1F8SA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
482
structure length
482
Chain Sequence
b'NPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-AMINO ACID OXIDASE
molecule tags Oxidoreductase
publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
total genus 176
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8sA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8sA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8sA01
1D4DA 2JB1A 4WCTA 4TM0A 2WP6A 2BCGG 1GTEA 1DODA 5CQFA 2YG4A 3GD4A 2F5ZA 4D03A 5C2TA 1FOHA 1VDCA 3H8LA 1LJ1A 3QSSA 4A6NA 1VG0A 1E1KA 3ITJA 1IUSA 2RGOA 2VQ7A 1KF6A 3LZXA 3IHGA 4J56A 4AT2A 3BI4A 3CNSA 5FS8A 2ZZBA 2E4GA 1KSUA 5L46A 4H4UA 3ATRA 3QFAA 1YQZA 2AR8A 2C65A 3CGBA 2B9WA 3AEDA 1XDIA 1W4XA 2WOIA 3NH3X 4N9XA 2X3NA 4H4QA 3AD7B 1TDFA 2Q0KA 4NTEA 1D7YA 1JOAA 3VR9A 2RGHA 2XFOA 2B76A 1TDNA 4TM1A 2IVDA 1H86A 5IPYA 3CNJA 3KD9A 3L1RA 1CC6A 3VRBA 2R9ZA 4DSHA 3II4A 3UTHA 2JB3A 4CY6A 2OALA 1QO8A 1KFYA 3ALJA 1YY5A 3AYLA 5M10A 4C77A 3CNTA 1S3BA 3P1WA 4Z2UA 1LVLA 2EQ6A 3FIMB 3O0HA 4FK1A 4EIPA 3G5SA 2GB0A 2A89A 4EM3A 5KOWA 2ZBWA 1DOEA 1X31B 1Q1RA 3UKLA 3H4KA 3K7MX 5KVIA 3NK1X 1TDKA 3ZYXA 2APGA 1K0JA 3RP8A 3CGEA 1FECA 1H7XA 5J7XA 3UKFA 3UTFA 4B65A 4BJZA 2V3AA 4CCRA 4CNJA 1Y56A 3RP6A 1F8SA 4TM3A 2QAEA 2W0HA 3R9UA 4EQWA 5KWFA 3DGHA 1E6EA 3NYFA 2FJDA 1JNZA 3KPFA 3V76A 3GMCA 1REOA 4UP3A 3ADAB 2JAEA 2GR0A 5EOWA 2WHDA 3IC9A 1B4VA 2Y6RA 3AE7A 3HZLA 3NK0X 3PO7A 1EL5A 3K7TA 4K22A 4OCGA 1GALA 3AEFA 2YG5A 3DK8A 1DJNA 5FS7A 1ZOVA 3QFBA 4YKFA 1CJ3A 3C4NA 3T37A 2C73A 2B7RA 1AOGA 3FMWA 3AEBA 1TYPA 3C4AA 2C75A 3CGCA 2XYOA 2X8HA 4HB9A 4PAAA 5U63A 2JBVA 1FEAA 2H89A 1LPFA 2WPFA 1MOKA 1XANA 4U8NA 3REDA 1L9EA 2AQJA 1K0LA 4YTMA 1EL8A 2Q0LA 2Z5YA 1GREA 3F8DA 5CKUA 4A5LA 1F6MA 4RG4A 3LZWA 2JKCA 3DJJA 3K7QX 3DGZA 1CBOA 1PJ5A 1DJQA 5KVHA 1VRQB 3P4QA 1Q1WA 3EPTA 4LU6A 3OC4A 1JU2A 4OPIA 1S3EA 4EMJA 4AP3A 2NPXA 3KLJA 3QJ4A 4H50A 3UP5A 4J2WA 4Z24A 4YSZA 1YKJA 2YQUA 4JY2A 2YLRA 5HYMA 3P4RA 3VR8A 2R0PA 2Q7VA 1L9CA 2X99A 2Y6QA 2YR5A 3ICTA 4GF7A 4JY3A 1BZLA 1TRBA 2V6OA 1GRAA 3NIXA 3NKSA 4U2TA 1H81A 4BJYA 1D5TA 4IVOB 4ZCDA 5DBJA 5KOXA 4EM4A 4B66A 3ICSA 4KPRA 2Q6UA 1D4CA 3CNDA 3UCLA 1PXBA 2WP5A 2C7GA 2ARDA 3UKPA 4H2PA 1V59A 4OPDA 3AEEA 3IWAA 2VOUA 4YXDA 1DNCA 1DOCA 2CDUA 2R46A 4JNAA 4GUVA 3ATQA 1ELIA 4GRTA 5U25A 5EB4A 1IUWA 1BKWA 2GQFA 2VZ2A 1PBDA 1PXCA 4B68A 3GWFA 5KXJA 4OPTA 4Y4MA 3URHA 2FJBA 3AYIA 4CBQA 2JB2A 2BK5A 2C66A 1BGNA 3BHKA 1OJ9A 4A65A 3GDPA 1CHUA 2VRMA 1H6VA 1CJ4A 1LQTA 1XHCA 4FX9A 1UKVG 2WS3A 4USQA 4C5OA 1MXTA 1DOBA 1PJ6A 1MO9A 1EBDA 1RYIA 4FK1C 5EBKA 4AP1A 4GCMA 1CC2A 3AD8B 1RP0A 4U8PA 4CRTA 3FG2P 2BC1A 5LV9A 3H8IA 4XXGA 3UKHA 3COXA 4AT0A 1ZX9A 2EQ7A 2XFUA 3GRSA 3G5RA 2YG7A 2DKHA 4IV9A 3NG7X 4NEWA 3I6DA 3AE6A 3LJPA 4UDPA 3JSKA 5JCMA 4CY8A 2GAGB 3LADA 2UZZA 1IUTA 1ZOYA 5BUKA 1BGJA 2TMDA 3ISHA 4EMIA 4EQRA 2BACA 4BK1A 1FL2A 1IUVA 1PN0A 3AEAA 3DA1A 2WPCA 3DH9A 2Z5XA 3VRDB 4H4PA 4OPUA 2BCPA 4XWZA 3GDNA 3SQPA 4P9SA 4EQXA 2GMHA 4APNA 1XPQA 2XFQA 2V3BA 4ADWA 1Y56B 2VRLA 3CN8A 2FJEA 3UOYA 3Q6JA 2BS4A 1ONFA 3NYEA 2C3CA 1TDEA 2WPEA 2GRTA 3DJGX 2YVFA 4J34A 4H7UA 3QVRA 3CPJG 4YSXA 5IQ4A 5FS9A 5BVAA 3EF6A 2YR4A 4H4YA 3SGLA 4B63A 3OZ2A 3PVCA 1Z6LA 4NTDA 1O95A 5GSNA 2V61A 3L8KA 1CC4A 5JCNA 3NHOX 4Z26A 2OLNA 1OJDA 2YLTA 1KDGA 4HA6A 4U2SA 1KNPA 1M64A 1GT8A 2XDOA 2X50A 2WU5A 3NRNA 3AE3A 3FPZA 4TLZA 2CULA 3ZDNA 2R4EA 1GRBA 3UOVA 3UOXA 5J60A 4REKA 4C3YA 4I59A 4EQSA 3I3LA 2YVJA 5M0ZA 1YQ4A 3DK4A 3CPIG 1GESA 3E1TA 4DSGA 1LV0A 4TM4A 4K7ZA 3RP7A 2BXRA 3CTYA 1PBBA 4A6NB 1KSSA 2YM1A 1EL7A 1Q9IA 3EAOA 1N4WA 1IJHA 1E1NA 1JEHA 1GRTA 4U8JA 4ECHA 2GR1A 4H2QA 3IF9A 3NT6A 2V60A 3CNPA 2GAHB 1GERA 2YLXA 3AD9B 3AEGA 3NYCA 3NN6X 3RNMA 3UTEA 1S2QA 3ALLA 1O94A 4BK2A 2DKIA 4FDCB 1FCDA 1S2YA 2XFNA 3ABVA 1BF3A 3GYJA 4A9WA 2B9XA 2WBAA 1H83A 4H4TA 4USRA 4ZN0A 4A79A 2IIDA 2X8GA 4LA1A 4RG3A 4AOSA 5JCKA 1GRFA 2YAUA 3UKAA 2WDQA 4X4JA 5U1OA 2VVLA 5FMHA 4H4ZA 4B69A 2V5ZA 4YSYA 1COYA 2GVCA 1GEUA 2R0CA 2ZZCA 4U8IA 1L0VA 1NPXA 4H2NA 1F3PA 2C76A 2OLOA 4JDRA 2GV8A 2WDVA 3S5WA 2C67A 2WU2A 2BK4A 2NVKX 2WP9A 2XVFA 3GD3A 3S61A 2OAMA 4OPLA 2CFYA 1PBFA 3D8XA 3AE1A 4H4WA 4J31A 2YVGA 4NTCA 2BA9A 1E1LA 4OPCA 1OJTA 1P2HA 2XVIA 3M13A 1H82A 4UDRA 2OA1A 4J36A 2GF3A 2IVEA 2EQ8A 1PBCA 1TYTA 3GYIA 3IHMA 3NN0X 4IA6A 1VQWA 3BHFA 1QLBA 1ZMDA 1HYUA 1ZK7A 4E0VA 2GEWA 3LXDA 1NAAA 3D1CA 1GOSA 1H7WA 1PDHA 1B37A 2E5VA 2XCGA 1B8SA 1CJ2A 2ZZ0A 3G5QA 2GMJA 3F8PA 4J33A 1N1PA 3KA7A 3M0OA 4H4VA 2C70A 2E1MA 1PHHA 2GH5A 3KU9A 4Z43A 2YG6A 3AE5A 5JCIA 1FEBA 1JRXA 3AE2A 2BYBA 3AE8A 3ICRA 3SFEA 1VG9A 4Z2RA 1KNRA 2CVJA 1BWCA 4K5RA 5C3JA 3RHAA 3DMEA 3QVPA 3SM8A 2J3NA 2YLWA 1JRZA 4JNQA 1F8RA 1NENA 1PS9A 2WESA 2VVMA 4JN9A 2C64A 4GDPA 3QSMA 4NZHA 4U8MA 2VVLG 4BK3A 1E7PA 1IUUA 1N4VA 2GR2A 2XLPA 1NG4A 3GSIA 3P4SA 4RSLA 2JK6A 4GDEA 1SEZA 1CJCA 3M12A 2R0GA 3PS9A 4NEVA 2WDRA 2X8CA 1YQ3A 1TDOA 1GXFA 2WOWA 2ACZA 4PABA 2YLSA 2GQWA 4UDQA 3C96A 3UKQA 2WOVA 1CF3A 4B67A 1NG3A 3CIRA 5HY5A 1JRYA 3BNUA 1NDAA 3EANA 4BV6A 2BS2A 3ALMA 1O5WA 1GETA 4U8KA 3WE0A 1M6IA 1K4QA 4TLXA 4U8OA 2B7SA 4YWOA 4DNAA 1NHSA 2YWLA 3BI2A 3NLCA 3NTDA 2XLSA 1CL0A 3B3RA 1E1MA 2BK3A 2O9ZA 2QCUA 3GMBA 4GR1A 4H4RA 4MJWA 2BC0A 3AXBA 4YT0A 2XVJA 1NHQA 3VRAA 1GSNA 4H4SA 3UOZA 3LB8A 4IVMB 4C74A 4O5QA 2XLRA 1QJDA 3CGDA 1H84A 1F8WA 2XVHA 4CNKA 3NNEA 5JCLA 2FJAA 4K8DA 3DJEA 4A7AA 5BULA 4DGKA 1NHPA 2RGJA 3P9UA 4IA5A 1EL9A 3UTGA 4X9MA 4AOXA 2EQ9A 2TPRA 3BI5A 2QA2A 4YTNA 3BNMA 1NEKA 4A99A 1GV4A 3AECA 2C72A 2GR3A 1L9DA 1PBEA 2VQBA 3F8RA 3NGCX 4XWRA 3V3NA 2H88A 1ZKQA 1ZP0A 3VQRA 3KKJA 4YKGA 1OJAA 2RABA 1RSGA 2R4JA 1PJ7A 2AAQA 2XVEA 5TR3A 4K5SA 5ER0A 2YR6A 4WX1A 2A87A 1LTXR 3GWDA 3FBSA 4U2LA 1P2EA 1GRGA 2QA1A 2WQYA 2PHHA 3DJDA 1IUXA 3NTAA 4H2RA 5GRTA 1LQUA 3B6DA 3SFDA 3Q9TA 3UP4A 1D4EA 1DXLA 4D04A 2I0ZA 4ICYA 1PXAA 4CCQA 1D7LA 5HHFA 4Z44A 3AWIA 1OJCA 2FBWA 2R45A 3NK2X 4Y4NA 4M52A 4JQ9A 1GTHA 4Z2TA 1ZDLA 4C3XA 4U8LA 2PYXA 2XLUA 5HXIA 2BXSA 2BABA 4B64A 3AE9A 4Y4LA 1ZMCA 2HQMA 2BS3A 1GRHA 3CPHG 3DK9A 4H4XA 4OVIA 1JNRA 4ZCCA 4B1BA 3K30A 5BRTA 3KVEA 1Y0PA 4EIQA 4YSHA 1N4UA 4O5UA 2XFPA 1ZY8A 2C3DA 4OPGA 1E39A 4J57A 2A8XA 3QSEA 5FS6A 4Z25A 1NHRA 4YTPA 2YM2A 3V3OA 4X9NA 5EB5A 4EMWA 2B9YA 3AYJA 3AB1A 3LOVA 3P4PA 3AE4A 2YLZA 3UKKA 5KRQA 2WETA 4KX6A 5IQ1A 1K0IA 4BURA 2YG3A 4LIIA 4K2XA 2XLTA 3GRTA 1B5QA 4I58A 1GPEA 1GNDA 2WEUA
chains in the Genus database with same CATH superfamily
1D4DA 2JB1A 4WCTA 4TM0A 2WP6A 2BCGG 1GTEA 1DODA 5CQFA 2YG4A 3GD4A 2F5ZA 4D03A 5C2TA 1FOHA 1VDCA 3H8LA 1LJ1A 3QSSA 4A6NA 1VG0A 1E1KA 3ITJA 1IUSA 2RGOA 2VQ7A 1KF6A 3LZXA 3IHGA 4J56A 4AT2A 3BI4A 3CNSA 5FS8A 2ZZBA 2E4GA 1KSUA 4NNJA 5L46A 4H4UA 3ATRA 3QFAA 1YQZA 2AR8A 4G74A 3SXIA 2C65A 3CGBA 2B9WA 3AEDA 1XDIA 1W4XA 2WOIA 3NH3X 4N9XA 2X3NA 4H4QA 3AD7B 1TDFA 2Q0KA 4NTEA 1D7YA 1JOAA 3VR9A 2RGHA 2XFOA 2B76A 1TDNA 4TM1A 2IVDA 1H86A 5IPYA 3CNJA 3KD9A 3L1RA 1CC6A 3T2YA 3VRBA 2R9ZA 4DSHA 3II4A 3UTHA 2JB3A 4CY6A 2OALA 1QO8A 1KFYA 3ALJA 1YY5A 4GAVA 3SZ0A 3AYLA 5M10A 4C77A 3CNTA 1S3BA 3P1WA 4Z2UA 1LVLA 2EQ6A 3FIMB 3O0HA 4FK1A 4EIPA 3G5SA 2GB0A 2A89A 4EM3A 5KOWA 2ZBWA 1DOEA 1X31B 1Q1RA 3UKLA 3H4KA 3K7MX 5KVIA 3NK1X 1TDKA 3ZYXA 2APGA 1K0JA 3RP8A 3CGEA 1FECA 1H7XA 5J7XA 3UKFA 3UTFA 4B65A 4BJZA 2V3AA 4CCRA 4CNJA 1Y56A 3RP6A 1F8SA 4TM3A 2QAEA 2W0HA 3R9UA 4EQWA 5KWFA 3DGHA 3T0KA 1E6EA 3NYFA 2FJDA 1JNZA 3KPFA 3V76A 3GMCA 5KMPA 1REOA 4UP3A 3SX6A 3ADAB 2JAEA 2GR0A 5EOWA 2WHDA 3IC9A 1B4VA 2Y6RA 3AE7A 3HZLA 5KNLA 3NK0X 3PO7A 1EL5A 3K7TA 4K22A 4OCGA 1GALA 3AEFA 2YG5A 3DK8A 1DJNA 5FS7A 1ZOVA 3QFBA 4YKFA 1CJ3A 3C4NA 3T37A 2C73A 2B7RA 1AOGA 3FMWA 3AEBA 1TYPA 3C4AA 2C75A 3CGCA 2XYOA 2X8HA 4HB9A 4PAAA 5U63A 2JBVA 1FEAA 2H89A 1LPFA 2WPFA 1MOKA 1XANA 4U8NA 3REDA 1L9EA 2AQJA 1K0LA 4YTMA 1EL8A 2Q0LA 2Z5YA 1GREA 3F8DA 5CKUA 4A5LA 1F6MA 4RG4A 3LZWA 2JKCA 3DJJA 3K7QX 3DGZA 1CBOA 1PJ5A 1DJQA 4G9KA 5KVHA 1VRQB 3P4QA 1Q1WA 3EPTA 4LU6A 3OC4A 1JU2A 4OPIA 1S3EA 4EMJA 4AP3A 2NPXA 3KLJA 3QJ4A 4H50A 3UP5A 4J2WA 4Z24A 4YSZA 1YKJA 2YQUA 4JY2A 2YLRA 5HYMA 3P4RA 3VR8A 2R0PA 2Q7VA 1L9CA 2X99A 2Y6QA 2YR5A 3ICTA 4GF7A 4JY3A 1BZLA 1TRBA 2V6OA 1GRAA 3NIXA 3NKSA 4U2TA 1H81A 4BJYA 1D5TA 4IVOB 4ZCDA 5DBJA 5KOXA 4EM4A 4B66A 3ICSA 4KPRA 2Q6UA 1D4CA 2BRYA 3CNDA 3UCLA 1PXBA 2WP5A 2C7GA 2ARDA 3UKPA 4H2PA 1V59A 3KPKA 4OPDA 3AEEA 3IWAA 2VOUA 4YXDA 1DNCA 1DOCA 2CDUA 2R46A 4JNAA 4GUVA 3ATQA 1ELIA 4GRTA 5U25A 5EB4A 1IUWA 1BKWA 2GQFA 2VZ2A 1PBDA 1PXCA 4B68A 3GWFA 5KXJA 4OPTA 4Y4MA 3URHA 2FJBA 3AYIA 4CBQA 2JB2A 2BK5A 2C66A 1BGNA 3BHKA 1OJ9A 4A65A 3GDPA 1CHUA 2VRMA 1H6VA 1CJ4A 1LQTA 1XHCA 4FX9A 1UKVG 2WS3A 4USQA 4C5OA 1MXTA 1DOBA 1PJ6A 1MO9A 1EBDA 1RYIA 4FK1C 5EBKA 4AP1A 4GCMA 1CC2A 3AD8B 1RP0A 4U8PA 4CRTA 3FG2P 2BC1A 5LV9A 3H8IA 4XXGA 3UKHA 3COXA 4AT0A 1ZX9A 2EQ7A 2XFUA 3GRSA 3G5RA 2YG7A 2DKHA 4IV9A 3NG7X 4NEWA 3I6DA 3AE6A 3LJPA 4UDPA 3JSKA 5JCMA 4CY8A 2GAGB 3T31A 3LADA 2UZZA 1IUTA 1ZOYA 5BUKA 1BGJA 2TMDA 3ISHA 4EMIA 4EQRA 2BACA 4BK1A 1FL2A 1IUVA 1PN0A 3AEAA 3DA1A 2WPCA 3DH9A 2Z5XA 3VRDB 4H4PA 4OPUA 2BCPA 4XWZA 3GDNA 3SQPA 4P9SA 4EQXA 2GMHA 3SYIA 4APNA 1XPQA 2XFQA 2V3BA 4ADWA 1Y56B 2VRLA 3CN8A 2FJEA 4NWZA 3UOYA 5KMQA 3Q6JA 2BS4A 1ONFA 3NYEA 2C3CA 1TDEA 2WPEA 2GRTA 3DJGX 2YVFA 4J34A 4H7UA 3QVRA 3CPJG 4YSXA 5IQ4A 5FS9A 5BVAA 3EF6A 2YR4A 4H4YA 3SGLA 4B63A 3OZ2A 3PVCA 1Z6LA 4NTDA 1O95A 5GSNA 2V61A 3L8KA 1CC4A 5JCNA 3NHOX 4Z26A 2OLNA 1OJDA 2YLTA 1KDGA 4HA6A 4U2SA 1KNPA 1M64A 1GT8A 2XDOA 2X50A 2WU5A 3NRNA 3AE3A 3FPZA 4TLZA 2CULA 3ZDNA 2R4EA 1GRBA 3UOVA 3UOXA 5J60A 4REKA 4C3YA 4I59A 4EQSA 3I3LA 2YVJA 5M0ZA 1YQ4A 4II3A 3DK4A 3CPIG 1GESA 3E1TA 4DSGA 1LV0A 4TM4A 4K7ZA 3RP7A 2BXRA 3CTYA 1PBBA 4A6NB 1KSSA 2YM1A 1EL7A 1Q9IA 3EAOA 1N4WA 1IJHA 1E1NA 1JEHA 1GRTA 4U8JA 4ECHA 2GR1A 4H2QA 3IF9A 3NT6A 2V60A 3CNPA 2GAHB 1GERA 2YLXA 3AD9B 3AEGA 3NYCA 3NN6X 3RNMA 3UTEA 1S2QA 3ALLA 1O94A 4BK2A 2DKIA 4FDCB 1FCDA 1S2YA 2XFNA 3ABVA 1BF3A 3GYJA 4G6HA 4A9WA 2B9XA 2WBAA 1H83A 4H4TA 4USRA 4ZN0A 4A79A 2IIDA 2X8GA 4LA1A 4RG3A 4AOSA 5JCKA 1GRFA 2YAUA 3UKAA 2WDQA 4X4JA 5U1OA 2VVLA 5FMHA 4H4ZA 4B69A 2V5ZA 4YSYA 1COYA 2GVCA 1GEUA 2R0CA 2ZZCA 4U8IA 1L0VA 1NPXA 4H2NA 1F3PA 2C76A 2OLOA 4JDRA 2GV8A 2WDVA 3SZFA 3S5WA 2C67A 2WU2A 2BK4A 2NVKX 2WP9A 2XVFA 3GD3A 3S61A 2OAMA 4OPLA 2CFYA 1PBFA 3D8XA 3AE1A 4H4WA 4J31A 2YVGA 2BRAA 4NTCA 2BA9A 1E1LA 4OPCA 1OJTA 1P2HA 2XVIA 3M13A 1H82A 4UDRA 2OA1A 4J36A 2GF3A 2IVEA 2EQ8A 1PBCA 1TYTA 3GYIA 3IHMA 3NN0X 4IA6A 3SZCA 1VQWA 3BHFA 1QLBA 1ZMDA 1HYUA 1ZK7A 4E0VA 2GEWA 3LXDA 1NAAA 3D1CA 4G73A 1GOSA 1H7WA 1PDHA 1B37A 2E5VA 2XCGA 1B8SA 1CJ2A 2ZZ0A 4II2A 3G5QA 2GMJA 3F8PA 4J33A 1N1PA 3KA7A 3M0OA 4H4VA 2C70A 2E1MA 1PHHA 2GH5A 3KU9A 4Z43A 2YG6A 3AE5A 5JCIA 1FEBA 1JRXA 3AE2A 2BYBA 3AE8A 3ICRA 3SFEA 1VG9A 4Z2RA 1KNRA 2CVJA 1BWCA 4K5RA 5C3JA 3RHAA 5KMRA 3DMEA 3QVPA 3SM8A 2J3NA 2YLWA 1JRZA 4JNQA 1F8RA 1NENA 1PS9A 2WESA 2VVMA 4JN9A 2C64A 4GDPA 3QSMA 4NZHA 4U8MA 2VVLG 4BK3A 1E7PA 1IUUA 1N4VA 2GR2A 2XLPA 1NG4A 3GSIA 3P4SA 4RSLA 2JK6A 4GDEA 1SEZA 3HYXA 1CJCA 3M12A 2R0GA 3PS9A 4NEVA 2WDRA 2X8CA 1YQ3A 1TDOA 1GXFA 2WOWA 2ACZA 4PABA 2YLSA 2GQWA 4UDQA 3C96A 3UKQA 2WOVA 1CF3A 4B67A 1NG3A 4GAPA 3CIRA 5HY5A 1JRYA 3BNUA 3T2KA 1NDAA 3EANA 4BV6A 2BS2A 3ALMA 3WE0A 1GETA 1O5WA 4U8KA 1M6IA 1K4QA 4TLXA 4U8OA 2B7SA 4YWOA 4DNAA 1NHSA 2YWLA 3BI2A 3NLCA 3NTDA 2XLSA 1CL0A 3B3RA 1E1MA 2BK3A 2O9ZA 2QCUA 3GMBA 4GR1A 4H4RA 4MJWA 2BC0A 3AXBA 4YT0A 2XVJA 1NHQA 3VRAA 1GSNA 4H4SA 3UOZA 3LB8A 4IVMB 4C74A 4O5QA 2XLRA 1QJDA 3CGDA 1H84A 1F8WA 2XVHA 4CNKA 3NNEA 5JCLA 3HYWA 3CMMA 2FJAA 4K8DA 3DJEA 4A7AA 5BULA 4DGKA 3HYVA 1NHPA 2RGJA 3P9UA 4IA5A 1EL9A 3UTGA 3SY4A 4X9MA 4AOXA 2EQ9A 2TPRA 3BI5A 2QA2A 4YTNA 3BNMA 1NEKA 4A99A 2C4CA 1GV4A 3AECA 2C72A 2GR3A 1L9DA 1PBEA 2VQBA 3F8RA 3NGCX 4XWRA 3V3NA 2H88A 1ZKQA 1ZP0A 3VQRA 3KKJA 4YKGA 1OJAA 2RABA 1RSGA 2R4JA 1PJ7A 3GYXA 2AAQA 2XVEA 5TR3A 4K5SA 5ER0A 2YR6A 4WX1A 2A87A 1LTXR 3GWDA 3FBSA 4U2LA 1P2EA 1GRGA 2QA1A 2WQYA 2PHHA 3DJDA 1IUXA 3NTAA 4H2RA 5GRTA 1LQUA 3B6DA 3SFDA 3T14A 3Q9TA 3UP4A 1D4EA 1DXLA 4D04A 2I0ZA 4ICYA 1PXAA 4CCQA 1D7LA 5HHFA 4Z44A 3AWIA 1OJCA 2FBWA 2R45A 3NK2X 4Y4NA 4M52A 4JQ9A 1GTHA 4Z2TA 1ZDLA 4C3XA 4U8LA 2PYXA 2XLUA 3SZWA 2BABA 2BXSA 4B64A 5HXIA 3AE9A 4Y4LA 1ZMCA 2HQMA 2BS3A 1GRHA 3CPHG 3DK9A 4H4XA 4OVIA 1JNRA 4ZCCA 4B1BA 3K30A 5BRTA 3KVEA 1Y0PA 4EIQA 4YSHA 1N4UA 4O5UA 2XFPA 1ZY8A 2C3DA 4OPGA 1E39A 4J57A 2A8XA 3QSEA 5FS6A 4Z25A 1NHRA 4YTPA 2YM2A 3V3OA 4X9NA 5EB5A 4EMWA 2B9YA 3AYJA 3AB1A 3LOVA 3P4PA 3AE4A 2YLZA 3UKKA 5KRQA 2WETA 4KX6A 5IQ1A 1K0IA 4BURA 2YG3A 4LIIA 4K2XA 2XLTA 5KMSA 3GRTA 1B5QA 4I58A 4G6GA 1GPEA 3T2ZA 1GNDA 2WEUA
chains in the Genus database with same CATH topology
1D4DA 2JB1A 4WCTA 4TM0A 2WP6A 2BCGG 1GTEA 1DODA 5CQFA 2YG4A 3GD4A 2F5ZA 4D03A 5C2TA 1FOHA 1VDCA 3H8LA 1LJ1A 3QSSA 4A6NA 1VG0A 1E1KA 3ITJA 1IUSA 2RGOA 2VQ7A 1KF6A 3LZXA 3IHGA 4J56A 4AT2A 3BI4A 3CNSA 5FS8A 2ZZBA 2E4GA 1KSUA 4NNJA 5L46A 4H4UA 3ATRA 3QFAA 1YQZA 2AR8A 4G74A 3SXIA 2C65A 3CGBA 2B9WA 3AEDA 1XDIA 1W4XA 2WOIA 3NH3X 4N9XA 2X3NA 4H4QA 3AD7B 1TDFA 2Q0KA 4NTEA 1D7YA 1JOAA 3VR9A 2RGHA 2XFOA 2B76A 1TDNA 4TM1A 2IVDA 1H86A 5IPYA 3CNJA 3KD9A 3L1RA 1CC6A 3T2YA 3VRBA 2R9ZA 4DSHA 3II4A 3UTHA 2JB3A 4CY6A 2OALA 1QO8A 1KFYA 3ALJA 1YY5A 4GAVA 3SZ0A 3AYLA 5M10A 4C77A 3CNTA 1S3BA 3P1WA 4Z2UA 1LVLA 2EQ6A 3FIMB 3O0HA 4FK1A 4EIPA 3G5SA 2GB0A 2A89A 4EM3A 5KOWA 2ZBWA 1DOEA 1X31B 1Q1RA 3UKLA 3H4KA 3K7MX 5KVIA 3NK1X 1TDKA 3ZYXA 2APGA 1K0JA 3RP8A 3CGEA 1FECA 1H7XA 5J7XA 3UKFA 3UTFA 4B65A 4BJZA 2V3AA 4CCRA 4CNJA 1Y56A 3RP6A 1F8SA 4TM3A 2QAEA 2W0HA 3R9UA 4EQWA 5KWFA 3DGHA 3T0KA 1E6EA 3NYFA 2FJDA 1JNZA 3KPFA 3V76A 3GMCA 5KMPA 1REOA 4UP3A 3SX6A 3ADAB 2JAEA 2GR0A 5EOWA 2WHDA 3IC9A 1B4VA 2Y6RA 3AE7A 3HZLA 5KNLA 3NK0X 3PO7A 1EL5A 3K7TA 4K22A 4OCGA 1GALA 3AEFA 2YG5A 3DK8A 1DJNA 5FS7A 1ZOVA 3QFBA 4YKFA 1CJ3A 3C4NA 3T37A 2C73A 2B7RA 1AOGA 3FMWA 3AEBA 1TYPA 3C4AA 2C75A 3CGCA 2XYOA 2X8HA 4HB9A 4PAAA 5U63A 2JBVA 1FEAA 2H89A 1LPFA 2WPFA 1MOKA 1XANA 4U8NA 3REDA 1L9EA 2AQJA 1K0LA 4YTMA 1EL8A 2Q0LA 2Z5YA 1GREA 3F8DA 5CKUA 4A5LA 1F6MA 4RG4A 3LZWA 2JKCA 3DJJA 3K7QX 3DGZA 1CBOA 1PJ5A 1DJQA 4G9KA 5KVHA 1VRQB 3P4QA 1Q1WA 3EPTA 4LU6A 3OC4A 1JU2A 4OPIA 1S3EA 4EMJA 4AP3A 2NPXA 3KLJA 3QJ4A 4H50A 3UP5A 4J2WA 4Z24A 4YSZA 1YKJA 2YQUA 4JY2A 2YLRA 5HYMA 3P4RA 3VR8A 2R0PA 2Q7VA 1L9CA 2X99A 2Y6QA 2YR5A 3ICTA 4GF7A 4JY3A 1BZLA 1TRBA 2V6OA 1GRAA 3NIXA 3NKSA 4U2TA 1H81A 4BJYA 1D5TA 4IVOB 4ZCDA 5DBJA 5KOXA 4EM4A 4B66A 3ICSA 4KPRA 2Q6UA 1D4CA 2BRYA 3CNDA 3UCLA 1PXBA 2WP5A 2C7GA 2ARDA 3UKPA 4H2PA 1V59A 3KPKA 4OPDA 3AEEA 3IWAA 2VOUA 4YXDA 1DNCA 1DOCA 2CDUA 2R46A 4JNAA 4GUVA 3ATQA 1ELIA 4GRTA 5U25A 5EB4A 1IUWA 1BKWA 2GQFA 2VZ2A 1PBDA 1PXCA 4B68A 3GWFA 5KXJA 4OPTA 4Y4MA 3URHA 2FJBA 3AYIA 4CBQA 2JB2A 2BK5A 2C66A 1BGNA 3BHKA 1OJ9A 4A65A 3GDPA 1CHUA 2VRMA 1H6VA 1CJ4A 1LQTA 1XHCA 4FX9A 1UKVG 2WS3A 4USQA 4C5OA 1MXTA 1DOBA 1PJ6A 1MO9A 1EBDA 1RYIA 4FK1C 5EBKA 4AP1A 4GCMA 1CC2A 3AD8B 1RP0A 4U8PA 4CRTA 3FG2P 2BC1A 5LV9A 3H8IA 4XXGA 3UKHA 3COXA 4AT0A 1ZX9A 2EQ7A 2XFUA 3GRSA 3G5RA 2YG7A 2DKHA 4IV9A 3NG7X 4NEWA 3I6DA 3AE6A 3LJPA 4UDPA 3JSKA 5JCMA 4CY8A 2GAGB 3T31A 3LADA 2UZZA 1IUTA 1ZOYA 5BUKA 1BGJA 2TMDA 3ISHA 4EMIA 4EQRA 2BACA 4BK1A 1FL2A 1IUVA 1PN0A 3AEAA 3DA1A 2WPCA 3DH9A 2Z5XA 3VRDB 4H4PA 4OPUA 2BCPA 4XWZA 3GDNA 3SQPA 4P9SA 4EQXA 2GMHA 3SYIA 4APNA 1XPQA 2XFQA 2V3BA 4ADWA 1Y56B 2VRLA 3CN8A 2FJEA 4NWZA 3UOYA 5KMQA 3Q6JA 2BS4A 1ONFA 3NYEA 2C3CA 1TDEA 2WPEA 2GRTA 3DJGX 2YVFA 4J34A 4H7UA 3QVRA 3CPJG 4YSXA 5IQ4A 5FS9A 5BVAA 3EF6A 2YR4A 4H4YA 3SGLA 4B63A 3OZ2A 3PVCA 1Z6LA 4NTDA 1O95A 5GSNA 2V61A 3L8KA 1CC4A 5JCNA 3NHOX 4Z26A 2OLNA 1OJDA 2YLTA 1KDGA 4HA6A 4U2SA 1KNPA 1M64A 1GT8A 2XDOA 2X50A 2WU5A 3NRNA 3AE3A 3FPZA 4TLZA 2CULA 3ZDNA 2R4EA 1GRBA 3UOVA 3UOXA 5J60A 4REKA 4C3YA 4I59A 4EQSA 3I3LA 2YVJA 5M0ZA 1YQ4A 4II3A 3DK4A 3CPIG 1GESA 3E1TA 4DSGA 1LV0A 4TM4A 4K7ZA 3RP7A 2BXRA 3CTYA 1PBBA 4A6NB 1KSSA 2YM1A 1EL7A 1Q9IA 3EAOA 1N4WA 1IJHA 1E1NA 1JEHA 1GRTA 4U8JA 4ECHA 2GR1A 4H2QA 3IF9A 3NT6A 2V60A 3CNPA 2GAHB 1GERA 2YLXA 3AD9B 3AEGA 3NYCA 3NN6X 3RNMA 3UTEA 1S2QA 3ALLA 1O94A 4BK2A 2DKIA 4FDCB 1FCDA 1S2YA 2XFNA 3ABVA 1BF3A 3GYJA 4G6HA 4A9WA 2B9XA 2WBAA 1H83A 4H4TA 4USRA 4ZN0A 4A79A 2IIDA 2X8GA 4LA1A 4RG3A 4AOSA 5JCKA 1GRFA 2YAUA 3UKAA 2WDQA 4X4JA 5U1OA 2VVLA 5FMHA 4H4ZA 4B69A 2V5ZA 4YSYA 1COYA 2GVCA 1GEUA 2R0CA 2ZZCA 4U8IA 1L0VA 1NPXA 4H2NA 1F3PA 2C76A 2OLOA 4JDRA 2GV8A 2WDVA 3SZFA 3S5WA 2C67A 2WU2A 2BK4A 2NVKX 2WP9A 2XVFA 3GD3A 3S61A 2OAMA 4OPLA 2CFYA 1PBFA 3D8XA 3AE1A 4H4WA 4J31A 2YVGA 2BRAA 4NTCA 2BA9A 1E1LA 4OPCA 1OJTA 1P2HA 2XVIA 3M13A 1H82A 4UDRA 2OA1A 4J36A 2GF3A 2IVEA 2EQ8A 1PBCA 1TYTA 3GYIA 3IHMA 3NN0X 4IA6A 3SZCA 1VQWA 3BHFA 1QLBA 1ZMDA 1HYUA 1ZK7A 4E0VA 2GEWA 3LXDA 1NAAA 3D1CA 4G73A 1GOSA 1H7WA 1PDHA 1B37A 2E5VA 2XCGA 1B8SA 1CJ2A 2ZZ0A 4II2A 3G5QA 2GMJA 3F8PA 4J33A 1N1PA 3KA7A 3M0OA 4H4VA 2C70A 2E1MA 1PHHA 2GH5A 3KU9A 4Z43A 2YG6A 3AE5A 5JCIA 1FEBA 1JRXA 3AE2A 2BYBA 3AE8A 3ICRA 3SFEA 1VG9A 4Z2RA 1KNRA 2CVJA 1BWCA 4K5RA 5C3JA 3RHAA 5KMRA 3DMEA 3QVPA 3SM8A 2J3NA 2YLWA 1JRZA 4JNQA 1F8RA 1NENA 1PS9A 2WESA 2VVMA 4JN9A 2C64A 4GDPA 3QSMA 4NZHA 4U8MA 2VVLG 4BK3A 1E7PA 1IUUA 1N4VA 2GR2A 2XLPA 1NG4A 3GSIA 3P4SA 4RSLA 2JK6A 4GDEA 1SEZA 3HYXA 1CJCA 3M12A 2R0GA 3PS9A 4NEVA 2WDRA 2X8CA 1YQ3A 1TDOA 1GXFA 2WOWA 2ACZA 4PABA 2YLSA 2GQWA 4UDQA 3C96A 3UKQA 2WOVA 1CF3A 4B67A 1NG3A 4GAPA 3CIRA 5HY5A 1JRYA 3BNUA 3T2KA 1NDAA 3EANA 4BV6A 2BS2A 3ALMA 1O5WA 1GETA 4U8KA 3WE0A 1M6IA 1K4QA 4TLXA 4U8OA 2B7SA 4YWOA 4DNAA 1NHSA 2YWLA 3BI2A 3NLCA 3NTDA 2XLSA 1CL0A 3B3RA 1E1MA 2BK3A 2O9ZA 2QCUA 3GMBA 4GR1A 4H4RA 4MJWA 2BC0A 3AXBA 4YT0A 2XVJA 1NHQA 3VRAA 1GSNA 4H4SA 3UOZA 3LB8A 4IVMB 4C74A 4O5QA 2XLRA 1QJDA 3CGDA 1H84A 1F8WA 2XVHA 4CNKA 3NNEA 5JCLA 3HYWA 3CMMA 2FJAA 4K8DA 3DJEA 4A7AA 5BULA 4DGKA 3HYVA 1NHPA 2RGJA 3P9UA 4IA5A 1EL9A 3UTGA 3SY4A 4X9MA 4AOXA 2EQ9A 2TPRA 3BI5A 2QA2A 4YTNA 3BNMA 1NEKA 4A99A 2C4CA 1GV4A 3AECA 2C72A 2GR3A 1L9DA 1PBEA 2VQBA 3F8RA 3NGCX 4XWRA 3V3NA 2H88A 1ZKQA 1ZP0A 3VQRA 3KKJA 4YKGA 1OJAA 2RABA 1RSGA 2R4JA 1PJ7A 3GYXA 2AAQA 2XVEA 5TR3A 4K5SA 5ER0A 2YR6A 4WX1A 2A87A 1LTXR 3GWDA 3FBSA 4U2LA 1P2EA 1GRGA 2QA1A 2WQYA 2PHHA 3DJDA 1IUXA 3NTAA 4H2RA 5GRTA 1LQUA 3B6DA 3SFDA 3T14A 3Q9TA 3UP4A 1D4EA 1DXLA 4D04A 2I0ZA 4ICYA 1PXAA 4CCQA 1D7LA 5HHFA 4Z44A 3AWIA 1OJCA 2FBWA 2R45A 3NK2X 4Y4NA 4M52A 4JQ9A 1GTHA 4Z2TA 1ZDLA 4C3XA 4U8LA 2PYXA 2XLUA 3SZWA 2BXSA 2BABA 4B64A 5HXIA 3AE9A 4Y4LA 1ZMCA 2HQMA 2BS3A 1GRHA 3CPHG 3DK9A 4H4XA 4OVIA 1JNRA 4ZCCA 4B1BA 3K30A 5BRTA 3KVEA 1Y0PA 4EIQA 4YSHA 1N4UA 4O5UA 2XFPA 1ZY8A 2C3DA 4OPGA 1E39A 4J57A 2A8XA 3QSEA 5FS6A 4Z25A 1NHRA 4YTPA 2YM2A 3V3OA 4X9NA 5EB5A 4EMWA 2B9YA 3AYJA 3AB1A 3LOVA 3P4PA 3AE4A 2YLZA 3UKKA 5KRQA 2WETA 4KX6A 5IQ1A 1K0IA 4BURA 2YG3A 4LIIA 4K2XA 2XLTA 5KMSA 3GRTA 1B5QA 4I58A 4G6GA 1GPEA 3T2ZA 1GNDA 2WEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D4D A;  2JB1 A;  4WCT A;  4TM0 A;  2WP6 A;  2BCG G;  1GTE A;  1DOD A;  5CQF A;  2YG4 A;  3GD4 A;  2F5Z A;  4D03 A;  5C2T A;  1FOH A;  1VDC A;  3H8L A;  1LJ1 A;  3QSS A;  4A6N A;  1VG0 A;  1E1K A;  3ITJ A;  1IUS A;  2RGO A;  2VQ7 A;  1KF6 A;  3LZX A;  3IHG A;  4J56 A;  4AT2 A;  3BI4 A;  3CNS A;  5FS8 A;  2ZZB A;  2E4G A;  1KSU A;  5L46 A;  4H4U A;  3ATR A;  3QFA A;  1YQZ A;  2AR8 A;  2C65 A;  3CGB A;  2B9W A;  3AED A;  1XDI A;  1W4X A;  2WOI A;  3NH3 X;  4N9X A;  2X3N A;  4H4Q A;  3AD7 B;  1TDF A;  2Q0K A;  4NTE A;  1D7Y A;  1JOA A;  3VR9 A;  2RGH A;  2XFO A;  2B76 A;  1TDN A;  4TM1 A;  2IVD A;  1H86 A;  5IPY A;  3CNJ A;  3KD9 A;  3L1R A;  1CC6 A;  3VRB A;  2R9Z A;  4DSH A;  3II4 A;  3UTH A;  2JB3 A;  4CY6 A;  2OAL A;  1QO8 A;  1KFY A;  3ALJ A;  1YY5 A;  3AYL A;  5M10 A;  4C77 A;  3CNT A;  1S3B A;  3P1W A;  4Z2U A;  1LVL A;  2EQ6 A;  3FIM B;  3O0H A;  4FK1 A;  4EIP A;  3G5S A;  2GB0 A;  2A89 A;  4EM3 A;  5KOW A;  2ZBW A;  1DOE A;  1X31 B;  1Q1R A;  3UKL A;  3H4K A;  3K7M X;  5KVI A;  3NK1 X;  1TDK A;  3ZYX A;  2APG A;  1K0J A;  3RP8 A;  3CGE A;  1FEC A;  1H7X A;  5J7X A;  3UKF A;  3UTF A;  4B65 A;  4BJZ A;  2V3A A;  4CCR A;  4CNJ A;  1Y56 A;  3RP6 A;  1F8S A;  4TM3 A;  2QAE A;  2W0H A;  3R9U A;  4EQW A;  5KWF A;  3DGH A;  1E6E A;  3NYF A;  2FJD A;  1JNZ A;  3KPF A;  3V76 A;  3GMC A;  1REO A;  4UP3 A;  3ADA B;  2JAE A;  2GR0 A;  5EOW A;  2WHD A;  3IC9 A;  1B4V A;  2Y6R A;  3AE7 A;  3HZL A;  3NK0 X;  3PO7 A;  1EL5 A;  3K7T A;  4K22 A;  4OCG A;  1GAL A;  3AEF A;  2YG5 A;  3DK8 A;  1DJN A;  5FS7 A;  1ZOV A;  3QFB A;  4YKF A;  1CJ3 A;  3C4N A;  3T37 A;  2C73 A;  2B7R A;  1AOG A;  3FMW A;  3AEB A;  1TYP A;  3C4A A;  2C75 A;  3CGC A;  2XYO A;  2X8H A;  4HB9 A;  4PAA A;  5U63 A;  2JBV A;  1FEA A;  2H89 A;  1LPF A;  2WPF A;  1MOK A;  1XAN A;  4U8N A;  3RED A;  1L9E A;  2AQJ A;  1K0L A;  4YTM A;  1EL8 A;  2Q0L A;  2Z5Y A;  1GRE A;  3F8D A;  5CKU A;  4A5L A;  1F6M A;  4RG4 A;  3LZW A;  2JKC A;  3DJJ A;  3K7Q X;  3DGZ A;  1CBO A;  1PJ5 A;  1DJQ A;  5KVH A;  1VRQ B;  3P4Q A;  1Q1W A;  3EPT A;  4LU6 A;  3OC4 A;  1JU2 A;  4OPI A;  1S3E A;  4EMJ A;  4AP3 A;  2NPX A;  3KLJ A;  3QJ4 A;  4H50 A;  3UP5 A;  4J2W A;  4Z24 A;  4YSZ A;  1YKJ A;  2YQU A;  4JY2 A;  2YLR A;  5HYM A;  3P4R A;  3VR8 A;  2R0P A;  2Q7V A;  1L9C A;  2X99 A;  2Y6Q A;  2YR5 A;  3ICT A;  4GF7 A;  4JY3 A;  1BZL A;  1TRB A;  2V6O A;  1GRA A;  3NIX A;  3NKS A;  4U2T A;  1H81 A;  4BJY A;  1D5T A;  4IVO B;  4ZCD A;  5DBJ A;  5KOX A;  4EM4 A;  4B66 A;  3ICS A;  4KPR A;  2Q6U A;  1D4C A;  3CND A;  3UCL A;  1PXB A;  2WP5 A;  2C7G A;  2ARD A;  3UKP A;  4H2P A;  1V59 A;  4OPD A;  3AEE A;  3IWA A;  2VOU A;  4YXD A;  1DNC A;  1DOC A;  2CDU A;  2R46 A;  4JNA A;  4GUV A;  3ATQ A;  1ELI A;  4GRT A;  5U25 A;  5EB4 A;  1IUW A;  1BKW A;  2GQF A;  2VZ2 A;  1PBD A;  1PXC A;  4B68 A;  3GWF A;  5KXJ A;  4OPT A;  4Y4M A;  3URH A;  2FJB A;  3AYI A;  4CBQ A;  2JB2 A;  2BK5 A;  2C66 A;  1BGN A;  3BHK A;  1OJ9 A;  4A65 A;  3GDP A;  1CHU A;  2VRM A;  1H6V A;  1CJ4 A;  1LQT A;  1XHC A;  4FX9 A;  1UKV G;  2WS3 A;  4USQ A;  4C5O A;  1MXT A;  1DOB A;  1PJ6 A;  1MO9 A;  1EBD A;  1RYI A;  4FK1 C;  5EBK A;  4AP1 A;  4GCM A;  1CC2 A;  3AD8 B;  1RP0 A;  4U8P A;  4CRT A;  3FG2 P;  2BC1 A;  5LV9 A;  3H8I A;  4XXG A;  3UKH A;  3COX A;  4AT0 A;  1ZX9 A;  2EQ7 A;  2XFU A;  3GRS A;  3G5R A;  2YG7 A;  2DKH A;  4IV9 A;  3NG7 X;  4NEW A;  3I6D A;  3AE6 A;  3LJP A;  4UDP A;  3JSK A;  5JCM A;  4CY8 A;  2GAG B;  3LAD A;  2UZZ A;  1IUT A;  1ZOY A;  5BUK A;  1BGJ A;  2TMD A;  3ISH A;  4EMI A;  4EQR A;  2BAC A;  4BK1 A;  1FL2 A;  1IUV A;  1PN0 A;  3AEA A;  3DA1 A;  2WPC A;  3DH9 A;  2Z5X A;  3VRD B;  4H4P A;  4OPU A;  2BCP A;  4XWZ A;  3GDN A;  3SQP A;  4P9S A;  4EQX A;  2GMH A;  4APN A;  1XPQ A;  2XFQ A;  2V3B A;  4ADW A;  1Y56 B;  2VRL A;  3CN8 A;  2FJE A;  3UOY A;  3Q6J A;  2BS4 A;  1ONF A;  3NYE A;  2C3C A;  1TDE A;  2WPE A;  2GRT A;  3DJG X;  2YVF A;  4J34 A;  4H7U A;  3QVR A;  3CPJ G;  4YSX A;  5IQ4 A;  5FS9 A;  5BVA A;  3EF6 A;  2YR4 A;  4H4Y A;  3SGL A;  4B63 A;  3OZ2 A;  3PVC A;  1Z6L A;  4NTD A;  1O95 A;  5GSN A;  2V61 A;  3L8K A;  1CC4 A;  5JCN A;  3NHO X;  4Z26 A;  2OLN A;  1OJD A;  2YLT A;  1KDG A;  4HA6 A;  4U2S A;  1KNP A;  1M64 A;  1GT8 A;  2XDO A;  2X50 A;  2WU5 A;  3NRN A;  3AE3 A;  3FPZ A;  4TLZ A;  2CUL A;  3ZDN A;  2R4E A;  1GRB A;  3UOV A;  3UOX A;  5J60 A;  4REK A;  4C3Y A;  4I59 A;  4EQS A;  3I3L A;  2YVJ A;  5M0Z A;  1YQ4 A;  3DK4 A;  3CPI G;  1GES A;  3E1T A;  4DSG A;  1LV0 A;  4TM4 A;  4K7Z A;  3RP7 A;  2BXR A;  3CTY A;  1PBB A;  4A6N B;  1KSS A;  2YM1 A;  1EL7 A;  1Q9I A;  3EAO A;  1N4W A;  1IJH A;  1E1N A;  1JEH A;  1GRT A;  4U8J A;  4ECH A;  2GR1 A;  4H2Q A;  3IF9 A;  3NT6 A;  2V60 A;  3CNP A;  2GAH B;  1GER A;  2YLX A;  3AD9 B;  3AEG A;  3NYC A;  3NN6 X;  3RNM A;  3UTE A;  1S2Q A;  3ALL A;  1O94 A;  4BK2 A;  2DKI A;  4FDC B;  1FCD A;  1S2Y A;  2XFN A;  3ABV A;  1BF3 A;  3GYJ A;  4A9W A;  2B9X A;  2WBA A;  1H83 A;  4H4T A;  4USR A;  4ZN0 A;  4A79 A;  2IID A;  2X8G A;  4LA1 A;  4RG3 A;  4AOS A;  5JCK A;  1GRF A;  2YAU A;  3UKA A;  2WDQ A;  4X4J A;  5U1O A;  2VVL A;  5FMH A;  4H4Z A;  4B69 A;  2V5Z A;  4YSY A;  1COY A;  2GVC A;  1GEU A;  2R0C A;  2ZZC A;  4U8I A;  1L0V A;  1NPX A;  4H2N A;  1F3P A;  2C76 A;  2OLO A;  4JDR A;  2GV8 A;  2WDV A;  3S5W A;  2C67 A;  2WU2 A;  2BK4 A;  2NVK X;  2WP9 A;  2XVF A;  3GD3 A;  3S61 A;  2OAM A;  4OPL A;  2CFY A;  1PBF A;  3D8X A;  3AE1 A;  4H4W A;  4J31 A;  2YVG A;  4NTC A;  2BA9 A;  1E1L A;  4OPC A;  1OJT A;  1P2H A;  2XVI A;  3M13 A;  1H82 A;  4UDR A;  2OA1 A;  4J36 A;  2GF3 A;  2IVE A;  2EQ8 A;  1PBC A;  1TYT A;  3GYI A;  3IHM A;  3NN0 X;  4IA6 A;  1VQW A;  3BHF A;  1QLB A;  1ZMD A;  1HYU A;  1ZK7 A;  4E0V A;  2GEW A;  3LXD A;  1NAA A;  3D1C A;  1GOS A;  1H7W A;  1PDH A;  1B37 A;  2E5V A;  2XCG A;  1B8S A;  1CJ2 A;  2ZZ0 A;  3G5Q A;  2GMJ A;  3F8P A;  4J33 A;  1N1P A;  3KA7 A;  3M0O A;  4H4V A;  2C70 A;  2E1M A;  1PHH A;  2GH5 A;  3KU9 A;  4Z43 A;  2YG6 A;  3AE5 A;  5JCI A;  1FEB A;  1JRX A;  3AE2 A;  2BYB A;  3AE8 A;  3ICR A;  3SFE A;  1VG9 A;  4Z2R A;  1KNR A;  2CVJ A;  1BWC A;  4K5R A;  5C3J A;  3RHA A;  3DME A;  3QVP A;  3SM8 A;  2J3N A;  2YLW A;  1JRZ A;  4JNQ A;  1F8R A;  1NEN A;  1PS9 A;  2WES A;  2VVM A;  4JN9 A;  2C64 A;  4GDP A;  3QSM A;  4NZH A;  4U8M A;  2VVL G;  4BK3 A;  1E7P A;  1IUU A;  1N4V A;  2GR2 A;  2XLP A;  1NG4 A;  3GSI A;  3P4S A;  4RSL A;  2JK6 A;  4GDE A;  1SEZ A;  1CJC A;  3M12 A;  2R0G A;  3PS9 A;  4NEV A;  2WDR A;  2X8C A;  1YQ3 A;  1TDO A;  1GXF A;  2WOW A;  2ACZ A;  4PAB A;  2YLS A;  2GQW A;  4UDQ A;  3C96 A;  3UKQ A;  2WOV A;  1CF3 A;  4B67 A;  1NG3 A;  3CIR A;  5HY5 A;  1JRY A;  3BNU A;  1NDA A;  3EAN A;  4BV6 A;  2BS2 A;  3ALM A;  1O5W A;  1GET A;  4U8K A;  3WE0 A;  1M6I A;  1K4Q A;  4TLX A;  4U8O A;  2B7S A;  4YWO A;  4DNA A;  1NHS A;  2YWL A;  3BI2 A;  3NLC A;  3NTD A;  2XLS A;  1CL0 A;  3B3R A;  1E1M A;  2BK3 A;  2O9Z A;  2QCU A;  3GMB A;  4GR1 A;  4H4R A;  4MJW A;  2BC0 A;  3AXB A;  4YT0 A;  2XVJ A;  1NHQ A;  3VRA A;  1GSN A;  4H4S A;  3UOZ A;  3LB8 A;  4IVM B;  4C74 A;  4O5Q A;  2XLR A;  1QJD A;  3CGD A;  1H84 A;  1F8W A;  2XVH A;  4CNK A;  3NNE A;  5JCL A;  2FJA A;  4K8D A;  3DJE A;  4A7A A;  5BUL A;  4DGK A;  1NHP A;  2RGJ A;  3P9U A;  4IA5 A;  1EL9 A;  3UTG A;  4X9M A;  4AOX A;  2EQ9 A;  2TPR A;  3BI5 A;  2QA2 A;  4YTN A;  3BNM A;  1NEK A;  4A99 A;  1GV4 A;  3AEC A;  2C72 A;  2GR3 A;  1L9D A;  1PBE A;  2VQB A;  3F8R A;  3NGC X;  4XWR A;  3V3N A;  2H88 A;  1ZKQ A;  1ZP0 A;  3VQR A;  3KKJ A;  4YKG A;  1OJA A;  2RAB A;  1RSG A;  2R4J A;  1PJ7 A;  2AAQ A;  2XVE A;  5TR3 A;  4K5S A;  5ER0 A;  2YR6 A;  4WX1 A;  2A87 A;  1LTX R;  3GWD A;  3FBS A;  4U2L A;  1P2E A;  1GRG A;  2QA1 A;  2WQY A;  2PHH A;  3DJD A;  1IUX A;  3NTA A;  4H2R A;  5GRT A;  1LQU A;  3B6D A;  3SFD A;  3Q9T A;  3UP4 A;  1D4E A;  1DXL A;  4D04 A;  2I0Z A;  4ICY A;  1PXA A;  4CCQ A;  1D7L A;  5HHF A;  4Z44 A;  3AWI A;  1OJC A;  2FBW A;  2R45 A;  3NK2 X;  4Y4N A;  4M52 A;  4JQ9 A;  1GTH A;  4Z2T A;  1ZDL A;  4C3X A;  4U8L A;  2PYX A;  2XLU A;  5HXI A;  2BXS A;  2BAB A;  4B64 A;  3AE9 A;  4Y4L A;  1ZMC A;  2HQM A;  2BS3 A;  1GRH A;  3CPH G;  3DK9 A;  4H4X A;  4OVI A;  1JNR A;  4ZCC A;  4B1B A;  3K30 A;  5BRT A;  3KVE A;  1Y0P A;  4EIQ A;  4YSH A;  1N4U A;  4O5U A;  2XFP A;  1ZY8 A;  2C3D A;  4OPG A;  1E39 A;  4J57 A;  2A8X A;  3QSE A;  5FS6 A;  4Z25 A;  1NHR A;  4YTP A;  2YM2 A;  3V3O A;  4X9N A;  5EB5 A;  4EMW A;  2B9Y A;  3AYJ A;  3AB1 A;  3LOV A;  3P4P A;  3AE4 A;  2YLZ A;  3UKK A;  5KRQ A;  2WET A;  4KX6 A;  5IQ1 A;  1K0I A;  4BUR A;  2YG3 A;  4LII A;  4K2X A;  2XLT A;  3GRT A;  1B5Q A;  4I58 A;  1GPE A;  1GND A;  2WEU A; 
#chains in the Genus database with same CATH topology
 1D4D A;  2JB1 A;  4WCT A;  4TM0 A;  2WP6 A;  2BCG G;  1GTE A;  1DOD A;  5CQF A;  2YG4 A;  3GD4 A;  2F5Z A;  4D03 A;  5C2T A;  1FOH A;  1VDC A;  3H8L A;  1LJ1 A;  3QSS A;  4A6N A;  1VG0 A;  1E1K A;  3ITJ A;  1IUS A;  2RGO A;  2VQ7 A;  1KF6 A;  3LZX A;  3IHG A;  4J56 A;  4AT2 A;  3BI4 A;  3CNS A;  5FS8 A;  2ZZB A;  2E4G A;  1KSU A;  4NNJ A;  5L46 A;  4H4U A;  3ATR A;  3QFA A;  1YQZ A;  2AR8 A;  4G74 A;  3SXI A;  2C65 A;  3CGB A;  2B9W A;  3AED A;  1XDI A;  1W4X A;  2WOI A;  3NH3 X;  4N9X A;  2X3N A;  4H4Q A;  3AD7 B;  1TDF A;  2Q0K A;  4NTE A;  1D7Y A;  1JOA A;  3VR9 A;  2RGH A;  2XFO A;  2B76 A;  1TDN A;  4TM1 A;  2IVD A;  1H86 A;  5IPY A;  3CNJ A;  3KD9 A;  3L1R A;  1CC6 A;  3T2Y A;  3VRB A;  2R9Z A;  4DSH A;  3II4 A;  3UTH A;  2JB3 A;  4CY6 A;  2OAL A;  1QO8 A;  1KFY A;  3ALJ A;  1YY5 A;  4GAV A;  3SZ0 A;  3AYL A;  5M10 A;  4C77 A;  3CNT A;  1S3B A;  3P1W A;  4Z2U A;  1LVL A;  2EQ6 A;  3FIM B;  3O0H A;  4FK1 A;  4EIP A;  3G5S A;  2GB0 A;  2A89 A;  4EM3 A;  5KOW A;  2ZBW A;  1DOE A;  1X31 B;  1Q1R A;  3UKL A;  3H4K A;  3K7M X;  5KVI A;  3NK1 X;  1TDK A;  3ZYX A;  2APG A;  1K0J A;  3RP8 A;  3CGE A;  1FEC A;  1H7X A;  5J7X A;  3UKF A;  3UTF A;  4B65 A;  4BJZ A;  2V3A A;  4CCR A;  4CNJ A;  1Y56 A;  3RP6 A;  1F8S A;  4TM3 A;  2QAE A;  2W0H A;  3R9U A;  4EQW A;  5KWF A;  3DGH A;  3T0K A;  1E6E A;  3NYF A;  2FJD A;  1JNZ A;  3KPF A;  3V76 A;  3GMC A;  5KMP A;  1REO A;  4UP3 A;  3SX6 A;  3ADA B;  2JAE A;  2GR0 A;  5EOW A;  2WHD A;  3IC9 A;  1B4V A;  2Y6R A;  3AE7 A;  3HZL A;  5KNL A;  3NK0 X;  3PO7 A;  1EL5 A;  3K7T A;  4K22 A;  4OCG A;  1GAL A;  3AEF A;  2YG5 A;  3DK8 A;  1DJN A;  5FS7 A;  1ZOV A;  3QFB A;  4YKF A;  1CJ3 A;  3C4N A;  3T37 A;  2C73 A;  2B7R A;  1AOG A;  3FMW A;  3AEB A;  1TYP A;  3C4A A;  2C75 A;  3CGC A;  2XYO A;  2X8H A;  4HB9 A;  4PAA A;  5U63 A;  2JBV A;  1FEA A;  2H89 A;  1LPF A;  2WPF A;  1MOK A;  1XAN A;  4U8N A;  3RED A;  1L9E A;  2AQJ A;  1K0L A;  4YTM A;  1EL8 A;  2Q0L A;  2Z5Y A;  1GRE A;  3F8D A;  5CKU A;  4A5L A;  1F6M A;  4RG4 A;  3LZW A;  2JKC A;  3DJJ A;  3K7Q X;  3DGZ A;  1CBO A;  1PJ5 A;  1DJQ A;  4G9K A;  5KVH A;  1VRQ B;  3P4Q A;  1Q1W A;  3EPT A;  4LU6 A;  3OC4 A;  1JU2 A;  4OPI A;  1S3E A;  4EMJ A;  4AP3 A;  2NPX A;  3KLJ A;  3QJ4 A;  4H50 A;  3UP5 A;  4J2W A;  4Z24 A;  4YSZ A;  1YKJ A;  2YQU A;  4JY2 A;  2YLR A;  5HYM A;  3P4R A;  3VR8 A;  2R0P A;  2Q7V A;  1L9C A;  2X99 A;  2Y6Q A;  2YR5 A;  3ICT A;  4GF7 A;  4JY3 A;  1BZL A;  1TRB A;  2V6O A;  1GRA A;  3NIX A;  3NKS A;  4U2T A;  1H81 A;  4BJY A;  1D5T A;  4IVO B;  4ZCD A;  5DBJ A;  5KOX A;  4EM4 A;  4B66 A;  3ICS A;  4KPR A;  2Q6U A;  1D4C A;  2BRY A;  3CND A;  3UCL A;  1PXB A;  2WP5 A;  2C7G A;  2ARD A;  3UKP A;  4H2P A;  1V59 A;  3KPK A;  4OPD A;  3AEE A;  3IWA A;  2VOU A;  4YXD A;  1DNC A;  1DOC A;  2CDU A;  2R46 A;  4JNA A;  4GUV A;  3ATQ A;  1ELI A;  4GRT A;  5U25 A;  5EB4 A;  1IUW A;  1BKW A;  2GQF A;  2VZ2 A;  1PBD A;  1PXC A;  4B68 A;  3GWF A;  5KXJ A;  4OPT A;  4Y4M A;  3URH A;  2FJB A;  3AYI A;  4CBQ A;  2JB2 A;  2BK5 A;  2C66 A;  1BGN A;  3BHK A;  1OJ9 A;  4A65 A;  3GDP A;  1CHU A;  2VRM A;  1H6V A;  1CJ4 A;  1LQT A;  1XHC A;  4FX9 A;  1UKV G;  2WS3 A;  4USQ A;  4C5O A;  1MXT A;  1DOB A;  1PJ6 A;  1MO9 A;  1EBD A;  1RYI A;  4FK1 C;  5EBK A;  4AP1 A;  4GCM A;  1CC2 A;  3AD8 B;  1RP0 A;  4U8P A;  4CRT A;  3FG2 P;  2BC1 A;  5LV9 A;  3H8I A;  4XXG A;  3UKH A;  3COX A;  4AT0 A;  1ZX9 A;  2EQ7 A;  2XFU A;  3GRS A;  3G5R A;  2YG7 A;  2DKH A;  4IV9 A;  3NG7 X;  4NEW A;  3I6D A;  3AE6 A;  3LJP A;  4UDP A;  3JSK A;  5JCM A;  4CY8 A;  2GAG B;  3T31 A;  3LAD A;  2UZZ A;  1IUT A;  1ZOY A;  5BUK A;  1BGJ A;  2TMD A;  3ISH A;  4EMI A;  4EQR A;  2BAC A;  4BK1 A;  1FL2 A;  1IUV A;  1PN0 A;  3AEA A;  3DA1 A;  2WPC A;  3DH9 A;  2Z5X A;  3VRD B;  4H4P A;  4OPU A;  2BCP A;  4XWZ A;  3GDN A;  3SQP A;  4P9S A;  4EQX A;  2GMH A;  3SYI A;  4APN A;  1XPQ A;  2XFQ A;  2V3B A;  4ADW A;  1Y56 B;  2VRL A;  3CN8 A;  2FJE A;  4NWZ A;  3UOY A;  5KMQ A;  3Q6J A;  2BS4 A;  1ONF A;  3NYE A;  2C3C A;  1TDE A;  2WPE A;  2GRT A;  3DJG X;  2YVF A;  4J34 A;  4H7U A;  3QVR A;  3CPJ G;  4YSX A;  5IQ4 A;  5FS9 A;  5BVA A;  3EF6 A;  2YR4 A;  4H4Y A;  3SGL A;  4B63 A;  3OZ2 A;  3PVC A;  1Z6L A;  4NTD A;  1O95 A;  5GSN A;  2V61 A;  3L8K A;  1CC4 A;  5JCN A;  3NHO X;  4Z26 A;  2OLN A;  1OJD A;  2YLT A;  1KDG A;  4HA6 A;  4U2S A;  1KNP A;  1M64 A;  1GT8 A;  2XDO A;  2X50 A;  2WU5 A;  3NRN A;  3AE3 A;  3FPZ A;  4TLZ A;  2CUL A;  3ZDN A;  2R4E A;  1GRB A;  3UOV A;  3UOX A;  5J60 A;  4REK A;  4C3Y A;  4I59 A;  4EQS A;  3I3L A;  2YVJ A;  5M0Z A;  1YQ4 A;  4II3 A;  3DK4 A;  3CPI G;  1GES A;  3E1T A;  4DSG A;  1LV0 A;  4TM4 A;  4K7Z A;  3RP7 A;  2BXR A;  3CTY A;  1PBB A;  4A6N B;  1KSS A;  2YM1 A;  1EL7 A;  1Q9I A;  3EAO A;  1N4W A;  1IJH A;  1E1N A;  1JEH A;  1GRT A;  4U8J A;  4ECH A;  2GR1 A;  4H2Q A;  3IF9 A;  3NT6 A;  2V60 A;  3CNP A;  2GAH B;  1GER A;  2YLX A;  3AD9 B;  3AEG A;  3NYC A;  3NN6 X;  3RNM A;  3UTE A;  1S2Q A;  3ALL A;  1O94 A;  4BK2 A;  2DKI A;  4FDC B;  1FCD A;  1S2Y A;  2XFN A;  3ABV A;  1BF3 A;  3GYJ A;  4G6H A;  4A9W A;  2B9X A;  2WBA A;  1H83 A;  4H4T A;  4USR A;  4ZN0 A;  4A79 A;  2IID A;  2X8G A;  4LA1 A;  4RG3 A;  4AOS A;  5JCK A;  1GRF A;  2YAU A;  3UKA A;  2WDQ A;  4X4J A;  5U1O A;  2VVL A;  5FMH A;  4H4Z A;  4B69 A;  2V5Z A;  4YSY A;  1COY A;  2GVC A;  1GEU A;  2R0C A;  2ZZC A;  4U8I A;  1L0V A;  1NPX A;  4H2N A;  1F3P A;  2C76 A;  2OLO A;  4JDR A;  2GV8 A;  2WDV A;  3SZF A;  3S5W A;  2C67 A;  2WU2 A;  2BK4 A;  2NVK X;  2WP9 A;  2XVF A;  3GD3 A;  3S61 A;  2OAM A;  4OPL A;  2CFY A;  1PBF A;  3D8X A;  3AE1 A;  4H4W A;  4J31 A;  2YVG A;  2BRA A;  4NTC A;  2BA9 A;  1E1L A;  4OPC A;  1OJT A;  1P2H A;  2XVI A;  3M13 A;  1H82 A;  4UDR A;  2OA1 A;  4J36 A;  2GF3 A;  2IVE A;  2EQ8 A;  1PBC A;  1TYT A;  3GYI A;  3IHM A;  3NN0 X;  4IA6 A;  3SZC A;  1VQW A;  3BHF A;  1QLB A;  1ZMD A;  1HYU A;  1ZK7 A;  4E0V A;  2GEW A;  3LXD A;  1NAA A;  3D1C A;  4G73 A;  1GOS A;  1H7W A;  1PDH A;  1B37 A;  2E5V A;  2XCG A;  1B8S A;  1CJ2 A;  2ZZ0 A;  4II2 A;  3G5Q A;  2GMJ A;  3F8P A;  4J33 A;  1N1P A;  3KA7 A;  3M0O A;  4H4V A;  2C70 A;  2E1M A;  1PHH A;  2GH5 A;  3KU9 A;  4Z43 A;  2YG6 A;  3AE5 A;  5JCI A;  1FEB A;  1JRX A;  3AE2 A;  2BYB A;  3AE8 A;  3ICR A;  3SFE A;  1VG9 A;  4Z2R A;  1KNR A;  2CVJ A;  1BWC A;  4K5R A;  5C3J A;  3RHA A;  5KMR A;  3DME A;  3QVP A;  3SM8 A;  2J3N A;  2YLW A;  1JRZ A;  4JNQ A;  1F8R A;  1NEN A;  1PS9 A;  2WES A;  2VVM A;  4JN9 A;  2C64 A;  4GDP A;  3QSM A;  4NZH A;  4U8M A;  2VVL G;  4BK3 A;  1E7P A;  1IUU A;  1N4V A;  2GR2 A;  2XLP A;  1NG4 A;  3GSI A;  3P4S A;  4RSL A;  2JK6 A;  4GDE A;  1SEZ A;  3HYX A;  1CJC A;  3M12 A;  2R0G A;  3PS9 A;  4NEV A;  2WDR A;  2X8C A;  1YQ3 A;  1TDO A;  1GXF A;  2WOW A;  2ACZ A;  4PAB A;  2YLS A;  2GQW A;  4UDQ A;  3C96 A;  3UKQ A;  2WOV A;  1CF3 A;  4B67 A;  1NG3 A;  4GAP A;  3CIR A;  5HY5 A;  1JRY A;  3BNU A;  3T2K A;  1NDA A;  3EAN A;  4BV6 A;  2BS2 A;  3ALM A;  3WE0 A;  1GET A;  1O5W A;  4U8K A;  1M6I A;  1K4Q A;  4TLX A;  4U8O A;  2B7S A;  4YWO A;  4DNA A;  1NHS A;  2YWL A;  3BI2 A;  3NLC A;  3NTD A;  2XLS A;  1CL0 A;  3B3R A;  1E1M A;  2BK3 A;  2O9Z A;  2QCU A;  3GMB A;  4GR1 A;  4H4R A;  4MJW A;  2BC0 A;  3AXB A;  4YT0 A;  2XVJ A;  1NHQ A;  3VRA A;  1GSN A;  4H4S A;  3UOZ A;  3LB8 A;  4IVM B;  4C74 A;  4O5Q A;  2XLR A;  1QJD A;  3CGD A;  1H84 A;  1F8W A;  2XVH A;  4CNK A;  3NNE A;  5JCL A;  3HYW A;  3CMM A;  2FJA A;  4K8D A;  3DJE A;  4A7A A;  5BUL A;  4DGK A;  3HYV A;  1NHP A;  2RGJ A;  3P9U A;  4IA5 A;  1EL9 A;  3UTG A;  3SY4 A;  4X9M A;  4AOX A;  2EQ9 A;  2TPR A;  3BI5 A;  2QA2 A;  4YTN A;  3BNM A;  1NEK A;  4A99 A;  2C4C A;  1GV4 A;  3AEC A;  2C72 A;  2GR3 A;  1L9D A;  1PBE A;  2VQB A;  3F8R A;  3NGC X;  4XWR A;  3V3N A;  2H88 A;  1ZKQ A;  1ZP0 A;  3VQR A;  3KKJ A;  4YKG A;  1OJA A;  2RAB A;  1RSG A;  2R4J A;  1PJ7 A;  3GYX A;  2AAQ A;  2XVE A;  5TR3 A;  4K5S A;  5ER0 A;  2YR6 A;  4WX1 A;  2A87 A;  1LTX R;  3GWD A;  3FBS A;  4U2L A;  1P2E A;  1GRG A;  2QA1 A;  2WQY A;  2PHH A;  3DJD A;  1IUX A;  3NTA A;  4H2R A;  5GRT A;  1LQU A;  3B6D A;  3SFD A;  3T14 A;  3Q9T A;  3UP4 A;  1D4E A;  1DXL A;  4D04 A;  2I0Z A;  4ICY A;  1PXA A;  4CCQ A;  1D7L A;  5HHF A;  4Z44 A;  3AWI A;  1OJC A;  2FBW A;  2R45 A;  3NK2 X;  4Y4N A;  4M52 A;  4JQ9 A;  1GTH A;  4Z2T A;  1ZDL A;  4C3X A;  4U8L A;  2PYX A;  2XLU A;  3SZW A;  2BAB A;  2BXS A;  4B64 A;  5HXI A;  3AE9 A;  4Y4L A;  1ZMC A;  2HQM A;  2BS3 A;  1GRH A;  3CPH G;  3DK9 A;  4H4X A;  4OVI A;  1JNR A;  4ZCC A;  4B1B A;  3K30 A;  5BRT A;  3KVE A;  1Y0P A;  4EIQ A;  4YSH A;  1N4U A;  4O5U A;  2XFP A;  1ZY8 A;  2C3D A;  4OPG A;  1E39 A;  4J57 A;  2A8X A;  3QSE A;  5FS6 A;  4Z25 A;  1NHR A;  4YTP A;  2YM2 A;  3V3O A;  4X9N A;  5EB5 A;  4EMW A;  2B9Y A;  3AYJ A;  3AB1 A;  3LOV A;  3P4P A;  3AE4 A;  2YLZ A;  3UKK A;  5KRQ A;  2WET A;  4KX6 A;  5IQ1 A;  1K0I A;  4BUR A;  2YG3 A;  4LII A;  4K2X A;  2XLT A;  5KMS A;  3GRT A;  1B5Q A;  4I58 A;  4G6G A;  1GPE A;  3T2Z A;  1GND A;  2WEU A; 
#chains in the Genus database with same CATH homology
 1D4D A;  2JB1 A;  4WCT A;  4TM0 A;  2WP6 A;  2BCG G;  1GTE A;  1DOD A;  5CQF A;  2YG4 A;  3GD4 A;  2F5Z A;  4D03 A;  5C2T A;  1FOH A;  1VDC A;  3H8L A;  1LJ1 A;  3QSS A;  4A6N A;  1VG0 A;  1E1K A;  3ITJ A;  1IUS A;  2RGO A;  2VQ7 A;  1KF6 A;  3LZX A;  3IHG A;  4J56 A;  4AT2 A;  3BI4 A;  3CNS A;  5FS8 A;  2ZZB A;  2E4G A;  1KSU A;  4NNJ A;  5L46 A;  4H4U A;  3ATR A;  3QFA A;  1YQZ A;  2AR8 A;  4G74 A;  3SXI A;  2C65 A;  3CGB A;  2B9W A;  3AED A;  1XDI A;  1W4X A;  2WOI A;  3NH3 X;  4N9X A;  2X3N A;  4H4Q A;  3AD7 B;  1TDF A;  2Q0K A;  4NTE A;  1D7Y A;  1JOA A;  3VR9 A;  2RGH A;  2XFO A;  2B76 A;  1TDN A;  4TM1 A;  2IVD A;  1H86 A;  5IPY A;  3CNJ A;  3KD9 A;  3L1R A;  1CC6 A;  3T2Y A;  3VRB A;  2R9Z A;  4DSH A;  3II4 A;  3UTH A;  2JB3 A;  4CY6 A;  2OAL A;  1QO8 A;  1KFY A;  3ALJ A;  1YY5 A;  4GAV A;  3SZ0 A;  3AYL A;  5M10 A;  4C77 A;  3CNT A;  1S3B A;  3P1W A;  4Z2U A;  1LVL A;  2EQ6 A;  3FIM B;  3O0H A;  4FK1 A;  4EIP A;  3G5S A;  2GB0 A;  2A89 A;  4EM3 A;  5KOW A;  2ZBW A;  1DOE A;  1X31 B;  1Q1R A;  3UKL A;  3H4K A;  3K7M X;  5KVI A;  3NK1 X;  1TDK A;  3ZYX A;  2APG A;  1K0J A;  3RP8 A;  3CGE A;  1FEC A;  1H7X A;  5J7X A;  3UKF A;  3UTF A;  4B65 A;  4BJZ A;  2V3A A;  4CCR A;  4CNJ A;  1Y56 A;  3RP6 A;  1F8S A;  4TM3 A;  2QAE A;  2W0H A;  3R9U A;  4EQW A;  5KWF A;  3DGH A;  3T0K A;  1E6E A;  3NYF A;  2FJD A;  1JNZ A;  3KPF A;  3V76 A;  3GMC A;  5KMP A;  1REO A;  4UP3 A;  3SX6 A;  3ADA B;  2JAE A;  2GR0 A;  5EOW A;  2WHD A;  3IC9 A;  1B4V A;  2Y6R A;  3AE7 A;  3HZL A;  5KNL A;  3NK0 X;  3PO7 A;  1EL5 A;  3K7T A;  4K22 A;  4OCG A;  1GAL A;  3AEF A;  2YG5 A;  3DK8 A;  1DJN A;  5FS7 A;  1ZOV A;  3QFB A;  4YKF A;  1CJ3 A;  3C4N A;  3T37 A;  2C73 A;  2B7R A;  1AOG A;  3FMW A;  3AEB A;  1TYP A;  3C4A A;  2C75 A;  3CGC A;  2XYO A;  2X8H A;  4HB9 A;  4PAA A;  5U63 A;  2JBV A;  1FEA A;  2H89 A;  1LPF A;  2WPF A;  1MOK A;  1XAN A;  4U8N A;  3RED A;  1L9E A;  2AQJ A;  1K0L A;  4YTM A;  1EL8 A;  2Q0L A;  2Z5Y A;  1GRE A;  3F8D A;  5CKU A;  4A5L A;  1F6M A;  4RG4 A;  3LZW A;  2JKC A;  3DJJ A;  3K7Q X;  3DGZ A;  1CBO A;  1PJ5 A;  1DJQ A;  4G9K A;  5KVH A;  1VRQ B;  3P4Q A;  1Q1W A;  3EPT A;  4LU6 A;  3OC4 A;  1JU2 A;  4OPI A;  1S3E A;  4EMJ A;  4AP3 A;  2NPX A;  3KLJ A;  3QJ4 A;  4H50 A;  3UP5 A;  4J2W A;  4Z24 A;  4YSZ A;  1YKJ A;  2YQU A;  4JY2 A;  2YLR A;  5HYM A;  3P4R A;  3VR8 A;  2R0P A;  2Q7V A;  1L9C A;  2X99 A;  2Y6Q A;  2YR5 A;  3ICT A;  4GF7 A;  4JY3 A;  1BZL A;  1TRB A;  2V6O A;  1GRA A;  3NIX A;  3NKS A;  4U2T A;  1H81 A;  4BJY A;  1D5T A;  4IVO B;  4ZCD A;  5DBJ A;  5KOX A;  4EM4 A;  4B66 A;  3ICS A;  4KPR A;  2Q6U A;  1D4C A;  2BRY A;  3CND A;  3UCL A;  1PXB A;  2WP5 A;  2C7G A;  2ARD A;  3UKP A;  4H2P A;  1V59 A;  3KPK A;  4OPD A;  3AEE A;  3IWA A;  2VOU A;  4YXD A;  1DNC A;  1DOC A;  2CDU A;  2R46 A;  4JNA A;  4GUV A;  3ATQ A;  1ELI A;  4GRT A;  5U25 A;  5EB4 A;  1IUW A;  1BKW A;  2GQF A;  2VZ2 A;  1PBD A;  1PXC A;  4B68 A;  3GWF A;  5KXJ A;  4OPT A;  4Y4M A;  3URH A;  2FJB A;  3AYI A;  4CBQ A;  2JB2 A;  2BK5 A;  2C66 A;  1BGN A;  3BHK A;  1OJ9 A;  4A65 A;  3GDP A;  1CHU A;  2VRM A;  1H6V A;  1CJ4 A;  1LQT A;  1XHC A;  4FX9 A;  1UKV G;  2WS3 A;  4USQ A;  4C5O A;  1MXT A;  1DOB A;  1PJ6 A;  1MO9 A;  1EBD A;  1RYI A;  4FK1 C;  5EBK A;  4AP1 A;  4GCM A;  1CC2 A;  3AD8 B;  1RP0 A;  4U8P A;  4CRT A;  3FG2 P;  2BC1 A;  5LV9 A;  3H8I A;  4XXG A;  3UKH A;  3COX A;  4AT0 A;  1ZX9 A;  2EQ7 A;  2XFU A;  3GRS A;  3G5R A;  2YG7 A;  2DKH A;  4IV9 A;  3NG7 X;  4NEW A;  3I6D A;  3AE6 A;  3LJP A;  4UDP A;  3JSK A;  5JCM A;  4CY8 A;  2GAG B;  3T31 A;  3LAD A;  2UZZ A;  1IUT A;  1ZOY A;  5BUK A;  1BGJ A;  2TMD A;  3ISH A;  4EMI A;  4EQR A;  2BAC A;  4BK1 A;  1FL2 A;  1IUV A;  1PN0 A;  3AEA A;  3DA1 A;  2WPC A;  3DH9 A;  2Z5X A;  3VRD B;  4H4P A;  4OPU A;  2BCP A;  4XWZ A;  3GDN A;  3SQP A;  4P9S A;  4EQX A;  2GMH A;  3SYI A;  4APN A;  1XPQ A;  2XFQ A;  2V3B A;  4ADW A;  1Y56 B;  2VRL A;  3CN8 A;  2FJE A;  4NWZ A;  3UOY A;  5KMQ A;  3Q6J A;  2BS4 A;  1ONF A;  3NYE A;  2C3C A;  1TDE A;  2WPE A;  2GRT A;  3DJG X;  2YVF A;  4J34 A;  4H7U A;  3QVR A;  3CPJ G;  4YSX A;  5IQ4 A;  5FS9 A;  5BVA A;  3EF6 A;  2YR4 A;  4H4Y A;  3SGL A;  4B63 A;  3OZ2 A;  3PVC A;  1Z6L A;  4NTD A;  1O95 A;  5GSN A;  2V61 A;  3L8K A;  1CC4 A;  5JCN A;  3NHO X;  4Z26 A;  2OLN A;  1OJD A;  2YLT A;  1KDG A;  4HA6 A;  4U2S A;  1KNP A;  1M64 A;  1GT8 A;  2XDO A;  2X50 A;  2WU5 A;  3NRN A;  3AE3 A;  3FPZ A;  4TLZ A;  2CUL A;  3ZDN A;  2R4E A;  1GRB A;  3UOV A;  3UOX A;  5J60 A;  4REK A;  4C3Y A;  4I59 A;  4EQS A;  3I3L A;  2YVJ A;  5M0Z A;  1YQ4 A;  4II3 A;  3DK4 A;  3CPI G;  1GES A;  3E1T A;  4DSG A;  1LV0 A;  4TM4 A;  4K7Z A;  3RP7 A;  2BXR A;  3CTY A;  1PBB A;  4A6N B;  1KSS A;  2YM1 A;  1EL7 A;  1Q9I A;  3EAO A;  1N4W A;  1IJH A;  1E1N A;  1JEH A;  1GRT A;  4U8J A;  4ECH A;  2GR1 A;  4H2Q A;  3IF9 A;  3NT6 A;  2V60 A;  3CNP A;  2GAH B;  1GER A;  2YLX A;  3AD9 B;  3AEG A;  3NYC A;  3NN6 X;  3RNM A;  3UTE A;  1S2Q A;  3ALL A;  1O94 A;  4BK2 A;  2DKI A;  4FDC B;  1FCD A;  1S2Y A;  2XFN A;  3ABV A;  1BF3 A;  3GYJ A;  4G6H A;  4A9W A;  2B9X A;  2WBA A;  1H83 A;  4H4T A;  4USR A;  4ZN0 A;  4A79 A;  2IID A;  2X8G A;  4LA1 A;  4RG3 A;  4AOS A;  5JCK A;  1GRF A;  2YAU A;  3UKA A;  2WDQ A;  4X4J A;  5U1O A;  2VVL A;  5FMH A;  4H4Z A;  4B69 A;  2V5Z A;  4YSY A;  1COY A;  2GVC A;  1GEU A;  2R0C A;  2ZZC A;  4U8I A;  1L0V A;  1NPX A;  4H2N A;  1F3P A;  2C76 A;  2OLO A;  4JDR A;  2GV8 A;  2WDV A;  3SZF A;  3S5W A;  2C67 A;  2WU2 A;  2BK4 A;  2NVK X;  2WP9 A;  2XVF A;  3GD3 A;  3S61 A;  2OAM A;  4OPL A;  2CFY A;  1PBF A;  3D8X A;  3AE1 A;  4H4W A;  4J31 A;  2YVG A;  2BRA A;  4NTC A;  2BA9 A;  1E1L A;  4OPC A;  1OJT A;  1P2H A;  2XVI A;  3M13 A;  1H82 A;  4UDR A;  2OA1 A;  4J36 A;  2GF3 A;  2IVE A;  2EQ8 A;  1PBC A;  1TYT A;  3GYI A;  3IHM A;  3NN0 X;  4IA6 A;  3SZC A;  1VQW A;  3BHF A;  1QLB A;  1ZMD A;  1HYU A;  1ZK7 A;  4E0V A;  2GEW A;  3LXD A;  1NAA A;  3D1C A;  4G73 A;  1GOS A;  1H7W A;  1PDH A;  1B37 A;  2E5V A;  2XCG A;  1B8S A;  1CJ2 A;  2ZZ0 A;  4II2 A;  3G5Q A;  2GMJ A;  3F8P A;  4J33 A;  1N1P A;  3KA7 A;  3M0O A;  4H4V A;  2C70 A;  2E1M A;  1PHH A;  2GH5 A;  3KU9 A;  4Z43 A;  2YG6 A;  3AE5 A;  5JCI A;  1FEB A;  1JRX A;  3AE2 A;  2BYB A;  3AE8 A;  3ICR A;  3SFE A;  1VG9 A;  4Z2R A;  1KNR A;  2CVJ A;  1BWC A;  4K5R A;  5C3J A;  3RHA A;  5KMR A;  3DME A;  3QVP A;  3SM8 A;  2J3N A;  2YLW A;  1JRZ A;  4JNQ A;  1F8R A;  1NEN A;  1PS9 A;  2WES A;  2VVM A;  4JN9 A;  2C64 A;  4GDP A;  3QSM A;  4NZH A;  4U8M A;  2VVL G;  4BK3 A;  1E7P A;  1IUU A;  1N4V A;  2GR2 A;  2XLP A;  1NG4 A;  3GSI A;  3P4S A;  4RSL A;  2JK6 A;  4GDE A;  1SEZ A;  3HYX A;  1CJC A;  3M12 A;  2R0G A;  3PS9 A;  4NEV A;  2WDR A;  2X8C A;  1YQ3 A;  1TDO A;  1GXF A;  2WOW A;  2ACZ A;  4PAB A;  2YLS A;  2GQW A;  4UDQ A;  3C96 A;  3UKQ A;  2WOV A;  1CF3 A;  4B67 A;  1NG3 A;  4GAP A;  3CIR A;  5HY5 A;  1JRY A;  3BNU A;  3T2K A;  1NDA A;  3EAN A;  4BV6 A;  2BS2 A;  3ALM A;  1O5W A;  1GET A;  4U8K A;  3WE0 A;  1M6I A;  1K4Q A;  4TLX A;  4U8O A;  2B7S A;  4YWO A;  4DNA A;  1NHS A;  2YWL A;  3BI2 A;  3NLC A;  3NTD A;  2XLS A;  1CL0 A;  3B3R A;  1E1M A;  2BK3 A;  2O9Z A;  2QCU A;  3GMB A;  4GR1 A;  4H4R A;  4MJW A;  2BC0 A;  3AXB A;  4YT0 A;  2XVJ A;  1NHQ A;  3VRA A;  1GSN A;  4H4S A;  3UOZ A;  3LB8 A;  4IVM B;  4C74 A;  4O5Q A;  2XLR A;  1QJD A;  3CGD A;  1H84 A;  1F8W A;  2XVH A;  4CNK A;  3NNE A;  5JCL A;  3HYW A;  3CMM A;  2FJA A;  4K8D A;  3DJE A;  4A7A A;  5BUL A;  4DGK A;  3HYV A;  1NHP A;  2RGJ A;  3P9U A;  4IA5 A;  1EL9 A;  3UTG A;  3SY4 A;  4X9M A;  4AOX A;  2EQ9 A;  2TPR A;  3BI5 A;  2QA2 A;  4YTN A;  3BNM A;  1NEK A;  4A99 A;  2C4C A;  1GV4 A;  3AEC A;  2C72 A;  2GR3 A;  1L9D A;  1PBE A;  2VQB A;  3F8R A;  3NGC X;  4XWR A;  3V3N A;  2H88 A;  1ZKQ A;  1ZP0 A;  3VQR A;  3KKJ A;  4YKG A;  1OJA A;  2RAB A;  1RSG A;  2R4J A;  1PJ7 A;  3GYX A;  2AAQ A;  2XVE A;  5TR3 A;  4K5S A;  5ER0 A;  2YR6 A;  4WX1 A;  2A87 A;  1LTX R;  3GWD A;  3FBS A;  4U2L A;  1P2E A;  1GRG A;  2QA1 A;  2WQY A;  2PHH A;  3DJD A;  1IUX A;  3NTA A;  4H2R A;  5GRT A;  1LQU A;  3B6D A;  3SFD A;  3T14 A;  3Q9T A;  3UP4 A;  1D4E A;  1DXL A;  4D04 A;  2I0Z A;  4ICY A;  1PXA A;  4CCQ A;  1D7L A;  5HHF A;  4Z44 A;  3AWI A;  1OJC A;  2FBW A;  2R45 A;  3NK2 X;  4Y4N A;  4M52 A;  4JQ9 A;  1GTH A;  4Z2T A;  1ZDL A;  4C3X A;  4U8L A;  2PYX A;  2XLU A;  3SZW A;  2BXS A;  2BAB A;  4B64 A;  5HXI A;  3AE9 A;  4Y4L A;  1ZMC A;  2HQM A;  2BS3 A;  1GRH A;  3CPH G;  3DK9 A;  4H4X A;  4OVI A;  1JNR A;  4ZCC A;  4B1B A;  3K30 A;  5BRT A;  3KVE A;  1Y0P A;  4EIQ A;  4YSH A;  1N4U A;  4O5U A;  2XFP A;  1ZY8 A;  2C3D A;  4OPG A;  1E39 A;  4J57 A;  2A8X A;  3QSE A;  5FS6 A;  4Z25 A;  1NHR A;  4YTP A;  2YM2 A;  3V3O A;  4X9N A;  5EB5 A;  4EMW A;  2B9Y A;  3AYJ A;  3AB1 A;  3LOV A;  3P4P A;  3AE4 A;  2YLZ A;  3UKK A;  5KRQ A;  2WET A;  4KX6 A;  5IQ1 A;  1K0I A;  4BUR A;  2YG3 A;  4LII A;  4K2X A;  2XLT A;  5KMS A;  3GRT A;  1B5Q A;  4I58 A;  4G6G A;  1GPE A;  3T2Z A;  1GND A;  2WEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...