1H83A

Structure of polyamine oxidase in complex with 1,8-diaminooctane
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
459
structure length
459
Chain Sequence
b'PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 166
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h83A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h83A02
1IUXA 3M12A 3L1RA 1EL7A 3O0HA 3LADA 4B66A 2C67A 5EB5A 4EIPA 2PHHA 3DJJA 1EBDA 4Z26A 1XPQA 1PBBA 3K7QX 1NHRA 4NTDA 4YTMA 4H50A 2BYBA 1H6VA 1DODA 2BA9A 3AE5A 2BCPA 4YKGA 2Y6RA 5IQ1A 1NDAA 2B9XA 3G5RA 2B76A 2B7RA 2WU2A 2YM2A 1YKJA 3ITJA 4GUVA 3BNUA 3LJPA 2WU5A 3LZXA 1GOSA 3VRAA 4EQSA 1PBEA 4B63A 1Y56A 1B8SA 4H4ZA 2RGJA 1K0LA 4IVOB 3JSKA 1Q1RA 1PN0A 1KDGA 2BABA 2WS3A 2ACZA 5GRTA 2WP5A 2GAHB 2FJBA 2BK5A 1RP0A 4Z2UA 3UCLA 1EL8A 5BRTA 4ZN0A 3P9UA 2R0GA 1GALA 2NVKX 1ZOYA 4Z43A 1VG0A 4OPLA 1N4VA 3AE1A 3GRTA 1UKVG 3GYJA 1DJNA 2AR8A 2VVLA 1L0VA 3K7MX 3COXA 3ICTA 2XDOA 2RGOA 4NEWA 4C74A 3VQRA 3P4PA 1ELIA 3DK9A 2Q0KA 4CNJA 1RSGA 4C77A 3NYFA 2FJAA 4FK1A 1PBDA 3DA1A 1BZLA 1Y0PA 2YR6A 3FBSA 3GSIA 2OLOA 5M10A 1GRGA 3UOZA 3S5WA 1OJ9A 2TPRA 1X31B 3SFEA 1PBCA 2YLZA 3GRSA 2OA1A 3HZLA 4YSXA 1IUTA 1PXBA 1D5TA 4YSHA 5TR3A 4BJZA 2C66A 2XYOA 2WDRA 5CKUA 4C3YA 4X9NA 3I6DA 3QVPA 1KSUA 3DGZA 3AYLA 2DKIA 1P2HA 1GEUA 1GRBA 1GSNA 2X8CA 1TRBA 3GYIA 2GR3A 3NKSA 4ICYA 5U63A 3AEFA 3UTFA 4Z44A 3ALJA 4H4UA 3ICRA 2WDQA 4ECHA 3AE9A 1GTEA 2VQ7A 4H4PA 2WQYA 4WX1A 1P2EA 3FPZA 3NN6X 1IUSA 3RP6A 1NEKA 3ABVA 1E39A 2YQUA 3AEBA 4RSLA 4GF7A 3PS9A 3GMCA 4U8KA 4H4XA 3UKHA 4RG3A 4O5QA 5BULA 1BGNA 1KFYA 2YVJA 3M0OA 4OPUA 3P4QA 4B69A 4BURA 1E1MA 2Z5YA 4GDPA 2YWLA 4CNKA 2B9WA 2BS2A 2IVEA 4J31A 2C72A 4JQ9A 3ZDNA 4J33A 4CRTA 4K5SA 5KRQA 3UP4A 3L8KA 2BC0A 2QA2A 3UKAA 4TM1A 3AXBA 1ZMDA 2A89A 4IA6A 1KF6A 3UKPA 5EBKA 4GR1A 2FBWA 4OPGA 4H7UA 2Q0LA 2YG6A 3KKJA 3NK0X 2YLRA 2XVHA 1ZMCA 5HYMA 3AD7B 2GMJA 1EL9A 2FJDA 2GRTA 2GR2A 2WHDA 4OPTA 3VR9A 2CFYA 3CNTA 2XFPA 3DK4A 5BVAA 1ZY8A 3CPJG 3DMEA 4Y4NA 2WEUA 5JCMA 3NH3X 2C73A 1BGJA 1NPXA 1JRYA 1PJ7A 2GAGB 3ADAB 3CNDA 3NTDA 4JY3A 3DJGX 4I58A 2XFNA 4H4WA 4YSYA 1PDHA 4U8JA 1IUUA 1IJHA 4HA6A 2H89A 3NG7X 3UOYA 3GWDA 2YG5A 3ICSA 4C5OA 3BI5A 3EPTA 4B1BA 3RP7A 2XFOA 1N1PA 2WPCA 3WE0A 3NIXA 3OC4A 2YG3A 2QA1A 4H4QA 2XLRA 1NG4A 1TYPA 1D4CA 4DSHA 3QSMA 2GQWA 1O5WA 4AP1A 4A5LA 1LJ1A 3UTGA 2ARDA 2V3AA 1FCDA 3EANA 4D04A 2GQFA 4Z25A 1COYA 1TYTA 3NTAA 2CULA 4J34A 4AP3A 2C3DA 3AE8A 1Q1WA 4UDPA 1BWCA 4H4VA 3Q9TA 4UDRA 3CGBA 4YKFA 5KXJA 3IF9A 4TM4A 1REOA 2YLXA 1GRHA 1M64A 1N4UA 3C4NA 1ZKQA 2E1MA 3OZ2A 3AE4A 4H2NA 3LXDA 1JU2A 4JDRA 3QFAA 1H7WA 1GRTA 2BC1A 5HHFA 2YR5A 1VQWA 1YQ4A 1S2QA 2A87A 4YWOA 1GESA 5HXIA 3KVEA 3CPIG 2WP9A 3ALLA 3KU9A 1FOHA 2EQ6A 3AWIA 3B3RA 3NLCA 4BK2A 1ZX9A 4I59A 1GETA 2XCGA 3AB1A 3GD4A 3QSEA 1DOEA 4DNAA 2XLTA 1K0IA 1JRXA 3KD9A 1IUWA 2WP6A 4X4JA 1YQZA 2EQ9A 4LIIA 1YY5A 2Q7VA 3NGCX 1NAAA 4H2RA 2BCGG 2X8HA 3AYIA 5GSNA 2C3CA 2WBAA 4A6NA 1QJDA 1XANA 1GV4A 2YVFA 2PYXA 4JN9A 5M0ZA 2VOUA 3UKFA 3UP5A 4LA1A 4CBQA 5JCNA 3E1TA 3REDA 2QAEA 4JNQA 1VRQB 3NHOX 4H4TA 2R46A 1CHUA 2YLSA 5FS7A 4XWRA 2W0HA 4BJYA 3DK8A 1JNRA 3IC9A 3G5SA 5KVIA 4O5UA 2X8GA 2F5ZA 3QJ4A 4A65A 2I0ZA 4CCRA 2YVGA 3RNMA 2JB1A 2CDUA 1DNCA 1O94A 2OAMA 3F8RA 4H2QA 1F8SA 1RYIA 2XLPA 2QCUA 1HYUA 4CY6A 4Z24A 1GNDA 3NRNA 1NHPA 3LOVA 2XLUA 4ZCDA 3UKQA 1KSSA 2VZ2A 1LV0A 3AE7A 3K30A 2C64A 1FL2A 2YLWA 3H8LA 3KA7A 4EM3A 3AECA 4UP3A 3AE3A 2C7GA 4EMIA 1LVLA 4ZCCA 3AEEA 3DH9A 1CC4A 1H82A 1S3BA 3NK2X 4CCQA 1W4XA 2C65A 2ZZBA 4AOXA 1XHCA 4YXDA 4A9WA 2V60A 2R4EA 3P4RA 2XVEA 2GB0A 2WPEA 5C2TA 1PHHA 3CN8A 2WDVA 4K8DA 3NN0X 2JAEA 1NG3A 3RHAA 5JCKA 1F8WA 2APGA 3AEAA 4TLZA 5ER0A 5IPYA 1LQTA 1FECA 4APNA 3D1CA 1D4DA 2JBVA 2Y6QA 4WCTA 2JB2A 3PO7A 3H8IA 2ZZ0A 1NENA 2IVDA 2V61A 3UOVA 4Y4MA 2Q6UA 3S61A 5FS6A 1QO8A 3UKKA 3NYCA 3CGEA 1D4EA 2B7SA 2RGHA 1JOAA 4JY2A 3D8XA 4J2WA 1H83A 4EQRA 4TLXA 2YG4A 5J7XA 5FS9A 1LTXR 3SFDA 2AAQA 3LZWA 3UTEA 2B9YA 2HQMA 4B67A 4AOSA 1BKWA 1OJCA 3V76A 1D7YA 2DKHA 4TM3A 1B37A 1PXCA 5EOWA 1V59A 1Y56B 4U8MA 3NYEA 1DOBA 1TDKA 4USRA 5JCIA 4YT0A 2JKCA 2BS4A 2RABA 5DBJA 1FEBA 2WOVA 4B65A 4CY8A 4U8LA 1MXTA 1KNRA 1XDIA 3CGCA 4EMJA 3AE6A 4Z2RA 1CC6A 3NNEA 4EM4A 1PJ6A 3SGLA 2EQ8A 3F8PA 4RG4A 4A99A 1CBOA 1CJ3A 2V3BA 2VQBA 1GPEA 2GMHA 3DGHA 2GV8A 2VVMA 4IA5A 1CF3A 4OPCA 1E7PA 3NK1X 2J3NA 1GTHA 2VVLG 4H4RA 3FMWA 1H81A 4M52A 3GD3A 2XVFA 1H86A 4PABA 5C3JA 5CQFA 2GF3A 4JNAA 3PVCA 3IHGA 2R45A 4GRTA 3GDNA 4J57A 3C96A 3ATQA 3RP8A 1JEHA 4DGKA 2GH5A 1Z6LA 4FX9A 5U1OA 1GREA 5KVHA 3UOXA 4FDCB 2WOIA 4A6NB 1NHSA 4D03A 3AE2A 2XVJA 3ZYXA 1GRAA 5U25A 4EQWA 4K2XA 2ZZCA 1L9CA 4DSGA 1K4QA 1KNPA 1YQ3A 2O9ZA 2YAUA 5KOWA 3DJDA 2V6OA 4B68A 1VG9A 1H84A 4BK1A 2YR4A 4EQXA 2XLSA 2V5ZA 3FG2P 3KLJA 3AEGA 1OJDA 4AT0A 3LB8A 3ATRA 2E4GA 4USQA 5LV9A 4C3XA 3FIMB 4OPIA 3ALMA 1GXFA 2R9ZA 2WOWA 4OCGA 4TM0A 1TDEA 3DJEA 1ZP0A 4AT2A 3NT6A 4REKA 3CGDA 1S2YA 1CJ2A 3IWAA 4X9MA 1Q9IA 2H88A 4IV9A 2AQJA 1E1NA 4U8NA 3H4KA 4U2LA 3K7TA 4NEVA 2NPXA 3CIRA 5BUKA 3UTHA 4E0VA 5EB4A 2OLNA 3GWFA 4YSZA 1S3EA 1N4WA 3C4AA 4FK1C 2X99A 1H7XA 3AD8B 4H2PA 3CTYA 4IVMB 5HY5A 4NZHA 3F8DA 3QSSA 4XWZA 4XXGA 2C70A 4B64A 3I3LA 1GT8A 2BXRA 1TDNA 2R0PA 3BI4A 4H4SA 4A7AA 4K22A 2BK3A 4Z2TA 2C76A 1LPFA 3GDPA 2JK6A 2BK4A 4MJWA 4NTCA 5FMHA 5IQ4A 1FEAA 2JB3A 2VRMA 1B5QA 3CNPA 5KWFA 1PXAA 1F3PA 1E1KA 5L46A 4KPRA 2ZBWA 1K0JA 3AEDA 1F8RA 1D7LA 4K7ZA 4J56A 3URHA 3B6DA 2GR0A 3QVRA 3BHFA 1O95A 1PBFA 1QLBA 1DOCA 3AYJA 2YM1A 2GR1A 2BACA 5FS8A 1AOGA 3T37A 1L9EA 4Y4LA 4YTNA 4GDEA 3GMBA 2A8XA 3VRDB 3M13A 1B4VA 2Z5XA 4P9SA 1E1LA 1JNZA 1TDFA 3G5QA 3QFBA 4U8PA 4U8IA 2VRLA 1CL0A 1IUVA 1DXLA 2R4JA 2XFQA 2WPFA 3ISHA 2CVJA 1CJ4A 4NTEA 2C75A 4YTPA 4UDQA 1L9DA 4U8OA 3SM8A 3VR8A 1SEZA 3AD9B 1CJCA 2WETA 4N9XA 3SQPA 3CNSA 1JRZA 1ONFA 3P1WA 1F6MA 3KPFA 4OVIA 2WESA 2XFUA 4EMWA 3R9UA 4ADWA 2BXSA 4BK3A 4EIQA 1GRFA 3CPHG 1LQUA 1M6IA 1OJAA 4K5RA 1BF3A 1DJQA 3BNMA 1NHQA 2GVCA 3Q6JA 1TDOA 4U2SA 2X50A 5JCLA 2E5VA 2TMDA 5KOXA 5J60A 3V3NA 1EL5A 3IHMA 3BI2A 1ZDLA 1OJTA 4KX6A 3EAOA 3II4A 2IIDA 3EF6A 2BS3A 4A79A 4HB9A 3UKLA 3CNJA 1ZOVA 3P4SA 1VDCA 3V3OA 1PJ5A 2YG7A 4H4YA 4BV6A 3BHKA 3VRBA 1E6EA 2X3NA 2EQ7A 4J36A 2YLTA 2OALA 1MOKA 1MO9A 4OPDA 2FJEA 1CC2A 2R0CA 1PS9A 4GCMA 2XVIA 4LU6A 1ZK7A 4PAAA 4U2TA 1GERA 2GEWA 2UZZA
chains in the Genus database with same CATH superfamily
1IUXA 3M12A 3L1RA 1EL7A 3O0HA 5KMRA 3LADA 4B66A 2C67A 5EB5A 4EIPA 2PHHA 3DJJA 1EBDA 4Z26A 1XPQA 1PBBA 3K7QX 1NHRA 4NTDA 4YTMA 4H50A 2BYBA 1H6VA 1DODA 2BA9A 3AE5A 2BCPA 4YKGA 2Y6RA 3SY4A 5IQ1A 1NDAA 2B9XA 3G5RA 2B76A 2B7RA 2WU2A 2YM2A 1YKJA 3ITJA 4GUVA 3BNUA 3LJPA 2WU5A 3LZXA 1GOSA 3VRAA 4EQSA 1PBEA 4B63A 1Y56A 1B8SA 4H4ZA 2RGJA 1K0LA 3HYXA 3JSKA 4IVOB 1Q1RA 1PN0A 1KDGA 2BABA 2WS3A 2ACZA 5GRTA 2WP5A 2GAHB 2FJBA 2BK5A 1RP0A 4Z2UA 3UCLA 1EL8A 5BRTA 4ZN0A 3P9UA 2R0GA 1GALA 2NVKX 1ZOYA 4Z43A 1VG0A 4OPLA 1N4VA 3AE1A 3GRTA 1UKVG 3GYJA 1DJNA 2AR8A 2VVLA 1L0VA 3K7MX 3COXA 3ICTA 2XDOA 2RGOA 4NEWA 4C74A 3VQRA 3P4PA 1ELIA 3DK9A 2Q0KA 4G73A 4CNJA 1RSGA 4C77A 3NYFA 2FJAA 4FK1A 1PBDA 3DA1A 1BZLA 1Y0PA 2YR6A 3FBSA 3GSIA 2OLOA 5M10A 1GRGA 3UOZA 3S5WA 1OJ9A 2TPRA 1X31B 3SFEA 1PBCA 2YLZA 3GRSA 2OA1A 3HZLA 5KMQA 1IUTA 4YSXA 1PXBA 1D5TA 4YSHA 5TR3A 4BJZA 2C66A 2XYOA 2WDRA 5CKUA 4C3YA 4X9NA 3I6DA 3QVPA 1KSUA 3DGZA 3AYLA 2DKIA 1P2HA 1GEUA 1GRBA 1GSNA 2X8CA 1TRBA 3GYIA 2GR3A 3NKSA 4ICYA 5U63A 3AEFA 3UTFA 4Z44A 3ALJA 4H4UA 3ICRA 2WDQA 4ECHA 3AE9A 1GTEA 2VQ7A 4H4PA 2WQYA 4WX1A 1P2EA 3KPKA 3FPZA 3NN6X 1IUSA 3RP6A 1NEKA 3ABVA 1E39A 2YQUA 3AEBA 4RSLA 4GF7A 3PS9A 3GMCA 4U8KA 4H4XA 3UKHA 4RG3A 4O5QA 5BULA 1BGNA 1KFYA 2YVJA 3M0OA 4OPUA 3P4QA 4B69A 4BURA 1E1MA 2Z5YA 4GDPA 2YWLA 4CNKA 2B9WA 2BS2A 2IVEA 4J31A 2C72A 4JQ9A 3ZDNA 4J33A 4CRTA 4K5SA 5KRQA 3UP4A 3L8KA 2BC0A 2QA2A 3UKAA 4TM1A 3AXBA 1ZMDA 2A89A 4IA6A 1KF6A 3UKPA 5EBKA 4GR1A 2FBWA 4OPGA 4H7UA 2Q0LA 2YG6A 3KKJA 3NK0X 3T14A 2YLRA 2XVHA 1ZMCA 5HYMA 5KNLA 3AD7B 2GMJA 1EL9A 2FJDA 2GRTA 2GR2A 2WHDA 4OPTA 3VR9A 2CFYA 3CNTA 2XFPA 3DK4A 5BVAA 1ZY8A 3CPJG 3DMEA 4Y4NA 2WEUA 5JCMA 3NH3X 2C73A 1BGJA 1NPXA 1JRYA 1PJ7A 2GAGB 3ADAB 3CNDA 3NTDA 4JY3A 3DJGX 4I58A 2XFNA 4H4WA 4YSYA 1PDHA 4U8JA 1IUUA 1IJHA 4HA6A 2H89A 3NG7X 3UOYA 3GWDA 2YG5A 3ICSA 4C5OA 3BI5A 3EPTA 4B1BA 3RP7A 2XFOA 1N1PA 2WPCA 3WE0A 3NIXA 3OC4A 2YG3A 4II3A 2QA1A 4H4QA 2XLRA 1NG4A 1TYPA 4G9KA 1D4CA 4DSHA 3QSMA 2GQWA 1O5WA 4AP1A 4A5LA 1LJ1A 3UTGA 2ARDA 2V3AA 1FCDA 3EANA 4D04A 2GQFA 4Z25A 1COYA 1TYTA 3NTAA 2CULA 4J34A 4AP3A 2C3DA 3AE8A 1Q1WA 4UDPA 1BWCA 4H4VA 3Q9TA 4UDRA 3CGBA 4YKFA 5KXJA 3IF9A 4TM4A 1REOA 2YLXA 1GRHA 1M64A 1N4UA 3C4NA 1ZKQA 2E1MA 3OZ2A 3AE4A 4H2NA 3LXDA 1JU2A 4JDRA 3QFAA 1H7WA 1GRTA 2BC1A 5HHFA 2YR5A 1VQWA 1YQ4A 1S2QA 2A87A 4YWOA 1GESA 5HXIA 3KVEA 3CPIG 2WP9A 3ALLA 3KU9A 1FOHA 3HYVA 2EQ6A 3AWIA 3B3RA 3NLCA 4BK2A 1ZX9A 4I59A 1GETA 2XCGA 3AB1A 3GD4A 3QSEA 1DOEA 4DNAA 2XLTA 1K0IA 1JRXA 3KD9A 1IUWA 2WP6A 4X4JA 1YQZA 2EQ9A 4LIIA 1YY5A 2Q7VA 3NGCX 1NAAA 4H2RA 2BCGG 2X8HA 3AYIA 5GSNA 2C3CA 2WBAA 4A6NA 1QJDA 1XANA 1GV4A 2YVFA 2PYXA 4JN9A 5M0ZA 2VOUA 3UKFA 3UP5A 4LA1A 5KMPA 4CBQA 5JCNA 3E1TA 3REDA 2QAEA 4JNQA 1VRQB 3NHOX 4H4TA 3T2ZA 2R46A 1CHUA 2YLSA 5FS7A 4XWRA 2W0HA 4G6GA 4BJYA 3DK8A 1JNRA 3IC9A 3G5SA 5KVIA 4O5UA 2X8GA 2F5ZA 3QJ4A 4A65A 2I0ZA 4CCRA 2YVGA 3RNMA 2JB1A 2CDUA 1DNCA 1O94A 2OAMA 3F8RA 4H2QA 1F8SA 1RYIA 2XLPA 2QCUA 1HYUA 4CY6A 4Z24A 1GNDA 3NRNA 1NHPA 3LOVA 2XLUA 4ZCDA 3UKQA 1KSSA 2VZ2A 1LV0A 3AE7A 3K30A 2C64A 1FL2A 2YLWA 3H8LA 3KA7A 4EM3A 3AECA 4UP3A 3AE3A 2C7GA 4EMIA 1LVLA 4ZCCA 3AEEA 3DH9A 1CC4A 1H82A 1S3BA 3NK2X 4CCQA 1W4XA 2C65A 2ZZBA 4AOXA 1XHCA 4YXDA 4A9WA 2V60A 3SZWA 2R4EA 3P4RA 2XVEA 2GB0A 2WPEA 5C2TA 1PHHA 3CN8A 2WDVA 4K8DA 3NN0X 2JAEA 1NG3A 3RHAA 5JCKA 1F8WA 2APGA 3T2YA 3AEAA 4TLZA 5ER0A 5IPYA 1LQTA 1FECA 4APNA 3D1CA 1D4DA 2JBVA 2Y6QA 4WCTA 2JB2A 3PO7A 3H8IA 2ZZ0A 1NENA 2IVDA 3HYWA 4NNJA 2V61A 3UOVA 4Y4MA 2Q6UA 3S61A 5FS6A 1QO8A 3UKKA 3NYCA 3CGEA 1D4EA 2B7SA 2RGHA 1JOAA 4JY2A 3D8XA 4J2WA 1H83A 4EQRA 4TLXA 2YG4A 5J7XA 5FS9A 1LTXR 3SFDA 2AAQA 3LZWA 3UTEA 2B9YA 2HQMA 4B67A 4AOSA 1BKWA 1OJCA 3V76A 1D7YA 2DKHA 4TM3A 1B37A 1PXCA 5EOWA 1V59A 1Y56B 4U8MA 3NYEA 1DOBA 1TDKA 4USRA 5JCIA 4YT0A 2JKCA 2BS4A 2RABA 5DBJA 1FEBA 2WOVA 4B65A 4CY8A 4U8LA 1MXTA 1KNRA 1XDIA 3CGCA 4EMJA 3AE6A 4Z2RA 1CC6A 3NNEA 4EM4A 1PJ6A 3SGLA 3SYIA 2EQ8A 3F8PA 4RG4A 4A99A 1CBOA 1CJ3A 2V3BA 2VQBA 1GPEA 2GMHA 3DGHA 2GV8A 2VVMA 4IA5A 1CF3A 4OPCA 1E7PA 3NK1X 2J3NA 1GTHA 2VVLG 4H4RA 3FMWA 1H81A 4M52A 3GD3A 2XVFA 1H86A 4PABA 5C3JA 5CQFA 2GF3A 4JNAA 3PVCA 3IHGA 2R45A 4GRTA 3GDNA 4J57A 3C96A 3ATQA 3RP8A 1JEHA 4DGKA 2GH5A 1Z6LA 4FX9A 5U1OA 1GREA 4II2A 5KVHA 3UOXA 4FDCB 2WOIA 4A6NB 1NHSA 4D03A 3AE2A 2XVJA 3ZYXA 1GRAA 5U25A 4EQWA 4K2XA 2ZZCA 1L9CA 4DSGA 1K4QA 1KNPA 1YQ3A 2O9ZA 2YAUA 3SX6A 5KOWA 3DJDA 2V6OA 3SZFA 4B68A 1VG9A 1H84A 4BK1A 2YR4A 4EQXA 2XLSA 2V5ZA 3FG2P 3KLJA 3AEGA 1OJDA 4AT0A 3LB8A 3ATRA 3SZ0A 2E4GA 4USQA 3T0KA 5LV9A 2BRYA 4C3XA 3FIMB 4OPIA 3ALMA 1GXFA 2R9ZA 2WOWA 4OCGA 4TM0A 1TDEA 3DJEA 1ZP0A 4AT2A 3NT6A 4REKA 3CGDA 1S2YA 1CJ2A 4GAVA 3IWAA 4X9MA 1Q9IA 2H88A 4IV9A 2AQJA 1E1NA 4U8NA 3H4KA 4U2LA 3K7TA 4NEVA 2NPXA 3CIRA 5BUKA 3UTHA 4E0VA 5EB4A 2OLNA 3GWFA 4YSZA 1S3EA 1N4WA 3C4AA 4FK1C 2X99A 1H7XA 3AD8B 4H2PA 3CTYA 4IVMB 5HY5A 4GAPA 4G74A 4NZHA 3F8DA 3QSSA 4XWZA 4XXGA 2C70A 4B64A 3I3LA 1GT8A 2BXRA 1TDNA 2R0PA 3BI4A 4H4SA 4A7AA 5KMSA 4K22A 2BK3A 4Z2TA 2C4CA 2C76A 1LPFA 3GDPA 2JK6A 2BK4A 4MJWA 4NTCA 5FMHA 5IQ4A 1FEAA 2JB3A 2VRMA 1B5QA 3CNPA 5KWFA 1PXAA 1F3PA 1E1KA 5L46A 4KPRA 2ZBWA 1K0JA 3AEDA 1F8RA 1D7LA 4K7ZA 4J56A 3URHA 3B6DA 2GR0A 3QVRA 3BHFA 3T31A 1O95A 1PBFA 1QLBA 1DOCA 3AYJA 2YM1A 2GR1A 4NWZA 2BACA 3SZCA 5FS8A 1AOGA 3T37A 1L9EA 4Y4LA 4YTNA 4GDEA 3GMBA 2A8XA 3VRDB 3M13A 1B4VA 2Z5XA 4P9SA 1E1LA 1JNZA 1TDFA 3G5QA 3QFBA 4U8PA 4U8IA 2VRLA 1CL0A 1IUVA 1DXLA 2R4JA 2XFQA 2WPFA 3ISHA 2CVJA 1CJ4A 4NTEA 2C75A 3CMMA 4YTPA 4UDQA 1L9DA 4U8OA 3SM8A 3VR8A 1SEZA 3AD9B 1CJCA 2WETA 4N9XA 3SQPA 3CNSA 1JRZA 1ONFA 3P1WA 1F6MA 4G6HA 3KPFA 4OVIA 2WESA 2XFUA 4EMWA 3R9UA 4ADWA 2BXSA 4BK3A 4EIQA 1GRFA 3CPHG 1LQUA 1M6IA 1OJAA 4K5RA 1BF3A 3SXIA 1DJQA 3BNMA 1NHQA 2GVCA 3Q6JA 1TDOA 4U2SA 2X50A 5JCLA 2E5VA 2TMDA 3T2KA 5KOXA 5J60A 3V3NA 1EL5A 3IHMA 3BI2A 1ZDLA 1OJTA 4KX6A 3EAOA 3II4A 2IIDA 3EF6A 2BS3A 4A79A 4HB9A 3UKLA 2BRAA 3CNJA 1ZOVA 3P4SA 1VDCA 3V3OA 1PJ5A 2YG7A 4H4YA 4BV6A 3BHKA 3VRBA 1E6EA 2X3NA 2EQ7A 4J36A 2YLTA 2OALA 1MOKA 1MO9A 4OPDA 2FJEA 1CC2A 2R0CA 1PS9A 4GCMA 2XVIA 4LU6A 1ZK7A 4PAAA 4U2TA 1GERA 2GEWA 3GYXA 2UZZA
chains in the Genus database with same CATH topology
1IUXA 3M12A 3L1RA 1EL7A 3O0HA 5KMRA 3LADA 4B66A 2C67A 5EB5A 4EIPA 2PHHA 3DJJA 1EBDA 4Z26A 1XPQA 1PBBA 3K7QX 1NHRA 4NTDA 4YTMA 4H50A 2BYBA 1H6VA 1DODA 2BA9A 3AE5A 2BCPA 4YKGA 2Y6RA 3SY4A 5IQ1A 1NDAA 2B9XA 3G5RA 2B76A 2B7RA 2WU2A 2YM2A 1YKJA 3ITJA 4GUVA 3BNUA 3LJPA 2WU5A 3LZXA 1GOSA 3VRAA 4EQSA 1PBEA 4B63A 1Y56A 1B8SA 4H4ZA 2RGJA 1K0LA 3HYXA 3JSKA 4IVOB 1Q1RA 1PN0A 1KDGA 2BABA 2WS3A 2ACZA 5GRTA 2WP5A 2GAHB 2FJBA 2BK5A 1RP0A 4Z2UA 3UCLA 1EL8A 5BRTA 4ZN0A 3P9UA 2R0GA 1GALA 2NVKX 1ZOYA 4Z43A 1VG0A 4OPLA 1N4VA 3AE1A 3GRTA 1UKVG 3GYJA 1DJNA 2AR8A 2VVLA 1L0VA 3K7MX 3COXA 3ICTA 2XDOA 2RGOA 4NEWA 4C74A 3VQRA 3P4PA 1ELIA 3DK9A 2Q0KA 4G73A 4CNJA 1RSGA 4C77A 3NYFA 2FJAA 4FK1A 1PBDA 3DA1A 1BZLA 1Y0PA 2YR6A 3FBSA 3GSIA 2OLOA 5M10A 1GRGA 3UOZA 3S5WA 1OJ9A 2TPRA 1X31B 3SFEA 1PBCA 2YLZA 3GRSA 2OA1A 3HZLA 5KMQA 1IUTA 4YSXA 1PXBA 1D5TA 4YSHA 5TR3A 4BJZA 2C66A 2XYOA 2WDRA 5CKUA 4C3YA 4X9NA 3I6DA 3QVPA 1KSUA 3DGZA 3AYLA 2DKIA 1P2HA 1GEUA 1GRBA 1GSNA 2X8CA 1TRBA 3GYIA 2GR3A 3NKSA 4ICYA 5U63A 3AEFA 3UTFA 4Z44A 3ALJA 4H4UA 3ICRA 2WDQA 4ECHA 3AE9A 1GTEA 2VQ7A 4H4PA 2WQYA 4WX1A 1P2EA 3KPKA 3FPZA 3NN6X 1IUSA 3RP6A 1NEKA 3ABVA 1E39A 2YQUA 3AEBA 4RSLA 4GF7A 3PS9A 3GMCA 4U8KA 4H4XA 3UKHA 4RG3A 4O5QA 5BULA 1BGNA 1KFYA 2YVJA 3M0OA 4OPUA 3P4QA 4B69A 4BURA 1E1MA 2Z5YA 4GDPA 2YWLA 4CNKA 2B9WA 2BS2A 2IVEA 4J31A 2C72A 4JQ9A 3ZDNA 4J33A 4CRTA 4K5SA 5KRQA 3UP4A 3L8KA 2BC0A 2QA2A 3UKAA 4TM1A 3AXBA 1ZMDA 2A89A 4IA6A 1KF6A 3UKPA 5EBKA 4GR1A 2FBWA 4OPGA 4H7UA 2Q0LA 2YG6A 3KKJA 3NK0X 3T14A 2YLRA 2XVHA 1ZMCA 5HYMA 5KNLA 3AD7B 2GMJA 1EL9A 2FJDA 2GRTA 2GR2A 2WHDA 4OPTA 3VR9A 2CFYA 3CNTA 2XFPA 3DK4A 5BVAA 1ZY8A 3CPJG 3DMEA 4Y4NA 2WEUA 5JCMA 3NH3X 2C73A 1BGJA 1NPXA 1JRYA 1PJ7A 2GAGB 3ADAB 3CNDA 3NTDA 4JY3A 3DJGX 4I58A 2XFNA 4H4WA 4YSYA 1PDHA 4U8JA 1IUUA 1IJHA 4HA6A 2H89A 3NG7X 3UOYA 3GWDA 2YG5A 3ICSA 4C5OA 3BI5A 3EPTA 4B1BA 3RP7A 2XFOA 1N1PA 2WPCA 3WE0A 3NIXA 3OC4A 2YG3A 4II3A 2QA1A 4H4QA 2XLRA 1NG4A 1TYPA 4G9KA 1D4CA 4DSHA 3QSMA 2GQWA 1O5WA 4AP1A 4A5LA 1LJ1A 3UTGA 2ARDA 2V3AA 1FCDA 3EANA 4D04A 2GQFA 4Z25A 1COYA 1TYTA 3NTAA 2CULA 4J34A 4AP3A 2C3DA 3AE8A 1Q1WA 4UDPA 1BWCA 4H4VA 3Q9TA 4UDRA 3CGBA 4YKFA 5KXJA 3IF9A 4TM4A 1REOA 2YLXA 1GRHA 1M64A 1N4UA 3C4NA 1ZKQA 2E1MA 3OZ2A 3AE4A 4H2NA 3LXDA 1JU2A 4JDRA 3QFAA 1H7WA 1GRTA 2BC1A 5HHFA 2YR5A 1VQWA 1YQ4A 1S2QA 2A87A 4YWOA 1GESA 5HXIA 3KVEA 3CPIG 2WP9A 3ALLA 3KU9A 1FOHA 3HYVA 2EQ6A 3AWIA 3B3RA 3NLCA 4BK2A 1ZX9A 4I59A 1GETA 2XCGA 3AB1A 3GD4A 3QSEA 1DOEA 4DNAA 2XLTA 1K0IA 1JRXA 3KD9A 1IUWA 2WP6A 4X4JA 1YQZA 2EQ9A 4LIIA 1YY5A 2Q7VA 3NGCX 1NAAA 4H2RA 2BCGG 2X8HA 3AYIA 5GSNA 2C3CA 2WBAA 4A6NA 1QJDA 1XANA 1GV4A 2YVFA 2PYXA 4JN9A 5M0ZA 2VOUA 3UKFA 3UP5A 4LA1A 5KMPA 4CBQA 5JCNA 3E1TA 3REDA 2QAEA 4JNQA 1VRQB 3NHOX 4H4TA 3T2ZA 2R46A 1CHUA 2YLSA 5FS7A 4XWRA 2W0HA 4G6GA 4BJYA 3DK8A 1JNRA 3IC9A 3G5SA 5KVIA 4O5UA 2X8GA 2F5ZA 3QJ4A 4A65A 2I0ZA 4CCRA 2YVGA 3RNMA 2JB1A 2CDUA 1DNCA 1O94A 2OAMA 3F8RA 4H2QA 1F8SA 1RYIA 2XLPA 2QCUA 1HYUA 4CY6A 4Z24A 1GNDA 3NRNA 1NHPA 3LOVA 2XLUA 4ZCDA 3UKQA 1KSSA 2VZ2A 1LV0A 3AE7A 3K30A 2C64A 1FL2A 2YLWA 3H8LA 3KA7A 4EM3A 3AECA 4UP3A 3AE3A 2C7GA 4EMIA 1LVLA 4ZCCA 3AEEA 3DH9A 1CC4A 1H82A 1S3BA 3NK2X 4CCQA 1W4XA 2C65A 2ZZBA 4AOXA 1XHCA 4YXDA 4A9WA 2V60A 3SZWA 2R4EA 3P4RA 2XVEA 2GB0A 2WPEA 5C2TA 1PHHA 3CN8A 2WDVA 4K8DA 3NN0X 2JAEA 1NG3A 3RHAA 5JCKA 1F8WA 2APGA 3T2YA 3AEAA 4TLZA 5ER0A 5IPYA 1LQTA 1FECA 4APNA 3D1CA 1D4DA 2JBVA 2Y6QA 4WCTA 2JB2A 3PO7A 3H8IA 2ZZ0A 1NENA 2IVDA 3HYWA 4NNJA 2V61A 3UOVA 4Y4MA 2Q6UA 3S61A 5FS6A 1QO8A 3UKKA 3NYCA 3CGEA 1D4EA 2B7SA 2RGHA 1JOAA 4JY2A 3D8XA 4J2WA 1H83A 4EQRA 4TLXA 2YG4A 5J7XA 5FS9A 1LTXR 3SFDA 2AAQA 3LZWA 3UTEA 2B9YA 2HQMA 4B67A 4AOSA 1BKWA 1OJCA 3V76A 1D7YA 2DKHA 4TM3A 1B37A 1PXCA 5EOWA 1V59A 1Y56B 4U8MA 3NYEA 1DOBA 1TDKA 4USRA 5JCIA 4YT0A 2JKCA 2BS4A 2RABA 5DBJA 1FEBA 2WOVA 4B65A 4CY8A 4U8LA 1MXTA 1KNRA 1XDIA 3CGCA 4EMJA 3AE6A 4Z2RA 1CC6A 3NNEA 4EM4A 1PJ6A 3SGLA 3SYIA 2EQ8A 3F8PA 4RG4A 4A99A 1CBOA 1CJ3A 2V3BA 2VQBA 1GPEA 2GMHA 3DGHA 2GV8A 2VVMA 4IA5A 1CF3A 4OPCA 1E7PA 3NK1X 2J3NA 1GTHA 2VVLG 4H4RA 3FMWA 1H81A 4M52A 3GD3A 2XVFA 1H86A 4PABA 5C3JA 5CQFA 2GF3A 4JNAA 3PVCA 3IHGA 2R45A 4GRTA 3GDNA 4J57A 3C96A 3ATQA 3RP8A 1JEHA 4DGKA 2GH5A 1Z6LA 4FX9A 5U1OA 1GREA 4II2A 5KVHA 3UOXA 4FDCB 2WOIA 4A6NB 1NHSA 4D03A 3AE2A 2XVJA 3ZYXA 1GRAA 5U25A 4EQWA 4K2XA 2ZZCA 1L9CA 4DSGA 1K4QA 1KNPA 1YQ3A 2O9ZA 2YAUA 3SX6A 5KOWA 3DJDA 2V6OA 3SZFA 4B68A 1VG9A 1H84A 4BK1A 2YR4A 4EQXA 2XLSA 2V5ZA 3FG2P 3KLJA 3AEGA 1OJDA 4AT0A 3LB8A 3ATRA 3SZ0A 2E4GA 4USQA 3T0KA 5LV9A 2BRYA 4C3XA 3FIMB 4OPIA 3ALMA 1GXFA 2R9ZA 2WOWA 4OCGA 4TM0A 1TDEA 3DJEA 1ZP0A 4AT2A 3NT6A 4REKA 3CGDA 1S2YA 1CJ2A 4GAVA 3IWAA 4X9MA 1Q9IA 2H88A 4IV9A 2AQJA 1E1NA 4U8NA 3H4KA 4U2LA 3K7TA 4NEVA 2NPXA 3CIRA 5BUKA 3UTHA 4E0VA 5EB4A 2OLNA 3GWFA 4YSZA 1S3EA 1N4WA 3C4AA 4FK1C 2X99A 1H7XA 3AD8B 4H2PA 3CTYA 4IVMB 5HY5A 4GAPA 4G74A 4NZHA 3F8DA 3QSSA 4XWZA 4XXGA 2C70A 4B64A 3I3LA 1GT8A 2BXRA 1TDNA 2R0PA 3BI4A 4H4SA 4A7AA 5KMSA 4K22A 2BK3A 4Z2TA 2C4CA 2C76A 1LPFA 3GDPA 2JK6A 2BK4A 4MJWA 4NTCA 5FMHA 5IQ4A 1FEAA 2JB3A 2VRMA 1B5QA 3CNPA 5KWFA 1PXAA 1F3PA 1E1KA 5L46A 4KPRA 2ZBWA 1K0JA 3AEDA 1F8RA 1D7LA 4K7ZA 4J56A 3URHA 3B6DA 2GR0A 3QVRA 3BHFA 3T31A 1O95A 1PBFA 1QLBA 1DOCA 3AYJA 2YM1A 2GR1A 4NWZA 2BACA 3SZCA 5FS8A 1AOGA 3T37A 1L9EA 4Y4LA 4YTNA 4GDEA 3GMBA 2A8XA 3VRDB 3M13A 1B4VA 2Z5XA 4P9SA 1E1LA 1JNZA 1TDFA 3G5QA 3QFBA 4U8PA 4U8IA 2VRLA 1CL0A 1IUVA 1DXLA 2R4JA 2XFQA 2WPFA 3ISHA 2CVJA 1CJ4A 4NTEA 2C75A 3CMMA 4YTPA 4UDQA 1L9DA 4U8OA 3SM8A 3VR8A 1SEZA 3AD9B 1CJCA 2WETA 4N9XA 3SQPA 3CNSA 1JRZA 1ONFA 3P1WA 1F6MA 4G6HA 3KPFA 4OVIA 2WESA 2XFUA 4EMWA 3R9UA 4ADWA 2BXSA 4BK3A 4EIQA 1GRFA 3CPHG 1LQUA 1M6IA 1OJAA 4K5RA 1BF3A 3SXIA 1DJQA 3BNMA 1NHQA 2GVCA 3Q6JA 1TDOA 4U2SA 2X50A 5JCLA 2E5VA 2TMDA 3T2KA 5KOXA 5J60A 3V3NA 1EL5A 3IHMA 3BI2A 1ZDLA 1OJTA 4KX6A 3EAOA 3II4A 2IIDA 3EF6A 2BS3A 4A79A 4HB9A 3UKLA 2BRAA 3CNJA 1ZOVA 3P4SA 1VDCA 3V3OA 1PJ5A 2YG7A 4H4YA 4BV6A 3BHKA 3VRBA 1E6EA 2X3NA 2EQ7A 4J36A 2YLTA 2OALA 1MOKA 1MO9A 4OPDA 2FJEA 1CC2A 2R0CA 1PS9A 4GCMA 2XVIA 4LU6A 1ZK7A 4PAAA 4U2TA 1GERA 2GEWA 3GYXA 2UZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IUX A;  3M12 A;  3L1R A;  1EL7 A;  3O0H A;  3LAD A;  4B66 A;  2C67 A;  5EB5 A;  4EIP A;  2PHH A;  3DJJ A;  1EBD A;  4Z26 A;  1XPQ A;  1PBB A;  3K7Q X;  1NHR A;  4NTD A;  4YTM A;  4H50 A;  2BYB A;  1H6V A;  1DOD A;  2BA9 A;  3AE5 A;  2BCP A;  4YKG A;  2Y6R A;  5IQ1 A;  1NDA A;  2B9X A;  3G5R A;  2B76 A;  2B7R A;  2WU2 A;  2YM2 A;  1YKJ A;  3ITJ A;  4GUV A;  3BNU A;  3LJP A;  2WU5 A;  3LZX A;  1GOS A;  3VRA A;  4EQS A;  1PBE A;  4B63 A;  1Y56 A;  1B8S A;  4H4Z A;  2RGJ A;  1K0L A;  4IVO B;  3JSK A;  1Q1R A;  1PN0 A;  1KDG A;  2BAB A;  2WS3 A;  2ACZ A;  5GRT A;  2WP5 A;  2GAH B;  2FJB A;  2BK5 A;  1RP0 A;  4Z2U A;  3UCL A;  1EL8 A;  5BRT A;  4ZN0 A;  3P9U A;  2R0G A;  1GAL A;  2NVK X;  1ZOY A;  4Z43 A;  1VG0 A;  4OPL A;  1N4V A;  3AE1 A;  3GRT A;  1UKV G;  3GYJ A;  1DJN A;  2AR8 A;  2VVL A;  1L0V A;  3K7M X;  3COX A;  3ICT A;  2XDO A;  2RGO A;  4NEW A;  4C74 A;  3VQR A;  3P4P A;  1ELI A;  3DK9 A;  2Q0K A;  4CNJ A;  1RSG A;  4C77 A;  3NYF A;  2FJA A;  4FK1 A;  1PBD A;  3DA1 A;  1BZL A;  1Y0P A;  2YR6 A;  3FBS A;  3GSI A;  2OLO A;  5M10 A;  1GRG A;  3UOZ A;  3S5W A;  1OJ9 A;  2TPR A;  1X31 B;  3SFE A;  1PBC A;  2YLZ A;  3GRS A;  2OA1 A;  3HZL A;  4YSX A;  1IUT A;  1PXB A;  1D5T A;  4YSH A;  5TR3 A;  4BJZ A;  2C66 A;  2XYO A;  2WDR A;  5CKU A;  4C3Y A;  4X9N A;  3I6D A;  3QVP A;  1KSU A;  3DGZ A;  3AYL A;  2DKI A;  1P2H A;  1GEU A;  1GRB A;  1GSN A;  2X8C A;  1TRB A;  3GYI A;  2GR3 A;  3NKS A;  4ICY A;  5U63 A;  3AEF A;  3UTF A;  4Z44 A;  3ALJ A;  4H4U A;  3ICR A;  2WDQ A;  4ECH A;  3AE9 A;  1GTE A;  2VQ7 A;  4H4P A;  2WQY A;  4WX1 A;  1P2E A;  3FPZ A;  3NN6 X;  1IUS A;  3RP6 A;  1NEK A;  3ABV A;  1E39 A;  2YQU A;  3AEB A;  4RSL A;  4GF7 A;  3PS9 A;  3GMC A;  4U8K A;  4H4X A;  3UKH A;  4RG3 A;  4O5Q A;  5BUL A;  1BGN A;  1KFY A;  2YVJ A;  3M0O A;  4OPU A;  3P4Q A;  4B69 A;  4BUR A;  1E1M A;  2Z5Y A;  4GDP A;  2YWL A;  4CNK A;  2B9W A;  2BS2 A;  2IVE A;  4J31 A;  2C72 A;  4JQ9 A;  3ZDN A;  4J33 A;  4CRT A;  4K5S A;  5KRQ A;  3UP4 A;  3L8K A;  2BC0 A;  2QA2 A;  3UKA A;  4TM1 A;  3AXB A;  1ZMD A;  2A89 A;  4IA6 A;  1KF6 A;  3UKP A;  5EBK A;  4GR1 A;  2FBW A;  4OPG A;  4H7U A;  2Q0L A;  2YG6 A;  3KKJ A;  3NK0 X;  2YLR A;  2XVH A;  1ZMC A;  5HYM A;  3AD7 B;  2GMJ A;  1EL9 A;  2FJD A;  2GRT A;  2GR2 A;  2WHD A;  4OPT A;  3VR9 A;  2CFY A;  3CNT A;  2XFP A;  3DK4 A;  5BVA A;  1ZY8 A;  3CPJ G;  3DME A;  4Y4N A;  2WEU A;  5JCM A;  3NH3 X;  2C73 A;  1BGJ A;  1NPX A;  1JRY A;  1PJ7 A;  2GAG B;  3ADA B;  3CND A;  3NTD A;  4JY3 A;  3DJG X;  4I58 A;  2XFN A;  4H4W A;  4YSY A;  1PDH A;  4U8J A;  1IUU A;  1IJH A;  4HA6 A;  2H89 A;  3NG7 X;  3UOY A;  3GWD A;  2YG5 A;  3ICS A;  4C5O A;  3BI5 A;  3EPT A;  4B1B A;  3RP7 A;  2XFO A;  1N1P A;  2WPC A;  3WE0 A;  3NIX A;  3OC4 A;  2YG3 A;  2QA1 A;  4H4Q A;  2XLR A;  1NG4 A;  1TYP A;  1D4C A;  4DSH A;  3QSM A;  2GQW A;  1O5W A;  4AP1 A;  4A5L A;  1LJ1 A;  3UTG A;  2ARD A;  2V3A A;  1FCD A;  3EAN A;  4D04 A;  2GQF A;  4Z25 A;  1COY A;  1TYT A;  3NTA A;  2CUL A;  4J34 A;  4AP3 A;  2C3D A;  3AE8 A;  1Q1W A;  4UDP A;  1BWC A;  4H4V A;  3Q9T A;  4UDR A;  3CGB A;  4YKF A;  5KXJ A;  3IF9 A;  4TM4 A;  1REO A;  2YLX A;  1GRH A;  1M64 A;  1N4U A;  3C4N A;  1ZKQ A;  2E1M A;  3OZ2 A;  3AE4 A;  4H2N A;  3LXD A;  1JU2 A;  4JDR A;  3QFA A;  1H7W A;  1GRT A;  2BC1 A;  5HHF A;  2YR5 A;  1VQW A;  1YQ4 A;  1S2Q A;  2A87 A;  4YWO A;  1GES A;  5HXI A;  3KVE A;  3CPI G;  2WP9 A;  3ALL A;  3KU9 A;  1FOH A;  2EQ6 A;  3AWI A;  3B3R A;  3NLC A;  4BK2 A;  1ZX9 A;  4I59 A;  1GET A;  2XCG A;  3AB1 A;  3GD4 A;  3QSE A;  1DOE A;  4DNA A;  2XLT A;  1K0I A;  1JRX A;  3KD9 A;  1IUW A;  2WP6 A;  4X4J A;  1YQZ A;  2EQ9 A;  4LII A;  1YY5 A;  2Q7V A;  3NGC X;  1NAA A;  4H2R A;  2BCG G;  2X8H A;  3AYI A;  5GSN A;  2C3C A;  2WBA A;  4A6N A;  1QJD A;  1XAN A;  1GV4 A;  2YVF A;  2PYX A;  4JN9 A;  5M0Z A;  2VOU A;  3UKF A;  3UP5 A;  4LA1 A;  4CBQ A;  5JCN A;  3E1T A;  3RED A;  2QAE A;  4JNQ A;  1VRQ B;  3NHO X;  4H4T A;  2R46 A;  1CHU A;  2YLS A;  5FS7 A;  4XWR A;  2W0H A;  4BJY A;  3DK8 A;  1JNR A;  3IC9 A;  3G5S A;  5KVI A;  4O5U A;  2X8G A;  2F5Z A;  3QJ4 A;  4A65 A;  2I0Z A;  4CCR A;  2YVG A;  3RNM A;  2JB1 A;  2CDU A;  1DNC A;  1O94 A;  2OAM A;  3F8R A;  4H2Q A;  1F8S A;  1RYI A;  2XLP A;  2QCU A;  1HYU A;  4CY6 A;  4Z24 A;  1GND A;  3NRN A;  1NHP A;  3LOV A;  2XLU A;  4ZCD A;  3UKQ A;  1KSS A;  2VZ2 A;  1LV0 A;  3AE7 A;  3K30 A;  2C64 A;  1FL2 A;  2YLW A;  3H8L A;  3KA7 A;  4EM3 A;  3AEC A;  4UP3 A;  3AE3 A;  2C7G A;  4EMI A;  1LVL A;  4ZCC A;  3AEE A;  3DH9 A;  1CC4 A;  1H82 A;  1S3B A;  3NK2 X;  4CCQ A;  1W4X A;  2C65 A;  2ZZB A;  4AOX A;  1XHC A;  4YXD A;  4A9W A;  2V60 A;  2R4E A;  3P4R A;  2XVE A;  2GB0 A;  2WPE A;  5C2T A;  1PHH A;  3CN8 A;  2WDV A;  4K8D A;  3NN0 X;  2JAE A;  1NG3 A;  3RHA A;  5JCK A;  1F8W A;  2APG A;  3AEA A;  4TLZ A;  5ER0 A;  5IPY A;  1LQT A;  1FEC A;  4APN A;  3D1C A;  1D4D A;  2JBV A;  2Y6Q A;  4WCT A;  2JB2 A;  3PO7 A;  3H8I A;  2ZZ0 A;  1NEN A;  2IVD A;  2V61 A;  3UOV A;  4Y4M A;  2Q6U A;  3S61 A;  5FS6 A;  1QO8 A;  3UKK A;  3NYC A;  3CGE A;  1D4E A;  2B7S A;  2RGH A;  1JOA A;  4JY2 A;  3D8X A;  4J2W A;  1H83 A;  4EQR A;  4TLX A;  2YG4 A;  5J7X A;  5FS9 A;  1LTX R;  3SFD A;  2AAQ A;  3LZW A;  3UTE A;  2B9Y A;  2HQM A;  4B67 A;  4AOS A;  1BKW A;  1OJC A;  3V76 A;  1D7Y A;  2DKH A;  4TM3 A;  1B37 A;  1PXC A;  5EOW A;  1V59 A;  1Y56 B;  4U8M A;  3NYE A;  1DOB A;  1TDK A;  4USR A;  5JCI A;  4YT0 A;  2JKC A;  2BS4 A;  2RAB A;  5DBJ A;  1FEB A;  2WOV A;  4B65 A;  4CY8 A;  4U8L A;  1MXT A;  1KNR A;  1XDI A;  3CGC A;  4EMJ A;  3AE6 A;  4Z2R A;  1CC6 A;  3NNE A;  4EM4 A;  1PJ6 A;  3SGL A;  2EQ8 A;  3F8P A;  4RG4 A;  4A99 A;  1CBO A;  1CJ3 A;  2V3B A;  2VQB A;  1GPE A;  2GMH A;  3DGH A;  2GV8 A;  2VVM A;  4IA5 A;  1CF3 A;  4OPC A;  1E7P A;  3NK1 X;  2J3N A;  1GTH A;  2VVL G;  4H4R A;  3FMW A;  1H81 A;  4M52 A;  3GD3 A;  2XVF A;  1H86 A;  4PAB A;  5C3J A;  5CQF A;  2GF3 A;  4JNA A;  3PVC A;  3IHG A;  2R45 A;  4GRT A;  3GDN A;  4J57 A;  3C96 A;  3ATQ A;  3RP8 A;  1JEH A;  4DGK A;  2GH5 A;  1Z6L A;  4FX9 A;  5U1O A;  1GRE A;  5KVH A;  3UOX A;  4FDC B;  2WOI A;  4A6N B;  1NHS A;  4D03 A;  3AE2 A;  2XVJ A;  3ZYX A;  1GRA A;  5U25 A;  4EQW A;  4K2X A;  2ZZC A;  1L9C A;  4DSG A;  1K4Q A;  1KNP A;  1YQ3 A;  2O9Z A;  2YAU A;  5KOW A;  3DJD A;  2V6O A;  4B68 A;  1VG9 A;  1H84 A;  4BK1 A;  2YR4 A;  4EQX A;  2XLS A;  2V5Z A;  3FG2 P;  3KLJ A;  3AEG A;  1OJD A;  4AT0 A;  3LB8 A;  3ATR A;  2E4G A;  4USQ A;  5LV9 A;  4C3X A;  3FIM B;  4OPI A;  3ALM A;  1GXF A;  2R9Z A;  2WOW A;  4OCG A;  4TM0 A;  1TDE A;  3DJE A;  1ZP0 A;  4AT2 A;  3NT6 A;  4REK A;  3CGD A;  1S2Y A;  1CJ2 A;  3IWA A;  4X9M A;  1Q9I A;  2H88 A;  4IV9 A;  2AQJ A;  1E1N A;  4U8N A;  3H4K A;  4U2L A;  3K7T A;  4NEV A;  2NPX A;  3CIR A;  5BUK A;  3UTH A;  4E0V A;  5EB4 A;  2OLN A;  3GWF A;  4YSZ A;  1S3E A;  1N4W A;  3C4A A;  4FK1 C;  2X99 A;  1H7X A;  3AD8 B;  4H2P A;  3CTY A;  4IVM B;  5HY5 A;  4NZH A;  3F8D A;  3QSS A;  4XWZ A;  4XXG A;  2C70 A;  4B64 A;  3I3L A;  1GT8 A;  2BXR A;  1TDN A;  2R0P A;  3BI4 A;  4H4S A;  4A7A A;  4K22 A;  2BK3 A;  4Z2T A;  2C76 A;  1LPF A;  3GDP A;  2JK6 A;  2BK4 A;  4MJW A;  4NTC A;  5FMH A;  5IQ4 A;  1FEA A;  2JB3 A;  2VRM A;  1B5Q A;  3CNP A;  5KWF A;  1PXA A;  1F3P A;  1E1K A;  5L46 A;  4KPR A;  2ZBW A;  1K0J A;  3AED A;  1F8R A;  1D7L A;  4K7Z A;  4J56 A;  3URH A;  3B6D A;  2GR0 A;  3QVR A;  3BHF A;  1O95 A;  1PBF A;  1QLB A;  1DOC A;  3AYJ A;  2YM1 A;  2GR1 A;  2BAC A;  5FS8 A;  1AOG A;  3T37 A;  1L9E A;  4Y4L A;  4YTN A;  4GDE A;  3GMB A;  2A8X A;  3VRD B;  3M13 A;  1B4V A;  2Z5X A;  4P9S A;  1E1L A;  1JNZ A;  1TDF A;  3G5Q A;  3QFB A;  4U8P A;  4U8I A;  2VRL A;  1CL0 A;  1IUV A;  1DXL A;  2R4J A;  2XFQ A;  2WPF A;  3ISH A;  2CVJ A;  1CJ4 A;  4NTE A;  2C75 A;  4YTP A;  4UDQ A;  1L9D A;  4U8O A;  3SM8 A;  3VR8 A;  1SEZ A;  3AD9 B;  1CJC A;  2WET A;  4N9X A;  3SQP A;  3CNS A;  1JRZ A;  1ONF A;  3P1W A;  1F6M A;  3KPF A;  4OVI A;  2WES A;  2XFU A;  4EMW A;  3R9U A;  4ADW A;  2BXS A;  4BK3 A;  4EIQ A;  1GRF A;  3CPH G;  1LQU A;  1M6I A;  1OJA A;  4K5R A;  1BF3 A;  1DJQ A;  3BNM A;  1NHQ A;  2GVC A;  3Q6J A;  1TDO A;  4U2S A;  2X50 A;  5JCL A;  2E5V A;  2TMD A;  5KOX A;  5J60 A;  3V3N A;  1EL5 A;  3IHM A;  3BI2 A;  1ZDL A;  1OJT A;  4KX6 A;  3EAO A;  3II4 A;  2IID A;  3EF6 A;  2BS3 A;  4A79 A;  4HB9 A;  3UKL A;  3CNJ A;  1ZOV A;  3P4S A;  1VDC A;  3V3O A;  1PJ5 A;  2YG7 A;  4H4Y A;  4BV6 A;  3BHK A;  3VRB A;  1E6E A;  2X3N A;  2EQ7 A;  4J36 A;  2YLT A;  2OAL A;  1MOK A;  1MO9 A;  4OPD A;  2FJE A;  1CC2 A;  2R0C A;  1PS9 A;  4GCM A;  2XVI A;  4LU6 A;  1ZK7 A;  4PAA A;  4U2T A;  1GER A;  2GEW A;  2UZZ A; 
#chains in the Genus database with same CATH topology
 1IUX A;  3M12 A;  3L1R A;  1EL7 A;  3O0H A;  5KMR A;  3LAD A;  4B66 A;  2C67 A;  5EB5 A;  4EIP A;  2PHH A;  3DJJ A;  1EBD A;  4Z26 A;  1XPQ A;  1PBB A;  3K7Q X;  1NHR A;  4NTD A;  4YTM A;  4H50 A;  2BYB A;  1H6V A;  1DOD A;  2BA9 A;  3AE5 A;  2BCP A;  4YKG A;  2Y6R A;  3SY4 A;  5IQ1 A;  1NDA A;  2B9X A;  3G5R A;  2B76 A;  2B7R A;  2WU2 A;  2YM2 A;  1YKJ A;  3ITJ A;  4GUV A;  3BNU A;  3LJP A;  2WU5 A;  3LZX A;  1GOS A;  3VRA A;  4EQS A;  1PBE A;  4B63 A;  1Y56 A;  1B8S A;  4H4Z A;  2RGJ A;  1K0L A;  3HYX A;  3JSK A;  4IVO B;  1Q1R A;  1PN0 A;  1KDG A;  2BAB A;  2WS3 A;  2ACZ A;  5GRT A;  2WP5 A;  2GAH B;  2FJB A;  2BK5 A;  1RP0 A;  4Z2U A;  3UCL A;  1EL8 A;  5BRT A;  4ZN0 A;  3P9U A;  2R0G A;  1GAL A;  2NVK X;  1ZOY A;  4Z43 A;  1VG0 A;  4OPL A;  1N4V A;  3AE1 A;  3GRT A;  1UKV G;  3GYJ A;  1DJN A;  2AR8 A;  2VVL A;  1L0V A;  3K7M X;  3COX A;  3ICT A;  2XDO A;  2RGO A;  4NEW A;  4C74 A;  3VQR A;  3P4P A;  1ELI A;  3DK9 A;  2Q0K A;  4G73 A;  4CNJ A;  1RSG A;  4C77 A;  3NYF A;  2FJA A;  4FK1 A;  1PBD A;  3DA1 A;  1BZL A;  1Y0P A;  2YR6 A;  3FBS A;  3GSI A;  2OLO A;  5M10 A;  1GRG A;  3UOZ A;  3S5W A;  1OJ9 A;  2TPR A;  1X31 B;  3SFE A;  1PBC A;  2YLZ A;  3GRS A;  2OA1 A;  3HZL A;  5KMQ A;  1IUT A;  4YSX A;  1PXB A;  1D5T A;  4YSH A;  5TR3 A;  4BJZ A;  2C66 A;  2XYO A;  2WDR A;  5CKU A;  4C3Y A;  4X9N A;  3I6D A;  3QVP A;  1KSU A;  3DGZ A;  3AYL A;  2DKI A;  1P2H A;  1GEU A;  1GRB A;  1GSN A;  2X8C A;  1TRB A;  3GYI A;  2GR3 A;  3NKS A;  4ICY A;  5U63 A;  3AEF A;  3UTF A;  4Z44 A;  3ALJ A;  4H4U A;  3ICR A;  2WDQ A;  4ECH A;  3AE9 A;  1GTE A;  2VQ7 A;  4H4P A;  2WQY A;  4WX1 A;  1P2E A;  3KPK A;  3FPZ A;  3NN6 X;  1IUS A;  3RP6 A;  1NEK A;  3ABV A;  1E39 A;  2YQU A;  3AEB A;  4RSL A;  4GF7 A;  3PS9 A;  3GMC A;  4U8K A;  4H4X A;  3UKH A;  4RG3 A;  4O5Q A;  5BUL A;  1BGN A;  1KFY A;  2YVJ A;  3M0O A;  4OPU A;  3P4Q A;  4B69 A;  4BUR A;  1E1M A;  2Z5Y A;  4GDP A;  2YWL A;  4CNK A;  2B9W A;  2BS2 A;  2IVE A;  4J31 A;  2C72 A;  4JQ9 A;  3ZDN A;  4J33 A;  4CRT A;  4K5S A;  5KRQ A;  3UP4 A;  3L8K A;  2BC0 A;  2QA2 A;  3UKA A;  4TM1 A;  3AXB A;  1ZMD A;  2A89 A;  4IA6 A;  1KF6 A;  3UKP A;  5EBK A;  4GR1 A;  2FBW A;  4OPG A;  4H7U A;  2Q0L A;  2YG6 A;  3KKJ A;  3NK0 X;  3T14 A;  2YLR A;  2XVH A;  1ZMC A;  5HYM A;  5KNL A;  3AD7 B;  2GMJ A;  1EL9 A;  2FJD A;  2GRT A;  2GR2 A;  2WHD A;  4OPT A;  3VR9 A;  2CFY A;  3CNT A;  2XFP A;  3DK4 A;  5BVA A;  1ZY8 A;  3CPJ G;  3DME A;  4Y4N A;  2WEU A;  5JCM A;  3NH3 X;  2C73 A;  1BGJ A;  1NPX A;  1JRY A;  1PJ7 A;  2GAG B;  3ADA B;  3CND A;  3NTD A;  4JY3 A;  3DJG X;  4I58 A;  2XFN A;  4H4W A;  4YSY A;  1PDH A;  4U8J A;  1IUU A;  1IJH A;  4HA6 A;  2H89 A;  3NG7 X;  3UOY A;  3GWD A;  2YG5 A;  3ICS A;  4C5O A;  3BI5 A;  3EPT A;  4B1B A;  3RP7 A;  2XFO A;  1N1P A;  2WPC A;  3WE0 A;  3NIX A;  3OC4 A;  2YG3 A;  4II3 A;  2QA1 A;  4H4Q A;  2XLR A;  1NG4 A;  1TYP A;  4G9K A;  1D4C A;  4DSH A;  3QSM A;  2GQW A;  1O5W A;  4AP1 A;  4A5L A;  1LJ1 A;  3UTG A;  2ARD A;  2V3A A;  1FCD A;  3EAN A;  4D04 A;  2GQF A;  4Z25 A;  1COY A;  1TYT A;  3NTA A;  2CUL A;  4J34 A;  4AP3 A;  2C3D A;  3AE8 A;  1Q1W A;  4UDP A;  1BWC A;  4H4V A;  3Q9T A;  4UDR A;  3CGB A;  4YKF A;  5KXJ A;  3IF9 A;  4TM4 A;  1REO A;  2YLX A;  1GRH A;  1M64 A;  1N4U A;  3C4N A;  1ZKQ A;  2E1M A;  3OZ2 A;  3AE4 A;  4H2N A;  3LXD A;  1JU2 A;  4JDR A;  3QFA A;  1H7W A;  1GRT A;  2BC1 A;  5HHF A;  2YR5 A;  1VQW A;  1YQ4 A;  1S2Q A;  2A87 A;  4YWO A;  1GES A;  5HXI A;  3KVE A;  3CPI G;  2WP9 A;  3ALL A;  3KU9 A;  1FOH A;  3HYV A;  2EQ6 A;  3AWI A;  3B3R A;  3NLC A;  4BK2 A;  1ZX9 A;  4I59 A;  1GET A;  2XCG A;  3AB1 A;  3GD4 A;  3QSE A;  1DOE A;  4DNA A;  2XLT A;  1K0I A;  1JRX A;  3KD9 A;  1IUW A;  2WP6 A;  4X4J A;  1YQZ A;  2EQ9 A;  4LII A;  1YY5 A;  2Q7V A;  3NGC X;  1NAA A;  4H2R A;  2BCG G;  2X8H A;  3AYI A;  5GSN A;  2C3C A;  2WBA A;  4A6N A;  1QJD A;  1XAN A;  1GV4 A;  2YVF A;  2PYX A;  4JN9 A;  5M0Z A;  2VOU A;  3UKF A;  3UP5 A;  4LA1 A;  5KMP A;  4CBQ A;  5JCN A;  3E1T A;  3RED A;  2QAE A;  4JNQ A;  1VRQ B;  3NHO X;  4H4T A;  3T2Z A;  2R46 A;  1CHU A;  2YLS A;  5FS7 A;  4XWR A;  2W0H A;  4G6G A;  4BJY A;  3DK8 A;  1JNR A;  3IC9 A;  3G5S A;  5KVI A;  4O5U A;  2X8G A;  2F5Z A;  3QJ4 A;  4A65 A;  2I0Z A;  4CCR A;  2YVG A;  3RNM A;  2JB1 A;  2CDU A;  1DNC A;  1O94 A;  2OAM A;  3F8R A;  4H2Q A;  1F8S A;  1RYI A;  2XLP A;  2QCU A;  1HYU A;  4CY6 A;  4Z24 A;  1GND A;  3NRN A;  1NHP A;  3LOV A;  2XLU A;  4ZCD A;  3UKQ A;  1KSS A;  2VZ2 A;  1LV0 A;  3AE7 A;  3K30 A;  2C64 A;  1FL2 A;  2YLW A;  3H8L A;  3KA7 A;  4EM3 A;  3AEC A;  4UP3 A;  3AE3 A;  2C7G A;  4EMI A;  1LVL A;  4ZCC A;  3AEE A;  3DH9 A;  1CC4 A;  1H82 A;  1S3B A;  3NK2 X;  4CCQ A;  1W4X A;  2C65 A;  2ZZB A;  4AOX A;  1XHC A;  4YXD A;  4A9W A;  2V60 A;  3SZW A;  2R4E A;  3P4R A;  2XVE A;  2GB0 A;  2WPE A;  5C2T A;  1PHH A;  3CN8 A;  2WDV A;  4K8D A;  3NN0 X;  2JAE A;  1NG3 A;  3RHA A;  5JCK A;  1F8W A;  2APG A;  3T2Y A;  3AEA A;  4TLZ A;  5ER0 A;  5IPY A;  1LQT A;  1FEC A;  4APN A;  3D1C A;  1D4D A;  2JBV A;  2Y6Q A;  4WCT A;  2JB2 A;  3PO7 A;  3H8I A;  2ZZ0 A;  1NEN A;  2IVD A;  3HYW A;  4NNJ A;  2V61 A;  3UOV A;  4Y4M A;  2Q6U A;  3S61 A;  5FS6 A;  1QO8 A;  3UKK A;  3NYC A;  3CGE A;  1D4E A;  2B7S A;  2RGH A;  1JOA A;  4JY2 A;  3D8X A;  4J2W A;  1H83 A;  4EQR A;  4TLX A;  2YG4 A;  5J7X A;  5FS9 A;  1LTX R;  3SFD A;  2AAQ A;  3LZW A;  3UTE A;  2B9Y A;  2HQM A;  4B67 A;  4AOS A;  1BKW A;  1OJC A;  3V76 A;  1D7Y A;  2DKH A;  4TM3 A;  1B37 A;  1PXC A;  5EOW A;  1V59 A;  1Y56 B;  4U8M A;  3NYE A;  1DOB A;  1TDK A;  4USR A;  5JCI A;  4YT0 A;  2JKC A;  2BS4 A;  2RAB A;  5DBJ A;  1FEB A;  2WOV A;  4B65 A;  4CY8 A;  4U8L A;  1MXT A;  1KNR A;  1XDI A;  3CGC A;  4EMJ A;  3AE6 A;  4Z2R A;  1CC6 A;  3NNE A;  4EM4 A;  1PJ6 A;  3SGL A;  3SYI A;  2EQ8 A;  3F8P A;  4RG4 A;  4A99 A;  1CBO A;  1CJ3 A;  2V3B A;  2VQB A;  1GPE A;  2GMH A;  3DGH A;  2GV8 A;  2VVM A;  4IA5 A;  1CF3 A;  4OPC A;  1E7P A;  3NK1 X;  2J3N A;  1GTH A;  2VVL G;  4H4R A;  3FMW A;  1H81 A;  4M52 A;  3GD3 A;  2XVF A;  1H86 A;  4PAB A;  5C3J A;  5CQF A;  2GF3 A;  4JNA A;  3PVC A;  3IHG A;  2R45 A;  4GRT A;  3GDN A;  4J57 A;  3C96 A;  3ATQ A;  3RP8 A;  1JEH A;  4DGK A;  2GH5 A;  1Z6L A;  4FX9 A;  5U1O A;  1GRE A;  4II2 A;  5KVH A;  3UOX A;  4FDC B;  2WOI A;  4A6N B;  1NHS A;  4D03 A;  3AE2 A;  2XVJ A;  3ZYX A;  1GRA A;  5U25 A;  4EQW A;  4K2X A;  2ZZC A;  1L9C A;  4DSG A;  1K4Q A;  1KNP A;  1YQ3 A;  2O9Z A;  2YAU A;  3SX6 A;  5KOW A;  3DJD A;  2V6O A;  3SZF A;  4B68 A;  1VG9 A;  1H84 A;  4BK1 A;  2YR4 A;  4EQX A;  2XLS A;  2V5Z A;  3FG2 P;  3KLJ A;  3AEG A;  1OJD A;  4AT0 A;  3LB8 A;  3ATR A;  3SZ0 A;  2E4G A;  4USQ A;  3T0K A;  5LV9 A;  2BRY A;  4C3X A;  3FIM B;  4OPI A;  3ALM A;  1GXF A;  2R9Z A;  2WOW A;  4OCG A;  4TM0 A;  1TDE A;  3DJE A;  1ZP0 A;  4AT2 A;  3NT6 A;  4REK A;  3CGD A;  1S2Y A;  1CJ2 A;  4GAV A;  3IWA A;  4X9M A;  1Q9I A;  2H88 A;  4IV9 A;  2AQJ A;  1E1N A;  4U8N A;  3H4K A;  4U2L A;  3K7T A;  4NEV A;  2NPX A;  3CIR A;  5BUK A;  3UTH A;  4E0V A;  5EB4 A;  2OLN A;  3GWF A;  4YSZ A;  1S3E A;  1N4W A;  3C4A A;  4FK1 C;  2X99 A;  1H7X A;  3AD8 B;  4H2P A;  3CTY A;  4IVM B;  5HY5 A;  4GAP A;  4G74 A;  4NZH A;  3F8D A;  3QSS A;  4XWZ A;  4XXG A;  2C70 A;  4B64 A;  3I3L A;  1GT8 A;  2BXR A;  1TDN A;  2R0P A;  3BI4 A;  4H4S A;  4A7A A;  5KMS A;  4K22 A;  2BK3 A;  4Z2T A;  2C4C A;  2C76 A;  1LPF A;  3GDP A;  2JK6 A;  2BK4 A;  4MJW A;  4NTC A;  5FMH A;  5IQ4 A;  1FEA A;  2JB3 A;  2VRM A;  1B5Q A;  3CNP A;  5KWF A;  1PXA A;  1F3P A;  1E1K A;  5L46 A;  4KPR A;  2ZBW A;  1K0J A;  3AED A;  1F8R A;  1D7L A;  4K7Z A;  4J56 A;  3URH A;  3B6D A;  2GR0 A;  3QVR A;  3BHF A;  3T31 A;  1O95 A;  1PBF A;  1QLB A;  1DOC A;  3AYJ A;  2YM1 A;  2GR1 A;  4NWZ A;  2BAC A;  3SZC A;  5FS8 A;  1AOG A;  3T37 A;  1L9E A;  4Y4L A;  4YTN A;  4GDE A;  3GMB A;  2A8X A;  3VRD B;  3M13 A;  1B4V A;  2Z5X A;  4P9S A;  1E1L A;  1JNZ A;  1TDF A;  3G5Q A;  3QFB A;  4U8P A;  4U8I A;  2VRL A;  1CL0 A;  1IUV A;  1DXL A;  2R4J A;  2XFQ A;  2WPF A;  3ISH A;  2CVJ A;  1CJ4 A;  4NTE A;  2C75 A;  3CMM A;  4YTP A;  4UDQ A;  1L9D A;  4U8O A;  3SM8 A;  3VR8 A;  1SEZ A;  3AD9 B;  1CJC A;  2WET A;  4N9X A;  3SQP A;  3CNS A;  1JRZ A;  1ONF A;  3P1W A;  1F6M A;  4G6H A;  3KPF A;  4OVI A;  2WES A;  2XFU A;  4EMW A;  3R9U A;  4ADW A;  2BXS A;  4BK3 A;  4EIQ A;  1GRF A;  3CPH G;  1LQU A;  1M6I A;  1OJA A;  4K5R A;  1BF3 A;  3SXI A;  1DJQ A;  3BNM A;  1NHQ A;  2GVC A;  3Q6J A;  1TDO A;  4U2S A;  2X50 A;  5JCL A;  2E5V A;  2TMD A;  3T2K A;  5KOX A;  5J60 A;  3V3N A;  1EL5 A;  3IHM A;  3BI2 A;  1ZDL A;  1OJT A;  4KX6 A;  3EAO A;  3II4 A;  2IID A;  3EF6 A;  2BS3 A;  4A79 A;  4HB9 A;  3UKL A;  2BRA A;  3CNJ A;  1ZOV A;  3P4S A;  1VDC A;  3V3O A;  1PJ5 A;  2YG7 A;  4H4Y A;  4BV6 A;  3BHK A;  3VRB A;  1E6E A;  2X3N A;  2EQ7 A;  4J36 A;  2YLT A;  2OAL A;  1MOK A;  1MO9 A;  4OPD A;  2FJE A;  1CC2 A;  2R0C A;  1PS9 A;  4GCM A;  2XVI A;  4LU6 A;  1ZK7 A;  4PAA A;  4U2T A;  1GER A;  2GEW A;  3GYX A;  2UZZ A; 
#chains in the Genus database with same CATH homology
 1IUX A;  3M12 A;  3L1R A;  1EL7 A;  3O0H A;  5KMR A;  3LAD A;  4B66 A;  2C67 A;  5EB5 A;  4EIP A;  2PHH A;  3DJJ A;  1EBD A;  4Z26 A;  1XPQ A;  1PBB A;  3K7Q X;  1NHR A;  4NTD A;  4YTM A;  4H50 A;  2BYB A;  1H6V A;  1DOD A;  2BA9 A;  3AE5 A;  2BCP A;  4YKG A;  2Y6R A;  3SY4 A;  5IQ1 A;  1NDA A;  2B9X A;  3G5R A;  2B76 A;  2B7R A;  2WU2 A;  2YM2 A;  1YKJ A;  3ITJ A;  4GUV A;  3BNU A;  3LJP A;  2WU5 A;  3LZX A;  1GOS A;  3VRA A;  4EQS A;  1PBE A;  4B63 A;  1Y56 A;  1B8S A;  4H4Z A;  2RGJ A;  1K0L A;  3HYX A;  3JSK A;  4IVO B;  1Q1R A;  1PN0 A;  1KDG A;  2BAB A;  2WS3 A;  2ACZ A;  5GRT A;  2WP5 A;  2GAH B;  2FJB A;  2BK5 A;  1RP0 A;  4Z2U A;  3UCL A;  1EL8 A;  5BRT A;  4ZN0 A;  3P9U A;  2R0G A;  1GAL A;  2NVK X;  1ZOY A;  4Z43 A;  1VG0 A;  4OPL A;  1N4V A;  3AE1 A;  3GRT A;  1UKV G;  3GYJ A;  1DJN A;  2AR8 A;  2VVL A;  1L0V A;  3K7M X;  3COX A;  3ICT A;  2XDO A;  2RGO A;  4NEW A;  4C74 A;  3VQR A;  3P4P A;  1ELI A;  3DK9 A;  2Q0K A;  4G73 A;  4CNJ A;  1RSG A;  4C77 A;  3NYF A;  2FJA A;  4FK1 A;  1PBD A;  3DA1 A;  1BZL A;  1Y0P A;  2YR6 A;  3FBS A;  3GSI A;  2OLO A;  5M10 A;  1GRG A;  3UOZ A;  3S5W A;  1OJ9 A;  2TPR A;  1X31 B;  3SFE A;  1PBC A;  2YLZ A;  3GRS A;  2OA1 A;  3HZL A;  5KMQ A;  1IUT A;  4YSX A;  1PXB A;  1D5T A;  4YSH A;  5TR3 A;  4BJZ A;  2C66 A;  2XYO A;  2WDR A;  5CKU A;  4C3Y A;  4X9N A;  3I6D A;  3QVP A;  1KSU A;  3DGZ A;  3AYL A;  2DKI A;  1P2H A;  1GEU A;  1GRB A;  1GSN A;  2X8C A;  1TRB A;  3GYI A;  2GR3 A;  3NKS A;  4ICY A;  5U63 A;  3AEF A;  3UTF A;  4Z44 A;  3ALJ A;  4H4U A;  3ICR A;  2WDQ A;  4ECH A;  3AE9 A;  1GTE A;  2VQ7 A;  4H4P A;  2WQY A;  4WX1 A;  1P2E A;  3KPK A;  3FPZ A;  3NN6 X;  1IUS A;  3RP6 A;  1NEK A;  3ABV A;  1E39 A;  2YQU A;  3AEB A;  4RSL A;  4GF7 A;  3PS9 A;  3GMC A;  4U8K A;  4H4X A;  3UKH A;  4RG3 A;  4O5Q A;  5BUL A;  1BGN A;  1KFY A;  2YVJ A;  3M0O A;  4OPU A;  3P4Q A;  4B69 A;  4BUR A;  1E1M A;  2Z5Y A;  4GDP A;  2YWL A;  4CNK A;  2B9W A;  2BS2 A;  2IVE A;  4J31 A;  2C72 A;  4JQ9 A;  3ZDN A;  4J33 A;  4CRT A;  4K5S A;  5KRQ A;  3UP4 A;  3L8K A;  2BC0 A;  2QA2 A;  3UKA A;  4TM1 A;  3AXB A;  1ZMD A;  2A89 A;  4IA6 A;  1KF6 A;  3UKP A;  5EBK A;  4GR1 A;  2FBW A;  4OPG A;  4H7U A;  2Q0L A;  2YG6 A;  3KKJ A;  3NK0 X;  3T14 A;  2YLR A;  2XVH A;  1ZMC A;  5HYM A;  5KNL A;  3AD7 B;  2GMJ A;  1EL9 A;  2FJD A;  2GRT A;  2GR2 A;  2WHD A;  4OPT A;  3VR9 A;  2CFY A;  3CNT A;  2XFP A;  3DK4 A;  5BVA A;  1ZY8 A;  3CPJ G;  3DME A;  4Y4N A;  2WEU A;  5JCM A;  3NH3 X;  2C73 A;  1BGJ A;  1NPX A;  1JRY A;  1PJ7 A;  2GAG B;  3ADA B;  3CND A;  3NTD A;  4JY3 A;  3DJG X;  4I58 A;  2XFN A;  4H4W A;  4YSY A;  1PDH A;  4U8J A;  1IUU A;  1IJH A;  4HA6 A;  2H89 A;  3NG7 X;  3UOY A;  3GWD A;  2YG5 A;  3ICS A;  4C5O A;  3BI5 A;  3EPT A;  4B1B A;  3RP7 A;  2XFO A;  1N1P A;  2WPC A;  3WE0 A;  3NIX A;  3OC4 A;  2YG3 A;  4II3 A;  2QA1 A;  4H4Q A;  2XLR A;  1NG4 A;  1TYP A;  4G9K A;  1D4C A;  4DSH A;  3QSM A;  2GQW A;  1O5W A;  4AP1 A;  4A5L A;  1LJ1 A;  3UTG A;  2ARD A;  2V3A A;  1FCD A;  3EAN A;  4D04 A;  2GQF A;  4Z25 A;  1COY A;  1TYT A;  3NTA A;  2CUL A;  4J34 A;  4AP3 A;  2C3D A;  3AE8 A;  1Q1W A;  4UDP A;  1BWC A;  4H4V A;  3Q9T A;  4UDR A;  3CGB A;  4YKF A;  5KXJ A;  3IF9 A;  4TM4 A;  1REO A;  2YLX A;  1GRH A;  1M64 A;  1N4U A;  3C4N A;  1ZKQ A;  2E1M A;  3OZ2 A;  3AE4 A;  4H2N A;  3LXD A;  1JU2 A;  4JDR A;  3QFA A;  1H7W A;  1GRT A;  2BC1 A;  5HHF A;  2YR5 A;  1VQW A;  1YQ4 A;  1S2Q A;  2A87 A;  4YWO A;  1GES A;  5HXI A;  3KVE A;  3CPI G;  2WP9 A;  3ALL A;  3KU9 A;  1FOH A;  3HYV A;  2EQ6 A;  3AWI A;  3B3R A;  3NLC A;  4BK2 A;  1ZX9 A;  4I59 A;  1GET A;  2XCG A;  3AB1 A;  3GD4 A;  3QSE A;  1DOE A;  4DNA A;  2XLT A;  1K0I A;  1JRX A;  3KD9 A;  1IUW A;  2WP6 A;  4X4J A;  1YQZ A;  2EQ9 A;  4LII A;  1YY5 A;  2Q7V A;  3NGC X;  1NAA A;  4H2R A;  2BCG G;  2X8H A;  3AYI A;  5GSN A;  2C3C A;  2WBA A;  4A6N A;  1QJD A;  1XAN A;  1GV4 A;  2YVF A;  2PYX A;  4JN9 A;  5M0Z A;  2VOU A;  3UKF A;  3UP5 A;  4LA1 A;  5KMP A;  4CBQ A;  5JCN A;  3E1T A;  3RED A;  2QAE A;  4JNQ A;  1VRQ B;  3NHO X;  4H4T A;  3T2Z A;  2R46 A;  1CHU A;  2YLS A;  5FS7 A;  4XWR A;  2W0H A;  4G6G A;  4BJY A;  3DK8 A;  1JNR A;  3IC9 A;  3G5S A;  5KVI A;  4O5U A;  2X8G A;  2F5Z A;  3QJ4 A;  4A65 A;  2I0Z A;  4CCR A;  2YVG A;  3RNM A;  2JB1 A;  2CDU A;  1DNC A;  1O94 A;  2OAM A;  3F8R A;  4H2Q A;  1F8S A;  1RYI A;  2XLP A;  2QCU A;  1HYU A;  4CY6 A;  4Z24 A;  1GND A;  3NRN A;  1NHP A;  3LOV A;  2XLU A;  4ZCD A;  3UKQ A;  1KSS A;  2VZ2 A;  1LV0 A;  3AE7 A;  3K30 A;  2C64 A;  1FL2 A;  2YLW A;  3H8L A;  3KA7 A;  4EM3 A;  3AEC A;  4UP3 A;  3AE3 A;  2C7G A;  4EMI A;  1LVL A;  4ZCC A;  3AEE A;  3DH9 A;  1CC4 A;  1H82 A;  1S3B A;  3NK2 X;  4CCQ A;  1W4X A;  2C65 A;  2ZZB A;  4AOX A;  1XHC A;  4YXD A;  4A9W A;  2V60 A;  3SZW A;  2R4E A;  3P4R A;  2XVE A;  2GB0 A;  2WPE A;  5C2T A;  1PHH A;  3CN8 A;  2WDV A;  4K8D A;  3NN0 X;  2JAE A;  1NG3 A;  3RHA A;  5JCK A;  1F8W A;  2APG A;  3T2Y A;  3AEA A;  4TLZ A;  5ER0 A;  5IPY A;  1LQT A;  1FEC A;  4APN A;  3D1C A;  1D4D A;  2JBV A;  2Y6Q A;  4WCT A;  2JB2 A;  3PO7 A;  3H8I A;  2ZZ0 A;  1NEN A;  2IVD A;  3HYW A;  4NNJ A;  2V61 A;  3UOV A;  4Y4M A;  2Q6U A;  3S61 A;  5FS6 A;  1QO8 A;  3UKK A;  3NYC A;  3CGE A;  1D4E A;  2B7S A;  2RGH A;  1JOA A;  4JY2 A;  3D8X A;  4J2W A;  1H83 A;  4EQR A;  4TLX A;  2YG4 A;  5J7X A;  5FS9 A;  1LTX R;  3SFD A;  2AAQ A;  3LZW A;  3UTE A;  2B9Y A;  2HQM A;  4B67 A;  4AOS A;  1BKW A;  1OJC A;  3V76 A;  1D7Y A;  2DKH A;  4TM3 A;  1B37 A;  1PXC A;  5EOW A;  1V59 A;  1Y56 B;  4U8M A;  3NYE A;  1DOB A;  1TDK A;  4USR A;  5JCI A;  4YT0 A;  2JKC A;  2BS4 A;  2RAB A;  5DBJ A;  1FEB A;  2WOV A;  4B65 A;  4CY8 A;  4U8L A;  1MXT A;  1KNR A;  1XDI A;  3CGC A;  4EMJ A;  3AE6 A;  4Z2R A;  1CC6 A;  3NNE A;  4EM4 A;  1PJ6 A;  3SGL A;  3SYI A;  2EQ8 A;  3F8P A;  4RG4 A;  4A99 A;  1CBO A;  1CJ3 A;  2V3B A;  2VQB A;  1GPE A;  2GMH A;  3DGH A;  2GV8 A;  2VVM A;  4IA5 A;  1CF3 A;  4OPC A;  1E7P A;  3NK1 X;  2J3N A;  1GTH A;  2VVL G;  4H4R A;  3FMW A;  1H81 A;  4M52 A;  3GD3 A;  2XVF A;  1H86 A;  4PAB A;  5C3J A;  5CQF A;  2GF3 A;  4JNA A;  3PVC A;  3IHG A;  2R45 A;  4GRT A;  3GDN A;  4J57 A;  3C96 A;  3ATQ A;  3RP8 A;  1JEH A;  4DGK A;  2GH5 A;  1Z6L A;  4FX9 A;  5U1O A;  1GRE A;  4II2 A;  5KVH A;  3UOX A;  4FDC B;  2WOI A;  4A6N B;  1NHS A;  4D03 A;  3AE2 A;  2XVJ A;  3ZYX A;  1GRA A;  5U25 A;  4EQW A;  4K2X A;  2ZZC A;  1L9C A;  4DSG A;  1K4Q A;  1KNP A;  1YQ3 A;  2O9Z A;  2YAU A;  3SX6 A;  5KOW A;  3DJD A;  2V6O A;  3SZF A;  4B68 A;  1VG9 A;  1H84 A;  4BK1 A;  2YR4 A;  4EQX A;  2XLS A;  2V5Z A;  3FG2 P;  3KLJ A;  3AEG A;  1OJD A;  4AT0 A;  3LB8 A;  3ATR A;  3SZ0 A;  2E4G A;  4USQ A;  3T0K A;  5LV9 A;  2BRY A;  4C3X A;  3FIM B;  4OPI A;  3ALM A;  1GXF A;  2R9Z A;  2WOW A;  4OCG A;  4TM0 A;  1TDE A;  3DJE A;  1ZP0 A;  4AT2 A;  3NT6 A;  4REK A;  3CGD A;  1S2Y A;  1CJ2 A;  4GAV A;  3IWA A;  4X9M A;  1Q9I A;  2H88 A;  4IV9 A;  2AQJ A;  1E1N A;  4U8N A;  3H4K A;  4U2L A;  3K7T A;  4NEV A;  2NPX A;  3CIR A;  5BUK A;  3UTH A;  4E0V A;  5EB4 A;  2OLN A;  3GWF A;  4YSZ A;  1S3E A;  1N4W A;  3C4A A;  4FK1 C;  2X99 A;  1H7X A;  3AD8 B;  4H2P A;  3CTY A;  4IVM B;  5HY5 A;  4GAP A;  4G74 A;  4NZH A;  3F8D A;  3QSS A;  4XWZ A;  4XXG A;  2C70 A;  4B64 A;  3I3L A;  1GT8 A;  2BXR A;  1TDN A;  2R0P A;  3BI4 A;  4H4S A;  4A7A A;  5KMS A;  4K22 A;  2BK3 A;  4Z2T A;  2C4C A;  2C76 A;  1LPF A;  3GDP A;  2JK6 A;  2BK4 A;  4MJW A;  4NTC A;  5FMH A;  5IQ4 A;  1FEA A;  2JB3 A;  2VRM A;  1B5Q A;  3CNP A;  5KWF A;  1PXA A;  1F3P A;  1E1K A;  5L46 A;  4KPR A;  2ZBW A;  1K0J A;  3AED A;  1F8R A;  1D7L A;  4K7Z A;  4J56 A;  3URH A;  3B6D A;  2GR0 A;  3QVR A;  3BHF A;  3T31 A;  1O95 A;  1PBF A;  1QLB A;  1DOC A;  3AYJ A;  2YM1 A;  2GR1 A;  4NWZ A;  2BAC A;  3SZC A;  5FS8 A;  1AOG A;  3T37 A;  1L9E A;  4Y4L A;  4YTN A;  4GDE A;  3GMB A;  2A8X A;  3VRD B;  3M13 A;  1B4V A;  2Z5X A;  4P9S A;  1E1L A;  1JNZ A;  1TDF A;  3G5Q A;  3QFB A;  4U8P A;  4U8I A;  2VRL A;  1CL0 A;  1IUV A;  1DXL A;  2R4J A;  2XFQ A;  2WPF A;  3ISH A;  2CVJ A;  1CJ4 A;  4NTE A;  2C75 A;  3CMM A;  4YTP A;  4UDQ A;  1L9D A;  4U8O A;  3SM8 A;  3VR8 A;  1SEZ A;  3AD9 B;  1CJC A;  2WET A;  4N9X A;  3SQP A;  3CNS A;  1JRZ A;  1ONF A;  3P1W A;  1F6M A;  4G6H A;  3KPF A;  4OVI A;  2WES A;  2XFU A;  4EMW A;  3R9U A;  4ADW A;  2BXS A;  4BK3 A;  4EIQ A;  1GRF A;  3CPH G;  1LQU A;  1M6I A;  1OJA A;  4K5R A;  1BF3 A;  3SXI A;  1DJQ A;  3BNM A;  1NHQ A;  2GVC A;  3Q6J A;  1TDO A;  4U2S A;  2X50 A;  5JCL A;  2E5V A;  2TMD A;  3T2K A;  5KOX A;  5J60 A;  3V3N A;  1EL5 A;  3IHM A;  3BI2 A;  1ZDL A;  1OJT A;  4KX6 A;  3EAO A;  3II4 A;  2IID A;  3EF6 A;  2BS3 A;  4A79 A;  4HB9 A;  3UKL A;  2BRA A;  3CNJ A;  1ZOV A;  3P4S A;  1VDC A;  3V3O A;  1PJ5 A;  2YG7 A;  4H4Y A;  4BV6 A;  3BHK A;  3VRB A;  1E6E A;  2X3N A;  2EQ7 A;  4J36 A;  2YLT A;  2OAL A;  1MOK A;  1MO9 A;  4OPD A;  2FJE A;  1CC2 A;  2R0C A;  1PS9 A;  4GCM A;  2XVI A;  4LU6 A;  1ZK7 A;  4PAA A;  4U2T A;  1GER A;  2GEW A;  3GYX A;  2UZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...