3NGCX

Complex of 6-hydroxy-l-nicotine oxidase with intermediate methylmyosmine product formed during catalytic turnover
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 146
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ngcX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3ngcX02
3GYJA 4KPRA 3RP6A 1CBOA 2C64A 3IHGA 2BXRA 2WOIA 1NAAA 1GPEA 3LADA 1VDCA 3OC4A 4B67A 2ZZ0A 3QJ4A 3BNUA 2EQ7A 2OAMA 4H50A 2CULA 5CQFA 4C77A 3CGCA 3URHA 4TM3A 2VZ2A 3QFAA 1KF6A 5DBJA 2VOUA 5KOWA 2C67A 3UOZA 4YKGA 2ACZA 3ADAB 1NEKA 3COXA 3P4RA 4GCMA 1ZKQA 1EL8A 1NDAA 2BK5A 3NNEA 4PAAA 2XFNA 3DGHA 2WPCA 5HYMA 4Z44A 2UZZA 1GRGA 2C76A 4RG4A 3UKQA 1TDKA 1TDEA 4XXGA 5HXIA 3UTFA 4YXDA 2FJBA 2RABA 1B37A 1TYTA 3AYJA 3NH3X 4OPTA 3NTDA 1EBDA 2AQJA 1IUUA 2CFYA 4JY2A 1LQUA 3ICTA 4C5OA 2C72A 3ISHA 4EQXA 4CNKA 1LTXR 1IUWA 1L9CA 3GD3A 4CY6A 2YG7A 1IUXA 1TYPA 2FJDA 1PJ5A 4RG3A 3Q9TA 1FECA 4K8DA 1ZP0A 1IUSA 2APGA 1M64A 4LA1A 3P4SA 4JY3A 3G5RA 4CCRA 1CJ3A 1OJDA 4H2PA 4J34A 1ZDLA 3DK9A 4K5SA 1GEUA 1GSNA 4CRTA 4M52A 2XLPA 5KXJA 2GMJA 4O5UA 4TM1A 2FJAA 3UKPA 2TPRA 3GRSA 3P4PA 2XVIA 1GALA 4CY8A 3M13A 2YVGA 3G5QA 3QVRA 4FX9A 4TLXA 4JDRA 3CNJA 3AYLA 1Y56A 1H82A 2B9YA 2BCGG 1E1MA 3UOVA 3ALMA 1H84A 4NTEA 2YLRA 3UTHA 3AEEA 3CPIG 1K0JA 1QO8A 4A6NA 3PO7A 4X9NA 2WEUA 3NHOX 2WDQA 3EPTA 4U8KA 4J33A 3DJDA 2JB3A 1B4VA 1H7XA 4UDRA 4GRTA 1FEAA 4HB9A 4A9WA 1IUTA 2GR3A 3AE4A 2B9WA 5EOWA 1PDHA 5FS6A 4D03A 3I3LA 2R0GA 1GERA 4YT0A 3AE9A 2ARDA 3VRBA 2GR2A 4FK1A 4KX6A 3RNMA 3ITJA 2BCPA 3ZDNA 5BUKA 2VRMA 2WPFA 2C3CA 2XYOA 1KDGA 1DJNA 4IVOB 1PBEA 2GRTA 4IVMB 3CNDA 1N4WA 3ZYXA 4FDCB 5C3JA 4H4UA 4NZHA 4OPLA 1JOAA 2YLTA 4Z26A 2BACA 1E1KA 4OPUA 1CJ2A 1D7LA 4GDPA 3KPFA 3NLCA 4GDEA 4YWOA 3GYIA 2QA2A 3H8IA 1KSSA 4ZCDA 4Z24A 1L9DA 4U8NA 4AOXA 2R45A 2NVKX 1CJCA 3BNMA 2ZBWA 1CF3A 3DGZA 4H4VA 3UOXA 4WCTA 5LV9A 2A89A 3FIMB 2F5ZA 2VVLG 2Y6RA 1N4UA 1DODA 4B64A 2Y6QA 2Q0LA 4OPIA 3UKAA 2WP9A 4OCGA 3BI5A 1H86A 2WU2A 3ALJA 1F8SA 4BURA 3II4A 3SM8A 3BI4A 3V3NA 2BABA 2W0HA 2YVFA 3V3OA 1PS9A 4B65A 4B69A 1GV4A 2B7RA 2V60A 4H2QA 1IJHA 1JNRA 3REDA 2R4EA 4PABA 3I6DA 3OZ2A 1GNDA 1E1NA 4A65A 5BULA 1CL0A 2GAGB 2E1MA 5FMHA 1V59A 1BGJA 2TMDA 1RP0A 3CNTA 1O94A 5JCLA 5EBKA 4YTNA 3NK1X 1GRTA 4OPGA 3CGEA 4BK2A 3GMBA 5GRTA 1NHSA 1D4EA 1BZLA 1JNZA 1B5QA 1M6IA 2CVJA 3C4AA 1K0IA 3QVPA 1ZMCA 2YM1A 3NKSA 3DMEA 1E6EA 1PBBA 2C3DA 1YQ3A 1CC6A 2YM2A 2V61A 2WPEA 3FG2P 4U8MA 1ZK7A 3AB1A 3IWAA 4IA5A 4Y4MA 3B6DA 4B68A 2XDOA 4DSGA 4I58A 3ABVA 1LQTA 2Q6UA 4EQWA 1OJCA 4B63A 3EANA 3BHFA 4TLZA 5KWFA 3M12A 2X3NA 2R9ZA 2BC1A 2R0PA 2WQYA 5JCNA 2C75A 4XWRA 1FL2A 1JRYA 1DJQA 1TDOA 2YG5A 3AEBA 2V6OA 1LVLA 1JU2A 2XVJA 3LOVA 2JK6A 3NN6X 2BC0A 5FS9A 1DOCA 2Q7VA 2WU5A 4OPDA 3P4QA 1PN0A 1Q9IA 2X8HA 1DNCA 3F8PA 5HHFA 2E4GA 3GWFA 2O9ZA 2C73A 3VRDB 2NPXA 4H4RA 4ECHA 3AEAA 4GR1A 1NHRA 3AXBA 2OA1A 4YTMA 5J7XA 2R4JA 2H88A 4EM3A 2BS3A 1CC4A 1DOBA 2FBWA 2XVFA 4I59A 3SFDA 2J3NA 2V3BA 4K7ZA 1RYIA 2XLSA 3FMWA 4U8OA 3IF9A 4A79A 2WHDA 4A7AA 4C3XA 2V5ZA 3AE7A 1N1PA 4USRA 4GF7A 4RSLA 4B1BA 3H8LA 4YSZA 3NYFA 1COYA 2QCUA 3AEFA 1REOA 2X8CA 2HQMA 4J31A 5U1OA 1S3BA 4OVIA 1H81A 4U2TA 4H4TA 4YKFA 1B8SA 3NG7X 3EAOA 2YAUA 2X8GA 2DKIA 3K30A 1K0LA 1GTEA 5IQ4A 2RGHA 1GETA 2GH5A 3NN0X 3VR9A 1P2HA 1YY5A 2C65A 4JQ9A 5IQ1A 2QA1A 3GD4A 4AP3A 2EQ8A 3WE0A 4U8PA 5KVHA 1NG4A 2OLNA 4APNA 2YR6A 1PJ7A 1XHCA 5KRQA 3ICSA 3LJPA 1ZMDA 3NYCA 2GQFA 4MJWA 2OALA 4X4JA 3NRNA 3NTAA 4JNQA 2BS2A 1XPQA 2BS4A 3JSKA 1ELIA 1TDFA 2ZZCA 3PS9A 1L0VA 1BGNA 2IIDA 2YG3A 5U63A 3F8DA 1PXAA 2R46A 2GVCA 4K22A 2WOWA 3NK2X 1NPXA 1GRHA 5IPYA 5M10A 5EB4A 1PXBA 1MOKA 3E1TA 2XFPA 1CJ4A 1X31B 2WDRA 1GTHA 2JB2A 4K5RA 3NGCX 2YR5A 3CNPA 1GXFA 1W4XA 3DH9A 4YTPA 1JRZA 3B3RA 3DA1A 1S2QA 4EMIA 4WX1A 2PYXA 3SGLA 3UKHA 3CIRA 3UKLA 2XFOA 4AP1A 4CCQA 4LU6A 1CC2A 1Q1WA 4Z2UA 1F8RA 2WESA 1VQWA 2WDVA 4EQRA 2XFQA 3DJGX 2YVJA 5CKUA 3K7QX 1XANA 3NK0X 4EIQA 3VQRA 1QJDA 4BJZA 3DK4A 2GQWA 1O95A 3RP7A 1GESA 1OJTA 1GRBA 3CTYA 3ATQA 1DXLA 4H4SA 2YLSA 3BI2A 2I0ZA 2RGJA 5BVAA 4H7UA 3S5WA 4DNAA 5KOXA 1CHUA 2WP6A 3UTGA 3UP5A 1GOSA 1TDNA 2JAEA 4UDQA 4USQA 1E1LA 2VRLA 2PHHA 3LZXA 3RHAA 4C3YA 3IC9A 1F3PA 1S3EA 2XVEA 3AE3A 2DKHA 1VRQB 4GUVA 3Q6JA 1PBFA 1LV0A 3G5SA 2YLZA 3AWIA 1E7PA 2YG4A 2QAEA 4U8LA 1D4CA 4XWZA 2JBVA 4EMWA 2VQBA 3C96A 3K7TA 3QSEA 3LZWA 1L9EA 2OLOA 1D7YA 3P9UA 5FS8A 1LPFA 2XLRA 3FPZA 2CDUA 4IA6A 3KD9A 4AT0A 1UKVG 3GDPA 4YSYA 2GR0A 1GT8A 3UTEA 4BJYA 1VG0A 1FEBA 3DJEA 2X99A 5KVIA 3BHKA 4U8JA 3VRAA 1YQZA 3AE6A 4N9XA 2EQ9A 2Q0KA 1KFYA 3FBSA 1H7WA 2WBAA 5FS7A 3T37A 1PHHA 3AYIA 1P2EA 1TRBA 2C66A 4U8IA 3QSMA 2B7SA 4J2WA 4EM4A 2Z5XA 1NHQA 2A87A 1XDIA 3AE1A 1YQ4A 3CGBA 4YSHA 3AD7B 5GSNA 4D04A 4Z2RA 4CNJA 4J57A 3O0HA 1JEHA 1ZX9A 3ATRA 2BA9A 2GAHB 4A5LA 4AOSA 2GEWA 4BK1A 1Y0PA 1ZOVA 2VQ7A 3GRTA 1BF3A 2IVEA 2YG6A 3P1WA 3GMCA 3AE2A 2GV8A 4ICYA 4Y4NA 3UP4A 4BV6A 4C74A 1VG9A 1SEZA 1NENA 5JCIA 1NG3A 2BK4A 2JKCA 4NTCA 1ZY8A 4ADWA 3CPJG 1GRAA 3EF6A 3K7MX 1FCDA 4IV9A 4REKA 4Y4LA 4EQSA 1EL5A 1E39A 3DJJA 2R0CA 3GWDA 1F6MA 3M0OA 5U25A 3SQPA 3UKKA 2XFUA 4JN9A 2GMHA 1MO9A 4LIIA 4X9MA 1FOHA 2WETA 4EIPA 1QLBA 4H2RA 4TM4A 1DOEA 3H4KA 2ZZBA 3KA7A 1OJAA 1Q1RA 3CPHG 2RGOA 2YR4A 3UOYA 4Z25A 3D8XA 4NEWA 5TR3A 4ZCCA 4BK3A 3R9UA 3AE8A 4UDPA 3QFBA 4H2NA 2WP5A 2AAQA 4H4QA 3AD9B 3VR8A 2GF3A 3AECA 3CN8A 2VVMA 3NYEA 3UCLA 1KNRA 1BKWA 4H4ZA 1OJ9A 1YKJA 3ICRA 4TM0A 1HYUA 4K2XA 3S61A 4AT2A 1EL7A 4HA6A 2B76A 4DSHA 5BRTA 3AEGA 2BYBA 5ER0A 4FK1C 1ONFA 1IUVA 3CGDA 4J36A 3UKFA 1PXCA 2XLTA 4A99A 4B66A 1D4DA 1F8WA 3AEDA 3AE5A 3SFEA 3NT6A 4Z43A 2YWLA 5L46A 1D5TA 1KNPA 2EQ6A 3IHMA 2A8XA 4H4PA 1LJ1A 1EL9A 3C4NA 4YSXA 2C7GA 4J56A 2GB0A 3AD8B 4ZN0A 4JNAA 5JCKA 1NHPA 3D1CA 1BWCA 1RSGA 2IVDA 1KSUA 2XVHA 5HY5A 4NTDA 2JB1A 4CBQA 4Z2TA 2C70A 4NEVA 4DGKA 3LB8A 1ZOYA 4U2SA 2YQUA 3DK8A 2WOVA 3HZLA 1N4VA 1O5WA 3GSIA 3CNSA 3L1RA 5C2TA 1GREA 2BXSA 3NIXA 4H4XA 5JCMA 4EMJA 2YLWA 2X50A 3KU9A 3KVEA 5J60A 4H4YA 5M0ZA 2GR1A 3RP8A 2H89A 1PBDA 2WS3A 2B9XA 1JRXA 2Z5YA 1H6VA 1MXTA 3PVCA 3V76A 4P9SA 1PJ6A 3GDNA 3LXDA 1K4QA 1Y56B 2E5VA 1PBCA 2XCGA 4UP3A 2AR8A 2BK3A 1AOGA 1Z6LA 4U2LA 2FJEA 4A6NB 2VVLA 3KLJA 4O5QA 2YLXA 3L8KA 1S2YA 2XLUA 3ALLA 3KKJA 2V3AA 1H83A 5EB5A 3F8RA 3QSSA 1GRFA 4E0VA 4H4WA 4OPCA
chains in the Genus database with same CATH superfamily
3GYJA 4KPRA 3RP6A 1CBOA 2C64A 3IHGA 2BXRA 2WOIA 1NAAA 1GPEA 3LADA 1VDCA 3OC4A 4B67A 2ZZ0A 3QJ4A 3BNUA 2EQ7A 2OAMA 4H50A 2CULA 5CQFA 4C77A 3CGCA 3URHA 4TM3A 2VZ2A 3QFAA 1KF6A 5DBJA 2VOUA 5KOWA 2C67A 3UOZA 4YKGA 2ACZA 3ADAB 1NEKA 3COXA 3P4RA 4GCMA 1ZKQA 1EL8A 1NDAA 2BK5A 3NNEA 4PAAA 2XFNA 3DGHA 2WPCA 5HYMA 4Z44A 2UZZA 1GRGA 2C76A 4RG4A 3UKQA 1TDKA 1TDEA 3CMMA 4XXGA 5HXIA 3UTFA 4YXDA 2FJBA 2RABA 1B37A 1TYTA 3AYJA 3NH3X 4G74A 4OPTA 3NTDA 1EBDA 2AQJA 1IUUA 2CFYA 4JY2A 1LQUA 3ICTA 4C5OA 2C72A 3ISHA 4EQXA 4CNKA 1LTXR 4NNJA 1IUWA 1L9CA 3GD3A 4CY6A 2YG7A 1IUXA 1TYPA 2FJDA 1PJ5A 4RG3A 3Q9TA 1FECA 4K8DA 1ZP0A 1IUSA 2APGA 1M64A 4LA1A 3P4SA 4JY3A 3G5RA 4CCRA 1CJ3A 1OJDA 4H2PA 4J34A 1ZDLA 3DK9A 4K5SA 1GEUA 1GSNA 4CRTA 4M52A 2XLPA 5KXJA 2GMJA 4O5UA 4TM1A 2FJAA 3UKPA 2TPRA 3GRSA 3P4PA 2XVIA 1GALA 4CY8A 3M13A 2YVGA 3G5QA 3QVRA 4FX9A 4TLXA 4JDRA 3CNJA 3AYLA 1Y56A 1H82A 2B9YA 2BCGG 4II3A 1E1MA 3UOVA 3ALMA 1H84A 4NTEA 2YLRA 3UTHA 3AEEA 3CPIG 1K0JA 1QO8A 4GAVA 4A6NA 3PO7A 4X9NA 2WEUA 3NHOX 2WDQA 3EPTA 4U8KA 4J33A 3DJDA 2JB3A 1B4VA 1H7XA 4UDRA 4GRTA 1FEAA 4HB9A 4A9WA 1IUTA 2GR3A 3AE4A 2B9WA 5EOWA 1PDHA 5FS6A 4D03A 3I3LA 4G9KA 2R0GA 1GERA 4YT0A 3AE9A 2ARDA 3VRBA 2GR2A 4FK1A 4KX6A 3RNMA 3ITJA 2BCPA 5KMSA 3ZDNA 5BUKA 2VRMA 2WPFA 4G6HA 2C3CA 2XYOA 1KDGA 1DJNA 4IVOB 1PBEA 2GRTA 4IVMB 3CNDA 1N4WA 3ZYXA 4FDCB 5C3JA 4H4UA 4NZHA 4OPLA 1JOAA 2YLTA 4Z26A 2BACA 1E1KA 4OPUA 1CJ2A 1D7LA 3HYXA 4GDPA 3KPFA 5KMQA 3NLCA 4GDEA 4YWOA 3GYIA 2QA2A 3H8IA 1KSSA 4ZCDA 4Z24A 1L9DA 4U8NA 4AOXA 3T31A 2R45A 2NVKX 1CJCA 3BNMA 2ZBWA 1CF3A 3DGZA 4H4VA 3UOXA 4WCTA 5LV9A 2A89A 3FIMB 2F5ZA 2VVLG 2Y6RA 1N4UA 3T14A 1DODA 4B64A 2Y6QA 2Q0LA 4OPIA 3UKAA 2WP9A 4OCGA 3BI5A 1H86A 2WU2A 3ALJA 1F8SA 4BURA 3II4A 3SM8A 3BI4A 3V3NA 2BABA 2W0HA 2YVFA 3V3OA 1PS9A 4B65A 4B69A 1GV4A 2B7RA 2V60A 4H2QA 1IJHA 1JNRA 3REDA 2R4EA 4PABA 3T2YA 3I6DA 3OZ2A 1GNDA 1E1NA 4A65A 5BULA 1CL0A 2GAGB 2E1MA 5FMHA 1V59A 1BGJA 2TMDA 1RP0A 3CNTA 1O94A 5JCLA 5EBKA 4YTNA 3NK1X 1GRTA 4OPGA 3CGEA 4BK2A 3GMBA 5GRTA 1NHSA 1D4EA 1BZLA 1JNZA 1B5QA 1M6IA 5KMRA 2CVJA 3C4AA 1K0IA 3QVPA 1ZMCA 2YM1A 3NKSA 3DMEA 1E6EA 1PBBA 2C3DA 1YQ3A 1CC6A 2YM2A 2V61A 2WPEA 3FG2P 4U8MA 1ZK7A 3AB1A 3IWAA 4IA5A 4Y4MA 3B6DA 4B68A 2XDOA 4DSGA 4I58A 3ABVA 1LQTA 2Q6UA 4EQWA 1OJCA 4B63A 3EANA 3BHFA 4TLZA 5KWFA 3M12A 4GAPA 2X3NA 2R9ZA 2BC1A 2R0PA 2WQYA 5JCNA 2C75A 4XWRA 1FL2A 1JRYA 1DJQA 3T0KA 1TDOA 2YG5A 3AEBA 2V6OA 1LVLA 1JU2A 2XVJA 3LOVA 2JK6A 3NN6X 2BC0A 5FS9A 1DOCA 2Q7VA 2WU5A 4OPDA 3P4QA 1PN0A 1Q9IA 2X8HA 1DNCA 3F8PA 5HHFA 2E4GA 3GWFA 2O9ZA 2C73A 3VRDB 2NPXA 4H4RA 3SZ0A 3AEAA 4ECHA 4GR1A 1NHRA 3AXBA 2OA1A 4YTMA 5J7XA 2R4JA 2H88A 4EM3A 3SY4A 2BS3A 1CC4A 1DOBA 2FBWA 2XVFA 4I59A 3SFDA 2J3NA 2V3BA 4K7ZA 3HYVA 1RYIA 2XLSA 3FMWA 4U8OA 3IF9A 4A79A 2WHDA 4A7AA 4C3XA 2V5ZA 3AE7A 1N1PA 4USRA 4GF7A 4G6GA 4RSLA 4B1BA 3H8LA 4YSZA 3NYFA 1COYA 2QCUA 3AEFA 1REOA 2X8CA 2HQMA 4J31A 5U1OA 1S3BA 5KNLA 4OVIA 1H81A 4U2TA 4H4TA 4YKFA 1B8SA 3NG7X 3EAOA 2YAUA 2C4CA 2DKIA 2X8GA 3K30A 4NWZA 1K0LA 1GTEA 5IQ4A 2RGHA 1GETA 2GH5A 3NN0X 3VR9A 1P2HA 1YY5A 2BRYA 2C65A 4JQ9A 2QA1A 3GD4A 5IQ1A 4AP3A 2EQ8A 3WE0A 4U8PA 5KVHA 1NG4A 2OLNA 4APNA 2YR6A 1PJ7A 1XHCA 5KRQA 3ICSA 3LJPA 1ZMDA 3NYCA 2GQFA 4MJWA 2OALA 4X4JA 3NRNA 3NTAA 4JNQA 2BS2A 1XPQA 2BS4A 3JSKA 1ELIA 1TDFA 2ZZCA 3PS9A 1L0VA 1BGNA 2IIDA 2YG3A 5U63A 3F8DA 1PXAA 2R46A 2GVCA 4K22A 2WOWA 3NK2X 1NPXA 1GRHA 5IPYA 5M10A 5EB4A 1PXBA 1MOKA 3E1TA 2XFPA 1CJ4A 1X31B 2WDRA 1GTHA 2JB2A 4K5RA 3NGCX 2YR5A 3CNPA 1GXFA 1W4XA 3DH9A 4YTPA 1JRZA 3B3RA 3DA1A 3SZWA 1S2QA 4EMIA 4WX1A 2PYXA 3SGLA 3UKHA 3CIRA 3UKLA 2XFOA 4AP1A 2BRAA 4LU6A 1CC2A 1Q1WA 4CCQA 1F8RA 2WESA 1VQWA 2WDVA 3SZCA 4EQRA 4Z2UA 2XFQA 3DJGX 2YVJA 5CKUA 3K7QX 1XANA 3NK0X 4EIQA 3VQRA 1QJDA 4BJZA 3DK4A 2GQWA 1O95A 3HYWA 3RP7A 1GESA 1OJTA 1GRBA 3CTYA 3ATQA 1DXLA 4H4SA 2YLSA 3BI2A 2I0ZA 2RGJA 5BVAA 4H7UA 3S5WA 4DNAA 5KOXA 1CHUA 2WP6A 3UTGA 3UP5A 1GOSA 1TDNA 2JAEA 4UDQA 4USQA 1E1LA 2VRLA 2PHHA 3LZXA 3RHAA 4C3YA 3IC9A 1F3PA 1S3EA 2XVEA 3AE3A 2DKHA 4G73A 1VRQB 4GUVA 3Q6JA 1PBFA 1LV0A 3G5SA 2YLZA 3AWIA 1E7PA 2YG4A 2QAEA 4U8LA 1D4CA 4XWZA 2JBVA 4EMWA 2VQBA 3C96A 3K7TA 3QSEA 3LZWA 1L9EA 2OLOA 1D7YA 3P9UA 5FS8A 1LPFA 2XLRA 3FPZA 2CDUA 3T2KA 4IA6A 3KD9A 4AT0A 1UKVG 3GDPA 4YSYA 2GR0A 1GT8A 3UTEA 4BJYA 1VG0A 1FEBA 3DJEA 2X99A 5KVIA 3BHKA 4U8JA 3VRAA 1YQZA 3AE6A 4N9XA 2EQ9A 2Q0KA 1KFYA 3FBSA 1H7WA 2WBAA 5FS7A 3T37A 1PHHA 3AYIA 1P2EA 1TRBA 2C66A 4U8IA 3QSMA 2B7SA 4J2WA 4EM4A 2Z5XA 1NHQA 2A87A 1XDIA 3AE1A 1YQ4A 3CGBA 4YSHA 3AD7B 5GSNA 4D04A 4Z2RA 4CNJA 4J57A 3O0HA 1JEHA 1ZX9A 3ATRA 2BA9A 2GAHB 4A5LA 4AOSA 2GEWA 4BK1A 3SX6A 1Y0PA 1ZOVA 2VQ7A 3GRTA 1BF3A 2IVEA 2YG6A 3P1WA 3GMCA 3AE2A 2GV8A 4ICYA 4Y4NA 3UP4A 4BV6A 4C74A 1VG9A 1SEZA 1NENA 5JCIA 1NG3A 2BK4A 2JKCA 4II2A 1ZY8A 4NTCA 4ADWA 3SZFA 3CPJG 1GRAA 3EF6A 3K7MX 1FCDA 4IV9A 4REKA 4Y4LA 4EQSA 1EL5A 1E39A 3DJJA 2R0CA 3GWDA 1F6MA 3M0OA 5U25A 3SQPA 3UKKA 2XFUA 4JN9A 2GMHA 1MO9A 4LIIA 4X9MA 1FOHA 2WETA 4EIPA 1QLBA 4H2RA 4TM4A 1DOEA 3H4KA 2ZZBA 3KA7A 1OJAA 1Q1RA 3CPHG 2RGOA 2YR4A 3UOYA 4Z25A 3D8XA 4NEWA 5TR3A 4ZCCA 4BK3A 3R9UA 3AE8A 4UDPA 3QFBA 4H2NA 2WP5A 2AAQA 4H4QA 5KMPA 3AD9B 3VR8A 2GF3A 3AECA 3CN8A 3SYIA 2VVMA 3NYEA 3UCLA 3T2ZA 3GYXA 1KNRA 1BKWA 4H4ZA 1OJ9A 1YKJA 3ICRA 4TM0A 1HYUA 4K2XA 3S61A 4AT2A 1EL7A 4HA6A 2B76A 4DSHA 5BRTA 3AEGA 2BYBA 5ER0A 4FK1C 1ONFA 1IUVA 3CGDA 4J36A 3UKFA 1PXCA 2XLTA 4A99A 4B66A 1D4DA 1F8WA 3AEDA 3AE5A 3SFEA 3NT6A 4Z43A 3SXIA 2YWLA 5L46A 1D5TA 1KNPA 2EQ6A 3IHMA 2A8XA 4H4PA 1LJ1A 1EL9A 3C4NA 4YSXA 2C7GA 4J56A 2GB0A 3AD8B 4ZN0A 4JNAA 5JCKA 1NHPA 3D1CA 1BWCA 1RSGA 2IVDA 1KSUA 2XVHA 5HY5A 4NTDA 2JB1A 4CBQA 4Z2TA 2C70A 4NEVA 4DGKA 3LB8A 1ZOYA 4U2SA 2YQUA 3DK8A 2WOVA 3HZLA 1N4VA 1O5WA 3GSIA 3CNSA 3L1RA 5C2TA 1GREA 2BXSA 3NIXA 4H4XA 5JCMA 4EMJA 2YLWA 2X50A 3KU9A 3KVEA 5J60A 4H4YA 5M0ZA 2GR1A 3RP8A 2H89A 1PBDA 2WS3A 2B9XA 1JRXA 2Z5YA 1H6VA 1MXTA 3PVCA 3V76A 4P9SA 1PJ6A 3GDNA 3LXDA 1K4QA 1Y56B 2E5VA 1PBCA 2XCGA 4UP3A 2AR8A 2BK3A 1AOGA 1Z6LA 4U2LA 2FJEA 4A6NB 2VVLA 3KLJA 4O5QA 2YLXA 3L8KA 1S2YA 2XLUA 3KPKA 3ALLA 3KKJA 2V3AA 1H83A 5EB5A 3F8RA 3QSSA 1GRFA 4E0VA 4H4WA 4OPCA
chains in the Genus database with same CATH topology
3GYJA 4KPRA 3RP6A 1CBOA 2C64A 3IHGA 2BXRA 2WOIA 1NAAA 1GPEA 3LADA 1VDCA 3OC4A 4B67A 2ZZ0A 3QJ4A 3BNUA 2EQ7A 2OAMA 4H50A 2CULA 5CQFA 4C77A 3CGCA 3URHA 4TM3A 2VZ2A 3QFAA 1KF6A 5DBJA 2VOUA 5KOWA 2C67A 3UOZA 4YKGA 2ACZA 3ADAB 1NEKA 3COXA 3P4RA 4GCMA 1ZKQA 1EL8A 1NDAA 2BK5A 3NNEA 4PAAA 2XFNA 3DGHA 2WPCA 5HYMA 4Z44A 2UZZA 1GRGA 2C76A 4RG4A 3UKQA 1TDKA 1TDEA 3CMMA 4XXGA 5HXIA 3UTFA 4YXDA 2FJBA 2RABA 1B37A 1TYTA 3AYJA 3NH3X 4G74A 4OPTA 3NTDA 1EBDA 2AQJA 1IUUA 2CFYA 4JY2A 1LQUA 3ICTA 4C5OA 2C72A 3ISHA 4EQXA 4CNKA 1LTXR 4NNJA 1IUWA 1L9CA 3GD3A 4CY6A 2YG7A 1IUXA 1TYPA 2FJDA 1PJ5A 4RG3A 3Q9TA 1FECA 4K8DA 1ZP0A 1IUSA 2APGA 1M64A 4LA1A 3P4SA 4JY3A 3G5RA 4CCRA 1CJ3A 1OJDA 4H2PA 4J34A 1ZDLA 3DK9A 4K5SA 1GEUA 1GSNA 4CRTA 4M52A 2XLPA 5KXJA 2GMJA 4O5UA 4TM1A 2FJAA 3UKPA 2TPRA 3GRSA 3P4PA 2XVIA 1GALA 4CY8A 3M13A 2YVGA 3G5QA 3QVRA 4FX9A 4TLXA 4JDRA 3CNJA 3AYLA 1Y56A 1H82A 2B9YA 2BCGG 4II3A 1E1MA 3UOVA 3ALMA 1H84A 4NTEA 2YLRA 3UTHA 3AEEA 3CPIG 1K0JA 1QO8A 4GAVA 4A6NA 3PO7A 4X9NA 2WEUA 3NHOX 2WDQA 3EPTA 4U8KA 4J33A 3DJDA 2JB3A 1B4VA 1H7XA 4UDRA 4GRTA 1FEAA 4HB9A 4A9WA 1IUTA 2GR3A 3AE4A 2B9WA 5EOWA 1PDHA 5FS6A 4D03A 3I3LA 4G9KA 2R0GA 1GERA 4YT0A 3AE9A 2ARDA 3VRBA 2GR2A 4FK1A 4KX6A 3RNMA 3ITJA 2BCPA 5KMSA 3ZDNA 5BUKA 2VRMA 2WPFA 4G6HA 2C3CA 2XYOA 1KDGA 1DJNA 4IVOB 1PBEA 2GRTA 4IVMB 3CNDA 1N4WA 3ZYXA 4FDCB 5C3JA 4H4UA 4NZHA 4OPLA 1JOAA 2YLTA 4Z26A 2BACA 1E1KA 4OPUA 1CJ2A 1D7LA 3HYXA 4GDPA 3KPFA 5KMQA 3NLCA 4GDEA 4YWOA 3GYIA 2QA2A 3H8IA 1KSSA 4ZCDA 4Z24A 1L9DA 4U8NA 4AOXA 3T31A 2R45A 2NVKX 1CJCA 3BNMA 2ZBWA 1CF3A 3DGZA 4H4VA 3UOXA 4WCTA 5LV9A 2A89A 3FIMB 2F5ZA 2VVLG 2Y6RA 1N4UA 3T14A 1DODA 4B64A 2Y6QA 2Q0LA 4OPIA 3UKAA 2WP9A 4OCGA 3BI5A 1H86A 2WU2A 3ALJA 1F8SA 4BURA 3II4A 3SM8A 3BI4A 3V3NA 2BABA 2W0HA 2YVFA 3V3OA 1PS9A 4B65A 4B69A 1GV4A 2B7RA 2V60A 4H2QA 1IJHA 1JNRA 3REDA 2R4EA 4PABA 3T2YA 3I6DA 3OZ2A 1GNDA 1E1NA 4A65A 5BULA 1CL0A 2GAGB 2E1MA 5FMHA 1V59A 1BGJA 2TMDA 1RP0A 3CNTA 1O94A 5JCLA 5EBKA 4YTNA 3NK1X 1GRTA 4OPGA 3CGEA 4BK2A 3GMBA 5GRTA 1NHSA 1D4EA 1BZLA 1JNZA 1B5QA 1M6IA 5KMRA 2CVJA 3C4AA 1K0IA 3QVPA 1ZMCA 2YM1A 3NKSA 3DMEA 1E6EA 1PBBA 2C3DA 1YQ3A 1CC6A 2YM2A 2V61A 2WPEA 3FG2P 4U8MA 1ZK7A 3AB1A 3IWAA 4IA5A 4Y4MA 3B6DA 4B68A 2XDOA 4DSGA 4I58A 3ABVA 1LQTA 2Q6UA 4EQWA 1OJCA 4B63A 3EANA 3BHFA 4TLZA 5KWFA 3M12A 4GAPA 2X3NA 2R9ZA 2BC1A 2R0PA 2WQYA 5JCNA 2C75A 4XWRA 1FL2A 1JRYA 1DJQA 3T0KA 1TDOA 2YG5A 3AEBA 2V6OA 1LVLA 1JU2A 2XVJA 3LOVA 2JK6A 3NN6X 2BC0A 5FS9A 1DOCA 2Q7VA 2WU5A 4OPDA 3P4QA 1PN0A 1Q9IA 2X8HA 1DNCA 3F8PA 5HHFA 2E4GA 3GWFA 2O9ZA 2C73A 3VRDB 2NPXA 4H4RA 3SZ0A 3AEAA 4ECHA 4GR1A 1NHRA 3AXBA 2OA1A 4YTMA 5J7XA 2R4JA 2H88A 4EM3A 3SY4A 2BS3A 1CC4A 1DOBA 2FBWA 2XVFA 4I59A 3SFDA 2J3NA 2V3BA 4K7ZA 3HYVA 1RYIA 2XLSA 3FMWA 4U8OA 3IF9A 4A79A 2WHDA 4A7AA 4C3XA 2V5ZA 3AE7A 1N1PA 4USRA 4GF7A 4G6GA 4RSLA 4B1BA 3H8LA 4YSZA 3NYFA 1COYA 2QCUA 3AEFA 1REOA 2X8CA 2HQMA 4J31A 5U1OA 1S3BA 5KNLA 4OVIA 1H81A 4U2TA 4H4TA 4YKFA 1B8SA 3NG7X 3EAOA 2YAUA 2C4CA 2DKIA 2X8GA 3K30A 4NWZA 1K0LA 1GTEA 5IQ4A 2RGHA 1GETA 2GH5A 3NN0X 3VR9A 1P2HA 1YY5A 2BRYA 2C65A 4JQ9A 2QA1A 3GD4A 5IQ1A 4AP3A 2EQ8A 3WE0A 4U8PA 5KVHA 1NG4A 2OLNA 4APNA 2YR6A 1PJ7A 1XHCA 5KRQA 3ICSA 3LJPA 1ZMDA 3NYCA 2GQFA 4MJWA 2OALA 4X4JA 3NRNA 3NTAA 4JNQA 2BS2A 1XPQA 2BS4A 3JSKA 1ELIA 1TDFA 2ZZCA 3PS9A 1L0VA 1BGNA 2IIDA 2YG3A 5U63A 3F8DA 1PXAA 2R46A 2GVCA 4K22A 2WOWA 3NK2X 1NPXA 1GRHA 5IPYA 5M10A 5EB4A 1PXBA 1MOKA 3E1TA 2XFPA 1CJ4A 1X31B 2WDRA 1GTHA 2JB2A 4K5RA 3NGCX 2YR5A 3CNPA 1GXFA 1W4XA 3DH9A 4YTPA 1JRZA 3B3RA 3DA1A 3SZWA 1S2QA 4EMIA 4WX1A 2PYXA 3SGLA 3UKHA 3CIRA 3UKLA 2XFOA 4AP1A 2BRAA 4LU6A 1CC2A 1Q1WA 4CCQA 1F8RA 2WESA 1VQWA 2WDVA 3SZCA 4EQRA 4Z2UA 2XFQA 3DJGX 2YVJA 5CKUA 3K7QX 1XANA 3NK0X 4EIQA 3VQRA 1QJDA 4BJZA 3DK4A 2GQWA 1O95A 3HYWA 3RP7A 1GESA 1OJTA 1GRBA 3CTYA 3ATQA 1DXLA 4H4SA 2YLSA 3BI2A 2I0ZA 2RGJA 5BVAA 4H7UA 3S5WA 4DNAA 5KOXA 1CHUA 2WP6A 3UTGA 3UP5A 1GOSA 1TDNA 2JAEA 4UDQA 4USQA 1E1LA 2VRLA 2PHHA 3LZXA 3RHAA 4C3YA 3IC9A 1F3PA 1S3EA 2XVEA 3AE3A 2DKHA 4G73A 1VRQB 4GUVA 3Q6JA 1PBFA 1LV0A 3G5SA 2YLZA 3AWIA 1E7PA 2YG4A 2QAEA 4U8LA 1D4CA 4XWZA 2JBVA 4EMWA 2VQBA 3C96A 3K7TA 3QSEA 3LZWA 1L9EA 2OLOA 1D7YA 3P9UA 5FS8A 1LPFA 2XLRA 3FPZA 2CDUA 3T2KA 4IA6A 3KD9A 4AT0A 1UKVG 3GDPA 4YSYA 2GR0A 1GT8A 3UTEA 4BJYA 1VG0A 1FEBA 3DJEA 2X99A 5KVIA 3BHKA 4U8JA 3VRAA 1YQZA 3AE6A 4N9XA 2EQ9A 2Q0KA 1KFYA 3FBSA 1H7WA 2WBAA 5FS7A 3T37A 1PHHA 3AYIA 1P2EA 1TRBA 2C66A 4U8IA 3QSMA 2B7SA 4J2WA 4EM4A 2Z5XA 1NHQA 2A87A 1XDIA 3AE1A 1YQ4A 3CGBA 4YSHA 3AD7B 5GSNA 4D04A 4Z2RA 4CNJA 4J57A 3O0HA 1JEHA 1ZX9A 3ATRA 2BA9A 2GAHB 4A5LA 4AOSA 2GEWA 4BK1A 3SX6A 1Y0PA 1ZOVA 2VQ7A 3GRTA 1BF3A 2IVEA 2YG6A 3P1WA 3GMCA 3AE2A 2GV8A 4ICYA 4Y4NA 3UP4A 4BV6A 4C74A 1VG9A 1SEZA 1NENA 5JCIA 1NG3A 2BK4A 2JKCA 4II2A 1ZY8A 4NTCA 4ADWA 3SZFA 3CPJG 1GRAA 3EF6A 3K7MX 1FCDA 4IV9A 4REKA 4Y4LA 4EQSA 1EL5A 1E39A 3DJJA 2R0CA 3GWDA 1F6MA 3M0OA 5U25A 3SQPA 3UKKA 2XFUA 4JN9A 2GMHA 1MO9A 4LIIA 4X9MA 1FOHA 2WETA 4EIPA 1QLBA 4H2RA 4TM4A 1DOEA 3H4KA 2ZZBA 3KA7A 1OJAA 1Q1RA 3CPHG 2RGOA 2YR4A 3UOYA 4Z25A 3D8XA 4NEWA 5TR3A 4ZCCA 4BK3A 3R9UA 3AE8A 4UDPA 3QFBA 4H2NA 2WP5A 2AAQA 4H4QA 5KMPA 3AD9B 3VR8A 2GF3A 3AECA 3CN8A 3SYIA 2VVMA 3NYEA 3UCLA 3T2ZA 3GYXA 1KNRA 1BKWA 4H4ZA 1OJ9A 1YKJA 3ICRA 4TM0A 1HYUA 4K2XA 3S61A 4AT2A 1EL7A 4HA6A 2B76A 4DSHA 5BRTA 3AEGA 2BYBA 5ER0A 4FK1C 1ONFA 1IUVA 3CGDA 4J36A 3UKFA 1PXCA 2XLTA 4A99A 4B66A 1D4DA 1F8WA 3AEDA 3AE5A 3SFEA 3NT6A 4Z43A 3SXIA 2YWLA 5L46A 1D5TA 1KNPA 2EQ6A 3IHMA 2A8XA 4H4PA 1LJ1A 1EL9A 3C4NA 4YSXA 2C7GA 4J56A 2GB0A 3AD8B 4ZN0A 4JNAA 5JCKA 1NHPA 3D1CA 1BWCA 1RSGA 2IVDA 1KSUA 2XVHA 5HY5A 4NTDA 2JB1A 4CBQA 4Z2TA 2C70A 4NEVA 4DGKA 3LB8A 1ZOYA 4U2SA 2YQUA 3DK8A 2WOVA 3HZLA 1N4VA 1O5WA 3GSIA 3CNSA 3L1RA 5C2TA 1GREA 2BXSA 3NIXA 4H4XA 5JCMA 4EMJA 2YLWA 2X50A 3KU9A 3KVEA 5J60A 4H4YA 5M0ZA 2GR1A 3RP8A 2H89A 1PBDA 2WS3A 2B9XA 1JRXA 2Z5YA 1H6VA 1MXTA 3PVCA 3V76A 4P9SA 1PJ6A 3GDNA 3LXDA 1K4QA 1Y56B 2E5VA 1PBCA 2XCGA 4UP3A 2AR8A 2BK3A 1AOGA 1Z6LA 4U2LA 2FJEA 4A6NB 2VVLA 3KLJA 4O5QA 2YLXA 3L8KA 1S2YA 2XLUA 3KPKA 3ALLA 3KKJA 2V3AA 1H83A 5EB5A 3F8RA 3QSSA 1GRFA 4E0VA 4H4WA 4OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GYJ A;  4KPR A;  3RP6 A;  1CBO A;  2C64 A;  3IHG A;  2BXR A;  2WOI A;  1NAA A;  1GPE A;  3LAD A;  1VDC A;  3OC4 A;  4B67 A;  2ZZ0 A;  3QJ4 A;  3BNU A;  2EQ7 A;  2OAM A;  4H50 A;  2CUL A;  5CQF A;  4C77 A;  3CGC A;  3URH A;  4TM3 A;  2VZ2 A;  3QFA A;  1KF6 A;  5DBJ A;  2VOU A;  5KOW A;  2C67 A;  3UOZ A;  4YKG A;  2ACZ A;  3ADA B;  1NEK A;  3COX A;  3P4R A;  4GCM A;  1ZKQ A;  1EL8 A;  1NDA A;  2BK5 A;  3NNE A;  4PAA A;  2XFN A;  3DGH A;  2WPC A;  5HYM A;  4Z44 A;  2UZZ A;  1GRG A;  2C76 A;  4RG4 A;  3UKQ A;  1TDK A;  1TDE A;  4XXG A;  5HXI A;  3UTF A;  4YXD A;  2FJB A;  2RAB A;  1B37 A;  1TYT A;  3AYJ A;  3NH3 X;  4OPT A;  3NTD A;  1EBD A;  2AQJ A;  1IUU A;  2CFY A;  4JY2 A;  1LQU A;  3ICT A;  4C5O A;  2C72 A;  3ISH A;  4EQX A;  4CNK A;  1LTX R;  1IUW A;  1L9C A;  3GD3 A;  4CY6 A;  2YG7 A;  1IUX A;  1TYP A;  2FJD A;  1PJ5 A;  4RG3 A;  3Q9T A;  1FEC A;  4K8D A;  1ZP0 A;  1IUS A;  2APG A;  1M64 A;  4LA1 A;  3P4S A;  4JY3 A;  3G5R A;  4CCR A;  1CJ3 A;  1OJD A;  4H2P A;  4J34 A;  1ZDL A;  3DK9 A;  4K5S A;  1GEU A;  1GSN A;  4CRT A;  4M52 A;  2XLP A;  5KXJ A;  2GMJ A;  4O5U A;  4TM1 A;  2FJA A;  3UKP A;  2TPR A;  3GRS A;  3P4P A;  2XVI A;  1GAL A;  4CY8 A;  3M13 A;  2YVG A;  3G5Q A;  3QVR A;  4FX9 A;  4TLX A;  4JDR A;  3CNJ A;  3AYL A;  1Y56 A;  1H82 A;  2B9Y A;  2BCG G;  1E1M A;  3UOV A;  3ALM A;  1H84 A;  4NTE A;  2YLR A;  3UTH A;  3AEE A;  3CPI G;  1K0J A;  1QO8 A;  4A6N A;  3PO7 A;  4X9N A;  2WEU A;  3NHO X;  2WDQ A;  3EPT A;  4U8K A;  4J33 A;  3DJD A;  2JB3 A;  1B4V A;  1H7X A;  4UDR A;  4GRT A;  1FEA A;  4HB9 A;  4A9W A;  1IUT A;  2GR3 A;  3AE4 A;  2B9W A;  5EOW A;  1PDH A;  5FS6 A;  4D03 A;  3I3L A;  2R0G A;  1GER A;  4YT0 A;  3AE9 A;  2ARD A;  3VRB A;  2GR2 A;  4FK1 A;  4KX6 A;  3RNM A;  3ITJ A;  2BCP A;  3ZDN A;  5BUK A;  2VRM A;  2WPF A;  2C3C A;  2XYO A;  1KDG A;  1DJN A;  4IVO B;  1PBE A;  2GRT A;  4IVM B;  3CND A;  1N4W A;  3ZYX A;  4FDC B;  5C3J A;  4H4U A;  4NZH A;  4OPL A;  1JOA A;  2YLT A;  4Z26 A;  2BAC A;  1E1K A;  4OPU A;  1CJ2 A;  1D7L A;  4GDP A;  3KPF A;  3NLC A;  4GDE A;  4YWO A;  3GYI A;  2QA2 A;  3H8I A;  1KSS A;  4ZCD A;  4Z24 A;  1L9D A;  4U8N A;  4AOX A;  2R45 A;  2NVK X;  1CJC A;  3BNM A;  2ZBW A;  1CF3 A;  3DGZ A;  4H4V A;  3UOX A;  4WCT A;  5LV9 A;  2A89 A;  3FIM B;  2F5Z A;  2VVL G;  2Y6R A;  1N4U A;  1DOD A;  4B64 A;  2Y6Q A;  2Q0L A;  4OPI A;  3UKA A;  2WP9 A;  4OCG A;  3BI5 A;  1H86 A;  2WU2 A;  3ALJ A;  1F8S A;  4BUR A;  3II4 A;  3SM8 A;  3BI4 A;  3V3N A;  2BAB A;  2W0H A;  2YVF A;  3V3O A;  1PS9 A;  4B65 A;  4B69 A;  1GV4 A;  2B7R A;  2V60 A;  4H2Q A;  1IJH A;  1JNR A;  3RED A;  2R4E A;  4PAB A;  3I6D A;  3OZ2 A;  1GND A;  1E1N A;  4A65 A;  5BUL A;  1CL0 A;  2GAG B;  2E1M A;  5FMH A;  1V59 A;  1BGJ A;  2TMD A;  1RP0 A;  3CNT A;  1O94 A;  5JCL A;  5EBK A;  4YTN A;  3NK1 X;  1GRT A;  4OPG A;  3CGE A;  4BK2 A;  3GMB A;  5GRT A;  1NHS A;  1D4E A;  1BZL A;  1JNZ A;  1B5Q A;  1M6I A;  2CVJ A;  3C4A A;  1K0I A;  3QVP A;  1ZMC A;  2YM1 A;  3NKS A;  3DME A;  1E6E A;  1PBB A;  2C3D A;  1YQ3 A;  1CC6 A;  2YM2 A;  2V61 A;  2WPE A;  3FG2 P;  4U8M A;  1ZK7 A;  3AB1 A;  3IWA A;  4IA5 A;  4Y4M A;  3B6D A;  4B68 A;  2XDO A;  4DSG A;  4I58 A;  3ABV A;  1LQT A;  2Q6U A;  4EQW A;  1OJC A;  4B63 A;  3EAN A;  3BHF A;  4TLZ A;  5KWF A;  3M12 A;  2X3N A;  2R9Z A;  2BC1 A;  2R0P A;  2WQY A;  5JCN A;  2C75 A;  4XWR A;  1FL2 A;  1JRY A;  1DJQ A;  1TDO A;  2YG5 A;  3AEB A;  2V6O A;  1LVL A;  1JU2 A;  2XVJ A;  3LOV A;  2JK6 A;  3NN6 X;  2BC0 A;  5FS9 A;  1DOC A;  2Q7V A;  2WU5 A;  4OPD A;  3P4Q A;  1PN0 A;  1Q9I A;  2X8H A;  1DNC A;  3F8P A;  5HHF A;  2E4G A;  3GWF A;  2O9Z A;  2C73 A;  3VRD B;  2NPX A;  4H4R A;  4ECH A;  3AEA A;  4GR1 A;  1NHR A;  3AXB A;  2OA1 A;  4YTM A;  5J7X A;  2R4J A;  2H88 A;  4EM3 A;  2BS3 A;  1CC4 A;  1DOB A;  2FBW A;  2XVF A;  4I59 A;  3SFD A;  2J3N A;  2V3B A;  4K7Z A;  1RYI A;  2XLS A;  3FMW A;  4U8O A;  3IF9 A;  4A79 A;  2WHD A;  4A7A A;  4C3X A;  2V5Z A;  3AE7 A;  1N1P A;  4USR A;  4GF7 A;  4RSL A;  4B1B A;  3H8L A;  4YSZ A;  3NYF A;  1COY A;  2QCU A;  3AEF A;  1REO A;  2X8C A;  2HQM A;  4J31 A;  5U1O A;  1S3B A;  4OVI A;  1H81 A;  4U2T A;  4H4T A;  4YKF A;  1B8S A;  3NG7 X;  3EAO A;  2YAU A;  2X8G A;  2DKI A;  3K30 A;  1K0L A;  1GTE A;  5IQ4 A;  2RGH A;  1GET A;  2GH5 A;  3NN0 X;  3VR9 A;  1P2H A;  1YY5 A;  2C65 A;  4JQ9 A;  5IQ1 A;  2QA1 A;  3GD4 A;  4AP3 A;  2EQ8 A;  3WE0 A;  4U8P A;  5KVH A;  1NG4 A;  2OLN A;  4APN A;  2YR6 A;  1PJ7 A;  1XHC A;  5KRQ A;  3ICS A;  3LJP A;  1ZMD A;  3NYC A;  2GQF A;  4MJW A;  2OAL A;  4X4J A;  3NRN A;  3NTA A;  4JNQ A;  2BS2 A;  1XPQ A;  2BS4 A;  3JSK A;  1ELI A;  1TDF A;  2ZZC A;  3PS9 A;  1L0V A;  1BGN A;  2IID A;  2YG3 A;  5U63 A;  3F8D A;  1PXA A;  2R46 A;  2GVC A;  4K22 A;  2WOW A;  3NK2 X;  1NPX A;  1GRH A;  5IPY A;  5M10 A;  5EB4 A;  1PXB A;  1MOK A;  3E1T A;  2XFP A;  1CJ4 A;  1X31 B;  2WDR A;  1GTH A;  2JB2 A;  4K5R A;  3NGC X;  2YR5 A;  3CNP A;  1GXF A;  1W4X A;  3DH9 A;  4YTP A;  1JRZ A;  3B3R A;  3DA1 A;  1S2Q A;  4EMI A;  4WX1 A;  2PYX A;  3SGL A;  3UKH A;  3CIR A;  3UKL A;  2XFO A;  4AP1 A;  4CCQ A;  4LU6 A;  1CC2 A;  1Q1W A;  4Z2U A;  1F8R A;  2WES A;  1VQW A;  2WDV A;  4EQR A;  2XFQ A;  3DJG X;  2YVJ A;  5CKU A;  3K7Q X;  1XAN A;  3NK0 X;  4EIQ A;  3VQR A;  1QJD A;  4BJZ A;  3DK4 A;  2GQW A;  1O95 A;  3RP7 A;  1GES A;  1OJT A;  1GRB A;  3CTY A;  3ATQ A;  1DXL A;  4H4S A;  2YLS A;  3BI2 A;  2I0Z A;  2RGJ A;  5BVA A;  4H7U A;  3S5W A;  4DNA A;  5KOX A;  1CHU A;  2WP6 A;  3UTG A;  3UP5 A;  1GOS A;  1TDN A;  2JAE A;  4UDQ A;  4USQ A;  1E1L A;  2VRL A;  2PHH A;  3LZX A;  3RHA A;  4C3Y A;  3IC9 A;  1F3P A;  1S3E A;  2XVE A;  3AE3 A;  2DKH A;  1VRQ B;  4GUV A;  3Q6J A;  1PBF A;  1LV0 A;  3G5S A;  2YLZ A;  3AWI A;  1E7P A;  2YG4 A;  2QAE A;  4U8L A;  1D4C A;  4XWZ A;  2JBV A;  4EMW A;  2VQB A;  3C96 A;  3K7T A;  3QSE A;  3LZW A;  1L9E A;  2OLO A;  1D7Y A;  3P9U A;  5FS8 A;  1LPF A;  2XLR A;  3FPZ A;  2CDU A;  4IA6 A;  3KD9 A;  4AT0 A;  1UKV G;  3GDP A;  4YSY A;  2GR0 A;  1GT8 A;  3UTE A;  4BJY A;  1VG0 A;  1FEB A;  3DJE A;  2X99 A;  5KVI A;  3BHK A;  4U8J A;  3VRA A;  1YQZ A;  3AE6 A;  4N9X A;  2EQ9 A;  2Q0K A;  1KFY A;  3FBS A;  1H7W A;  2WBA A;  5FS7 A;  3T37 A;  1PHH A;  3AYI A;  1P2E A;  1TRB A;  2C66 A;  4U8I A;  3QSM A;  2B7S A;  4J2W A;  4EM4 A;  2Z5X A;  1NHQ A;  2A87 A;  1XDI A;  3AE1 A;  1YQ4 A;  3CGB A;  4YSH A;  3AD7 B;  5GSN A;  4D04 A;  4Z2R A;  4CNJ A;  4J57 A;  3O0H A;  1JEH A;  1ZX9 A;  3ATR A;  2BA9 A;  2GAH B;  4A5L A;  4AOS A;  2GEW A;  4BK1 A;  1Y0P A;  1ZOV A;  2VQ7 A;  3GRT A;  1BF3 A;  2IVE A;  2YG6 A;  3P1W A;  3GMC A;  3AE2 A;  2GV8 A;  4ICY A;  4Y4N A;  3UP4 A;  4BV6 A;  4C74 A;  1VG9 A;  1SEZ A;  1NEN A;  5JCI A;  1NG3 A;  2BK4 A;  2JKC A;  4NTC A;  1ZY8 A;  4ADW A;  3CPJ G;  1GRA A;  3EF6 A;  3K7M X;  1FCD A;  4IV9 A;  4REK A;  4Y4L A;  4EQS A;  1EL5 A;  1E39 A;  3DJJ A;  2R0C A;  3GWD A;  1F6M A;  3M0O A;  5U25 A;  3SQP A;  3UKK A;  2XFU A;  4JN9 A;  2GMH A;  1MO9 A;  4LII A;  4X9M A;  1FOH A;  2WET A;  4EIP A;  1QLB A;  4H2R A;  4TM4 A;  1DOE A;  3H4K A;  2ZZB A;  3KA7 A;  1OJA A;  1Q1R A;  3CPH G;  2RGO A;  2YR4 A;  3UOY A;  4Z25 A;  3D8X A;  4NEW A;  5TR3 A;  4ZCC A;  4BK3 A;  3R9U A;  3AE8 A;  4UDP A;  3QFB A;  4H2N A;  2WP5 A;  2AAQ A;  4H4Q A;  3AD9 B;  3VR8 A;  2GF3 A;  3AEC A;  3CN8 A;  2VVM A;  3NYE A;  3UCL A;  1KNR A;  1BKW A;  4H4Z A;  1OJ9 A;  1YKJ A;  3ICR A;  4TM0 A;  1HYU A;  4K2X A;  3S61 A;  4AT2 A;  1EL7 A;  4HA6 A;  2B76 A;  4DSH A;  5BRT A;  3AEG A;  2BYB A;  5ER0 A;  4FK1 C;  1ONF A;  1IUV A;  3CGD A;  4J36 A;  3UKF A;  1PXC A;  2XLT A;  4A99 A;  4B66 A;  1D4D A;  1F8W A;  3AED A;  3AE5 A;  3SFE A;  3NT6 A;  4Z43 A;  2YWL A;  5L46 A;  1D5T A;  1KNP A;  2EQ6 A;  3IHM A;  2A8X A;  4H4P A;  1LJ1 A;  1EL9 A;  3C4N A;  4YSX A;  2C7G A;  4J56 A;  2GB0 A;  3AD8 B;  4ZN0 A;  4JNA A;  5JCK A;  1NHP A;  3D1C A;  1BWC A;  1RSG A;  2IVD A;  1KSU A;  2XVH A;  5HY5 A;  4NTD A;  2JB1 A;  4CBQ A;  4Z2T A;  2C70 A;  4NEV A;  4DGK A;  3LB8 A;  1ZOY A;  4U2S A;  2YQU A;  3DK8 A;  2WOV A;  3HZL A;  1N4V A;  1O5W A;  3GSI A;  3CNS A;  3L1R A;  5C2T A;  1GRE A;  2BXS A;  3NIX A;  4H4X A;  5JCM A;  4EMJ A;  2YLW A;  2X50 A;  3KU9 A;  3KVE A;  5J60 A;  4H4Y A;  5M0Z A;  2GR1 A;  3RP8 A;  2H89 A;  1PBD A;  2WS3 A;  2B9X A;  1JRX A;  2Z5Y A;  1H6V A;  1MXT A;  3PVC A;  3V76 A;  4P9S A;  1PJ6 A;  3GDN A;  3LXD A;  1K4Q A;  1Y56 B;  2E5V A;  1PBC A;  2XCG A;  4UP3 A;  2AR8 A;  2BK3 A;  1AOG A;  1Z6L A;  4U2L A;  2FJE A;  4A6N B;  2VVL A;  3KLJ A;  4O5Q A;  2YLX A;  3L8K A;  1S2Y A;  2XLU A;  3ALL A;  3KKJ A;  2V3A A;  1H83 A;  5EB5 A;  3F8R A;  3QSS A;  1GRF A;  4E0V A;  4H4W A;  4OPC A; 
#chains in the Genus database with same CATH topology
 3GYJ A;  4KPR A;  3RP6 A;  1CBO A;  2C64 A;  3IHG A;  2BXR A;  2WOI A;  1NAA A;  1GPE A;  3LAD A;  1VDC A;  3OC4 A;  4B67 A;  2ZZ0 A;  3QJ4 A;  3BNU A;  2EQ7 A;  2OAM A;  4H50 A;  2CUL A;  5CQF A;  4C77 A;  3CGC A;  3URH A;  4TM3 A;  2VZ2 A;  3QFA A;  1KF6 A;  5DBJ A;  2VOU A;  5KOW A;  2C67 A;  3UOZ A;  4YKG A;  2ACZ A;  3ADA B;  1NEK A;  3COX A;  3P4R A;  4GCM A;  1ZKQ A;  1EL8 A;  1NDA A;  2BK5 A;  3NNE A;  4PAA A;  2XFN A;  3DGH A;  2WPC A;  5HYM A;  4Z44 A;  2UZZ A;  1GRG A;  2C76 A;  4RG4 A;  3UKQ A;  1TDK A;  1TDE A;  3CMM A;  4XXG A;  5HXI A;  3UTF A;  4YXD A;  2FJB A;  2RAB A;  1B37 A;  1TYT A;  3AYJ A;  3NH3 X;  4G74 A;  4OPT A;  3NTD A;  1EBD A;  2AQJ A;  1IUU A;  2CFY A;  4JY2 A;  1LQU A;  3ICT A;  4C5O A;  2C72 A;  3ISH A;  4EQX A;  4CNK A;  1LTX R;  4NNJ A;  1IUW A;  1L9C A;  3GD3 A;  4CY6 A;  2YG7 A;  1IUX A;  1TYP A;  2FJD A;  1PJ5 A;  4RG3 A;  3Q9T A;  1FEC A;  4K8D A;  1ZP0 A;  1IUS A;  2APG A;  1M64 A;  4LA1 A;  3P4S A;  4JY3 A;  3G5R A;  4CCR A;  1CJ3 A;  1OJD A;  4H2P A;  4J34 A;  1ZDL A;  3DK9 A;  4K5S A;  1GEU A;  1GSN A;  4CRT A;  4M52 A;  2XLP A;  5KXJ A;  2GMJ A;  4O5U A;  4TM1 A;  2FJA A;  3UKP A;  2TPR A;  3GRS A;  3P4P A;  2XVI A;  1GAL A;  4CY8 A;  3M13 A;  2YVG A;  3G5Q A;  3QVR A;  4FX9 A;  4TLX A;  4JDR A;  3CNJ A;  3AYL A;  1Y56 A;  1H82 A;  2B9Y A;  2BCG G;  4II3 A;  1E1M A;  3UOV A;  3ALM A;  1H84 A;  4NTE A;  2YLR A;  3UTH A;  3AEE A;  3CPI G;  1K0J A;  1QO8 A;  4GAV A;  4A6N A;  3PO7 A;  4X9N A;  2WEU A;  3NHO X;  2WDQ A;  3EPT A;  4U8K A;  4J33 A;  3DJD A;  2JB3 A;  1B4V A;  1H7X A;  4UDR A;  4GRT A;  1FEA A;  4HB9 A;  4A9W A;  1IUT A;  2GR3 A;  3AE4 A;  2B9W A;  5EOW A;  1PDH A;  5FS6 A;  4D03 A;  3I3L A;  4G9K A;  2R0G A;  1GER A;  4YT0 A;  3AE9 A;  2ARD A;  3VRB A;  2GR2 A;  4FK1 A;  4KX6 A;  3RNM A;  3ITJ A;  2BCP A;  5KMS A;  3ZDN A;  5BUK A;  2VRM A;  2WPF A;  4G6H A;  2C3C A;  2XYO A;  1KDG A;  1DJN A;  4IVO B;  1PBE A;  2GRT A;  4IVM B;  3CND A;  1N4W A;  3ZYX A;  4FDC B;  5C3J A;  4H4U A;  4NZH A;  4OPL A;  1JOA A;  2YLT A;  4Z26 A;  2BAC A;  1E1K A;  4OPU A;  1CJ2 A;  1D7L A;  3HYX A;  4GDP A;  3KPF A;  5KMQ A;  3NLC A;  4GDE A;  4YWO A;  3GYI A;  2QA2 A;  3H8I A;  1KSS A;  4ZCD A;  4Z24 A;  1L9D A;  4U8N A;  4AOX A;  3T31 A;  2R45 A;  2NVK X;  1CJC A;  3BNM A;  2ZBW A;  1CF3 A;  3DGZ A;  4H4V A;  3UOX A;  4WCT A;  5LV9 A;  2A89 A;  3FIM B;  2F5Z A;  2VVL G;  2Y6R A;  1N4U A;  3T14 A;  1DOD A;  4B64 A;  2Y6Q A;  2Q0L A;  4OPI A;  3UKA A;  2WP9 A;  4OCG A;  3BI5 A;  1H86 A;  2WU2 A;  3ALJ A;  1F8S A;  4BUR A;  3II4 A;  3SM8 A;  3BI4 A;  3V3N A;  2BAB A;  2W0H A;  2YVF A;  3V3O A;  1PS9 A;  4B65 A;  4B69 A;  1GV4 A;  2B7R A;  2V60 A;  4H2Q A;  1IJH A;  1JNR A;  3RED A;  2R4E A;  4PAB A;  3T2Y A;  3I6D A;  3OZ2 A;  1GND A;  1E1N A;  4A65 A;  5BUL A;  1CL0 A;  2GAG B;  2E1M A;  5FMH A;  1V59 A;  1BGJ A;  2TMD A;  1RP0 A;  3CNT A;  1O94 A;  5JCL A;  5EBK A;  4YTN A;  3NK1 X;  1GRT A;  4OPG A;  3CGE A;  4BK2 A;  3GMB A;  5GRT A;  1NHS A;  1D4E A;  1BZL A;  1JNZ A;  1B5Q A;  1M6I A;  5KMR A;  2CVJ A;  3C4A A;  1K0I A;  3QVP A;  1ZMC A;  2YM1 A;  3NKS A;  3DME A;  1E6E A;  1PBB A;  2C3D A;  1YQ3 A;  1CC6 A;  2YM2 A;  2V61 A;  2WPE A;  3FG2 P;  4U8M A;  1ZK7 A;  3AB1 A;  3IWA A;  4IA5 A;  4Y4M A;  3B6D A;  4B68 A;  2XDO A;  4DSG A;  4I58 A;  3ABV A;  1LQT A;  2Q6U A;  4EQW A;  1OJC A;  4B63 A;  3EAN A;  3BHF A;  4TLZ A;  5KWF A;  3M12 A;  4GAP A;  2X3N A;  2R9Z A;  2BC1 A;  2R0P A;  2WQY A;  5JCN A;  2C75 A;  4XWR A;  1FL2 A;  1JRY A;  1DJQ A;  3T0K A;  1TDO A;  2YG5 A;  3AEB A;  2V6O A;  1LVL A;  1JU2 A;  2XVJ A;  3LOV A;  2JK6 A;  3NN6 X;  2BC0 A;  5FS9 A;  1DOC A;  2Q7V A;  2WU5 A;  4OPD A;  3P4Q A;  1PN0 A;  1Q9I A;  2X8H A;  1DNC A;  3F8P A;  5HHF A;  2E4G A;  3GWF A;  2O9Z A;  2C73 A;  3VRD B;  2NPX A;  4H4R A;  3SZ0 A;  3AEA A;  4ECH A;  4GR1 A;  1NHR A;  3AXB A;  2OA1 A;  4YTM A;  5J7X A;  2R4J A;  2H88 A;  4EM3 A;  3SY4 A;  2BS3 A;  1CC4 A;  1DOB A;  2FBW A;  2XVF A;  4I59 A;  3SFD A;  2J3N A;  2V3B A;  4K7Z A;  3HYV A;  1RYI A;  2XLS A;  3FMW A;  4U8O A;  3IF9 A;  4A79 A;  2WHD A;  4A7A A;  4C3X A;  2V5Z A;  3AE7 A;  1N1P A;  4USR A;  4GF7 A;  4G6G A;  4RSL A;  4B1B A;  3H8L A;  4YSZ A;  3NYF A;  1COY A;  2QCU A;  3AEF A;  1REO A;  2X8C A;  2HQM A;  4J31 A;  5U1O A;  1S3B A;  5KNL A;  4OVI A;  1H81 A;  4U2T A;  4H4T A;  4YKF A;  1B8S A;  3NG7 X;  3EAO A;  2YAU A;  2C4C A;  2DKI A;  2X8G A;  3K30 A;  4NWZ A;  1K0L A;  1GTE A;  5IQ4 A;  2RGH A;  1GET A;  2GH5 A;  3NN0 X;  3VR9 A;  1P2H A;  1YY5 A;  2BRY A;  2C65 A;  4JQ9 A;  2QA1 A;  3GD4 A;  5IQ1 A;  4AP3 A;  2EQ8 A;  3WE0 A;  4U8P A;  5KVH A;  1NG4 A;  2OLN A;  4APN A;  2YR6 A;  1PJ7 A;  1XHC A;  5KRQ A;  3ICS A;  3LJP A;  1ZMD A;  3NYC A;  2GQF A;  4MJW A;  2OAL A;  4X4J A;  3NRN A;  3NTA A;  4JNQ A;  2BS2 A;  1XPQ A;  2BS4 A;  3JSK A;  1ELI A;  1TDF A;  2ZZC A;  3PS9 A;  1L0V A;  1BGN A;  2IID A;  2YG3 A;  5U63 A;  3F8D A;  1PXA A;  2R46 A;  2GVC A;  4K22 A;  2WOW A;  3NK2 X;  1NPX A;  1GRH A;  5IPY A;  5M10 A;  5EB4 A;  1PXB A;  1MOK A;  3E1T A;  2XFP A;  1CJ4 A;  1X31 B;  2WDR A;  1GTH A;  2JB2 A;  4K5R A;  3NGC X;  2YR5 A;  3CNP A;  1GXF A;  1W4X A;  3DH9 A;  4YTP A;  1JRZ A;  3B3R A;  3DA1 A;  3SZW A;  1S2Q A;  4EMI A;  4WX1 A;  2PYX A;  3SGL A;  3UKH A;  3CIR A;  3UKL A;  2XFO A;  4AP1 A;  2BRA A;  4LU6 A;  1CC2 A;  1Q1W A;  4CCQ A;  1F8R A;  2WES A;  1VQW A;  2WDV A;  3SZC A;  4EQR A;  4Z2U A;  2XFQ A;  3DJG X;  2YVJ A;  5CKU A;  3K7Q X;  1XAN A;  3NK0 X;  4EIQ A;  3VQR A;  1QJD A;  4BJZ A;  3DK4 A;  2GQW A;  1O95 A;  3HYW A;  3RP7 A;  1GES A;  1OJT A;  1GRB A;  3CTY A;  3ATQ A;  1DXL A;  4H4S A;  2YLS A;  3BI2 A;  2I0Z A;  2RGJ A;  5BVA A;  4H7U A;  3S5W A;  4DNA A;  5KOX A;  1CHU A;  2WP6 A;  3UTG A;  3UP5 A;  1GOS A;  1TDN A;  2JAE A;  4UDQ A;  4USQ A;  1E1L A;  2VRL A;  2PHH A;  3LZX A;  3RHA A;  4C3Y A;  3IC9 A;  1F3P A;  1S3E A;  2XVE A;  3AE3 A;  2DKH A;  4G73 A;  1VRQ B;  4GUV A;  3Q6J A;  1PBF A;  1LV0 A;  3G5S A;  2YLZ A;  3AWI A;  1E7P A;  2YG4 A;  2QAE A;  4U8L A;  1D4C A;  4XWZ A;  2JBV A;  4EMW A;  2VQB A;  3C96 A;  3K7T A;  3QSE A;  3LZW A;  1L9E A;  2OLO A;  1D7Y A;  3P9U A;  5FS8 A;  1LPF A;  2XLR A;  3FPZ A;  2CDU A;  3T2K A;  4IA6 A;  3KD9 A;  4AT0 A;  1UKV G;  3GDP A;  4YSY A;  2GR0 A;  1GT8 A;  3UTE A;  4BJY A;  1VG0 A;  1FEB A;  3DJE A;  2X99 A;  5KVI A;  3BHK A;  4U8J A;  3VRA A;  1YQZ A;  3AE6 A;  4N9X A;  2EQ9 A;  2Q0K A;  1KFY A;  3FBS A;  1H7W A;  2WBA A;  5FS7 A;  3T37 A;  1PHH A;  3AYI A;  1P2E A;  1TRB A;  2C66 A;  4U8I A;  3QSM A;  2B7S A;  4J2W A;  4EM4 A;  2Z5X A;  1NHQ A;  2A87 A;  1XDI A;  3AE1 A;  1YQ4 A;  3CGB A;  4YSH A;  3AD7 B;  5GSN A;  4D04 A;  4Z2R A;  4CNJ A;  4J57 A;  3O0H A;  1JEH A;  1ZX9 A;  3ATR A;  2BA9 A;  2GAH B;  4A5L A;  4AOS A;  2GEW A;  4BK1 A;  3SX6 A;  1Y0P A;  1ZOV A;  2VQ7 A;  3GRT A;  1BF3 A;  2IVE A;  2YG6 A;  3P1W A;  3GMC A;  3AE2 A;  2GV8 A;  4ICY A;  4Y4N A;  3UP4 A;  4BV6 A;  4C74 A;  1VG9 A;  1SEZ A;  1NEN A;  5JCI A;  1NG3 A;  2BK4 A;  2JKC A;  4II2 A;  1ZY8 A;  4NTC A;  4ADW A;  3SZF A;  3CPJ G;  1GRA A;  3EF6 A;  3K7M X;  1FCD A;  4IV9 A;  4REK A;  4Y4L A;  4EQS A;  1EL5 A;  1E39 A;  3DJJ A;  2R0C A;  3GWD A;  1F6M A;  3M0O A;  5U25 A;  3SQP A;  3UKK A;  2XFU A;  4JN9 A;  2GMH A;  1MO9 A;  4LII A;  4X9M A;  1FOH A;  2WET A;  4EIP A;  1QLB A;  4H2R A;  4TM4 A;  1DOE A;  3H4K A;  2ZZB A;  3KA7 A;  1OJA A;  1Q1R A;  3CPH G;  2RGO A;  2YR4 A;  3UOY A;  4Z25 A;  3D8X A;  4NEW A;  5TR3 A;  4ZCC A;  4BK3 A;  3R9U A;  3AE8 A;  4UDP A;  3QFB A;  4H2N A;  2WP5 A;  2AAQ A;  4H4Q A;  5KMP A;  3AD9 B;  3VR8 A;  2GF3 A;  3AEC A;  3CN8 A;  3SYI A;  2VVM A;  3NYE A;  3UCL A;  3T2Z A;  3GYX A;  1KNR A;  1BKW A;  4H4Z A;  1OJ9 A;  1YKJ A;  3ICR A;  4TM0 A;  1HYU A;  4K2X A;  3S61 A;  4AT2 A;  1EL7 A;  4HA6 A;  2B76 A;  4DSH A;  5BRT A;  3AEG A;  2BYB A;  5ER0 A;  4FK1 C;  1ONF A;  1IUV A;  3CGD A;  4J36 A;  3UKF A;  1PXC A;  2XLT A;  4A99 A;  4B66 A;  1D4D A;  1F8W A;  3AED A;  3AE5 A;  3SFE A;  3NT6 A;  4Z43 A;  3SXI A;  2YWL A;  5L46 A;  1D5T A;  1KNP A;  2EQ6 A;  3IHM A;  2A8X A;  4H4P A;  1LJ1 A;  1EL9 A;  3C4N A;  4YSX A;  2C7G A;  4J56 A;  2GB0 A;  3AD8 B;  4ZN0 A;  4JNA A;  5JCK A;  1NHP A;  3D1C A;  1BWC A;  1RSG A;  2IVD A;  1KSU A;  2XVH A;  5HY5 A;  4NTD A;  2JB1 A;  4CBQ A;  4Z2T A;  2C70 A;  4NEV A;  4DGK A;  3LB8 A;  1ZOY A;  4U2S A;  2YQU A;  3DK8 A;  2WOV A;  3HZL A;  1N4V A;  1O5W A;  3GSI A;  3CNS A;  3L1R A;  5C2T A;  1GRE A;  2BXS A;  3NIX A;  4H4X A;  5JCM A;  4EMJ A;  2YLW A;  2X50 A;  3KU9 A;  3KVE A;  5J60 A;  4H4Y A;  5M0Z A;  2GR1 A;  3RP8 A;  2H89 A;  1PBD A;  2WS3 A;  2B9X A;  1JRX A;  2Z5Y A;  1H6V A;  1MXT A;  3PVC A;  3V76 A;  4P9S A;  1PJ6 A;  3GDN A;  3LXD A;  1K4Q A;  1Y56 B;  2E5V A;  1PBC A;  2XCG A;  4UP3 A;  2AR8 A;  2BK3 A;  1AOG A;  1Z6L A;  4U2L A;  2FJE A;  4A6N B;  2VVL A;  3KLJ A;  4O5Q A;  2YLX A;  3L8K A;  1S2Y A;  2XLU A;  3KPK A;  3ALL A;  3KKJ A;  2V3A A;  1H83 A;  5EB5 A;  3F8R A;  3QSS A;  1GRF A;  4E0V A;  4H4W A;  4OPC A; 
#chains in the Genus database with same CATH homology
 3GYJ A;  4KPR A;  3RP6 A;  1CBO A;  2C64 A;  3IHG A;  2BXR A;  2WOI A;  1NAA A;  1GPE A;  3LAD A;  1VDC A;  3OC4 A;  4B67 A;  2ZZ0 A;  3QJ4 A;  3BNU A;  2EQ7 A;  2OAM A;  4H50 A;  2CUL A;  5CQF A;  4C77 A;  3CGC A;  3URH A;  4TM3 A;  2VZ2 A;  3QFA A;  1KF6 A;  5DBJ A;  2VOU A;  5KOW A;  2C67 A;  3UOZ A;  4YKG A;  2ACZ A;  3ADA B;  1NEK A;  3COX A;  3P4R A;  4GCM A;  1ZKQ A;  1EL8 A;  1NDA A;  2BK5 A;  3NNE A;  4PAA A;  2XFN A;  3DGH A;  2WPC A;  5HYM A;  4Z44 A;  2UZZ A;  1GRG A;  2C76 A;  4RG4 A;  3UKQ A;  1TDK A;  1TDE A;  3CMM A;  4XXG A;  5HXI A;  3UTF A;  4YXD A;  2FJB A;  2RAB A;  1B37 A;  1TYT A;  3AYJ A;  3NH3 X;  4G74 A;  4OPT A;  3NTD A;  1EBD A;  2AQJ A;  1IUU A;  2CFY A;  4JY2 A;  1LQU A;  3ICT A;  4C5O A;  2C72 A;  3ISH A;  4EQX A;  4CNK A;  1LTX R;  4NNJ A;  1IUW A;  1L9C A;  3GD3 A;  4CY6 A;  2YG7 A;  1IUX A;  1TYP A;  2FJD A;  1PJ5 A;  4RG3 A;  3Q9T A;  1FEC A;  4K8D A;  1ZP0 A;  1IUS A;  2APG A;  1M64 A;  4LA1 A;  3P4S A;  4JY3 A;  3G5R A;  4CCR A;  1CJ3 A;  1OJD A;  4H2P A;  4J34 A;  1ZDL A;  3DK9 A;  4K5S A;  1GEU A;  1GSN A;  4CRT A;  4M52 A;  2XLP A;  5KXJ A;  2GMJ A;  4O5U A;  4TM1 A;  2FJA A;  3UKP A;  2TPR A;  3GRS A;  3P4P A;  2XVI A;  1GAL A;  4CY8 A;  3M13 A;  2YVG A;  3G5Q A;  3QVR A;  4FX9 A;  4TLX A;  4JDR A;  3CNJ A;  3AYL A;  1Y56 A;  1H82 A;  2B9Y A;  2BCG G;  4II3 A;  1E1M A;  3UOV A;  3ALM A;  1H84 A;  4NTE A;  2YLR A;  3UTH A;  3AEE A;  3CPI G;  1K0J A;  1QO8 A;  4GAV A;  4A6N A;  3PO7 A;  4X9N A;  2WEU A;  3NHO X;  2WDQ A;  3EPT A;  4U8K A;  4J33 A;  3DJD A;  2JB3 A;  1B4V A;  1H7X A;  4UDR A;  4GRT A;  1FEA A;  4HB9 A;  4A9W A;  1IUT A;  2GR3 A;  3AE4 A;  2B9W A;  5EOW A;  1PDH A;  5FS6 A;  4D03 A;  3I3L A;  4G9K A;  2R0G A;  1GER A;  4YT0 A;  3AE9 A;  2ARD A;  3VRB A;  2GR2 A;  4FK1 A;  4KX6 A;  3RNM A;  3ITJ A;  2BCP A;  5KMS A;  3ZDN A;  5BUK A;  2VRM A;  2WPF A;  4G6H A;  2C3C A;  2XYO A;  1KDG A;  1DJN A;  4IVO B;  1PBE A;  2GRT A;  4IVM B;  3CND A;  1N4W A;  3ZYX A;  4FDC B;  5C3J A;  4H4U A;  4NZH A;  4OPL A;  1JOA A;  2YLT A;  4Z26 A;  2BAC A;  1E1K A;  4OPU A;  1CJ2 A;  1D7L A;  3HYX A;  4GDP A;  3KPF A;  5KMQ A;  3NLC A;  4GDE A;  4YWO A;  3GYI A;  2QA2 A;  3H8I A;  1KSS A;  4ZCD A;  4Z24 A;  1L9D A;  4U8N A;  4AOX A;  3T31 A;  2R45 A;  2NVK X;  1CJC A;  3BNM A;  2ZBW A;  1CF3 A;  3DGZ A;  4H4V A;  3UOX A;  4WCT A;  5LV9 A;  2A89 A;  3FIM B;  2F5Z A;  2VVL G;  2Y6R A;  1N4U A;  3T14 A;  1DOD A;  4B64 A;  2Y6Q A;  2Q0L A;  4OPI A;  3UKA A;  2WP9 A;  4OCG A;  3BI5 A;  1H86 A;  2WU2 A;  3ALJ A;  1F8S A;  4BUR A;  3II4 A;  3SM8 A;  3BI4 A;  3V3N A;  2BAB A;  2W0H A;  2YVF A;  3V3O A;  1PS9 A;  4B65 A;  4B69 A;  1GV4 A;  2B7R A;  2V60 A;  4H2Q A;  1IJH A;  1JNR A;  3RED A;  2R4E A;  4PAB A;  3T2Y A;  3I6D A;  3OZ2 A;  1GND A;  1E1N A;  4A65 A;  5BUL A;  1CL0 A;  2GAG B;  2E1M A;  5FMH A;  1V59 A;  1BGJ A;  2TMD A;  1RP0 A;  3CNT A;  1O94 A;  5JCL A;  5EBK A;  4YTN A;  3NK1 X;  1GRT A;  4OPG A;  3CGE A;  4BK2 A;  3GMB A;  5GRT A;  1NHS A;  1D4E A;  1BZL A;  1JNZ A;  1B5Q A;  1M6I A;  5KMR A;  2CVJ A;  3C4A A;  1K0I A;  3QVP A;  1ZMC A;  2YM1 A;  3NKS A;  3DME A;  1E6E A;  1PBB A;  2C3D A;  1YQ3 A;  1CC6 A;  2YM2 A;  2V61 A;  2WPE A;  3FG2 P;  4U8M A;  1ZK7 A;  3AB1 A;  3IWA A;  4IA5 A;  4Y4M A;  3B6D A;  4B68 A;  2XDO A;  4DSG A;  4I58 A;  3ABV A;  1LQT A;  2Q6U A;  4EQW A;  1OJC A;  4B63 A;  3EAN A;  3BHF A;  4TLZ A;  5KWF A;  3M12 A;  4GAP A;  2X3N A;  2R9Z A;  2BC1 A;  2R0P A;  2WQY A;  5JCN A;  2C75 A;  4XWR A;  1FL2 A;  1JRY A;  1DJQ A;  3T0K A;  1TDO A;  2YG5 A;  3AEB A;  2V6O A;  1LVL A;  1JU2 A;  2XVJ A;  3LOV A;  2JK6 A;  3NN6 X;  2BC0 A;  5FS9 A;  1DOC A;  2Q7V A;  2WU5 A;  4OPD A;  3P4Q A;  1PN0 A;  1Q9I A;  2X8H A;  1DNC A;  3F8P A;  5HHF A;  2E4G A;  3GWF A;  2O9Z A;  2C73 A;  3VRD B;  2NPX A;  4H4R A;  3SZ0 A;  3AEA A;  4ECH A;  4GR1 A;  1NHR A;  3AXB A;  2OA1 A;  4YTM A;  5J7X A;  2R4J A;  2H88 A;  4EM3 A;  3SY4 A;  2BS3 A;  1CC4 A;  1DOB A;  2FBW A;  2XVF A;  4I59 A;  3SFD A;  2J3N A;  2V3B A;  4K7Z A;  3HYV A;  1RYI A;  2XLS A;  3FMW A;  4U8O A;  3IF9 A;  4A79 A;  2WHD A;  4A7A A;  4C3X A;  2V5Z A;  3AE7 A;  1N1P A;  4USR A;  4GF7 A;  4G6G A;  4RSL A;  4B1B A;  3H8L A;  4YSZ A;  3NYF A;  1COY A;  2QCU A;  3AEF A;  1REO A;  2X8C A;  2HQM A;  4J31 A;  5U1O A;  1S3B A;  5KNL A;  4OVI A;  1H81 A;  4U2T A;  4H4T A;  4YKF A;  1B8S A;  3NG7 X;  3EAO A;  2YAU A;  2C4C A;  2DKI A;  2X8G A;  3K30 A;  4NWZ A;  1K0L A;  1GTE A;  5IQ4 A;  2RGH A;  1GET A;  2GH5 A;  3NN0 X;  3VR9 A;  1P2H A;  1YY5 A;  2BRY A;  2C65 A;  4JQ9 A;  2QA1 A;  3GD4 A;  5IQ1 A;  4AP3 A;  2EQ8 A;  3WE0 A;  4U8P A;  5KVH A;  1NG4 A;  2OLN A;  4APN A;  2YR6 A;  1PJ7 A;  1XHC A;  5KRQ A;  3ICS A;  3LJP A;  1ZMD A;  3NYC A;  2GQF A;  4MJW A;  2OAL A;  4X4J A;  3NRN A;  3NTA A;  4JNQ A;  2BS2 A;  1XPQ A;  2BS4 A;  3JSK A;  1ELI A;  1TDF A;  2ZZC A;  3PS9 A;  1L0V A;  1BGN A;  2IID A;  2YG3 A;  5U63 A;  3F8D A;  1PXA A;  2R46 A;  2GVC A;  4K22 A;  2WOW A;  3NK2 X;  1NPX A;  1GRH A;  5IPY A;  5M10 A;  5EB4 A;  1PXB A;  1MOK A;  3E1T A;  2XFP A;  1CJ4 A;  1X31 B;  2WDR A;  1GTH A;  2JB2 A;  4K5R A;  3NGC X;  2YR5 A;  3CNP A;  1GXF A;  1W4X A;  3DH9 A;  4YTP A;  1JRZ A;  3B3R A;  3DA1 A;  3SZW A;  1S2Q A;  4EMI A;  4WX1 A;  2PYX A;  3SGL A;  3UKH A;  3CIR A;  3UKL A;  2XFO A;  4AP1 A;  2BRA A;  4LU6 A;  1CC2 A;  1Q1W A;  4CCQ A;  1F8R A;  2WES A;  1VQW A;  2WDV A;  3SZC A;  4EQR A;  4Z2U A;  2XFQ A;  3DJG X;  2YVJ A;  5CKU A;  3K7Q X;  1XAN A;  3NK0 X;  4EIQ A;  3VQR A;  1QJD A;  4BJZ A;  3DK4 A;  2GQW A;  1O95 A;  3HYW A;  3RP7 A;  1GES A;  1OJT A;  1GRB A;  3CTY A;  3ATQ A;  1DXL A;  4H4S A;  2YLS A;  3BI2 A;  2I0Z A;  2RGJ A;  5BVA A;  4H7U A;  3S5W A;  4DNA A;  5KOX A;  1CHU A;  2WP6 A;  3UTG A;  3UP5 A;  1GOS A;  1TDN A;  2JAE A;  4UDQ A;  4USQ A;  1E1L A;  2VRL A;  2PHH A;  3LZX A;  3RHA A;  4C3Y A;  3IC9 A;  1F3P A;  1S3E A;  2XVE A;  3AE3 A;  2DKH A;  4G73 A;  1VRQ B;  4GUV A;  3Q6J A;  1PBF A;  1LV0 A;  3G5S A;  2YLZ A;  3AWI A;  1E7P A;  2YG4 A;  2QAE A;  4U8L A;  1D4C A;  4XWZ A;  2JBV A;  4EMW A;  2VQB A;  3C96 A;  3K7T A;  3QSE A;  3LZW A;  1L9E A;  2OLO A;  1D7Y A;  3P9U A;  5FS8 A;  1LPF A;  2XLR A;  3FPZ A;  2CDU A;  3T2K A;  4IA6 A;  3KD9 A;  4AT0 A;  1UKV G;  3GDP A;  4YSY A;  2GR0 A;  1GT8 A;  3UTE A;  4BJY A;  1VG0 A;  1FEB A;  3DJE A;  2X99 A;  5KVI A;  3BHK A;  4U8J A;  3VRA A;  1YQZ A;  3AE6 A;  4N9X A;  2EQ9 A;  2Q0K A;  1KFY A;  3FBS A;  1H7W A;  2WBA A;  5FS7 A;  3T37 A;  1PHH A;  3AYI A;  1P2E A;  1TRB A;  2C66 A;  4U8I A;  3QSM A;  2B7S A;  4J2W A;  4EM4 A;  2Z5X A;  1NHQ A;  2A87 A;  1XDI A;  3AE1 A;  1YQ4 A;  3CGB A;  4YSH A;  3AD7 B;  5GSN A;  4D04 A;  4Z2R A;  4CNJ A;  4J57 A;  3O0H A;  1JEH A;  1ZX9 A;  3ATR A;  2BA9 A;  2GAH B;  4A5L A;  4AOS A;  2GEW A;  4BK1 A;  3SX6 A;  1Y0P A;  1ZOV A;  2VQ7 A;  3GRT A;  1BF3 A;  2IVE A;  2YG6 A;  3P1W A;  3GMC A;  3AE2 A;  2GV8 A;  4ICY A;  4Y4N A;  3UP4 A;  4BV6 A;  4C74 A;  1VG9 A;  1SEZ A;  1NEN A;  5JCI A;  1NG3 A;  2BK4 A;  2JKC A;  4II2 A;  1ZY8 A;  4NTC A;  4ADW A;  3SZF A;  3CPJ G;  1GRA A;  3EF6 A;  3K7M X;  1FCD A;  4IV9 A;  4REK A;  4Y4L A;  4EQS A;  1EL5 A;  1E39 A;  3DJJ A;  2R0C A;  3GWD A;  1F6M A;  3M0O A;  5U25 A;  3SQP A;  3UKK A;  2XFU A;  4JN9 A;  2GMH A;  1MO9 A;  4LII A;  4X9M A;  1FOH A;  2WET A;  4EIP A;  1QLB A;  4H2R A;  4TM4 A;  1DOE A;  3H4K A;  2ZZB A;  3KA7 A;  1OJA A;  1Q1R A;  3CPH G;  2RGO A;  2YR4 A;  3UOY A;  4Z25 A;  3D8X A;  4NEW A;  5TR3 A;  4ZCC A;  4BK3 A;  3R9U A;  3AE8 A;  4UDP A;  3QFB A;  4H2N A;  2WP5 A;  2AAQ A;  4H4Q A;  5KMP A;  3AD9 B;  3VR8 A;  2GF3 A;  3AEC A;  3CN8 A;  3SYI A;  2VVM A;  3NYE A;  3UCL A;  3T2Z A;  3GYX A;  1KNR A;  1BKW A;  4H4Z A;  1OJ9 A;  1YKJ A;  3ICR A;  4TM0 A;  1HYU A;  4K2X A;  3S61 A;  4AT2 A;  1EL7 A;  4HA6 A;  2B76 A;  4DSH A;  5BRT A;  3AEG A;  2BYB A;  5ER0 A;  4FK1 C;  1ONF A;  1IUV A;  3CGD A;  4J36 A;  3UKF A;  1PXC A;  2XLT A;  4A99 A;  4B66 A;  1D4D A;  1F8W A;  3AED A;  3AE5 A;  3SFE A;  3NT6 A;  4Z43 A;  3SXI A;  2YWL A;  5L46 A;  1D5T A;  1KNP A;  2EQ6 A;  3IHM A;  2A8X A;  4H4P A;  1LJ1 A;  1EL9 A;  3C4N A;  4YSX A;  2C7G A;  4J56 A;  2GB0 A;  3AD8 B;  4ZN0 A;  4JNA A;  5JCK A;  1NHP A;  3D1C A;  1BWC A;  1RSG A;  2IVD A;  1KSU A;  2XVH A;  5HY5 A;  4NTD A;  2JB1 A;  4CBQ A;  4Z2T A;  2C70 A;  4NEV A;  4DGK A;  3LB8 A;  1ZOY A;  4U2S A;  2YQU A;  3DK8 A;  2WOV A;  3HZL A;  1N4V A;  1O5W A;  3GSI A;  3CNS A;  3L1R A;  5C2T A;  1GRE A;  2BXS A;  3NIX A;  4H4X A;  5JCM A;  4EMJ A;  2YLW A;  2X50 A;  3KU9 A;  3KVE A;  5J60 A;  4H4Y A;  5M0Z A;  2GR1 A;  3RP8 A;  2H89 A;  1PBD A;  2WS3 A;  2B9X A;  1JRX A;  2Z5Y A;  1H6V A;  1MXT A;  3PVC A;  3V76 A;  4P9S A;  1PJ6 A;  3GDN A;  3LXD A;  1K4Q A;  1Y56 B;  2E5V A;  1PBC A;  2XCG A;  4UP3 A;  2AR8 A;  2BK3 A;  1AOG A;  1Z6L A;  4U2L A;  2FJE A;  4A6N B;  2VVL A;  3KLJ A;  4O5Q A;  2YLX A;  3L8K A;  1S2Y A;  2XLU A;  3KPK A;  3ALL A;  3KKJ A;  2V3A A;  1H83 A;  5EB5 A;  3F8R A;  3QSS A;  1GRF A;  4E0V A;  4H4W A;  4OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...