1F8SA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
482
structure length
482
Chain Sequence
NPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-AMINO ACID OXIDASE
publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 176
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8sA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8sA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8sA01
2C75A 2EQ8A 4KX6A 3BNMA 3UOVA 1NHQA 2Y6RA 2OAMA 3AD7B 4B69A 2CDUA 2C67A 1E1NA 2GR1A 2XLTA 1GRFA 3I3LA 3NHOX 3NLCA 3DK9A 3P4RA 4YXDA 3CN8A 3EANA 4YSHA 1NEKA 3IF9A 3CNJA 3KD9A 1LV0A 2QCUA 1JRZA 3BNUA 2R4JA 3UKHA 4Z26A 1P2EA 4U2SA 4A79A 3OC4A 3RHAA 3UKKA 3LOVA 1YY5A 3NK0X 1PXBA 2GMHA 4PABA 3H8IA 1EL9A 3GRTA 1N4VA 3ALMA 1JNZA 5FS6A 2BS4A 2GRTA 5IPYA 2WPEA 4OVIA 2Z5YA 1BWCA 2X8CA 3AE4A 3KLJA 2WPFA 3AE6A 4TM1A 1KSUA 4C3YA 1H7WA 4YWOA 4UDQA 5FS7A 3UKQA 1OJAA 3DK4A 3NTDA 3UKFA 1D4EA 2XFOA 2GH5A 2E4GA 2JAEA 2R0CA 1L0VA 3SFDA 4U8MA 4GCMA 4TLZA 1M6IA 5HHFA 5BVAA 1DJNA 2OLOA 4U8PA 4CNJA 3S5WA 3AE5A 3AE3A 1VRQB 3NIXA 2GQWA 2O9ZA 2BK3A 1JRYA 4H4WA 1REOA 3GD3A 5U63A 4A5LA 2QA1A 4ADWA 3DJEA 1GSNA 3DGHA 4H4YA 4B65A 1ZDLA 3CNPA 1DODA 2YLTA 4D04A 1D4DA 1PS9A 2RGJA 3QSMA 3FIMB 1CF3A 1YKJA 2XDOA 4DGKA 5FS8A 2BABA 4GDPA 5EB4A 1E39A 5M10A 4JNAA 3P4QA 3I6DA 4KPRA 1O5WA 2VZ2A 1GPEA 3R9UA 3IHGA 4H2QA 4NTEA 1CL0A 1HYUA 4N9XA 1LJ1A 4CCRA 2OALA 4CNKA 2JBVA 1GT8A 2QAEA 5EOWA 4B68A 3VRBA 4Z44A 2BK5A 2I0ZA 3GMBA 1F6MA 1ZP0A 1K0JA 3EAOA 3F8RA 2FBWA 4DSGA 4H4QA 4U8NA 3UP5A 2BCPA 4RG4A 1NDAA 2F5ZA 2YR6A 3PS9A 2C65A 3OZ2A 1Z6LA 5C3JA 1FL2A 1DNCA 3H4KA 3L1RA 2AQJA 1XHCA 1NAAA 2H89A 3EPTA 1PJ5A 1TYTA 2CFYA 3ATRA 3AXBA 3II4A 2FJEA 2XLRA 3M0OA 3LZWA 4FK1A 4K22A 4O5UA 2X8HA 4JN9A 3GYJA 2A87A 4YTPA 3ADAB 1VDCA 3UOYA 3GSIA 2AAQA 1GOSA 4AT0A 4Z2RA 4CRTA 4OPUA 1CC4A 1RYIA 4H4UA 4BURA 3NN0X 2C3CA 1GERA 1PN0A 1OJTA 4A6NB 1N4WA 2WOVA 4Z2UA 5EB5A 1KDGA 2V3AA 1CBOA 4CY8A 2R0PA 2XFPA 4OCGA 2XLUA 1ZMDA 3B3RA 3GD4A 2RGOA 2VVLA 5U25A 3C4AA 2QA2A 3CGEA 1AOGA 4PAAA 1IUVA 4YSYA 3DJJA 2GVCA 2WEUA 3GWDA 1JRXA 5BRTA 3NT6A 4XXGA 1PHHA 2B9WA 2JB1A 2X3NA 3QSEA 1NHSA 3V76A 1YQ3A 4H2RA 1L9CA 3GRSA 1H7XA 2Z5XA 1ZKQA 2JK6A 1S2YA 1K4QA 2VVLG 2B7SA 4YKFA 3WE0A 2PYXA 3DA1A 4JDRA 4JY3A 1PJ7A 4OPCA 4RSLA 2GAGB 4FX9A 4BK2A 3AEDA 1GRHA 3GYIA 4EIQA 2YWLA 4J57A 5J60A 3BHKA 2BXSA 1EL8A 3QSSA 3DH9A 4BK3A 3ICRA 1IUSA 1DOEA 2B9XA 4K8DA 4EQSA 4IA5A 3UTHA 5KOXA 4Z2TA 1YQ4A 3RP7A 5KXJA 2EQ6A 1S2QA 2DKIA 1XANA 3KPFA 4GUVA 2WBAA 3K30A 3FBSA 2BA9A 1OJDA 1S3EA 1PBBA 1V59A 1O94A 1XPQA 1GALA 1GRAA 2WDQA 1QO8A 2WPCA 2YLXA 3LXDA 5TR3A 4A99A 2V61A 3HZLA 4EM4A 2V60A 1GEUA 4GF7A 1CJ4A 2IVEA 2JKCA 3NNEA 1E6EA 4H4RA 1FEBA 3UP4A 4H4VA 2YQUA 4BJZA 5JCLA 1TYPA 4U2LA 3QFAA 1B8SA 1ONFA 1N1PA 2YAUA 1D7YA 3AEFA 4A6NA 1O95A 2WETA 1OJCA 2GAHB 2B9YA 1D7LA 3H8LA 3M13A 1KNRA 3T37A 1CJ3A 2XLPA 2GMJA 2H88A 4Y4LA 2V3BA 1ZOYA 3KA7A 4YT0A 4XWZA 2XVIA 3D8XA 4EM3A 4REKA 4ZCCA 5BUKA 3UOZA 1MO9A 5BULA 2WP6A 5JCNA 3ALJA 3C96A 3V3OA 5HY5A 2ACZA 2YG3A 5CQFA 3KVEA 3G5RA 3KKJA 1CHUA 4B66A 3ZYXA 2TPRA 1NHPA 2YR5A 3UTGA 4AP1A 4EMJA 3IWAA 3RP6A 3VR8A 2J3NA 1PXCA 3AYLA 3P1WA 3VQRA 4H4XA 4H2PA 1QJDA 3P4SA 3QVPA 1DJQA 1GXFA 4OPLA 1L9DA 3ATQA 2YG6A 4TM3A 4H2NA 4U8KA 4C5OA 2ZZCA 3F8DA 4UP3A 2RGHA 4ICYA 4J33A 5IQ1A 1BGNA 2IIDA 1H83A 1B4VA 1LTXR 2YLZA 4C3XA 2VQBA 2XFQA 1PBFA 3CGDA 3SQPA 4Y4NA 2WP5A 1GESA 2C66A 1H86A 4MJWA 4EQRA 1Q1RA 1W4XA 2FJBA 2GEWA 2VVMA 3ZDNA 4A9WA 4YKGA 1KFYA 2R46A 2YM2A 3B6DA 2HQMA 5KRQA 1TDOA 4I58A 4NZHA 5JCIA 1ZK7A 4APNA 1VQWA 3KU9A 5L46A 3PVCA 4ZN0A 3F8PA 3FPZA 2EQ9A 1LVLA 4UDPA 4E0VA 5KOWA 1TDFA 2XVEA 1ZY8A 4EQWA 2BS3A 1PJ6A 2XVHA 2XFNA 3UOXA 4B64A 1FEAA 1M64A 3DMEA 1GRGA 3AWIA 3LB8A 4Y4MA 1KF6A 4C77A 3VRAA 3NYFA 4TLXA 5J7XA 2PHHA 2ZZ0A 4LU6A 3IC9A 1GNDA 1B37A 1MXTA 1NG4A 1PXAA 2X50A 1E1KA 2YG7A 2CVJA 3AE9A 3SGLA 3CPIG 1IUWA 3G5SA 4U8OA 4NEWA 2R9ZA 4J56A 4B1BA 1TRBA 4TM0A 1YQZA 2YG4A 2WESA 2WP9A 2C3DA 2C72A 3AE7A 4M52A 5FMHA 1GTHA 1K0IA 2NPXA 4U8IA 1E1MA 1FECA 4OPGA 1UKVG 4UDRA 2C73A 4NTCA 2XVJA 4HA6A 4WX1A 4O5QA 2YLSA 1Q1WA 1FOHA 3EF6A 3ISHA 4ZCDA 1NHRA 4JNQA 4Z24A 3O0HA 2WHDA 4C74A 4DSHA 3QJ4A 3E1TA 4TM4A 1EL7A 1NENA 1BKWA 3K7TA 3FMWA 2X99A 3LZXA 1L9EA 1VG9A 4AT2A 4IA6A 1ELIA 3SM8A 3CPJG 1ZMCA 3ICSA 2C7GA 4YSZA 1LQTA 5M0ZA 2XFUA 3NYEA 1F8SA 2GR3A 4X4JA 1PBCA 1IJHA 4J2WA 4DNAA 3BI4A 2A8XA 3RP8A 5DBJA 2FJAA 1H84A 1ZX9A 4A7AA 3NGCX 4OPTA 2BXRA 2B76A 2OA1A 2APGA 1EL5A 2JB3A 2YG5A 1E7PA 4HB9A 2WOWA 5HYMA 4B67A 1JOAA 3NTAA 3AYJA 1JNRA 4ECHA 1PBDA 1CJ2A 3REDA 1GRBA 1COYA 1DXLA 4NEVA 4NTDA 4K5SA 3UCLA 4D03A 4IVOB 3CIRA 5JCMA 4H4PA 3AYIA 4LA1A 3NH3X 1LQUA 2WU2A 1IUTA 3D1CA 3ABVA 2R0GA 2GR0A 5KVHA 2BC0A 1Y56B 4CBQA 3AEAA 2GB0A 3NKSA 3UTEA 2GF3A 3LADA 3NRNA 4CCQA 5FS9A 3PO7A 3UKPA 4K7ZA 2BACA 2XVFA 2EQ7A 5CKUA 1GRTA 1F3PA 1K0LA 1LPFA 5C2TA 3AEGA 2VRLA 3LJPA 1X31B 1GTEA 3NN6X 3M12A 3SFEA 4AP3A 2X8GA 3BI2A 3NYCA 2XCGA 2B7RA 2C70A 1JEHA 2Q6UA 4FK1C 4JQ9A 4X9MA 2BK4A 2A89A 1VG0A 2GR2A 4AOXA 2VRMA 5GSNA 4Z25A 1H81A 4GDEA 1D4CA 4BJYA 5JCKA 2YVJA 4BV6A 2AR8A 3NK1X 1Q9IA 3DGZA 5ER0A 3C4NA 1KSSA 3QFBA 3AE2A 2GQFA 4H7UA 4J36A 2V6OA 4JY2A 4Z43A 5GRTA 3DJDA 1RP0A 2UZZA 1CC6A 3AB1A 3ICTA 4EMIA 4RG3A 1IUXA 1P2HA 2OLNA 2W0HA 4AOSA 1GETA 3AECA 4BK1A 2YVGA 4EIPA 3V3NA 1PBEA 3AE8A 3CGBA 1D5TA 2WS3A 2E1MA 3CNSA 4OPIA 2C64A 4WCTA 1RSGA 2Q7VA 2R45A 4USQA 4GRTA 3FG2P 5IQ4A 3GWFA 2BYBA 1MOKA 3RNMA 1H82A 1KNPA 2IVDA 1CJCA 3COXA 4EQXA 2WU5A 2VOUA 3K7QX 3JSKA 5LV9A 3DK8A 5KVIA 1F8WA 1BGJA 5U1OA 2Y6QA 4U8LA 2R4EA 3AE1A 3BHFA 4OPDA 2WDRA 3URHA 3L8KA 2E5VA 2BCGG 2XLSA 2GV8A 1Y56A 2JB2A 2Q0KA 3P4PA 3S61A 1CC2A 1EBDA 4K5RA 3CTYA 4X9NA 3CNTA 1B5QA 1GV4A 1FCDA 1PDHA 3AD9B 2BS2A 3BI5A 5EBKA 4J31A 2WOIA 4CY6A 3CPHG 2Q0LA 2ZZBA 1TDNA 1JU2A 3VRDB 3Q6JA 3CGCA 3P9UA 1QLBA 1XDIA 4LIIA 4P9SA 1DOCA 3ITJA 1H6VA 4EMWA 3CNDA 3GDPA 3AD8B 3UKAA 4B63A 2WQYA 3GMCA 3VR9A 3QVRA 4A65A 4IV9A 1OJ9A 2CULA 2FJDA 1GREA 2RABA 3DJGX 3Q9TA 1SEZA 3UTFA 1N4UA 2XYOA 4IVMB 1S3BA 2V5ZA 3AEBA 1ZOVA 2YR4A 2VQ7A 4H4TA 4U2TA 4H4SA 4H4ZA 4GR1A 1NPXA 2YLWA 2C76A 3G5QA 3AEEA 3NK2X 4YTMA 1TDEA 1F8RA 2NVKX 4J34A 1Y0PA 2ARDA 4H50A 2DKHA 1BF3A 4USRA 4U8JA 4K2XA 3NG7X 1BZLA 1E1LA 2YM1A 3UKLA 5KWFA 1NG3A 2ZBWA 5HXIA 1TDKA 3GDNA 4I59A 4FDCB 1IUUA 3ALLA 2WDVA 4XWRA 2TMDA 2YLRA 1DOBA 3K7MX 4YSXA 4YTNA 3IHMA 2BC1A 2YVFA
chains in the Genus database with same CATH superfamily
2C75A 2EQ8A 4KX6A 3BNMA 3UOVA 1NHQA 2Y6RA 2OAMA 3AD7B 4B69A 2CDUA 2C67A 1E1NA 2GR1A 2XLTA 1GRFA 3I3LA 3NHOX 3NLCA 3DK9A 3P4RA 4YXDA 3CN8A 3EANA 4YSHA 1NEKA 3IF9A 3CNJA 3KD9A 1LV0A 2QCUA 1JRZA 3BNUA 2R4JA 3UKHA 4Z26A 1P2EA 4U2SA 4A79A 3HYVA 3OC4A 3RHAA 3LOVA 3UKKA 1YY5A 3NK0X 1PXBA 2GMHA 4PABA 3H8IA 1EL9A 3GRTA 1N4VA 3ALMA 1JNZA 5FS6A 2BS4A 2GRTA 5IPYA 2WPEA 4OVIA 2Z5YA 1BWCA 2X8CA 3AE4A 3CMMA 3KLJA 2WPFA 3AE6A 4TM1A 1KSUA 4C3YA 1H7WA 4YWOA 4UDQA 5FS7A 3UKQA 1OJAA 5KMSA 3GYXA 3DK4A 3NTDA 3UKFA 1D4EA 2XFOA 2GH5A 2E4GA 2JAEA 2R0CA 1L0VA 3SFDA 3T0KA 4U8MA 4GCMA 4TLZA 1M6IA 5HHFA 5BVAA 1DJNA 2OLOA 4U8PA 4CNJA 3S5WA 3AE5A 3AE3A 1VRQB 3NIXA 2GQWA 2O9ZA 2BK3A 1JRYA 4H4WA 1REOA 3GD3A 5U63A 4A5LA 2QA1A 4ADWA 3DJEA 1GSNA 3DGHA 4H4YA 4B65A 1ZDLA 3CNPA 1DODA 2YLTA 4D04A 1D4DA 1PS9A 2RGJA 3QSMA 3FIMB 1CF3A 1YKJA 2XDOA 4DGKA 5FS8A 2BABA 4GDPA 5EB4A 1E39A 5M10A 4JNAA 3P4QA 3I6DA 4KPRA 1O5WA 2VZ2A 1GPEA 3R9UA 3IHGA 4H2QA 4NTEA 1CL0A 1HYUA 4N9XA 4GAVA 1LJ1A 4CCRA 2OALA 4CNKA 2JBVA 1GT8A 2QAEA 5EOWA 4B68A 3VRBA 4Z44A 2BK5A 2I0ZA 3GMBA 1F6MA 1ZP0A 1K0JA 3EAOA 3F8RA 2FBWA 4DSGA 4H4QA 4U8NA 3UP5A 2BCPA 4RG4A 1NDAA 2F5ZA 2YR6A 3PS9A 2C65A 3OZ2A 1Z6LA 5C3JA 1FL2A 1DNCA 3H4KA 3L1RA 2AQJA 1XHCA 1NAAA 2H89A 3EPTA 1PJ5A 1TYTA 2CFYA 3ATRA 3AXBA 3II4A 3T2YA 2FJEA 2XLRA 3M0OA 3LZWA 4FK1A 4K22A 4O5UA 2X8HA 4JN9A 3GYJA 3SZCA 2A87A 4YTPA 3ADAB 1VDCA 3UOYA 3GSIA 2AAQA 1GOSA 4AT0A 4Z2RA 4CRTA 4OPUA 3T14A 1CC4A 1RYIA 4H4UA 4BURA 3NN0X 2C3CA 1GERA 1PN0A 1OJTA 4A6NB 1N4WA 2WOVA 4Z2UA 5KMRA 5EB5A 1KDGA 2V3AA 1CBOA 4CY8A 2R0PA 2XFPA 4OCGA 2XLUA 2BRAA 1ZMDA 3B3RA 3GD4A 2RGOA 2VVLA 5U25A 3C4AA 2QA2A 3CGEA 1AOGA 4PAAA 1IUVA 4YSYA 3DJJA 2GVCA 2WEUA 3GWDA 1JRXA 5BRTA 3NT6A 4XXGA 1PHHA 2B9WA 2JB1A 2X3NA 3QSEA 1NHSA 3V76A 1YQ3A 4H2RA 4G9KA 1L9CA 3GRSA 1H7XA 2Z5XA 1ZKQA 2JK6A 1S2YA 1K4QA 2VVLG 2B7SA 4YKFA 3WE0A 2PYXA 3DA1A 4JDRA 4JY3A 1PJ7A 4OPCA 4RSLA 2GAGB 4FX9A 4BK2A 3AEDA 1GRHA 3GYIA 4EIQA 2YWLA 4J57A 5J60A 3BHKA 2BXSA 1EL8A 3QSSA 3DH9A 4BK3A 3ICRA 1IUSA 1DOEA 2B9XA 4K8DA 4EQSA 4IA5A 3UTHA 5KOXA 4Z2TA 1YQ4A 3RP7A 5KXJA 2EQ6A 1S2QA 2DKIA 1XANA 3KPFA 4GUVA 2WBAA 3K30A 3FBSA 2BA9A 1OJDA 1S3EA 1PBBA 1V59A 1O94A 1XPQA 1GALA 1GRAA 2WDQA 1QO8A 2WPCA 2YLXA 3LXDA 5TR3A 4A99A 2V61A 3HZLA 4EM4A 2V60A 1GEUA 4GF7A 1CJ4A 2IVEA 2JKCA 3NNEA 1E6EA 4H4RA 1FEBA 3UP4A 4H4VA 2YQUA 4BJZA 5JCLA 1TYPA 4U2LA 3QFAA 1B8SA 1ONFA 1N1PA 2YAUA 1D7YA 3AEFA 4A6NA 1O95A 2WETA 1OJCA 2GAHB 2B9YA 1D7LA 3H8LA 3M13A 1KNRA 3T37A 1CJ3A 2XLPA 2GMJA 2H88A 4Y4LA 2V3BA 1ZOYA 3KA7A 4YT0A 4XWZA 2XVIA 3D8XA 4EM3A 4REKA 4ZCCA 5BUKA 3UOZA 1MO9A 5BULA 2WP6A 5JCNA 3ALJA 3C96A 3V3OA 5HY5A 2ACZA 2YG3A 5CQFA 3KVEA 3G5RA 3KKJA 1CHUA 4B66A 3ZYXA 2TPRA 1NHPA 2YR5A 3UTGA 4AP1A 4EMJA 3IWAA 3RP6A 3VR8A 2J3NA 1PXCA 3AYLA 3P1WA 3VQRA 4H4XA 4H2PA 1QJDA 3P4SA 3QVPA 1DJQA 1GXFA 4OPLA 1L9DA 3ATQA 2YG6A 4TM3A 4H2NA 4U8KA 4C5OA 2ZZCA 3F8DA 4UP3A 2RGHA 4ICYA 4J33A 5IQ1A 1BGNA 2IIDA 1H83A 1B4VA 3T2ZA 1LTXR 2YLZA 4C3XA 2VQBA 2XFQA 1PBFA 3CGDA 3SQPA 4Y4NA 2WP5A 1GESA 2C66A 1H86A 4MJWA 3SZ0A 1Q1RA 4EQRA 1W4XA 2FJBA 2GEWA 2VVMA 3ZDNA 4A9WA 4YKGA 1KFYA 2R46A 2YM2A 3B6DA 2HQMA 5KRQA 1TDOA 4I58A 4NZHA 5JCIA 1ZK7A 4APNA 1VQWA 3KU9A 5L46A 3PVCA 4ZN0A 3F8PA 3FPZA 2EQ9A 1LVLA 4UDPA 4NNJA 4E0VA 5KOWA 1TDFA 2XVEA 1ZY8A 4EQWA 2BS3A 1PJ6A 2XVHA 2XFNA 3UOXA 4B64A 1FEAA 1M64A 3DMEA 1GRGA 3AWIA 3LB8A 4Y4MA 1KF6A 4C77A 3VRAA 3NYFA 4TLXA 5J7XA 2PHHA 2ZZ0A 4LU6A 3IC9A 1GNDA 1B37A 1MXTA 1NG4A 1PXAA 2X50A 1E1KA 2YG7A 2CVJA 3AE9A 3SGLA 3CPIG 1IUWA 3G5SA 4U8OA 4NEWA 2R9ZA 4J56A 4B1BA 1TRBA 4TM0A 1YQZA 2YG4A 2WESA 2WP9A 2C3DA 2C72A 3AE7A 4II3A 4M52A 5FMHA 1GTHA 1K0IA 2NPXA 4U8IA 1E1MA 1FECA 4OPGA 1UKVG 4UDRA 2C73A 3SX6A 4NTCA 2XVJA 4HA6A 4II2A 4O5QA 4G6HA 4WX1A 2YLSA 1Q1WA 1FOHA 3EF6A 3ISHA 4ZCDA 1NHRA 4JNQA 4Z24A 3O0HA 2WHDA 4C74A 4DSHA 3QJ4A 3E1TA 4TM4A 1EL7A 1NENA 1BKWA 3K7TA 3FMWA 2X99A 3LZXA 1L9EA 1VG9A 4AT2A 4IA6A 1ELIA 3SM8A 3CPJG 1ZMCA 3ICSA 2C7GA 4YSZA 1LQTA 5M0ZA 2XFUA 3NYEA 1F8SA 2GR3A 4X4JA 1PBCA 1IJHA 4J2WA 4DNAA 3BI4A 2A8XA 3RP8A 5DBJA 2FJAA 1H84A 1ZX9A 4A7AA 3NGCX 4OPTA 2BXRA 2B76A 2OA1A 2APGA 5KNLA 1EL5A 2JB3A 2YG5A 1E7PA 4HB9A 2WOWA 5HYMA 4NWZA 4B67A 1JOAA 3NTAA 3AYJA 1JNRA 4ECHA 1PBDA 1CJ2A 3REDA 1GRBA 1COYA 1DXLA 5KMQA 4NEVA 4NTDA 4K5SA 3UCLA 4D03A 4IVOB 3CIRA 5JCMA 4H4PA 3AYIA 4LA1A 3NH3X 1LQUA 2WU2A 1IUTA 3T31A 3D1CA 3SYIA 5KMPA 3ABVA 2R0GA 2GR0A 5KVHA 2BC0A 1Y56B 4CBQA 3AEAA 2GB0A 3NKSA 3UTEA 2GF3A 3LADA 3NRNA 3HYWA 4CCQA 2BRYA 3PO7A 5FS9A 3UKPA 4K7ZA 2BACA 2XVFA 2EQ7A 5CKUA 1GRTA 1F3PA 1K0LA 1LPFA 5C2TA 3AEGA 2VRLA 3LJPA 1X31B 4GAPA 1GTEA 3NN6X 3M12A 3SFEA 4AP3A 2X8GA 3BI2A 3NYCA 2XCGA 2B7RA 4G6GA 2C70A 1JEHA 2Q6UA 4FK1C 4JQ9A 4X9MA 3T2KA 2BK4A 2A89A 1VG0A 2GR2A 4AOXA 2VRMA 5GSNA 4Z25A 1H81A 4G73A 4GDEA 1D4CA 4BJYA 3HYXA 5JCKA 2YVJA 4BV6A 2AR8A 3NK1X 1Q9IA 3DGZA 5ER0A 3C4NA 1KSSA 3QFBA 3AE2A 2GQFA 4H7UA 4J36A 2V6OA 4JY2A 4Z43A 5GRTA 3DJDA 1RP0A 2UZZA 1CC6A 3AB1A 3ICTA 4EMIA 4RG3A 1IUXA 1P2HA 2OLNA 2W0HA 4AOSA 1GETA 3AECA 4BK1A 2YVGA 4EIPA 3V3NA 1PBEA 3AE8A 3CGBA 1D5TA 2WS3A 2E1MA 3CNSA 4OPIA 2C64A 4WCTA 1RSGA 2Q7VA 2R45A 4USQA 4GRTA 3SXIA 3FG2P 5IQ4A 3GWFA 2BYBA 1MOKA 3RNMA 1H82A 1KNPA 2IVDA 1CJCA 2C4CA 3COXA 4EQXA 2WU5A 2VOUA 3K7QX 3JSKA 5LV9A 3DK8A 5KVIA 1F8WA 1BGJA 5U1OA 2Y6QA 4U8LA 2R4EA 3AE1A 3BHFA 4OPDA 2WDRA 3URHA 3L8KA 2E5VA 2BCGG 2XLSA 2GV8A 1Y56A 2JB2A 2Q0KA 3P4PA 3S61A 1CC2A 1EBDA 4K5RA 3CTYA 4X9NA 3CNTA 1B5QA 1GV4A 3SZFA 1FCDA 1PDHA 3AD9B 2BS2A 3BI5A 5EBKA 4J31A 2WOIA 4CY6A 3CPHG 2Q0LA 2ZZBA 1TDNA 1JU2A 3VRDB 3Q6JA 3CGCA 3P9UA 1QLBA 1XDIA 4LIIA 4P9SA 1DOCA 3ITJA 1H6VA 4EMWA 3CNDA 3GDPA 3AD8B 3UKAA 4B63A 2WQYA 3GMCA 3VR9A 3QVRA 4A65A 4G74A 4IV9A 1OJ9A 2CULA 2FJDA 1GREA 2RABA 3DJGX 3Q9TA 1SEZA 3UTFA 1N4UA 2XYOA 4IVMB 1S3BA 2V5ZA 3AEBA 1ZOVA 2YR4A 2VQ7A 4H4TA 4U2TA 4H4SA 4H4ZA 4GR1A 1NPXA 2YLWA 2C76A 3G5QA 3AEEA 3NK2X 4YTMA 3SY4A 1TDEA 1F8RA 2NVKX 4J34A 1Y0PA 2ARDA 4H50A 2DKHA 1BF3A 4USRA 4U8JA 4K2XA 3KPKA 3NG7X 1BZLA 1E1LA 2YM1A 3UKLA 5KWFA 1NG3A 2ZBWA 5HXIA 1TDKA 3GDNA 4I59A 4FDCB 1IUUA 3ALLA 2WDVA 4XWRA 2TMDA 2YLRA 1DOBA 3K7MX 4YSXA 3SZWA 4YTNA 3IHMA 2BC1A 2YVFA
chains in the Genus database with same CATH topology
2C75A 2EQ8A 4KX6A 3BNMA 3UOVA 1NHQA 2Y6RA 2OAMA 3AD7B 4B69A 2CDUA 2C67A 1E1NA 2GR1A 2XLTA 1GRFA 3I3LA 3NHOX 3NLCA 3DK9A 3P4RA 4YXDA 3CN8A 3EANA 4YSHA 1NEKA 3IF9A 3CNJA 3KD9A 1LV0A 2QCUA 1JRZA 3BNUA 2R4JA 3UKHA 4Z26A 1P2EA 4U2SA 4A79A 3HYVA 3OC4A 3RHAA 3LOVA 3UKKA 1YY5A 3NK0X 1PXBA 2GMHA 4PABA 3H8IA 1EL9A 3GRTA 1N4VA 3ALMA 1JNZA 5FS6A 2BS4A 2GRTA 5IPYA 2WPEA 4OVIA 2Z5YA 1BWCA 2X8CA 3AE4A 3CMMA 3KLJA 2WPFA 3AE6A 4TM1A 1KSUA 4C3YA 1H7WA 4YWOA 4UDQA 5FS7A 3UKQA 1OJAA 5KMSA 3GYXA 3DK4A 3NTDA 3UKFA 1D4EA 2XFOA 2GH5A 2E4GA 2JAEA 2R0CA 1L0VA 3SFDA 3T0KA 4U8MA 4GCMA 4TLZA 1M6IA 5HHFA 5BVAA 1DJNA 2OLOA 4U8PA 4CNJA 3S5WA 3AE5A 3AE3A 1VRQB 3NIXA 2GQWA 2O9ZA 2BK3A 1JRYA 4H4WA 1REOA 3GD3A 5U63A 4A5LA 2QA1A 4ADWA 3DJEA 1GSNA 3DGHA 4H4YA 4B65A 1ZDLA 3CNPA 1DODA 2YLTA 4D04A 1D4DA 1PS9A 2RGJA 3QSMA 3FIMB 1CF3A 1YKJA 2XDOA 4DGKA 5FS8A 2BABA 4GDPA 5EB4A 1E39A 5M10A 4JNAA 3P4QA 3I6DA 4KPRA 1O5WA 2VZ2A 1GPEA 3R9UA 3IHGA 4H2QA 4NTEA 1CL0A 1HYUA 4N9XA 4GAVA 1LJ1A 4CCRA 2OALA 4CNKA 2JBVA 1GT8A 2QAEA 5EOWA 4B68A 3VRBA 4Z44A 2BK5A 2I0ZA 3GMBA 1F6MA 1ZP0A 1K0JA 3EAOA 3F8RA 2FBWA 4DSGA 4H4QA 4U8NA 3UP5A 2BCPA 4RG4A 1NDAA 2F5ZA 2YR6A 3PS9A 2C65A 3OZ2A 1Z6LA 5C3JA 1FL2A 1DNCA 3H4KA 3L1RA 2AQJA 1XHCA 1NAAA 2H89A 3EPTA 1PJ5A 1TYTA 2CFYA 3ATRA 3AXBA 3II4A 3T2YA 2FJEA 2XLRA 3M0OA 3LZWA 4FK1A 4K22A 4O5UA 2X8HA 4JN9A 3GYJA 3SZCA 2A87A 4YTPA 3ADAB 1VDCA 3UOYA 3GSIA 2AAQA 1GOSA 4AT0A 4Z2RA 4CRTA 4OPUA 3T14A 1CC4A 1RYIA 4H4UA 4BURA 3NN0X 2C3CA 1GERA 1PN0A 1OJTA 4A6NB 1N4WA 2WOVA 4Z2UA 5KMRA 5EB5A 1KDGA 2V3AA 1CBOA 4CY8A 2R0PA 2XFPA 4OCGA 2XLUA 2BRAA 1ZMDA 3B3RA 3GD4A 2RGOA 2VVLA 5U25A 3C4AA 2QA2A 3CGEA 1AOGA 4PAAA 1IUVA 4YSYA 3DJJA 2GVCA 2WEUA 3GWDA 1JRXA 5BRTA 3NT6A 4XXGA 1PHHA 2B9WA 2JB1A 2X3NA 3QSEA 1NHSA 3V76A 1YQ3A 4H2RA 4G9KA 1L9CA 3GRSA 1H7XA 2Z5XA 1ZKQA 2JK6A 1S2YA 1K4QA 2VVLG 2B7SA 4YKFA 3WE0A 2PYXA 3DA1A 4JDRA 4JY3A 1PJ7A 4OPCA 4RSLA 2GAGB 4FX9A 4BK2A 3AEDA 1GRHA 3GYIA 4EIQA 2YWLA 4J57A 5J60A 3BHKA 2BXSA 1EL8A 3QSSA 3DH9A 4BK3A 3ICRA 1IUSA 1DOEA 2B9XA 4K8DA 4EQSA 4IA5A 3UTHA 5KOXA 4Z2TA 1YQ4A 3RP7A 5KXJA 2EQ6A 1S2QA 2DKIA 1XANA 3KPFA 4GUVA 2WBAA 3K30A 3FBSA 2BA9A 1OJDA 1S3EA 1PBBA 1V59A 1O94A 1XPQA 1GALA 1GRAA 2WDQA 1QO8A 2WPCA 2YLXA 3LXDA 5TR3A 4A99A 2V61A 3HZLA 4EM4A 2V60A 1GEUA 4GF7A 1CJ4A 2IVEA 2JKCA 3NNEA 1E6EA 4H4RA 1FEBA 3UP4A 4H4VA 2YQUA 4BJZA 5JCLA 1TYPA 4U2LA 3QFAA 1B8SA 1ONFA 1N1PA 2YAUA 1D7YA 3AEFA 4A6NA 1O95A 2WETA 1OJCA 2GAHB 2B9YA 1D7LA 3H8LA 3M13A 1KNRA 3T37A 1CJ3A 2XLPA 2GMJA 2H88A 4Y4LA 2V3BA 1ZOYA 3KA7A 4YT0A 4XWZA 2XVIA 3D8XA 4EM3A 4REKA 4ZCCA 5BUKA 3UOZA 1MO9A 5BULA 2WP6A 5JCNA 3ALJA 3C96A 3V3OA 5HY5A 2ACZA 2YG3A 5CQFA 3KVEA 3G5RA 3KKJA 1CHUA 4B66A 3ZYXA 2TPRA 1NHPA 2YR5A 3UTGA 4AP1A 4EMJA 3IWAA 3RP6A 3VR8A 2J3NA 1PXCA 3AYLA 3P1WA 3VQRA 4H4XA 4H2PA 1QJDA 3P4SA 3QVPA 1DJQA 1GXFA 4OPLA 1L9DA 3ATQA 2YG6A 4TM3A 4H2NA 4U8KA 4C5OA 2ZZCA 3F8DA 4UP3A 2RGHA 4ICYA 4J33A 5IQ1A 1BGNA 2IIDA 1H83A 1B4VA 3T2ZA 1LTXR 2YLZA 4C3XA 2VQBA 2XFQA 1PBFA 3CGDA 3SQPA 4Y4NA 2WP5A 1GESA 2C66A 1H86A 4MJWA 3SZ0A 1Q1RA 4EQRA 1W4XA 2FJBA 2GEWA 2VVMA 3ZDNA 4A9WA 4YKGA 1KFYA 2R46A 2YM2A 3B6DA 2HQMA 5KRQA 1TDOA 4I58A 4NZHA 5JCIA 1ZK7A 4APNA 1VQWA 3KU9A 5L46A 3PVCA 4ZN0A 3F8PA 3FPZA 2EQ9A 1LVLA 4UDPA 4NNJA 4E0VA 5KOWA 1TDFA 2XVEA 1ZY8A 4EQWA 2BS3A 1PJ6A 2XVHA 2XFNA 3UOXA 4B64A 1FEAA 1M64A 3DMEA 1GRGA 3AWIA 3LB8A 4Y4MA 1KF6A 4C77A 3VRAA 3NYFA 4TLXA 5J7XA 2PHHA 2ZZ0A 4LU6A 3IC9A 1GNDA 1B37A 1MXTA 1NG4A 1PXAA 2X50A 1E1KA 2YG7A 2CVJA 3AE9A 3SGLA 3CPIG 1IUWA 3G5SA 4U8OA 4NEWA 2R9ZA 4J56A 4B1BA 1TRBA 4TM0A 1YQZA 2YG4A 2WESA 2WP9A 2C3DA 2C72A 3AE7A 4II3A 4M52A 5FMHA 1GTHA 1K0IA 2NPXA 4U8IA 1E1MA 1FECA 4OPGA 1UKVG 4UDRA 2C73A 3SX6A 4NTCA 2XVJA 4HA6A 4II2A 4O5QA 4G6HA 4WX1A 2YLSA 1Q1WA 1FOHA 3EF6A 3ISHA 4ZCDA 1NHRA 4JNQA 4Z24A 3O0HA 2WHDA 4C74A 4DSHA 3QJ4A 3E1TA 4TM4A 1EL7A 1NENA 1BKWA 3K7TA 3FMWA 2X99A 3LZXA 1L9EA 1VG9A 4AT2A 4IA6A 1ELIA 3SM8A 3CPJG 1ZMCA 3ICSA 2C7GA 4YSZA 1LQTA 5M0ZA 2XFUA 3NYEA 1F8SA 2GR3A 4X4JA 1PBCA 1IJHA 4J2WA 4DNAA 3BI4A 2A8XA 3RP8A 5DBJA 2FJAA 1H84A 1ZX9A 4A7AA 3NGCX 4OPTA 2BXRA 2B76A 2OA1A 2APGA 5KNLA 1EL5A 2JB3A 2YG5A 1E7PA 4HB9A 2WOWA 5HYMA 4NWZA 4B67A 1JOAA 3NTAA 3AYJA 1JNRA 4ECHA 1PBDA 1CJ2A 3REDA 1GRBA 1COYA 1DXLA 5KMQA 4NEVA 4NTDA 4K5SA 3UCLA 4D03A 4IVOB 3CIRA 5JCMA 4H4PA 3AYIA 4LA1A 3NH3X 1LQUA 2WU2A 1IUTA 3T31A 3D1CA 3SYIA 5KMPA 3ABVA 2R0GA 2GR0A 5KVHA 2BC0A 1Y56B 4CBQA 3AEAA 2GB0A 3NKSA 3UTEA 2GF3A 3LADA 3NRNA 3HYWA 4CCQA 2BRYA 3PO7A 5FS9A 3UKPA 4K7ZA 2BACA 2XVFA 2EQ7A 5CKUA 1GRTA 1F3PA 1K0LA 1LPFA 5C2TA 3AEGA 2VRLA 3LJPA 1X31B 4GAPA 1GTEA 3NN6X 3M12A 3SFEA 4AP3A 2X8GA 3BI2A 3NYCA 2XCGA 2B7RA 4G6GA 2C70A 1JEHA 2Q6UA 4FK1C 4JQ9A 4X9MA 3T2KA 2BK4A 2A89A 1VG0A 2GR2A 4AOXA 2VRMA 5GSNA 4Z25A 1H81A 4G73A 4GDEA 1D4CA 4BJYA 3HYXA 5JCKA 2YVJA 4BV6A 2AR8A 3NK1X 1Q9IA 3DGZA 5ER0A 3C4NA 1KSSA 3QFBA 3AE2A 2GQFA 4H7UA 4J36A 2V6OA 4JY2A 4Z43A 5GRTA 3DJDA 1RP0A 2UZZA 1CC6A 3AB1A 3ICTA 4EMIA 4RG3A 1IUXA 1P2HA 2OLNA 2W0HA 4AOSA 1GETA 3AECA 4BK1A 2YVGA 4EIPA 3V3NA 1PBEA 3AE8A 3CGBA 1D5TA 2WS3A 2E1MA 3CNSA 4OPIA 2C64A 4WCTA 1RSGA 2Q7VA 2R45A 4USQA 4GRTA 3SXIA 3FG2P 5IQ4A 3GWFA 2BYBA 1MOKA 3RNMA 1H82A 1KNPA 2IVDA 1CJCA 2C4CA 3COXA 4EQXA 2WU5A 2VOUA 3K7QX 3JSKA 5LV9A 3DK8A 5KVIA 1F8WA 1BGJA 5U1OA 2Y6QA 4U8LA 2R4EA 3AE1A 3BHFA 4OPDA 2WDRA 3URHA 3L8KA 2E5VA 2BCGG 2XLSA 2GV8A 1Y56A 2JB2A 2Q0KA 3P4PA 3S61A 1CC2A 1EBDA 4K5RA 3CTYA 4X9NA 3CNTA 1B5QA 1GV4A 3SZFA 1FCDA 1PDHA 3AD9B 2BS2A 3BI5A 5EBKA 4J31A 2WOIA 4CY6A 3CPHG 2Q0LA 2ZZBA 1TDNA 1JU2A 3VRDB 3Q6JA 3CGCA 3P9UA 1QLBA 1XDIA 4LIIA 4P9SA 1DOCA 3ITJA 1H6VA 4EMWA 3CNDA 3GDPA 3AD8B 3UKAA 4B63A 2WQYA 3GMCA 3VR9A 3QVRA 4A65A 4G74A 4IV9A 1OJ9A 2CULA 2FJDA 1GREA 2RABA 3DJGX 3Q9TA 1SEZA 3UTFA 1N4UA 2XYOA 4IVMB 1S3BA 2V5ZA 3AEBA 1ZOVA 2YR4A 2VQ7A 4H4TA 4U2TA 4H4SA 4H4ZA 4GR1A 1NPXA 2YLWA 2C76A 3G5QA 3AEEA 3NK2X 4YTMA 3SY4A 1TDEA 1F8RA 2NVKX 4J34A 1Y0PA 2ARDA 4H50A 2DKHA 1BF3A 4USRA 4U8JA 4K2XA 3KPKA 3NG7X 1BZLA 1E1LA 2YM1A 3UKLA 5KWFA 1NG3A 2ZBWA 5HXIA 1TDKA 3GDNA 4I59A 4FDCB 1IUUA 3ALLA 2WDVA 4XWRA 2TMDA 2YLRA 1DOBA 3K7MX 4YSXA 3SZWA 4YTNA 3IHMA 2BC1A 2YVFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C75 A;  2EQ8 A;  4KX6 A;  3BNM A;  3UOV A;  1NHQ A;  2Y6R A;  2OAM A;  3AD7 B;  4B69 A;  2CDU A;  2C67 A;  1E1N A;  2GR1 A;  2XLT A;  1GRF A;  3I3L A;  3NHO X;  3NLC A;  3DK9 A;  3P4R A;  4YXD A;  3CN8 A;  3EAN A;  4YSH A;  1NEK A;  3IF9 A;  3CNJ A;  3KD9 A;  1LV0 A;  2QCU A;  1JRZ A;  3BNU A;  2R4J A;  3UKH A;  4Z26 A;  1P2E A;  4U2S A;  4A79 A;  3OC4 A;  3RHA A;  3UKK A;  3LOV A;  1YY5 A;  3NK0 X;  1PXB A;  2GMH A;  4PAB A;  3H8I A;  1EL9 A;  3GRT A;  1N4V A;  3ALM A;  1JNZ A;  5FS6 A;  2BS4 A;  2GRT A;  5IPY A;  2WPE A;  4OVI A;  2Z5Y A;  1BWC A;  2X8C A;  3AE4 A;  3KLJ A;  2WPF A;  3AE6 A;  4TM1 A;  1KSU A;  4C3Y A;  1H7W A;  4YWO A;  4UDQ A;  5FS7 A;  3UKQ A;  1OJA A;  3DK4 A;  3NTD A;  3UKF A;  1D4E A;  2XFO A;  2GH5 A;  2E4G A;  2JAE A;  2R0C A;  1L0V A;  3SFD A;  4U8M A;  4GCM A;  4TLZ A;  1M6I A;  5HHF A;  5BVA A;  1DJN A;  2OLO A;  4U8P A;  4CNJ A;  3S5W A;  3AE5 A;  3AE3 A;  1VRQ B;  3NIX A;  2GQW A;  2O9Z A;  2BK3 A;  1JRY A;  4H4W A;  1REO A;  3GD3 A;  5U63 A;  4A5L A;  2QA1 A;  4ADW A;  3DJE A;  1GSN A;  3DGH A;  4H4Y A;  4B65 A;  1ZDL A;  3CNP A;  1DOD A;  2YLT A;  4D04 A;  1D4D A;  1PS9 A;  2RGJ A;  3QSM A;  3FIM B;  1CF3 A;  1YKJ A;  2XDO A;  4DGK A;  5FS8 A;  2BAB A;  4GDP A;  5EB4 A;  1E39 A;  5M10 A;  4JNA A;  3P4Q A;  3I6D A;  4KPR A;  1O5W A;  2VZ2 A;  1GPE A;  3R9U A;  3IHG A;  4H2Q A;  4NTE A;  1CL0 A;  1HYU A;  4N9X A;  1LJ1 A;  4CCR A;  2OAL A;  4CNK A;  2JBV A;  1GT8 A;  2QAE A;  5EOW A;  4B68 A;  3VRB A;  4Z44 A;  2BK5 A;  2I0Z A;  3GMB A;  1F6M A;  1ZP0 A;  1K0J A;  3EAO A;  3F8R A;  2FBW A;  4DSG A;  4H4Q A;  4U8N A;  3UP5 A;  2BCP A;  4RG4 A;  1NDA A;  2F5Z A;  2YR6 A;  3PS9 A;  2C65 A;  3OZ2 A;  1Z6L A;  5C3J A;  1FL2 A;  1DNC A;  3H4K A;  3L1R A;  2AQJ A;  1XHC A;  1NAA A;  2H89 A;  3EPT A;  1PJ5 A;  1TYT A;  2CFY A;  3ATR A;  3AXB A;  3II4 A;  2FJE A;  2XLR A;  3M0O A;  3LZW A;  4FK1 A;  4K22 A;  4O5U A;  2X8H A;  4JN9 A;  3GYJ A;  2A87 A;  4YTP A;  3ADA B;  1VDC A;  3UOY A;  3GSI A;  2AAQ A;  1GOS A;  4AT0 A;  4Z2R A;  4CRT A;  4OPU A;  1CC4 A;  1RYI A;  4H4U A;  4BUR A;  3NN0 X;  2C3C A;  1GER A;  1PN0 A;  1OJT A;  4A6N B;  1N4W A;  2WOV A;  4Z2U A;  5EB5 A;  1KDG A;  2V3A A;  1CBO A;  4CY8 A;  2R0P A;  2XFP A;  4OCG A;  2XLU A;  1ZMD A;  3B3R A;  3GD4 A;  2RGO A;  2VVL A;  5U25 A;  3C4A A;  2QA2 A;  3CGE A;  1AOG A;  4PAA A;  1IUV A;  4YSY A;  3DJJ A;  2GVC A;  2WEU A;  3GWD A;  1JRX A;  5BRT A;  3NT6 A;  4XXG A;  1PHH A;  2B9W A;  2JB1 A;  2X3N A;  3QSE A;  1NHS A;  3V76 A;  1YQ3 A;  4H2R A;  1L9C A;  3GRS A;  1H7X A;  2Z5X A;  1ZKQ A;  2JK6 A;  1S2Y A;  1K4Q A;  2VVL G;  2B7S A;  4YKF A;  3WE0 A;  2PYX A;  3DA1 A;  4JDR A;  4JY3 A;  1PJ7 A;  4OPC A;  4RSL A;  2GAG B;  4FX9 A;  4BK2 A;  3AED A;  1GRH A;  3GYI A;  4EIQ A;  2YWL A;  4J57 A;  5J60 A;  3BHK A;  2BXS A;  1EL8 A;  3QSS A;  3DH9 A;  4BK3 A;  3ICR A;  1IUS A;  1DOE A;  2B9X A;  4K8D A;  4EQS A;  4IA5 A;  3UTH A;  5KOX A;  4Z2T A;  1YQ4 A;  3RP7 A;  5KXJ A;  2EQ6 A;  1S2Q A;  2DKI A;  1XAN A;  3KPF A;  4GUV A;  2WBA A;  3K30 A;  3FBS A;  2BA9 A;  1OJD A;  1S3E A;  1PBB A;  1V59 A;  1O94 A;  1XPQ A;  1GAL A;  1GRA A;  2WDQ A;  1QO8 A;  2WPC A;  2YLX A;  3LXD A;  5TR3 A;  4A99 A;  2V61 A;  3HZL A;  4EM4 A;  2V60 A;  1GEU A;  4GF7 A;  1CJ4 A;  2IVE A;  2JKC A;  3NNE A;  1E6E A;  4H4R A;  1FEB A;  3UP4 A;  4H4V A;  2YQU A;  4BJZ A;  5JCL A;  1TYP A;  4U2L A;  3QFA A;  1B8S A;  1ONF A;  1N1P A;  2YAU A;  1D7Y A;  3AEF A;  4A6N A;  1O95 A;  2WET A;  1OJC A;  2GAH B;  2B9Y A;  1D7L A;  3H8L A;  3M13 A;  1KNR A;  3T37 A;  1CJ3 A;  2XLP A;  2GMJ A;  2H88 A;  4Y4L A;  2V3B A;  1ZOY A;  3KA7 A;  4YT0 A;  4XWZ A;  2XVI A;  3D8X A;  4EM3 A;  4REK A;  4ZCC A;  5BUK A;  3UOZ A;  1MO9 A;  5BUL A;  2WP6 A;  5JCN A;  3ALJ A;  3C96 A;  3V3O A;  5HY5 A;  2ACZ A;  2YG3 A;  5CQF A;  3KVE A;  3G5R A;  3KKJ A;  1CHU A;  4B66 A;  3ZYX A;  2TPR A;  1NHP A;  2YR5 A;  3UTG A;  4AP1 A;  4EMJ A;  3IWA A;  3RP6 A;  3VR8 A;  2J3N A;  1PXC A;  3AYL A;  3P1W A;  3VQR A;  4H4X A;  4H2P A;  1QJD A;  3P4S A;  3QVP A;  1DJQ A;  1GXF A;  4OPL A;  1L9D A;  3ATQ A;  2YG6 A;  4TM3 A;  4H2N A;  4U8K A;  4C5O A;  2ZZC A;  3F8D A;  4UP3 A;  2RGH A;  4ICY A;  4J33 A;  5IQ1 A;  1BGN A;  2IID A;  1H83 A;  1B4V A;  1LTX R;  2YLZ A;  4C3X A;  2VQB A;  2XFQ A;  1PBF A;  3CGD A;  3SQP A;  4Y4N A;  2WP5 A;  1GES A;  2C66 A;  1H86 A;  4MJW A;  4EQR A;  1Q1R A;  1W4X A;  2FJB A;  2GEW A;  2VVM A;  3ZDN A;  4A9W A;  4YKG A;  1KFY A;  2R46 A;  2YM2 A;  3B6D A;  2HQM A;  5KRQ A;  1TDO A;  4I58 A;  4NZH A;  5JCI A;  1ZK7 A;  4APN A;  1VQW A;  3KU9 A;  5L46 A;  3PVC A;  4ZN0 A;  3F8P A;  3FPZ A;  2EQ9 A;  1LVL A;  4UDP A;  4E0V A;  5KOW A;  1TDF A;  2XVE A;  1ZY8 A;  4EQW A;  2BS3 A;  1PJ6 A;  2XVH A;  2XFN A;  3UOX A;  4B64 A;  1FEA A;  1M64 A;  3DME A;  1GRG A;  3AWI A;  3LB8 A;  4Y4M A;  1KF6 A;  4C77 A;  3VRA A;  3NYF A;  4TLX A;  5J7X A;  2PHH A;  2ZZ0 A;  4LU6 A;  3IC9 A;  1GND A;  1B37 A;  1MXT A;  1NG4 A;  1PXA A;  2X50 A;  1E1K A;  2YG7 A;  2CVJ A;  3AE9 A;  3SGL A;  3CPI G;  1IUW A;  3G5S A;  4U8O A;  4NEW A;  2R9Z A;  4J56 A;  4B1B A;  1TRB A;  4TM0 A;  1YQZ A;  2YG4 A;  2WES A;  2WP9 A;  2C3D A;  2C72 A;  3AE7 A;  4M52 A;  5FMH A;  1GTH A;  1K0I A;  2NPX A;  4U8I A;  1E1M A;  1FEC A;  4OPG A;  1UKV G;  4UDR A;  2C73 A;  4NTC A;  2XVJ A;  4HA6 A;  4WX1 A;  4O5Q A;  2YLS A;  1Q1W A;  1FOH A;  3EF6 A;  3ISH A;  4ZCD A;  1NHR A;  4JNQ A;  4Z24 A;  3O0H A;  2WHD A;  4C74 A;  4DSH A;  3QJ4 A;  3E1T A;  4TM4 A;  1EL7 A;  1NEN A;  1BKW A;  3K7T A;  3FMW A;  2X99 A;  3LZX A;  1L9E A;  1VG9 A;  4AT2 A;  4IA6 A;  1ELI A;  3SM8 A;  3CPJ G;  1ZMC A;  3ICS A;  2C7G A;  4YSZ A;  1LQT A;  5M0Z A;  2XFU A;  3NYE A;  1F8S A;  2GR3 A;  4X4J A;  1PBC A;  1IJH A;  4J2W A;  4DNA A;  3BI4 A;  2A8X A;  3RP8 A;  5DBJ A;  2FJA A;  1H84 A;  1ZX9 A;  4A7A A;  3NGC X;  4OPT A;  2BXR A;  2B76 A;  2OA1 A;  2APG A;  1EL5 A;  2JB3 A;  2YG5 A;  1E7P A;  4HB9 A;  2WOW A;  5HYM A;  4B67 A;  1JOA A;  3NTA A;  3AYJ A;  1JNR A;  4ECH A;  1PBD A;  1CJ2 A;  3RED A;  1GRB A;  1COY A;  1DXL A;  4NEV A;  4NTD A;  4K5S A;  3UCL A;  4D03 A;  4IVO B;  3CIR A;  5JCM A;  4H4P A;  3AYI A;  4LA1 A;  3NH3 X;  1LQU A;  2WU2 A;  1IUT A;  3D1C A;  3ABV A;  2R0G A;  2GR0 A;  5KVH A;  2BC0 A;  1Y56 B;  4CBQ A;  3AEA A;  2GB0 A;  3NKS A;  3UTE A;  2GF3 A;  3LAD A;  3NRN A;  4CCQ A;  5FS9 A;  3PO7 A;  3UKP A;  4K7Z A;  2BAC A;  2XVF A;  2EQ7 A;  5CKU A;  1GRT A;  1F3P A;  1K0L A;  1LPF A;  5C2T A;  3AEG A;  2VRL A;  3LJP A;  1X31 B;  1GTE A;  3NN6 X;  3M12 A;  3SFE A;  4AP3 A;  2X8G A;  3BI2 A;  3NYC A;  2XCG A;  2B7R A;  2C70 A;  1JEH A;  2Q6U A;  4FK1 C;  4JQ9 A;  4X9M A;  2BK4 A;  2A89 A;  1VG0 A;  2GR2 A;  4AOX A;  2VRM A;  5GSN A;  4Z25 A;  1H81 A;  4GDE A;  1D4C A;  4BJY A;  5JCK A;  2YVJ A;  4BV6 A;  2AR8 A;  3NK1 X;  1Q9I A;  3DGZ A;  5ER0 A;  3C4N A;  1KSS A;  3QFB A;  3AE2 A;  2GQF A;  4H7U A;  4J36 A;  2V6O A;  4JY2 A;  4Z43 A;  5GRT A;  3DJD A;  1RP0 A;  2UZZ A;  1CC6 A;  3AB1 A;  3ICT A;  4EMI A;  4RG3 A;  1IUX A;  1P2H A;  2OLN A;  2W0H A;  4AOS A;  1GET A;  3AEC A;  4BK1 A;  2YVG A;  4EIP A;  3V3N A;  1PBE A;  3AE8 A;  3CGB A;  1D5T A;  2WS3 A;  2E1M A;  3CNS A;  4OPI A;  2C64 A;  4WCT A;  1RSG A;  2Q7V A;  2R45 A;  4USQ A;  4GRT A;  3FG2 P;  5IQ4 A;  3GWF A;  2BYB A;  1MOK A;  3RNM A;  1H82 A;  1KNP A;  2IVD A;  1CJC A;  3COX A;  4EQX A;  2WU5 A;  2VOU A;  3K7Q X;  3JSK A;  5LV9 A;  3DK8 A;  5KVI A;  1F8W A;  1BGJ A;  5U1O A;  2Y6Q A;  4U8L A;  2R4E A;  3AE1 A;  3BHF A;  4OPD A;  2WDR A;  3URH A;  3L8K A;  2E5V A;  2BCG G;  2XLS A;  2GV8 A;  1Y56 A;  2JB2 A;  2Q0K A;  3P4P A;  3S61 A;  1CC2 A;  1EBD A;  4K5R A;  3CTY A;  4X9N A;  3CNT A;  1B5Q A;  1GV4 A;  1FCD A;  1PDH A;  3AD9 B;  2BS2 A;  3BI5 A;  5EBK A;  4J31 A;  2WOI A;  4CY6 A;  3CPH G;  2Q0L A;  2ZZB A;  1TDN A;  1JU2 A;  3VRD B;  3Q6J A;  3CGC A;  3P9U A;  1QLB A;  1XDI A;  4LII A;  4P9S A;  1DOC A;  3ITJ A;  1H6V A;  4EMW A;  3CND A;  3GDP A;  3AD8 B;  3UKA A;  4B63 A;  2WQY A;  3GMC A;  3VR9 A;  3QVR A;  4A65 A;  4IV9 A;  1OJ9 A;  2CUL A;  2FJD A;  1GRE A;  2RAB A;  3DJG X;  3Q9T A;  1SEZ A;  3UTF A;  1N4U A;  2XYO A;  4IVM B;  1S3B A;  2V5Z A;  3AEB A;  1ZOV A;  2YR4 A;  2VQ7 A;  4H4T A;  4U2T A;  4H4S A;  4H4Z A;  4GR1 A;  1NPX A;  2YLW A;  2C76 A;  3G5Q A;  3AEE A;  3NK2 X;  4YTM A;  1TDE A;  1F8R A;  2NVK X;  4J34 A;  1Y0P A;  2ARD A;  4H50 A;  2DKH A;  1BF3 A;  4USR A;  4U8J A;  4K2X A;  3NG7 X;  1BZL A;  1E1L A;  2YM1 A;  3UKL A;  5KWF A;  1NG3 A;  2ZBW A;  5HXI A;  1TDK A;  3GDN A;  4I59 A;  4FDC B;  1IUU A;  3ALL A;  2WDV A;  4XWR A;  2TMD A;  2YLR A;  1DOB A;  3K7M X;  4YSX A;  4YTN A;  3IHM A;  2BC1 A;  2YVF A; 
#chains in the Genus database with same CATH topology
 2C75 A;  2EQ8 A;  4KX6 A;  3BNM A;  3UOV A;  1NHQ A;  2Y6R A;  2OAM A;  3AD7 B;  4B69 A;  2CDU A;  2C67 A;  1E1N A;  2GR1 A;  2XLT A;  1GRF A;  3I3L A;  3NHO X;  3NLC A;  3DK9 A;  3P4R A;  4YXD A;  3CN8 A;  3EAN A;  4YSH A;  1NEK A;  3IF9 A;  3CNJ A;  3KD9 A;  1LV0 A;  2QCU A;  1JRZ A;  3BNU A;  2R4J A;  3UKH A;  4Z26 A;  1P2E A;  4U2S A;  4A79 A;  3HYV A;  3OC4 A;  3RHA A;  3LOV A;  3UKK A;  1YY5 A;  3NK0 X;  1PXB A;  2GMH A;  4PAB A;  3H8I A;  1EL9 A;  3GRT A;  1N4V A;  3ALM A;  1JNZ A;  5FS6 A;  2BS4 A;  2GRT A;  5IPY A;  2WPE A;  4OVI A;  2Z5Y A;  1BWC A;  2X8C A;  3AE4 A;  3CMM A;  3KLJ A;  2WPF A;  3AE6 A;  4TM1 A;  1KSU A;  4C3Y A;  1H7W A;  4YWO A;  4UDQ A;  5FS7 A;  3UKQ A;  1OJA A;  5KMS A;  3GYX A;  3DK4 A;  3NTD A;  3UKF A;  1D4E A;  2XFO A;  2GH5 A;  2E4G A;  2JAE A;  2R0C A;  1L0V A;  3SFD A;  3T0K A;  4U8M A;  4GCM A;  4TLZ A;  1M6I A;  5HHF A;  5BVA A;  1DJN A;  2OLO A;  4U8P A;  4CNJ A;  3S5W A;  3AE5 A;  3AE3 A;  1VRQ B;  3NIX A;  2GQW A;  2O9Z A;  2BK3 A;  1JRY A;  4H4W A;  1REO A;  3GD3 A;  5U63 A;  4A5L A;  2QA1 A;  4ADW A;  3DJE A;  1GSN A;  3DGH A;  4H4Y A;  4B65 A;  1ZDL A;  3CNP A;  1DOD A;  2YLT A;  4D04 A;  1D4D A;  1PS9 A;  2RGJ A;  3QSM A;  3FIM B;  1CF3 A;  1YKJ A;  2XDO A;  4DGK A;  5FS8 A;  2BAB A;  4GDP A;  5EB4 A;  1E39 A;  5M10 A;  4JNA A;  3P4Q A;  3I6D A;  4KPR A;  1O5W A;  2VZ2 A;  1GPE A;  3R9U A;  3IHG A;  4H2Q A;  4NTE A;  1CL0 A;  1HYU A;  4N9X A;  4GAV A;  1LJ1 A;  4CCR A;  2OAL A;  4CNK A;  2JBV A;  1GT8 A;  2QAE A;  5EOW A;  4B68 A;  3VRB A;  4Z44 A;  2BK5 A;  2I0Z A;  3GMB A;  1F6M A;  1ZP0 A;  1K0J A;  3EAO A;  3F8R A;  2FBW A;  4DSG A;  4H4Q A;  4U8N A;  3UP5 A;  2BCP A;  4RG4 A;  1NDA A;  2F5Z A;  2YR6 A;  3PS9 A;  2C65 A;  3OZ2 A;  1Z6L A;  5C3J A;  1FL2 A;  1DNC A;  3H4K A;  3L1R A;  2AQJ A;  1XHC A;  1NAA A;  2H89 A;  3EPT A;  1PJ5 A;  1TYT A;  2CFY A;  3ATR A;  3AXB A;  3II4 A;  3T2Y A;  2FJE A;  2XLR A;  3M0O A;  3LZW A;  4FK1 A;  4K22 A;  4O5U A;  2X8H A;  4JN9 A;  3GYJ A;  3SZC A;  2A87 A;  4YTP A;  3ADA B;  1VDC A;  3UOY A;  3GSI A;  2AAQ A;  1GOS A;  4AT0 A;  4Z2R A;  4CRT A;  4OPU A;  3T14 A;  1CC4 A;  1RYI A;  4H4U A;  4BUR A;  3NN0 X;  2C3C A;  1GER A;  1PN0 A;  1OJT A;  4A6N B;  1N4W A;  2WOV A;  4Z2U A;  5KMR A;  5EB5 A;  1KDG A;  2V3A A;  1CBO A;  4CY8 A;  2R0P A;  2XFP A;  4OCG A;  2XLU A;  2BRA A;  1ZMD A;  3B3R A;  3GD4 A;  2RGO A;  2VVL A;  5U25 A;  3C4A A;  2QA2 A;  3CGE A;  1AOG A;  4PAA A;  1IUV A;  4YSY A;  3DJJ A;  2GVC A;  2WEU A;  3GWD A;  1JRX A;  5BRT A;  3NT6 A;  4XXG A;  1PHH A;  2B9W A;  2JB1 A;  2X3N A;  3QSE A;  1NHS A;  3V76 A;  1YQ3 A;  4H2R A;  4G9K A;  1L9C A;  3GRS A;  1H7X A;  2Z5X A;  1ZKQ A;  2JK6 A;  1S2Y A;  1K4Q A;  2VVL G;  2B7S A;  4YKF A;  3WE0 A;  2PYX A;  3DA1 A;  4JDR A;  4JY3 A;  1PJ7 A;  4OPC A;  4RSL A;  2GAG B;  4FX9 A;  4BK2 A;  3AED A;  1GRH A;  3GYI A;  4EIQ A;  2YWL A;  4J57 A;  5J60 A;  3BHK A;  2BXS A;  1EL8 A;  3QSS A;  3DH9 A;  4BK3 A;  3ICR A;  1IUS A;  1DOE A;  2B9X A;  4K8D A;  4EQS A;  4IA5 A;  3UTH A;  5KOX A;  4Z2T A;  1YQ4 A;  3RP7 A;  5KXJ A;  2EQ6 A;  1S2Q A;  2DKI A;  1XAN A;  3KPF A;  4GUV A;  2WBA A;  3K30 A;  3FBS A;  2BA9 A;  1OJD A;  1S3E A;  1PBB A;  1V59 A;  1O94 A;  1XPQ A;  1GAL A;  1GRA A;  2WDQ A;  1QO8 A;  2WPC A;  2YLX A;  3LXD A;  5TR3 A;  4A99 A;  2V61 A;  3HZL A;  4EM4 A;  2V60 A;  1GEU A;  4GF7 A;  1CJ4 A;  2IVE A;  2JKC A;  3NNE A;  1E6E A;  4H4R A;  1FEB A;  3UP4 A;  4H4V A;  2YQU A;  4BJZ A;  5JCL A;  1TYP A;  4U2L A;  3QFA A;  1B8S A;  1ONF A;  1N1P A;  2YAU A;  1D7Y A;  3AEF A;  4A6N A;  1O95 A;  2WET A;  1OJC A;  2GAH B;  2B9Y A;  1D7L A;  3H8L A;  3M13 A;  1KNR A;  3T37 A;  1CJ3 A;  2XLP A;  2GMJ A;  2H88 A;  4Y4L A;  2V3B A;  1ZOY A;  3KA7 A;  4YT0 A;  4XWZ A;  2XVI A;  3D8X A;  4EM3 A;  4REK A;  4ZCC A;  5BUK A;  3UOZ A;  1MO9 A;  5BUL A;  2WP6 A;  5JCN A;  3ALJ A;  3C96 A;  3V3O A;  5HY5 A;  2ACZ A;  2YG3 A;  5CQF A;  3KVE A;  3G5R A;  3KKJ A;  1CHU A;  4B66 A;  3ZYX A;  2TPR A;  1NHP A;  2YR5 A;  3UTG A;  4AP1 A;  4EMJ A;  3IWA A;  3RP6 A;  3VR8 A;  2J3N A;  1PXC A;  3AYL A;  3P1W A;  3VQR A;  4H4X A;  4H2P A;  1QJD A;  3P4S A;  3QVP A;  1DJQ A;  1GXF A;  4OPL A;  1L9D A;  3ATQ A;  2YG6 A;  4TM3 A;  4H2N A;  4U8K A;  4C5O A;  2ZZC A;  3F8D A;  4UP3 A;  2RGH A;  4ICY A;  4J33 A;  5IQ1 A;  1BGN A;  2IID A;  1H83 A;  1B4V A;  3T2Z A;  1LTX R;  2YLZ A;  4C3X A;  2VQB A;  2XFQ A;  1PBF A;  3CGD A;  3SQP A;  4Y4N A;  2WP5 A;  1GES A;  2C66 A;  1H86 A;  4MJW A;  3SZ0 A;  1Q1R A;  4EQR A;  1W4X A;  2FJB A;  2GEW A;  2VVM A;  3ZDN A;  4A9W A;  4YKG A;  1KFY A;  2R46 A;  2YM2 A;  3B6D A;  2HQM A;  5KRQ A;  1TDO A;  4I58 A;  4NZH A;  5JCI A;  1ZK7 A;  4APN A;  1VQW A;  3KU9 A;  5L46 A;  3PVC A;  4ZN0 A;  3F8P A;  3FPZ A;  2EQ9 A;  1LVL A;  4UDP A;  4NNJ A;  4E0V A;  5KOW A;  1TDF A;  2XVE A;  1ZY8 A;  4EQW A;  2BS3 A;  1PJ6 A;  2XVH A;  2XFN A;  3UOX A;  4B64 A;  1FEA A;  1M64 A;  3DME A;  1GRG A;  3AWI A;  3LB8 A;  4Y4M A;  1KF6 A;  4C77 A;  3VRA A;  3NYF A;  4TLX A;  5J7X A;  2PHH A;  2ZZ0 A;  4LU6 A;  3IC9 A;  1GND A;  1B37 A;  1MXT A;  1NG4 A;  1PXA A;  2X50 A;  1E1K A;  2YG7 A;  2CVJ A;  3AE9 A;  3SGL A;  3CPI G;  1IUW A;  3G5S A;  4U8O A;  4NEW A;  2R9Z A;  4J56 A;  4B1B A;  1TRB A;  4TM0 A;  1YQZ A;  2YG4 A;  2WES A;  2WP9 A;  2C3D A;  2C72 A;  3AE7 A;  4II3 A;  4M52 A;  5FMH A;  1GTH A;  1K0I A;  2NPX A;  4U8I A;  1E1M A;  1FEC A;  4OPG A;  1UKV G;  4UDR A;  2C73 A;  3SX6 A;  4NTC A;  2XVJ A;  4HA6 A;  4II2 A;  4O5Q A;  4G6H A;  4WX1 A;  2YLS A;  1Q1W A;  1FOH A;  3EF6 A;  3ISH A;  4ZCD A;  1NHR A;  4JNQ A;  4Z24 A;  3O0H A;  2WHD A;  4C74 A;  4DSH A;  3QJ4 A;  3E1T A;  4TM4 A;  1EL7 A;  1NEN A;  1BKW A;  3K7T A;  3FMW A;  2X99 A;  3LZX A;  1L9E A;  1VG9 A;  4AT2 A;  4IA6 A;  1ELI A;  3SM8 A;  3CPJ G;  1ZMC A;  3ICS A;  2C7G A;  4YSZ A;  1LQT A;  5M0Z A;  2XFU A;  3NYE A;  1F8S A;  2GR3 A;  4X4J A;  1PBC A;  1IJH A;  4J2W A;  4DNA A;  3BI4 A;  2A8X A;  3RP8 A;  5DBJ A;  2FJA A;  1H84 A;  1ZX9 A;  4A7A A;  3NGC X;  4OPT A;  2BXR A;  2B76 A;  2OA1 A;  2APG A;  5KNL A;  1EL5 A;  2JB3 A;  2YG5 A;  1E7P A;  4HB9 A;  2WOW A;  5HYM A;  4NWZ A;  4B67 A;  1JOA A;  3NTA A;  3AYJ A;  1JNR A;  4ECH A;  1PBD A;  1CJ2 A;  3RED A;  1GRB A;  1COY A;  1DXL A;  5KMQ A;  4NEV A;  4NTD A;  4K5S A;  3UCL A;  4D03 A;  4IVO B;  3CIR A;  5JCM A;  4H4P A;  3AYI A;  4LA1 A;  3NH3 X;  1LQU A;  2WU2 A;  1IUT A;  3T31 A;  3D1C A;  3SYI A;  5KMP A;  3ABV A;  2R0G A;  2GR0 A;  5KVH A;  2BC0 A;  1Y56 B;  4CBQ A;  3AEA A;  2GB0 A;  3NKS A;  3UTE A;  2GF3 A;  3LAD A;  3NRN A;  3HYW A;  4CCQ A;  2BRY A;  3PO7 A;  5FS9 A;  3UKP A;  4K7Z A;  2BAC A;  2XVF A;  2EQ7 A;  5CKU A;  1GRT A;  1F3P A;  1K0L A;  1LPF A;  5C2T A;  3AEG A;  2VRL A;  3LJP A;  1X31 B;  4GAP A;  1GTE A;  3NN6 X;  3M12 A;  3SFE A;  4AP3 A;  2X8G A;  3BI2 A;  3NYC A;  2XCG A;  2B7R A;  4G6G A;  2C70 A;  1JEH A;  2Q6U A;  4FK1 C;  4JQ9 A;  4X9M A;  3T2K A;  2BK4 A;  2A89 A;  1VG0 A;  2GR2 A;  4AOX A;  2VRM A;  5GSN A;  4Z25 A;  1H81 A;  4G73 A;  4GDE A;  1D4C A;  4BJY A;  3HYX A;  5JCK A;  2YVJ A;  4BV6 A;  2AR8 A;  3NK1 X;  1Q9I A;  3DGZ A;  5ER0 A;  3C4N A;  1KSS A;  3QFB A;  3AE2 A;  2GQF A;  4H7U A;  4J36 A;  2V6O A;  4JY2 A;  4Z43 A;  5GRT A;  3DJD A;  1RP0 A;  2UZZ A;  1CC6 A;  3AB1 A;  3ICT A;  4EMI A;  4RG3 A;  1IUX A;  1P2H A;  2OLN A;  2W0H A;  4AOS A;  1GET A;  3AEC A;  4BK1 A;  2YVG A;  4EIP A;  3V3N A;  1PBE A;  3AE8 A;  3CGB A;  1D5T A;  2WS3 A;  2E1M A;  3CNS A;  4OPI A;  2C64 A;  4WCT A;  1RSG A;  2Q7V A;  2R45 A;  4USQ A;  4GRT A;  3SXI A;  3FG2 P;  5IQ4 A;  3GWF A;  2BYB A;  1MOK A;  3RNM A;  1H82 A;  1KNP A;  2IVD A;  1CJC A;  2C4C A;  3COX A;  4EQX A;  2WU5 A;  2VOU A;  3K7Q X;  3JSK A;  5LV9 A;  3DK8 A;  5KVI A;  1F8W A;  1BGJ A;  5U1O A;  2Y6Q A;  4U8L A;  2R4E A;  3AE1 A;  3BHF A;  4OPD A;  2WDR A;  3URH A;  3L8K A;  2E5V A;  2BCG G;  2XLS A;  2GV8 A;  1Y56 A;  2JB2 A;  2Q0K A;  3P4P A;  3S61 A;  1CC2 A;  1EBD A;  4K5R A;  3CTY A;  4X9N A;  3CNT A;  1B5Q A;  1GV4 A;  3SZF A;  1FCD A;  1PDH A;  3AD9 B;  2BS2 A;  3BI5 A;  5EBK A;  4J31 A;  2WOI A;  4CY6 A;  3CPH G;  2Q0L A;  2ZZB A;  1TDN A;  1JU2 A;  3VRD B;  3Q6J A;  3CGC A;  3P9U A;  1QLB A;  1XDI A;  4LII A;  4P9S A;  1DOC A;  3ITJ A;  1H6V A;  4EMW A;  3CND A;  3GDP A;  3AD8 B;  3UKA A;  4B63 A;  2WQY A;  3GMC A;  3VR9 A;  3QVR A;  4A65 A;  4G74 A;  4IV9 A;  1OJ9 A;  2CUL A;  2FJD A;  1GRE A;  2RAB A;  3DJG X;  3Q9T A;  1SEZ A;  3UTF A;  1N4U A;  2XYO A;  4IVM B;  1S3B A;  2V5Z A;  3AEB A;  1ZOV A;  2YR4 A;  2VQ7 A;  4H4T A;  4U2T A;  4H4S A;  4H4Z A;  4GR1 A;  1NPX A;  2YLW A;  2C76 A;  3G5Q A;  3AEE A;  3NK2 X;  4YTM A;  3SY4 A;  1TDE A;  1F8R A;  2NVK X;  4J34 A;  1Y0P A;  2ARD A;  4H50 A;  2DKH A;  1BF3 A;  4USR A;  4U8J A;  4K2X A;  3KPK A;  3NG7 X;  1BZL A;  1E1L A;  2YM1 A;  3UKL A;  5KWF A;  1NG3 A;  2ZBW A;  5HXI A;  1TDK A;  3GDN A;  4I59 A;  4FDC B;  1IUU A;  3ALL A;  2WDV A;  4XWR A;  2TMD A;  2YLR A;  1DOB A;  3K7M X;  4YSX A;  3SZW A;  4YTN A;  3IHM A;  2BC1 A;  2YVF A; 
#chains in the Genus database with same CATH homology
 2C75 A;  2EQ8 A;  4KX6 A;  3BNM A;  3UOV A;  1NHQ A;  2Y6R A;  2OAM A;  3AD7 B;  4B69 A;  2CDU A;  2C67 A;  1E1N A;  2GR1 A;  2XLT A;  1GRF A;  3I3L A;  3NHO X;  3NLC A;  3DK9 A;  3P4R A;  4YXD A;  3CN8 A;  3EAN A;  4YSH A;  1NEK A;  3IF9 A;  3CNJ A;  3KD9 A;  1LV0 A;  2QCU A;  1JRZ A;  3BNU A;  2R4J A;  3UKH A;  4Z26 A;  1P2E A;  4U2S A;  4A79 A;  3HYV A;  3OC4 A;  3RHA A;  3LOV A;  3UKK A;  1YY5 A;  3NK0 X;  1PXB A;  2GMH A;  4PAB A;  3H8I A;  1EL9 A;  3GRT A;  1N4V A;  3ALM A;  1JNZ A;  5FS6 A;  2BS4 A;  2GRT A;  5IPY A;  2WPE A;  4OVI A;  2Z5Y A;  1BWC A;  2X8C A;  3AE4 A;  3CMM A;  3KLJ A;  2WPF A;  3AE6 A;  4TM1 A;  1KSU A;  4C3Y A;  1H7W A;  4YWO A;  4UDQ A;  5FS7 A;  3UKQ A;  1OJA A;  5KMS A;  3GYX A;  3DK4 A;  3NTD A;  3UKF A;  1D4E A;  2XFO A;  2GH5 A;  2E4G A;  2JAE A;  2R0C A;  1L0V A;  3SFD A;  3T0K A;  4U8M A;  4GCM A;  4TLZ A;  1M6I A;  5HHF A;  5BVA A;  1DJN A;  2OLO A;  4U8P A;  4CNJ A;  3S5W A;  3AE5 A;  3AE3 A;  1VRQ B;  3NIX A;  2GQW A;  2O9Z A;  2BK3 A;  1JRY A;  4H4W A;  1REO A;  3GD3 A;  5U63 A;  4A5L A;  2QA1 A;  4ADW A;  3DJE A;  1GSN A;  3DGH A;  4H4Y A;  4B65 A;  1ZDL A;  3CNP A;  1DOD A;  2YLT A;  4D04 A;  1D4D A;  1PS9 A;  2RGJ A;  3QSM A;  3FIM B;  1CF3 A;  1YKJ A;  2XDO A;  4DGK A;  5FS8 A;  2BAB A;  4GDP A;  5EB4 A;  1E39 A;  5M10 A;  4JNA A;  3P4Q A;  3I6D A;  4KPR A;  1O5W A;  2VZ2 A;  1GPE A;  3R9U A;  3IHG A;  4H2Q A;  4NTE A;  1CL0 A;  1HYU A;  4N9X A;  4GAV A;  1LJ1 A;  4CCR A;  2OAL A;  4CNK A;  2JBV A;  1GT8 A;  2QAE A;  5EOW A;  4B68 A;  3VRB A;  4Z44 A;  2BK5 A;  2I0Z A;  3GMB A;  1F6M A;  1ZP0 A;  1K0J A;  3EAO A;  3F8R A;  2FBW A;  4DSG A;  4H4Q A;  4U8N A;  3UP5 A;  2BCP A;  4RG4 A;  1NDA A;  2F5Z A;  2YR6 A;  3PS9 A;  2C65 A;  3OZ2 A;  1Z6L A;  5C3J A;  1FL2 A;  1DNC A;  3H4K A;  3L1R A;  2AQJ A;  1XHC A;  1NAA A;  2H89 A;  3EPT A;  1PJ5 A;  1TYT A;  2CFY A;  3ATR A;  3AXB A;  3II4 A;  3T2Y A;  2FJE A;  2XLR A;  3M0O A;  3LZW A;  4FK1 A;  4K22 A;  4O5U A;  2X8H A;  4JN9 A;  3GYJ A;  3SZC A;  2A87 A;  4YTP A;  3ADA B;  1VDC A;  3UOY A;  3GSI A;  2AAQ A;  1GOS A;  4AT0 A;  4Z2R A;  4CRT A;  4OPU A;  3T14 A;  1CC4 A;  1RYI A;  4H4U A;  4BUR A;  3NN0 X;  2C3C A;  1GER A;  1PN0 A;  1OJT A;  4A6N B;  1N4W A;  2WOV A;  4Z2U A;  5KMR A;  5EB5 A;  1KDG A;  2V3A A;  1CBO A;  4CY8 A;  2R0P A;  2XFP A;  4OCG A;  2XLU A;  2BRA A;  1ZMD A;  3B3R A;  3GD4 A;  2RGO A;  2VVL A;  5U25 A;  3C4A A;  2QA2 A;  3CGE A;  1AOG A;  4PAA A;  1IUV A;  4YSY A;  3DJJ A;  2GVC A;  2WEU A;  3GWD A;  1JRX A;  5BRT A;  3NT6 A;  4XXG A;  1PHH A;  2B9W A;  2JB1 A;  2X3N A;  3QSE A;  1NHS A;  3V76 A;  1YQ3 A;  4H2R A;  4G9K A;  1L9C A;  3GRS A;  1H7X A;  2Z5X A;  1ZKQ A;  2JK6 A;  1S2Y A;  1K4Q A;  2VVL G;  2B7S A;  4YKF A;  3WE0 A;  2PYX A;  3DA1 A;  4JDR A;  4JY3 A;  1PJ7 A;  4OPC A;  4RSL A;  2GAG B;  4FX9 A;  4BK2 A;  3AED A;  1GRH A;  3GYI A;  4EIQ A;  2YWL A;  4J57 A;  5J60 A;  3BHK A;  2BXS A;  1EL8 A;  3QSS A;  3DH9 A;  4BK3 A;  3ICR A;  1IUS A;  1DOE A;  2B9X A;  4K8D A;  4EQS A;  4IA5 A;  3UTH A;  5KOX A;  4Z2T A;  1YQ4 A;  3RP7 A;  5KXJ A;  2EQ6 A;  1S2Q A;  2DKI A;  1XAN A;  3KPF A;  4GUV A;  2WBA A;  3K30 A;  3FBS A;  2BA9 A;  1OJD A;  1S3E A;  1PBB A;  1V59 A;  1O94 A;  1XPQ A;  1GAL A;  1GRA A;  2WDQ A;  1QO8 A;  2WPC A;  2YLX A;  3LXD A;  5TR3 A;  4A99 A;  2V61 A;  3HZL A;  4EM4 A;  2V60 A;  1GEU A;  4GF7 A;  1CJ4 A;  2IVE A;  2JKC A;  3NNE A;  1E6E A;  4H4R A;  1FEB A;  3UP4 A;  4H4V A;  2YQU A;  4BJZ A;  5JCL A;  1TYP A;  4U2L A;  3QFA A;  1B8S A;  1ONF A;  1N1P A;  2YAU A;  1D7Y A;  3AEF A;  4A6N A;  1O95 A;  2WET A;  1OJC A;  2GAH B;  2B9Y A;  1D7L A;  3H8L A;  3M13 A;  1KNR A;  3T37 A;  1CJ3 A;  2XLP A;  2GMJ A;  2H88 A;  4Y4L A;  2V3B A;  1ZOY A;  3KA7 A;  4YT0 A;  4XWZ A;  2XVI A;  3D8X A;  4EM3 A;  4REK A;  4ZCC A;  5BUK A;  3UOZ A;  1MO9 A;  5BUL A;  2WP6 A;  5JCN A;  3ALJ A;  3C96 A;  3V3O A;  5HY5 A;  2ACZ A;  2YG3 A;  5CQF A;  3KVE A;  3G5R A;  3KKJ A;  1CHU A;  4B66 A;  3ZYX A;  2TPR A;  1NHP A;  2YR5 A;  3UTG A;  4AP1 A;  4EMJ A;  3IWA A;  3RP6 A;  3VR8 A;  2J3N A;  1PXC A;  3AYL A;  3P1W A;  3VQR A;  4H4X A;  4H2P A;  1QJD A;  3P4S A;  3QVP A;  1DJQ A;  1GXF A;  4OPL A;  1L9D A;  3ATQ A;  2YG6 A;  4TM3 A;  4H2N A;  4U8K A;  4C5O A;  2ZZC A;  3F8D A;  4UP3 A;  2RGH A;  4ICY A;  4J33 A;  5IQ1 A;  1BGN A;  2IID A;  1H83 A;  1B4V A;  3T2Z A;  1LTX R;  2YLZ A;  4C3X A;  2VQB A;  2XFQ A;  1PBF A;  3CGD A;  3SQP A;  4Y4N A;  2WP5 A;  1GES A;  2C66 A;  1H86 A;  4MJW A;  3SZ0 A;  1Q1R A;  4EQR A;  1W4X A;  2FJB A;  2GEW A;  2VVM A;  3ZDN A;  4A9W A;  4YKG A;  1KFY A;  2R46 A;  2YM2 A;  3B6D A;  2HQM A;  5KRQ A;  1TDO A;  4I58 A;  4NZH A;  5JCI A;  1ZK7 A;  4APN A;  1VQW A;  3KU9 A;  5L46 A;  3PVC A;  4ZN0 A;  3F8P A;  3FPZ A;  2EQ9 A;  1LVL A;  4UDP A;  4NNJ A;  4E0V A;  5KOW A;  1TDF A;  2XVE A;  1ZY8 A;  4EQW A;  2BS3 A;  1PJ6 A;  2XVH A;  2XFN A;  3UOX A;  4B64 A;  1FEA A;  1M64 A;  3DME A;  1GRG A;  3AWI A;  3LB8 A;  4Y4M A;  1KF6 A;  4C77 A;  3VRA A;  3NYF A;  4TLX A;  5J7X A;  2PHH A;  2ZZ0 A;  4LU6 A;  3IC9 A;  1GND A;  1B37 A;  1MXT A;  1NG4 A;  1PXA A;  2X50 A;  1E1K A;  2YG7 A;  2CVJ A;  3AE9 A;  3SGL A;  3CPI G;  1IUW A;  3G5S A;  4U8O A;  4NEW A;  2R9Z A;  4J56 A;  4B1B A;  1TRB A;  4TM0 A;  1YQZ A;  2YG4 A;  2WES A;  2WP9 A;  2C3D A;  2C72 A;  3AE7 A;  4II3 A;  4M52 A;  5FMH A;  1GTH A;  1K0I A;  2NPX A;  4U8I A;  1E1M A;  1FEC A;  4OPG A;  1UKV G;  4UDR A;  2C73 A;  3SX6 A;  4NTC A;  2XVJ A;  4HA6 A;  4II2 A;  4O5Q A;  4G6H A;  4WX1 A;  2YLS A;  1Q1W A;  1FOH A;  3EF6 A;  3ISH A;  4ZCD A;  1NHR A;  4JNQ A;  4Z24 A;  3O0H A;  2WHD A;  4C74 A;  4DSH A;  3QJ4 A;  3E1T A;  4TM4 A;  1EL7 A;  1NEN A;  1BKW A;  3K7T A;  3FMW A;  2X99 A;  3LZX A;  1L9E A;  1VG9 A;  4AT2 A;  4IA6 A;  1ELI A;  3SM8 A;  3CPJ G;  1ZMC A;  3ICS A;  2C7G A;  4YSZ A;  1LQT A;  5M0Z A;  2XFU A;  3NYE A;  1F8S A;  2GR3 A;  4X4J A;  1PBC A;  1IJH A;  4J2W A;  4DNA A;  3BI4 A;  2A8X A;  3RP8 A;  5DBJ A;  2FJA A;  1H84 A;  1ZX9 A;  4A7A A;  3NGC X;  4OPT A;  2BXR A;  2B76 A;  2OA1 A;  2APG A;  5KNL A;  1EL5 A;  2JB3 A;  2YG5 A;  1E7P A;  4HB9 A;  2WOW A;  5HYM A;  4NWZ A;  4B67 A;  1JOA A;  3NTA A;  3AYJ A;  1JNR A;  4ECH A;  1PBD A;  1CJ2 A;  3RED A;  1GRB A;  1COY A;  1DXL A;  5KMQ A;  4NEV A;  4NTD A;  4K5S A;  3UCL A;  4D03 A;  4IVO B;  3CIR A;  5JCM A;  4H4P A;  3AYI A;  4LA1 A;  3NH3 X;  1LQU A;  2WU2 A;  1IUT A;  3T31 A;  3D1C A;  3SYI A;  5KMP A;  3ABV A;  2R0G A;  2GR0 A;  5KVH A;  2BC0 A;  1Y56 B;  4CBQ A;  3AEA A;  2GB0 A;  3NKS A;  3UTE A;  2GF3 A;  3LAD A;  3NRN A;  3HYW A;  4CCQ A;  2BRY A;  3PO7 A;  5FS9 A;  3UKP A;  4K7Z A;  2BAC A;  2XVF A;  2EQ7 A;  5CKU A;  1GRT A;  1F3P A;  1K0L A;  1LPF A;  5C2T A;  3AEG A;  2VRL A;  3LJP A;  1X31 B;  4GAP A;  1GTE A;  3NN6 X;  3M12 A;  3SFE A;  4AP3 A;  2X8G A;  3BI2 A;  3NYC A;  2XCG A;  2B7R A;  4G6G A;  2C70 A;  1JEH A;  2Q6U A;  4FK1 C;  4JQ9 A;  4X9M A;  3T2K A;  2BK4 A;  2A89 A;  1VG0 A;  2GR2 A;  4AOX A;  2VRM A;  5GSN A;  4Z25 A;  1H81 A;  4G73 A;  4GDE A;  1D4C A;  4BJY A;  3HYX A;  5JCK A;  2YVJ A;  4BV6 A;  2AR8 A;  3NK1 X;  1Q9I A;  3DGZ A;  5ER0 A;  3C4N A;  1KSS A;  3QFB A;  3AE2 A;  2GQF A;  4H7U A;  4J36 A;  2V6O A;  4JY2 A;  4Z43 A;  5GRT A;  3DJD A;  1RP0 A;  2UZZ A;  1CC6 A;  3AB1 A;  3ICT A;  4EMI A;  4RG3 A;  1IUX A;  1P2H A;  2OLN A;  2W0H A;  4AOS A;  1GET A;  3AEC A;  4BK1 A;  2YVG A;  4EIP A;  3V3N A;  1PBE A;  3AE8 A;  3CGB A;  1D5T A;  2WS3 A;  2E1M A;  3CNS A;  4OPI A;  2C64 A;  4WCT A;  1RSG A;  2Q7V A;  2R45 A;  4USQ A;  4GRT A;  3SXI A;  3FG2 P;  5IQ4 A;  3GWF A;  2BYB A;  1MOK A;  3RNM A;  1H82 A;  1KNP A;  2IVD A;  1CJC A;  2C4C A;  3COX A;  4EQX A;  2WU5 A;  2VOU A;  3K7Q X;  3JSK A;  5LV9 A;  3DK8 A;  5KVI A;  1F8W A;  1BGJ A;  5U1O A;  2Y6Q A;  4U8L A;  2R4E A;  3AE1 A;  3BHF A;  4OPD A;  2WDR A;  3URH A;  3L8K A;  2E5V A;  2BCG G;  2XLS A;  2GV8 A;  1Y56 A;  2JB2 A;  2Q0K A;  3P4P A;  3S61 A;  1CC2 A;  1EBD A;  4K5R A;  3CTY A;  4X9N A;  3CNT A;  1B5Q A;  1GV4 A;  3SZF A;  1FCD A;  1PDH A;  3AD9 B;  2BS2 A;  3BI5 A;  5EBK A;  4J31 A;  2WOI A;  4CY6 A;  3CPH G;  2Q0L A;  2ZZB A;  1TDN A;  1JU2 A;  3VRD B;  3Q6J A;  3CGC A;  3P9U A;  1QLB A;  1XDI A;  4LII A;  4P9S A;  1DOC A;  3ITJ A;  1H6V A;  4EMW A;  3CND A;  3GDP A;  3AD8 B;  3UKA A;  4B63 A;  2WQY A;  3GMC A;  3VR9 A;  3QVR A;  4A65 A;  4G74 A;  4IV9 A;  1OJ9 A;  2CUL A;  2FJD A;  1GRE A;  2RAB A;  3DJG X;  3Q9T A;  1SEZ A;  3UTF A;  1N4U A;  2XYO A;  4IVM B;  1S3B A;  2V5Z A;  3AEB A;  1ZOV A;  2YR4 A;  2VQ7 A;  4H4T A;  4U2T A;  4H4S A;  4H4Z A;  4GR1 A;  1NPX A;  2YLW A;  2C76 A;  3G5Q A;  3AEE A;  3NK2 X;  4YTM A;  3SY4 A;  1TDE A;  1F8R A;  2NVK X;  4J34 A;  1Y0P A;  2ARD A;  4H50 A;  2DKH A;  1BF3 A;  4USR A;  4U8J A;  4K2X A;  3KPK A;  3NG7 X;  1BZL A;  1E1L A;  2YM1 A;  3UKL A;  5KWF A;  1NG3 A;  2ZBW A;  5HXI A;  1TDK A;  3GDN A;  4I59 A;  4FDC B;  1IUU A;  3ALL A;  2WDV A;  4XWR A;  2TMD A;  2YLR A;  1DOB A;  3K7M X;  4YSX A;  3SZW A;  4YTN A;  3IHM A;  2BC1 A;  2YVF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...