1F8SA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
482
structure length
482
Chain Sequence
NPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-AMINO ACID OXIDASE
publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
total genus 176
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8sA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8sA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8sA01
3SFEA 1BWCA 3L1RA 1GTEA 2R4JA 3KU9A 4Y4NA 4EQWA 2WQYA 2X99A 2V3AA 2BCGG 1Y56B 1IUXA 1TDEA 3BHKA 4U8MA 3V3NA 2OAMA 1NHSA 1W4XA 2XLPA 3NT6A 3NYCA 2APGA 2WDVA 2WOWA 1Q1RA 3G5QA 1VG0A 3IF9A 3G5SA 3LXDA 3I3LA 2A87A 2WP6A 4AT0A 3KLJA 1XDIA 3GDNA 1MO9A 4KPRA 3II4A 2X8CA 4J34A 3AEDA 4OPTA 4ZCDA 4GF7A 2GEWA 1REOA 1FECA 4JNQA 3AD8B 4CY8A 3R9UA 3ISHA 1XHCA 1CBOA 5EB5A 3L8KA 4J56A 1BGJA 3DA1A 3AEFA 3OZ2A 2A8XA 4Z26A 3ICTA 4TM4A 2J3NA 1PHHA 2QCUA 3T37A 4I59A 1NG4A 2XYOA 1LV0A 5HXIA 2X8GA 2XVFA 4HA6A 2WPCA 3VR8A 1NG3A 3AB1A 3URHA 5IQ4A 1DOBA 4J57A 1GERA 1FEAA 2FJDA 4K7ZA 4WX1A 2X50A 5JCLA 2YG7A 4C3YA 3P4SA 2OLOA 2FJBA 2PYXA 4K2XA 1JNZA 3BI2A 4DSHA 1GTHA 3SM8A 4C5OA 2WPFA 1FL2A 2BC1A 1MOKA 3AEGA 3NH3X 4GR1A 1L9DA 4JY3A 5LV9A 2CDUA 3BHFA 3LB8A 1ZKQA 2W0HA 5DBJA 5KRQA 4YSXA 3CPHG 1PDHA 4JN9A 2ZZBA 2R4EA 1TRBA 3FMWA 4X4JA 1EL9A 1L9EA 4U2TA 4AP1A 4EIPA 5KOWA 3GYJA 2YLWA 1KNRA 5HY5A 2GR0A 2RGHA 3I6DA 4IV9A 2E5VA 4K5SA 4AOXA 2BABA 3RNMA 2XFQA 2C75A 1HYUA 2BS3A 1D7YA 2I0ZA 2YQUA 3ICRA 4H2RA 3IC9A 4UP3A 2XLTA 4EQRA 1VQWA 3PVCA 5FS7A 4EQXA 5FS6A 2DKHA 2YG3A 3ATQA 3CNTA 4AT2A 2Q0KA 3G5RA 4H4QA 1F8WA 1ZX9A 2C7GA 2R46A 1FEBA 4TM3A 2IVEA 3AEAA 1K4QA 3LJPA 1H84A 1D7LA 1PN0A 4D04A 1NHPA 1S3BA 2GAGB 3DJDA 1PS9A 3P4PA 4CRTA 3Q9TA 4GUVA 4CNJA 2C64A 5C2TA 3DGZA 1GESA 4Z2RA 3KVEA 2GMHA 3NGCX 4A5LA 1F8SA 2PHHA 2BXSA 3M0OA 5FS8A 1IUVA 1NHQA 3QFBA 1YQ3A 4X9MA 4EM4A 3M13A 1JEHA 4YTPA 3UOXA 2GQFA 1H86A 1DNCA 1M6IA 1ELIA 2ZZCA 2O9ZA 3D8XA 3CGDA 5IQ1A 4PABA 4TM1A 3D1CA 2BACA 4NTDA 1GSNA 1CJ4A 3GMBA 3QFAA 5BRTA 2Y6QA 4FDCB 4P9SA 1GETA 3AYIA 3VRBA 2Q6UA 3M12A 3K7TA 3AE2A 1CJCA 1CL0A 1PXBA 4RG4A 3UKAA 1ZOYA 3DK8A 4H4YA 1OJ9A 3ABVA 4OPDA 4BK1A 3LZXA 2XFUA 5JCNA 3FIMB 1B37A 4GCMA 4NZHA 2EQ8A 4EMIA 3QJ4A 5TR3A 1Q9IA 4RG3A 4H7UA 3UKLA 1X31B 2WP9A 4AOSA 3IHGA 3QSSA 2WDQA 1KNPA 5U63A 1KSUA 1VG9A 4YSHA 1GRTA 2H88A 4NTEA 4Z2UA 2C65A 4K5RA 4A6NB 1MXTA 5FS9A 2YG6A 2YAUA 4B69A 3COXA 1F6MA 4Z24A 2IVDA 3VQRA 3NLCA 2YR4A 1E7PA 3K7MX 4JDRA 4NEVA 1N1PA 4A9WA 1DOCA 3CGCA 3GWFA 2B9WA 1OJAA 3ALMA 5U25A 4XWZA 4USQA 4A65A 2XVJA 2V5ZA 2E1MA 2XFNA 1RP0A 3AEBA 5BUKA 4U8LA 4UDQA 4EIQA 1NEKA 2FJAA 3UKHA 1DOEA 2YLSA 4Y4MA 4AP3A 5ER0A 2R45A 4OVIA 4DSGA 1D5TA 3DH9A 4J31A 4IA5A 3AE1A 4LIIA 1EL5A 5KXJA 1ZMCA 4NTCA 1JNRA 4ADWA 3AE7A 4FX9A 4C77A 3NNEA 3F8DA 3LOVA 3CIRA 3CNDA 1JRXA 2B76A 1QJDA 3GDPA 3CGBA 1EBDA 1BZLA 2CVJA 2YG5A 1RYIA 1NENA 1P2EA 1P2HA 5EBKA 3C4AA 3K7QX 1PBDA 2V61A 4H50A 1YY5A 1B8SA 5JCIA 1F3PA 1E39A 2AR8A 3GSIA 2GR2A 3REDA 1ZOVA 5CQFA 5EB4A 4H4SA 4XWRA 1O5WA 1V59A 4YWOA 4JQ9A 3K30A 4H4VA 2B9YA 4K22A 4J33A 2YVGA 1OJTA 2B9XA 3VRDB 1IUWA 1XANA 1CHUA 2VRLA 1IUUA 3RP6A 1GT8A 4J36A 3GRSA 3GWDA 3S61A 1CC6A 1O94A 3AD9B 3FBSA 4YTMA 4Y4LA 3EAOA 1JOAA 2BCPA 4I58A 3F8PA 1GRGA 2C67A 2XFOA 4OPUA 3UTFA 4YXDA 4TM0A 1ZDLA 2GQWA 2TPRA 2XFPA 4TLXA 2GH5A 3UOYA 2BC0A 4U8IA 4BURA 3P9UA 3CNPA 3AE9A 1BF3A 3V76A 3H8LA 1TDNA 2BK5A 1TYPA 1H82A 1OJDA 1EL8A 2TMDA 2C73A 1S3EA 4H2QA 3FPZA 5KVHA 1ZY8A 2NVKX 5GSNA 5JCMA 4U8KA 2WEUA 1ONFA 2Z5XA 1KDGA 1DXLA 2WP5A 2VVMA 4CNKA 2B7RA 2OALA 2WHDA 2BS4A 1IUTA 3BI4A 2OLNA 4CY6A 3ITJA 4YSZA 2JB1A 3V3OA 2YG4A 5CKUA 1B4VA 1E1KA 5BVAA 2JAEA 2NPXA 2C3CA 1QO8A 2CULA 3BI5A 2HQMA 2XVIA 3AYLA 4CCRA 4U2SA 4O5UA 2C76A 3GD4A 3NN6X 1CJ3A 1PBEA 2XLSA 3NG7X 5BULA 3SGLA 4M52A 1GOSA 3B3RA 3UCLA 4K8DA 3NK2X 1PXAA 1GALA 3NTAA 2V60A 4U8OA 3UP4A 2BXRA 2WDRA 1KF6A 1N4VA 2YWLA 3AWIA 2C70A 4H4PA 4UDPA 1CJ2A 3ADAB 2R9ZA 1ZP0A 3FG2P 4J2WA 5U1OA 1OJCA 3KPFA 1Q1WA 4H4XA 1CF3A 4XXGA 3KA7A 4EMJA 2QA1A 2IIDA 4U8JA 3AECA 2RABA 1YQZA 3HZLA 1H81A 4A99A 4EM3A 4H4UA 1Y56A 1DODA 1PJ5A 3UOZA 2R0CA 2H89A 5KWFA 2F5ZA 1VRQB 4GRTA 2WBAA 3WE0A 1GPEA 1CC4A 4DGKA 1H7XA 4KX6A 3CPIG 1BKWA 2GB0A 2WETA 2XVEA 3NIXA 1JRZA 2Q0LA 1F8RA 4U2LA 3ZDNA 1LQTA 1S2QA 3O0HA 3QVRA 3RP8A 4OPGA 3EF6A 4RSLA 1GRAA 3NK1X 3RP7A 3UTHA 1GEUA 4C74A 4NEWA 4D03A 1DJNA 4H4WA 1TDKA 4LA1A 3VRAA 1FOHA 1RSGA 2BK3A 1IUSA 3CNJA 3GRTA 3H4KA 1YQ4A 3SFDA 4TLZA 2C66A 4H2NA 1AOGA 2VOUA 4JNAA 1FCDA 1D4DA 2YLRA 4ZN0A 3AE3A 2VVLG 2RGOA 2YLTA 1B5QA 3QSEA 2VZ2A 1LPFA 3P1WA 1PBCA 2GVCA 1YKJA 3ALLA 4USRA 1K0LA 2A89A 3CN8A 4BJZA 1K0IA 3BNMA 4X9NA 4OCGA 2V6OA 3KKJA 2JB3A 2YM1A 2QA2A 3UKKA 3AXBA 2GR1A 3LZWA 1H7WA 5M10A 3E1TA 4ECHA 2ZBWA 3QSMA 4Z43A 5HYMA 1DJQA 2AAQA 4EMWA 2C3DA 1NAAA 4FK1A 3IWAA 4OPCA 1LJ1A 1K0JA 2VRMA 1GXFA 3NTDA 2XVHA 3ZYXA 4N9XA 2RGJA 3AYJA 2BA9A 1D4EA 2UZZA 2YLZA 3GYIA 3AE8A 2XLUA 1KFYA 2GMJA 3S5WA 3DJEA 1Z6LA 4FK1C 1KSSA 3CTYA 3GD3A 2WS3A 1TDOA 4MJWA 3SQPA 2BYBA 4ICYA 2X8HA 3UKQA 2XDOA 4E0VA 3EANA 2VQBA 1QLBA 1GRHA 2WESA 2GF3A 4YT0A 4OPIA 1ZK7A 1D4CA 2ZZ0A 2EQ9A 5JCKA 4YTNA 4B64A 4GDPA 4A7AA 1PJ6A 1XPQA 1JRYA 1GRBA 2ACZA 1PBFA 2Z5YA 4REKA 5C3JA 4DNAA 3JSKA 1NHRA 3NHOX 2CFYA 1M64A 4O5QA 4CCQA 3P4QA 1PXCA 2JB2A 3DJJA 2V3BA 4IA6A 3UTEA 3GMCA 4BV6A 4H4RA 2VVLA 1ZMDA 2EQ6A 1BGNA 1LQUA 5HHFA 4BK3A 3UP5A 2FJEA 3RHAA 3QVPA 2R0GA 2Y6RA 5GRTA 2GV8A 1COYA 1NDAA 3NK0X 4UDRA 2YR6A 3VR9A 4BJYA 1TDFA 2WU5A 4H4ZA 5KOXA 2YVJA 4U8NA 3CGEA 2YM2A 2B7SA 2WOIA 4A79A 2WPEA 3OC4A 2JKCA 4GDEA 2JBVA 1TYTA 3UKPA 1JU2A 3AEEA 2ARDA 5J7XA 3UTGA 1L9CA 3AE5A 3UOVA 1VDCA 1IJHA 4B66A 3UKFA 4WCTA 2WU2A 4ZCCA 1CC2A 1LTXR 4B63A 4B65A 5FMHA 3DJGX 4JY2A 3F8RA 5L46A 3H8IA 2E4GA 4Z2TA 3PO7A 2YR5A 3C4NA 3CPJG 4PAAA 5EOWA 1E1LA 4A6NA 1GRFA 3NKSA 3BNUA 3NRNA 3AE4A 1Y0PA 1NPXA 3AE6A 4CBQA 4YKGA 2AQJA 4IVMB 3DK9A 3AD7B 1PJ7A 1H83A 3P4RA 3DK4A 4APNA 2QAEA 3LADA 2YVFA 4Z44A 4B68A 4BK2A 5IPYA 2FBWA 3B6DA 2BK4A 3NYEA 4Z25A 3NYFA 4U8PA 4B67A 2DKIA 2EQ7A 3DMEA 2Q7VA 3PS9A 1E1MA 1N4WA 2JK6A 1S2YA 4H4TA 3ATRA 1SEZA 2GR3A 1H6VA 1EL7A 1UKVG 1E1NA 4YSYA 4B1BA 1GREA 1GV4A 2GRTA 3EPTA 1PBBA 4IVOB 1L0VA 2X3NA 1O95A 1GNDA 4C3XA 2BS2A 5J60A 3ICSA 5KVIA 3ALJA 3Q6JA 2YLXA 3KD9A 1E6EA 3DGHA 2GAHB 2C72A 2XCGA 4EQSA 1LVLA 1N4UA 2XLRA 4LU6A 3IHMA 4H2PA 2WOVA 4HB9A 4OPLA 4YKFA 3C96A 2R0PA 3NN0X 2OA1A 3CNSA 5M0ZA 2VQ7A
chains in the Genus database with same CATH superfamily
3SFEA 1BWCA 3L1RA 1GTEA 2R4JA 3KU9A 4Y4NA 4EQWA 2WQYA 2X99A 2V3AA 2BCGG 1Y56B 1IUXA 1TDEA 3BHKA 4U8MA 3V3NA 2OAMA 1NHSA 1W4XA 2XLPA 3NT6A 3NYCA 2APGA 2WDVA 2WOWA 1Q1RA 3G5QA 1VG0A 3IF9A 3G5SA 3LXDA 3I3LA 2A87A 2WP6A 4AT0A 3KLJA 1XDIA 3GDNA 1MO9A 3SZ0A 4KPRA 3II4A 2X8CA 4J34A 3AEDA 4OPTA 4ZCDA 4GF7A 2GEWA 1REOA 1FECA 4JNQA 3AD8B 4CY8A 3R9UA 3ISHA 1XHCA 1CBOA 5EB5A 3L8KA 4J56A 1BGJA 3DA1A 4II2A 3AEFA 3OZ2A 2A8XA 4Z26A 3ICTA 4TM4A 2J3NA 1PHHA 2QCUA 3T37A 4I59A 1NG4A 2XYOA 1LV0A 5HXIA 2X8GA 2XVFA 4HA6A 2WPCA 3VR8A 1NG3A 3AB1A 3URHA 5IQ4A 1DOBA 4J57A 1GERA 1FEAA 2FJDA 4K7ZA 4WX1A 2X50A 5JCLA 2YG7A 4C3YA 3P4SA 2OLOA 2FJBA 2PYXA 4K2XA 1JNZA 3BI2A 4DSHA 1GTHA 3SM8A 4C5OA 2WPFA 1FL2A 2BC1A 3SXIA 1MOKA 3AEGA 3NH3X 4GR1A 1L9DA 4JY3A 4NNJA 5LV9A 2CDUA 3BHFA 3T0KA 3LB8A 1ZKQA 2W0HA 5DBJA 5KRQA 4YSXA 3CPHG 1PDHA 4JN9A 2ZZBA 2R4EA 1TRBA 3FMWA 4X4JA 1EL9A 1L9EA 4U2TA 4AP1A 4EIPA 5KOWA 3GYJA 2YLWA 1KNRA 5HY5A 2GR0A 2RGHA 3I6DA 4IV9A 2E5VA 4K5SA 4AOXA 2BABA 3RNMA 3SYIA 4G74A 2XFQA 2C75A 1HYUA 2BS3A 1D7YA 2I0ZA 2YQUA 3ICRA 4H2RA 3IC9A 4UP3A 2XLTA 3SX6A 1VQWA 3PVCA 5FS7A 4EQRA 5FS6A 2DKHA 2YG3A 3ATQA 3SZFA 3CNTA 4AT2A 2Q0KA 3G5RA 4H4QA 1F8WA 1ZX9A 2C7GA 2R46A 1FEBA 4TM3A 2IVEA 3AEAA 1K4QA 3LJPA 1H84A 1D7LA 1PN0A 4D04A 1NHPA 4G73A 1S3BA 2GAGB 3DJDA 1PS9A 3P4PA 4CRTA 3Q9TA 4GUVA 4CNJA 2C64A 5C2TA 3DGZA 1GESA 4Z2RA 3KVEA 2GMHA 3NGCX 4A5LA 1F8SA 2PHHA 2BXSA 3M0OA 5FS8A 1IUVA 1NHQA 3QFBA 1YQ3A 4X9MA 4EM4A 3M13A 1JEHA 4YTPA 3UOXA 2GQFA 1H86A 1DNCA 1M6IA 1ELIA 2ZZCA 2O9ZA 3D8XA 3CGDA 5IQ1A 4PABA 4TM1A 3D1CA 2BACA 4NTDA 1GSNA 1CJ4A 3GMBA 3QFAA 5BRTA 2Y6QA 4FDCB 4P9SA 1GETA 3AYIA 3VRBA 2Q6UA 3M12A 3K7TA 3AE2A 1CJCA 1CL0A 1PXBA 4RG4A 3UKAA 1ZOYA 3DK8A 4H4YA 1OJ9A 3ABVA 4OPDA 4BK1A 3LZXA 2XFUA 5JCNA 3FIMB 1B37A 4GCMA 4NZHA 2EQ8A 4EMIA 3QJ4A 5TR3A 1Q9IA 4RG3A 4H7UA 3UKLA 1X31B 2WP9A 5KMSA 4AOSA 3IHGA 3QSSA 2WDQA 1KNPA 5U63A 1KSUA 1VG9A 4YSHA 3KPKA 1GRTA 2H88A 4NTEA 4Z2UA 2C65A 4K5RA 4A6NB 1MXTA 5FS9A 2YG6A 2YAUA 4B69A 3COXA 1F6MA 4Z24A 2IVDA 3VQRA 3NLCA 2YR4A 1E7PA 3K7MX 4JDRA 4NEVA 3T2KA 1N1PA 4A9WA 1DOCA 3CGCA 3GWFA 2B9WA 1OJAA 3ALMA 5U25A 4XWZA 4USQA 4A65A 2XVJA 2V5ZA 2E1MA 2XFNA 1RP0A 3AEBA 5BUKA 4U8LA 4UDQA 4EIQA 1NEKA 2FJAA 3UKHA 1DOEA 2YLSA 2BRYA 4Y4MA 4AP3A 5ER0A 2R45A 4OVIA 4DSGA 1D5TA 3DH9A 4J31A 4IA5A 3AE1A 4LIIA 1EL5A 5KXJA 1ZMCA 4NTCA 1JNRA 3GYXA 4ADWA 3AE7A 3HYWA 4FX9A 4C77A 3NNEA 3F8DA 3LOVA 3CIRA 3CNDA 1JRXA 2B76A 1QJDA 3GDPA 3CGBA 1EBDA 1BZLA 2CVJA 2YG5A 1RYIA 1NENA 1P2EA 1P2HA 3T2ZA 5EBKA 3C4AA 3K7QX 1PBDA 2V61A 4H50A 1YY5A 1B8SA 5JCIA 1F3PA 1E39A 2AR8A 3GSIA 2GR2A 3REDA 1ZOVA 5CQFA 5EB4A 4H4SA 4XWRA 1O5WA 1V59A 4YWOA 4JQ9A 3K30A 4H4VA 2B9YA 4K22A 4J33A 2YVGA 1OJTA 2B9XA 3VRDB 1IUWA 1XANA 1CHUA 2VRLA 1IUUA 3RP6A 1GT8A 4J36A 3GRSA 3GWDA 3S61A 1CC6A 1O94A 3AD9B 3FBSA 4YTMA 4Y4LA 3EAOA 1JOAA 2BCPA 4I58A 3F8PA 1GRGA 2C67A 2XFOA 4OPUA 3UTFA 4YXDA 4TM0A 1ZDLA 2GQWA 2TPRA 2XFPA 4TLXA 2GH5A 3UOYA 2BC0A 4U8IA 4BURA 3P9UA 3CNPA 3AE9A 1BF3A 3V76A 3H8LA 1TDNA 2BK5A 1TYPA 1H82A 1OJDA 1EL8A 2TMDA 2C73A 1S3EA 4H2QA 3FPZA 5KVHA 1ZY8A 2NVKX 5GSNA 5JCMA 4U8KA 2WEUA 1ONFA 2Z5XA 1KDGA 1DXLA 2WP5A 2VVMA 4CNKA 2B7RA 2OALA 2WHDA 2BS4A 1IUTA 3BI4A 2OLNA 4CY6A 3ITJA 3HYVA 4YSZA 2JB1A 3V3OA 2YG4A 5CKUA 1B4VA 1E1KA 5BVAA 2JAEA 2NPXA 2C3CA 1QO8A 2CULA 3BI5A 2HQMA 2XVIA 3AYLA 4CCRA 4U2SA 4O5UA 2C76A 3GD4A 3NN6X 1CJ3A 1PBEA 2XLSA 3NG7X 5BULA 3SGLA 4M52A 1GOSA 3B3RA 3UCLA 4K8DA 3NK2X 1PXAA 1GALA 3NTAA 2V60A 4U8OA 5KMPA 3UP4A 2BXRA 2WDRA 1KF6A 1N4VA 2YWLA 3AWIA 2C70A 4H4PA 4UDPA 1CJ2A 3ADAB 2R9ZA 1ZP0A 3FG2P 4J2WA 5U1OA 1OJCA 3KPFA 1Q1WA 4H4XA 1CF3A 4XXGA 3KA7A 4EMJA 2QA1A 2IIDA 4U8JA 3AECA 2RABA 1YQZA 3HZLA 1H81A 4A99A 4EM3A 4H4UA 1Y56A 1DODA 1PJ5A 3UOZA 2R0CA 3T2YA 2H89A 5KWFA 2F5ZA 1VRQB 4GRTA 2WBAA 3WE0A 1GPEA 1CC4A 4DGKA 1H7XA 4KX6A 3CPIG 1BKWA 2GB0A 2WETA 2XVEA 3NIXA 1JRZA 2Q0LA 1F8RA 4U2LA 3ZDNA 1LQTA 1S2QA 3O0HA 3QVRA 3RP8A 4OPGA 3EF6A 4RSLA 1GRAA 3NK1X 3RP7A 3UTHA 5KNLA 1GEUA 4C74A 4NEWA 4D03A 1DJNA 4H4WA 1TDKA 4II3A 4LA1A 3VRAA 3T14A 1FOHA 1RSGA 2BK3A 1IUSA 3CNJA 3GRTA 3H4KA 1YQ4A 3SFDA 4TLZA 2C66A 4H2NA 1AOGA 2VOUA 4JNAA 1FCDA 1D4DA 2YLRA 4G9KA 4ZN0A 3AE3A 2VVLG 2RGOA 2YLTA 1B5QA 3QSEA 2VZ2A 1LPFA 3P1WA 1PBCA 2GVCA 1YKJA 3ALLA 4USRA 1K0LA 2A89A 3CN8A 4BJZA 4G6GA 1K0IA 3BNMA 4X9NA 4OCGA 2V6OA 3KKJA 2JB3A 2YM1A 2QA2A 3UKKA 3AXBA 2GR1A 3LZWA 1H7WA 5M10A 3E1TA 4ECHA 2ZBWA 3QSMA 4Z43A 5HYMA 1DJQA 2AAQA 4EMWA 2C3DA 1NAAA 4FK1A 3IWAA 4OPCA 1LJ1A 1K0JA 2VRMA 1GXFA 3SZWA 3NTDA 2XVHA 3ZYXA 4N9XA 2RGJA 3AYJA 2BA9A 1D4EA 2UZZA 2YLZA 3GYIA 3CMMA 3AE8A 2XLUA 1KFYA 2GMJA 3S5WA 3DJEA 1Z6LA 4FK1C 5KMRA 1KSSA 3CTYA 3GD3A 2WS3A 1TDOA 4MJWA 3SQPA 2BYBA 4ICYA 2X8HA 3UKQA 2XDOA 4E0VA 3EANA 2VQBA 1QLBA 1GRHA 2WESA 2GF3A 4YT0A 4OPIA 1ZK7A 1D4CA 2ZZ0A 2EQ9A 5JCKA 4YTNA 4B64A 4GDPA 4A7AA 4GAVA 1PJ6A 4G6HA 1XPQA 1JRYA 1GRBA 2ACZA 1PBFA 2Z5YA 4REKA 5C3JA 4DNAA 3JSKA 1NHRA 3NHOX 2CFYA 1M64A 4O5QA 4CCQA 3P4QA 1PXCA 2JB2A 3DJJA 2V3BA 4IA6A 3UTEA 3GMCA 4BV6A 4H4RA 2VVLA 1ZMDA 2EQ6A 1BGNA 1LQUA 5HHFA 4BK3A 3UP5A 2FJEA 3T31A 3RHAA 3QVPA 2R0GA 2Y6RA 5GRTA 2GV8A 1COYA 1NDAA 3NK0X 4UDRA 2YR6A 3VR9A 4BJYA 1TDFA 2WU5A 4H4ZA 5KOXA 2YVJA 4U8NA 3CGEA 2YM2A 2B7SA 2WOIA 4A79A 2WPEA 3OC4A 2JKCA 4GDEA 2JBVA 1TYTA 4GAPA 3UKPA 1JU2A 3AEEA 2ARDA 5J7XA 3UTGA 1L9CA 3AE5A 3UOVA 1VDCA 1IJHA 4B66A 3UKFA 4WCTA 2WU2A 4ZCCA 1CC2A 1LTXR 4B63A 4B65A 5FMHA 3DJGX 4JY2A 3F8RA 3SY4A 5L46A 2C4CA 3H8IA 2E4GA 4Z2TA 3PO7A 2YR5A 3C4NA 3CPJG 4PAAA 5EOWA 1E1LA 4A6NA 1GRFA 3NKSA 3BNUA 3NRNA 3AE4A 1Y0PA 1NPXA 3AE6A 4CBQA 4YKGA 2AQJA 4IVMB 3DK9A 3AD7B 1PJ7A 1H83A 3P4RA 3DK4A 4APNA 2QAEA 3LADA 2YVFA 4Z44A 4B68A 4BK2A 5IPYA 2FBWA 3SZCA 3B6DA 2BK4A 3NYEA 4Z25A 3NYFA 4U8PA 4B67A 2DKIA 2EQ7A 3DMEA 2Q7VA 3PS9A 1E1MA 1N4WA 2JK6A 1S2YA 4H4TA 3ATRA 1SEZA 3HYXA 4NWZA 2GR3A 1H6VA 1EL7A 1UKVG 1E1NA 4YSYA 4B1BA 1GREA 1GV4A 2GRTA 3EPTA 1PBBA 4IVOB 1L0VA 2X3NA 1O95A 1GNDA 2BRAA 4C3XA 2BS2A 5J60A 3ICSA 5KVIA 4EQXA 3ALJA 3Q6JA 2YLXA 3KD9A 1E6EA 3DGHA 2GAHB 2C72A 2XCGA 4EQSA 1LVLA 1N4UA 2XLRA 4LU6A 3IHMA 4H2PA 2WOVA 4HB9A 4OPLA 4YKFA 3C96A 2R0PA 3NN0X 2OA1A 3CNSA 5KMQA 5M0ZA 2VQ7A
chains in the Genus database with same CATH topology
3SFEA 1BWCA 3L1RA 1GTEA 2R4JA 3KU9A 4Y4NA 4EQWA 2WQYA 2X99A 2V3AA 2BCGG 1Y56B 1IUXA 1TDEA 3BHKA 4U8MA 3V3NA 2OAMA 1NHSA 1W4XA 2XLPA 3NT6A 3NYCA 2APGA 2WDVA 2WOWA 1Q1RA 3G5QA 1VG0A 3IF9A 3G5SA 3LXDA 3I3LA 2A87A 2WP6A 4AT0A 3KLJA 1XDIA 3GDNA 1MO9A 3SZ0A 4KPRA 3II4A 2X8CA 4J34A 3AEDA 4OPTA 4ZCDA 4GF7A 2GEWA 1REOA 1FECA 4JNQA 3AD8B 4CY8A 3R9UA 3ISHA 1XHCA 1CBOA 5EB5A 3L8KA 4J56A 1BGJA 3DA1A 4II2A 3AEFA 3OZ2A 2A8XA 4Z26A 3ICTA 4TM4A 2J3NA 1PHHA 2QCUA 3T37A 4I59A 1NG4A 2XYOA 1LV0A 5HXIA 2X8GA 2XVFA 4HA6A 2WPCA 3VR8A 1NG3A 3AB1A 3URHA 5IQ4A 1DOBA 4J57A 1GERA 1FEAA 2FJDA 4K7ZA 4WX1A 2X50A 5JCLA 2YG7A 4C3YA 3P4SA 2OLOA 2FJBA 2PYXA 4K2XA 1JNZA 3BI2A 4DSHA 1GTHA 3SM8A 4C5OA 2WPFA 1FL2A 2BC1A 3SXIA 1MOKA 3AEGA 3NH3X 4GR1A 1L9DA 4JY3A 4NNJA 5LV9A 2CDUA 3BHFA 3T0KA 3LB8A 1ZKQA 2W0HA 5DBJA 5KRQA 4YSXA 3CPHG 1PDHA 4JN9A 2ZZBA 2R4EA 1TRBA 3FMWA 4X4JA 1EL9A 1L9EA 4U2TA 4AP1A 4EIPA 5KOWA 3GYJA 2YLWA 1KNRA 5HY5A 2GR0A 2RGHA 3I6DA 4IV9A 2E5VA 4K5SA 4AOXA 2BABA 3RNMA 3SYIA 4G74A 2XFQA 2C75A 1HYUA 2BS3A 1D7YA 2I0ZA 2YQUA 3ICRA 4H2RA 3IC9A 4UP3A 2XLTA 3SX6A 1VQWA 3PVCA 5FS7A 4EQRA 5FS6A 2DKHA 2YG3A 3ATQA 3SZFA 3CNTA 4AT2A 2Q0KA 3G5RA 4H4QA 1F8WA 1ZX9A 2C7GA 2R46A 1FEBA 4TM3A 2IVEA 3AEAA 1K4QA 3LJPA 1H84A 1D7LA 1PN0A 4D04A 1NHPA 4G73A 1S3BA 2GAGB 3DJDA 1PS9A 3P4PA 4CRTA 3Q9TA 4GUVA 4CNJA 2C64A 5C2TA 3DGZA 1GESA 4Z2RA 3KVEA 2GMHA 3NGCX 4A5LA 1F8SA 2PHHA 2BXSA 3M0OA 5FS8A 1IUVA 1NHQA 3QFBA 1YQ3A 4X9MA 4EM4A 3M13A 1JEHA 4YTPA 3UOXA 2GQFA 1H86A 1DNCA 1M6IA 1ELIA 2ZZCA 2O9ZA 3D8XA 3CGDA 5IQ1A 4PABA 4TM1A 3D1CA 2BACA 4NTDA 1GSNA 1CJ4A 3GMBA 3QFAA 5BRTA 2Y6QA 4FDCB 4P9SA 1GETA 3AYIA 3VRBA 2Q6UA 3M12A 3K7TA 3AE2A 1CJCA 1CL0A 1PXBA 4RG4A 3UKAA 1ZOYA 3DK8A 4H4YA 1OJ9A 3ABVA 4OPDA 4BK1A 3LZXA 2XFUA 5JCNA 3FIMB 1B37A 4GCMA 4NZHA 2EQ8A 4EMIA 3QJ4A 5TR3A 1Q9IA 4RG3A 4H7UA 3UKLA 1X31B 2WP9A 5KMSA 4AOSA 3IHGA 3QSSA 2WDQA 1KNPA 5U63A 1KSUA 1VG9A 4YSHA 3KPKA 1GRTA 2H88A 4NTEA 4Z2UA 2C65A 4K5RA 4A6NB 1MXTA 5FS9A 2YG6A 2YAUA 4B69A 3COXA 1F6MA 4Z24A 2IVDA 3VQRA 3NLCA 2YR4A 1E7PA 3K7MX 4JDRA 4NEVA 3T2KA 1N1PA 4A9WA 1DOCA 3CGCA 3GWFA 2B9WA 1OJAA 3ALMA 5U25A 4XWZA 4USQA 4A65A 2XVJA 2V5ZA 2E1MA 2XFNA 1RP0A 3AEBA 5BUKA 4U8LA 4UDQA 4EIQA 1NEKA 2FJAA 3UKHA 1DOEA 2YLSA 2BRYA 4Y4MA 4AP3A 5ER0A 2R45A 4OVIA 4DSGA 1D5TA 3DH9A 4J31A 4IA5A 3AE1A 4LIIA 1EL5A 5KXJA 1ZMCA 4NTCA 1JNRA 3GYXA 4ADWA 3AE7A 3HYWA 4FX9A 4C77A 3NNEA 3F8DA 3LOVA 3CIRA 3CNDA 1JRXA 2B76A 1QJDA 3GDPA 3CGBA 1EBDA 1BZLA 2CVJA 2YG5A 1RYIA 1NENA 1P2EA 1P2HA 3T2ZA 5EBKA 3C4AA 3K7QX 1PBDA 2V61A 4H50A 1YY5A 1B8SA 5JCIA 1F3PA 1E39A 2AR8A 3GSIA 2GR2A 3REDA 1ZOVA 5CQFA 5EB4A 4H4SA 4XWRA 1O5WA 1V59A 4YWOA 4JQ9A 3K30A 4H4VA 2B9YA 4K22A 4J33A 2YVGA 1OJTA 2B9XA 3VRDB 1IUWA 1XANA 1CHUA 2VRLA 1IUUA 3RP6A 1GT8A 4J36A 3GRSA 3GWDA 3S61A 1CC6A 1O94A 3AD9B 3FBSA 4YTMA 4Y4LA 3EAOA 1JOAA 2BCPA 4I58A 3F8PA 1GRGA 2C67A 2XFOA 4OPUA 3UTFA 4YXDA 4TM0A 1ZDLA 2GQWA 2TPRA 2XFPA 4TLXA 2GH5A 3UOYA 2BC0A 4U8IA 4BURA 3P9UA 3CNPA 3AE9A 1BF3A 3V76A 3H8LA 1TDNA 2BK5A 1TYPA 1H82A 1OJDA 1EL8A 2TMDA 2C73A 1S3EA 4H2QA 3FPZA 5KVHA 1ZY8A 2NVKX 5GSNA 5JCMA 4U8KA 2WEUA 1ONFA 2Z5XA 1KDGA 1DXLA 2WP5A 2VVMA 4CNKA 2B7RA 2OALA 2WHDA 2BS4A 1IUTA 3BI4A 2OLNA 4CY6A 3ITJA 3HYVA 4YSZA 2JB1A 3V3OA 2YG4A 5CKUA 1B4VA 1E1KA 5BVAA 2JAEA 2NPXA 2C3CA 1QO8A 2CULA 3BI5A 2HQMA 2XVIA 3AYLA 4CCRA 4U2SA 4O5UA 2C76A 3GD4A 3NN6X 1CJ3A 1PBEA 2XLSA 3NG7X 5BULA 3SGLA 4M52A 1GOSA 3B3RA 3UCLA 4K8DA 3NK2X 1PXAA 1GALA 3NTAA 2V60A 4U8OA 5KMPA 3UP4A 2BXRA 2WDRA 1KF6A 1N4VA 2YWLA 3AWIA 2C70A 4H4PA 4UDPA 1CJ2A 3ADAB 2R9ZA 1ZP0A 3FG2P 4J2WA 5U1OA 1OJCA 3KPFA 1Q1WA 4H4XA 1CF3A 4XXGA 3KA7A 4EMJA 2QA1A 2IIDA 4U8JA 3AECA 2RABA 1YQZA 3HZLA 1H81A 4A99A 4EM3A 4H4UA 1Y56A 1DODA 1PJ5A 3UOZA 2R0CA 3T2YA 2H89A 5KWFA 2F5ZA 1VRQB 4GRTA 2WBAA 3WE0A 1GPEA 1CC4A 4DGKA 1H7XA 4KX6A 3CPIG 1BKWA 2GB0A 2WETA 2XVEA 3NIXA 1JRZA 2Q0LA 1F8RA 4U2LA 3ZDNA 1LQTA 1S2QA 3O0HA 3QVRA 3RP8A 4OPGA 3EF6A 4RSLA 1GRAA 3NK1X 3RP7A 3UTHA 5KNLA 1GEUA 4C74A 4NEWA 4D03A 1DJNA 4H4WA 1TDKA 4II3A 4LA1A 3VRAA 3T14A 1FOHA 1RSGA 2BK3A 1IUSA 3CNJA 3GRTA 3H4KA 1YQ4A 3SFDA 4TLZA 2C66A 4H2NA 1AOGA 2VOUA 4JNAA 1FCDA 1D4DA 2YLRA 4G9KA 4ZN0A 3AE3A 2VVLG 2RGOA 2YLTA 1B5QA 3QSEA 2VZ2A 1LPFA 3P1WA 1PBCA 2GVCA 1YKJA 3ALLA 4USRA 1K0LA 2A89A 3CN8A 4BJZA 4G6GA 1K0IA 3BNMA 4X9NA 4OCGA 2V6OA 3KKJA 2JB3A 2YM1A 2QA2A 3UKKA 3AXBA 2GR1A 3LZWA 1H7WA 5M10A 3E1TA 4ECHA 2ZBWA 3QSMA 4Z43A 5HYMA 1DJQA 2AAQA 4EMWA 2C3DA 1NAAA 4FK1A 3IWAA 4OPCA 1LJ1A 1K0JA 2VRMA 1GXFA 3SZWA 3NTDA 2XVHA 3ZYXA 4N9XA 2RGJA 3AYJA 2BA9A 1D4EA 2UZZA 2YLZA 3GYIA 3CMMA 3AE8A 2XLUA 1KFYA 2GMJA 3S5WA 3DJEA 1Z6LA 4FK1C 5KMRA 1KSSA 3CTYA 3GD3A 2WS3A 1TDOA 4MJWA 3SQPA 2BYBA 4ICYA 2X8HA 3UKQA 2XDOA 4E0VA 3EANA 2VQBA 1QLBA 1GRHA 2WESA 2GF3A 4YT0A 4OPIA 1ZK7A 1D4CA 2ZZ0A 2EQ9A 5JCKA 4YTNA 4B64A 4GDPA 4A7AA 4GAVA 1PJ6A 4G6HA 1XPQA 1JRYA 1GRBA 2ACZA 1PBFA 2Z5YA 4REKA 5C3JA 4DNAA 3JSKA 1NHRA 3NHOX 2CFYA 1M64A 4O5QA 4CCQA 3P4QA 1PXCA 2JB2A 3DJJA 2V3BA 4IA6A 3UTEA 3GMCA 4BV6A 4H4RA 2VVLA 1ZMDA 2EQ6A 1BGNA 1LQUA 5HHFA 4BK3A 3UP5A 2FJEA 3T31A 3RHAA 3QVPA 2R0GA 2Y6RA 5GRTA 2GV8A 1COYA 1NDAA 3NK0X 4UDRA 2YR6A 3VR9A 4BJYA 1TDFA 2WU5A 4H4ZA 5KOXA 2YVJA 4U8NA 3CGEA 2YM2A 2B7SA 2WOIA 4A79A 2WPEA 3OC4A 2JKCA 4GDEA 2JBVA 1TYTA 4GAPA 3UKPA 1JU2A 3AEEA 2ARDA 5J7XA 3UTGA 1L9CA 3AE5A 3UOVA 1VDCA 1IJHA 4B66A 3UKFA 4WCTA 2WU2A 4ZCCA 1CC2A 1LTXR 4B63A 4B65A 5FMHA 3DJGX 4JY2A 3F8RA 3SY4A 5L46A 2C4CA 3H8IA 2E4GA 4Z2TA 3PO7A 2YR5A 3C4NA 3CPJG 4PAAA 5EOWA 1E1LA 4A6NA 1GRFA 3NKSA 3BNUA 3NRNA 3AE4A 1Y0PA 1NPXA 3AE6A 4CBQA 4YKGA 2AQJA 4IVMB 3DK9A 3AD7B 1PJ7A 1H83A 3P4RA 3DK4A 4APNA 2QAEA 3LADA 2YVFA 4Z44A 4B68A 4BK2A 5IPYA 2FBWA 3SZCA 3B6DA 2BK4A 3NYEA 4Z25A 3NYFA 4U8PA 4B67A 2DKIA 2EQ7A 3DMEA 2Q7VA 3PS9A 1E1MA 1N4WA 2JK6A 1S2YA 4H4TA 3ATRA 1SEZA 3HYXA 4NWZA 2GR3A 1H6VA 1EL7A 1UKVG 1E1NA 4YSYA 4B1BA 1GREA 1GV4A 2GRTA 3EPTA 1PBBA 4IVOB 1L0VA 2X3NA 1O95A 1GNDA 2BRAA 4C3XA 2BS2A 5J60A 3ICSA 5KVIA 4EQXA 3ALJA 3Q6JA 2YLXA 3KD9A 1E6EA 3DGHA 2GAHB 2C72A 2XCGA 4EQSA 1LVLA 1N4UA 2XLRA 4LU6A 3IHMA 4H2PA 2WOVA 4HB9A 4OPLA 4YKFA 3C96A 2R0PA 3NN0X 2OA1A 3CNSA 5KMQA 5M0ZA 2VQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFE A;  1BWC A;  3L1R A;  1GTE A;  2R4J A;  3KU9 A;  4Y4N A;  4EQW A;  2WQY A;  2X99 A;  2V3A A;  2BCG G;  1Y56 B;  1IUX A;  1TDE A;  3BHK A;  4U8M A;  3V3N A;  2OAM A;  1NHS A;  1W4X A;  2XLP A;  3NT6 A;  3NYC A;  2APG A;  2WDV A;  2WOW A;  1Q1R A;  3G5Q A;  1VG0 A;  3IF9 A;  3G5S A;  3LXD A;  3I3L A;  2A87 A;  2WP6 A;  4AT0 A;  3KLJ A;  1XDI A;  3GDN A;  1MO9 A;  4KPR A;  3II4 A;  2X8C A;  4J34 A;  3AED A;  4OPT A;  4ZCD A;  4GF7 A;  2GEW A;  1REO A;  1FEC A;  4JNQ A;  3AD8 B;  4CY8 A;  3R9U A;  3ISH A;  1XHC A;  1CBO A;  5EB5 A;  3L8K A;  4J56 A;  1BGJ A;  3DA1 A;  3AEF A;  3OZ2 A;  2A8X A;  4Z26 A;  3ICT A;  4TM4 A;  2J3N A;  1PHH A;  2QCU A;  3T37 A;  4I59 A;  1NG4 A;  2XYO A;  1LV0 A;  5HXI A;  2X8G A;  2XVF A;  4HA6 A;  2WPC A;  3VR8 A;  1NG3 A;  3AB1 A;  3URH A;  5IQ4 A;  1DOB A;  4J57 A;  1GER A;  1FEA A;  2FJD A;  4K7Z A;  4WX1 A;  2X50 A;  5JCL A;  2YG7 A;  4C3Y A;  3P4S A;  2OLO A;  2FJB A;  2PYX A;  4K2X A;  1JNZ A;  3BI2 A;  4DSH A;  1GTH A;  3SM8 A;  4C5O A;  2WPF A;  1FL2 A;  2BC1 A;  1MOK A;  3AEG A;  3NH3 X;  4GR1 A;  1L9D A;  4JY3 A;  5LV9 A;  2CDU A;  3BHF A;  3LB8 A;  1ZKQ A;  2W0H A;  5DBJ A;  5KRQ A;  4YSX A;  3CPH G;  1PDH A;  4JN9 A;  2ZZB A;  2R4E A;  1TRB A;  3FMW A;  4X4J A;  1EL9 A;  1L9E A;  4U2T A;  4AP1 A;  4EIP A;  5KOW A;  3GYJ A;  2YLW A;  1KNR A;  5HY5 A;  2GR0 A;  2RGH A;  3I6D A;  4IV9 A;  2E5V A;  4K5S A;  4AOX A;  2BAB A;  3RNM A;  2XFQ A;  2C75 A;  1HYU A;  2BS3 A;  1D7Y A;  2I0Z A;  2YQU A;  3ICR A;  4H2R A;  3IC9 A;  4UP3 A;  2XLT A;  4EQR A;  1VQW A;  3PVC A;  5FS7 A;  4EQX A;  5FS6 A;  2DKH A;  2YG3 A;  3ATQ A;  3CNT A;  4AT2 A;  2Q0K A;  3G5R A;  4H4Q A;  1F8W A;  1ZX9 A;  2C7G A;  2R46 A;  1FEB A;  4TM3 A;  2IVE A;  3AEA A;  1K4Q A;  3LJP A;  1H84 A;  1D7L A;  1PN0 A;  4D04 A;  1NHP A;  1S3B A;  2GAG B;  3DJD A;  1PS9 A;  3P4P A;  4CRT A;  3Q9T A;  4GUV A;  4CNJ A;  2C64 A;  5C2T A;  3DGZ A;  1GES A;  4Z2R A;  3KVE A;  2GMH A;  3NGC X;  4A5L A;  1F8S A;  2PHH A;  2BXS A;  3M0O A;  5FS8 A;  1IUV A;  1NHQ A;  3QFB A;  1YQ3 A;  4X9M A;  4EM4 A;  3M13 A;  1JEH A;  4YTP A;  3UOX A;  2GQF A;  1H86 A;  1DNC A;  1M6I A;  1ELI A;  2ZZC A;  2O9Z A;  3D8X A;  3CGD A;  5IQ1 A;  4PAB A;  4TM1 A;  3D1C A;  2BAC A;  4NTD A;  1GSN A;  1CJ4 A;  3GMB A;  3QFA A;  5BRT A;  2Y6Q A;  4FDC B;  4P9S A;  1GET A;  3AYI A;  3VRB A;  2Q6U A;  3M12 A;  3K7T A;  3AE2 A;  1CJC A;  1CL0 A;  1PXB A;  4RG4 A;  3UKA A;  1ZOY A;  3DK8 A;  4H4Y A;  1OJ9 A;  3ABV A;  4OPD A;  4BK1 A;  3LZX A;  2XFU A;  5JCN A;  3FIM B;  1B37 A;  4GCM A;  4NZH A;  2EQ8 A;  4EMI A;  3QJ4 A;  5TR3 A;  1Q9I A;  4RG3 A;  4H7U A;  3UKL A;  1X31 B;  2WP9 A;  4AOS A;  3IHG A;  3QSS A;  2WDQ A;  1KNP A;  5U63 A;  1KSU A;  1VG9 A;  4YSH A;  1GRT A;  2H88 A;  4NTE A;  4Z2U A;  2C65 A;  4K5R A;  4A6N B;  1MXT A;  5FS9 A;  2YG6 A;  2YAU A;  4B69 A;  3COX A;  1F6M A;  4Z24 A;  2IVD A;  3VQR A;  3NLC A;  2YR4 A;  1E7P A;  3K7M X;  4JDR A;  4NEV A;  1N1P A;  4A9W A;  1DOC A;  3CGC A;  3GWF A;  2B9W A;  1OJA A;  3ALM A;  5U25 A;  4XWZ A;  4USQ A;  4A65 A;  2XVJ A;  2V5Z A;  2E1M A;  2XFN A;  1RP0 A;  3AEB A;  5BUK A;  4U8L A;  4UDQ A;  4EIQ A;  1NEK A;  2FJA A;  3UKH A;  1DOE A;  2YLS A;  4Y4M A;  4AP3 A;  5ER0 A;  2R45 A;  4OVI A;  4DSG A;  1D5T A;  3DH9 A;  4J31 A;  4IA5 A;  3AE1 A;  4LII A;  1EL5 A;  5KXJ A;  1ZMC A;  4NTC A;  1JNR A;  4ADW A;  3AE7 A;  4FX9 A;  4C77 A;  3NNE A;  3F8D A;  3LOV A;  3CIR A;  3CND A;  1JRX A;  2B76 A;  1QJD A;  3GDP A;  3CGB A;  1EBD A;  1BZL A;  2CVJ A;  2YG5 A;  1RYI A;  1NEN A;  1P2E A;  1P2H A;  5EBK A;  3C4A A;  3K7Q X;  1PBD A;  2V61 A;  4H50 A;  1YY5 A;  1B8S A;  5JCI A;  1F3P A;  1E39 A;  2AR8 A;  3GSI A;  2GR2 A;  3RED A;  1ZOV A;  5CQF A;  5EB4 A;  4H4S A;  4XWR A;  1O5W A;  1V59 A;  4YWO A;  4JQ9 A;  3K30 A;  4H4V A;  2B9Y A;  4K22 A;  4J33 A;  2YVG A;  1OJT A;  2B9X A;  3VRD B;  1IUW A;  1XAN A;  1CHU A;  2VRL A;  1IUU A;  3RP6 A;  1GT8 A;  4J36 A;  3GRS A;  3GWD A;  3S61 A;  1CC6 A;  1O94 A;  3AD9 B;  3FBS A;  4YTM A;  4Y4L A;  3EAO A;  1JOA A;  2BCP A;  4I58 A;  3F8P A;  1GRG A;  2C67 A;  2XFO A;  4OPU A;  3UTF A;  4YXD A;  4TM0 A;  1ZDL A;  2GQW A;  2TPR A;  2XFP A;  4TLX A;  2GH5 A;  3UOY A;  2BC0 A;  4U8I A;  4BUR A;  3P9U A;  3CNP A;  3AE9 A;  1BF3 A;  3V76 A;  3H8L A;  1TDN A;  2BK5 A;  1TYP A;  1H82 A;  1OJD A;  1EL8 A;  2TMD A;  2C73 A;  1S3E A;  4H2Q A;  3FPZ A;  5KVH A;  1ZY8 A;  2NVK X;  5GSN A;  5JCM A;  4U8K A;  2WEU A;  1ONF A;  2Z5X A;  1KDG A;  1DXL A;  2WP5 A;  2VVM A;  4CNK A;  2B7R A;  2OAL A;  2WHD A;  2BS4 A;  1IUT A;  3BI4 A;  2OLN A;  4CY6 A;  3ITJ A;  4YSZ A;  2JB1 A;  3V3O A;  2YG4 A;  5CKU A;  1B4V A;  1E1K A;  5BVA A;  2JAE A;  2NPX A;  2C3C A;  1QO8 A;  2CUL A;  3BI5 A;  2HQM A;  2XVI A;  3AYL A;  4CCR A;  4U2S A;  4O5U A;  2C76 A;  3GD4 A;  3NN6 X;  1CJ3 A;  1PBE A;  2XLS A;  3NG7 X;  5BUL A;  3SGL A;  4M52 A;  1GOS A;  3B3R A;  3UCL A;  4K8D A;  3NK2 X;  1PXA A;  1GAL A;  3NTA A;  2V60 A;  4U8O A;  3UP4 A;  2BXR A;  2WDR A;  1KF6 A;  1N4V A;  2YWL A;  3AWI A;  2C70 A;  4H4P A;  4UDP A;  1CJ2 A;  3ADA B;  2R9Z A;  1ZP0 A;  3FG2 P;  4J2W A;  5U1O A;  1OJC A;  3KPF A;  1Q1W A;  4H4X A;  1CF3 A;  4XXG A;  3KA7 A;  4EMJ A;  2QA1 A;  2IID A;  4U8J A;  3AEC A;  2RAB A;  1YQZ A;  3HZL A;  1H81 A;  4A99 A;  4EM3 A;  4H4U A;  1Y56 A;  1DOD A;  1PJ5 A;  3UOZ A;  2R0C A;  2H89 A;  5KWF A;  2F5Z A;  1VRQ B;  4GRT A;  2WBA A;  3WE0 A;  1GPE A;  1CC4 A;  4DGK A;  1H7X A;  4KX6 A;  3CPI G;  1BKW A;  2GB0 A;  2WET A;  2XVE A;  3NIX A;  1JRZ A;  2Q0L A;  1F8R A;  4U2L A;  3ZDN A;  1LQT A;  1S2Q A;  3O0H A;  3QVR A;  3RP8 A;  4OPG A;  3EF6 A;  4RSL A;  1GRA A;  3NK1 X;  3RP7 A;  3UTH A;  1GEU A;  4C74 A;  4NEW A;  4D03 A;  1DJN A;  4H4W A;  1TDK A;  4LA1 A;  3VRA A;  1FOH A;  1RSG A;  2BK3 A;  1IUS A;  3CNJ A;  3GRT A;  3H4K A;  1YQ4 A;  3SFD A;  4TLZ A;  2C66 A;  4H2N A;  1AOG A;  2VOU A;  4JNA A;  1FCD A;  1D4D A;  2YLR A;  4ZN0 A;  3AE3 A;  2VVL G;  2RGO A;  2YLT A;  1B5Q A;  3QSE A;  2VZ2 A;  1LPF A;  3P1W A;  1PBC A;  2GVC A;  1YKJ A;  3ALL A;  4USR A;  1K0L A;  2A89 A;  3CN8 A;  4BJZ A;  1K0I A;  3BNM A;  4X9N A;  4OCG A;  2V6O A;  3KKJ A;  2JB3 A;  2YM1 A;  2QA2 A;  3UKK A;  3AXB A;  2GR1 A;  3LZW A;  1H7W A;  5M10 A;  3E1T A;  4ECH A;  2ZBW A;  3QSM A;  4Z43 A;  5HYM A;  1DJQ A;  2AAQ A;  4EMW A;  2C3D A;  1NAA A;  4FK1 A;  3IWA A;  4OPC A;  1LJ1 A;  1K0J A;  2VRM A;  1GXF A;  3NTD A;  2XVH A;  3ZYX A;  4N9X A;  2RGJ A;  3AYJ A;  2BA9 A;  1D4E A;  2UZZ A;  2YLZ A;  3GYI A;  3AE8 A;  2XLU A;  1KFY A;  2GMJ A;  3S5W A;  3DJE A;  1Z6L A;  4FK1 C;  1KSS A;  3CTY A;  3GD3 A;  2WS3 A;  1TDO A;  4MJW A;  3SQP A;  2BYB A;  4ICY A;  2X8H A;  3UKQ A;  2XDO A;  4E0V A;  3EAN A;  2VQB A;  1QLB A;  1GRH A;  2WES A;  2GF3 A;  4YT0 A;  4OPI A;  1ZK7 A;  1D4C A;  2ZZ0 A;  2EQ9 A;  5JCK A;  4YTN A;  4B64 A;  4GDP A;  4A7A A;  1PJ6 A;  1XPQ A;  1JRY A;  1GRB A;  2ACZ A;  1PBF A;  2Z5Y A;  4REK A;  5C3J A;  4DNA A;  3JSK A;  1NHR A;  3NHO X;  2CFY A;  1M64 A;  4O5Q A;  4CCQ A;  3P4Q A;  1PXC A;  2JB2 A;  3DJJ A;  2V3B A;  4IA6 A;  3UTE A;  3GMC A;  4BV6 A;  4H4R A;  2VVL A;  1ZMD A;  2EQ6 A;  1BGN A;  1LQU A;  5HHF A;  4BK3 A;  3UP5 A;  2FJE A;  3RHA A;  3QVP A;  2R0G A;  2Y6R A;  5GRT A;  2GV8 A;  1COY A;  1NDA A;  3NK0 X;  4UDR A;  2YR6 A;  3VR9 A;  4BJY A;  1TDF A;  2WU5 A;  4H4Z A;  5KOX A;  2YVJ A;  4U8N A;  3CGE A;  2YM2 A;  2B7S A;  2WOI A;  4A79 A;  2WPE A;  3OC4 A;  2JKC A;  4GDE A;  2JBV A;  1TYT A;  3UKP A;  1JU2 A;  3AEE A;  2ARD A;  5J7X A;  3UTG A;  1L9C A;  3AE5 A;  3UOV A;  1VDC A;  1IJH A;  4B66 A;  3UKF A;  4WCT A;  2WU2 A;  4ZCC A;  1CC2 A;  1LTX R;  4B63 A;  4B65 A;  5FMH A;  3DJG X;  4JY2 A;  3F8R A;  5L46 A;  3H8I A;  2E4G A;  4Z2T A;  3PO7 A;  2YR5 A;  3C4N A;  3CPJ G;  4PAA A;  5EOW A;  1E1L A;  4A6N A;  1GRF A;  3NKS A;  3BNU A;  3NRN A;  3AE4 A;  1Y0P A;  1NPX A;  3AE6 A;  4CBQ A;  4YKG A;  2AQJ A;  4IVM B;  3DK9 A;  3AD7 B;  1PJ7 A;  1H83 A;  3P4R A;  3DK4 A;  4APN A;  2QAE A;  3LAD A;  2YVF A;  4Z44 A;  4B68 A;  4BK2 A;  5IPY A;  2FBW A;  3B6D A;  2BK4 A;  3NYE A;  4Z25 A;  3NYF A;  4U8P A;  4B67 A;  2DKI A;  2EQ7 A;  3DME A;  2Q7V A;  3PS9 A;  1E1M A;  1N4W A;  2JK6 A;  1S2Y A;  4H4T A;  3ATR A;  1SEZ A;  2GR3 A;  1H6V A;  1EL7 A;  1UKV G;  1E1N A;  4YSY A;  4B1B A;  1GRE A;  1GV4 A;  2GRT A;  3EPT A;  1PBB A;  4IVO B;  1L0V A;  2X3N A;  1O95 A;  1GND A;  4C3X A;  2BS2 A;  5J60 A;  3ICS A;  5KVI A;  3ALJ A;  3Q6J A;  2YLX A;  3KD9 A;  1E6E A;  3DGH A;  2GAH B;  2C72 A;  2XCG A;  4EQS A;  1LVL A;  1N4U A;  2XLR A;  4LU6 A;  3IHM A;  4H2P A;  2WOV A;  4HB9 A;  4OPL A;  4YKF A;  3C96 A;  2R0P A;  3NN0 X;  2OA1 A;  3CNS A;  5M0Z A;  2VQ7 A; 
#chains in the Genus database with same CATH topology
 3SFE A;  1BWC A;  3L1R A;  1GTE A;  2R4J A;  3KU9 A;  4Y4N A;  4EQW A;  2WQY A;  2X99 A;  2V3A A;  2BCG G;  1Y56 B;  1IUX A;  1TDE A;  3BHK A;  4U8M A;  3V3N A;  2OAM A;  1NHS A;  1W4X A;  2XLP A;  3NT6 A;  3NYC A;  2APG A;  2WDV A;  2WOW A;  1Q1R A;  3G5Q A;  1VG0 A;  3IF9 A;  3G5S A;  3LXD A;  3I3L A;  2A87 A;  2WP6 A;  4AT0 A;  3KLJ A;  1XDI A;  3GDN A;  1MO9 A;  3SZ0 A;  4KPR A;  3II4 A;  2X8C A;  4J34 A;  3AED A;  4OPT A;  4ZCD A;  4GF7 A;  2GEW A;  1REO A;  1FEC A;  4JNQ A;  3AD8 B;  4CY8 A;  3R9U A;  3ISH A;  1XHC A;  1CBO A;  5EB5 A;  3L8K A;  4J56 A;  1BGJ A;  3DA1 A;  4II2 A;  3AEF A;  3OZ2 A;  2A8X A;  4Z26 A;  3ICT A;  4TM4 A;  2J3N A;  1PHH A;  2QCU A;  3T37 A;  4I59 A;  1NG4 A;  2XYO A;  1LV0 A;  5HXI A;  2X8G A;  2XVF A;  4HA6 A;  2WPC A;  3VR8 A;  1NG3 A;  3AB1 A;  3URH A;  5IQ4 A;  1DOB A;  4J57 A;  1GER A;  1FEA A;  2FJD A;  4K7Z A;  4WX1 A;  2X50 A;  5JCL A;  2YG7 A;  4C3Y A;  3P4S A;  2OLO A;  2FJB A;  2PYX A;  4K2X A;  1JNZ A;  3BI2 A;  4DSH A;  1GTH A;  3SM8 A;  4C5O A;  2WPF A;  1FL2 A;  2BC1 A;  3SXI A;  1MOK A;  3AEG A;  3NH3 X;  4GR1 A;  1L9D A;  4JY3 A;  4NNJ A;  5LV9 A;  2CDU A;  3BHF A;  3T0K A;  3LB8 A;  1ZKQ A;  2W0H A;  5DBJ A;  5KRQ A;  4YSX A;  3CPH G;  1PDH A;  4JN9 A;  2ZZB A;  2R4E A;  1TRB A;  3FMW A;  4X4J A;  1EL9 A;  1L9E A;  4U2T A;  4AP1 A;  4EIP A;  5KOW A;  3GYJ A;  2YLW A;  1KNR A;  5HY5 A;  2GR0 A;  2RGH A;  3I6D A;  4IV9 A;  2E5V A;  4K5S A;  4AOX A;  2BAB A;  3RNM A;  3SYI A;  4G74 A;  2XFQ A;  2C75 A;  1HYU A;  2BS3 A;  1D7Y A;  2I0Z A;  2YQU A;  3ICR A;  4H2R A;  3IC9 A;  4UP3 A;  2XLT A;  3SX6 A;  1VQW A;  3PVC A;  5FS7 A;  4EQR A;  5FS6 A;  2DKH A;  2YG3 A;  3ATQ A;  3SZF A;  3CNT A;  4AT2 A;  2Q0K A;  3G5R A;  4H4Q A;  1F8W A;  1ZX9 A;  2C7G A;  2R46 A;  1FEB A;  4TM3 A;  2IVE A;  3AEA A;  1K4Q A;  3LJP A;  1H84 A;  1D7L A;  1PN0 A;  4D04 A;  1NHP A;  4G73 A;  1S3B A;  2GAG B;  3DJD A;  1PS9 A;  3P4P A;  4CRT A;  3Q9T A;  4GUV A;  4CNJ A;  2C64 A;  5C2T A;  3DGZ A;  1GES A;  4Z2R A;  3KVE A;  2GMH A;  3NGC X;  4A5L A;  1F8S A;  2PHH A;  2BXS A;  3M0O A;  5FS8 A;  1IUV A;  1NHQ A;  3QFB A;  1YQ3 A;  4X9M A;  4EM4 A;  3M13 A;  1JEH A;  4YTP A;  3UOX A;  2GQF A;  1H86 A;  1DNC A;  1M6I A;  1ELI A;  2ZZC A;  2O9Z A;  3D8X A;  3CGD A;  5IQ1 A;  4PAB A;  4TM1 A;  3D1C A;  2BAC A;  4NTD A;  1GSN A;  1CJ4 A;  3GMB A;  3QFA A;  5BRT A;  2Y6Q A;  4FDC B;  4P9S A;  1GET A;  3AYI A;  3VRB A;  2Q6U A;  3M12 A;  3K7T A;  3AE2 A;  1CJC A;  1CL0 A;  1PXB A;  4RG4 A;  3UKA A;  1ZOY A;  3DK8 A;  4H4Y A;  1OJ9 A;  3ABV A;  4OPD A;  4BK1 A;  3LZX A;  2XFU A;  5JCN A;  3FIM B;  1B37 A;  4GCM A;  4NZH A;  2EQ8 A;  4EMI A;  3QJ4 A;  5TR3 A;  1Q9I A;  4RG3 A;  4H7U A;  3UKL A;  1X31 B;  2WP9 A;  5KMS A;  4AOS A;  3IHG A;  3QSS A;  2WDQ A;  1KNP A;  5U63 A;  1KSU A;  1VG9 A;  4YSH A;  3KPK A;  1GRT A;  2H88 A;  4NTE A;  4Z2U A;  2C65 A;  4K5R A;  4A6N B;  1MXT A;  5FS9 A;  2YG6 A;  2YAU A;  4B69 A;  3COX A;  1F6M A;  4Z24 A;  2IVD A;  3VQR A;  3NLC A;  2YR4 A;  1E7P A;  3K7M X;  4JDR A;  4NEV A;  3T2K A;  1N1P A;  4A9W A;  1DOC A;  3CGC A;  3GWF A;  2B9W A;  1OJA A;  3ALM A;  5U25 A;  4XWZ A;  4USQ A;  4A65 A;  2XVJ A;  2V5Z A;  2E1M A;  2XFN A;  1RP0 A;  3AEB A;  5BUK A;  4U8L A;  4UDQ A;  4EIQ A;  1NEK A;  2FJA A;  3UKH A;  1DOE A;  2YLS A;  2BRY A;  4Y4M A;  4AP3 A;  5ER0 A;  2R45 A;  4OVI A;  4DSG A;  1D5T A;  3DH9 A;  4J31 A;  4IA5 A;  3AE1 A;  4LII A;  1EL5 A;  5KXJ A;  1ZMC A;  4NTC A;  1JNR A;  3GYX A;  4ADW A;  3AE7 A;  3HYW A;  4FX9 A;  4C77 A;  3NNE A;  3F8D A;  3LOV A;  3CIR A;  3CND A;  1JRX A;  2B76 A;  1QJD A;  3GDP A;  3CGB A;  1EBD A;  1BZL A;  2CVJ A;  2YG5 A;  1RYI A;  1NEN A;  1P2E A;  1P2H A;  3T2Z A;  5EBK A;  3C4A A;  3K7Q X;  1PBD A;  2V61 A;  4H50 A;  1YY5 A;  1B8S A;  5JCI A;  1F3P A;  1E39 A;  2AR8 A;  3GSI A;  2GR2 A;  3RED A;  1ZOV A;  5CQF A;  5EB4 A;  4H4S A;  4XWR A;  1O5W A;  1V59 A;  4YWO A;  4JQ9 A;  3K30 A;  4H4V A;  2B9Y A;  4K22 A;  4J33 A;  2YVG A;  1OJT A;  2B9X A;  3VRD B;  1IUW A;  1XAN A;  1CHU A;  2VRL A;  1IUU A;  3RP6 A;  1GT8 A;  4J36 A;  3GRS A;  3GWD A;  3S61 A;  1CC6 A;  1O94 A;  3AD9 B;  3FBS A;  4YTM A;  4Y4L A;  3EAO A;  1JOA A;  2BCP A;  4I58 A;  3F8P A;  1GRG A;  2C67 A;  2XFO A;  4OPU A;  3UTF A;  4YXD A;  4TM0 A;  1ZDL A;  2GQW A;  2TPR A;  2XFP A;  4TLX A;  2GH5 A;  3UOY A;  2BC0 A;  4U8I A;  4BUR A;  3P9U A;  3CNP A;  3AE9 A;  1BF3 A;  3V76 A;  3H8L A;  1TDN A;  2BK5 A;  1TYP A;  1H82 A;  1OJD A;  1EL8 A;  2TMD A;  2C73 A;  1S3E A;  4H2Q A;  3FPZ A;  5KVH A;  1ZY8 A;  2NVK X;  5GSN A;  5JCM A;  4U8K A;  2WEU A;  1ONF A;  2Z5X A;  1KDG A;  1DXL A;  2WP5 A;  2VVM A;  4CNK A;  2B7R A;  2OAL A;  2WHD A;  2BS4 A;  1IUT A;  3BI4 A;  2OLN A;  4CY6 A;  3ITJ A;  3HYV A;  4YSZ A;  2JB1 A;  3V3O A;  2YG4 A;  5CKU A;  1B4V A;  1E1K A;  5BVA A;  2JAE A;  2NPX A;  2C3C A;  1QO8 A;  2CUL A;  3BI5 A;  2HQM A;  2XVI A;  3AYL A;  4CCR A;  4U2S A;  4O5U A;  2C76 A;  3GD4 A;  3NN6 X;  1CJ3 A;  1PBE A;  2XLS A;  3NG7 X;  5BUL A;  3SGL A;  4M52 A;  1GOS A;  3B3R A;  3UCL A;  4K8D A;  3NK2 X;  1PXA A;  1GAL A;  3NTA A;  2V60 A;  4U8O A;  5KMP A;  3UP4 A;  2BXR A;  2WDR A;  1KF6 A;  1N4V A;  2YWL A;  3AWI A;  2C70 A;  4H4P A;  4UDP A;  1CJ2 A;  3ADA B;  2R9Z A;  1ZP0 A;  3FG2 P;  4J2W A;  5U1O A;  1OJC A;  3KPF A;  1Q1W A;  4H4X A;  1CF3 A;  4XXG A;  3KA7 A;  4EMJ A;  2QA1 A;  2IID A;  4U8J A;  3AEC A;  2RAB A;  1YQZ A;  3HZL A;  1H81 A;  4A99 A;  4EM3 A;  4H4U A;  1Y56 A;  1DOD A;  1PJ5 A;  3UOZ A;  2R0C A;  3T2Y A;  2H89 A;  5KWF A;  2F5Z A;  1VRQ B;  4GRT A;  2WBA A;  3WE0 A;  1GPE A;  1CC4 A;  4DGK A;  1H7X A;  4KX6 A;  3CPI G;  1BKW A;  2GB0 A;  2WET A;  2XVE A;  3NIX A;  1JRZ A;  2Q0L A;  1F8R A;  4U2L A;  3ZDN A;  1LQT A;  1S2Q A;  3O0H A;  3QVR A;  3RP8 A;  4OPG A;  3EF6 A;  4RSL A;  1GRA A;  3NK1 X;  3RP7 A;  3UTH A;  5KNL A;  1GEU A;  4C74 A;  4NEW A;  4D03 A;  1DJN A;  4H4W A;  1TDK A;  4II3 A;  4LA1 A;  3VRA A;  3T14 A;  1FOH A;  1RSG A;  2BK3 A;  1IUS A;  3CNJ A;  3GRT A;  3H4K A;  1YQ4 A;  3SFD A;  4TLZ A;  2C66 A;  4H2N A;  1AOG A;  2VOU A;  4JNA A;  1FCD A;  1D4D A;  2YLR A;  4G9K A;  4ZN0 A;  3AE3 A;  2VVL G;  2RGO A;  2YLT A;  1B5Q A;  3QSE A;  2VZ2 A;  1LPF A;  3P1W A;  1PBC A;  2GVC A;  1YKJ A;  3ALL A;  4USR A;  1K0L A;  2A89 A;  3CN8 A;  4BJZ A;  4G6G A;  1K0I A;  3BNM A;  4X9N A;  4OCG A;  2V6O A;  3KKJ A;  2JB3 A;  2YM1 A;  2QA2 A;  3UKK A;  3AXB A;  2GR1 A;  3LZW A;  1H7W A;  5M10 A;  3E1T A;  4ECH A;  2ZBW A;  3QSM A;  4Z43 A;  5HYM A;  1DJQ A;  2AAQ A;  4EMW A;  2C3D A;  1NAA A;  4FK1 A;  3IWA A;  4OPC A;  1LJ1 A;  1K0J A;  2VRM A;  1GXF A;  3SZW A;  3NTD A;  2XVH A;  3ZYX A;  4N9X A;  2RGJ A;  3AYJ A;  2BA9 A;  1D4E A;  2UZZ A;  2YLZ A;  3GYI A;  3CMM A;  3AE8 A;  2XLU A;  1KFY A;  2GMJ A;  3S5W A;  3DJE A;  1Z6L A;  4FK1 C;  5KMR A;  1KSS A;  3CTY A;  3GD3 A;  2WS3 A;  1TDO A;  4MJW A;  3SQP A;  2BYB A;  4ICY A;  2X8H A;  3UKQ A;  2XDO A;  4E0V A;  3EAN A;  2VQB A;  1QLB A;  1GRH A;  2WES A;  2GF3 A;  4YT0 A;  4OPI A;  1ZK7 A;  1D4C A;  2ZZ0 A;  2EQ9 A;  5JCK A;  4YTN A;  4B64 A;  4GDP A;  4A7A A;  4GAV A;  1PJ6 A;  4G6H A;  1XPQ A;  1JRY A;  1GRB A;  2ACZ A;  1PBF A;  2Z5Y A;  4REK A;  5C3J A;  4DNA A;  3JSK A;  1NHR A;  3NHO X;  2CFY A;  1M64 A;  4O5Q A;  4CCQ A;  3P4Q A;  1PXC A;  2JB2 A;  3DJJ A;  2V3B A;  4IA6 A;  3UTE A;  3GMC A;  4BV6 A;  4H4R A;  2VVL A;  1ZMD A;  2EQ6 A;  1BGN A;  1LQU A;  5HHF A;  4BK3 A;  3UP5 A;  2FJE A;  3T31 A;  3RHA A;  3QVP A;  2R0G A;  2Y6R A;  5GRT A;  2GV8 A;  1COY A;  1NDA A;  3NK0 X;  4UDR A;  2YR6 A;  3VR9 A;  4BJY A;  1TDF A;  2WU5 A;  4H4Z A;  5KOX A;  2YVJ A;  4U8N A;  3CGE A;  2YM2 A;  2B7S A;  2WOI A;  4A79 A;  2WPE A;  3OC4 A;  2JKC A;  4GDE A;  2JBV A;  1TYT A;  4GAP A;  3UKP A;  1JU2 A;  3AEE A;  2ARD A;  5J7X A;  3UTG A;  1L9C A;  3AE5 A;  3UOV A;  1VDC A;  1IJH A;  4B66 A;  3UKF A;  4WCT A;  2WU2 A;  4ZCC A;  1CC2 A;  1LTX R;  4B63 A;  4B65 A;  5FMH A;  3DJG X;  4JY2 A;  3F8R A;  3SY4 A;  5L46 A;  2C4C A;  3H8I A;  2E4G A;  4Z2T A;  3PO7 A;  2YR5 A;  3C4N A;  3CPJ G;  4PAA A;  5EOW A;  1E1L A;  4A6N A;  1GRF A;  3NKS A;  3BNU A;  3NRN A;  3AE4 A;  1Y0P A;  1NPX A;  3AE6 A;  4CBQ A;  4YKG A;  2AQJ A;  4IVM B;  3DK9 A;  3AD7 B;  1PJ7 A;  1H83 A;  3P4R A;  3DK4 A;  4APN A;  2QAE A;  3LAD A;  2YVF A;  4Z44 A;  4B68 A;  4BK2 A;  5IPY A;  2FBW A;  3SZC A;  3B6D A;  2BK4 A;  3NYE A;  4Z25 A;  3NYF A;  4U8P A;  4B67 A;  2DKI A;  2EQ7 A;  3DME A;  2Q7V A;  3PS9 A;  1E1M A;  1N4W A;  2JK6 A;  1S2Y A;  4H4T A;  3ATR A;  1SEZ A;  3HYX A;  4NWZ A;  2GR3 A;  1H6V A;  1EL7 A;  1UKV G;  1E1N A;  4YSY A;  4B1B A;  1GRE A;  1GV4 A;  2GRT A;  3EPT A;  1PBB A;  4IVO B;  1L0V A;  2X3N A;  1O95 A;  1GND A;  2BRA A;  4C3X A;  2BS2 A;  5J60 A;  3ICS A;  5KVI A;  4EQX A;  3ALJ A;  3Q6J A;  2YLX A;  3KD9 A;  1E6E A;  3DGH A;  2GAH B;  2C72 A;  2XCG A;  4EQS A;  1LVL A;  1N4U A;  2XLR A;  4LU6 A;  3IHM A;  4H2P A;  2WOV A;  4HB9 A;  4OPL A;  4YKF A;  3C96 A;  2R0P A;  3NN0 X;  2OA1 A;  3CNS A;  5KMQ A;  5M0Z A;  2VQ7 A; 
#chains in the Genus database with same CATH homology
 3SFE A;  1BWC A;  3L1R A;  1GTE A;  2R4J A;  3KU9 A;  4Y4N A;  4EQW A;  2WQY A;  2X99 A;  2V3A A;  2BCG G;  1Y56 B;  1IUX A;  1TDE A;  3BHK A;  4U8M A;  3V3N A;  2OAM A;  1NHS A;  1W4X A;  2XLP A;  3NT6 A;  3NYC A;  2APG A;  2WDV A;  2WOW A;  1Q1R A;  3G5Q A;  1VG0 A;  3IF9 A;  3G5S A;  3LXD A;  3I3L A;  2A87 A;  2WP6 A;  4AT0 A;  3KLJ A;  1XDI A;  3GDN A;  1MO9 A;  3SZ0 A;  4KPR A;  3II4 A;  2X8C A;  4J34 A;  3AED A;  4OPT A;  4ZCD A;  4GF7 A;  2GEW A;  1REO A;  1FEC A;  4JNQ A;  3AD8 B;  4CY8 A;  3R9U A;  3ISH A;  1XHC A;  1CBO A;  5EB5 A;  3L8K A;  4J56 A;  1BGJ A;  3DA1 A;  4II2 A;  3AEF A;  3OZ2 A;  2A8X A;  4Z26 A;  3ICT A;  4TM4 A;  2J3N A;  1PHH A;  2QCU A;  3T37 A;  4I59 A;  1NG4 A;  2XYO A;  1LV0 A;  5HXI A;  2X8G A;  2XVF A;  4HA6 A;  2WPC A;  3VR8 A;  1NG3 A;  3AB1 A;  3URH A;  5IQ4 A;  1DOB A;  4J57 A;  1GER A;  1FEA A;  2FJD A;  4K7Z A;  4WX1 A;  2X50 A;  5JCL A;  2YG7 A;  4C3Y A;  3P4S A;  2OLO A;  2FJB A;  2PYX A;  4K2X A;  1JNZ A;  3BI2 A;  4DSH A;  1GTH A;  3SM8 A;  4C5O A;  2WPF A;  1FL2 A;  2BC1 A;  3SXI A;  1MOK A;  3AEG A;  3NH3 X;  4GR1 A;  1L9D A;  4JY3 A;  4NNJ A;  5LV9 A;  2CDU A;  3BHF A;  3T0K A;  3LB8 A;  1ZKQ A;  2W0H A;  5DBJ A;  5KRQ A;  4YSX A;  3CPH G;  1PDH A;  4JN9 A;  2ZZB A;  2R4E A;  1TRB A;  3FMW A;  4X4J A;  1EL9 A;  1L9E A;  4U2T A;  4AP1 A;  4EIP A;  5KOW A;  3GYJ A;  2YLW A;  1KNR A;  5HY5 A;  2GR0 A;  2RGH A;  3I6D A;  4IV9 A;  2E5V A;  4K5S A;  4AOX A;  2BAB A;  3RNM A;  3SYI A;  4G74 A;  2XFQ A;  2C75 A;  1HYU A;  2BS3 A;  1D7Y A;  2I0Z A;  2YQU A;  3ICR A;  4H2R A;  3IC9 A;  4UP3 A;  2XLT A;  3SX6 A;  1VQW A;  3PVC A;  5FS7 A;  4EQR A;  5FS6 A;  2DKH A;  2YG3 A;  3ATQ A;  3SZF A;  3CNT A;  4AT2 A;  2Q0K A;  3G5R A;  4H4Q A;  1F8W A;  1ZX9 A;  2C7G A;  2R46 A;  1FEB A;  4TM3 A;  2IVE A;  3AEA A;  1K4Q A;  3LJP A;  1H84 A;  1D7L A;  1PN0 A;  4D04 A;  1NHP A;  4G73 A;  1S3B A;  2GAG B;  3DJD A;  1PS9 A;  3P4P A;  4CRT A;  3Q9T A;  4GUV A;  4CNJ A;  2C64 A;  5C2T A;  3DGZ A;  1GES A;  4Z2R A;  3KVE A;  2GMH A;  3NGC X;  4A5L A;  1F8S A;  2PHH A;  2BXS A;  3M0O A;  5FS8 A;  1IUV A;  1NHQ A;  3QFB A;  1YQ3 A;  4X9M A;  4EM4 A;  3M13 A;  1JEH A;  4YTP A;  3UOX A;  2GQF A;  1H86 A;  1DNC A;  1M6I A;  1ELI A;  2ZZC A;  2O9Z A;  3D8X A;  3CGD A;  5IQ1 A;  4PAB A;  4TM1 A;  3D1C A;  2BAC A;  4NTD A;  1GSN A;  1CJ4 A;  3GMB A;  3QFA A;  5BRT A;  2Y6Q A;  4FDC B;  4P9S A;  1GET A;  3AYI A;  3VRB A;  2Q6U A;  3M12 A;  3K7T A;  3AE2 A;  1CJC A;  1CL0 A;  1PXB A;  4RG4 A;  3UKA A;  1ZOY A;  3DK8 A;  4H4Y A;  1OJ9 A;  3ABV A;  4OPD A;  4BK1 A;  3LZX A;  2XFU A;  5JCN A;  3FIM B;  1B37 A;  4GCM A;  4NZH A;  2EQ8 A;  4EMI A;  3QJ4 A;  5TR3 A;  1Q9I A;  4RG3 A;  4H7U A;  3UKL A;  1X31 B;  2WP9 A;  5KMS A;  4AOS A;  3IHG A;  3QSS A;  2WDQ A;  1KNP A;  5U63 A;  1KSU A;  1VG9 A;  4YSH A;  3KPK A;  1GRT A;  2H88 A;  4NTE A;  4Z2U A;  2C65 A;  4K5R A;  4A6N B;  1MXT A;  5FS9 A;  2YG6 A;  2YAU A;  4B69 A;  3COX A;  1F6M A;  4Z24 A;  2IVD A;  3VQR A;  3NLC A;  2YR4 A;  1E7P A;  3K7M X;  4JDR A;  4NEV A;  3T2K A;  1N1P A;  4A9W A;  1DOC A;  3CGC A;  3GWF A;  2B9W A;  1OJA A;  3ALM A;  5U25 A;  4XWZ A;  4USQ A;  4A65 A;  2XVJ A;  2V5Z A;  2E1M A;  2XFN A;  1RP0 A;  3AEB A;  5BUK A;  4U8L A;  4UDQ A;  4EIQ A;  1NEK A;  2FJA A;  3UKH A;  1DOE A;  2YLS A;  2BRY A;  4Y4M A;  4AP3 A;  5ER0 A;  2R45 A;  4OVI A;  4DSG A;  1D5T A;  3DH9 A;  4J31 A;  4IA5 A;  3AE1 A;  4LII A;  1EL5 A;  5KXJ A;  1ZMC A;  4NTC A;  1JNR A;  3GYX A;  4ADW A;  3AE7 A;  3HYW A;  4FX9 A;  4C77 A;  3NNE A;  3F8D A;  3LOV A;  3CIR A;  3CND A;  1JRX A;  2B76 A;  1QJD A;  3GDP A;  3CGB A;  1EBD A;  1BZL A;  2CVJ A;  2YG5 A;  1RYI A;  1NEN A;  1P2E A;  1P2H A;  3T2Z A;  5EBK A;  3C4A A;  3K7Q X;  1PBD A;  2V61 A;  4H50 A;  1YY5 A;  1B8S A;  5JCI A;  1F3P A;  1E39 A;  2AR8 A;  3GSI A;  2GR2 A;  3RED A;  1ZOV A;  5CQF A;  5EB4 A;  4H4S A;  4XWR A;  1O5W A;  1V59 A;  4YWO A;  4JQ9 A;  3K30 A;  4H4V A;  2B9Y A;  4K22 A;  4J33 A;  2YVG A;  1OJT A;  2B9X A;  3VRD B;  1IUW A;  1XAN A;  1CHU A;  2VRL A;  1IUU A;  3RP6 A;  1GT8 A;  4J36 A;  3GRS A;  3GWD A;  3S61 A;  1CC6 A;  1O94 A;  3AD9 B;  3FBS A;  4YTM A;  4Y4L A;  3EAO A;  1JOA A;  2BCP A;  4I58 A;  3F8P A;  1GRG A;  2C67 A;  2XFO A;  4OPU A;  3UTF A;  4YXD A;  4TM0 A;  1ZDL A;  2GQW A;  2TPR A;  2XFP A;  4TLX A;  2GH5 A;  3UOY A;  2BC0 A;  4U8I A;  4BUR A;  3P9U A;  3CNP A;  3AE9 A;  1BF3 A;  3V76 A;  3H8L A;  1TDN A;  2BK5 A;  1TYP A;  1H82 A;  1OJD A;  1EL8 A;  2TMD A;  2C73 A;  1S3E A;  4H2Q A;  3FPZ A;  5KVH A;  1ZY8 A;  2NVK X;  5GSN A;  5JCM A;  4U8K A;  2WEU A;  1ONF A;  2Z5X A;  1KDG A;  1DXL A;  2WP5 A;  2VVM A;  4CNK A;  2B7R A;  2OAL A;  2WHD A;  2BS4 A;  1IUT A;  3BI4 A;  2OLN A;  4CY6 A;  3ITJ A;  3HYV A;  4YSZ A;  2JB1 A;  3V3O A;  2YG4 A;  5CKU A;  1B4V A;  1E1K A;  5BVA A;  2JAE A;  2NPX A;  2C3C A;  1QO8 A;  2CUL A;  3BI5 A;  2HQM A;  2XVI A;  3AYL A;  4CCR A;  4U2S A;  4O5U A;  2C76 A;  3GD4 A;  3NN6 X;  1CJ3 A;  1PBE A;  2XLS A;  3NG7 X;  5BUL A;  3SGL A;  4M52 A;  1GOS A;  3B3R A;  3UCL A;  4K8D A;  3NK2 X;  1PXA A;  1GAL A;  3NTA A;  2V60 A;  4U8O A;  5KMP A;  3UP4 A;  2BXR A;  2WDR A;  1KF6 A;  1N4V A;  2YWL A;  3AWI A;  2C70 A;  4H4P A;  4UDP A;  1CJ2 A;  3ADA B;  2R9Z A;  1ZP0 A;  3FG2 P;  4J2W A;  5U1O A;  1OJC A;  3KPF A;  1Q1W A;  4H4X A;  1CF3 A;  4XXG A;  3KA7 A;  4EMJ A;  2QA1 A;  2IID A;  4U8J A;  3AEC A;  2RAB A;  1YQZ A;  3HZL A;  1H81 A;  4A99 A;  4EM3 A;  4H4U A;  1Y56 A;  1DOD A;  1PJ5 A;  3UOZ A;  2R0C A;  3T2Y A;  2H89 A;  5KWF A;  2F5Z A;  1VRQ B;  4GRT A;  2WBA A;  3WE0 A;  1GPE A;  1CC4 A;  4DGK A;  1H7X A;  4KX6 A;  3CPI G;  1BKW A;  2GB0 A;  2WET A;  2XVE A;  3NIX A;  1JRZ A;  2Q0L A;  1F8R A;  4U2L A;  3ZDN A;  1LQT A;  1S2Q A;  3O0H A;  3QVR A;  3RP8 A;  4OPG A;  3EF6 A;  4RSL A;  1GRA A;  3NK1 X;  3RP7 A;  3UTH A;  5KNL A;  1GEU A;  4C74 A;  4NEW A;  4D03 A;  1DJN A;  4H4W A;  1TDK A;  4II3 A;  4LA1 A;  3VRA A;  3T14 A;  1FOH A;  1RSG A;  2BK3 A;  1IUS A;  3CNJ A;  3GRT A;  3H4K A;  1YQ4 A;  3SFD A;  4TLZ A;  2C66 A;  4H2N A;  1AOG A;  2VOU A;  4JNA A;  1FCD A;  1D4D A;  2YLR A;  4G9K A;  4ZN0 A;  3AE3 A;  2VVL G;  2RGO A;  2YLT A;  1B5Q A;  3QSE A;  2VZ2 A;  1LPF A;  3P1W A;  1PBC A;  2GVC A;  1YKJ A;  3ALL A;  4USR A;  1K0L A;  2A89 A;  3CN8 A;  4BJZ A;  4G6G A;  1K0I A;  3BNM A;  4X9N A;  4OCG A;  2V6O A;  3KKJ A;  2JB3 A;  2YM1 A;  2QA2 A;  3UKK A;  3AXB A;  2GR1 A;  3LZW A;  1H7W A;  5M10 A;  3E1T A;  4ECH A;  2ZBW A;  3QSM A;  4Z43 A;  5HYM A;  1DJQ A;  2AAQ A;  4EMW A;  2C3D A;  1NAA A;  4FK1 A;  3IWA A;  4OPC A;  1LJ1 A;  1K0J A;  2VRM A;  1GXF A;  3SZW A;  3NTD A;  2XVH A;  3ZYX A;  4N9X A;  2RGJ A;  3AYJ A;  2BA9 A;  1D4E A;  2UZZ A;  2YLZ A;  3GYI A;  3CMM A;  3AE8 A;  2XLU A;  1KFY A;  2GMJ A;  3S5W A;  3DJE A;  1Z6L A;  4FK1 C;  5KMR A;  1KSS A;  3CTY A;  3GD3 A;  2WS3 A;  1TDO A;  4MJW A;  3SQP A;  2BYB A;  4ICY A;  2X8H A;  3UKQ A;  2XDO A;  4E0V A;  3EAN A;  2VQB A;  1QLB A;  1GRH A;  2WES A;  2GF3 A;  4YT0 A;  4OPI A;  1ZK7 A;  1D4C A;  2ZZ0 A;  2EQ9 A;  5JCK A;  4YTN A;  4B64 A;  4GDP A;  4A7A A;  4GAV A;  1PJ6 A;  4G6H A;  1XPQ A;  1JRY A;  1GRB A;  2ACZ A;  1PBF A;  2Z5Y A;  4REK A;  5C3J A;  4DNA A;  3JSK A;  1NHR A;  3NHO X;  2CFY A;  1M64 A;  4O5Q A;  4CCQ A;  3P4Q A;  1PXC A;  2JB2 A;  3DJJ A;  2V3B A;  4IA6 A;  3UTE A;  3GMC A;  4BV6 A;  4H4R A;  2VVL A;  1ZMD A;  2EQ6 A;  1BGN A;  1LQU A;  5HHF A;  4BK3 A;  3UP5 A;  2FJE A;  3T31 A;  3RHA A;  3QVP A;  2R0G A;  2Y6R A;  5GRT A;  2GV8 A;  1COY A;  1NDA A;  3NK0 X;  4UDR A;  2YR6 A;  3VR9 A;  4BJY A;  1TDF A;  2WU5 A;  4H4Z A;  5KOX A;  2YVJ A;  4U8N A;  3CGE A;  2YM2 A;  2B7S A;  2WOI A;  4A79 A;  2WPE A;  3OC4 A;  2JKC A;  4GDE A;  2JBV A;  1TYT A;  4GAP A;  3UKP A;  1JU2 A;  3AEE A;  2ARD A;  5J7X A;  3UTG A;  1L9C A;  3AE5 A;  3UOV A;  1VDC A;  1IJH A;  4B66 A;  3UKF A;  4WCT A;  2WU2 A;  4ZCC A;  1CC2 A;  1LTX R;  4B63 A;  4B65 A;  5FMH A;  3DJG X;  4JY2 A;  3F8R A;  3SY4 A;  5L46 A;  2C4C A;  3H8I A;  2E4G A;  4Z2T A;  3PO7 A;  2YR5 A;  3C4N A;  3CPJ G;  4PAA A;  5EOW A;  1E1L A;  4A6N A;  1GRF A;  3NKS A;  3BNU A;  3NRN A;  3AE4 A;  1Y0P A;  1NPX A;  3AE6 A;  4CBQ A;  4YKG A;  2AQJ A;  4IVM B;  3DK9 A;  3AD7 B;  1PJ7 A;  1H83 A;  3P4R A;  3DK4 A;  4APN A;  2QAE A;  3LAD A;  2YVF A;  4Z44 A;  4B68 A;  4BK2 A;  5IPY A;  2FBW A;  3SZC A;  3B6D A;  2BK4 A;  3NYE A;  4Z25 A;  3NYF A;  4U8P A;  4B67 A;  2DKI A;  2EQ7 A;  3DME A;  2Q7V A;  3PS9 A;  1E1M A;  1N4W A;  2JK6 A;  1S2Y A;  4H4T A;  3ATR A;  1SEZ A;  3HYX A;  4NWZ A;  2GR3 A;  1H6V A;  1EL7 A;  1UKV G;  1E1N A;  4YSY A;  4B1B A;  1GRE A;  1GV4 A;  2GRT A;  3EPT A;  1PBB A;  4IVO B;  1L0V A;  2X3N A;  1O95 A;  1GND A;  2BRA A;  4C3X A;  2BS2 A;  5J60 A;  3ICS A;  5KVI A;  4EQX A;  3ALJ A;  3Q6J A;  2YLX A;  3KD9 A;  1E6E A;  3DGH A;  2GAH B;  2C72 A;  2XCG A;  4EQS A;  1LVL A;  1N4U A;  2XLR A;  4LU6 A;  3IHM A;  4H2P A;  2WOV A;  4HB9 A;  4OPL A;  4YKF A;  3C96 A;  2R0P A;  3NN0 X;  2OA1 A;  3CNS A;  5KMQ A;  5M0Z A;  2VQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...