  4TLX A;  1HYU A;  5IQ4 A;  4WX1 A;  3PS9 A;  2WBA A;  2X99 A;  1GRF A;  2GR0 A;  3AE5 A;  4B69 A;  3CGE A;  3ADA B;  2YQU A;  1LTX R;  3AD7 B;  4UDQ A;  3IWA A;  2ZBW A;  3NYF A;  2YWL A;  4YSZ A;  3HZL A;  4O5Q A;  1M6I A;  4FX9 A;  1ONF A;  1RSG A;  2C73 A;  2GMJ A;  2R9Z A;  3P4Q A;  3I6D A;  4BK3 A;  3GSI A;  4BJZ A;  2YVJ A;  4YSY A;  2GMH A;  1E7P A;  1PBF A;  3GWF A;  3NTD A;  4U2L A;  4XXG A;  4YSH A;  5JCK A;  5KVH A;  4C77 A;  1JNR A;  3AE4 A;  2BK3 A;  2ZZC A;  3QSS A;  1DOE A;  3CIR A;  1EL8 A;  2CVJ A;  3DJG X;  4O5U A;  3PVC A;  2AQJ A;  2YVF A;  2BC0 A;  4C3Y A;  2Z5X A;  2BA9 A;  4H4Q A;  3WE0 A;  3LZX A;  4J2W A;  2GVC A;  3Q6J A;  3RHA A;  2B9X A;  1AOG A;  1BWC A;  1IUU A;  2V6O A;  2VQ7 A;  4GUV A;  3P4R A;  2OLO A;  4JY2 A;  1VQW A;  2Q0L A;  3UKK A;  1IUV A;  3AED A;  3L8K A;  5U25 A;  1GTE A;  2R0G A;  4H4P A;  2B9Y A;  1DJN A;  1DXL A;  3PO7 A;  1QO8 A;  2YLX A;  2YAU A;  2GF3 A;  2FBW A;  3NIX A;  4YTN A;  2YR4 A;  1PJ6 A;  3FBS A;  1XDI A;  3LOV A;  3NK2 X;  5EB4 A;  3ALM A;  1JNZ A;  1PBE A;  4OCG A;  4Z2U A;  2V5Z A;  2E4G A;  4A79 A;  1PJ7 A;  2B9W A;  2C75 A;  3G5R A;  3GYJ A;  3NYE A;  2XLR A;  4UDR A;  2C3C A;  1TRB A;  3VQR A;  1S3E A;  2YG4 A;  3K7M X;  4B63 A;  3C96 A;  4NZH A;  1DNC A;  5TR3 A;  2UZZ A;  2BXR A;  1GER A;  3BI4 A;  1IUS A;  5C2T A;  2GR1 A;  1SEZ A;  3D1C A;  2BAC A;  4JQ9 A;  4M52 A;  1BGJ A;  2YM2 A;  3RNM A;  3NG7 X;  5J7X A;  1PS9 A;  2GRT A;  2V61 A;  3DA1 A;  4REK A;  3LAD A;  3QFA A;  4TM1 A;  1N4W A;  3GRS A;  4K2X A;  2BC1 A;  1CC4 A;  2H89 A;  4J36 A;  1B4V A;  1GET A;  1K0J A;  3GYI A;  2Z5Y A;  4LII A;  4RSL A;  3GMB A;  1QLB A;  1ZX9 A;  4Z2T A;  1PJ5 A;  3UKL A;  5CQF A;  1CC6 A;  1VRQ B;  2CUL A;  2WP6 A;  3UKF A;  1F8S A;  4GDE A;  5EB5 A;  4AP3 A;  1L9D A;  1GES A;  3CNS A;  2BCG G;  3SFE A;  3B6D A;  2GB0 A;  1LJ1 A;  3CNT A;  1K4Q A;  4IVM B;  4H4S A;  5JCM A;  1GRE A;  4OPD A;  1L0V A;  1PBD A;  2YLZ A;  2C67 A;  2XLS A;  2VRL A;  1S2Q A;  4XWZ A;  2BS3 A;  4RG4 A;  2C72 A;  3EAO A;  1Z6L A;  2ACZ A;  2XDO A;  2XFO A;  4U8O A;  3AE9 A;  5L46 A;  1NHP A;  3IHM A;  4APN A;  1EL5 A;  5BRT A;  1QJD A;  3DK4 A;  3VRA A;  1ZKQ A;  1ZP0 A;  4CY6 A;  3AEE A;  1REO A;  3FG2 P;  4YSX A;  3G5S A;  3KLJ A;  5KOX A;  2VOU A;  2XVI A;  4U8M A;  3ICT A;  5KXJ A;  2A8X A;  1TDF A;  2C70 A;  3CNJ A;  2XFU A;  4K8D A;  1GND A;  1NDA A;  5GRT A;  2V60 A;  1P2H A;  2YM1 A;  3AB1 A;  1D7L A;  1V59 A;  3GMC A;  1IUX A;  3M12 A;  4CCR A;  1NEK A;  3SM8 A;  4LA1 A;  1GV4 A;  1YKJ A;  1GTH A;  1H82 A;  1JEH A;  2VVL A;  4PAB A;  4CRT A;  3G5Q A;  2TPR A;  4EQR A;  1EBD A;  2YR5 A;  1COY A;  4H2P A;  1E6E A;  1YY5 A;  1O94 A;  2VVM A;  2W0H A;  2ARD A;  3FMW A;  2WU5 A;  4TM3 A;  4YWO A;  3UOY A;  4EMJ A;  3CNP A;  3M0O A;  1DOD A;  4FK1 C;  4X9M A;  1LPF A;  1IUW A;  3F8R A;  1ELI A;  1VG9 A;  2OAL A;  4KX6 A;  3ZYX A;  2R45 A;  4J31 A;  4OPT A;  2JK6 A;  5LV9 A;  2VZ2 A;  3AYJ A;  4B68 A;  2A87 A;  2X8C A;  4H4T A;  5KRQ A;  4J56 A;  2E1M A;  3P9U A;  3ALL A;  1D4D A;  1NPX A;  1GRH A;  4U8I A;  4J57 A;  3VR9 A;  3AEC A;  1LQT A;  1MO9 A;  3AD9 B;  1CJC A;  1CHU A;  1UKV G;  4A7A A;  2CDU A;  4TLZ A;  3AEF A;  2FJE A;  2H88 A;  1ZMD A;  2YLW A;  1PN0 A;  3ITJ A;  3UKP A;  1Q9I A;  2GR3 A;  3SGL A;  3NHO X;  2VVL G;  2R4E A;  3EPT A;  4EQS A;  2WEU A;  1E1M A;  5FS8 A;  3AE1 A;  5U63 A;  4C5O A;  1TDO A;  4BK1 A;  2R46 A;  3DGZ A;  1KF6 A;  4BK2 A;  2ZZB A;  5FS9 A;  1TDE A;  3RP7 A;  4AT2 A;  4LU6 A;  1FEB A;  3B3R A;  3BNU A;  1OJC A;  1OJ9 A;  4EM3 A;  4USR A;  2CFY A;  3KVE A;  1IJH A;  4J34 A;  4OPL A;  1D4E A;  2C64 A;  1CJ4 A;  3AE7 A;  4Y4M A;  4NEW A;  3H4K A;  4UP3 A;  2XLU A;  2YVG A;  4IV9 A;  2BK4 A;  1ZMC A;  3L1R A;  1F6M A;  2I0Z A;  1FEA A;  3VR8 A;  4GF7 A;  1S3B A;  2JB3 A;  4CNJ A;  1OJT A;  2WQY A;  3QJ4 A;  4BJY A;  3II4 A;  2WP9 A;  4H2R A;  2IVD A;  1ZDL A;  2GAG B;  4K7Z A;  1MOK A;  3CPJ G;  5BUK A;  1F8R A;  1LQU A;  4JNQ A;  2RGO A;  1H81 A;  3H8L A;  2WOW A;  4OPU A;  4U2S A;  1GEU A;  1X31 B;  2J3N A;  4Y4L A;  3AYI A;  4Y4N A;  2YG7 A;  2XVJ A;  2WES A;  2GQF A;  1BKW A;  3ALJ A;  4GCM A;  4NTE A;  1BGN A;  2B7S A;  1EL7 A;  3BI2 A;  3KU9 A;  3NT6 A;  1GPE A;  2RGJ A;  2APG A;  3O0H A;  1E1K A;  5DBJ A;  3DJJ A;  4JN9 A;  1JOA A;  1JRZ A;  1PXC A;  3GD4 A;  1E39 A;  3KA7 A;  2BYB A;  5KWF A;  2WPF A;  4FK1 A;  3LXD A;  3AEB A;  3ICR A;  1KNR A;  3Q9T A;  1XAN A;  2GH5 A;  3VRB A;  1NG4 A;  2JB2 A;  3UKQ A;  1Y56 B;  2FJB A;  2PYX A;  5FMH A;  4AT0 A;  2WDV A;  4I58 A;  2R0P A;  3CND A;  4XWR A;  4JDR A;  4ZN0 A;  2EQ7 A;  1CBO A;  3AD8 B;  4D03 A;  2WET A;  4DSG A;  1GAL A;  3OZ2 A;  1GXF A;  2XFN A;  3RP8 A;  4CCQ A;  3ICS A;  2PHH A;  3KKJ A;  3I3L A;  1PBB A;  2WPC A;  4GDP A;  3V3O A;  4EQW A;  3LB8 A;  4U8J A;  1JRX A;  2XVE A;  4P9S A;  5BVA A;  4YKF A;  3NH3 X;  2FJD A;  4Z2R A;  4HA6 A;  4H4Y A;  4D04 A;  2YG6 A;  3DK9 A;  2BS2 A;  2OAM A;  3D8X A;  3URH A;  2V3A A;  1E1L A;  4H7U A;  3NK0 X;  1H84 A;  2C7G A;  4H4W A;  2DKI A;  3M13 A;  3K7Q X;  3KD9 A;  3UCL A;  5HHF A;  4AOS A;  3FPZ A;  3UKA A;  3P4S A;  1GRT A;  3AWI A;  4OPC A;  3UKH A;  4H4R A;  1H83 A;  4AP1 A;  3NRN A;  1NHR A;  1Y56 A;  1CJ2 A;  2YG5 A;  3SFD A;  3OC4 A;  2XYO A;  4U8L A;  2IVE A;  4ICY A;  3SQP A;  1CF3 A;  2WOI A;  3R9U A;  5GSN A;  2Y6Q A;  3E1T A;  1Q1R A;  1LV0 A;  4E0V A;  3C4N A;  3UOZ A;  2YG3 A;  2IID A;  5JCI A;  4NTC A;  2YR6 A;  3AYL A;  3P4P A;  5KOW A;  4H4X A;  1N1P A;  1LVL A;  3QVP A;  3C4A A;  5ER0 A;  5M0Z A;  4U2T A;  2WS3 A;  3LJP A;  4OPI A;  1GRA A;  1H86 A;  2B7R A;  2GEW A;  5FS7 A;  2XLT A;  3DME A;  1VG0 A;  1NHQ A;  1TYT A;  2Q6U A;  2NPX A;  4FDC B;  5J60 A;  4ADW A;  2QCU A;  1H7W A;  3FIM B;  3NKS A;  2F5Z A;  3KPF A;  3NN0 X;  3V3N A;  3ATR A;  2WP5 A;  4Z26 A;  3F8P A;  1D7Y A;  4NEV A;  3CGC A;  3JSK A;  4YKG A;  2WOV A;  2GR2 A;  4C74 A;  5HXI A;  1NHS A;  1PDH A;  3CGB A;  3UTH A;  4YTP A;  4U8P A;  5EOW A;  2YLS A;  4Z25 A;  4EMI A;  3UTF A;  2X50 A;  2Y6R A;  1RYI A;  2Q7V A;  4B67 A;  1YQ4 A;  3EF6 A;  1PHH A;  2B76 A;  3CGD A;  1FCD A;  1PXB A;  2JB1 A;  2Q0K A;  2RGH A;  2XVF A;  4IVO B;  3ISH A;  4CNK A;  2GAH B; 
#chains in the Genus database with same CATH topology
 4YJG A;  1M64 A;  4EM4 A;  4YJH A;  4H4Z A;  2BAB A;  1L9C A;  3IC9 A;  1ZOY A;  3W4J A;  2C66 A;  1P2E A;  4BUR A;  2C65 A;  1VDC A;  4GRT A;  2C76 A;  3GDP A;  1BZL A;  1O95 A;  3W4K A;  1RP0 A;  4A99 A;  1C0K A;  3P1W A;  4YT0 A;  1KSS A;  2GV8 A;  2YLT A;  1PXA A;  3K30 A;  4G6G A;  3T2Z A;  2JKC A;  4DNA A;  3BHF A;  3RED A;  2AAQ A;  4Z24 A;  3SXI A;  1W4X A;  1XPQ A;  3DK8 A;  4EQX A;  1XHC A;  2EQ8 A;  3NN6 X;  5HY5 A;  3IHG A;  2BK5 A;  3NYC A;  5CKU A;  2ZZ0 A;  3QFB A;  2XLP A;  4USQ A;  4JNA A;  4RG3 A;  2FJA A;  4K5R A;  3AE2 A;  5FS6 A;  3T37 A;  1PBC A;  1D5T A;  2GQW A;  4JY3 A;  3CN8 A;  4H2Q A;  3GRT A;  4U8K A;  4H2N A;  1GSN A;  5BUL A;  3QSE A;  3AXB A;  2BCP A;  4X9N A;  2X3N A;  4Z43 A;  1TDK A;  3AE6 A;  1GOS A;  2X8G A;  4BV6 A;  4CY8 A;  4B64 A;  4NTD A;  3ZNQ A;  3F8D A;  1K0I A;  4ZCC A;  4Z44 A;  1TYP A;  1DOC A;  3GDN A;  2JAE A;  4OVI A;  3ZDN A;  3ABV A;  4WCT A;  3NLC A;  4TM4 A;  1DDO A;  1NEN A;  1B37 A;  3ATQ A;  4KPR A;  4ZCD A;  4A6N B;  3BI5 A;  3AE3 A;  5U1O A;  1F8W A;  3UOX A;  5IPY A;  4IA5 A;  4AOX A;  3AE8 A;  1KFY A;  1YQZ A;  3KPK A;  4C3X A;  2VRM A;  1EL9 A;  4A5L A;  1KDG A;  1NG3 A;  3UP4 A;  1FL2 A;  2HQM A;  1E1N A;  3CPI G;  4HB9 A;  5M10 A;  3IF9 A;  1L9E A;  4EMW A;  1AN9 A;  4A65 A;  2DKH A;  2TMD A;  2WPE A;  2WDR A;  2YLR A;  1CL0 A;  3UP5 A;  4DSH A;  2AR8 A;  2EQ9 A;  1ZOV A;  1GRG A;  3AEA A;  5EBK A;  1S2Y A;  2RAB A;  1FOH A;  2O9Z A;  2X8H A;  4EIQ A;  2XFP A;  3K7T A;  4I59 A;  3UOV A;  2QA1 A;  4MJW A;  1FEC A;  2XFQ A;  4A6N A;  5JCN A;  3EAN A;  2WDQ A;  1DOB A;  4K22 A;  1N4U A;  1JU2 A;  2BXS A;  2C4C A;  2XVH A;  4IA6 A;  1BF3 A;  2BS4 A;  1B5Q A;  1DJQ A;  3AEG A;  3QVR A;  4H4U A;  4J33 A;  2NVK X;  4EIP A;  1B8S A;  3NTA A;  3BHK A;  2R4J A;  2OLN A;  1K0L A;  1TDN A;  3DGH A;  1OJD A;  3DH9 A;  3NNE A;  3S61 A;  4II2 A;  4CBQ A;  5JCL A;  2EQ6 A;  1ZK7 A;  3CPH G;  3NGC X;  4X4J A;  3V76 A;  1GT8 A;  3UTG A;  3LZW A;  1O5W A;  2QAE A;  1MXT A;  5IQ1 A;  4DGK A;  5C3J A;  1JRY A;  4YXD A;  4YTM A;  3H8I A;  2XCG A;  4OPG A;  4GR1 A;  4B1B A;  3DJE A;  1N4V A;  3UTE A;  2R0C A;  2E5V A;  3GD3 A;  4H4V A;  3BNM A;  3CMM A;  4TM0 A;  2OA1 A;  1KNP A;  1CC2 A;  4H50 A;  4A9W A;  2QA2 A;  2WHD A;  1YQ3 A;  4ECH A;  1F3P A;  4UDP A;  1OJA A;  2VQB A;  3GWD A;  2JBV A;  1KSU A;  3SYI A;  1ZY8 A;  1Q1W A;  3COX A;  3CTY A;  1Y0P A;  2WU2 A;  4K5S A;  5KVI A;  4B65 A;  5HYM A;  3VRD B;  1GRB A;  1CJ3 A;  1IUT A;  4PAA A;  3S5W A;  3QSM A;  4U8N A;  2V3B A;  3NK1 X;  4N9X A;  1D4C A;  1H7X A;  4B66 A;  3DJD A;  1NAA A;  1H6V A;  2C3D A;  2A89 A;  4TLX A;  1HYU A;  2BRY A;  5IQ4 A;  4WX1 A;  1C0P A;  3PS9 A;  2WBA A;  2X99 A;  1GRF A;  2GR0 A;  2E49 A;  3AE5 A;  4B69 A;  3CGE A;  3ADA B;  2YQU A;  3AD7 B;  1LTX R;  4UDQ A;  3IWA A;  2ZBW A;  3NYF A;  2YWL A;  4YSZ A;  3HZL A;  5KMR A;  4O5Q A;  1M6I A;  4FX9 A;  1ONF A;  1RSG A;  2C73 A;  2GMJ A;  2R9Z A;  3P4Q A;  4BK3 A;  3I6D A;  3GSI A;  2E48 A;  4BJZ A;  2YVJ A;  4YSY A;  2GMH A;  1PBF A;  4YSH A;  1E7P A;  3GWF A;  3NTD A;  4U2L A;  4XXG A;  2E82 A;  5JCK A;  5KVH A;  4C77 A;  1JNR A;  3AE4 A;  2BK3 A;  2ZZC A;  3QSS A;  1DOE A;  3CIR A;  1EL8 A;  2CVJ A;  3DJG X;  4O5U A;  3PVC A;  2AQJ A;  2YVF A;  2BC0 A;  4C3Y A;  2Z5X A;  2BA9 A;  4H4Q A;  3SZ0 A;  3T31 A;  3LZX A;  3WE0 A;  4J36 A;  4J2W A;  2GVC A;  3Q6J A;  3RHA A;  2B9X A;  1AOG A;  1BWC A;  1IUU A;  2V6O A;  2VQ7 A;  4GUV A;  3P4R A;  2OLO A;  4JY2 A;  1VQW A;  2Q0L A;  3UKK A;  1IUV A;  3AED A;  3L8K A;  5U25 A;  1GTE A;  2R0G A;  4H4P A;  2B9Y A;  1DJN A;  1DXL A;  3PO7 A;  1QO8 A;  2YLX A;  2YAU A;  2GF3 A;  2FBW A;  3NIX A;  4YTN A;  2YR4 A;  1PJ6 A;  3FBS A;  1XDI A;  3LOV A;  3NK2 X;  5EB4 A;  3ALM A;  1JNZ A;  1PBE A;  4OCG A;  4Z2U A;  2V5Z A;  2E4G A;  4A79 A;  1PJ7 A;  2B9W A;  2C75 A;  3G5R A;  3GYJ A;  3NYE A;  2XLR A;  4UDR A;  2C3C A;  1TRB A;  3VQR A;  1S3E A;  2YG4 A;  3K7M X;  4B63 A;  3C96 A;  4NZH A;  1DNC A;  5TR3 A;  2UZZ A;  2BXR A;  1GER A;  3BI4 A;  1IUS A;  5C2T A;  2GR1 A;  1C0I A;  1SEZ A;  3D1C A;  2BAC A;  4JQ9 A;  4M52 A;  4YJF B;  1BGJ A;  2YM2 A;  4GAP A;  3RNM A;  3NG7 X;  5J7X A;  1PS9 A;  2GRT A;  3DA1 A;  2V61 A;  4REK A;  3LAD A;  3QFA A;  4TM1 A;  1N4W A;  3GRS A;  4K2X A;  1CC4 A;  3RP6 A;  3ZNP A;  4RSL A;  1B4V A;  1K0J A;  1GET A;  2BC1 A;  2H89 A;  2Z5Y A;  3GYI A;  3GMB A;  4LII A;  1QLB A;  1ZX9 A;  4Z2T A;  1PJ5 A;  3UKL A;  5CQF A;  1CC6 A;  1VRQ B;  2CUL A;  2WP6 A;  3UKF A;  1F8S A;  4GDE A;  5EB5 A;  4AP3 A;  1L9D A;  1GES A;  3CNS A;  2BCG G;  3SFE A;  3B6D A;  2GB0 A;  1LJ1 A;  3CNT A;  1K4Q A;  4IVM B;  4H4S A;  5JCM A;  1GRE A;  4OPD A;  1L0V A;  1PBD A;  2YLZ A;  4II3 A;  2C67 A;  2XLS A;  4XWZ A;  1S2Q A;  2VRL A;  2BS3 A;  4GAV A;  4RG4 A;  2C72 A;  3EAO A;  1Z6L A;  2ACZ A;  2XDO A;  2XFO A;  4U8O A;  5L46 A;  3AE9 A;  3IHM A;  4YJF A;  1NHP A;  1EL5 A;  2DU8 A;  3T2K A;  4APN A;  1QJD A;  5BRT A;  3DK4 A;  3VRA A;  1ZKQ A;  1ZP0 A;  4CY6 A;  3AEE A;  1REO A;  3FG2 P;  4YSX A;  3G5S A;  3KLJ A;  5KOX A;  2VOU A;  2XVI A;  4U8M A;  3ICT A;  5KXJ A;  2A8X A;  1TDF A;  2C70 A;  3CNJ A;  2XFU A;  4K8D A;  1GND A;  1NDA A;  5GRT A;  4QFC A;  2V60 A;  3M12 A;  1P2H A;  2YM1 A;  1D7L A;  1V59 A;  3GMC A;  1IUX A;  3AB1 A;  4CCR A;  1NEK A;  3SM8 A;  4LA1 A;  1GV4 A;  1YKJ A;  1GTH A;  4PAB A;  1JEH A;  3CUK A;  1H82 A;  2BRA A;  2VVL A;  3G5Q A;  2TPR A;  3SX6 A;  3T14 A;  4CRT A;  5KNL A;  4EQR A;  1EBD A;  4G74 A;  2YR5 A;  1COY A;  4H2P A;  3T0K A;  1E6E A;  1YY5 A;  1O94 A;  2VVM A;  2W0H A;  2ARD A;  3FMW A;  4QFD A;  2WU5 A;  4TM3 A;  4YWO A;  3UOY A;  4EMJ A;  3M0O A;  3CNP A;  1DOD A;  4FK1 C;  4X9M A;  1LPF A;  1IUW A;  3F8R A;  1ELI A;  1VG9 A;  2OAL A;  4KX6 A;  3ZYX A;  3SZW A;  2R45 A;  4J31 A;  4OPT A;  2JK6 A;  3WGT A;  5LV9 A;  2VZ2 A;  3AYJ A;  4B68 A;  2A87 A;  5KMS A;  3HYX A;  2X8C A;  4H4T A;  5KRQ A;  4J56 A;  2E1M A;  3P9U A;  3ALL A;  1D4D A;  1NPX A;  1GRH A;  4U8I A;  4J57 A;  3VR9 A;  3AEC A;  1LQT A;  1MO9 A;  3AD9 B;  1CJC A;  1CHU A;  1UKV G;  4A7A A;  2CDU A;  4TLZ A;  3AEF A;  2FJE A;  2H88 A;  1ZMD A;  2YLW A;  1PN0 A;  3ITJ A;  3UKP A;  3ZNN A;  1Q9I A;  2GR3 A;  3SGL A;  3NHO X;  1VE9 A;  2VVL G;  2R4E A;  3EPT A;  4EQS A;  2WEU A;  1E1M A;  5FS8 A;  4NNJ A;  3AE1 A;  5U63 A;  4C5O A;  3G3E A;  2E4A A;  1TDO A;  4BK1 A;  2R46 A;  3DGZ A;  1KF6 A;  4BK2 A;  2ZZB A;  5FS9 A;  1TDE A;  3RP7 A;  4AT2 A;  4LU6 A;  1FEB A;  3B3R A;  3BNU A;  1EVI A;  1OJC A;  1OJ9 A;  3T2Y A;  4USR A;  2CFY A;  4EM3 A;  3HYW A;  1IJH A;  3KVE A;  4J34 A;  4OPL A;  1D4E A;  2C64 A;  1CJ4 A;  3AE7 A;  4Y4M A;  4NEW A;  3H4K A;  4UP3 A;  2XLU A;  2YVG A;  4IV9 A;  1DAO A;  2BK4 A;  1ZMC A;  3W4I A;  3L1R A;  1F6M A;  2I0Z A;  3SY4 A;  1FEA A;  3VR8 A;  4GF7 A;  1S3B A;  2JB3 A;  4CNJ A;  1OJT A;  2WQY A;  3QJ4 A;  4BJY A;  3II4 A;  3SZC A;  2WP9 A;  4H2R A;  2IVD A;  2GAG B;  1ZDL A;  4K7Z A;  1MOK A;  3CPJ G;  5BUK A;  1F8R A;  1LQU A;  4JNQ A;  3SZF A;  2RGO A;  1H81 A;  3H8L A;  2WOW A;  4OPU A;  4U2S A;  1GEU A;  1X31 B;  2J3N A;  4Y4L A;  3AYI A;  4Y4N A;  2YG7 A;  2XVJ A;  2WES A;  2GQF A;  4NWZ A;  1BKW A;  3ALJ A;  4GCM A;  1KIF A;  4NTE A;  1BGN A;  2B7S A;  1EL7 A;  3BI2 A;  3KU9 A;  3NT6 A;  2RGJ A;  1GPE A;  2APG A;  3O0H A;  5KMQ A;  1E1K A;  5DBJ A;  3DJJ A;  4JN9 A;  1JOA A;  1PXC A;  1JRZ A;  3GD4 A;  1E39 A;  3KA7 A;  2BYB A;  5KWF A;  2WPF A;  4FK1 A;  3LXD A;  3AEB A;  3ICR A;  1KNR A;  3Q9T A;  1XAN A;  4YJD A;  2GH5 A;  3VRB A;  1NG4 A;  2JB2 A;  3UKQ A;  1Y56 B;  2FJB A;  2PYX A;  5FMH A;  4AT0 A;  2WDV A;  4I58 A;  2R0P A;  3CND A;  4XWR A;  4JDR A;  4ZN0 A;  3AD8 B;  1CBO A;  2EQ7 A;  4D03 A;  2WET A;  4DSG A;  1GAL A;  3OZ2 A;  3RP8 A;  1GXF A;  2XFN A;  4CCQ A;  3ICS A;  2PHH A;  3KKJ A;  3I3L A;  1PBB A;  2WPC A;  4GDP A;  3V3O A;  4EQW A;  3LB8 A;  3ZNO A;  4U8J A;  1JRX A;  4P9S A;  2XVE A;  5BVA A;  4YKF A;  3NH3 X;  2FJD A;  4Z2R A;  4HA6 A;  4H4Y A;  4D04 A;  2YG6 A;  3DK9 A;  2BS2 A;  2OAM A;  3D8X A;  3URH A;  2V3A A;  1E1L A;  4H7U A;  3NK0 X;  1H84 A;  2C7G A;  4H4W A;  2DKI A;  3M13 A;  3K7Q X;  3KD9 A;  3UCL A;  5HHF A;  4AOS A;  3FPZ A;  4G6H A;  3UKA A;  3P4S A;  1GRT A;  3AWI A;  4G9K A;  4OPC A;  3UKH A;  4H4R A;  1H83 A;  4AP1 A;  3NRN A;  1NHR A;  1Y56 A;  1CJ2 A;  2YG5 A;  3SFD A;  3OC4 A;  2XYO A;  4U8L A;  2IVE A;  4ICY A;  3SQP A;  1CF3 A;  2WOI A;  3R9U A;  5GSN A;  2Y6Q A;  3E1T A;  1Q1R A;  1LV0 A;  4E0V A;  5KMP A;  3C4N A;  3UOZ A;  2YG3 A;  2IID A;  5JCI A;  4NTC A;  2YR6 A;  3AYL A;  3P4P A;  5KOW A;  4H4X A;  1N1P A;  1LVL A;  4YJG B;  3C4A A;  3QVP A;  5ER0 A;  4YJH B;  5M0Z A;  4U2T A;  2WS3 A;  3LJP A;  4OPI A;  1GRA A;  1H86 A;  2B7R A;  2GEW A;  5FS7 A;  2XLT A;  3DME A;  4G73 A;  1VG0 A;  1NHQ A;  2Q6U A;  1TYT A;  1C0L A;  2NPX A;  4FDC B;  5J60 A;  4ADW A;  2QCU A;  1H7W A;  3FIM B;  3NKS A;  2F5Z A;  3KPF A;  3NN0 X;  3V3N A;  3ATR A;  2WP5 A;  3HYV A;  4Z26 A;  3F8P A;  1D7Y A;  4NEV A;  3CGC A;  3JSK A;  3GYX A;  4YKG A;  2WOV A;  2GR2 A;  4C74 A;  5HXI A;  1PDH A;  1NHS A;  3CGB A;  3UTH A;  4YTP A;  4U8P A;  5EOW A;  2YLS A;  4Z25 A;  4EMI A;  3UTF A;  2X50 A;  2Y6R A;  1RYI A;  2Q7V A;  4B67 A;  1YQ4 A;  3EF6 A;  1PHH A;  2B76 A;  3CGD A;  2RGH A;  1PXB A;  1FCD A;  2JB1 A;  2Q0K A;  2XVF A;  4IVO B;  3ISH A;  4CNK A;  2GAH B; 
#chains in the Genus database with same CATH homology
 4EM4 A;  1M64 A;  4H4Z A;  2BAB A;  1L9C A;  3IC9 A;  1ZOY A;  2C66 A;  1P2E A;  4BUR A;  2C65 A;  1VDC A;  4GRT A;  2C76 A;  3GDP A;  1BZL A;  1O95 A;  1RP0 A;  4A99 A;  3P1W A;  4YT0 A;  1KSS A;  2GV8 A;  2YLT A;  1PXA A;  3K30 A;  4G6G A;  3T2Z A;  2JKC A;  4DNA A;  3BHF A;  3RED A;  2AAQ A;  4Z24 A;  3SXI A;  1W4X A;  1XPQ A;  3DK8 A;  4EQX A;  1XHC A;  2EQ8 A;  3NN6 X;  5HY5 A;  3IHG A;  2BK5 A;  3NYC A;  5CKU A;  2ZZ0 A;  3QFB A;  2XLP A;  4USQ A;  4JNA A;  4RG3 A;  2FJA A;  4K5R A;  3AE2 A;  5FS6 A;  3T37 A;  1D5T A;  1PBC A;  2GQW A;  4JY3 A;  3CN8 A;  4H2Q A;  3GRT A;  4U8K A;  4H2N A;  1GSN A;  5BUL A;  3QSE A;  3AXB A;  2BCP A;  4X9N A;  2X3N A;  4Z43 A;  1TDK A;  3AE6 A;  1GOS A;  2X8G A;  4BV6 A;  4CY8 A;  4B64 A;  4NTD A;  4Z44 A;  3F8D A;  1K0I A;  4ZCC A;  1TYP A;  1DOC A;  3GDN A;  2JAE A;  4OVI A;  3ZDN A;  3ABV A;  3NLC A;  4WCT A;  4TM4 A;  1NEN A;  1B37 A;  3ATQ A;  4KPR A;  4ZCD A;  4A6N B;  3BI5 A;  3AE3 A;  5U1O A;  1F8W A;  3UOX A;  5IPY A;  4IA5 A;  4AOX A;  3AE8 A;  1KFY A;  1YQZ A;  3KPK A;  4C3X A;  2VRM A;  1EL9 A;  4A5L A;  1KDG A;  1NG3 A;  3UP4 A;  1FL2 A;  2HQM A;  1E1N A;  3CPI G;  4HB9 A;  5M10 A;  3IF9 A;  1L9E A;  4EMW A;  4A65 A;  2DKH A;  2TMD A;  2WPE A;  2WDR A;  2YLR A;  1CL0 A;  3UP5 A;  4DSH A;  2AR8 A;  2EQ9 A;  1GRG A;  1ZOV A;  3AEA A;  5EBK A;  1S2Y A;  2RAB A;  1FOH A;  2O9Z A;  2X8H A;  4EIQ A;  2XFP A;  3K7T A;  4I59 A;  3UOV A;  2QA1 A;  4MJW A;  1FEC A;  2XFQ A;  4A6N A;  5JCN A;  3EAN A;  2WDQ A;  1DOB A;  4K22 A;  1N4U A;  1JU2 A;  2BXS A;  2C4C A;  2XVH A;  4IA6 A;  1BF3 A;  2BS4 A;  1B5Q A;  1DJQ A;  3AEG A;  3QVR A;  4H4U A;  4J33 A;  2NVK X;  4EIP A;  1B8S A;  3NTA A;  3BHK A;  2R4J A;  2OLN A;  1K0L A;  1TDN A;  3DGH A;  1OJD A;  3DH9 A;  3NNE A;  3S61 A;  4II2 A;  4CBQ A;  5JCL A;  2EQ6 A;  1ZK7 A;  3CPH G;  3NGC X;  4X4J A;  3V76 A;  1GT8 A;  3UTG A;  3LZW A;  1O5W A;  2QAE A;  1MXT A;  5IQ1 A;  4DGK A;  5C3J A;  1JRY A;  4YXD A;  4YTM A;  3H8I A;  2XCG A;  4OPG A;  4GR1 A;  4B1B A;  1N4V A;  3DJE A;  3UTE A;  2R0C A;  2E5V A;  3GD3 A;  4H4V A;  3BNM A;  3CMM A;  4TM0 A;  2OA1 A;  1KNP A;  1CC2 A;  4H50 A;  4A9W A;  2QA2 A;  2WHD A;  1YQ3 A;  4ECH A;  1F3P A;  4UDP A;  1OJA A;  2VQB A;  3GWD A;  2JBV A;  1KSU A;  3SYI A;  1ZY8 A;  1Q1W A;  3COX A;  3CTY A;  1Y0P A;  2WU2 A;  4K5S A;  5KVI A;  4B65 A;  5HYM A;  3VRD B;  1GRB A;  1CJ3 A;  1IUT A;  4PAA A;  3S5W A;  3QSM A;  4U8N A;  2V3B A;  3NK1 X;  4N9X A;  1D4C A;  1H7X A;  4B66 A;  3DJD A;  1NAA A;  1H6V A;  2C3D A;  2A89 A;  4TLX A;  1HYU A;  2BRY A;  5IQ4 A;  4WX1 A;  3PS9 A;  2WBA A;  2X99 A;  1GRF A;  2GR0 A;  3AE5 A;  4B69 A;  3CGE A;  3ADA B;  2YQU A;  1LTX R;  3AD7 B;  4UDQ A;  3IWA A;  2ZBW A;  3NYF A;  2YWL A;  4YSZ A;  3HZL A;  5KMR A;  4O5Q A;  1M6I A;  4FX9 A;  1ONF A;  1RSG A;  2C73 A;  2GMJ A;  2R9Z A;  3P4Q A;  4BK3 A;  3I6D A;  3GSI A;  4BJZ A;  2YVJ A;  4YSY A;  2GMH A;  1E7P A;  1PBF A;  3GWF A;  3NTD A;  4U2L A;  4XXG A;  4YSH A;  5JCK A;  5KVH A;  4C77 A;  1JNR A;  3AE4 A;  2BK3 A;  2ZZC A;  3QSS A;  1DOE A;  3CIR A;  1EL8 A;  2CVJ A;  3DJG X;  4O5U A;  3PVC A;  2AQJ A;  2YVF A;  2BC0 A;  4C3Y A;  2Z5X A;  2BA9 A;  4H4Q A;  3SZ0 A;  3T31 A;  3LZX A;  3WE0 A;  4J2W A;  2GVC A;  3Q6J A;  3RHA A;  2B9X A;  1AOG A;  1BWC A;  1IUU A;  2V6O A;  2VQ7 A;  4GUV A;  3P4R A;  2OLO A;  4JY2 A;  1VQW A;  2Q0L A;  3UKK A;  1IUV A;  3AED A;  3L8K A;  5U25 A;  1GTE A;  2R0G A;  4H4P A;  2B9Y A;  1DJN A;  1DXL A;  3PO7 A;  1QO8 A;  2YLX A;  2YAU A;  2GF3 A;  2FBW A;  3NIX A;  4YTN A;  2YR4 A;  1PJ6 A;  3FBS A;  1XDI A;  3LOV A;  3NK2 X;  5EB4 A;  3ALM A;  1JNZ A;  1PBE A;  4OCG A;  4Z2U A;  2V5Z A;  2E4G A;  4A79 A;  1PJ7 A;  2B9W A;  2C75 A;  3G5R A;  3GYJ A;  3NYE A;  2XLR A;  4UDR A;  2C3C A;  1TRB A;  3VQR A;  1S3E A;  2YG4 A;  3K7M X;  4B63 A;  3C96 A;  4NZH A;  1DNC A;  5TR3 A;  2UZZ A;  2BXR A;  1GER A;  3BI4 A;  1IUS A;  5C2T A;  2GR1 A;  1SEZ A;  3D1C A;  2BAC A;  4JQ9 A;  4M52 A;  1BGJ A;  2YM2 A;  4GAP A;  3RNM A;  3NG7 X;  5J7X A;  1PS9 A;  2GRT A;  2V61 A;  3DA1 A;  4REK A;  3LAD A;  3QFA A;  4TM1 A;  1N4W A;  3GRS A;  4K2X A;  2BC1 A;  3RP6 A;  1CC4 A;  2H89 A;  1B4V A;  1GET A;  1K0J A;  3GYI A;  2Z5Y A;  4J36 A;  4LII A;  3GMB A;  4RSL A;  1QLB A;  1ZX9 A;  4Z2T A;  1PJ5 A;  3UKL A;  5CQF A;  1CC6 A;  1VRQ B;  2CUL A;  2WP6 A;  3UKF A;  1F8S A;  4GDE A;  5EB5 A;  4AP3 A;  1L9D A;  1GES A;  3CNS A;  2BCG G;  3SFE A;  3B6D A;  2GB0 A;  1LJ1 A;  3CNT A;  1K4Q A;  4IVM B;  4H4S A;  5JCM A;  1GRE A;  4OPD A;  1L0V A;  1PBD A;  2YLZ A;  4II3 A;  2C67 A;  2XLS A;  2VRL A;  1S2Q A;  4XWZ A;  2BS3 A;  4GAV A;  4RG4 A;  2C72 A;  3EAO A;  1Z6L A;  2ACZ A;  2XDO A;  2XFO A;  4U8O A;  3AE9 A;  5L46 A;  3IHM A;  1NHP A;  3T2K A;  1EL5 A;  4APN A;  5BRT A;  1QJD A;  3DK4 A;  3VRA A;  1ZKQ A;  1ZP0 A;  4CY6 A;  3AEE A;  1REO A;  3FG2 P;  4YSX A;  3G5S A;  3KLJ A;  5KOX A;  2VOU A;  2XVI A;  4U8M A;  3ICT A;  5KXJ A;  2A8X A;  1TDF A;  2C70 A;  3CNJ A;  2XFU A;  4K8D A;  1GND A;  1NDA A;  5GRT A;  2V60 A;  1P2H A;  2YM1 A;  3AB1 A;  1D7L A;  1V59 A;  3GMC A;  1IUX A;  3M12 A;  4CCR A;  1NEK A;  3SM8 A;  4LA1 A;  1GV4 A;  1YKJ A;  1GTH A;  1H82 A;  1JEH A;  2BRA A;  2VVL A;  4PAB A;  3T14 A;  3G5Q A;  2TPR A;  3SX6 A;  4CRT A;  5KNL A;  4EQR A;  1EBD A;  4G74 A;  2YR5 A;  1COY A;  4H2P A;  3T0K A;  1E6E A;  1YY5 A;  1O94 A;  2VVM A;  2W0H A;  2ARD A;  3FMW A;  2WU5 A;  4TM3 A;  4YWO A;  3UOY A;  4EMJ A;  3CNP A;  3M0O A;  1DOD A;  4FK1 C;  4X9M A;  1LPF A;  1IUW A;  3F8R A;  1ELI A;  1VG9 A;  2OAL A;  4KX6 A;  3ZYX A;  3SZW A;  2R45 A;  4J31 A;  4OPT A;  2JK6 A;  5LV9 A;  2VZ2 A;  3AYJ A;  4B68 A;  2A87 A;  5KMS A;  3HYX A;  2X8C A;  4H4T A;  5KRQ A;  4J56 A;  2E1M A;  3P9U A;  3ALL A;  1D4D A;  1NPX A;  1GRH A;  4U8I A;  4J57 A;  3VR9 A;  3AEC A;  1LQT A;  1MO9 A;  3AD9 B;  1CJC A;  1CHU A;  1UKV G;  4A7A A;  2CDU A;  4TLZ A;  3AEF A;  2FJE A;  2H88 A;  1ZMD A;  2YLW A;  1PN0 A;  3ITJ A;  3UKP A;  1Q9I A;  2GR3 A;  3SGL A;  3NHO X;  2VVL G;  2R4E A;  3EPT A;  4EQS A;  2WEU A;  1E1M A;  5FS8 A;  4NNJ A;  3AE1 A;  5U63 A;  4C5O A;  1TDO A;  4BK1 A;  2R46 A;  3DGZ A;  1KF6 A;  4BK2 A;  2ZZB A;  5FS9 A;  1TDE A;  3RP7 A;  4AT2 A;  4LU6 A;  1FEB A;  3B3R A;  3BNU A;  1OJC A;  1OJ9 A;  3T2Y A;  4USR A;  2CFY A;  4EM3 A;  3HYW A;  1IJH A;  3KVE A;  4J34 A;  4OPL A;  1D4E A;  2C64 A;  1CJ4 A;  3AE7 A;  4Y4M A;  4NEW A;  3H4K A;  4UP3 A;  2XLU A;  2YVG A;  4IV9 A;  2BK4 A;  1ZMC A;  3L1R A;  1F6M A;  2I0Z A;  3SY4 A;  1FEA A;  3VR8 A;  4GF7 A;  1S3B A;  2JB3 A;  4CNJ A;  1OJT A;  2WQY A;  3QJ4 A;  4BJY A;  3II4 A;  3SZC A;  2WP9 A;  4H2R A;  2IVD A;  1ZDL A;  2GAG B;  4K7Z A;  1MOK A;  3CPJ G;  5BUK A;  1F8R A;  1LQU A;  4JNQ A;  3SZF A;  2RGO A;  1H81 A;  3H8L A;  2WOW A;  4OPU A;  4U2S A;  1GEU A;  1X31 B;  2J3N A;  4Y4L A;  3AYI A;  4Y4N A;  2YG7 A;  2XVJ A;  2WES A;  2GQF A;  4NWZ A;  1BKW A;  3ALJ A;  4GCM A;  4NTE A;  1BGN A;  2B7S A;  1EL7 A;  3BI2 A;  3KU9 A;  3NT6 A;  2RGJ A;  1GPE A;  2APG A;  3O0H A;  5KMQ A;  1E1K A;  5DBJ A;  3DJJ A;  4JN9 A;  1JOA A;  1JRZ A;  1PXC A;  3GD4 A;  1E39 A;  3KA7 A;  2BYB A;  5KWF A;  2WPF A;  4FK1 A;  3LXD A;  3AEB A;  3ICR A;  1KNR A;  3Q9T A;  1XAN A;  2GH5 A;  3VRB A;  1NG4 A;  2JB2 A;  3UKQ A;  1Y56 B;  2FJB A;  2PYX A;  5FMH A;  4AT0 A;  2WDV A;  4I58 A;  2R0P A;  3CND A;  4XWR A;  4JDR A;  4ZN0 A;  2EQ7 A;  1CBO A;  3AD8 B;  4D03 A;  2WET A;  4DSG A;  1GAL A;  3OZ2 A;  3RP8 A;  1GXF A;  2XFN A;  4CCQ A;  3ICS A;  2PHH A;  3KKJ A;  3I3L A;  1PBB A;  2WPC A;  4GDP A;  3V3O A;  4EQW A;  3LB8 A;  4U8J A;  1JRX A;  2XVE A;  4P9S A;  5BVA A;  4YKF A;  3NH3 X;  2FJD A;  4Z2R A;  4HA6 A;  4H4Y A;  4D04 A;  2YG6 A;  3DK9 A;  2BS2 A;  2OAM A;  3D8X A;  3URH A;  2V3A A;  1E1L A;  4H7U A;  3NK0 X;  1H84 A;  2C7G A;  4H4W A;  2DKI A;  3M13 A;  3K7Q X;  3KD9 A;  3UCL A;  5HHF A;  4AOS A;  3FPZ A;  4G6H A;  3UKA A;  3P4S A;  1GRT A;  3AWI A;  4G9K A;  4OPC A;  3UKH A;  4H4R A;  1H83 A;  4AP1 A;  3NRN A;  1NHR A;  1Y56 A;  1CJ2 A;  2YG5 A;  3SFD A;  3OC4 A;  2XYO A;  4U8L A;  2IVE A;  4ICY A;  3SQP A;  1CF3 A;  2WOI A;  3R9U A;  5GSN A;  2Y6Q A;  3E1T A;  1Q1R A;  1LV0 A;  4E0V A;  5KMP A;  3C4N A;  3UOZ A;  2YG3 A;  2IID A;  5JCI A;  4NTC A;  2YR6 A;  3AYL A;  3P4P A;  5KOW A;  4H4X A;  1N1P A;  1LVL A;  3QVP A;  3C4A A;  5ER0 A;  5M0Z A;  4U2T A;  2WS3 A;  3LJP A;  4OPI A;  1GRA A;  1H86 A;  2B7R A;  2GEW A;  5FS7 A;  2XLT A;  3DME A;  4G73 A;  1VG0 A;  1NHQ A;  1TYT A;  2Q6U A;  2NPX A;  4FDC B;  5J60 A;  4ADW A;  2QCU A;  1H7W A;  3FIM B;  3NKS A;  2F5Z A;  3KPF A;  3NN0 X;  3V3N A;  3ATR A;  2WP5 A;  3HYV A;  4Z26 A;  3F8P A;  1D7Y A;  4NEV A;  3CGC A;  3JSK A;  3GYX A;  4YKG A;  2WOV A;  2GR2 A;  4C74 A;  5HXI A;  1NHS A;  1PDH A;  3CGB A;  3UTH A;  4YTP A;  4U8P A;  5EOW A;  2YLS A;  4Z25 A;  4EMI A;  3UTF A;  2X50 A;  2Y6R A;  1RYI A;  2Q7V A;  4B67 A;  1YQ4 A;  3EF6 A;  1PHH A;  2B76 A;  3CGD A;  1FCD A;  1PXB A;  2JB1 A;  2Q0K A;  2RGH A;  2XVF A;  4IVO B;  3ISH A;  4CNK A;  2GAH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...