1F8SA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
482
structure length
482
Chain Sequence
b'NPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-AMINO ACID OXIDASE
publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 176
structure length 482
sequence length 482
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8sA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8sA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8sA01
2E5VA 4LIIA 1BKWA 2WOVA 4PABA 2OALA 3B6DA 1LPFA 1JRXA 3NLCA 1E1KA 5EBKA 1JNZA 1YQ4A 2ZZBA 4RG4A 4JY2A 1DOCA 4YSZA 3GSIA 4D03A 5BULA 1H83A 2ARDA 1TDEA 4A5LA 3F8PA 1LVLA 3JSKA 3T37A 3E1TA 2R46A 2VZ2A 1L0VA 4YSYA 1LQTA 4GRTA 2YM1A 1PJ7A 3BI4A 1D4EA 2BC0A 1GRGA 4Y4LA 4AT0A 1JOAA 2YG7A 3C96A 3CGEA 4NZHA 1PBBA 2GMHA 2YR5A 4EMJA 4AP1A 1JU2A 1IUTA 2Z5XA 2GAHB 1BWCA 1PBFA 1YQZA 2WP6A 1GTHA 2YVGA 4H7UA 4O5QA 2GR2A 3LJPA 1KDGA 1GESA 3SFEA 4B1BA 1NHRA 1MO9A 5TR3A 1EL7A 1CJ4A 2A8XA 4UDPA 5J7XA 3CIRA 3NNEA 4USQA 3UCLA 2WETA 3C4NA 4TLZA 3HZLA 3UKQA 2WS3A 3AECA 1ZP0A 2VQBA 3AE3A 2BK4A 1DJQA 1HYUA 1NDAA 2RABA 2J3NA 2R0GA 2GH5A 3NT6A 4U8MA 3GWFA 2C66A 1MXTA 1F8SA 3I3LA 2OAMA 2XDOA 4H4WA 2YLSA 3DJDA 2OLOA 3AYIA 4LU6A 1Z6LA 3CGCA 3QSSA 3GWDA 2QCUA 2GMJA 4B66A 3B3RA 3M12A 3GRTA 2C7GA 2QAEA 2YLXA 4GR1A 4J57A 3LZWA 4WCTA 4A7AA 1GEUA 3ICRA 4U8LA 3GYIA 2BS3A 4U8PA 4CBQA 1GV4A 3F8RA 1E39A 3ICSA 3ITJA 1D7LA 2WU2A 3DGZA 4JN9A 5JCLA 2RGOA 3ATRA 3PVCA 4BJYA 2BCGG 2V6OA 1MOKA 2YLRA 5EOWA 2VOUA 2QA1A 3BHFA 4GCMA 3UKKA 4BURA 4OCGA 4X4JA 3FMWA 5M0ZA 5CQFA 3GYJA 1CBOA 2WDQA 1ELIA 3P9UA 1H7WA 3RHAA 1JNRA 4APNA 4IA5A 2YG4A 4U8IA 2YLZA 1V59A 2XFNA 1F8RA 3DH9A 1B4VA 1PXAA 1ZOYA 2XVFA 3VRAA 1GXFA 1FL2A 3RP6A 1GRHA 1BGNA 3CN8A 3UKHA 5KRQA 4FDCB 1P2HA 1RYIA 4LA1A 2Y6QA 5FS7A 3EPTA 2VVLA 2WP5A 3QFBA 5KOWA 3DGHA 3NGCX 4K8DA 3FPZA 5DBJA 2WP9A 3GDNA 4CCRA 1H7XA 5HYMA 1NHPA 3ATQA 1TDOA 3P4QA 3UKFA 4Z2TA 1P2EA 1YY5A 3VRBA 1CJ3A 4EIQA 3DJJA 3NK0X 2F5ZA 4BK1A 2XFUA 1BF3A 1KF6A 4UP3A 5M10A 2B9XA 1NHSA 3K7QX 3DK9A 2WU5A 3FIMB 3UKPA 3EF6A 1VQWA 4GDEA 3IHMA 4DSHA 4A9WA 2XLPA 1IUUA 2Y6RA 3LOVA 3AEAA 4OPUA 2BXSA 1XANA 3UTHA 1LV0A 2X8CA 3BHKA 4C5OA 1F3PA 4IVMB 3AE6A 1O95A 1VG0A 3P4SA 5IQ1A 2RGHA 1PJ6A 1KSUA 1N4WA 2X99A 2BCPA 3AD7B 3AYJA 4U2LA 4RSLA 1ZMCA 5KOXA 4REKA 4EQWA 1GERA 5JCIA 4KPRA 3DJGX 3KVEA 4RG3A 1H86A 3H4KA 2DKIA 4HA6A 4K7ZA 4H2PA 5EB4A 1DOBA 4H2RA 2EQ9A 4PAAA 1GSNA 4Y4MA 4U8OA 1GREA 2B9WA 3ISHA 1TYPA 1H6VA 4D04A 4BK3A 4EQSA 1ZKQA 1N4VA 4YTMA 3ZDNA 2YVFA 2V61A 4B69A 3VQRA 4FX9A 3URHA 4ZCDA 3DK8A 2VRLA 5GSNA 2VVMA 2FJDA 3OZ2A 2C65A 4B64A 2FBWA 3REDA 4YWOA 4X9NA 1K0IA 1NG3A 3UKLA 4B63A 3P4RA 2ZBWA 2WOWA 3AE5A 3FBSA 3QSMA 3I6DA 2QA2A 1E1LA 4JNAA 2AR8A 3Q6JA 4U8KA 3NN0X 3RP7A 2BS4A 3AEBA 1RSGA 1NAAA 3M13A 1GRFA 1GTEA 2JB1A 3AXBA 2B9YA 5KVIA 3SQPA 4CY6A 1F6MA 2CDUA 2H89A 3UKAA 3G5RA 2VQ7A 4GF7A 1COYA 1BGJA 3Q9TA 5FMHA 1YQ3A 1OJDA 1DOEA 3BNMA 3GDPA 1S2QA 4AOXA 4OPDA 1ONFA 4ICYA 3NYFA 2GEWA 2X3NA 1FOHA 2CVJA 3NG7X 2XVJA 2XFOA 3KLJA 4E0VA 3IF9A 1Q1WA 3V76A 3CNJA 1PJ5A 5U1OA 3UOXA 3FG2P 1AOGA 1QJDA 2A87A 4YSXA 2C67A 1NENA 5HXIA 2EQ8A 1GOSA 1ZDLA 3AEGA 1IUSA 1ZY8A 1GT8A 2CULA 2R4JA 3AE7A 2ACZA 2RGJA 4ZCCA 2ZZCA 1JRZA 4Y4NA 1FEAA 3NK2X 2YAUA 2FJBA 1PHHA 2R45A 3PS9A 2A89A 3RP8A 1GPEA 3AE1A 1B8SA 4GUVA 5JCNA 1DNCA 4U2SA 1NPXA 4AT2A 1SEZA 1F8WA 2EQ6A 2WDRA 1TDNA 4J2WA 2GF3A 4TM0A 4M52A 4YTNA 1OJAA 5BRTA 2ZZ0A 1QLBA 4J33A 4YSHA 3AE2A 3UTFA 2BACA 3L1RA 1E1NA 2AAQA 3AEEA 1O94A 1NG4A 4IVOB 2GV8A 2GRTA 2Z5YA 4P9SA 2C75A 4OPGA 5FS8A 2X50A 1PDHA 1D4DA 3NIXA 3AEDA 4X9MA 2R9ZA 4H4YA 3DJEA 5KXJA 2YR6A 1XPQA 5BVAA 3K30A 2Q0KA 4B65A 3AE8A 2XYOA 2YM2A 1K0LA 4EMWA 4U2TA 3SFDA 3UTGA 1DXLA 2XFPA 4XWZA 3AWIA 3OC4A 4EM3A 4TM4A 2BXRA 4NEVA 1CC4A 3UP4A 5LV9A 4OVIA 1S2YA 3ADAB 1PS9A 2GAGB 4H2NA 4U8NA 2GB0A 4GDPA 4CRTA 3NKSA 1H81A 3PO7A 2JBVA 5FS9A 4DNAA 2B7SA 1IUVA 1EBDA 1X31B 1KSSA 2X8GA 3GD4A 3KU9A 1PBCA 5U63A 5L46A 3EANA 4TLXA 3V3NA 3D8XA 4CNJA 2OA1A 4TM1A 2C64A 4U8JA 4A65A 4CY8A 4K22A 2WHDA 2OLNA 2VVLG 1L9CA 3AD8B 4H4ZA 4YKGA 1ZX9A 5CKUA 2JK6A 1OJCA 2WDVA 4YT0A 3SM8A 2V3AA 1S3EA 1XDIA 2YLTA 2YG3A 2WEUA 2DKHA 2O9ZA 2Q6UA 4H2QA 4H4UA 3IHGA 5KVHA 1CJCA 1CJ2A 1B37A 2WQYA 1FCDA 4K5SA 3G5SA 4TM3A 4C77A 2B76A 1GRAA 3DMEA 4A6NA 2YG5A 4C3XA 1FECA 3CNPA 2WESA 3H8IA 5ER0A 2BK3A 3V3OA 2NPXA 3LADA 3VR9A 4Z2RA 4J34A 1NEKA 3CNDA 1D4CA 3UOZA 2Q7VA 5IQ4A 4EM4A 3BI5A 2W0HA 3P4PA 1CC2A 2WOIA 3NN6X 1FEBA 2TMDA 3EAOA 4Z44A 1O5WA 3NH3X 1IUXA 3O0HA 4BV6A 3RNMA 2C76A 1N1PA 3QVPA 2JAEA 2C3CA 1QO8A 4FK1A 4C3YA 4WX1A 1TDFA 3ICTA 1GNDA 2IIDA 1L9EA 2R0CA 2FJAA 2JKCA 1D5TA 3QFAA 3L8KA 3ALLA 1IUWA 3KPFA 2XVEA 1W4XA 2B7RA 2XLRA 4FK1C 5BUKA 1KNRA 1NHQA 4N9XA 1OJ9A 3SGLA 4H4QA 4JDRA 2GR1A 3WE0A 1LJ1A 4I59A 2GQFA 1H82A 1Q9IA 4OPLA 1VG9A 1XHCA 2BS2A 1VRQB 2YLWA 3NYCA 3BI2A 5IPYA 3GD3A 1M64A 1Y0PA 2XLUA 5FS6A 4EMIA 2YVJA 1EL8A 3GMCA 1Q1RA 3NYEA 3S61A 2IVDA 4BK2A 2WPFA 3KKJA 2C70A 3BNUA 4UDQA 5JCKA 1LQUA 3COXA 4CNKA 2V60A 4BJZA 3UP5A 1B5QA 5GRTA 3UTEA 4CCQA 4H4RA 4Z43A 2BA9A 4NEWA 5J60A 2BC1A 2R0PA 2XLTA 4A79A 1H84A 2PYXA 3LXDA 4NTEA 4A6NB 4AP3A 2XCGA 1GRBA 2APGA 5HY5A 4K2XA 3CPJG 2E1MA 2JB3A 4B68A 5C2TA 2C72A 1EL9A 2NVKX 2PHHA 4H50A 4H4PA 5EB5A 2HQMA 1ZOVA 3CGDA 4H4SA 4XXGA 4KX6A 2GQWA 4JQ9A 3ALJA 1TDKA 4H4VA 2WPEA 2EQ7A 3AYLA 1KNPA 3GMBA 1JEHA 4ZN0A 2GR3A 5HHFA 1CC6A 2XVIA 3CNSA 3CTYA 4I58A 1OJTA 2FJEA 2TPRA 2XLSA 3GRSA 3IWAA 3NTAA 1GALA 4JNQA 1E1MA 2YR4A 1K4QA 1DODA 2XFQA 1VDCA 1Y56A 2C73A 1YKJA 1ZK7A 3D1CA 4Z2UA 1GETA 2Q0LA 3CNTA 2UZZA 3DK4A 2WPCA 2C3DA 3II4A 5C3JA 3QJ4A 1IJHA 3S5WA 4EIPA 1PN0A 4EQRA 3QSEA 3DA1A 3NHOX 2CFYA 4Z24A 3UOYA 4J56A 2I0ZA 3P1WA 4NTDA 3K7MX 3AE9A 3VR8A 4Z26A 4ECHA 2YG6A 3NK1X 3NRNA 3C4AA 3F8DA 1D7YA 2YWLA 1DJNA 4DGKA 4YKFA 1CF3A 3AD9B 1BZLA 1EL5A 3LB8A 4YTPA 3IC9A 4ADWA 4H4TA 3ZYXA 1KFYA 1CHUA 1REOA 3ALMA 4B67A 1JRYA 4J36A 3AEFA 4DSGA 2BYBA 2XVHA 2YQUA 2GVCA 2BK5A 3CPIG 3QVRA 3K7TA 4A99A 4H4XA 4UDRA 1LTXR 2X8HA 3CPHG 4MJWA 1L9DA 3H8LA 1TYTA 3VRDB 1K0JA 1RP0A 4JY3A 1PXBA 1E6EA 4OPCA 4OPTA 2V3BA 1PBEA 2IVEA 1PBDA 3G5QA 4K5RA 1ZMDA 3M0OA 3ABVA 4HB9A 2VRMA 2JB2A 3AE4A 3CGBA 4J31A 4IV9A 5U25A 1GRTA 2GR0A 3AB1A 2E4GA 4O5UA 3NTDA 2V5ZA 1E7PA 1TRBA 2R4EA 3R9UA 1M6IA 1PXCA 4AOSA 5JCMA 2H88A 4NTCA 4C74A 4YXDA 2AQJA 4USRA 2WBAA 3KD9A 3UOVA 5KWFA 1N4UA 1Y56B 1UKVG 1S3BA 2BABA 4IA6A 4XWRA 4EQXA 3KA7A 3LZXA 4OPIA 1CL0A 4Z25A
chains in the Genus database with same CATH superfamily
2E5VA 4LIIA 1BKWA 2WOVA 4PABA 2OALA 3B6DA 1LPFA 1JRXA 3NLCA 1E1KA 5EBKA 1JNZA 1YQ4A 2ZZBA 4RG4A 4JY2A 1DOCA 4YSZA 3GSIA 4D03A 5BULA 1H83A 2ARDA 1TDEA 4A5LA 3F8PA 1LVLA 3JSKA 3T37A 3E1TA 2R46A 2VZ2A 1L0VA 4YSYA 1LQTA 4GRTA 2YM1A 1PJ7A 3BI4A 1D4EA 2BC0A 1GRGA 4Y4LA 4AT0A 1JOAA 2YG7A 3C96A 3CGEA 4NZHA 1PBBA 2GMHA 2YR5A 4EMJA 4AP1A 1JU2A 1IUTA 2Z5XA 3T2ZA 2GAHB 1BWCA 1PBFA 1YQZA 2WP6A 1GTHA 2YVGA 4H7UA 4O5QA 2GR2A 3LJPA 1KDGA 1GESA 5KMQA 3SFEA 4B1BA 1NHRA 1MO9A 5TR3A 1EL7A 1CJ4A 2A8XA 4UDPA 5J7XA 3CIRA 3NNEA 4USQA 3UCLA 2WETA 3C4NA 4TLZA 3HZLA 3UKQA 2WS3A 3AECA 1ZP0A 2VQBA 3AE3A 2BK4A 1DJQA 1HYUA 1NDAA 2RABA 2J3NA 2R0GA 2GH5A 3NT6A 4U8MA 3GWFA 2C66A 1MXTA 1F8SA 3I3LA 3T31A 2OAMA 2XDOA 4H4WA 2YLSA 3DJDA 2OLOA 3AYIA 4LU6A 1Z6LA 3CGCA 3QSSA 3GWDA 2QCUA 2GMJA 4B66A 3B3RA 3M12A 3GRTA 2C7GA 2QAEA 2YLXA 4GR1A 4J57A 3LZWA 4WCTA 4A7AA 1GEUA 3ICRA 4U8LA 3GYIA 2BS3A 4U8PA 4CBQA 1GV4A 3F8RA 1E39A 3ICSA 3ITJA 1D7LA 2WU2A 3DGZA 4JN9A 5JCLA 2RGOA 3ATRA 3PVCA 4BJYA 2BCGG 2V6OA 1MOKA 2YLRA 5EOWA 2VOUA 2QA1A 3BHFA 4GCMA 3UKKA 4BURA 4OCGA 4X4JA 3FMWA 5M0ZA 5CQFA 3GYJA 1CBOA 2WDQA 1ELIA 3P9UA 1H7WA 2BRAA 1JNRA 3RHAA 4IA5A 2YG4A 4U8IA 4APNA 2YLZA 1V59A 2XFNA 1F8RA 3DH9A 1B4VA 1PXAA 1ZOYA 2XVFA 3KPKA 3VRAA 1GXFA 1FL2A 3RP6A 1GRHA 1BGNA 3CN8A 3UKHA 5KRQA 4FDCB 1P2HA 1RYIA 4G73A 4LA1A 2Y6QA 5FS7A 3EPTA 2VVLA 2WP5A 3HYWA 3QFBA 3DGHA 3NGCX 4K8DA 3FPZA 5DBJA 5KOWA 2WP9A 3GDNA 4CCRA 1H7XA 5HYMA 1NHPA 3ATQA 3SXIA 1TDOA 3P4QA 3UKFA 4Z2TA 1YY5A 1P2EA 3VRBA 1CJ3A 4EIQA 3DJJA 3NK0X 2F5ZA 4BK1A 2XFUA 1BF3A 1KF6A 4UP3A 5M10A 1NHSA 2B9XA 3K7QX 3DK9A 2WU5A 3FIMB 3UKPA 3EF6A 1VQWA 4GDEA 3IHMA 4DSHA 4A9WA 2XLPA 1IUUA 2Y6RA 3LOVA 3AEAA 4OPUA 2BXSA 1XANA 3UTHA 1LV0A 2X8CA 3BHKA 4C5OA 1F3PA 4IVMB 3AE6A 1O95A 1VG0A 3P4SA 5IQ1A 2RGHA 1PJ6A 1KSUA 1N4WA 3SZ0A 2X99A 2BCPA 3AD7B 3AYJA 4U2LA 4RSLA 1ZMCA 5KOXA 4REKA 4EQWA 1GERA 5JCIA 4KPRA 3DJGX 3KVEA 4RG3A 1H86A 3H4KA 2DKIA 4HA6A 4K7ZA 4H2PA 5EB4A 1DOBA 4H2RA 2EQ9A 4PAAA 1GSNA 4Y4MA 4U8OA 1GREA 2B9WA 3ISHA 1TYPA 1H6VA 4D04A 4BK3A 4G6GA 4EQSA 1ZKQA 1N4VA 4YTMA 3ZDNA 2YVFA 2V61A 4B69A 3VQRA 4FX9A 3URHA 4ZCDA 3DK8A 2VRLA 5GSNA 2VVMA 2FJDA 3OZ2A 2C65A 4B64A 2FBWA 3REDA 4YWOA 4X9NA 1K0IA 1NG3A 3UKLA 4B63A 3P4RA 2ZBWA 2WOWA 3AE5A 3FBSA 3QSMA 3I6DA 2QA2A 1E1LA 4JNAA 2AR8A 3Q6JA 4U8KA 3NN0X 3RP7A 2BS4A 3AEBA 3HYVA 1RSGA 1NAAA 3M13A 1GRFA 1GTEA 2JB1A 3AXBA 2B9YA 5KVIA 3SQPA 4CY6A 1F6MA 2CDUA 2H89A 3UKAA 3T14A 3G5RA 2VQ7A 4GF7A 1COYA 1BGJA 3Q9TA 5FMHA 1YQ3A 1OJDA 1DOEA 3BNMA 3GDPA 1S2QA 4AOXA 4OPDA 5KMSA 1ONFA 4ICYA 3NYFA 2GEWA 2X3NA 1FOHA 2CVJA 3NG7X 2XVJA 2XFOA 3KLJA 4E0VA 3IF9A 1Q1WA 3V76A 3CNJA 1PJ5A 5U1OA 3UOXA 3FG2P 1AOGA 1QJDA 2A87A 4YSXA 2C67A 1NENA 5HXIA 2EQ8A 1GOSA 1ZDLA 3AEGA 1IUSA 1ZY8A 1GT8A 2CULA 2R4JA 3AE7A 2ACZA 2RGJA 4ZCCA 2ZZCA 1JRZA 4Y4NA 1FEAA 3NK2X 2YAUA 2FJBA 1PHHA 2R45A 3PS9A 2A89A 3RP8A 1GPEA 3AE1A 1B8SA 4GUVA 5JCNA 1DNCA 4U2SA 3SZWA 1NPXA 4AT2A 1SEZA 1F8WA 2EQ6A 2WDRA 1TDNA 4J2WA 2GF3A 4TM0A 4M52A 4YTNA 1OJAA 5BRTA 2ZZ0A 1QLBA 3GYXA 4J33A 4YSHA 3AE2A 3UTFA 2BACA 3L1RA 1E1NA 2AAQA 3AEEA 1O94A 1NG4A 4IVOB 2GV8A 2GRTA 2Z5YA 4P9SA 2C75A 4OPGA 5FS8A 3SY4A 2X50A 1PDHA 1D4DA 3NIXA 3AEDA 4X9MA 2R9ZA 4H4YA 3DJEA 5KXJA 2YR6A 1XPQA 5BVAA 3K30A 2Q0KA 4B65A 3AE8A 2XYOA 2YM2A 1K0LA 4EMWA 4U2TA 3SFDA 3UTGA 1DXLA 2XFPA 4XWZA 3AWIA 3OC4A 5KNLA 4EM3A 4TM4A 2BXRA 4NEVA 1CC4A 3UP4A 5LV9A 4OVIA 1S2YA 3ADAB 1PS9A 2GAGB 4H2NA 4U8NA 2GB0A 4GDPA 4II3A 4CRTA 3NKSA 1H81A 3PO7A 2JBVA 5FS9A 3SZCA 3SX6A 4G6HA 4DNAA 2B7SA 1IUVA 1EBDA 1X31B 1KSSA 2X8GA 3GD4A 3KU9A 1PBCA 5U63A 5L46A 3EANA 4TLXA 3V3NA 3D8XA 4CNJA 2OA1A 4TM1A 2C64A 4U8JA 4A65A 4CY8A 4K22A 2WHDA 2OLNA 2VVLG 1L9CA 3AD8B 4H4ZA 4YKGA 1ZX9A 5CKUA 2JK6A 3T2YA 1OJCA 2WDVA 4YT0A 3SM8A 2V3AA 1S3EA 1XDIA 2YLTA 2YG3A 2WEUA 5KMPA 2DKHA 2O9ZA 2Q6UA 4H2QA 4H4UA 3IHGA 5KVHA 1CJCA 1CJ2A 1B37A 2WQYA 1FCDA 4K5SA 3G5SA 4TM3A 4C77A 2B76A 1GRAA 3DMEA 4A6NA 2YG5A 4C3XA 1FECA 3CNPA 2WESA 3H8IA 5ER0A 2BK3A 3V3OA 2NPXA 3LADA 3VR9A 4Z2RA 4J34A 1NEKA 3CNDA 1D4CA 3UOZA 2Q7VA 5IQ4A 3SZFA 4EM4A 3BI5A 2W0HA 3P4PA 1CC2A 2WOIA 3NN6X 1FEBA 2TMDA 3EAOA 4Z44A 1O5WA 3NH3X 1IUXA 3O0HA 4BV6A 3RNMA 2C76A 1N1PA 3QVPA 2JAEA 2C3CA 1QO8A 4GAVA 4FK1A 4C3YA 4WX1A 1TDFA 3ICTA 1GNDA 2IIDA 1L9EA 2R0CA 2FJAA 2JKCA 1D5TA 2C4CA 3QFAA 3L8KA 3ALLA 1IUWA 3KPFA 2XVEA 1W4XA 2B7RA 2XLRA 4FK1C 5KMRA 5BUKA 1KNRA 1NHQA 4N9XA 1OJ9A 3WE0A 4H4QA 4JDRA 2GR1A 3SGLA 1LJ1A 4I59A 2GQFA 1H82A 4NNJA 1Q9IA 4OPLA 1VG9A 1XHCA 2BS2A 1VRQB 2YLWA 3NYCA 3BI2A 5IPYA 3GD3A 1M64A 3T2KA 1Y0PA 2XLUA 4G74A 5FS6A 4EMIA 2YVJA 1EL8A 3GMCA 1Q1RA 3CMMA 3NYEA 3S61A 3SYIA 2IVDA 4BK2A 2WPFA 3KKJA 2C70A 3BNUA 4UDQA 5JCKA 1LQUA 3COXA 4CNKA 2V60A 4BJZA 3UP5A 1B5QA 5GRTA 3UTEA 4CCQA 4H4RA 4Z43A 2BA9A 4NEWA 4G9KA 2BC1A 5J60A 2R0PA 2XLTA 4A79A 1H84A 2PYXA 3LXDA 4NTEA 4A6NB 4AP3A 2XCGA 1GRBA 2APGA 5HY5A 2BRYA 4K2XA 3CPJG 2E1MA 2JB3A 4B68A 5C2TA 2C72A 1EL9A 2NVKX 2PHHA 4H50A 4H4PA 5EB5A 2HQMA 1ZOVA 3CGDA 4H4SA 4XXGA 4KX6A 2GQWA 4JQ9A 3ALJA 1TDKA 4H4VA 2WPEA 2EQ7A 3AYLA 1KNPA 3GMBA 1JEHA 4ZN0A 2GR3A 5HHFA 1CC6A 2XVIA 3CNSA 3CTYA 4I58A 1OJTA 2FJEA 2TPRA 2XLSA 3GRSA 3IWAA 3NTAA 1GALA 4JNQA 4GAPA 1E1MA 2YR4A 1K4QA 1DODA 2XFQA 1VDCA 1Y56A 2C73A 1YKJA 1ZK7A 3D1CA 4Z2UA 1GETA 2Q0LA 3CNTA 2UZZA 3DK4A 2WPCA 2C3DA 3II4A 5C3JA 3QJ4A 1IJHA 3S5WA 4EIPA 1PN0A 4EQRA 3QSEA 3DA1A 3NHOX 2CFYA 4NWZA 4Z24A 3UOYA 4J56A 2I0ZA 3P1WA 4NTDA 3K7MX 3AE9A 3VR8A 4Z26A 4ECHA 2YG6A 3NK1X 3NRNA 3C4AA 3F8DA 1D7YA 2YWLA 1DJNA 4DGKA 4YKFA 1CF3A 3AD9B 1BZLA 1EL5A 3LB8A 4YTPA 3IC9A 4ADWA 4H4TA 3ZYXA 1KFYA 1CHUA 1REOA 3ALMA 4B67A 1JRYA 4J36A 3AEFA 4DSGA 2BYBA 2XVHA 2YQUA 2GVCA 2BK5A 3CPIG 3QVRA 3K7TA 4A99A 4H4XA 4UDRA 1LTXR 2X8HA 3CPHG 4MJWA 4II2A 1L9DA 3H8LA 1TYTA 3VRDB 1K0JA 1RP0A 4JY3A 1PXBA 1E6EA 4OPCA 4OPTA 2V3BA 1PBEA 2IVEA 1PBDA 3G5QA 4K5RA 1ZMDA 3T0KA 3M0OA 3ABVA 4HB9A 2VRMA 2JB2A 4IV9A 3AE4A 3CGBA 4J31A 5U25A 1GRTA 2GR0A 3AB1A 2E4GA 4O5UA 3NTDA 2V5ZA 1E7PA 1TRBA 2R4EA 3R9UA 1M6IA 1PXCA 4AOSA 5JCMA 2H88A 3HYXA 4NTCA 4C74A 4YXDA 2AQJA 4USRA 2WBAA 3KD9A 3UOVA 5KWFA 1N4UA 1Y56B 1UKVG 1S3BA 2BABA 4IA6A 4XWRA 4EQXA 3KA7A 3LZXA 4OPIA 1CL0A 4Z25A
chains in the Genus database with same CATH topology
2E5VA 4LIIA 1BKWA 2WOVA 4PABA 2OALA 3B6DA 1LPFA 1JRXA 3NLCA 1E1KA 5EBKA 1JNZA 1YQ4A 2ZZBA 4RG4A 4JY2A 1DOCA 4YSZA 3GSIA 4D03A 5BULA 1H83A 2ARDA 1TDEA 4A5LA 3F8PA 1LVLA 3JSKA 3T37A 3E1TA 2R46A 2VZ2A 1L0VA 4YSYA 1LQTA 4GRTA 2YM1A 1PJ7A 3BI4A 1D4EA 2BC0A 1GRGA 4Y4LA 4AT0A 1JOAA 2YG7A 3C96A 3CGEA 4NZHA 1PBBA 2GMHA 2YR5A 4EMJA 4AP1A 1JU2A 1IUTA 2Z5XA 3T2ZA 2GAHB 1BWCA 1PBFA 1YQZA 2WP6A 1GTHA 2YVGA 4H7UA 4O5QA 2GR2A 3LJPA 1KDGA 1GESA 5KMQA 3SFEA 4B1BA 1NHRA 1MO9A 5TR3A 1EL7A 1CJ4A 2A8XA 4UDPA 5J7XA 3CIRA 3NNEA 4USQA 3UCLA 2WETA 3C4NA 4TLZA 3HZLA 3UKQA 2WS3A 3AECA 1ZP0A 2VQBA 3AE3A 2BK4A 1DJQA 1HYUA 1NDAA 2RABA 2J3NA 2R0GA 2GH5A 3NT6A 4U8MA 3GWFA 2C66A 1MXTA 1F8SA 3I3LA 3T31A 2OAMA 2XDOA 4H4WA 2YLSA 3DJDA 2OLOA 3AYIA 4LU6A 1Z6LA 3CGCA 3QSSA 3GWDA 2QCUA 2GMJA 4B66A 3B3RA 3M12A 3GRTA 2C7GA 2QAEA 2YLXA 4GR1A 4J57A 3LZWA 4WCTA 4A7AA 1GEUA 3ICRA 4U8LA 3GYIA 2BS3A 4U8PA 4CBQA 1GV4A 3F8RA 1E39A 3ICSA 3ITJA 1D7LA 2WU2A 3DGZA 4JN9A 5JCLA 2RGOA 3ATRA 3PVCA 4BJYA 2BCGG 2V6OA 1MOKA 2YLRA 5EOWA 2VOUA 2QA1A 3BHFA 4GCMA 3UKKA 4BURA 4OCGA 4X4JA 3FMWA 5M0ZA 5CQFA 3GYJA 1CBOA 2WDQA 1ELIA 3P9UA 1H7WA 2BRAA 1JNRA 3RHAA 4IA5A 2YG4A 4U8IA 4APNA 2YLZA 1V59A 2XFNA 1F8RA 3DH9A 1B4VA 1PXAA 1ZOYA 2XVFA 3KPKA 3VRAA 1GXFA 1FL2A 3RP6A 1GRHA 1BGNA 3CN8A 3UKHA 5KRQA 4FDCB 1P2HA 1RYIA 4G73A 4LA1A 2Y6QA 5FS7A 3EPTA 2VVLA 2WP5A 3HYWA 3QFBA 3DGHA 3NGCX 4K8DA 3FPZA 5DBJA 5KOWA 2WP9A 3GDNA 4CCRA 1H7XA 5HYMA 1NHPA 3ATQA 3SXIA 1TDOA 3P4QA 3UKFA 4Z2TA 1P2EA 1YY5A 3VRBA 1CJ3A 4EIQA 3DJJA 3NK0X 2F5ZA 4BK1A 2XFUA 1BF3A 1KF6A 4UP3A 5M10A 2B9XA 1NHSA 3K7QX 3DK9A 2WU5A 3FIMB 3UKPA 3EF6A 1VQWA 4GDEA 3IHMA 4DSHA 4A9WA 2XLPA 1IUUA 2Y6RA 3LOVA 3AEAA 4OPUA 2BXSA 1XANA 3UTHA 1LV0A 2X8CA 3BHKA 4C5OA 1F3PA 4IVMB 3AE6A 1O95A 1VG0A 3P4SA 5IQ1A 2RGHA 1PJ6A 1KSUA 1N4WA 3SZ0A 2X99A 2BCPA 3AD7B 3AYJA 4U2LA 4RSLA 1ZMCA 5KOXA 4REKA 4EQWA 1GERA 5JCIA 4KPRA 3DJGX 3KVEA 4RG3A 1H86A 3H4KA 2DKIA 4HA6A 4K7ZA 4H2PA 5EB4A 1DOBA 4H2RA 2EQ9A 4PAAA 1GSNA 4Y4MA 4U8OA 1GREA 2B9WA 3ISHA 1TYPA 1H6VA 4D04A 4BK3A 4G6GA 4EQSA 1ZKQA 1N4VA 4YTMA 3ZDNA 2YVFA 2V61A 4B69A 3VQRA 4FX9A 3URHA 4ZCDA 3DK8A 2VRLA 5GSNA 2VVMA 2FJDA 3OZ2A 2C65A 4B64A 2FBWA 3REDA 4YWOA 4X9NA 1K0IA 1NG3A 3UKLA 4B63A 3P4RA 2ZBWA 2WOWA 3AE5A 3FBSA 3QSMA 3I6DA 2QA2A 1E1LA 4JNAA 2AR8A 3Q6JA 4U8KA 3NN0X 3RP7A 2BS4A 3AEBA 3HYVA 1RSGA 1NAAA 3M13A 1GRFA 1GTEA 2JB1A 3AXBA 2B9YA 5KVIA 3SQPA 4CY6A 1F6MA 2CDUA 2H89A 3UKAA 3T14A 3G5RA 2VQ7A 4GF7A 1COYA 1BGJA 3Q9TA 5FMHA 1YQ3A 1OJDA 1DOEA 3BNMA 3GDPA 1S2QA 4AOXA 4OPDA 5KMSA 1ONFA 4ICYA 3NYFA 2GEWA 2X3NA 1FOHA 2CVJA 3NG7X 2XVJA 2XFOA 3KLJA 4E0VA 3IF9A 1Q1WA 3V76A 3CNJA 1PJ5A 5U1OA 3UOXA 3FG2P 1AOGA 1QJDA 2A87A 4YSXA 2C67A 1NENA 5HXIA 2EQ8A 1GOSA 1ZDLA 3AEGA 1IUSA 1ZY8A 1GT8A 2CULA 2R4JA 3AE7A 2ACZA 2RGJA 4ZCCA 2ZZCA 1JRZA 4Y4NA 1FEAA 3NK2X 2YAUA 2FJBA 1PHHA 2R45A 3PS9A 2A89A 3RP8A 1GPEA 3AE1A 1B8SA 4GUVA 5JCNA 1DNCA 4U2SA 3SZWA 1NPXA 4AT2A 1SEZA 1F8WA 2EQ6A 2WDRA 1TDNA 4J2WA 2GF3A 4TM0A 4M52A 4YTNA 1OJAA 5BRTA 2ZZ0A 1QLBA 3GYXA 4J33A 4YSHA 3AE2A 3UTFA 2BACA 3L1RA 1E1NA 2AAQA 3AEEA 1O94A 1NG4A 4IVOB 2GV8A 2GRTA 2Z5YA 4P9SA 2C75A 4OPGA 5FS8A 3SY4A 2X50A 1PDHA 1D4DA 3NIXA 3AEDA 4X9MA 2R9ZA 4H4YA 3DJEA 5KXJA 2YR6A 1XPQA 5BVAA 3K30A 2Q0KA 4B65A 3AE8A 2XYOA 2YM2A 1K0LA 4EMWA 4U2TA 3SFDA 3UTGA 1DXLA 2XFPA 4XWZA 3AWIA 3OC4A 5KNLA 4EM3A 4TM4A 2BXRA 4NEVA 1CC4A 3UP4A 5LV9A 4OVIA 1S2YA 3ADAB 1PS9A 2GAGB 4H2NA 4U8NA 2GB0A 4GDPA 4II3A 4CRTA 3NKSA 1H81A 3PO7A 2JBVA 5FS9A 3SZCA 3SX6A 4G6HA 4DNAA 2B7SA 1IUVA 1EBDA 1X31B 1KSSA 2X8GA 3GD4A 3KU9A 1PBCA 5U63A 5L46A 3EANA 4TLXA 3V3NA 3D8XA 4CNJA 2OA1A 4TM1A 2C64A 4U8JA 4A65A 4CY8A 4K22A 2WHDA 2OLNA 2VVLG 1L9CA 3AD8B 4H4ZA 4YKGA 1ZX9A 5CKUA 2JK6A 3T2YA 1OJCA 2WDVA 4YT0A 3SM8A 2V3AA 1S3EA 1XDIA 2YLTA 2YG3A 2WEUA 5KMPA 2DKHA 2O9ZA 2Q6UA 4H2QA 4H4UA 3IHGA 5KVHA 1CJCA 1CJ2A 1B37A 2WQYA 1FCDA 4K5SA 3G5SA 4TM3A 4C77A 2B76A 1GRAA 3DMEA 4A6NA 2YG5A 4C3XA 1FECA 3CNPA 2WESA 3H8IA 5ER0A 2BK3A 3V3OA 2NPXA 3LADA 3VR9A 4Z2RA 4J34A 1NEKA 3CNDA 1D4CA 3UOZA 2Q7VA 5IQ4A 3SZFA 4EM4A 3BI5A 2W0HA 3P4PA 1CC2A 2WOIA 3NN6X 1FEBA 2TMDA 3EAOA 4Z44A 1O5WA 3NH3X 1IUXA 3O0HA 4BV6A 3RNMA 2C76A 1N1PA 3QVPA 2JAEA 2C3CA 1QO8A 4GAVA 4FK1A 4C3YA 4WX1A 1TDFA 3ICTA 1GNDA 2IIDA 1L9EA 2R0CA 2FJAA 2JKCA 1D5TA 2C4CA 3QFAA 3L8KA 3ALLA 1IUWA 3KPFA 2XVEA 1W4XA 2B7RA 2XLRA 4FK1C 5KMRA 5BUKA 1KNRA 1NHQA 4N9XA 1OJ9A 3SGLA 4H4QA 4JDRA 2GR1A 3WE0A 1LJ1A 4I59A 2GQFA 1H82A 4NNJA 1Q9IA 4OPLA 1VG9A 1XHCA 2BS2A 1VRQB 2YLWA 3NYCA 3BI2A 5IPYA 3GD3A 1M64A 3T2KA 1Y0PA 2XLUA 4G74A 5FS6A 4EMIA 2YVJA 1EL8A 3GMCA 1Q1RA 3CMMA 3NYEA 3S61A 3SYIA 2IVDA 4BK2A 2WPFA 3KKJA 2C70A 3BNUA 4UDQA 5JCKA 1LQUA 3COXA 4CNKA 2V60A 4BJZA 3UP5A 1B5QA 5GRTA 3UTEA 4CCQA 4H4RA 4Z43A 2BA9A 4NEWA 4G9KA 2BC1A 5J60A 2R0PA 2XLTA 4A79A 1H84A 2PYXA 3LXDA 4NTEA 4A6NB 4AP3A 2XCGA 1GRBA 2APGA 5HY5A 2BRYA 4K2XA 3CPJG 2E1MA 2JB3A 4B68A 5C2TA 2C72A 1EL9A 2NVKX 2PHHA 4H50A 4H4PA 5EB5A 2HQMA 1ZOVA 3CGDA 4H4SA 4XXGA 4KX6A 2GQWA 4JQ9A 3ALJA 1TDKA 4H4VA 2WPEA 2EQ7A 3AYLA 1KNPA 3GMBA 1JEHA 4ZN0A 2GR3A 5HHFA 1CC6A 2XVIA 3CNSA 3CTYA 4I58A 1OJTA 2FJEA 2TPRA 2XLSA 3GRSA 3IWAA 3NTAA 1GALA 4JNQA 4GAPA 1E1MA 2YR4A 1K4QA 1DODA 2XFQA 1VDCA 1Y56A 2C73A 1YKJA 1ZK7A 3D1CA 4Z2UA 1GETA 2Q0LA 3CNTA 2UZZA 3DK4A 2WPCA 2C3DA 3II4A 5C3JA 3QJ4A 1IJHA 3S5WA 4EIPA 1PN0A 4EQRA 3QSEA 3DA1A 3NHOX 2CFYA 4NWZA 4Z24A 3UOYA 4J56A 2I0ZA 3P1WA 4NTDA 3K7MX 3AE9A 3VR8A 4Z26A 4ECHA 2YG6A 3NK1X 3NRNA 3C4AA 3F8DA 1D7YA 2YWLA 1DJNA 4DGKA 4YKFA 1CF3A 3AD9B 1BZLA 1EL5A 3LB8A 4YTPA 3IC9A 4ADWA 4H4TA 3ZYXA 1KFYA 1CHUA 1REOA 3ALMA 4B67A 1JRYA 4J36A 3AEFA 4DSGA 2BYBA 2XVHA 2YQUA 2GVCA 2BK5A 3CPIG 3QVRA 3K7TA 4A99A 4H4XA 4UDRA 1LTXR 2X8HA 3CPHG 4MJWA 4II2A 1L9DA 3H8LA 1TYTA 3VRDB 1K0JA 1RP0A 4JY3A 1PXBA 1E6EA 4OPCA 4OPTA 2V3BA 1PBEA 2IVEA 1PBDA 3G5QA 4K5RA 1ZMDA 3T0KA 3M0OA 3ABVA 4HB9A 2VRMA 2JB2A 3AE4A 3CGBA 4J31A 4IV9A 5U25A 1GRTA 2GR0A 3AB1A 2E4GA 4O5UA 3NTDA 2V5ZA 1E7PA 1TRBA 2R4EA 3R9UA 1M6IA 1PXCA 4AOSA 5JCMA 2H88A 3HYXA 4NTCA 4C74A 4YXDA 2AQJA 4USRA 2WBAA 3KD9A 3UOVA 5KWFA 1N4UA 1Y56B 1UKVG 1S3BA 2BABA 4IA6A 4XWRA 4EQXA 3KA7A 3LZXA 4OPIA 1CL0A 4Z25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E5V A;  4LII A;  1BKW A;  2WOV A;  4PAB A;  2OAL A;  3B6D A;  1LPF A;  1JRX A;  3NLC A;  1E1K A;  5EBK A;  1JNZ A;  1YQ4 A;  2ZZB A;  4RG4 A;  4JY2 A;  1DOC A;  4YSZ A;  3GSI A;  4D03 A;  5BUL A;  1H83 A;  2ARD A;  1TDE A;  4A5L A;  3F8P A;  1LVL A;  3JSK A;  3T37 A;  3E1T A;  2R46 A;  2VZ2 A;  1L0V A;  4YSY A;  1LQT A;  4GRT A;  2YM1 A;  1PJ7 A;  3BI4 A;  1D4E A;  2BC0 A;  1GRG A;  4Y4L A;  4AT0 A;  1JOA A;  2YG7 A;  3C96 A;  3CGE A;  4NZH A;  1PBB A;  2GMH A;  2YR5 A;  4EMJ A;  4AP1 A;  1JU2 A;  1IUT A;  2Z5X A;  2GAH B;  1BWC A;  1PBF A;  1YQZ A;  2WP6 A;  1GTH A;  2YVG A;  4H7U A;  4O5Q A;  2GR2 A;  3LJP A;  1KDG A;  1GES A;  3SFE A;  4B1B A;  1NHR A;  1MO9 A;  5TR3 A;  1EL7 A;  1CJ4 A;  2A8X A;  4UDP A;  5J7X A;  3CIR A;  3NNE A;  4USQ A;  3UCL A;  2WET A;  3C4N A;  4TLZ A;  3HZL A;  3UKQ A;  2WS3 A;  3AEC A;  1ZP0 A;  2VQB A;  3AE3 A;  2BK4 A;  1DJQ A;  1HYU A;  1NDA A;  2RAB A;  2J3N A;  2R0G A;  2GH5 A;  3NT6 A;  4U8M A;  3GWF A;  2C66 A;  1MXT A;  1F8S A;  3I3L A;  2OAM A;  2XDO A;  4H4W A;  2YLS A;  3DJD A;  2OLO A;  3AYI A;  4LU6 A;  1Z6L A;  3CGC A;  3QSS A;  3GWD A;  2QCU A;  2GMJ A;  4B66 A;  3B3R A;  3M12 A;  3GRT A;  2C7G A;  2QAE A;  2YLX A;  4GR1 A;  4J57 A;  3LZW A;  4WCT A;  4A7A A;  1GEU A;  3ICR A;  4U8L A;  3GYI A;  2BS3 A;  4U8P A;  4CBQ A;  1GV4 A;  3F8R A;  1E39 A;  3ICS A;  3ITJ A;  1D7L A;  2WU2 A;  3DGZ A;  4JN9 A;  5JCL A;  2RGO A;  3ATR A;  3PVC A;  4BJY A;  2BCG G;  2V6O A;  1MOK A;  2YLR A;  5EOW A;  2VOU A;  2QA1 A;  3BHF A;  4GCM A;  3UKK A;  4BUR A;  4OCG A;  4X4J A;  3FMW A;  5M0Z A;  5CQF A;  3GYJ A;  1CBO A;  2WDQ A;  1ELI A;  3P9U A;  1H7W A;  3RHA A;  1JNR A;  4APN A;  4IA5 A;  2YG4 A;  4U8I A;  2YLZ A;  1V59 A;  2XFN A;  1F8R A;  3DH9 A;  1B4V A;  1PXA A;  1ZOY A;  2XVF A;  3VRA A;  1GXF A;  1FL2 A;  3RP6 A;  1GRH A;  1BGN A;  3CN8 A;  3UKH A;  5KRQ A;  4FDC B;  1P2H A;  1RYI A;  4LA1 A;  2Y6Q A;  5FS7 A;  3EPT A;  2VVL A;  2WP5 A;  3QFB A;  5KOW A;  3DGH A;  3NGC X;  4K8D A;  3FPZ A;  5DBJ A;  2WP9 A;  3GDN A;  4CCR A;  1H7X A;  5HYM A;  1NHP A;  3ATQ A;  1TDO A;  3P4Q A;  3UKF A;  4Z2T A;  1P2E A;  1YY5 A;  3VRB A;  1CJ3 A;  4EIQ A;  3DJJ A;  3NK0 X;  2F5Z A;  4BK1 A;  2XFU A;  1BF3 A;  1KF6 A;  4UP3 A;  5M10 A;  2B9X A;  1NHS A;  3K7Q X;  3DK9 A;  2WU5 A;  3FIM B;  3UKP A;  3EF6 A;  1VQW A;  4GDE A;  3IHM A;  4DSH A;  4A9W A;  2XLP A;  1IUU A;  2Y6R A;  3LOV A;  3AEA A;  4OPU A;  2BXS A;  1XAN A;  3UTH A;  1LV0 A;  2X8C A;  3BHK A;  4C5O A;  1F3P A;  4IVM B;  3AE6 A;  1O95 A;  1VG0 A;  3P4S A;  5IQ1 A;  2RGH A;  1PJ6 A;  1KSU A;  1N4W A;  2X99 A;  2BCP A;  3AD7 B;  3AYJ A;  4U2L A;  4RSL A;  1ZMC A;  5KOX A;  4REK A;  4EQW A;  1GER A;  5JCI A;  4KPR A;  3DJG X;  3KVE A;  4RG3 A;  1H86 A;  3H4K A;  2DKI A;  4HA6 A;  4K7Z A;  4H2P A;  5EB4 A;  1DOB A;  4H2R A;  2EQ9 A;  4PAA A;  1GSN A;  4Y4M A;  4U8O A;  1GRE A;  2B9W A;  3ISH A;  1TYP A;  1H6V A;  4D04 A;  4BK3 A;  4EQS A;  1ZKQ A;  1N4V A;  4YTM A;  3ZDN A;  2YVF A;  2V61 A;  4B69 A;  3VQR A;  4FX9 A;  3URH A;  4ZCD A;  3DK8 A;  2VRL A;  5GSN A;  2VVM A;  2FJD A;  3OZ2 A;  2C65 A;  4B64 A;  2FBW A;  3RED A;  4YWO A;  4X9N A;  1K0I A;  1NG3 A;  3UKL A;  4B63 A;  3P4R A;  2ZBW A;  2WOW A;  3AE5 A;  3FBS A;  3QSM A;  3I6D A;  2QA2 A;  1E1L A;  4JNA A;  2AR8 A;  3Q6J A;  4U8K A;  3NN0 X;  3RP7 A;  2BS4 A;  3AEB A;  1RSG A;  1NAA A;  3M13 A;  1GRF A;  1GTE A;  2JB1 A;  3AXB A;  2B9Y A;  5KVI A;  3SQP A;  4CY6 A;  1F6M A;  2CDU A;  2H89 A;  3UKA A;  3G5R A;  2VQ7 A;  4GF7 A;  1COY A;  1BGJ A;  3Q9T A;  5FMH A;  1YQ3 A;  1OJD A;  1DOE A;  3BNM A;  3GDP A;  1S2Q A;  4AOX A;  4OPD A;  1ONF A;  4ICY A;  3NYF A;  2GEW A;  2X3N A;  1FOH A;  2CVJ A;  3NG7 X;  2XVJ A;  2XFO A;  3KLJ A;  4E0V A;  3IF9 A;  1Q1W A;  3V76 A;  3CNJ A;  1PJ5 A;  5U1O A;  3UOX A;  3FG2 P;  1AOG A;  1QJD A;  2A87 A;  4YSX A;  2C67 A;  1NEN A;  5HXI A;  2EQ8 A;  1GOS A;  1ZDL A;  3AEG A;  1IUS A;  1ZY8 A;  1GT8 A;  2CUL A;  2R4J A;  3AE7 A;  2ACZ A;  2RGJ A;  4ZCC A;  2ZZC A;  1JRZ A;  4Y4N A;  1FEA A;  3NK2 X;  2YAU A;  2FJB A;  1PHH A;  2R45 A;  3PS9 A;  2A89 A;  3RP8 A;  1GPE A;  3AE1 A;  1B8S A;  4GUV A;  5JCN A;  1DNC A;  4U2S A;  1NPX A;  4AT2 A;  1SEZ A;  1F8W A;  2EQ6 A;  2WDR A;  1TDN A;  4J2W A;  2GF3 A;  4TM0 A;  4M52 A;  4YTN A;  1OJA A;  5BRT A;  2ZZ0 A;  1QLB A;  4J33 A;  4YSH A;  3AE2 A;  3UTF A;  2BAC A;  3L1R A;  1E1N A;  2AAQ A;  3AEE A;  1O94 A;  1NG4 A;  4IVO B;  2GV8 A;  2GRT A;  2Z5Y A;  4P9S A;  2C75 A;  4OPG A;  5FS8 A;  2X50 A;  1PDH A;  1D4D A;  3NIX A;  3AED A;  4X9M A;  2R9Z A;  4H4Y A;  3DJE A;  5KXJ A;  2YR6 A;  1XPQ A;  5BVA A;  3K30 A;  2Q0K A;  4B65 A;  3AE8 A;  2XYO A;  2YM2 A;  1K0L A;  4EMW A;  4U2T A;  3SFD A;  3UTG A;  1DXL A;  2XFP A;  4XWZ A;  3AWI A;  3OC4 A;  4EM3 A;  4TM4 A;  2BXR A;  4NEV A;  1CC4 A;  3UP4 A;  5LV9 A;  4OVI A;  1S2Y A;  3ADA B;  1PS9 A;  2GAG B;  4H2N A;  4U8N A;  2GB0 A;  4GDP A;  4CRT A;  3NKS A;  1H81 A;  3PO7 A;  2JBV A;  5FS9 A;  4DNA A;  2B7S A;  1IUV A;  1EBD A;  1X31 B;  1KSS A;  2X8G A;  3GD4 A;  3KU9 A;  1PBC A;  5U63 A;  5L46 A;  3EAN A;  4TLX A;  3V3N A;  3D8X A;  4CNJ A;  2OA1 A;  4TM1 A;  2C64 A;  4U8J A;  4A65 A;  4CY8 A;  4K22 A;  2WHD A;  2OLN A;  2VVL G;  1L9C A;  3AD8 B;  4H4Z A;  4YKG A;  1ZX9 A;  5CKU A;  2JK6 A;  1OJC A;  2WDV A;  4YT0 A;  3SM8 A;  2V3A A;  1S3E A;  1XDI A;  2YLT A;  2YG3 A;  2WEU A;  2DKH A;  2O9Z A;  2Q6U A;  4H2Q A;  4H4U A;  3IHG A;  5KVH A;  1CJC A;  1CJ2 A;  1B37 A;  2WQY A;  1FCD A;  4K5S A;  3G5S A;  4TM3 A;  4C77 A;  2B76 A;  1GRA A;  3DME A;  4A6N A;  2YG5 A;  4C3X A;  1FEC A;  3CNP A;  2WES A;  3H8I A;  5ER0 A;  2BK3 A;  3V3O A;  2NPX A;  3LAD A;  3VR9 A;  4Z2R A;  4J34 A;  1NEK A;  3CND A;  1D4C A;  3UOZ A;  2Q7V A;  5IQ4 A;  4EM4 A;  3BI5 A;  2W0H A;  3P4P A;  1CC2 A;  2WOI A;  3NN6 X;  1FEB A;  2TMD A;  3EAO A;  4Z44 A;  1O5W A;  3NH3 X;  1IUX A;  3O0H A;  4BV6 A;  3RNM A;  2C76 A;  1N1P A;  3QVP A;  2JAE A;  2C3C A;  1QO8 A;  4FK1 A;  4C3Y A;  4WX1 A;  1TDF A;  3ICT A;  1GND A;  2IID A;  1L9E A;  2R0C A;  2FJA A;  2JKC A;  1D5T A;  3QFA A;  3L8K A;  3ALL A;  1IUW A;  3KPF A;  2XVE A;  1W4X A;  2B7R A;  2XLR A;  4FK1 C;  5BUK A;  1KNR A;  1NHQ A;  4N9X A;  1OJ9 A;  3SGL A;  4H4Q A;  4JDR A;  2GR1 A;  3WE0 A;  1LJ1 A;  4I59 A;  2GQF A;  1H82 A;  1Q9I A;  4OPL A;  1VG9 A;  1XHC A;  2BS2 A;  1VRQ B;  2YLW A;  3NYC A;  3BI2 A;  5IPY A;  3GD3 A;  1M64 A;  1Y0P A;  2XLU A;  5FS6 A;  4EMI A;  2YVJ A;  1EL8 A;  3GMC A;  1Q1R A;  3NYE A;  3S61 A;  2IVD A;  4BK2 A;  2WPF A;  3KKJ A;  2C70 A;  3BNU A;  4UDQ A;  5JCK A;  1LQU A;  3COX A;  4CNK A;  2V60 A;  4BJZ A;  3UP5 A;  1B5Q A;  5GRT A;  3UTE A;  4CCQ A;  4H4R A;  4Z43 A;  2BA9 A;  4NEW A;  5J60 A;  2BC1 A;  2R0P A;  2XLT A;  4A79 A;  1H84 A;  2PYX A;  3LXD A;  4NTE A;  4A6N B;  4AP3 A;  2XCG A;  1GRB A;  2APG A;  5HY5 A;  4K2X A;  3CPJ G;  2E1M A;  2JB3 A;  4B68 A;  5C2T A;  2C72 A;  1EL9 A;  2NVK X;  2PHH A;  4H50 A;  4H4P A;  5EB5 A;  2HQM A;  1ZOV A;  3CGD A;  4H4S A;  4XXG A;  4KX6 A;  2GQW A;  4JQ9 A;  3ALJ A;  1TDK A;  4H4V A;  2WPE A;  2EQ7 A;  3AYL A;  1KNP A;  3GMB A;  1JEH A;  4ZN0 A;  2GR3 A;  5HHF A;  1CC6 A;  2XVI A;  3CNS A;  3CTY A;  4I58 A;  1OJT A;  2FJE A;  2TPR A;  2XLS A;  3GRS A;  3IWA A;  3NTA A;  1GAL A;  4JNQ A;  1E1M A;  2YR4 A;  1K4Q A;  1DOD A;  2XFQ A;  1VDC A;  1Y56 A;  2C73 A;  1YKJ A;  1ZK7 A;  3D1C A;  4Z2U A;  1GET A;  2Q0L A;  3CNT A;  2UZZ A;  3DK4 A;  2WPC A;  2C3D A;  3II4 A;  5C3J A;  3QJ4 A;  1IJH A;  3S5W A;  4EIP A;  1PN0 A;  4EQR A;  3QSE A;  3DA1 A;  3NHO X;  2CFY A;  4Z24 A;  3UOY A;  4J56 A;  2I0Z A;  3P1W A;  4NTD A;  3K7M X;  3AE9 A;  3VR8 A;  4Z26 A;  4ECH A;  2YG6 A;  3NK1 X;  3NRN A;  3C4A A;  3F8D A;  1D7Y A;  2YWL A;  1DJN A;  4DGK A;  4YKF A;  1CF3 A;  3AD9 B;  1BZL A;  1EL5 A;  3LB8 A;  4YTP A;  3IC9 A;  4ADW A;  4H4T A;  3ZYX A;  1KFY A;  1CHU A;  1REO A;  3ALM A;  4B67 A;  1JRY A;  4J36 A;  3AEF A;  4DSG A;  2BYB A;  2XVH A;  2YQU A;  2GVC A;  2BK5 A;  3CPI G;  3QVR A;  3K7T A;  4A99 A;  4H4X A;  4UDR A;  1LTX R;  2X8H A;  3CPH G;  4MJW A;  1L9D A;  3H8L A;  1TYT A;  3VRD B;  1K0J A;  1RP0 A;  4JY3 A;  1PXB A;  1E6E A;  4OPC A;  4OPT A;  2V3B A;  1PBE A;  2IVE A;  1PBD A;  3G5Q A;  4K5R A;  1ZMD A;  3M0O A;  3ABV A;  4HB9 A;  2VRM A;  2JB2 A;  3AE4 A;  3CGB A;  4J31 A;  4IV9 A;  5U25 A;  1GRT A;  2GR0 A;  3AB1 A;  2E4G A;  4O5U A;  3NTD A;  2V5Z A;  1E7P A;  1TRB A;  2R4E A;  3R9U A;  1M6I A;  1PXC A;  4AOS A;  5JCM A;  2H88 A;  4NTC A;  4C74 A;  4YXD A;  2AQJ A;  4USR A;  2WBA A;  3KD9 A;  3UOV A;  5KWF A;  1N4U A;  1Y56 B;  1UKV G;  1S3B A;  2BAB A;  4IA6 A;  4XWR A;  4EQX A;  3KA7 A;  3LZX A;  4OPI A;  1CL0 A;  4Z25 A; 
#chains in the Genus database with same CATH topology
 2E5V A;  4LII A;  1BKW A;  2WOV A;  4PAB A;  2OAL A;  3B6D A;  1LPF A;  1JRX A;  3NLC A;  1E1K A;  5EBK A;  1JNZ A;  1YQ4 A;  2ZZB A;  4RG4 A;  4JY2 A;  1DOC A;  4YSZ A;  3GSI A;  4D03 A;  5BUL A;  1H83 A;  2ARD A;  1TDE A;  4A5L A;  3F8P A;  1LVL A;  3JSK A;  3T37 A;  3E1T A;  2R46 A;  2VZ2 A;  1L0V A;  4YSY A;  1LQT A;  4GRT A;  2YM1 A;  1PJ7 A;  3BI4 A;  1D4E A;  2BC0 A;  1GRG A;  4Y4L A;  4AT0 A;  1JOA A;  2YG7 A;  3C96 A;  3CGE A;  4NZH A;  1PBB A;  2GMH A;  2YR5 A;  4EMJ A;  4AP1 A;  1JU2 A;  1IUT A;  2Z5X A;  3T2Z A;  2GAH B;  1BWC A;  1PBF A;  1YQZ A;  2WP6 A;  1GTH A;  2YVG A;  4H7U A;  4O5Q A;  2GR2 A;  3LJP A;  1KDG A;  1GES A;  5KMQ A;  3SFE A;  4B1B A;  1NHR A;  1MO9 A;  5TR3 A;  1EL7 A;  1CJ4 A;  2A8X A;  4UDP A;  5J7X A;  3CIR A;  3NNE A;  4USQ A;  3UCL A;  2WET A;  3C4N A;  4TLZ A;  3HZL A;  3UKQ A;  2WS3 A;  3AEC A;  1ZP0 A;  2VQB A;  3AE3 A;  2BK4 A;  1DJQ A;  1HYU A;  1NDA A;  2RAB A;  2J3N A;  2R0G A;  2GH5 A;  3NT6 A;  4U8M A;  3GWF A;  2C66 A;  1MXT A;  1F8S A;  3I3L A;  3T31 A;  2OAM A;  2XDO A;  4H4W A;  2YLS A;  3DJD A;  2OLO A;  3AYI A;  4LU6 A;  1Z6L A;  3CGC A;  3QSS A;  3GWD A;  2QCU A;  2GMJ A;  4B66 A;  3B3R A;  3M12 A;  3GRT A;  2C7G A;  2QAE A;  2YLX A;  4GR1 A;  4J57 A;  3LZW A;  4WCT A;  4A7A A;  1GEU A;  3ICR A;  4U8L A;  3GYI A;  2BS3 A;  4U8P A;  4CBQ A;  1GV4 A;  3F8R A;  1E39 A;  3ICS A;  3ITJ A;  1D7L A;  2WU2 A;  3DGZ A;  4JN9 A;  5JCL A;  2RGO A;  3ATR A;  3PVC A;  4BJY A;  2BCG G;  2V6O A;  1MOK A;  2YLR A;  5EOW A;  2VOU A;  2QA1 A;  3BHF A;  4GCM A;  3UKK A;  4BUR A;  4OCG A;  4X4J A;  3FMW A;  5M0Z A;  5CQF A;  3GYJ A;  1CBO A;  2WDQ A;  1ELI A;  3P9U A;  1H7W A;  2BRA A;  1JNR A;  3RHA A;  4IA5 A;  2YG4 A;  4U8I A;  4APN A;  2YLZ A;  1V59 A;  2XFN A;  1F8R A;  3DH9 A;  1B4V A;  1PXA A;  1ZOY A;  2XVF A;  3KPK A;  3VRA A;  1GXF A;  1FL2 A;  3RP6 A;  1GRH A;  1BGN A;  3CN8 A;  3UKH A;  5KRQ A;  4FDC B;  1P2H A;  1RYI A;  4G73 A;  4LA1 A;  2Y6Q A;  5FS7 A;  3EPT A;  2VVL A;  2WP5 A;  3HYW A;  3QFB A;  3DGH A;  3NGC X;  4K8D A;  3FPZ A;  5DBJ A;  5KOW A;  2WP9 A;  3GDN A;  4CCR A;  1H7X A;  5HYM A;  1NHP A;  3ATQ A;  3SXI A;  1TDO A;  3P4Q A;  3UKF A;  4Z2T A;  1YY5 A;  1P2E A;  3VRB A;  1CJ3 A;  4EIQ A;  3DJJ A;  3NK0 X;  2F5Z A;  4BK1 A;  2XFU A;  1BF3 A;  1KF6 A;  4UP3 A;  5M10 A;  1NHS A;  2B9X A;  3K7Q X;  3DK9 A;  2WU5 A;  3FIM B;  3UKP A;  3EF6 A;  1VQW A;  4GDE A;  3IHM A;  4DSH A;  4A9W A;  2XLP A;  1IUU A;  2Y6R A;  3LOV A;  3AEA A;  4OPU A;  2BXS A;  1XAN A;  3UTH A;  1LV0 A;  2X8C A;  3BHK A;  4C5O A;  1F3P A;  4IVM B;  3AE6 A;  1O95 A;  1VG0 A;  3P4S A;  5IQ1 A;  2RGH A;  1PJ6 A;  1KSU A;  1N4W A;  3SZ0 A;  2X99 A;  2BCP A;  3AD7 B;  3AYJ A;  4U2L A;  4RSL A;  1ZMC A;  5KOX A;  4REK A;  4EQW A;  1GER A;  5JCI A;  4KPR A;  3DJG X;  3KVE A;  4RG3 A;  1H86 A;  3H4K A;  2DKI A;  4HA6 A;  4K7Z A;  4H2P A;  5EB4 A;  1DOB A;  4H2R A;  2EQ9 A;  4PAA A;  1GSN A;  4Y4M A;  4U8O A;  1GRE A;  2B9W A;  3ISH A;  1TYP A;  1H6V A;  4D04 A;  4BK3 A;  4G6G A;  4EQS A;  1ZKQ A;  1N4V A;  4YTM A;  3ZDN A;  2YVF A;  2V61 A;  4B69 A;  3VQR A;  4FX9 A;  3URH A;  4ZCD A;  3DK8 A;  2VRL A;  5GSN A;  2VVM A;  2FJD A;  3OZ2 A;  2C65 A;  4B64 A;  2FBW A;  3RED A;  4YWO A;  4X9N A;  1K0I A;  1NG3 A;  3UKL A;  4B63 A;  3P4R A;  2ZBW A;  2WOW A;  3AE5 A;  3FBS A;  3QSM A;  3I6D A;  2QA2 A;  1E1L A;  4JNA A;  2AR8 A;  3Q6J A;  4U8K A;  3NN0 X;  3RP7 A;  2BS4 A;  3AEB A;  3HYV A;  1RSG A;  1NAA A;  3M13 A;  1GRF A;  1GTE A;  2JB1 A;  3AXB A;  2B9Y A;  5KVI A;  3SQP A;  4CY6 A;  1F6M A;  2CDU A;  2H89 A;  3UKA A;  3T14 A;  3G5R A;  2VQ7 A;  4GF7 A;  1COY A;  1BGJ A;  3Q9T A;  5FMH A;  1YQ3 A;  1OJD A;  1DOE A;  3BNM A;  3GDP A;  1S2Q A;  4AOX A;  4OPD A;  5KMS A;  1ONF A;  4ICY A;  3NYF A;  2GEW A;  2X3N A;  1FOH A;  2CVJ A;  3NG7 X;  2XVJ A;  2XFO A;  3KLJ A;  4E0V A;  3IF9 A;  1Q1W A;  3V76 A;  3CNJ A;  1PJ5 A;  5U1O A;  3UOX A;  3FG2 P;  1AOG A;  1QJD A;  2A87 A;  4YSX A;  2C67 A;  1NEN A;  5HXI A;  2EQ8 A;  1GOS A;  1ZDL A;  3AEG A;  1IUS A;  1ZY8 A;  1GT8 A;  2CUL A;  2R4J A;  3AE7 A;  2ACZ A;  2RGJ A;  4ZCC A;  2ZZC A;  1JRZ A;  4Y4N A;  1FEA A;  3NK2 X;  2YAU A;  2FJB A;  1PHH A;  2R45 A;  3PS9 A;  2A89 A;  3RP8 A;  1GPE A;  3AE1 A;  1B8S A;  4GUV A;  5JCN A;  1DNC A;  4U2S A;  3SZW A;  1NPX A;  4AT2 A;  1SEZ A;  1F8W A;  2EQ6 A;  2WDR A;  1TDN A;  4J2W A;  2GF3 A;  4TM0 A;  4M52 A;  4YTN A;  1OJA A;  5BRT A;  2ZZ0 A;  1QLB A;  3GYX A;  4J33 A;  4YSH A;  3AE2 A;  3UTF A;  2BAC A;  3L1R A;  1E1N A;  2AAQ A;  3AEE A;  1O94 A;  1NG4 A;  4IVO B;  2GV8 A;  2GRT A;  2Z5Y A;  4P9S A;  2C75 A;  4OPG A;  5FS8 A;  3SY4 A;  2X50 A;  1PDH A;  1D4D A;  3NIX A;  3AED A;  4X9M A;  2R9Z A;  4H4Y A;  3DJE A;  5KXJ A;  2YR6 A;  1XPQ A;  5BVA A;  3K30 A;  2Q0K A;  4B65 A;  3AE8 A;  2XYO A;  2YM2 A;  1K0L A;  4EMW A;  4U2T A;  3SFD A;  3UTG A;  1DXL A;  2XFP A;  4XWZ A;  3AWI A;  3OC4 A;  5KNL A;  4EM3 A;  4TM4 A;  2BXR A;  4NEV A;  1CC4 A;  3UP4 A;  5LV9 A;  4OVI A;  1S2Y A;  3ADA B;  1PS9 A;  2GAG B;  4H2N A;  4U8N A;  2GB0 A;  4GDP A;  4II3 A;  4CRT A;  3NKS A;  1H81 A;  3PO7 A;  2JBV A;  5FS9 A;  3SZC A;  3SX6 A;  4G6H A;  4DNA A;  2B7S A;  1IUV A;  1EBD A;  1X31 B;  1KSS A;  2X8G A;  3GD4 A;  3KU9 A;  1PBC A;  5U63 A;  5L46 A;  3EAN A;  4TLX A;  3V3N A;  3D8X A;  4CNJ A;  2OA1 A;  4TM1 A;  2C64 A;  4U8J A;  4A65 A;  4CY8 A;  4K22 A;  2WHD A;  2OLN A;  2VVL G;  1L9C A;  3AD8 B;  4H4Z A;  4YKG A;  1ZX9 A;  5CKU A;  2JK6 A;  3T2Y A;  1OJC A;  2WDV A;  4YT0 A;  3SM8 A;  2V3A A;  1S3E A;  1XDI A;  2YLT A;  2YG3 A;  2WEU A;  5KMP A;  2DKH A;  2O9Z A;  2Q6U A;  4H2Q A;  4H4U A;  3IHG A;  5KVH A;  1CJC A;  1CJ2 A;  1B37 A;  2WQY A;  1FCD A;  4K5S A;  3G5S A;  4TM3 A;  4C77 A;  2B76 A;  1GRA A;  3DME A;  4A6N A;  2YG5 A;  4C3X A;  1FEC A;  3CNP A;  2WES A;  3H8I A;  5ER0 A;  2BK3 A;  3V3O A;  2NPX A;  3LAD A;  3VR9 A;  4Z2R A;  4J34 A;  1NEK A;  3CND A;  1D4C A;  3UOZ A;  2Q7V A;  5IQ4 A;  3SZF A;  4EM4 A;  3BI5 A;  2W0H A;  3P4P A;  1CC2 A;  2WOI A;  3NN6 X;  1FEB A;  2TMD A;  3EAO A;  4Z44 A;  1O5W A;  3NH3 X;  1IUX A;  3O0H A;  4BV6 A;  3RNM A;  2C76 A;  1N1P A;  3QVP A;  2JAE A;  2C3C A;  1QO8 A;  4GAV A;  4FK1 A;  4C3Y A;  4WX1 A;  1TDF A;  3ICT A;  1GND A;  2IID A;  1L9E A;  2R0C A;  2FJA A;  2JKC A;  1D5T A;  2C4C A;  3QFA A;  3L8K A;  3ALL A;  1IUW A;  3KPF A;  2XVE A;  1W4X A;  2B7R A;  2XLR A;  4FK1 C;  5KMR A;  5BUK A;  1KNR A;  1NHQ A;  4N9X A;  1OJ9 A;  3WE0 A;  4H4Q A;  4JDR A;  2GR1 A;  3SGL A;  1LJ1 A;  4I59 A;  2GQF A;  1H82 A;  4NNJ A;  1Q9I A;  4OPL A;  1VG9 A;  1XHC A;  2BS2 A;  1VRQ B;  2YLW A;  3NYC A;  3BI2 A;  5IPY A;  3GD3 A;  1M64 A;  3T2K A;  1Y0P A;  2XLU A;  4G74 A;  5FS6 A;  4EMI A;  2YVJ A;  1EL8 A;  3GMC A;  1Q1R A;  3CMM A;  3NYE A;  3S61 A;  3SYI A;  2IVD A;  4BK2 A;  2WPF A;  3KKJ A;  2C70 A;  3BNU A;  4UDQ A;  5JCK A;  1LQU A;  3COX A;  4CNK A;  2V60 A;  4BJZ A;  3UP5 A;  1B5Q A;  5GRT A;  3UTE A;  4CCQ A;  4H4R A;  4Z43 A;  2BA9 A;  4NEW A;  4G9K A;  2BC1 A;  5J60 A;  2R0P A;  2XLT A;  4A79 A;  1H84 A;  2PYX A;  3LXD A;  4NTE A;  4A6N B;  4AP3 A;  2XCG A;  1GRB A;  2APG A;  5HY5 A;  2BRY A;  4K2X A;  3CPJ G;  2E1M A;  2JB3 A;  4B68 A;  5C2T A;  2C72 A;  1EL9 A;  2NVK X;  2PHH A;  4H50 A;  4H4P A;  5EB5 A;  2HQM A;  1ZOV A;  3CGD A;  4H4S A;  4XXG A;  4KX6 A;  2GQW A;  4JQ9 A;  3ALJ A;  1TDK A;  4H4V A;  2WPE A;  2EQ7 A;  3AYL A;  1KNP A;  3GMB A;  1JEH A;  4ZN0 A;  2GR3 A;  5HHF A;  1CC6 A;  2XVI A;  3CNS A;  3CTY A;  4I58 A;  1OJT A;  2FJE A;  2TPR A;  2XLS A;  3GRS A;  3IWA A;  3NTA A;  1GAL A;  4JNQ A;  4GAP A;  1E1M A;  2YR4 A;  1K4Q A;  1DOD A;  2XFQ A;  1VDC A;  1Y56 A;  2C73 A;  1YKJ A;  1ZK7 A;  3D1C A;  4Z2U A;  1GET A;  2Q0L A;  3CNT A;  2UZZ A;  3DK4 A;  2WPC A;  2C3D A;  3II4 A;  5C3J A;  3QJ4 A;  1IJH A;  3S5W A;  4EIP A;  1PN0 A;  4EQR A;  3QSE A;  3DA1 A;  3NHO X;  2CFY A;  4NWZ A;  4Z24 A;  3UOY A;  4J56 A;  2I0Z A;  3P1W A;  4NTD A;  3K7M X;  3AE9 A;  3VR8 A;  4Z26 A;  4ECH A;  2YG6 A;  3NK1 X;  3NRN A;  3C4A A;  3F8D A;  1D7Y A;  2YWL A;  1DJN A;  4DGK A;  4YKF A;  1CF3 A;  3AD9 B;  1BZL A;  1EL5 A;  3LB8 A;  4YTP A;  3IC9 A;  4ADW A;  4H4T A;  3ZYX A;  1KFY A;  1CHU A;  1REO A;  3ALM A;  4B67 A;  1JRY A;  4J36 A;  3AEF A;  4DSG A;  2BYB A;  2XVH A;  2YQU A;  2GVC A;  2BK5 A;  3CPI G;  3QVR A;  3K7T A;  4A99 A;  4H4X A;  4UDR A;  1LTX R;  2X8H A;  3CPH G;  4MJW A;  4II2 A;  1L9D A;  3H8L A;  1TYT A;  3VRD B;  1K0J A;  1RP0 A;  4JY3 A;  1PXB A;  1E6E A;  4OPC A;  4OPT A;  2V3B A;  1PBE A;  2IVE A;  1PBD A;  3G5Q A;  4K5R A;  1ZMD A;  3T0K A;  3M0O A;  3ABV A;  4HB9 A;  2VRM A;  2JB2 A;  4IV9 A;  3AE4 A;  3CGB A;  4J31 A;  5U25 A;  1GRT A;  2GR0 A;  3AB1 A;  2E4G A;  4O5U A;  3NTD A;  2V5Z A;  1E7P A;  1TRB A;  2R4E A;  3R9U A;  1M6I A;  1PXC A;  4AOS A;  5JCM A;  2H88 A;  3HYX A;  4NTC A;  4C74 A;  4YXD A;  2AQJ A;  4USR A;  2WBA A;  3KD9 A;  3UOV A;  5KWF A;  1N4U A;  1Y56 B;  1UKV G;  1S3B A;  2BAB A;  4IA6 A;  4XWR A;  4EQX A;  3KA7 A;  3LZX A;  4OPI A;  1CL0 A;  4Z25 A; 
#chains in the Genus database with same CATH homology
 2E5V A;  4LII A;  1BKW A;  2WOV A;  4PAB A;  2OAL A;  3B6D A;  1LPF A;  1JRX A;  3NLC A;  1E1K A;  5EBK A;  1JNZ A;  1YQ4 A;  2ZZB A;  4RG4 A;  4JY2 A;  1DOC A;  4YSZ A;  3GSI A;  4D03 A;  5BUL A;  1H83 A;  2ARD A;  1TDE A;  4A5L A;  3F8P A;  1LVL A;  3JSK A;  3T37 A;  3E1T A;  2R46 A;  2VZ2 A;  1L0V A;  4YSY A;  1LQT A;  4GRT A;  2YM1 A;  1PJ7 A;  3BI4 A;  1D4E A;  2BC0 A;  1GRG A;  4Y4L A;  4AT0 A;  1JOA A;  2YG7 A;  3C96 A;  3CGE A;  4NZH A;  1PBB A;  2GMH A;  2YR5 A;  4EMJ A;  4AP1 A;  1JU2 A;  1IUT A;  2Z5X A;  3T2Z A;  2GAH B;  1BWC A;  1PBF A;  1YQZ A;  2WP6 A;  1GTH A;  2YVG A;  4H7U A;  4O5Q A;  2GR2 A;  3LJP A;  1KDG A;  1GES A;  5KMQ A;  3SFE A;  4B1B A;  1NHR A;  1MO9 A;  5TR3 A;  1EL7 A;  1CJ4 A;  2A8X A;  4UDP A;  5J7X A;  3CIR A;  3NNE A;  4USQ A;  3UCL A;  2WET A;  3C4N A;  4TLZ A;  3HZL A;  3UKQ A;  2WS3 A;  3AEC A;  1ZP0 A;  2VQB A;  3AE3 A;  2BK4 A;  1DJQ A;  1HYU A;  1NDA A;  2RAB A;  2J3N A;  2R0G A;  2GH5 A;  3NT6 A;  4U8M A;  3GWF A;  2C66 A;  1MXT A;  1F8S A;  3I3L A;  3T31 A;  2OAM A;  2XDO A;  4H4W A;  2YLS A;  3DJD A;  2OLO A;  3AYI A;  4LU6 A;  1Z6L A;  3CGC A;  3QSS A;  3GWD A;  2QCU A;  2GMJ A;  4B66 A;  3B3R A;  3M12 A;  3GRT A;  2C7G A;  2QAE A;  2YLX A;  4GR1 A;  4J57 A;  3LZW A;  4WCT A;  4A7A A;  1GEU A;  3ICR A;  4U8L A;  3GYI A;  2BS3 A;  4U8P A;  4CBQ A;  1GV4 A;  3F8R A;  1E39 A;  3ICS A;  3ITJ A;  1D7L A;  2WU2 A;  3DGZ A;  4JN9 A;  5JCL A;  2RGO A;  3ATR A;  3PVC A;  4BJY A;  2BCG G;  2V6O A;  1MOK A;  2YLR A;  5EOW A;  2VOU A;  2QA1 A;  3BHF A;  4GCM A;  3UKK A;  4BUR A;  4OCG A;  4X4J A;  3FMW A;  5M0Z A;  5CQF A;  3GYJ A;  1CBO A;  2WDQ A;  1ELI A;  3P9U A;  1H7W A;  2BRA A;  1JNR A;  3RHA A;  4IA5 A;  2YG4 A;  4U8I A;  4APN A;  2YLZ A;  1V59 A;  2XFN A;  1F8R A;  3DH9 A;  1B4V A;  1PXA A;  1ZOY A;  2XVF A;  3KPK A;  3VRA A;  1GXF A;  1FL2 A;  3RP6 A;  1GRH A;  1BGN A;  3CN8 A;  3UKH A;  5KRQ A;  4FDC B;  1P2H A;  1RYI A;  4G73 A;  4LA1 A;  2Y6Q A;  5FS7 A;  3EPT A;  2VVL A;  2WP5 A;  3HYW A;  3QFB A;  3DGH A;  3NGC X;  4K8D A;  3FPZ A;  5DBJ A;  5KOW A;  2WP9 A;  3GDN A;  4CCR A;  1H7X A;  5HYM A;  1NHP A;  3ATQ A;  3SXI A;  1TDO A;  3P4Q A;  3UKF A;  4Z2T A;  1P2E A;  1YY5 A;  3VRB A;  1CJ3 A;  4EIQ A;  3DJJ A;  3NK0 X;  2F5Z A;  4BK1 A;  2XFU A;  1BF3 A;  1KF6 A;  4UP3 A;  5M10 A;  2B9X A;  1NHS A;  3K7Q X;  3DK9 A;  2WU5 A;  3FIM B;  3UKP A;  3EF6 A;  1VQW A;  4GDE A;  3IHM A;  4DSH A;  4A9W A;  2XLP A;  1IUU A;  2Y6R A;  3LOV A;  3AEA A;  4OPU A;  2BXS A;  1XAN A;  3UTH A;  1LV0 A;  2X8C A;  3BHK A;  4C5O A;  1F3P A;  4IVM B;  3AE6 A;  1O95 A;  1VG0 A;  3P4S A;  5IQ1 A;  2RGH A;  1PJ6 A;  1KSU A;  1N4W A;  3SZ0 A;  2X99 A;  2BCP A;  3AD7 B;  3AYJ A;  4U2L A;  4RSL A;  1ZMC A;  5KOX A;  4REK A;  4EQW A;  1GER A;  5JCI A;  4KPR A;  3DJG X;  3KVE A;  4RG3 A;  1H86 A;  3H4K A;  2DKI A;  4HA6 A;  4K7Z A;  4H2P A;  5EB4 A;  1DOB A;  4H2R A;  2EQ9 A;  4PAA A;  1GSN A;  4Y4M A;  4U8O A;  1GRE A;  2B9W A;  3ISH A;  1TYP A;  1H6V A;  4D04 A;  4BK3 A;  4G6G A;  4EQS A;  1ZKQ A;  1N4V A;  4YTM A;  3ZDN A;  2YVF A;  2V61 A;  4B69 A;  3VQR A;  4FX9 A;  3URH A;  4ZCD A;  3DK8 A;  2VRL A;  5GSN A;  2VVM A;  2FJD A;  3OZ2 A;  2C65 A;  4B64 A;  2FBW A;  3RED A;  4YWO A;  4X9N A;  1K0I A;  1NG3 A;  3UKL A;  4B63 A;  3P4R A;  2ZBW A;  2WOW A;  3AE5 A;  3FBS A;  3QSM A;  3I6D A;  2QA2 A;  1E1L A;  4JNA A;  2AR8 A;  3Q6J A;  4U8K A;  3NN0 X;  3RP7 A;  2BS4 A;  3AEB A;  3HYV A;  1RSG A;  1NAA A;  3M13 A;  1GRF A;  1GTE A;  2JB1 A;  3AXB A;  2B9Y A;  5KVI A;  3SQP A;  4CY6 A;  1F6M A;  2CDU A;  2H89 A;  3UKA A;  3T14 A;  3G5R A;  2VQ7 A;  4GF7 A;  1COY A;  1BGJ A;  3Q9T A;  5FMH A;  1YQ3 A;  1OJD A;  1DOE A;  3BNM A;  3GDP A;  1S2Q A;  4AOX A;  4OPD A;  5KMS A;  1ONF A;  4ICY A;  3NYF A;  2GEW A;  2X3N A;  1FOH A;  2CVJ A;  3NG7 X;  2XVJ A;  2XFO A;  3KLJ A;  4E0V A;  3IF9 A;  1Q1W A;  3V76 A;  3CNJ A;  1PJ5 A;  5U1O A;  3UOX A;  3FG2 P;  1AOG A;  1QJD A;  2A87 A;  4YSX A;  2C67 A;  1NEN A;  5HXI A;  2EQ8 A;  1GOS A;  1ZDL A;  3AEG A;  1IUS A;  1ZY8 A;  1GT8 A;  2CUL A;  2R4J A;  3AE7 A;  2ACZ A;  2RGJ A;  4ZCC A;  2ZZC A;  1JRZ A;  4Y4N A;  1FEA A;  3NK2 X;  2YAU A;  2FJB A;  1PHH A;  2R45 A;  3PS9 A;  2A89 A;  3RP8 A;  1GPE A;  3AE1 A;  1B8S A;  4GUV A;  5JCN A;  1DNC A;  4U2S A;  3SZW A;  1NPX A;  4AT2 A;  1SEZ A;  1F8W A;  2EQ6 A;  2WDR A;  1TDN A;  4J2W A;  2GF3 A;  4TM0 A;  4M52 A;  4YTN A;  1OJA A;  5BRT A;  2ZZ0 A;  1QLB A;  3GYX A;  4J33 A;  4YSH A;  3AE2 A;  3UTF A;  2BAC A;  3L1R A;  1E1N A;  2AAQ A;  3AEE A;  1O94 A;  1NG4 A;  4IVO B;  2GV8 A;  2GRT A;  2Z5Y A;  4P9S A;  2C75 A;  4OPG A;  5FS8 A;  3SY4 A;  2X50 A;  1PDH A;  1D4D A;  3NIX A;  3AED A;  4X9M A;  2R9Z A;  4H4Y A;  3DJE A;  5KXJ A;  2YR6 A;  1XPQ A;  5BVA A;  3K30 A;  2Q0K A;  4B65 A;  3AE8 A;  2XYO A;  2YM2 A;  1K0L A;  4EMW A;  4U2T A;  3SFD A;  3UTG A;  1DXL A;  2XFP A;  4XWZ A;  3AWI A;  3OC4 A;  5KNL A;  4EM3 A;  4TM4 A;  2BXR A;  4NEV A;  1CC4 A;  3UP4 A;  5LV9 A;  4OVI A;  1S2Y A;  3ADA B;  1PS9 A;  2GAG B;  4H2N A;  4U8N A;  2GB0 A;  4GDP A;  4II3 A;  4CRT A;  3NKS A;  1H81 A;  3PO7 A;  2JBV A;  5FS9 A;  3SZC A;  3SX6 A;  4G6H A;  4DNA A;  2B7S A;  1IUV A;  1EBD A;  1X31 B;  1KSS A;  2X8G A;  3GD4 A;  3KU9 A;  1PBC A;  5U63 A;  5L46 A;  3EAN A;  4TLX A;  3V3N A;  3D8X A;  4CNJ A;  2OA1 A;  4TM1 A;  2C64 A;  4U8J A;  4A65 A;  4CY8 A;  4K22 A;  2WHD A;  2OLN A;  2VVL G;  1L9C A;  3AD8 B;  4H4Z A;  4YKG A;  1ZX9 A;  5CKU A;  2JK6 A;  3T2Y A;  1OJC A;  2WDV A;  4YT0 A;  3SM8 A;  2V3A A;  1S3E A;  1XDI A;  2YLT A;  2YG3 A;  2WEU A;  5KMP A;  2DKH A;  2O9Z A;  2Q6U A;  4H2Q A;  4H4U A;  3IHG A;  5KVH A;  1CJC A;  1CJ2 A;  1B37 A;  2WQY A;  1FCD A;  4K5S A;  3G5S A;  4TM3 A;  4C77 A;  2B76 A;  1GRA A;  3DME A;  4A6N A;  2YG5 A;  4C3X A;  1FEC A;  3CNP A;  2WES A;  3H8I A;  5ER0 A;  2BK3 A;  3V3O A;  2NPX A;  3LAD A;  3VR9 A;  4Z2R A;  4J34 A;  1NEK A;  3CND A;  1D4C A;  3UOZ A;  2Q7V A;  5IQ4 A;  3SZF A;  4EM4 A;  3BI5 A;  2W0H A;  3P4P A;  1CC2 A;  2WOI A;  3NN6 X;  1FEB A;  2TMD A;  3EAO A;  4Z44 A;  1O5W A;  3NH3 X;  1IUX A;  3O0H A;  4BV6 A;  3RNM A;  2C76 A;  1N1P A;  3QVP A;  2JAE A;  2C3C A;  1QO8 A;  4GAV A;  4FK1 A;  4C3Y A;  4WX1 A;  1TDF A;  3ICT A;  1GND A;  2IID A;  1L9E A;  2R0C A;  2FJA A;  2JKC A;  1D5T A;  2C4C A;  3QFA A;  3L8K A;  3ALL A;  1IUW A;  3KPF A;  2XVE A;  1W4X A;  2B7R A;  2XLR A;  4FK1 C;  5KMR A;  5BUK A;  1KNR A;  1NHQ A;  4N9X A;  1OJ9 A;  3SGL A;  4H4Q A;  4JDR A;  2GR1 A;  3WE0 A;  1LJ1 A;  4I59 A;  2GQF A;  1H82 A;  4NNJ A;  1Q9I A;  4OPL A;  1VG9 A;  1XHC A;  2BS2 A;  1VRQ B;  2YLW A;  3NYC A;  3BI2 A;  5IPY A;  3GD3 A;  1M64 A;  3T2K A;  1Y0P A;  2XLU A;  4G74 A;  5FS6 A;  4EMI A;  2YVJ A;  1EL8 A;  3GMC A;  1Q1R A;  3CMM A;  3NYE A;  3S61 A;  3SYI A;  2IVD A;  4BK2 A;  2WPF A;  3KKJ A;  2C70 A;  3BNU A;  4UDQ A;  5JCK A;  1LQU A;  3COX A;  4CNK A;  2V60 A;  4BJZ A;  3UP5 A;  1B5Q A;  5GRT A;  3UTE A;  4CCQ A;  4H4R A;  4Z43 A;  2BA9 A;  4NEW A;  4G9K A;  2BC1 A;  5J60 A;  2R0P A;  2XLT A;  4A79 A;  1H84 A;  2PYX A;  3LXD A;  4NTE A;  4A6N B;  4AP3 A;  2XCG A;  1GRB A;  2APG A;  5HY5 A;  2BRY A;  4K2X A;  3CPJ G;  2E1M A;  2JB3 A;  4B68 A;  5C2T A;  2C72 A;  1EL9 A;  2NVK X;  2PHH A;  4H50 A;  4H4P A;  5EB5 A;  2HQM A;  1ZOV A;  3CGD A;  4H4S A;  4XXG A;  4KX6 A;  2GQW A;  4JQ9 A;  3ALJ A;  1TDK A;  4H4V A;  2WPE A;  2EQ7 A;  3AYL A;  1KNP A;  3GMB A;  1JEH A;  4ZN0 A;  2GR3 A;  5HHF A;  1CC6 A;  2XVI A;  3CNS A;  3CTY A;  4I58 A;  1OJT A;  2FJE A;  2TPR A;  2XLS A;  3GRS A;  3IWA A;  3NTA A;  1GAL A;  4JNQ A;  4GAP A;  1E1M A;  2YR4 A;  1K4Q A;  1DOD A;  2XFQ A;  1VDC A;  1Y56 A;  2C73 A;  1YKJ A;  1ZK7 A;  3D1C A;  4Z2U A;  1GET A;  2Q0L A;  3CNT A;  2UZZ A;  3DK4 A;  2WPC A;  2C3D A;  3II4 A;  5C3J A;  3QJ4 A;  1IJH A;  3S5W A;  4EIP A;  1PN0 A;  4EQR A;  3QSE A;  3DA1 A;  3NHO X;  2CFY A;  4NWZ A;  4Z24 A;  3UOY A;  4J56 A;  2I0Z A;  3P1W A;  4NTD A;  3K7M X;  3AE9 A;  3VR8 A;  4Z26 A;  4ECH A;  2YG6 A;  3NK1 X;  3NRN A;  3C4A A;  3F8D A;  1D7Y A;  2YWL A;  1DJN A;  4DGK A;  4YKF A;  1CF3 A;  3AD9 B;  1BZL A;  1EL5 A;  3LB8 A;  4YTP A;  3IC9 A;  4ADW A;  4H4T A;  3ZYX A;  1KFY A;  1CHU A;  1REO A;  3ALM A;  4B67 A;  1JRY A;  4J36 A;  3AEF A;  4DSG A;  2BYB A;  2XVH A;  2YQU A;  2GVC A;  2BK5 A;  3CPI G;  3QVR A;  3K7T A;  4A99 A;  4H4X A;  4UDR A;  1LTX R;  2X8H A;  3CPH G;  4MJW A;  4II2 A;  1L9D A;  3H8L A;  1TYT A;  3VRD B;  1K0J A;  1RP0 A;  4JY3 A;  1PXB A;  1E6E A;  4OPC A;  4OPT A;  2V3B A;  1PBE A;  2IVE A;  1PBD A;  3G5Q A;  4K5R A;  1ZMD A;  3T0K A;  3M0O A;  3ABV A;  4HB9 A;  2VRM A;  2JB2 A;  3AE4 A;  3CGB A;  4J31 A;  4IV9 A;  5U25 A;  1GRT A;  2GR0 A;  3AB1 A;  2E4G A;  4O5U A;  3NTD A;  2V5Z A;  1E7P A;  1TRB A;  2R4E A;  3R9U A;  1M6I A;  1PXC A;  4AOS A;  5JCM A;  2H88 A;  3HYX A;  4NTC A;  4C74 A;  4YXD A;  2AQJ A;  4USR A;  2WBA A;  3KD9 A;  3UOV A;  5KWF A;  1N4U A;  1Y56 B;  1UKV G;  1S3B A;  2BAB A;  4IA6 A;  4XWR A;  4EQX A;  3KA7 A;  3LZX A;  4OPI A;  1CL0 A;  4Z25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...