3NGCX

Complex of 6-hydroxy-l-nicotine oxidase with intermediate methylmyosmine product formed during catalytic turnover
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 146
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ngcX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3ngcX02
1E7PA 1KNRA 5EB5A 1BWCA 3AD7B 4UDQA 4J2WA 2NPXA 3I6DA 4Y4NA 3VRAA 2X8CA 2YR4A 1GXFA 3AXBA 3F8DA 4OPTA 4AOSA 2IVEA 2XLUA 1CHUA 1JOAA 1K0IA 3DA1A 3P4SA 1Y56A 4YTNA 2YVFA 3ZYXA 4UDRA 2C67A 1E39A 3AEBA 4DSHA 1GPEA 1BF3A 2QAEA 1DJNA 2YLSA 3SQPA 4OPDA 1H83A 2YLTA 1IUVA 2BS2A 2GH5A 1VDCA 4X9MA 1Q1WA 1PBFA 1GALA 1GEUA 1VG0A 3AE3A 3UCLA 3UTFA 1L9DA 4EM3A 1TYPA 2VRLA 4FK1C 2ZZBA 2IVDA 1DOEA 5M10A 2OAMA 1CBOA 1L9CA 4B1BA 2W0HA 3AEGA 3ICRA 4C3XA 5BRTA 4EMWA 5KOWA 1XANA 2XLPA 1MO9A 1E1MA 2BS3A 5EOWA 2GR0A 3VQRA 2FJAA 3GYJA 2YLXA 1IUUA 1O94A 3NTDA 2ZZCA 4K5RA 4H2QA 4B67A 3AE4A 3WE0A 1OJTA 2GAGB 2WETA 2NVKX 2YLZA 3NT6A 1RP0A 4OPGA 1NHQA 2EQ9A 2V61A 4YXDA 1PBEA 1Q1RA 1EBDA 3AEFA 2XFPA 1DJQA 4NTCA 2GR3A 3QSEA 1PDHA 5JCMA 2GB0A 2X8GA 2B9WA 4NTEA 2VVLG 4CCRA 4B69A 2GF3A 2X50A 3KU9A 2Z5YA 3H8IA 3AEDA 4JQ9A 1GV4A 5U1OA 3BI4A 1HYUA 2EQ8A 4EQRA 4HB9A 3PO7A 4OPUA 3GRSA 3NYEA 4GDPA 3P1WA 4TM1A 1E6EA 1JNZA 2BACA 3M12A 4H4ZA 3LZXA 4N9XA 1F3PA 1NG3A 2JB3A 1EL5A 4IA5A 4IV9A 3DJJA 2R9ZA 3AE9A 1CL0A 2AAQA 4TLZA 3RP7A 3CGCA 4B65A 3RP8A 4H50A 3V3OA 3ADAB 1D5TA 3BI2A 4AT2A 1OJDA 2XVHA 3UKAA 2GEWA 5DBJA 3CNJA 2CDUA 1M6IA 1JRZA 3UOYA 3K7QX 3B3RA 3AYLA 2C70A 1GRHA 2VQ7A 2XFOA 2B9YA 3AE5A 4PAAA 2H88A 2JB1A 3NRNA 1FECA 2YG6A 3DJEA 4P9SA 2GQFA 2XLTA 4GDEA 2WDVA 5J7XA 2WBAA 3K7TA 1JEHA 4U8MA 3AE6A 1NEKA 5EB4A 3P4QA 4YSXA 1VG9A 3NK1X 3UKKA 5TR3A 2BC0A 4ZN0A 1BGNA 4H4SA 3II4A 1N1PA 3UKFA 2XVIA 4NTDA 5C3JA 2C65A 3ATRA 4GR1A 4I59A 1K0JA 1XDIA 1GRTA 3NYFA 2CFYA 1H6VA 2R0PA 3RP6A 1COYA 1DOBA 2XFUA 4ZCCA 2C73A 3NLCA 2B76A 4BK1A 3AECA 4NEWA 4Z44A 2BXSA 4JY2A 4XXGA 3BNUA 1BGJA 1K0LA 1PBCA 5KVIA 4I58A 1K4QA 4C3YA 1GOSA 1ZMCA 1B8SA 1ZK7A 2XDOA 4B64A 3O0HA 4YSZA 1TDKA 2APGA 4YKGA 2HQMA 4OPCA 1BZLA 3ABVA 3DGZA 5IQ1A 3C96A 1GRAA 5HY5A 3VR8A 4J31A 1H86A 4OPLA 3CIRA 2UZZA 1OJ9A 1Z6LA 2JKCA 3D8XA 2JB2A 3ICSA 4GUVA 4IVOB 4U8JA 4H4TA 4ECHA 1XPQA 4J34A 1EL9A 2C7GA 4AOXA 4Z24A 3FBSA 1B5QA 3ICTA 1B4VA 1CC4A 1LQTA 2CULA 3AB1A 4YSHA 4B63A 2V5ZA 2V6OA 3FPZA 1B37A 1YQZA 2R4JA 3C4AA 3OZ2A 3SFEA 1CC2A 2YM2A 4YTPA 4FDCB 3SM8A 1LPFA 1D4DA 3P4RA 2BABA 3SFDA 3K7MX 2PYXA 4DSGA 2WHDA 3SGLA 4NEVA 1ELIA 2YVJA 2WDRA 4E0VA 1TDFA 2XLRA 2ZBWA 3EPTA 2Z5XA 1F8WA 3IHMA 4H4WA 3E1TA 1PBDA 1DXLA 3ZDNA 1N4VA 3I3LA 4JNAA 3CN8A 3IF9A 3GDNA 3M13A 3URHA 4A5LA 1VRQB 2WP5A 1GRGA 3ALMA 4H4VA 5FS8A 2BYBA 2YLWA 1D4EA 4IA6A 4EIPA 2GRTA 1GERA 2Y6QA 4K5SA 3CPJG 3GYIA 1REOA 3DJDA 1YQ3A 4WX1A 5JCIA 3T37A 1CC6A 5JCKA 2J3NA 2RGJA 4YTMA 2WESA 3CGDA 3FG2P 3D1CA 4H4PA 3HZLA 3CPHG 4H4QA 4U2SA 1TDEA 4H2PA 2BCPA 3COXA 4BV6A 2RGHA 2DKIA 2Q6UA 3BI5A 3G5QA 1Q9IA 2BK5A 2BCGG 3AD9B 2WEUA 1N4WA 1IUXA 4USRA 1X31B 4APNA 2AQJA 3DGHA 4EMJA 4H7UA 2WQYA 4U8OA 3V3NA 4TM0A 2E5VA 1CJ3A 3F8RA 1ZOVA 2BK4A 2YR5A 1GSNA 3PS9A 3FIMB 1ZX9A 4J56A 4A65A 3C4NA 2CVJA 4BK3A 4Z43A 3NNEA 2B7RA 2H89A 3RNMA 2B9XA 1E1KA 1RYIA 3NN0X 4LA1A 2RGOA 1V59A 2DKHA 5FMHA 4U2TA 1IUTA 2WPEA 2WOVA 3NTAA 4FX9A 5IPYA 4Z2UA 4X9NA 4Y4LA 3S61A 3IWAA 3UTHA 1XHCA 1S2YA 4A6NB 3KA7A 4Z26A 3AD8B 3UTGA 3GDPA 1NHPA 1SEZA 4ICYA 2E4GA 1LV0A 4Y4MA 4RSLA 1DOCA 1KDGA 3EF6A 2VVMA 3KVEA 3DK4A 1CJ2A 2VRMA 2XCGA 4U8PA 3AYIA 5KRQA 3ITJA 3JSKA 5FS7A 3H4KA 5KXJA 1F8RA 1PBBA 3G5RA 5HYMA 4H4XA 2YG4A 3L1RA 1GRBA 2WU2A 3V76A 3DK8A 2WPFA 4H4RA 2VOUA 1L0VA 2A87A 1EL8A 3LZWA 1S3BA 3F8PA 1LJ1A 1O95A 2I0ZA 3M0OA 4K8DA 1TDNA 4GF7A 4H2NA 2BXRA 1FOHA 4JNQA 1GTEA 5C2TA 5BULA 4YSYA 4CNJA 1NDAA 1KSSA 1GREA 4PABA 3LOVA 4OPIA 4BJYA 4U8IA 2Y6RA 2R0CA 1CF3A 2PHHA 5BVAA 2C64A 3AE8A 3H8LA 2GAHB 3B6DA 2BC1A 2V60A 4J57A 4RG3A 2YAUA 3BNMA 3CNPA 1VQWA 3G5SA 4X4JA 1MXTA 3QVRA 4H2RA 1NENA 4JDRA 4XWZA 5J60A 4H4UA 1D7LA 4EQXA 3CTYA 1PXAA 1FL2A 3IHGA 1PS9A 3GWFA 3PVCA 5KVHA 4Z25A 3VRDB 3NIXA 4CRTA 3GD3A 1D7YA 5FS6A 1FEBA 5FS9A 2YG3A 4MJWA 4YWOA 4RG4A 1IUWA 3RHAA 1LTXR 1L9EA 4A7AA 3NKSA 1H81A 2E1MA 2FJBA 2TPRA 1PJ5A 2GR2A 3UOZA 2XFQA 2YQUA 1KFYA 1QJDA 2OA1A 2WDQA 1OJAA 3QFAA 4O5QA 3LJPA 4CCQA 5HXIA 3AYJA 3AE1A 4B66A 5JCNA 1ZP0A 3UTEA 2OLOA 3DJGX 2WOWA 1CJCA 1GTHA 2C3DA 2A89A 2BS4A 5CKUA 3Q9TA 1S2QA 4C5OA 2FJEA 3CPIG 1GT8A 1OJCA 3P9UA 3LADA 4NZHA 1KF6A 2QA1A 2XVEA 4EMIA 3EAOA 3UKQA 4USQA 2A8XA 2OLNA 5ER0A 5KWFA 2ACZA 2OALA 3FMWA 3P4PA 3NGCX 4Z2RA 3BHKA 3AE2A 1ONFA 3AE7A 4GCMA 1ZOYA 3KPFA 3GWDA 1Y56B 1KSUA 3NYCA 1JRXA 3AWIA 3UKLA 4IVMB 4BJZA 1NHSA 4CY6A 1QO8A 1KNPA 3UKHA 4M52A 1JU2A 2JBVA 2O9ZA 3R9UA 4K22A 2C3CA 1H82A 5HHFA 4A99A 4UDPA 2XYOA 1GNDA 4A79A 4BK2A 2GQWA 4EIQA 4EM4A 1FEAA 2VVLA 4AP1A 3L8KA 2C75A 2XFNA 1MOKA 4FK1A 4K7ZA 2FJDA 4KX6A 1TDOA 4U2LA 2JAEA 2F5ZA 3GD4A 2FBWA 4YKFA 1GETA 3AEEA 3DH9A 2C76A 4U8KA 4AP3A 4BURA 5KOXA 4K2XA 3DMEA 4J33A 2Q0LA 4KPRA 3ALJA 2BK3A 3CNTA 3ATQA 4GRTA 3GSIA 2V3BA 4TM4A 1E1NA 1H7XA 3KKJA 4OVIA 3LB8A 1O5WA 2WPCA 5U25A 5JCLA 1NPXA 2X99A 2ZZ0A 3GMCA 4A6NA 2EQ6A 3KLJA 1W4XA 2GV8A 1NAAA 1F6MA 1YQ4A 2EQ7A 3ISHA 3VR9A 2AR8A 4HA6A 2IIDA 4AT0A 2XVJA 3Q6JA 5CQFA 2YG7A 3REDA 1IJHA 4UP3A 3QVPA 3UOXA 2YG5A 1PJ6A 1BKWA 2C66A 4CBQA 1P2EA 1TYTA 2BA9A 2R0GA 3VRBA 5BUKA 2WP6A 1E1LA 2GVCA 2YWLA 5GRTA 4DNAA 3UKPA 3NH3X 1Y0PA 4JN9A 3CNDA 4EQSA 2VZ2A 1ZKQA 2ARDA 2Q7VA 5IQ4A 3NK2X 2GMHA 4TLXA 1JNRA 2WOIA 3NK0X 4U8NA 4U8LA 1F8SA 3QSMA 4B68A 1RSGA 4XWRA 4OCGA 2YR6A 2WU5A 2V3AA 4A9WA 1CJ4A 3EANA 3GMBA 2QA2A 4D03A 3NG7X 4C77A 1D4CA 1JRYA 2X3NA 1FCDA 1NHRA 3S5WA 1PXBA 1PXCA 1LQUA 1H7WA 4TM3A 4LIIA 4ADWA 2YM1A 3BHFA 3K30A 3KD9A 4D04A 1LVLA 4EQWA 1P2HA 3OC4A 2Q0KA 1PN0A 4REKA 3UP4A 4O5UA 5GSNA 2VQBA 1TRBA 1S3EA 4CNKA 1PHHA 1N4UA 2R4EA 4H4YA 4C74A 1ZY8A 5L46A 3DK9A 2TMDA 5EBKA 2YVGA 1PJ7A 2C72A 2JK6A 2RABA 1M64A 4JY3A 2R45A 4CY8A 4J36A 4LU6A 2GMJA 5M0ZA 4Z2TA 1DNCA 1ZMDA 4ZCDA 1ZDLA 1AOGA 3LXDA 3NN6X 3UOVA 5LV9A 2QCUA 3CGEA 1DODA 2WS3A 3CNSA 3NHOX 2WP9A 1UKVG 2GR1A 3IC9A 2YLRA 4WCTA 1H84A 3QFBA 5U63A 1GESA 4DGKA 1YKJA 3UP5A 4YT0A 2X8HA 3QJ4A 2B7SA 1YY5A 2R46A 1IUSA 3CGBA 1EL7A 1GRFA 1QLBA 1NG4A 2XVFA 2XLSA 3AEAA 3ALLA 3QSSA 3GRTA
chains in the Genus database with same CATH superfamily
1E7PA 1KNRA 5EB5A 1BWCA 3AD7B 4UDQA 4J2WA 2NPXA 3I6DA 4Y4NA 3VRAA 2X8CA 2YR4A 1GXFA 3AXBA 3F8DA 4OPTA 4AOSA 2IVEA 2XLUA 1CHUA 1JOAA 1K0IA 3DA1A 3P4SA 2BRAA 1Y56A 4YTNA 2YVFA 3ZYXA 4UDRA 2C67A 1E39A 3AEBA 4DSHA 1GPEA 1BF3A 2QAEA 1DJNA 2YLSA 3SQPA 5KNLA 4OPDA 1H83A 2YLTA 1IUVA 2BS2A 2GH5A 1VDCA 4X9MA 1Q1WA 1PBFA 1GALA 1GEUA 1VG0A 3AE3A 3UCLA 3UTFA 1L9DA 4EM3A 1TYPA 2VRLA 4FK1C 2ZZBA 2IVDA 1DOEA 5M10A 2OAMA 1CBOA 1L9CA 4B1BA 2W0HA 3AEGA 3ICRA 4II2A 4C3XA 4EMWA 5BRTA 1XANA 5KOWA 2XLPA 1MO9A 1E1MA 2BS3A 5EOWA 2GR0A 3VQRA 2FJAA 3SXIA 3GYJA 2YLXA 1IUUA 1O94A 3NTDA 2ZZCA 4K5RA 4H2QA 4B67A 3AE4A 3WE0A 1OJTA 2GAGB 2WETA 2NVKX 2YLZA 3NT6A 1RP0A 4OPGA 1NHQA 2EQ9A 2V61A 4YXDA 1PBEA 1Q1RA 1EBDA 3AEFA 2XFPA 1DJQA 4NTCA 2GR3A 3QSEA 1PDHA 5JCMA 2GB0A 2X8GA 2B9WA 4NTEA 2VVLG 4CCRA 4B69A 2GF3A 2X50A 3KU9A 2Z5YA 3H8IA 3AEDA 4JQ9A 1GV4A 5U1OA 3BI4A 1HYUA 5KMQA 2EQ8A 4EQRA 4HB9A 3PO7A 4OPUA 3GRSA 3NYEA 4GDPA 3P1WA 4TM1A 1E6EA 1JNZA 2BACA 3M12A 4H4ZA 3LZXA 4N9XA 1F3PA 1NG3A 2JB3A 1EL5A 4IA5A 4IV9A 3DJJA 3SY4A 2R9ZA 3AE9A 1CL0A 2AAQA 4TLZA 3RP7A 3CGCA 4B65A 3RP8A 4H50A 3V3OA 3ADAB 1D5TA 3BI2A 4AT2A 1OJDA 2XVHA 3UKAA 2GEWA 5DBJA 3CNJA 2CDUA 4NNJA 1M6IA 1JRZA 3UOYA 3K7QX 3B3RA 3AYLA 2C70A 1GRHA 2VQ7A 2XFOA 2B9YA 3AE5A 4PAAA 2C4CA 2H88A 2JB1A 3NRNA 1FECA 2YG6A 3DJEA 4P9SA 2GQFA 2XLTA 4GDEA 2WDVA 5J7XA 2WBAA 3HYXA 3K7TA 1JEHA 4U8MA 3AE6A 1NEKA 5EB4A 3P4QA 4YSXA 1VG9A 3NK1X 4G73A 3UKKA 5TR3A 2BC0A 4ZN0A 1BGNA 4H4SA 3II4A 1N1PA 3UKFA 2XVIA 4NTDA 5C3JA 2C65A 3ATRA 4GR1A 4I59A 1K0JA 1XDIA 1GRTA 3NYFA 2CFYA 1H6VA 2R0PA 3RP6A 1COYA 1DOBA 2XFUA 4II3A 4ZCCA 2C73A 3NLCA 2B76A 4BK1A 3AECA 4NEWA 4Z44A 3GYXA 2BXSA 4JY2A 4XXGA 3BNUA 1BGJA 1K0LA 1PBCA 5KVIA 4I58A 3SZCA 3SZFA 1K4QA 4C3YA 1GOSA 1ZMCA 1B8SA 1ZK7A 2XDOA 4B64A 3O0HA 4YSZA 1TDKA 2APGA 4YKGA 2HQMA 4OPCA 1BZLA 3ABVA 3DGZA 5IQ1A 3C96A 1GRAA 5HY5A 3VR8A 4J31A 1H86A 4OPLA 3CIRA 2UZZA 5KMPA 1OJ9A 1Z6LA 2JKCA 3D8XA 3T14A 2JB2A 3ICSA 4GUVA 4IVOB 4U8JA 4H4TA 4ECHA 1XPQA 4J34A 1EL9A 2C7GA 4AOXA 5KMSA 4Z24A 3FBSA 1B5QA 3ICTA 1B4VA 1CC4A 1LQTA 2CULA 3AB1A 4YSHA 4B63A 2V5ZA 2V6OA 3FPZA 1B37A 1YQZA 2R4JA 3C4AA 3OZ2A 3SFEA 1CC2A 2YM2A 4YTPA 4FDCB 3SM8A 1LPFA 1D4DA 3P4RA 2BABA 3SFDA 3K7MX 2PYXA 4DSGA 2WHDA 3SGLA 4NEVA 1ELIA 2YVJA 5KMRA 2WDRA 4E0VA 3SYIA 1TDFA 2XLRA 2ZBWA 3EPTA 2Z5XA 1F8WA 3IHMA 4H4WA 3E1TA 1PBDA 1DXLA 3ZDNA 1N4VA 3I3LA 4JNAA 3CN8A 3IF9A 3GDNA 3M13A 3URHA 4A5LA 1VRQB 2WP5A 1GRGA 3ALMA 4H4VA 5FS8A 2BYBA 2YLWA 1D4EA 4IA6A 4EIPA 2GRTA 1GERA 2Y6QA 4K5SA 3CPJG 3GYIA 1REOA 3DJDA 1YQ3A 4WX1A 5JCIA 3T37A 1CC6A 5JCKA 2J3NA 2RGJA 4YTMA 2WESA 3CGDA 3FG2P 3D1CA 4H4PA 3HZLA 3CPHG 4H4QA 4U2SA 1TDEA 4H2PA 2BCPA 3COXA 4BV6A 2RGHA 2DKIA 2Q6UA 3BI5A 3G5QA 1Q9IA 2BK5A 2BCGG 3AD9B 3T2YA 2WEUA 1N4WA 1IUXA 4USRA 1X31B 4APNA 2AQJA 3DGHA 4EMJA 4H7UA 2WQYA 4U8OA 3V3NA 3CMMA 4TM0A 2E5VA 1CJ3A 2BRYA 3F8RA 1ZOVA 2BK4A 2YR5A 1GSNA 3PS9A 3FIMB 1ZX9A 4J56A 4A65A 3C4NA 2CVJA 4BK3A 4Z43A 3NNEA 2B7RA 2H89A 3RNMA 2B9XA 1E1KA 1RYIA 3NN0X 4LA1A 2RGOA 1V59A 2DKHA 5FMHA 4U2TA 1IUTA 2WPEA 2WOVA 3NTAA 4FX9A 5IPYA 4Z2UA 4X9NA 4Y4LA 3S61A 3IWAA 3UTHA 1XHCA 1S2YA 3T2KA 3HYVA 4A6NB 3KA7A 4Z26A 3AD8B 3UTGA 3GDPA 1NHPA 1SEZA 4ICYA 2E4GA 1LV0A 3KPKA 4RSLA 1DOCA 4Y4MA 1KDGA 3EF6A 2VVMA 3KVEA 3DK4A 1CJ2A 2VRMA 2XCGA 4U8PA 3AYIA 5KRQA 3ITJA 3JSKA 4NWZA 3H4KA 5FS7A 5KXJA 3SZ0A 1F8RA 1PBBA 3G5RA 5HYMA 4H4XA 2YG4A 3L1RA 1GRBA 2WU2A 3V76A 3DK8A 2WPFA 4H4RA 2VOUA 1L0VA 2A87A 1EL8A 3LZWA 1S3BA 3F8PA 1LJ1A 1O95A 2I0ZA 3M0OA 4K8DA 1TDNA 4GF7A 4H2NA 2BXRA 1FOHA 4JNQA 1GTEA 5C2TA 5BULA 4YSYA 4CNJA 1NDAA 1KSSA 1GREA 4PABA 3LOVA 4G74A 4OPIA 4BJYA 4U8IA 2Y6RA 2R0CA 1CF3A 2PHHA 5BVAA 2C64A 3AE8A 3H8LA 2GAHB 3B6DA 2BC1A 2V60A 4GAPA 4J57A 2YAUA 3BNMA 4RG3A 3CNPA 1VQWA 3G5SA 4X4JA 1MXTA 3QVRA 4H2RA 1NENA 4JDRA 4XWZA 5J60A 4H4UA 1D7LA 4EQXA 3CTYA 1PXAA 1FL2A 3IHGA 1PS9A 3GWFA 3PVCA 4GAVA 4Z25A 3VRDB 3NIXA 4CRTA 5KVHA 3GD3A 1D7YA 5FS6A 1FEBA 5FS9A 2YG3A 4MJWA 4YWOA 4RG4A 1IUWA 3RHAA 1LTXR 1L9EA 4A7AA 3NKSA 1H81A 2E1MA 2FJBA 2TPRA 1PJ5A 2GR2A 3UOZA 2XFQA 2YQUA 1KFYA 1QJDA 2OA1A 2WDQA 1OJAA 3QFAA 4G6HA 3LJPA 4O5QA 4CCQA 3AYJA 5HXIA 3AE1A 4B66A 5JCNA 1ZP0A 3UTEA 2OLOA 3DJGX 2WOWA 1CJCA 1GTHA 2C3DA 2A89A 2BS4A 5CKUA 3Q9TA 1S2QA 4C5OA 2FJEA 3CPIG 1GT8A 1OJCA 3P9UA 3LADA 4NZHA 1KF6A 2QA1A 2XVEA 4EMIA 3EAOA 3UKQA 4USQA 2A8XA 2OLNA 5ER0A 5KWFA 2ACZA 2OALA 3FMWA 3P4PA 3NGCX 4Z2RA 3BHKA 3AE2A 1ONFA 3AE7A 4GCMA 1ZOYA 3KPFA 3GWDA 1Y56B 1KSUA 3NYCA 1JRXA 3AWIA 3T31A 3UKLA 4IVMB 4BJZA 1NHSA 4CY6A 1QO8A 1KNPA 3UKHA 4M52A 1JU2A 2JBVA 2O9ZA 3R9UA 4K22A 2C3CA 1H82A 5HHFA 4A99A 4UDPA 2XYOA 1GNDA 4A79A 4BK2A 2GQWA 4EIQA 4EM4A 1FEAA 2VVLA 4AP1A 3L8KA 2C75A 2XFNA 1MOKA 4FK1A 4K7ZA 2FJDA 4KX6A 1TDOA 4U2LA 2JAEA 2F5ZA 3GD4A 3SX6A 2FBWA 3T2ZA 4YKFA 1GETA 3AEEA 3DH9A 2C76A 4U8KA 4AP3A 4BURA 5KOXA 4K2XA 3DMEA 4J33A 2Q0LA 4KPRA 3ALJA 2BK3A 3CNTA 3ATQA 4GRTA 3GSIA 2V3BA 4TM4A 1E1NA 1H7XA 3KKJA 4OVIA 3LB8A 1O5WA 2WPCA 5U25A 5JCLA 1NPXA 2X99A 2ZZ0A 3GMCA 4A6NA 2EQ6A 3KLJA 1W4XA 2GV8A 1NAAA 1F6MA 1YQ4A 2EQ7A 3ISHA 3VR9A 2AR8A 4HA6A 2IIDA 4AT0A 2XVJA 3Q6JA 5CQFA 2YG7A 3REDA 1IJHA 4UP3A 3QVPA 3UOXA 2YG5A 1PJ6A 1BKWA 2C66A 4CBQA 1P2EA 1TYTA 2BA9A 2R0GA 3VRBA 5BUKA 2WP6A 1E1LA 2GVCA 2YWLA 5GRTA 4DNAA 3UKPA 3NH3X 1Y0PA 4JN9A 3CNDA 4EQSA 2VZ2A 1ZKQA 2ARDA 2Q7VA 5IQ4A 3NK2X 2GMHA 4TLXA 1JNRA 2WOIA 3NK0X 4U8NA 4U8LA 1F8SA 3QSMA 4B68A 1RSGA 4XWRA 4OCGA 2YR6A 2WU5A 2V3AA 4A9WA 1CJ4A 3EANA 3GMBA 2QA2A 4D03A 3NG7X 4C77A 1D4CA 1JRYA 2X3NA 1FCDA 1NHRA 4G9KA 1PXBA 1PXCA 3S5WA 1LQUA 1H7WA 4TM3A 4LIIA 4ADWA 2YM1A 3BHFA 3K30A 3KD9A 4D04A 1LVLA 4EQWA 1P2HA 3OC4A 2Q0KA 3T0KA 1PN0A 4REKA 3UP4A 4O5UA 5GSNA 2VQBA 1TRBA 1S3EA 4CNKA 1PHHA 1N4UA 2R4EA 4H4YA 4C74A 1ZY8A 5L46A 3DK9A 2TMDA 5EBKA 2YVGA 1PJ7A 2C72A 2JK6A 2RABA 1M64A 4JY3A 2R45A 4CY8A 4J36A 4LU6A 2GMJA 5M0ZA 4Z2TA 1DNCA 1ZMDA 4ZCDA 1ZDLA 1AOGA 3LXDA 3NN6X 3UOVA 5LV9A 2QCUA 3CGEA 1DODA 2WS3A 3HYWA 3CNSA 3NHOX 2WP9A 1UKVG 2GR1A 3IC9A 2YLRA 4WCTA 4G6GA 1H84A 3QFBA 5U63A 1GESA 4DGKA 1YKJA 3UP5A 4YT0A 3SZWA 2X8HA 3QJ4A 2B7SA 1YY5A 2R46A 1IUSA 3CGBA 1EL7A 1GRFA 1QLBA 1NG4A 2XVFA 2XLSA 3AEAA 3ALLA 3QSSA 3GRTA
chains in the Genus database with same CATH topology
1E7PA 1KNRA 5EB5A 1BWCA 3AD7B 4UDQA 4J2WA 2NPXA 3I6DA 4Y4NA 3VRAA 2X8CA 2YR4A 1GXFA 3AXBA 3F8DA 4OPTA 4AOSA 2IVEA 2XLUA 1CHUA 1JOAA 1K0IA 3DA1A 3P4SA 2BRAA 1Y56A 4YTNA 2YVFA 3ZYXA 4UDRA 2C67A 1E39A 3AEBA 4DSHA 1GPEA 1BF3A 2QAEA 1DJNA 2YLSA 3SQPA 5KNLA 4OPDA 1H83A 2YLTA 1IUVA 2BS2A 2GH5A 1VDCA 4X9MA 1Q1WA 1PBFA 1GALA 1GEUA 1VG0A 3AE3A 3UCLA 3UTFA 1L9DA 4EM3A 1TYPA 2VRLA 4FK1C 2ZZBA 2IVDA 1DOEA 5M10A 2OAMA 1CBOA 1L9CA 4B1BA 2W0HA 3AEGA 3ICRA 4II2A 4C3XA 4EMWA 5BRTA 1XANA 5KOWA 2XLPA 1MO9A 1E1MA 2BS3A 5EOWA 2GR0A 3VQRA 2FJAA 3SXIA 3GYJA 2YLXA 1IUUA 1O94A 3NTDA 2ZZCA 4K5RA 4H2QA 4B67A 3AE4A 3WE0A 1OJTA 2GAGB 2WETA 2NVKX 2YLZA 3NT6A 1RP0A 4OPGA 1NHQA 2EQ9A 2V61A 4YXDA 1PBEA 1Q1RA 1EBDA 3AEFA 2XFPA 1DJQA 4NTCA 2GR3A 3QSEA 1PDHA 5JCMA 2GB0A 2X8GA 2B9WA 4NTEA 2VVLG 4CCRA 4B69A 2GF3A 2X50A 3KU9A 2Z5YA 3H8IA 3AEDA 4JQ9A 1GV4A 5U1OA 3BI4A 1HYUA 5KMQA 2EQ8A 4EQRA 4HB9A 3PO7A 4OPUA 3GRSA 3NYEA 4GDPA 3P1WA 4TM1A 1E6EA 1JNZA 2BACA 3M12A 4H4ZA 3LZXA 4N9XA 1F3PA 1NG3A 2JB3A 1EL5A 4IA5A 4IV9A 3DJJA 3SY4A 2R9ZA 3AE9A 1CL0A 2AAQA 4TLZA 3RP7A 3CGCA 4B65A 3RP8A 4H50A 3V3OA 3ADAB 1D5TA 3BI2A 4AT2A 1OJDA 2XVHA 3UKAA 2GEWA 5DBJA 3CNJA 2CDUA 4NNJA 1M6IA 1JRZA 3UOYA 3K7QX 3B3RA 3AYLA 2C70A 1GRHA 2VQ7A 2XFOA 2B9YA 3AE5A 4PAAA 2C4CA 2H88A 2JB1A 3NRNA 1FECA 2YG6A 3DJEA 4P9SA 2GQFA 2XLTA 4GDEA 2WDVA 5J7XA 2WBAA 3HYXA 3K7TA 1JEHA 4U8MA 3AE6A 1NEKA 5EB4A 3P4QA 4YSXA 1VG9A 3NK1X 4G73A 3UKKA 5TR3A 2BC0A 4ZN0A 1BGNA 4H4SA 3II4A 1N1PA 3UKFA 2XVIA 4NTDA 5C3JA 2C65A 3ATRA 4GR1A 4I59A 1K0JA 1XDIA 1GRTA 3NYFA 2CFYA 1H6VA 2R0PA 3RP6A 1COYA 1DOBA 2XFUA 4II3A 4ZCCA 2C73A 3NLCA 2B76A 4BK1A 3AECA 4NEWA 4Z44A 3GYXA 2BXSA 4JY2A 4XXGA 3BNUA 1BGJA 1K0LA 1PBCA 5KVIA 4I58A 3SZCA 3SZFA 1K4QA 4C3YA 1GOSA 1ZMCA 1B8SA 1ZK7A 2XDOA 4B64A 3O0HA 4YSZA 1TDKA 2APGA 4YKGA 2HQMA 4OPCA 1BZLA 3ABVA 3DGZA 5IQ1A 3C96A 1GRAA 5HY5A 3VR8A 4J31A 1H86A 4OPLA 3CIRA 2UZZA 5KMPA 1OJ9A 1Z6LA 2JKCA 3D8XA 3T14A 2JB2A 3ICSA 4GUVA 4IVOB 4U8JA 4H4TA 4ECHA 1XPQA 4J34A 1EL9A 2C7GA 4AOXA 5KMSA 4Z24A 3FBSA 1B5QA 3ICTA 1B4VA 1CC4A 1LQTA 2CULA 3AB1A 4YSHA 4B63A 2V5ZA 2V6OA 3FPZA 1B37A 1YQZA 2R4JA 3C4AA 3OZ2A 3SFEA 1CC2A 2YM2A 4YTPA 4FDCB 3SM8A 1LPFA 1D4DA 3P4RA 2BABA 3SFDA 3K7MX 2PYXA 4DSGA 2WHDA 3SGLA 4NEVA 1ELIA 2YVJA 5KMRA 2WDRA 4E0VA 3SYIA 1TDFA 2XLRA 2ZBWA 3EPTA 2Z5XA 1F8WA 3IHMA 4H4WA 3E1TA 1PBDA 1DXLA 3ZDNA 1N4VA 3I3LA 4JNAA 3CN8A 3IF9A 3GDNA 3M13A 3URHA 4A5LA 1VRQB 2WP5A 1GRGA 3ALMA 4H4VA 5FS8A 2BYBA 2YLWA 1D4EA 4IA6A 4EIPA 2GRTA 1GERA 2Y6QA 4K5SA 3CPJG 3GYIA 1REOA 3DJDA 1YQ3A 4WX1A 5JCIA 3T37A 1CC6A 5JCKA 2J3NA 2RGJA 4YTMA 2WESA 3CGDA 3FG2P 3D1CA 4H4PA 3HZLA 3CPHG 4H4QA 4U2SA 1TDEA 4H2PA 2BCPA 3COXA 4BV6A 2RGHA 2DKIA 2Q6UA 3BI5A 3G5QA 1Q9IA 2BK5A 2BCGG 3AD9B 3T2YA 2WEUA 1N4WA 1IUXA 4USRA 1X31B 4APNA 2AQJA 3DGHA 4EMJA 4H7UA 2WQYA 4U8OA 3V3NA 3CMMA 4TM0A 2E5VA 1CJ3A 2BRYA 3F8RA 1ZOVA 2BK4A 2YR5A 1GSNA 3PS9A 3FIMB 1ZX9A 4J56A 4A65A 3C4NA 2CVJA 4BK3A 4Z43A 3NNEA 2B7RA 2H89A 3RNMA 2B9XA 1E1KA 1RYIA 3NN0X 4LA1A 2RGOA 1V59A 2DKHA 5FMHA 4U2TA 1IUTA 2WPEA 2WOVA 3NTAA 4FX9A 5IPYA 4Z2UA 4X9NA 4Y4LA 3S61A 3IWAA 3UTHA 1XHCA 1S2YA 3T2KA 3HYVA 4A6NB 3KA7A 4Z26A 3AD8B 3UTGA 3GDPA 1NHPA 1SEZA 4ICYA 2E4GA 1LV0A 3KPKA 4RSLA 1DOCA 4Y4MA 1KDGA 3EF6A 2VVMA 3KVEA 3DK4A 1CJ2A 2VRMA 2XCGA 4U8PA 3AYIA 5KRQA 3ITJA 3JSKA 4NWZA 3H4KA 5FS7A 5KXJA 3SZ0A 1F8RA 1PBBA 3G5RA 5HYMA 4H4XA 2YG4A 3L1RA 1GRBA 2WU2A 3V76A 3DK8A 2WPFA 4H4RA 2VOUA 1L0VA 2A87A 1EL8A 3LZWA 1S3BA 3F8PA 1LJ1A 1O95A 2I0ZA 3M0OA 4K8DA 1TDNA 4GF7A 4H2NA 2BXRA 1FOHA 4JNQA 1GTEA 5C2TA 5BULA 4YSYA 4CNJA 1NDAA 1KSSA 1GREA 4PABA 3LOVA 4G74A 4OPIA 4BJYA 4U8IA 2Y6RA 2R0CA 1CF3A 2PHHA 5BVAA 2C64A 3AE8A 3H8LA 2GAHB 3B6DA 2BC1A 2V60A 4GAPA 4J57A 2YAUA 3BNMA 4RG3A 3CNPA 1VQWA 3G5SA 4X4JA 1MXTA 3QVRA 4H2RA 1NENA 4JDRA 4XWZA 5J60A 4H4UA 1D7LA 4EQXA 3CTYA 1PXAA 1FL2A 3IHGA 1PS9A 3GWFA 3PVCA 4GAVA 4Z25A 3VRDB 3NIXA 4CRTA 5KVHA 3GD3A 1D7YA 5FS6A 1FEBA 5FS9A 2YG3A 4MJWA 4YWOA 4RG4A 1IUWA 3RHAA 1LTXR 1L9EA 4A7AA 3NKSA 1H81A 2E1MA 2FJBA 2TPRA 1PJ5A 2GR2A 3UOZA 2XFQA 2YQUA 1KFYA 1QJDA 2OA1A 2WDQA 1OJAA 3QFAA 4G6HA 3LJPA 4O5QA 4CCQA 3AYJA 5HXIA 3AE1A 4B66A 5JCNA 1ZP0A 3UTEA 2OLOA 3DJGX 2WOWA 1CJCA 1GTHA 2C3DA 2A89A 2BS4A 5CKUA 3Q9TA 1S2QA 4C5OA 2FJEA 3CPIG 1GT8A 1OJCA 3P9UA 3LADA 4NZHA 1KF6A 2QA1A 2XVEA 4EMIA 3EAOA 3UKQA 4USQA 2A8XA 2OLNA 5ER0A 5KWFA 2ACZA 2OALA 3FMWA 3P4PA 3NGCX 4Z2RA 3BHKA 3AE2A 1ONFA 3AE7A 4GCMA 1ZOYA 3KPFA 3GWDA 1Y56B 1KSUA 3NYCA 1JRXA 3AWIA 3T31A 3UKLA 4IVMB 4BJZA 1NHSA 4CY6A 1QO8A 1KNPA 3UKHA 4M52A 1JU2A 2JBVA 2O9ZA 3R9UA 4K22A 2C3CA 1H82A 5HHFA 4A99A 4UDPA 2XYOA 1GNDA 4A79A 4BK2A 2GQWA 4EIQA 4EM4A 1FEAA 2VVLA 4AP1A 3L8KA 2C75A 2XFNA 1MOKA 4FK1A 4K7ZA 2FJDA 4KX6A 1TDOA 4U2LA 2JAEA 2F5ZA 3GD4A 3SX6A 2FBWA 3T2ZA 4YKFA 1GETA 3AEEA 3DH9A 2C76A 4U8KA 4AP3A 4BURA 5KOXA 4K2XA 3DMEA 4J33A 2Q0LA 4KPRA 3ALJA 2BK3A 3CNTA 3ATQA 4GRTA 3GSIA 2V3BA 4TM4A 1E1NA 1H7XA 3KKJA 4OVIA 3LB8A 1O5WA 2WPCA 5U25A 5JCLA 1NPXA 2X99A 2ZZ0A 3GMCA 4A6NA 2EQ6A 3KLJA 1W4XA 2GV8A 1NAAA 1F6MA 1YQ4A 2EQ7A 3ISHA 3VR9A 2AR8A 4HA6A 2IIDA 4AT0A 2XVJA 3Q6JA 5CQFA 2YG7A 3REDA 1IJHA 4UP3A 3QVPA 3UOXA 2YG5A 1PJ6A 1BKWA 2C66A 4CBQA 1P2EA 1TYTA 2BA9A 2R0GA 3VRBA 5BUKA 2WP6A 1E1LA 2GVCA 2YWLA 5GRTA 4DNAA 3UKPA 3NH3X 1Y0PA 4JN9A 3CNDA 4EQSA 2VZ2A 1ZKQA 2ARDA 2Q7VA 5IQ4A 3NK2X 2GMHA 4TLXA 1JNRA 2WOIA 3NK0X 4U8NA 4U8LA 1F8SA 3QSMA 4B68A 1RSGA 4XWRA 4OCGA 2YR6A 2WU5A 2V3AA 4A9WA 1CJ4A 3EANA 3GMBA 2QA2A 4D03A 3NG7X 4C77A 1D4CA 1JRYA 2X3NA 1FCDA 1NHRA 4G9KA 1PXBA 1PXCA 3S5WA 1LQUA 1H7WA 4TM3A 4LIIA 4ADWA 2YM1A 3BHFA 3K30A 3KD9A 4D04A 1LVLA 4EQWA 1P2HA 3OC4A 2Q0KA 3T0KA 1PN0A 4REKA 3UP4A 4O5UA 5GSNA 2VQBA 1TRBA 1S3EA 4CNKA 1PHHA 1N4UA 2R4EA 4H4YA 4C74A 1ZY8A 5L46A 3DK9A 2TMDA 5EBKA 2YVGA 1PJ7A 2C72A 2JK6A 2RABA 1M64A 4JY3A 2R45A 4CY8A 4J36A 4LU6A 2GMJA 5M0ZA 4Z2TA 1DNCA 1ZMDA 4ZCDA 1ZDLA 1AOGA 3LXDA 3NN6X 3UOVA 5LV9A 2QCUA 3CGEA 1DODA 2WS3A 3HYWA 3CNSA 3NHOX 2WP9A 1UKVG 2GR1A 3IC9A 2YLRA 4WCTA 4G6GA 1H84A 3QFBA 5U63A 1GESA 4DGKA 1YKJA 3UP5A 4YT0A 3SZWA 2X8HA 3QJ4A 2B7SA 1YY5A 2R46A 1IUSA 3CGBA 1EL7A 1GRFA 1QLBA 1NG4A 2XVFA 2XLSA 3AEAA 3ALLA 3QSSA 3GRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7P A;  1KNR A;  5EB5 A;  1BWC A;  3AD7 B;  4UDQ A;  4J2W A;  2NPX A;  3I6D A;  4Y4N A;  3VRA A;  2X8C A;  2YR4 A;  1GXF A;  3AXB A;  3F8D A;  4OPT A;  4AOS A;  2IVE A;  2XLU A;  1CHU A;  1JOA A;  1K0I A;  3DA1 A;  3P4S A;  1Y56 A;  4YTN A;  2YVF A;  3ZYX A;  4UDR A;  2C67 A;  1E39 A;  3AEB A;  4DSH A;  1GPE A;  1BF3 A;  2QAE A;  1DJN A;  2YLS A;  3SQP A;  4OPD A;  1H83 A;  2YLT A;  1IUV A;  2BS2 A;  2GH5 A;  1VDC A;  4X9M A;  1Q1W A;  1PBF A;  1GAL A;  1GEU A;  1VG0 A;  3AE3 A;  3UCL A;  3UTF A;  1L9D A;  4EM3 A;  1TYP A;  2VRL A;  4FK1 C;  2ZZB A;  2IVD A;  1DOE A;  5M10 A;  2OAM A;  1CBO A;  1L9C A;  4B1B A;  2W0H A;  3AEG A;  3ICR A;  4C3X A;  5BRT A;  4EMW A;  5KOW A;  1XAN A;  2XLP A;  1MO9 A;  1E1M A;  2BS3 A;  5EOW A;  2GR0 A;  3VQR A;  2FJA A;  3GYJ A;  2YLX A;  1IUU A;  1O94 A;  3NTD A;  2ZZC A;  4K5R A;  4H2Q A;  4B67 A;  3AE4 A;  3WE0 A;  1OJT A;  2GAG B;  2WET A;  2NVK X;  2YLZ A;  3NT6 A;  1RP0 A;  4OPG A;  1NHQ A;  2EQ9 A;  2V61 A;  4YXD A;  1PBE A;  1Q1R A;  1EBD A;  3AEF A;  2XFP A;  1DJQ A;  4NTC A;  2GR3 A;  3QSE A;  1PDH A;  5JCM A;  2GB0 A;  2X8G A;  2B9W A;  4NTE A;  2VVL G;  4CCR A;  4B69 A;  2GF3 A;  2X50 A;  3KU9 A;  2Z5Y A;  3H8I A;  3AED A;  4JQ9 A;  1GV4 A;  5U1O A;  3BI4 A;  1HYU A;  2EQ8 A;  4EQR A;  4HB9 A;  3PO7 A;  4OPU A;  3GRS A;  3NYE A;  4GDP A;  3P1W A;  4TM1 A;  1E6E A;  1JNZ A;  2BAC A;  3M12 A;  4H4Z A;  3LZX A;  4N9X A;  1F3P A;  1NG3 A;  2JB3 A;  1EL5 A;  4IA5 A;  4IV9 A;  3DJJ A;  2R9Z A;  3AE9 A;  1CL0 A;  2AAQ A;  4TLZ A;  3RP7 A;  3CGC A;  4B65 A;  3RP8 A;  4H50 A;  3V3O A;  3ADA B;  1D5T A;  3BI2 A;  4AT2 A;  1OJD A;  2XVH A;  3UKA A;  2GEW A;  5DBJ A;  3CNJ A;  2CDU A;  1M6I A;  1JRZ A;  3UOY A;  3K7Q X;  3B3R A;  3AYL A;  2C70 A;  1GRH A;  2VQ7 A;  2XFO A;  2B9Y A;  3AE5 A;  4PAA A;  2H88 A;  2JB1 A;  3NRN A;  1FEC A;  2YG6 A;  3DJE A;  4P9S A;  2GQF A;  2XLT A;  4GDE A;  2WDV A;  5J7X A;  2WBA A;  3K7T A;  1JEH A;  4U8M A;  3AE6 A;  1NEK A;  5EB4 A;  3P4Q A;  4YSX A;  1VG9 A;  3NK1 X;  3UKK A;  5TR3 A;  2BC0 A;  4ZN0 A;  1BGN A;  4H4S A;  3II4 A;  1N1P A;  3UKF A;  2XVI A;  4NTD A;  5C3J A;  2C65 A;  3ATR A;  4GR1 A;  4I59 A;  1K0J A;  1XDI A;  1GRT A;  3NYF A;  2CFY A;  1H6V A;  2R0P A;  3RP6 A;  1COY A;  1DOB A;  2XFU A;  4ZCC A;  2C73 A;  3NLC A;  2B76 A;  4BK1 A;  3AEC A;  4NEW A;  4Z44 A;  2BXS A;  4JY2 A;  4XXG A;  3BNU A;  1BGJ A;  1K0L A;  1PBC A;  5KVI A;  4I58 A;  1K4Q A;  4C3Y A;  1GOS A;  1ZMC A;  1B8S A;  1ZK7 A;  2XDO A;  4B64 A;  3O0H A;  4YSZ A;  1TDK A;  2APG A;  4YKG A;  2HQM A;  4OPC A;  1BZL A;  3ABV A;  3DGZ A;  5IQ1 A;  3C96 A;  1GRA A;  5HY5 A;  3VR8 A;  4J31 A;  1H86 A;  4OPL A;  3CIR A;  2UZZ A;  1OJ9 A;  1Z6L A;  2JKC A;  3D8X A;  2JB2 A;  3ICS A;  4GUV A;  4IVO B;  4U8J A;  4H4T A;  4ECH A;  1XPQ A;  4J34 A;  1EL9 A;  2C7G A;  4AOX A;  4Z24 A;  3FBS A;  1B5Q A;  3ICT A;  1B4V A;  1CC4 A;  1LQT A;  2CUL A;  3AB1 A;  4YSH A;  4B63 A;  2V5Z A;  2V6O A;  3FPZ A;  1B37 A;  1YQZ A;  2R4J A;  3C4A A;  3OZ2 A;  3SFE A;  1CC2 A;  2YM2 A;  4YTP A;  4FDC B;  3SM8 A;  1LPF A;  1D4D A;  3P4R A;  2BAB A;  3SFD A;  3K7M X;  2PYX A;  4DSG A;  2WHD A;  3SGL A;  4NEV A;  1ELI A;  2YVJ A;  2WDR A;  4E0V A;  1TDF A;  2XLR A;  2ZBW A;  3EPT A;  2Z5X A;  1F8W A;  3IHM A;  4H4W A;  3E1T A;  1PBD A;  1DXL A;  3ZDN A;  1N4V A;  3I3L A;  4JNA A;  3CN8 A;  3IF9 A;  3GDN A;  3M13 A;  3URH A;  4A5L A;  1VRQ B;  2WP5 A;  1GRG A;  3ALM A;  4H4V A;  5FS8 A;  2BYB A;  2YLW A;  1D4E A;  4IA6 A;  4EIP A;  2GRT A;  1GER A;  2Y6Q A;  4K5S A;  3CPJ G;  3GYI A;  1REO A;  3DJD A;  1YQ3 A;  4WX1 A;  5JCI A;  3T37 A;  1CC6 A;  5JCK A;  2J3N A;  2RGJ A;  4YTM A;  2WES A;  3CGD A;  3FG2 P;  3D1C A;  4H4P A;  3HZL A;  3CPH G;  4H4Q A;  4U2S A;  1TDE A;  4H2P A;  2BCP A;  3COX A;  4BV6 A;  2RGH A;  2DKI A;  2Q6U A;  3BI5 A;  3G5Q A;  1Q9I A;  2BK5 A;  2BCG G;  3AD9 B;  2WEU A;  1N4W A;  1IUX A;  4USR A;  1X31 B;  4APN A;  2AQJ A;  3DGH A;  4EMJ A;  4H7U A;  2WQY A;  4U8O A;  3V3N A;  4TM0 A;  2E5V A;  1CJ3 A;  3F8R A;  1ZOV A;  2BK4 A;  2YR5 A;  1GSN A;  3PS9 A;  3FIM B;  1ZX9 A;  4J56 A;  4A65 A;  3C4N A;  2CVJ A;  4BK3 A;  4Z43 A;  3NNE A;  2B7R A;  2H89 A;  3RNM A;  2B9X A;  1E1K A;  1RYI A;  3NN0 X;  4LA1 A;  2RGO A;  1V59 A;  2DKH A;  5FMH A;  4U2T A;  1IUT A;  2WPE A;  2WOV A;  3NTA A;  4FX9 A;  5IPY A;  4Z2U A;  4X9N A;  4Y4L A;  3S61 A;  3IWA A;  3UTH A;  1XHC A;  1S2Y A;  4A6N B;  3KA7 A;  4Z26 A;  3AD8 B;  3UTG A;  3GDP A;  1NHP A;  1SEZ A;  4ICY A;  2E4G A;  1LV0 A;  4Y4M A;  4RSL A;  1DOC A;  1KDG A;  3EF6 A;  2VVM A;  3KVE A;  3DK4 A;  1CJ2 A;  2VRM A;  2XCG A;  4U8P A;  3AYI A;  5KRQ A;  3ITJ A;  3JSK A;  5FS7 A;  3H4K A;  5KXJ A;  1F8R A;  1PBB A;  3G5R A;  5HYM A;  4H4X A;  2YG4 A;  3L1R A;  1GRB A;  2WU2 A;  3V76 A;  3DK8 A;  2WPF A;  4H4R A;  2VOU A;  1L0V A;  2A87 A;  1EL8 A;  3LZW A;  1S3B A;  3F8P A;  1LJ1 A;  1O95 A;  2I0Z A;  3M0O A;  4K8D A;  1TDN A;  4GF7 A;  4H2N A;  2BXR A;  1FOH A;  4JNQ A;  1GTE A;  5C2T A;  5BUL A;  4YSY A;  4CNJ A;  1NDA A;  1KSS A;  1GRE A;  4PAB A;  3LOV A;  4OPI A;  4BJY A;  4U8I A;  2Y6R A;  2R0C A;  1CF3 A;  2PHH A;  5BVA A;  2C64 A;  3AE8 A;  3H8L A;  2GAH B;  3B6D A;  2BC1 A;  2V60 A;  4J57 A;  4RG3 A;  2YAU A;  3BNM A;  3CNP A;  1VQW A;  3G5S A;  4X4J A;  1MXT A;  3QVR A;  4H2R A;  1NEN A;  4JDR A;  4XWZ A;  5J60 A;  4H4U A;  1D7L A;  4EQX A;  3CTY A;  1PXA A;  1FL2 A;  3IHG A;  1PS9 A;  3GWF A;  3PVC A;  5KVH A;  4Z25 A;  3VRD B;  3NIX A;  4CRT A;  3GD3 A;  1D7Y A;  5FS6 A;  1FEB A;  5FS9 A;  2YG3 A;  4MJW A;  4YWO A;  4RG4 A;  1IUW A;  3RHA A;  1LTX R;  1L9E A;  4A7A A;  3NKS A;  1H81 A;  2E1M A;  2FJB A;  2TPR A;  1PJ5 A;  2GR2 A;  3UOZ A;  2XFQ A;  2YQU A;  1KFY A;  1QJD A;  2OA1 A;  2WDQ A;  1OJA A;  3QFA A;  4O5Q A;  3LJP A;  4CCQ A;  5HXI A;  3AYJ A;  3AE1 A;  4B66 A;  5JCN A;  1ZP0 A;  3UTE A;  2OLO A;  3DJG X;  2WOW A;  1CJC A;  1GTH A;  2C3D A;  2A89 A;  2BS4 A;  5CKU A;  3Q9T A;  1S2Q A;  4C5O A;  2FJE A;  3CPI G;  1GT8 A;  1OJC A;  3P9U A;  3LAD A;  4NZH A;  1KF6 A;  2QA1 A;  2XVE A;  4EMI A;  3EAO A;  3UKQ A;  4USQ A;  2A8X A;  2OLN A;  5ER0 A;  5KWF A;  2ACZ A;  2OAL A;  3FMW A;  3P4P A;  3NGC X;  4Z2R A;  3BHK A;  3AE2 A;  1ONF A;  3AE7 A;  4GCM A;  1ZOY A;  3KPF A;  3GWD A;  1Y56 B;  1KSU A;  3NYC A;  1JRX A;  3AWI A;  3UKL A;  4IVM B;  4BJZ A;  1NHS A;  4CY6 A;  1QO8 A;  1KNP A;  3UKH A;  4M52 A;  1JU2 A;  2JBV A;  2O9Z A;  3R9U A;  4K22 A;  2C3C A;  1H82 A;  5HHF A;  4A99 A;  4UDP A;  2XYO A;  1GND A;  4A79 A;  4BK2 A;  2GQW A;  4EIQ A;  4EM4 A;  1FEA A;  2VVL A;  4AP1 A;  3L8K A;  2C75 A;  2XFN A;  1MOK A;  4FK1 A;  4K7Z A;  2FJD A;  4KX6 A;  1TDO A;  4U2L A;  2JAE A;  2F5Z A;  3GD4 A;  2FBW A;  4YKF A;  1GET A;  3AEE A;  3DH9 A;  2C76 A;  4U8K A;  4AP3 A;  4BUR A;  5KOX A;  4K2X A;  3DME A;  4J33 A;  2Q0L A;  4KPR A;  3ALJ A;  2BK3 A;  3CNT A;  3ATQ A;  4GRT A;  3GSI A;  2V3B A;  4TM4 A;  1E1N A;  1H7X A;  3KKJ A;  4OVI A;  3LB8 A;  1O5W A;  2WPC A;  5U25 A;  5JCL A;  1NPX A;  2X99 A;  2ZZ0 A;  3GMC A;  4A6N A;  2EQ6 A;  3KLJ A;  1W4X A;  2GV8 A;  1NAA A;  1F6M A;  1YQ4 A;  2EQ7 A;  3ISH A;  3VR9 A;  2AR8 A;  4HA6 A;  2IID A;  4AT0 A;  2XVJ A;  3Q6J A;  5CQF A;  2YG7 A;  3RED A;  1IJH A;  4UP3 A;  3QVP A;  3UOX A;  2YG5 A;  1PJ6 A;  1BKW A;  2C66 A;  4CBQ A;  1P2E A;  1TYT A;  2BA9 A;  2R0G A;  3VRB A;  5BUK A;  2WP6 A;  1E1L A;  2GVC A;  2YWL A;  5GRT A;  4DNA A;  3UKP A;  3NH3 X;  1Y0P A;  4JN9 A;  3CND A;  4EQS A;  2VZ2 A;  1ZKQ A;  2ARD A;  2Q7V A;  5IQ4 A;  3NK2 X;  2GMH A;  4TLX A;  1JNR A;  2WOI A;  3NK0 X;  4U8N A;  4U8L A;  1F8S A;  3QSM A;  4B68 A;  1RSG A;  4XWR A;  4OCG A;  2YR6 A;  2WU5 A;  2V3A A;  4A9W A;  1CJ4 A;  3EAN A;  3GMB A;  2QA2 A;  4D03 A;  3NG7 X;  4C77 A;  1D4C A;  1JRY A;  2X3N A;  1FCD A;  1NHR A;  3S5W A;  1PXB A;  1PXC A;  1LQU A;  1H7W A;  4TM3 A;  4LII A;  4ADW A;  2YM1 A;  3BHF A;  3K30 A;  3KD9 A;  4D04 A;  1LVL A;  4EQW A;  1P2H A;  3OC4 A;  2Q0K A;  1PN0 A;  4REK A;  3UP4 A;  4O5U A;  5GSN A;  2VQB A;  1TRB A;  1S3E A;  4CNK A;  1PHH A;  1N4U A;  2R4E A;  4H4Y A;  4C74 A;  1ZY8 A;  5L46 A;  3DK9 A;  2TMD A;  5EBK A;  2YVG A;  1PJ7 A;  2C72 A;  2JK6 A;  2RAB A;  1M64 A;  4JY3 A;  2R45 A;  4CY8 A;  4J36 A;  4LU6 A;  2GMJ A;  5M0Z A;  4Z2T A;  1DNC A;  1ZMD A;  4ZCD A;  1ZDL A;  1AOG A;  3LXD A;  3NN6 X;  3UOV A;  5LV9 A;  2QCU A;  3CGE A;  1DOD A;  2WS3 A;  3CNS A;  3NHO X;  2WP9 A;  1UKV G;  2GR1 A;  3IC9 A;  2YLR A;  4WCT A;  1H84 A;  3QFB A;  5U63 A;  1GES A;  4DGK A;  1YKJ A;  3UP5 A;  4YT0 A;  2X8H A;  3QJ4 A;  2B7S A;  1YY5 A;  2R46 A;  1IUS A;  3CGB A;  1EL7 A;  1GRF A;  1QLB A;  1NG4 A;  2XVF A;  2XLS A;  3AEA A;  3ALL A;  3QSS A;  3GRT A; 
#chains in the Genus database with same CATH topology
 1E7P A;  1KNR A;  5EB5 A;  1BWC A;  3AD7 B;  4UDQ A;  4J2W A;  2NPX A;  3I6D A;  4Y4N A;  3VRA A;  2X8C A;  2YR4 A;  1GXF A;  3AXB A;  3F8D A;  4OPT A;  4AOS A;  2IVE A;  2XLU A;  1CHU A;  1JOA A;  1K0I A;  3DA1 A;  3P4S A;  2BRA A;  1Y56 A;  4YTN A;  2YVF A;  3ZYX A;  4UDR A;  2C67 A;  1E39 A;  3AEB A;  4DSH A;  1GPE A;  1BF3 A;  2QAE A;  1DJN A;  2YLS A;  3SQP A;  5KNL A;  4OPD A;  1H83 A;  2YLT A;  1IUV A;  2BS2 A;  2GH5 A;  1VDC A;  4X9M A;  1Q1W A;  1PBF A;  1GAL A;  1GEU A;  1VG0 A;  3AE3 A;  3UCL A;  3UTF A;  1L9D A;  4EM3 A;  1TYP A;  2VRL A;  4FK1 C;  2ZZB A;  2IVD A;  1DOE A;  5M10 A;  2OAM A;  1CBO A;  1L9C A;  4B1B A;  2W0H A;  3AEG A;  3ICR A;  4II2 A;  4C3X A;  4EMW A;  5BRT A;  1XAN A;  5KOW A;  2XLP A;  1MO9 A;  1E1M A;  2BS3 A;  5EOW A;  2GR0 A;  3VQR A;  2FJA A;  3SXI A;  3GYJ A;  2YLX A;  1IUU A;  1O94 A;  3NTD A;  2ZZC A;  4K5R A;  4H2Q A;  4B67 A;  3AE4 A;  3WE0 A;  1OJT A;  2GAG B;  2WET A;  2NVK X;  2YLZ A;  3NT6 A;  1RP0 A;  4OPG A;  1NHQ A;  2EQ9 A;  2V61 A;  4YXD A;  1PBE A;  1Q1R A;  1EBD A;  3AEF A;  2XFP A;  1DJQ A;  4NTC A;  2GR3 A;  3QSE A;  1PDH A;  5JCM A;  2GB0 A;  2X8G A;  2B9W A;  4NTE A;  2VVL G;  4CCR A;  4B69 A;  2GF3 A;  2X50 A;  3KU9 A;  2Z5Y A;  3H8I A;  3AED A;  4JQ9 A;  1GV4 A;  5U1O A;  3BI4 A;  1HYU A;  5KMQ A;  2EQ8 A;  4EQR A;  4HB9 A;  3PO7 A;  4OPU A;  3GRS A;  3NYE A;  4GDP A;  3P1W A;  4TM1 A;  1E6E A;  1JNZ A;  2BAC A;  3M12 A;  4H4Z A;  3LZX A;  4N9X A;  1F3P A;  1NG3 A;  2JB3 A;  1EL5 A;  4IA5 A;  4IV9 A;  3DJJ A;  3SY4 A;  2R9Z A;  3AE9 A;  1CL0 A;  2AAQ A;  4TLZ A;  3RP7 A;  3CGC A;  4B65 A;  3RP8 A;  4H50 A;  3V3O A;  3ADA B;  1D5T A;  3BI2 A;  4AT2 A;  1OJD A;  2XVH A;  3UKA A;  2GEW A;  5DBJ A;  3CNJ A;  2CDU A;  4NNJ A;  1M6I A;  1JRZ A;  3UOY A;  3K7Q X;  3B3R A;  3AYL A;  2C70 A;  1GRH A;  2VQ7 A;  2XFO A;  2B9Y A;  3AE5 A;  4PAA A;  2C4C A;  2H88 A;  2JB1 A;  3NRN A;  1FEC A;  2YG6 A;  3DJE A;  4P9S A;  2GQF A;  2XLT A;  4GDE A;  2WDV A;  5J7X A;  2WBA A;  3HYX A;  3K7T A;  1JEH A;  4U8M A;  3AE6 A;  1NEK A;  5EB4 A;  3P4Q A;  4YSX A;  1VG9 A;  3NK1 X;  4G73 A;  3UKK A;  5TR3 A;  2BC0 A;  4ZN0 A;  1BGN A;  4H4S A;  3II4 A;  1N1P A;  3UKF A;  2XVI A;  4NTD A;  5C3J A;  2C65 A;  3ATR A;  4GR1 A;  4I59 A;  1K0J A;  1XDI A;  1GRT A;  3NYF A;  2CFY A;  1H6V A;  2R0P A;  3RP6 A;  1COY A;  1DOB A;  2XFU A;  4II3 A;  4ZCC A;  2C73 A;  3NLC A;  2B76 A;  4BK1 A;  3AEC A;  4NEW A;  4Z44 A;  3GYX A;  2BXS A;  4JY2 A;  4XXG A;  3BNU A;  1BGJ A;  1K0L A;  1PBC A;  5KVI A;  4I58 A;  3SZC A;  3SZF A;  1K4Q A;  4C3Y A;  1GOS A;  1ZMC A;  1B8S A;  1ZK7 A;  2XDO A;  4B64 A;  3O0H A;  4YSZ A;  1TDK A;  2APG A;  4YKG A;  2HQM A;  4OPC A;  1BZL A;  3ABV A;  3DGZ A;  5IQ1 A;  3C96 A;  1GRA A;  5HY5 A;  3VR8 A;  4J31 A;  1H86 A;  4OPL A;  3CIR A;  2UZZ A;  5KMP A;  1OJ9 A;  1Z6L A;  2JKC A;  3D8X A;  3T14 A;  2JB2 A;  3ICS A;  4GUV A;  4IVO B;  4U8J A;  4H4T A;  4ECH A;  1XPQ A;  4J34 A;  1EL9 A;  2C7G A;  4AOX A;  5KMS A;  4Z24 A;  3FBS A;  1B5Q A;  3ICT A;  1B4V A;  1CC4 A;  1LQT A;  2CUL A;  3AB1 A;  4YSH A;  4B63 A;  2V5Z A;  2V6O A;  3FPZ A;  1B37 A;  1YQZ A;  2R4J A;  3C4A A;  3OZ2 A;  3SFE A;  1CC2 A;  2YM2 A;  4YTP A;  4FDC B;  3SM8 A;  1LPF A;  1D4D A;  3P4R A;  2BAB A;  3SFD A;  3K7M X;  2PYX A;  4DSG A;  2WHD A;  3SGL A;  4NEV A;  1ELI A;  2YVJ A;  5KMR A;  2WDR A;  4E0V A;  3SYI A;  1TDF A;  2XLR A;  2ZBW A;  3EPT A;  2Z5X A;  1F8W A;  3IHM A;  4H4W A;  3E1T A;  1PBD A;  1DXL A;  3ZDN A;  1N4V A;  3I3L A;  4JNA A;  3CN8 A;  3IF9 A;  3GDN A;  3M13 A;  3URH A;  4A5L A;  1VRQ B;  2WP5 A;  1GRG A;  3ALM A;  4H4V A;  5FS8 A;  2BYB A;  2YLW A;  1D4E A;  4IA6 A;  4EIP A;  2GRT A;  1GER A;  2Y6Q A;  4K5S A;  3CPJ G;  3GYI A;  1REO A;  3DJD A;  1YQ3 A;  4WX1 A;  5JCI A;  3T37 A;  1CC6 A;  5JCK A;  2J3N A;  2RGJ A;  4YTM A;  2WES A;  3CGD A;  3FG2 P;  3D1C A;  4H4P A;  3HZL A;  3CPH G;  4H4Q A;  4U2S A;  1TDE A;  4H2P A;  2BCP A;  3COX A;  4BV6 A;  2RGH A;  2DKI A;  2Q6U A;  3BI5 A;  3G5Q A;  1Q9I A;  2BK5 A;  2BCG G;  3AD9 B;  3T2Y A;  2WEU A;  1N4W A;  1IUX A;  4USR A;  1X31 B;  4APN A;  2AQJ A;  3DGH A;  4EMJ A;  4H7U A;  2WQY A;  4U8O A;  3V3N A;  3CMM A;  4TM0 A;  2E5V A;  1CJ3 A;  2BRY A;  3F8R A;  1ZOV A;  2BK4 A;  2YR5 A;  1GSN A;  3PS9 A;  3FIM B;  1ZX9 A;  4J56 A;  4A65 A;  3C4N A;  2CVJ A;  4BK3 A;  4Z43 A;  3NNE A;  2B7R A;  2H89 A;  3RNM A;  2B9X A;  1E1K A;  1RYI A;  3NN0 X;  4LA1 A;  2RGO A;  1V59 A;  2DKH A;  5FMH A;  4U2T A;  1IUT A;  2WPE A;  2WOV A;  3NTA A;  4FX9 A;  5IPY A;  4Z2U A;  4X9N A;  4Y4L A;  3S61 A;  3IWA A;  3UTH A;  1XHC A;  1S2Y A;  3T2K A;  3HYV A;  4A6N B;  3KA7 A;  4Z26 A;  3AD8 B;  3UTG A;  3GDP A;  1NHP A;  1SEZ A;  4ICY A;  2E4G A;  1LV0 A;  3KPK A;  4RSL A;  1DOC A;  4Y4M A;  1KDG A;  3EF6 A;  2VVM A;  3KVE A;  3DK4 A;  1CJ2 A;  2VRM A;  2XCG A;  4U8P A;  3AYI A;  5KRQ A;  3ITJ A;  3JSK A;  4NWZ A;  3H4K A;  5FS7 A;  5KXJ A;  3SZ0 A;  1F8R A;  1PBB A;  3G5R A;  5HYM A;  4H4X A;  2YG4 A;  3L1R A;  1GRB A;  2WU2 A;  3V76 A;  3DK8 A;  2WPF A;  4H4R A;  2VOU A;  1L0V A;  2A87 A;  1EL8 A;  3LZW A;  1S3B A;  3F8P A;  1LJ1 A;  1O95 A;  2I0Z A;  3M0O A;  4K8D A;  1TDN A;  4GF7 A;  4H2N A;  2BXR A;  1FOH A;  4JNQ A;  1GTE A;  5C2T A;  5BUL A;  4YSY A;  4CNJ A;  1NDA A;  1KSS A;  1GRE A;  4PAB A;  3LOV A;  4G74 A;  4OPI A;  4BJY A;  4U8I A;  2Y6R A;  2R0C A;  1CF3 A;  2PHH A;  5BVA A;  2C64 A;  3AE8 A;  3H8L A;  2GAH B;  3B6D A;  2BC1 A;  2V60 A;  4GAP A;  4J57 A;  2YAU A;  3BNM A;  4RG3 A;  3CNP A;  1VQW A;  3G5S A;  4X4J A;  1MXT A;  3QVR A;  4H2R A;  1NEN A;  4JDR A;  4XWZ A;  5J60 A;  4H4U A;  1D7L A;  4EQX A;  3CTY A;  1PXA A;  1FL2 A;  3IHG A;  1PS9 A;  3GWF A;  3PVC A;  4GAV A;  4Z25 A;  3VRD B;  3NIX A;  4CRT A;  5KVH A;  3GD3 A;  1D7Y A;  5FS6 A;  1FEB A;  5FS9 A;  2YG3 A;  4MJW A;  4YWO A;  4RG4 A;  1IUW A;  3RHA A;  1LTX R;  1L9E A;  4A7A A;  3NKS A;  1H81 A;  2E1M A;  2FJB A;  2TPR A;  1PJ5 A;  2GR2 A;  3UOZ A;  2XFQ A;  2YQU A;  1KFY A;  1QJD A;  2OA1 A;  2WDQ A;  1OJA A;  3QFA A;  4G6H A;  3LJP A;  4O5Q A;  4CCQ A;  3AYJ A;  5HXI A;  3AE1 A;  4B66 A;  5JCN A;  1ZP0 A;  3UTE A;  2OLO A;  3DJG X;  2WOW A;  1CJC A;  1GTH A;  2C3D A;  2A89 A;  2BS4 A;  5CKU A;  3Q9T A;  1S2Q A;  4C5O A;  2FJE A;  3CPI G;  1GT8 A;  1OJC A;  3P9U A;  3LAD A;  4NZH A;  1KF6 A;  2QA1 A;  2XVE A;  4EMI A;  3EAO A;  3UKQ A;  4USQ A;  2A8X A;  2OLN A;  5ER0 A;  5KWF A;  2ACZ A;  2OAL A;  3FMW A;  3P4P A;  3NGC X;  4Z2R A;  3BHK A;  3AE2 A;  1ONF A;  3AE7 A;  4GCM A;  1ZOY A;  3KPF A;  3GWD A;  1Y56 B;  1KSU A;  3NYC A;  1JRX A;  3AWI A;  3T31 A;  3UKL A;  4IVM B;  4BJZ A;  1NHS A;  4CY6 A;  1QO8 A;  1KNP A;  3UKH A;  4M52 A;  1JU2 A;  2JBV A;  2O9Z A;  3R9U A;  4K22 A;  2C3C A;  1H82 A;  5HHF A;  4A99 A;  4UDP A;  2XYO A;  1GND A;  4A79 A;  4BK2 A;  2GQW A;  4EIQ A;  4EM4 A;  1FEA A;  2VVL A;  4AP1 A;  3L8K A;  2C75 A;  2XFN A;  1MOK A;  4FK1 A;  4K7Z A;  2FJD A;  4KX6 A;  1TDO A;  4U2L A;  2JAE A;  2F5Z A;  3GD4 A;  3SX6 A;  2FBW A;  3T2Z A;  4YKF A;  1GET A;  3AEE A;  3DH9 A;  2C76 A;  4U8K A;  4AP3 A;  4BUR A;  5KOX A;  4K2X A;  3DME A;  4J33 A;  2Q0L A;  4KPR A;  3ALJ A;  2BK3 A;  3CNT A;  3ATQ A;  4GRT A;  3GSI A;  2V3B A;  4TM4 A;  1E1N A;  1H7X A;  3KKJ A;  4OVI A;  3LB8 A;  1O5W A;  2WPC A;  5U25 A;  5JCL A;  1NPX A;  2X99 A;  2ZZ0 A;  3GMC A;  4A6N A;  2EQ6 A;  3KLJ A;  1W4X A;  2GV8 A;  1NAA A;  1F6M A;  1YQ4 A;  2EQ7 A;  3ISH A;  3VR9 A;  2AR8 A;  4HA6 A;  2IID A;  4AT0 A;  2XVJ A;  3Q6J A;  5CQF A;  2YG7 A;  3RED A;  1IJH A;  4UP3 A;  3QVP A;  3UOX A;  2YG5 A;  1PJ6 A;  1BKW A;  2C66 A;  4CBQ A;  1P2E A;  1TYT A;  2BA9 A;  2R0G A;  3VRB A;  5BUK A;  2WP6 A;  1E1L A;  2GVC A;  2YWL A;  5GRT A;  4DNA A;  3UKP A;  3NH3 X;  1Y0P A;  4JN9 A;  3CND A;  4EQS A;  2VZ2 A;  1ZKQ A;  2ARD A;  2Q7V A;  5IQ4 A;  3NK2 X;  2GMH A;  4TLX A;  1JNR A;  2WOI A;  3NK0 X;  4U8N A;  4U8L A;  1F8S A;  3QSM A;  4B68 A;  1RSG A;  4XWR A;  4OCG A;  2YR6 A;  2WU5 A;  2V3A A;  4A9W A;  1CJ4 A;  3EAN A;  3GMB A;  2QA2 A;  4D03 A;  3NG7 X;  4C77 A;  1D4C A;  1JRY A;  2X3N A;  1FCD A;  1NHR A;  4G9K A;  1PXB A;  1PXC A;  3S5W A;  1LQU A;  1H7W A;  4TM3 A;  4LII A;  4ADW A;  2YM1 A;  3BHF A;  3K30 A;  3KD9 A;  4D04 A;  1LVL A;  4EQW A;  1P2H A;  3OC4 A;  2Q0K A;  3T0K A;  1PN0 A;  4REK A;  3UP4 A;  4O5U A;  5GSN A;  2VQB A;  1TRB A;  1S3E A;  4CNK A;  1PHH A;  1N4U A;  2R4E A;  4H4Y A;  4C74 A;  1ZY8 A;  5L46 A;  3DK9 A;  2TMD A;  5EBK A;  2YVG A;  1PJ7 A;  2C72 A;  2JK6 A;  2RAB A;  1M64 A;  4JY3 A;  2R45 A;  4CY8 A;  4J36 A;  4LU6 A;  2GMJ A;  5M0Z A;  4Z2T A;  1DNC A;  1ZMD A;  4ZCD A;  1ZDL A;  1AOG A;  3LXD A;  3NN6 X;  3UOV A;  5LV9 A;  2QCU A;  3CGE A;  1DOD A;  2WS3 A;  3HYW A;  3CNS A;  3NHO X;  2WP9 A;  1UKV G;  2GR1 A;  3IC9 A;  2YLR A;  4WCT A;  4G6G A;  1H84 A;  3QFB A;  5U63 A;  1GES A;  4DGK A;  1YKJ A;  3UP5 A;  4YT0 A;  3SZW A;  2X8H A;  3QJ4 A;  2B7S A;  1YY5 A;  2R46 A;  1IUS A;  3CGB A;  1EL7 A;  1GRF A;  1QLB A;  1NG4 A;  2XVF A;  2XLS A;  3AEA A;  3ALL A;  3QSS A;  3GRT A; 
#chains in the Genus database with same CATH homology
 1E7P A;  1KNR A;  5EB5 A;  1BWC A;  3AD7 B;  4UDQ A;  4J2W A;  2NPX A;  3I6D A;  4Y4N A;  3VRA A;  2X8C A;  2YR4 A;  1GXF A;  3AXB A;  3F8D A;  4OPT A;  4AOS A;  2IVE A;  2XLU A;  1CHU A;  1JOA A;  1K0I A;  3DA1 A;  3P4S A;  2BRA A;  1Y56 A;  4YTN A;  2YVF A;  3ZYX A;  4UDR A;  2C67 A;  1E39 A;  3AEB A;  4DSH A;  1GPE A;  1BF3 A;  2QAE A;  1DJN A;  2YLS A;  3SQP A;  5KNL A;  4OPD A;  1H83 A;  2YLT A;  1IUV A;  2BS2 A;  2GH5 A;  1VDC A;  4X9M A;  1Q1W A;  1PBF A;  1GAL A;  1GEU A;  1VG0 A;  3AE3 A;  3UCL A;  3UTF A;  1L9D A;  4EM3 A;  1TYP A;  2VRL A;  4FK1 C;  2ZZB A;  2IVD A;  1DOE A;  5M10 A;  2OAM A;  1CBO A;  1L9C A;  4B1B A;  2W0H A;  3AEG A;  3ICR A;  4II2 A;  4C3X A;  4EMW A;  5BRT A;  1XAN A;  5KOW A;  2XLP A;  1MO9 A;  1E1M A;  2BS3 A;  5EOW A;  2GR0 A;  3VQR A;  2FJA A;  3SXI A;  3GYJ A;  2YLX A;  1IUU A;  1O94 A;  3NTD A;  2ZZC A;  4K5R A;  4H2Q A;  4B67 A;  3AE4 A;  3WE0 A;  1OJT A;  2GAG B;  2WET A;  2NVK X;  2YLZ A;  3NT6 A;  1RP0 A;  4OPG A;  1NHQ A;  2EQ9 A;  2V61 A;  4YXD A;  1PBE A;  1Q1R A;  1EBD A;  3AEF A;  2XFP A;  1DJQ A;  4NTC A;  2GR3 A;  3QSE A;  1PDH A;  5JCM A;  2GB0 A;  2X8G A;  2B9W A;  4NTE A;  2VVL G;  4CCR A;  4B69 A;  2GF3 A;  2X50 A;  3KU9 A;  2Z5Y A;  3H8I A;  3AED A;  4JQ9 A;  1GV4 A;  5U1O A;  3BI4 A;  1HYU A;  5KMQ A;  2EQ8 A;  4EQR A;  4HB9 A;  3PO7 A;  4OPU A;  3GRS A;  3NYE A;  4GDP A;  3P1W A;  4TM1 A;  1E6E A;  1JNZ A;  2BAC A;  3M12 A;  4H4Z A;  3LZX A;  4N9X A;  1F3P A;  1NG3 A;  2JB3 A;  1EL5 A;  4IA5 A;  4IV9 A;  3DJJ A;  3SY4 A;  2R9Z A;  3AE9 A;  1CL0 A;  2AAQ A;  4TLZ A;  3RP7 A;  3CGC A;  4B65 A;  3RP8 A;  4H50 A;  3V3O A;  3ADA B;  1D5T A;  3BI2 A;  4AT2 A;  1OJD A;  2XVH A;  3UKA A;  2GEW A;  5DBJ A;  3CNJ A;  2CDU A;  4NNJ A;  1M6I A;  1JRZ A;  3UOY A;  3K7Q X;  3B3R A;  3AYL A;  2C70 A;  1GRH A;  2VQ7 A;  2XFO A;  2B9Y A;  3AE5 A;  4PAA A;  2C4C A;  2H88 A;  2JB1 A;  3NRN A;  1FEC A;  2YG6 A;  3DJE A;  4P9S A;  2GQF A;  2XLT A;  4GDE A;  2WDV A;  5J7X A;  2WBA A;  3HYX A;  3K7T A;  1JEH A;  4U8M A;  3AE6 A;  1NEK A;  5EB4 A;  3P4Q A;  4YSX A;  1VG9 A;  3NK1 X;  4G73 A;  3UKK A;  5TR3 A;  2BC0 A;  4ZN0 A;  1BGN A;  4H4S A;  3II4 A;  1N1P A;  3UKF A;  2XVI A;  4NTD A;  5C3J A;  2C65 A;  3ATR A;  4GR1 A;  4I59 A;  1K0J A;  1XDI A;  1GRT A;  3NYF A;  2CFY A;  1H6V A;  2R0P A;  3RP6 A;  1COY A;  1DOB A;  2XFU A;  4II3 A;  4ZCC A;  2C73 A;  3NLC A;  2B76 A;  4BK1 A;  3AEC A;  4NEW A;  4Z44 A;  3GYX A;  2BXS A;  4JY2 A;  4XXG A;  3BNU A;  1BGJ A;  1K0L A;  1PBC A;  5KVI A;  4I58 A;  3SZC A;  3SZF A;  1K4Q A;  4C3Y A;  1GOS A;  1ZMC A;  1B8S A;  1ZK7 A;  2XDO A;  4B64 A;  3O0H A;  4YSZ A;  1TDK A;  2APG A;  4YKG A;  2HQM A;  4OPC A;  1BZL A;  3ABV A;  3DGZ A;  5IQ1 A;  3C96 A;  1GRA A;  5HY5 A;  3VR8 A;  4J31 A;  1H86 A;  4OPL A;  3CIR A;  2UZZ A;  5KMP A;  1OJ9 A;  1Z6L A;  2JKC A;  3D8X A;  3T14 A;  2JB2 A;  3ICS A;  4GUV A;  4IVO B;  4U8J A;  4H4T A;  4ECH A;  1XPQ A;  4J34 A;  1EL9 A;  2C7G A;  4AOX A;  5KMS A;  4Z24 A;  3FBS A;  1B5Q A;  3ICT A;  1B4V A;  1CC4 A;  1LQT A;  2CUL A;  3AB1 A;  4YSH A;  4B63 A;  2V5Z A;  2V6O A;  3FPZ A;  1B37 A;  1YQZ A;  2R4J A;  3C4A A;  3OZ2 A;  3SFE A;  1CC2 A;  2YM2 A;  4YTP A;  4FDC B;  3SM8 A;  1LPF A;  1D4D A;  3P4R A;  2BAB A;  3SFD A;  3K7M X;  2PYX A;  4DSG A;  2WHD A;  3SGL A;  4NEV A;  1ELI A;  2YVJ A;  5KMR A;  2WDR A;  4E0V A;  3SYI A;  1TDF A;  2XLR A;  2ZBW A;  3EPT A;  2Z5X A;  1F8W A;  3IHM A;  4H4W A;  3E1T A;  1PBD A;  1DXL A;  3ZDN A;  1N4V A;  3I3L A;  4JNA A;  3CN8 A;  3IF9 A;  3GDN A;  3M13 A;  3URH A;  4A5L A;  1VRQ B;  2WP5 A;  1GRG A;  3ALM A;  4H4V A;  5FS8 A;  2BYB A;  2YLW A;  1D4E A;  4IA6 A;  4EIP A;  2GRT A;  1GER A;  2Y6Q A;  4K5S A;  3CPJ G;  3GYI A;  1REO A;  3DJD A;  1YQ3 A;  4WX1 A;  5JCI A;  3T37 A;  1CC6 A;  5JCK A;  2J3N A;  2RGJ A;  4YTM A;  2WES A;  3CGD A;  3FG2 P;  3D1C A;  4H4P A;  3HZL A;  3CPH G;  4H4Q A;  4U2S A;  1TDE A;  4H2P A;  2BCP A;  3COX A;  4BV6 A;  2RGH A;  2DKI A;  2Q6U A;  3BI5 A;  3G5Q A;  1Q9I A;  2BK5 A;  2BCG G;  3AD9 B;  3T2Y A;  2WEU A;  1N4W A;  1IUX A;  4USR A;  1X31 B;  4APN A;  2AQJ A;  3DGH A;  4EMJ A;  4H7U A;  2WQY A;  4U8O A;  3V3N A;  3CMM A;  4TM0 A;  2E5V A;  1CJ3 A;  2BRY A;  3F8R A;  1ZOV A;  2BK4 A;  2YR5 A;  1GSN A;  3PS9 A;  3FIM B;  1ZX9 A;  4J56 A;  4A65 A;  3C4N A;  2CVJ A;  4BK3 A;  4Z43 A;  3NNE A;  2B7R A;  2H89 A;  3RNM A;  2B9X A;  1E1K A;  1RYI A;  3NN0 X;  4LA1 A;  2RGO A;  1V59 A;  2DKH A;  5FMH A;  4U2T A;  1IUT A;  2WPE A;  2WOV A;  3NTA A;  4FX9 A;  5IPY A;  4Z2U A;  4X9N A;  4Y4L A;  3S61 A;  3IWA A;  3UTH A;  1XHC A;  1S2Y A;  3T2K A;  3HYV A;  4A6N B;  3KA7 A;  4Z26 A;  3AD8 B;  3UTG A;  3GDP A;  1NHP A;  1SEZ A;  4ICY A;  2E4G A;  1LV0 A;  3KPK A;  4RSL A;  1DOC A;  4Y4M A;  1KDG A;  3EF6 A;  2VVM A;  3KVE A;  3DK4 A;  1CJ2 A;  2VRM A;  2XCG A;  4U8P A;  3AYI A;  5KRQ A;  3ITJ A;  3JSK A;  4NWZ A;  3H4K A;  5FS7 A;  5KXJ A;  3SZ0 A;  1F8R A;  1PBB A;  3G5R A;  5HYM A;  4H4X A;  2YG4 A;  3L1R A;  1GRB A;  2WU2 A;  3V76 A;  3DK8 A;  2WPF A;  4H4R A;  2VOU A;  1L0V A;  2A87 A;  1EL8 A;  3LZW A;  1S3B A;  3F8P A;  1LJ1 A;  1O95 A;  2I0Z A;  3M0O A;  4K8D A;  1TDN A;  4GF7 A;  4H2N A;  2BXR A;  1FOH A;  4JNQ A;  1GTE A;  5C2T A;  5BUL A;  4YSY A;  4CNJ A;  1NDA A;  1KSS A;  1GRE A;  4PAB A;  3LOV A;  4G74 A;  4OPI A;  4BJY A;  4U8I A;  2Y6R A;  2R0C A;  1CF3 A;  2PHH A;  5BVA A;  2C64 A;  3AE8 A;  3H8L A;  2GAH B;  3B6D A;  2BC1 A;  2V60 A;  4GAP A;  4J57 A;  2YAU A;  3BNM A;  4RG3 A;  3CNP A;  1VQW A;  3G5S A;  4X4J A;  1MXT A;  3QVR A;  4H2R A;  1NEN A;  4JDR A;  4XWZ A;  5J60 A;  4H4U A;  1D7L A;  4EQX A;  3CTY A;  1PXA A;  1FL2 A;  3IHG A;  1PS9 A;  3GWF A;  3PVC A;  4GAV A;  4Z25 A;  3VRD B;  3NIX A;  4CRT A;  5KVH A;  3GD3 A;  1D7Y A;  5FS6 A;  1FEB A;  5FS9 A;  2YG3 A;  4MJW A;  4YWO A;  4RG4 A;  1IUW A;  3RHA A;  1LTX R;  1L9E A;  4A7A A;  3NKS A;  1H81 A;  2E1M A;  2FJB A;  2TPR A;  1PJ5 A;  2GR2 A;  3UOZ A;  2XFQ A;  2YQU A;  1KFY A;  1QJD A;  2OA1 A;  2WDQ A;  1OJA A;  3QFA A;  4G6H A;  3LJP A;  4O5Q A;  4CCQ A;  3AYJ A;  5HXI A;  3AE1 A;  4B66 A;  5JCN A;  1ZP0 A;  3UTE A;  2OLO A;  3DJG X;  2WOW A;  1CJC A;  1GTH A;  2C3D A;  2A89 A;  2BS4 A;  5CKU A;  3Q9T A;  1S2Q A;  4C5O A;  2FJE A;  3CPI G;  1GT8 A;  1OJC A;  3P9U A;  3LAD A;  4NZH A;  1KF6 A;  2QA1 A;  2XVE A;  4EMI A;  3EAO A;  3UKQ A;  4USQ A;  2A8X A;  2OLN A;  5ER0 A;  5KWF A;  2ACZ A;  2OAL A;  3FMW A;  3P4P A;  3NGC X;  4Z2R A;  3BHK A;  3AE2 A;  1ONF A;  3AE7 A;  4GCM A;  1ZOY A;  3KPF A;  3GWD A;  1Y56 B;  1KSU A;  3NYC A;  1JRX A;  3AWI A;  3T31 A;  3UKL A;  4IVM B;  4BJZ A;  1NHS A;  4CY6 A;  1QO8 A;  1KNP A;  3UKH A;  4M52 A;  1JU2 A;  2JBV A;  2O9Z A;  3R9U A;  4K22 A;  2C3C A;  1H82 A;  5HHF A;  4A99 A;  4UDP A;  2XYO A;  1GND A;  4A79 A;  4BK2 A;  2GQW A;  4EIQ A;  4EM4 A;  1FEA A;  2VVL A;  4AP1 A;  3L8K A;  2C75 A;  2XFN A;  1MOK A;  4FK1 A;  4K7Z A;  2FJD A;  4KX6 A;  1TDO A;  4U2L A;  2JAE A;  2F5Z A;  3GD4 A;  3SX6 A;  2FBW A;  3T2Z A;  4YKF A;  1GET A;  3AEE A;  3DH9 A;  2C76 A;  4U8K A;  4AP3 A;  4BUR A;  5KOX A;  4K2X A;  3DME A;  4J33 A;  2Q0L A;  4KPR A;  3ALJ A;  2BK3 A;  3CNT A;  3ATQ A;  4GRT A;  3GSI A;  2V3B A;  4TM4 A;  1E1N A;  1H7X A;  3KKJ A;  4OVI A;  3LB8 A;  1O5W A;  2WPC A;  5U25 A;  5JCL A;  1NPX A;  2X99 A;  2ZZ0 A;  3GMC A;  4A6N A;  2EQ6 A;  3KLJ A;  1W4X A;  2GV8 A;  1NAA A;  1F6M A;  1YQ4 A;  2EQ7 A;  3ISH A;  3VR9 A;  2AR8 A;  4HA6 A;  2IID A;  4AT0 A;  2XVJ A;  3Q6J A;  5CQF A;  2YG7 A;  3RED A;  1IJH A;  4UP3 A;  3QVP A;  3UOX A;  2YG5 A;  1PJ6 A;  1BKW A;  2C66 A;  4CBQ A;  1P2E A;  1TYT A;  2BA9 A;  2R0G A;  3VRB A;  5BUK A;  2WP6 A;  1E1L A;  2GVC A;  2YWL A;  5GRT A;  4DNA A;  3UKP A;  3NH3 X;  1Y0P A;  4JN9 A;  3CND A;  4EQS A;  2VZ2 A;  1ZKQ A;  2ARD A;  2Q7V A;  5IQ4 A;  3NK2 X;  2GMH A;  4TLX A;  1JNR A;  2WOI A;  3NK0 X;  4U8N A;  4U8L A;  1F8S A;  3QSM A;  4B68 A;  1RSG A;  4XWR A;  4OCG A;  2YR6 A;  2WU5 A;  2V3A A;  4A9W A;  1CJ4 A;  3EAN A;  3GMB A;  2QA2 A;  4D03 A;  3NG7 X;  4C77 A;  1D4C A;  1JRY A;  2X3N A;  1FCD A;  1NHR A;  4G9K A;  1PXB A;  1PXC A;  3S5W A;  1LQU A;  1H7W A;  4TM3 A;  4LII A;  4ADW A;  2YM1 A;  3BHF A;  3K30 A;  3KD9 A;  4D04 A;  1LVL A;  4EQW A;  1P2H A;  3OC4 A;  2Q0K A;  3T0K A;  1PN0 A;  4REK A;  3UP4 A;  4O5U A;  5GSN A;  2VQB A;  1TRB A;  1S3E A;  4CNK A;  1PHH A;  1N4U A;  2R4E A;  4H4Y A;  4C74 A;  1ZY8 A;  5L46 A;  3DK9 A;  2TMD A;  5EBK A;  2YVG A;  1PJ7 A;  2C72 A;  2JK6 A;  2RAB A;  1M64 A;  4JY3 A;  2R45 A;  4CY8 A;  4J36 A;  4LU6 A;  2GMJ A;  5M0Z A;  4Z2T A;  1DNC A;  1ZMD A;  4ZCD A;  1ZDL A;  1AOG A;  3LXD A;  3NN6 X;  3UOV A;  5LV9 A;  2QCU A;  3CGE A;  1DOD A;  2WS3 A;  3HYW A;  3CNS A;  3NHO X;  2WP9 A;  1UKV G;  2GR1 A;  3IC9 A;  2YLR A;  4WCT A;  4G6G A;  1H84 A;  3QFB A;  5U63 A;  1GES A;  4DGK A;  1YKJ A;  3UP5 A;  4YT0 A;  3SZW A;  2X8H A;  3QJ4 A;  2B7S A;  1YY5 A;  2R46 A;  1IUS A;  3CGB A;  1EL7 A;  1GRF A;  1QLB A;  1NG4 A;  2XVF A;  2XLS A;  3AEA A;  3ALL A;  3QSS A;  3GRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...