1H83A

Structure of polyamine oxidase in complex with 1,8-diaminooctane
Total Genus 166
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
166
sequence length
459
structure length
459
Chain Sequence
PRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTKIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords POLYAMINE OXIDASE
publication title Structural Bases for Inhibitor Binding and Catalysis in Polyamine Oxidase
pubmed doi rcsb
total genus 166
structure length 459
sequence length 459
chains with identical sequence B, C
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2001-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1h83A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1h83A02
2C64A 1JRZA 2ZZBA 3UKHA 2V3BA 2GR3A 1EL8A 1GPEA 1N1PA 1S2QA 1TRBA 4CCRA 4NTEA 3UP4A 4H4QA 3AE5A 1VG9A 2CDUA 4Z25A 1D7LA 1YQ3A 4CY8A 2V61A 4BURA 3T37A 1DJNA 2YLSA 2VVMA 3SFDA 3LXDA 3NKSA 3V76A 4TLZA 1YQ4A 3NTAA 4GDEA 1PXAA 3DK9A 1CL0A 5HYMA 3KVEA 1H81A 3GDPA 3NK1X 3ZYXA 2WPEA 5EB5A 4A6NA 4LU6A 3CPHG 3NH3X 4ICYA 4OPLA 4AP3A 2ZZCA 5KWFA 2APGA 2YVGA 3UTHA 2TPRA 4H4SA 1VRQB 3AE8A 2XFOA 1CHUA 3JSKA 4OPUA 3GSIA 4J36A 5EBKA 1NHRA 4K22A 3LZWA 1CBOA 4H4TA 2VVLA 4APNA 2DKHA 1ZMDA 2FBWA 4JY3A 3DJEA 1JNRA 3B6DA 4H4UA 2GQFA 4U8NA 1IUXA 3KLJA 1O94A 3DA1A 5FS6A 2GAHB 1E1MA 2Q7VA 4BJYA 1LV0A 1F3PA 2F5ZA 3AE6A 4X4JA 3IC9A 2B7SA 2JB3A 2CULA 4JN9A 1GETA 4XWRA 3SQPA 2RGOA 2X8HA 2PYXA 2GR1A 3CNTA 4ZCDA 5FS9A 3FPZA 1D4EA 2WEUA 3CNPA 5KOWA 5BUKA 1XDIA 2BS2A 4YKGA 1LQTA 2TMDA 3GRTA 2Z5XA 4ZCCA 2H88A 3CNDA 4DNAA 4H4WA 3DJDA 3LB8A 3UKLA 3VRAA 2WBAA 3GMBA 2WPCA 3RP8A 1PBCA 3DMEA 4YT0A 5LV9A 2JB1A 5GRTA 1Q1WA 3KU9A 5KVHA 3ADAB 1LJ1A 3ALLA 2XLPA 2Y6QA 3E1TA 1D5TA 1N4VA 1JU2A 2BA9A 3II4A 4H7UA 3REDA 3G5QA 4OPDA 2YLXA 2I0ZA 2YVFA 1GRAA 3NYCA 2B76A 2XCGA 1V59A 3BNUA 3IF9A 3AE3A 3S5WA 1YKJA 2X8GA 2BC0A 1F8SA 4H50A 2YLWA 2XYOA 4C77A 1N4WA 2RGJA 3NNEA 2XDOA 2C3CA 4WX1A 4EM4A 5JCNA 1LPFA 2YLRA 2YM2A 2GR2A 4GCMA 1L0VA 4J33A 2XFPA 1XPQA 4AT2A 3G5RA 1E39A 3P9UA 2BYBA 3UOZA 3IWAA 2Q0LA 4Z26A 3NYFA 3ISHA 4USQA 4U8JA 3AEAA 1F6MA 4OPGA 2UZZA 3LZXA 2QA1A 3OZ2A 1GTHA 1H6VA 4A6NB 3BI2A 1REOA 2GQWA 2V6OA 3AYLA 2BS3A 3GMCA 4EMIA 5KRQA 4I58A 3CGCA 4IVOB 3SM8A 3CTYA 4DSHA 1ZDLA 3K7TA 4CY6A 1IUTA 1HYUA 4REKA 4B63A 4D03A 2BABA 1JRYA 4MJWA 1CJCA 4CNJA 2JB2A 1TDEA 3LJPA 1JRXA 2B7RA 1NG4A 5TR3A 3BI4A 5M0ZA 2BK3A 4N9XA 3C4NA 2HQMA 1SEZA 3LADA 4D04A 4JY2A 2WOWA 4FK1A 1CF3A 3UKQA 3COXA 4AT0A 3P4QA 1D4CA 4BV6A 5IQ4A 3AE2A 1PJ7A 4K2XA 2C65A 4EQXA 3NN0X 1H84A 1GSNA 4EMJA 4J56A 5C3JA 2E1MA 3PS9A 2X8CA 3CGDA 4K7ZA 1B37A 3URHA 3ICRA 4GF7A 1PBDA 3QFAA 3VR9A 5HY5A 3IHGA 3I3LA 1VG0A 2R0CA 3K7MX 4YSXA 2YM1A 1S3BA 2WETA 3CGBA 3OC4A 2ARDA 3EPTA 1GREA 2C76A 3AD9B 5U25A 4EQSA 4BK1A 2WOVA 4B68A 4H4XA 4EIQA 1H7XA 2R4EA 3FG2P 3WE0A 4H2NA 5J7XA 4A7AA 1FL2A 4EQWA 1BWCA 2FJAA 3EANA 1TDKA 4U2LA 2R4JA 2GR0A 4XXGA 3AB1A 4C3YA 1TDOA 4AP1A 4A79A 2GEWA 1E1KA 2RABA 2A89A 3KD9A 4AOXA 4H4RA 3GDNA 1PBBA 1GEUA 2OAMA 3AE1A 3GYIA 2CFYA 1BZLA 2NVKX 1EL7A 1FEBA 1CJ3A 1JNZA 2YWLA 1KF6A 3PVCA 4FK1C 4X9NA 1E6EA 2OA1A 1NHPA 2XLRA 4K5SA 3M0OA 3GRSA 1OJTA 4YKFA 2B9XA 4KPRA 1NENA 1CC6A 1CJ4A 3CN8A 3BHFA 5JCIA 1PJ5A 4IA5A 2PHHA 2XVEA 1PXCA 4TM3A 4EQRA 2VQ7A 4O5UA 2JAEA 1MO9A 2C73A 1ZOYA 2GB0A 4J2WA 4H4VA 1QO8A 1GV4A 2ZBWA 1Y56A 3F8RA 2DKIA 4U8OA 5U1OA 4WCTA 1S2YA 3GD3A 4U8KA 5EB4A 4GRTA 5DBJA 4O5QA 2GMJA 5L46A 1ZK7A 2C7GA 1K0JA 4FX9A 4BK2A 3M13A 4CBQA 2X50A 1MOKA 3DK8A 4Y4NA 3PO7A 2OLNA 4JDRA 1GT8A 1KDGA 2YG4A 3KKJA 1NHSA 2E4GA 3O0HA 1DOEA 3AE9A 3AE4A 3ATQA 2BS4A 2FJBA 3CNSA 3ICTA 2WU2A 4U2TA 1E1NA 4EM3A 1FCDA 3D8XA 4OPTA 4IVMB 3BHKA 1H7WA 4C3XA 1TYPA 1BGJA 1ZY8A 3QSMA 1QLBA 1H82A 5KVIA 2AR8A 1IUSA 5IQ1A 3UTGA 4H4YA 4OPIA 1P2HA 3H4KA 1B5QA 1PXBA 1GRGA 3FMWA 4YWOA 1YQZA 1PBEA 1XHCA 1GERA 3DJJA 4KX6A 4EMWA 2J3NA 1KFYA 3GD4A 3NT6A 1LVLA 3V3OA 4Y4LA 2VRMA 4NTDA 1GXFA 2OALA 3CGEA 2GF3A 2YG6A 3DK4A 4TM0A 3SGLA 3ATRA 3CIRA 1K0IA 2BK5A 5JCLA 1GALA 3SFEA 3ZDNA 2EQ7A 1X31B 3GWDA 2R0GA 3CPIG 4BJZA 3F8DA 3P4PA 1IUVA 4DSGA 4ECHA 3V3NA 1GNDA 4H4ZA 4USRA 2QCUA 1DXLA 1CJ2A 2XLSA 4TM4A 1H83A 1OJ9A 1TDFA 1Q9IA 1MXTA 2GRTA 2XVHA 3NK0X 4ZN0A 3NHOX 2IVEA 3UCLA 1NDAA 2XVFA 2R0PA 1KSUA 4J57A 3P1WA 4PAAA 2WU5A 3NYEA 2E5VA 2H89A 5FMHA 1KNRA 3AE7A 1M6IA 3Q6JA 2YR5A 4I59A 5BVAA 2XFUA 4UDQA 4BK3A 2WP6A 4Z2TA 3K7QX 2QA2A 3IHMA 4B66A 3DJGX 1E1LA 4U8LA 4CRTA 1LQUA 3K30A 5HXIA 4C5OA 4M52A 5KXJA 2GVCA 3UOXA 1PN0A 1EBDA 1K4QA 2JKCA 4IA6A 3AYJA 1D4DA 2NPXA 3UOYA 3M12A 3DH9A 4H2QA 1Y0PA 2ACZA 2Q6UA 2X99A 3QVRA 4JNAA 2YR4A 1Z6LA 2QAEA 2WDQA 2XFQA 2EQ9A 2ZZ0A 3AEFA 2WESA 1DJQA 2EQ6A 3AXBA 3VQRA 2YG7A 3AEGA 1K0LA 2FJEA 3P4RA 3RP6A 1IUUA 4NEVA 2VOUA 4LA1A 2OLOA 2YLTA 1N4UA 4YXDA 3NIXA 2WHDA 1ZX9A 2B9WA 2R9ZA 2WP9A 3UOVA 1DOCA 1D7YA 3ALMA 1M64A 4Z2RA 2XVIA 2YG3A 3Q9TA 3L8KA 2WP5A 4GR1A 5J60A 2BCPA 3C96A 4Z24A 1NHQA 3FIMB 4CNKA 5KOXA 1Q1RA 4E0VA 2C75A 4PABA 4B69A 2WQYA 4RG4A 4U2SA 1JOAA 3FBSA 4YTMA 2XFNA 4H2PA 2GAGB 3KPFA 1VQWA 3H8LA 3QSEA 3I6DA 4GDPA 2A8XA 4EIPA 1XANA 5JCKA 3S61A 2C66A 3C4AA 2WDVA 3NLCA 1O95A 1FEAA 2BK4A 3D1CA 4H4PA 3NRNA 3UP5A 1P2EA 2YR6A 2W0HA 3AWIA 3F8PA 1OJCA 1NAAA 4H2RA 5C2TA 3G5SA 2VRLA 4JQ9A 4YSZA 2C3DA 4B65A 1GRBA 1F8RA 2WOIA 4J31A 1OJAA 3CPJG 3CNJA 3AD8B 4U8MA 5GSNA 2Z5YA 3QSSA 1S3EA 2XLUA 4A99A 3NG7X 3GWFA 1COYA 2BXRA 1CC2A 3VRBA 3RNMA 1GOSA 1QJDA 4Z2UA 2YQUA 2BCGG 1TDNA 3NTDA 1AOGA 2V3AA 3AECA 2X3NA 4YTNA 4FDCB 2BXSA 5EOWA 3LOVA 4NZHA 2RGHA 4ADWA 4OVIA 4XWZA 4X9MA 4Z43A 1RP0A 1E7PA 4RG3A 3GYJA 3UKKA 4RSLA 4JNQA 1DNCA 4TLXA 4CCQA 1B8SA 2C67A 1ZKQA 2Q0KA 4HA6A 1KNPA 5FS7A 1PDHA 4Y4MA 5BRTA 4UDPA 4YTPA 2JBVA 1NEKA 1L9CA 2XLTA 1KSSA 2EQ8A 2GMHA 2YAUA 4B64A 4C74A 1L9EA 3DGHA 3R9UA 2XVJA 4NTCA 1EL9A 4A65A 4YSHA 1PBFA 3EF6A 1B4VA 3H8IA 5BULA 5JCMA 5M10A 2WPFA 1JEHA 2R45A 4AOSA 1RYIA 3UKAA 3ICSA 1GRFA 2JK6A 2AAQA 2VZ2A 3RHAA 1TYTA 1FECA 2AQJA 2YG5A 3RP7A 3P4SA 2GV8A 4B67A 5ER0A 1O5WA 3KA7A 3NGCX 1GRHA 4UP3A 5U63A 1PS9A 2B9YA 3VRDB 3AEEA 3BNMA 4DGKA 4P9SA 4YSYA 3EAOA 1FOHA 3NN6X 3QFBA 4OPCA 3ITJA 5CKUA 3VR8A 1ZP0A 1IJHA 1PJ6A 2FJDA 3UKFA 2C72A 1W4XA 4J34A 2GH5A 1ZOVA 2WS3A 3ALJA 3AYIA 3B3RA 2CVJA 4UDRA 4Z44A 4B1BA 1ELIA 1L9DA 1LTXR 5HHFA 3UKPA 5IPYA 1DODA 4GUVA 2IVDA 1UKVG 3BI5A 1CC4A 3AEDA 4U8PA 1RSGA 2V60A 4IV9A 2WDRA 1EL5A 1F8WA 2BC1A 2Y6RA 5CQFA 4U8IA 1BGNA 1NG3A 1Y56B 4K8DA 4A9WA 1NPXA 5FS8A 1OJDA 4NEWA 1BF3A 3QVPA 3DGZA 3AEBA 4LIIA 1PHHA 2A87A 3UTEA 1VDCA 4OCGA 3HZLA 3ABVA 2VQBA 4A5LA 2V5ZA 2YVJA 4HB9A 1IUWA 1GTEA 4K5RA 1GESA 1ZMCA 1DOBA 1BKWA 2O9ZA 2R46A 3QJ4A 2C70A 2VVLG 2BACA 1ONFA 2YLZA 2IIDA 1YY5A 1GRTA 1H86A 3NK2X 3L1RA 4TM1A 3UTFA 3AD7B
chains in the Genus database with same CATH superfamily
2C64A 1JRZA 2ZZBA 3UKHA 2V3BA 2GR3A 1EL8A 1GPEA 1N1PA 1S2QA 1TRBA 4CCRA 4NTEA 3UP4A 4H4QA 3AE5A 1VG9A 2CDUA 4Z25A 1D7LA 1YQ3A 4CY8A 2V61A 4BURA 3T37A 1DJNA 2YLSA 2VVMA 3SFDA 3LXDA 3NKSA 3V76A 3SZWA 4TLZA 1YQ4A 3NTAA 4GDEA 1PXAA 3DK9A 1CL0A 2BRAA 5HYMA 3KVEA 1H81A 3GDPA 3NK1X 3ZYXA 2WPEA 5EB5A 4A6NA 4LU6A 3CPHG 3NH3X 4ICYA 4OPLA 4AP3A 2ZZCA 5KWFA 2APGA 2YVGA 3UTHA 2TPRA 4H4SA 1VRQB 3AE8A 2XFOA 1CHUA 3JSKA 4OPUA 3GSIA 4J36A 5EBKA 1NHRA 4K22A 3LZWA 1CBOA 4H4TA 2VVLA 3T14A 4APNA 2DKHA 1ZMDA 2FBWA 4JY3A 3DJEA 1JNRA 3B6DA 4H4UA 2GQFA 4U8NA 1IUXA 3KLJA 1O94A 3DA1A 5FS6A 2GAHB 1E1MA 2Q7VA 4BJYA 1LV0A 1F3PA 2F5ZA 3AE6A 4X4JA 3IC9A 2B7SA 2JB3A 2CULA 4JN9A 1GETA 4XWRA 3SQPA 2RGOA 2X8HA 2PYXA 2GR1A 3CNTA 4II2A 4ZCDA 5FS9A 3FPZA 1D4EA 2WEUA 3CNPA 5KOWA 5BUKA 3SXIA 1XDIA 2BS2A 4YKGA 1LQTA 2TMDA 3GRTA 2Z5XA 4ZCCA 2H88A 3CNDA 4DNAA 4H4WA 3DJDA 3LB8A 3UKLA 3VRAA 2WBAA 3GMBA 2WPCA 3RP8A 1PBCA 3DMEA 4YT0A 5LV9A 2JB1A 5GRTA 1Q1WA 3KU9A 5KVHA 3ADAB 1LJ1A 3ALLA 2XLPA 2Y6QA 3E1TA 1D5TA 1N4VA 1JU2A 2BA9A 3II4A 4H7UA 3REDA 3G5QA 4OPDA 2YLXA 2I0ZA 2YVFA 1GRAA 3NYCA 2B76A 2XCGA 1V59A 3BNUA 3IF9A 3AE3A 3S5WA 1YKJA 2X8GA 2BC0A 1F8SA 4H50A 2YLWA 2XYOA 3HYWA 4C77A 1N4WA 2RGJA 3NNEA 2XDOA 2C3CA 4WX1A 4EM4A 5JCNA 1LPFA 2YLRA 2YM2A 2GR2A 4GCMA 1L0VA 4J33A 2XFPA 1XPQA 4AT2A 3G5RA 1E39A 3P9UA 2BYBA 3UOZA 3IWAA 2Q0LA 4Z26A 3NYFA 3ISHA 4USQA 4U8JA 3AEAA 1F6MA 4OPGA 2UZZA 3LZXA 2QA1A 3OZ2A 1GTHA 1H6VA 4A6NB 3BI2A 1REOA 2GQWA 2V6OA 3AYLA 2BS3A 3GMCA 4EMIA 5KRQA 4I58A 3CGCA 4IVOB 3SM8A 3CTYA 4DSHA 1ZDLA 3K7TA 4CY6A 1IUTA 1HYUA 4REKA 4B63A 4D03A 2BABA 1JRYA 4MJWA 1CJCA 4CNJA 2JB2A 1TDEA 3LJPA 1JRXA 2B7RA 1NG4A 5TR3A 3BI4A 5M0ZA 2BK3A 4N9XA 3C4NA 2HQMA 1SEZA 3LADA 4D04A 4JY2A 3SZCA 2WOWA 4GAPA 4FK1A 1CF3A 3UKQA 3SYIA 3COXA 4AT0A 3P4QA 1D4CA 4BV6A 5IQ4A 3AE2A 1PJ7A 4K2XA 2C65A 4EQXA 3NN0X 1H84A 4G9KA 1GSNA 4EMJA 4J56A 5C3JA 2E1MA 3PS9A 3T0KA 2X8CA 3CGDA 4K7ZA 1B37A 3URHA 3ICRA 4GF7A 1PBDA 3QFAA 4G6HA 3VR9A 3IHGA 3I3LA 5HY5A 1VG0A 2R0CA 3K7MX 4YSXA 2YM1A 1S3BA 2WETA 3CGBA 3OC4A 3KPKA 2ARDA 3EPTA 1GREA 2C76A 3AD9B 5U25A 4EQSA 3SZ0A 4BK1A 2WOVA 4B68A 5KMSA 4H4XA 5KNLA 4EIQA 1H7XA 2R4EA 3FG2P 3WE0A 4H2NA 5J7XA 4A7AA 3GYXA 1FL2A 4EQWA 1BWCA 2FJAA 3EANA 1TDKA 4U2LA 2R4JA 2GR0A 4XXGA 3AB1A 4C3YA 1TDOA 4AP1A 4A79A 2GEWA 1E1KA 2RABA 2A89A 3KD9A 4AOXA 4H4RA 3GDNA 1PBBA 1GEUA 2OAMA 3AE1A 3GYIA 2CFYA 1BZLA 2NVKX 1EL7A 1FEBA 1CJ3A 1JNZA 2YWLA 1KF6A 3PVCA 4FK1C 4GAVA 1E6EA 4X9NA 2OA1A 1NHPA 2XLRA 4K5SA 3M0OA 3GRSA 1OJTA 4YKFA 2B9XA 4KPRA 1NENA 1CC6A 1CJ4A 3CN8A 3BHFA 5JCIA 1PJ5A 4IA5A 2PHHA 2XVEA 1PXCA 4TM3A 4EQRA 2VQ7A 4O5UA 2JAEA 1MO9A 2C73A 1ZOYA 2GB0A 4J2WA 4H4VA 1QO8A 1GV4A 2ZBWA 3T31A 1Y56A 3F8RA 2DKIA 4U8OA 5U1OA 4WCTA 1S2YA 3GD3A 4U8KA 5EB4A 4GRTA 5DBJA 4O5QA 2GMJA 5L46A 1ZK7A 2C7GA 1K0JA 4FX9A 4BK2A 3M13A 4CBQA 2X50A 1MOKA 3DK8A 4Y4NA 3PO7A 2OLNA 4JDRA 1GT8A 1KDGA 2YG4A 3KKJA 1NHSA 2E4GA 3O0HA 1DOEA 3AE9A 3AE4A 3ATQA 2BS4A 2FJBA 3CNSA 3ICTA 2WU2A 4U2TA 1E1NA 4EM3A 1FCDA 3D8XA 4OPTA 4IVMB 3BHKA 1H7WA 4NNJA 4C3XA 1TYPA 1BGJA 1ZY8A 3QSMA 1QLBA 1H82A 5KVIA 2AR8A 1IUSA 5IQ1A 3UTGA 4H4YA 4OPIA 1P2HA 5KMPA 3H4KA 1B5QA 1PXBA 1GRGA 3FMWA 4YWOA 1YQZA 1PBEA 1XHCA 1GERA 3DJJA 4KX6A 4EMWA 2J3NA 3HYVA 1KFYA 3GD4A 3NT6A 1LVLA 3SX6A 4Y4LA 3V3OA 2VRMA 4NTDA 1GXFA 2OALA 3CGEA 2GF3A 2YG6A 3DK4A 4TM0A 3SGLA 3ATRA 3CIRA 1K0IA 2BK5A 5JCLA 1GALA 3SFEA 3ZDNA 2EQ7A 1X31B 3GWDA 2R0GA 3CPIG 4BJZA 3F8DA 3T2YA 3P4PA 1IUVA 4DSGA 4ECHA 3V3NA 1GNDA 4H4ZA 4NWZA 2QCUA 1DXLA 1CJ2A 2XLSA 4TM4A 4USRA 1H83A 1OJ9A 1TDFA 1Q9IA 1MXTA 2GRTA 2XVHA 3NK0X 4ZN0A 3NHOX 2IVEA 3UCLA 1NDAA 2XVFA 2R0PA 1KSUA 4J57A 3P1WA 4PAAA 2WU5A 3NYEA 2E5VA 2H89A 5FMHA 1KNRA 3AE7A 1M6IA 3Q6JA 2YR5A 4I59A 5BVAA 2XFUA 4UDQA 4BK3A 2WP6A 4Z2TA 3K7QX 2QA2A 3IHMA 4B66A 2BRYA 1E1LA 3DJGX 4U8LA 1LQUA 3K30A 4CRTA 4C5OA 4M52A 5HXIA 2GVCA 3UOXA 1PN0A 1EBDA 1K4QA 2JKCA 4IA6A 3AYJA 1D4DA 2NPXA 3UOYA 3M12A 3DH9A 4H2QA 3T2ZA 1Y0PA 2ACZA 2Q6UA 2X99A 3QVRA 4JNAA 2YR4A 1Z6LA 2QAEA 2WDQA 2XFQA 2EQ9A 2ZZ0A 3AEFA 2WESA 4G74A 1DJQA 2EQ6A 3AXBA 3VQRA 2YG7A 3AEGA 3HYXA 1K0LA 2FJEA 3P4RA 3RP6A 1IUUA 4NEVA 2VOUA 4LA1A 2OLOA 2YLTA 1N4UA 4YXDA 3NIXA 2WHDA 1ZX9A 2B9WA 2R9ZA 2WP9A 3UOVA 1DOCA 1D7YA 3ALMA 1M64A 3CMMA 2XVIA 2YG3A 3Q9TA 4Z2RA 3L8KA 2WP5A 4GR1A 3SY4A 5J60A 2BCPA 3C96A 4Z24A 1NHQA 3FIMB 4CNKA 5KOXA 4G73A 1Q1RA 4E0VA 2C75A 4PABA 4B69A 2WQYA 4RG4A 4U2SA 1JOAA 3FBSA 4YTMA 2XFNA 4H2PA 2GAGB 3KPFA 1VQWA 3H8LA 3QSEA 3I6DA 4GDPA 2A8XA 4EIPA 1XANA 5JCKA 3S61A 2C66A 3C4AA 2WDVA 3NLCA 1O95A 1FEAA 2BK4A 3D1CA 4H4PA 3NRNA 3UP5A 1P2EA 2YR6A 2W0HA 3AWIA 3F8PA 1OJCA 4G6GA 1NAAA 4H2RA 5C2TA 3G5SA 2VRLA 4JQ9A 4YSZA 2C3DA 4B65A 1GRBA 2C4CA 1F8RA 2WOIA 4J31A 1OJAA 3CPJG 3CNJA 3AD8B 4U8MA 5GSNA 2Z5YA 3QSSA 1S3EA 2XLUA 4A99A 3NG7X 3GWFA 1COYA 2BXRA 1CC2A 3VRBA 3RNMA 1GOSA 1QJDA 4Z2UA 2YQUA 2BCGG 1TDNA 3NTDA 1AOGA 2V3AA 3AECA 2X3NA 4YTNA 4FDCB 2BXSA 5EOWA 3LOVA 4NZHA 2RGHA 4ADWA 4OVIA 4XWZA 4X9MA 4Z43A 1RP0A 1E7PA 4RG3A 3GYJA 3UKKA 4RSLA 4JNQA 1DNCA 4TLXA 4CCQA 1B8SA 2C67A 1ZKQA 2Q0KA 4HA6A 4II3A 5KMRA 1KNPA 5FS7A 1PDHA 4Y4MA 5BRTA 4UDPA 4YTPA 2JBVA 1NEKA 1L9CA 2XLTA 1KSSA 2EQ8A 2GMHA 2YAUA 4B64A 4C74A 1L9EA 3DGHA 3R9UA 2XVJA 4NTCA 1EL9A 4A65A 4YSHA 1PBFA 3EF6A 1B4VA 3H8IA 5BULA 5JCMA 5M10A 2WPFA 5KXJA 1JEHA 2R45A 4AOSA 1RYIA 3UKAA 3ICSA 1GRFA 2JK6A 2AAQA 2VZ2A 3RHAA 1TYTA 1FECA 2AQJA 2YG5A 3RP7A 3P4SA 2GV8A 4B67A 5ER0A 1O5WA 3KA7A 3NGCX 1GRHA 4UP3A 5U63A 1PS9A 2B9YA 3VRDB 3AEEA 3BNMA 4DGKA 4P9SA 4YSYA 3EAOA 1FOHA 3NN6X 3QFBA 4OPCA 3ITJA 5CKUA 3VR8A 1ZP0A 1IJHA 1PJ6A 2FJDA 3UKFA 2C72A 1W4XA 4J34A 2GH5A 1ZOVA 2WS3A 3ALJA 3AYIA 3B3RA 2CVJA 4UDRA 4Z44A 4B1BA 1ELIA 1L9DA 1LTXR 5HHFA 3UKPA 5IPYA 1DODA 4GUVA 2IVDA 1UKVG 3BI5A 1CC4A 3AEDA 4U8PA 1RSGA 2V60A 4IV9A 2WDRA 1EL5A 1F8WA 2BC1A 2Y6RA 5CQFA 4U8IA 1BGNA 1NG3A 1Y56B 4K8DA 4A9WA 1NPXA 5FS8A 1OJDA 4NEWA 1BF3A 3QVPA 3DGZA 3AEBA 4LIIA 1PHHA 2A87A 3UTEA 1VDCA 4OCGA 5KMQA 3HZLA 3ABVA 2VQBA 4A5LA 2V5ZA 2YVJA 4HB9A 1IUWA 3T2KA 1GTEA 4K5RA 1GESA 1ZMCA 1DOBA 3SZFA 1BKWA 2O9ZA 2R46A 3QJ4A 2C70A 2VVLG 2BACA 1ONFA 2YLZA 2IIDA 1YY5A 1GRTA 1H86A 3NK2X 3L1RA 4TM1A 3UTFA 3AD7B
chains in the Genus database with same CATH topology
2C64A 1JRZA 2ZZBA 3UKHA 2V3BA 2GR3A 1EL8A 1GPEA 1N1PA 1S2QA 1TRBA 4CCRA 4NTEA 3UP4A 4H4QA 3AE5A 1VG9A 2CDUA 4Z25A 1D7LA 1YQ3A 4CY8A 2V61A 4BURA 3T37A 1DJNA 2YLSA 2VVMA 3SFDA 3LXDA 3NKSA 3V76A 3SZWA 4TLZA 1YQ4A 3NTAA 4GDEA 1PXAA 3DK9A 1CL0A 2BRAA 5HYMA 3KVEA 1H81A 3GDPA 3NK1X 3ZYXA 2WPEA 5EB5A 4A6NA 4LU6A 3CPHG 3NH3X 4ICYA 4OPLA 4AP3A 2ZZCA 5KWFA 2APGA 2YVGA 3UTHA 2TPRA 4H4SA 1VRQB 3AE8A 2XFOA 1CHUA 3JSKA 4OPUA 3GSIA 4J36A 5EBKA 1NHRA 4K22A 3LZWA 1CBOA 4H4TA 2VVLA 3T14A 4APNA 2DKHA 1ZMDA 2FBWA 4JY3A 3DJEA 1JNRA 3B6DA 4H4UA 2GQFA 4U8NA 1IUXA 3KLJA 1O94A 3DA1A 5FS6A 2GAHB 1E1MA 2Q7VA 4BJYA 1LV0A 1F3PA 2F5ZA 3AE6A 4X4JA 3IC9A 2B7SA 2JB3A 2CULA 4JN9A 1GETA 4XWRA 3SQPA 2RGOA 2X8HA 2PYXA 2GR1A 3CNTA 4II2A 4ZCDA 5FS9A 3FPZA 1D4EA 2WEUA 3CNPA 5KOWA 5BUKA 3SXIA 1XDIA 2BS2A 4YKGA 1LQTA 2TMDA 3GRTA 2Z5XA 4ZCCA 2H88A 3CNDA 4DNAA 4H4WA 3DJDA 3LB8A 3UKLA 3VRAA 2WBAA 3GMBA 2WPCA 3RP8A 1PBCA 3DMEA 4YT0A 5LV9A 2JB1A 5GRTA 1Q1WA 3KU9A 5KVHA 3ADAB 1LJ1A 3ALLA 2XLPA 2Y6QA 3E1TA 1D5TA 1N4VA 1JU2A 2BA9A 3II4A 4H7UA 3REDA 3G5QA 4OPDA 2YLXA 2I0ZA 2YVFA 1GRAA 3NYCA 2B76A 2XCGA 1V59A 3BNUA 3IF9A 3AE3A 3S5WA 1YKJA 2X8GA 2BC0A 1F8SA 4H50A 2YLWA 2XYOA 3HYWA 4C77A 1N4WA 2RGJA 3NNEA 2XDOA 2C3CA 4WX1A 4EM4A 5JCNA 1LPFA 2YLRA 2YM2A 2GR2A 4GCMA 1L0VA 4J33A 2XFPA 1XPQA 4AT2A 3G5RA 1E39A 3P9UA 2BYBA 3UOZA 3IWAA 2Q0LA 4Z26A 3NYFA 3ISHA 4USQA 4U8JA 3AEAA 1F6MA 4OPGA 2UZZA 3LZXA 2QA1A 3OZ2A 1GTHA 1H6VA 4A6NB 3BI2A 1REOA 2GQWA 2V6OA 3AYLA 2BS3A 3GMCA 4EMIA 5KRQA 4I58A 3CGCA 4IVOB 3SM8A 3CTYA 4DSHA 1ZDLA 3K7TA 4CY6A 1IUTA 1HYUA 4REKA 4B63A 4D03A 2BABA 1JRYA 4MJWA 1CJCA 4CNJA 2JB2A 1TDEA 3LJPA 1JRXA 2B7RA 1NG4A 5TR3A 3BI4A 5M0ZA 2BK3A 4N9XA 3C4NA 2HQMA 1SEZA 3LADA 4D04A 4JY2A 3SZCA 2WOWA 4GAPA 4FK1A 1CF3A 3UKQA 3SYIA 3COXA 4AT0A 3P4QA 1D4CA 4BV6A 5IQ4A 3AE2A 1PJ7A 4K2XA 2C65A 4EQXA 3NN0X 1H84A 4G9KA 1GSNA 4EMJA 4J56A 5C3JA 2E1MA 3PS9A 3T0KA 2X8CA 3CGDA 4K7ZA 1B37A 3URHA 3ICRA 4GF7A 1PBDA 3QFAA 4G6HA 3VR9A 3IHGA 3I3LA 5HY5A 1VG0A 2R0CA 3K7MX 4YSXA 2YM1A 1S3BA 2WETA 3CGBA 3OC4A 3KPKA 2ARDA 3EPTA 1GREA 2C76A 3AD9B 5U25A 4EQSA 3SZ0A 4BK1A 2WOVA 4B68A 5KMSA 4H4XA 5KNLA 4EIQA 1H7XA 2R4EA 3FG2P 3WE0A 4H2NA 5J7XA 4A7AA 3GYXA 1FL2A 4EQWA 1BWCA 2FJAA 3EANA 1TDKA 4U2LA 2R4JA 2GR0A 4XXGA 3AB1A 4C3YA 1TDOA 4AP1A 4A79A 2GEWA 1E1KA 2RABA 2A89A 3KD9A 4AOXA 4H4RA 3GDNA 1PBBA 1GEUA 2OAMA 3AE1A 3GYIA 2CFYA 1BZLA 2NVKX 1EL7A 1FEBA 1CJ3A 1JNZA 2YWLA 1KF6A 3PVCA 4FK1C 4GAVA 1E6EA 4X9NA 2OA1A 1NHPA 2XLRA 4K5SA 3M0OA 3GRSA 1OJTA 4YKFA 2B9XA 4KPRA 1NENA 1CC6A 1CJ4A 3CN8A 3BHFA 5JCIA 1PJ5A 4IA5A 2PHHA 2XVEA 1PXCA 4TM3A 4EQRA 2VQ7A 4O5UA 2JAEA 1MO9A 2C73A 1ZOYA 2GB0A 4J2WA 4H4VA 1QO8A 1GV4A 2ZBWA 3T31A 1Y56A 3F8RA 2DKIA 4U8OA 5U1OA 4WCTA 1S2YA 3GD3A 4U8KA 5EB4A 4GRTA 5DBJA 4O5QA 2GMJA 5L46A 1ZK7A 2C7GA 1K0JA 4FX9A 4BK2A 3M13A 4CBQA 2X50A 1MOKA 3DK8A 4Y4NA 3PO7A 2OLNA 4JDRA 1GT8A 1KDGA 2YG4A 3KKJA 1NHSA 2E4GA 3O0HA 1DOEA 3AE9A 3AE4A 3ATQA 2BS4A 2FJBA 3CNSA 3ICTA 2WU2A 4U2TA 1E1NA 4EM3A 1FCDA 3D8XA 4OPTA 4IVMB 3BHKA 1H7WA 4NNJA 4C3XA 1TYPA 1BGJA 1ZY8A 3QSMA 1QLBA 1H82A 5KVIA 2AR8A 1IUSA 5IQ1A 3UTGA 4H4YA 4OPIA 1P2HA 5KMPA 3H4KA 1B5QA 1PXBA 1GRGA 3FMWA 4YWOA 1YQZA 1PBEA 1XHCA 1GERA 3DJJA 4KX6A 4EMWA 2J3NA 3HYVA 1KFYA 3GD4A 3NT6A 1LVLA 3SX6A 4Y4LA 3V3OA 2VRMA 4NTDA 1GXFA 2OALA 3CGEA 2GF3A 2YG6A 3DK4A 4TM0A 3SGLA 3ATRA 3CIRA 1K0IA 2BK5A 5JCLA 1GALA 3SFEA 3ZDNA 2EQ7A 1X31B 3GWDA 2R0GA 3CPIG 4BJZA 3F8DA 3T2YA 3P4PA 1IUVA 4DSGA 4ECHA 3V3NA 1GNDA 4H4ZA 4NWZA 2QCUA 1DXLA 1CJ2A 2XLSA 4TM4A 4USRA 1H83A 1OJ9A 1TDFA 1Q9IA 1MXTA 2GRTA 2XVHA 3NK0X 4ZN0A 3NHOX 2IVEA 3UCLA 1NDAA 2XVFA 2R0PA 1KSUA 4J57A 3P1WA 4PAAA 2WU5A 3NYEA 2E5VA 2H89A 5FMHA 1KNRA 3AE7A 1M6IA 3Q6JA 2YR5A 4I59A 5BVAA 2XFUA 4UDQA 4BK3A 2WP6A 4Z2TA 3K7QX 2QA2A 3IHMA 4B66A 2BRYA 1E1LA 3DJGX 4U8LA 1LQUA 3K30A 4CRTA 4C5OA 4M52A 5HXIA 2GVCA 3UOXA 1PN0A 1EBDA 1K4QA 2JKCA 4IA6A 3AYJA 1D4DA 2NPXA 3UOYA 3M12A 3DH9A 4H2QA 3T2ZA 1Y0PA 2ACZA 2Q6UA 2X99A 3QVRA 4JNAA 2YR4A 1Z6LA 2QAEA 2WDQA 2XFQA 2EQ9A 2ZZ0A 3AEFA 2WESA 4G74A 1DJQA 2EQ6A 3AXBA 3VQRA 2YG7A 3AEGA 3HYXA 1K0LA 2FJEA 3P4RA 3RP6A 1IUUA 4NEVA 2VOUA 4LA1A 2OLOA 2YLTA 1N4UA 4YXDA 3NIXA 2WHDA 1ZX9A 2B9WA 2R9ZA 2WP9A 3UOVA 1DOCA 1D7YA 3ALMA 1M64A 3CMMA 2XVIA 2YG3A 3Q9TA 4Z2RA 3L8KA 2WP5A 4GR1A 3SY4A 5J60A 2BCPA 3C96A 4Z24A 1NHQA 3FIMB 4CNKA 5KOXA 4G73A 1Q1RA 4E0VA 2C75A 4PABA 4B69A 2WQYA 4RG4A 4U2SA 1JOAA 3FBSA 4YTMA 2XFNA 4H2PA 2GAGB 3KPFA 1VQWA 3H8LA 3QSEA 3I6DA 4GDPA 2A8XA 4EIPA 1XANA 5JCKA 3S61A 2C66A 3C4AA 2WDVA 3NLCA 1O95A 1FEAA 2BK4A 3D1CA 4H4PA 3NRNA 3UP5A 1P2EA 2YR6A 2W0HA 3AWIA 3F8PA 1OJCA 4G6GA 1NAAA 4H2RA 5C2TA 3G5SA 2VRLA 4JQ9A 4YSZA 2C3DA 4B65A 1GRBA 2C4CA 1F8RA 2WOIA 4J31A 1OJAA 3CPJG 3CNJA 3AD8B 4U8MA 5GSNA 2Z5YA 3QSSA 1S3EA 2XLUA 4A99A 3NG7X 3GWFA 1COYA 2BXRA 1CC2A 3VRBA 3RNMA 1GOSA 1QJDA 4Z2UA 2YQUA 2BCGG 1TDNA 3NTDA 1AOGA 2V3AA 3AECA 2X3NA 4YTNA 4FDCB 2BXSA 5EOWA 3LOVA 4NZHA 2RGHA 4ADWA 4OVIA 4XWZA 4X9MA 4Z43A 1RP0A 1E7PA 4RG3A 3GYJA 3UKKA 4RSLA 4JNQA 1DNCA 4TLXA 4CCQA 1B8SA 2C67A 1ZKQA 2Q0KA 4HA6A 4II3A 5KMRA 1KNPA 5FS7A 1PDHA 4Y4MA 5BRTA 4UDPA 4YTPA 2JBVA 1NEKA 1L9CA 2XLTA 1KSSA 2EQ8A 2GMHA 2YAUA 4B64A 4C74A 1L9EA 3DGHA 3R9UA 2XVJA 4NTCA 1EL9A 4A65A 4YSHA 1PBFA 3EF6A 1B4VA 3H8IA 5BULA 5JCMA 5M10A 2WPFA 5KXJA 1JEHA 2R45A 4AOSA 1RYIA 3UKAA 3ICSA 1GRFA 2JK6A 2AAQA 2VZ2A 3RHAA 1TYTA 1FECA 2AQJA 2YG5A 3RP7A 3P4SA 2GV8A 4B67A 5ER0A 1O5WA 3KA7A 3NGCX 1GRHA 4UP3A 5U63A 1PS9A 2B9YA 3VRDB 3AEEA 3BNMA 4DGKA 4P9SA 4YSYA 3EAOA 1FOHA 3NN6X 3QFBA 4OPCA 3ITJA 5CKUA 3VR8A 1ZP0A 1IJHA 1PJ6A 2FJDA 3UKFA 2C72A 1W4XA 4J34A 2GH5A 1ZOVA 2WS3A 3ALJA 3AYIA 3B3RA 2CVJA 4UDRA 4Z44A 4B1BA 1ELIA 1L9DA 1LTXR 5HHFA 3UKPA 5IPYA 1DODA 4GUVA 2IVDA 1UKVG 3BI5A 1CC4A 3AEDA 4U8PA 1RSGA 2V60A 4IV9A 2WDRA 1EL5A 1F8WA 2BC1A 2Y6RA 5CQFA 4U8IA 1BGNA 1NG3A 1Y56B 4K8DA 4A9WA 1NPXA 5FS8A 1OJDA 4NEWA 1BF3A 3QVPA 3DGZA 3AEBA 4LIIA 1PHHA 2A87A 3UTEA 1VDCA 4OCGA 5KMQA 3HZLA 3ABVA 2VQBA 4A5LA 2V5ZA 2YVJA 4HB9A 1IUWA 3T2KA 1GTEA 4K5RA 1GESA 1ZMCA 1DOBA 3SZFA 1BKWA 2O9ZA 2R46A 3QJ4A 2C70A 2VVLG 2BACA 1ONFA 2YLZA 2IIDA 1YY5A 1GRTA 1H86A 3NK2X 3L1RA 4TM1A 3UTFA 3AD7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C64 A;  1JRZ A;  2ZZB A;  3UKH A;  2V3B A;  2GR3 A;  1EL8 A;  1GPE A;  1N1P A;  1S2Q A;  1TRB A;  4CCR A;  4NTE A;  3UP4 A;  4H4Q A;  3AE5 A;  1VG9 A;  2CDU A;  4Z25 A;  1D7L A;  1YQ3 A;  4CY8 A;  2V61 A;  4BUR A;  3T37 A;  1DJN A;  2YLS A;  2VVM A;  3SFD A;  3LXD A;  3NKS A;  3V76 A;  4TLZ A;  1YQ4 A;  3NTA A;  4GDE A;  1PXA A;  3DK9 A;  1CL0 A;  5HYM A;  3KVE A;  1H81 A;  3GDP A;  3NK1 X;  3ZYX A;  2WPE A;  5EB5 A;  4A6N A;  4LU6 A;  3CPH G;  3NH3 X;  4ICY A;  4OPL A;  4AP3 A;  2ZZC A;  5KWF A;  2APG A;  2YVG A;  3UTH A;  2TPR A;  4H4S A;  1VRQ B;  3AE8 A;  2XFO A;  1CHU A;  3JSK A;  4OPU A;  3GSI A;  4J36 A;  5EBK A;  1NHR A;  4K22 A;  3LZW A;  1CBO A;  4H4T A;  2VVL A;  4APN A;  2DKH A;  1ZMD A;  2FBW A;  4JY3 A;  3DJE A;  1JNR A;  3B6D A;  4H4U A;  2GQF A;  4U8N A;  1IUX A;  3KLJ A;  1O94 A;  3DA1 A;  5FS6 A;  2GAH B;  1E1M A;  2Q7V A;  4BJY A;  1LV0 A;  1F3P A;  2F5Z A;  3AE6 A;  4X4J A;  3IC9 A;  2B7S A;  2JB3 A;  2CUL A;  4JN9 A;  1GET A;  4XWR A;  3SQP A;  2RGO A;  2X8H A;  2PYX A;  2GR1 A;  3CNT A;  4ZCD A;  5FS9 A;  3FPZ A;  1D4E A;  2WEU A;  3CNP A;  5KOW A;  5BUK A;  1XDI A;  2BS2 A;  4YKG A;  1LQT A;  2TMD A;  3GRT A;  2Z5X A;  4ZCC A;  2H88 A;  3CND A;  4DNA A;  4H4W A;  3DJD A;  3LB8 A;  3UKL A;  3VRA A;  2WBA A;  3GMB A;  2WPC A;  3RP8 A;  1PBC A;  3DME A;  4YT0 A;  5LV9 A;  2JB1 A;  5GRT A;  1Q1W A;  3KU9 A;  5KVH A;  3ADA B;  1LJ1 A;  3ALL A;  2XLP A;  2Y6Q A;  3E1T A;  1D5T A;  1N4V A;  1JU2 A;  2BA9 A;  3II4 A;  4H7U A;  3RED A;  3G5Q A;  4OPD A;  2YLX A;  2I0Z A;  2YVF A;  1GRA A;  3NYC A;  2B76 A;  2XCG A;  1V59 A;  3BNU A;  3IF9 A;  3AE3 A;  3S5W A;  1YKJ A;  2X8G A;  2BC0 A;  1F8S A;  4H50 A;  2YLW A;  2XYO A;  4C77 A;  1N4W A;  2RGJ A;  3NNE A;  2XDO A;  2C3C A;  4WX1 A;  4EM4 A;  5JCN A;  1LPF A;  2YLR A;  2YM2 A;  2GR2 A;  4GCM A;  1L0V A;  4J33 A;  2XFP A;  1XPQ A;  4AT2 A;  3G5R A;  1E39 A;  3P9U A;  2BYB A;  3UOZ A;  3IWA A;  2Q0L A;  4Z26 A;  3NYF A;  3ISH A;  4USQ A;  4U8J A;  3AEA A;  1F6M A;  4OPG A;  2UZZ A;  3LZX A;  2QA1 A;  3OZ2 A;  1GTH A;  1H6V A;  4A6N B;  3BI2 A;  1REO A;  2GQW A;  2V6O A;  3AYL A;  2BS3 A;  3GMC A;  4EMI A;  5KRQ A;  4I58 A;  3CGC A;  4IVO B;  3SM8 A;  3CTY A;  4DSH A;  1ZDL A;  3K7T A;  4CY6 A;  1IUT A;  1HYU A;  4REK A;  4B63 A;  4D03 A;  2BAB A;  1JRY A;  4MJW A;  1CJC A;  4CNJ A;  2JB2 A;  1TDE A;  3LJP A;  1JRX A;  2B7R A;  1NG4 A;  5TR3 A;  3BI4 A;  5M0Z A;  2BK3 A;  4N9X A;  3C4N A;  2HQM A;  1SEZ A;  3LAD A;  4D04 A;  4JY2 A;  2WOW A;  4FK1 A;  1CF3 A;  3UKQ A;  3COX A;  4AT0 A;  3P4Q A;  1D4C A;  4BV6 A;  5IQ4 A;  3AE2 A;  1PJ7 A;  4K2X A;  2C65 A;  4EQX A;  3NN0 X;  1H84 A;  1GSN A;  4EMJ A;  4J56 A;  5C3J A;  2E1M A;  3PS9 A;  2X8C A;  3CGD A;  4K7Z A;  1B37 A;  3URH A;  3ICR A;  4GF7 A;  1PBD A;  3QFA A;  3VR9 A;  5HY5 A;  3IHG A;  3I3L A;  1VG0 A;  2R0C A;  3K7M X;  4YSX A;  2YM1 A;  1S3B A;  2WET A;  3CGB A;  3OC4 A;  2ARD A;  3EPT A;  1GRE A;  2C76 A;  3AD9 B;  5U25 A;  4EQS A;  4BK1 A;  2WOV A;  4B68 A;  4H4X A;  4EIQ A;  1H7X A;  2R4E A;  3FG2 P;  3WE0 A;  4H2N A;  5J7X A;  4A7A A;  1FL2 A;  4EQW A;  1BWC A;  2FJA A;  3EAN A;  1TDK A;  4U2L A;  2R4J A;  2GR0 A;  4XXG A;  3AB1 A;  4C3Y A;  1TDO A;  4AP1 A;  4A79 A;  2GEW A;  1E1K A;  2RAB A;  2A89 A;  3KD9 A;  4AOX A;  4H4R A;  3GDN A;  1PBB A;  1GEU A;  2OAM A;  3AE1 A;  3GYI A;  2CFY A;  1BZL A;  2NVK X;  1EL7 A;  1FEB A;  1CJ3 A;  1JNZ A;  2YWL A;  1KF6 A;  3PVC A;  4FK1 C;  4X9N A;  1E6E A;  2OA1 A;  1NHP A;  2XLR A;  4K5S A;  3M0O A;  3GRS A;  1OJT A;  4YKF A;  2B9X A;  4KPR A;  1NEN A;  1CC6 A;  1CJ4 A;  3CN8 A;  3BHF A;  5JCI A;  1PJ5 A;  4IA5 A;  2PHH A;  2XVE A;  1PXC A;  4TM3 A;  4EQR A;  2VQ7 A;  4O5U A;  2JAE A;  1MO9 A;  2C73 A;  1ZOY A;  2GB0 A;  4J2W A;  4H4V A;  1QO8 A;  1GV4 A;  2ZBW A;  1Y56 A;  3F8R A;  2DKI A;  4U8O A;  5U1O A;  4WCT A;  1S2Y A;  3GD3 A;  4U8K A;  5EB4 A;  4GRT A;  5DBJ A;  4O5Q A;  2GMJ A;  5L46 A;  1ZK7 A;  2C7G A;  1K0J A;  4FX9 A;  4BK2 A;  3M13 A;  4CBQ A;  2X50 A;  1MOK A;  3DK8 A;  4Y4N A;  3PO7 A;  2OLN A;  4JDR A;  1GT8 A;  1KDG A;  2YG4 A;  3KKJ A;  1NHS A;  2E4G A;  3O0H A;  1DOE A;  3AE9 A;  3AE4 A;  3ATQ A;  2BS4 A;  2FJB A;  3CNS A;  3ICT A;  2WU2 A;  4U2T A;  1E1N A;  4EM3 A;  1FCD A;  3D8X A;  4OPT A;  4IVM B;  3BHK A;  1H7W A;  4C3X A;  1TYP A;  1BGJ A;  1ZY8 A;  3QSM A;  1QLB A;  1H82 A;  5KVI A;  2AR8 A;  1IUS A;  5IQ1 A;  3UTG A;  4H4Y A;  4OPI A;  1P2H A;  3H4K A;  1B5Q A;  1PXB A;  1GRG A;  3FMW A;  4YWO A;  1YQZ A;  1PBE A;  1XHC A;  1GER A;  3DJJ A;  4KX6 A;  4EMW A;  2J3N A;  1KFY A;  3GD4 A;  3NT6 A;  1LVL A;  3V3O A;  4Y4L A;  2VRM A;  4NTD A;  1GXF A;  2OAL A;  3CGE A;  2GF3 A;  2YG6 A;  3DK4 A;  4TM0 A;  3SGL A;  3ATR A;  3CIR A;  1K0I A;  2BK5 A;  5JCL A;  1GAL A;  3SFE A;  3ZDN A;  2EQ7 A;  1X31 B;  3GWD A;  2R0G A;  3CPI G;  4BJZ A;  3F8D A;  3P4P A;  1IUV A;  4DSG A;  4ECH A;  3V3N A;  1GND A;  4H4Z A;  4USR A;  2QCU A;  1DXL A;  1CJ2 A;  2XLS A;  4TM4 A;  1H83 A;  1OJ9 A;  1TDF A;  1Q9I A;  1MXT A;  2GRT A;  2XVH A;  3NK0 X;  4ZN0 A;  3NHO X;  2IVE A;  3UCL A;  1NDA A;  2XVF A;  2R0P A;  1KSU A;  4J57 A;  3P1W A;  4PAA A;  2WU5 A;  3NYE A;  2E5V A;  2H89 A;  5FMH A;  1KNR A;  3AE7 A;  1M6I A;  3Q6J A;  2YR5 A;  4I59 A;  5BVA A;  2XFU A;  4UDQ A;  4BK3 A;  2WP6 A;  4Z2T A;  3K7Q X;  2QA2 A;  3IHM A;  4B66 A;  3DJG X;  1E1L A;  4U8L A;  4CRT A;  1LQU A;  3K30 A;  5HXI A;  4C5O A;  4M52 A;  5KXJ A;  2GVC A;  3UOX A;  1PN0 A;  1EBD A;  1K4Q A;  2JKC A;  4IA6 A;  3AYJ A;  1D4D A;  2NPX A;  3UOY A;  3M12 A;  3DH9 A;  4H2Q A;  1Y0P A;  2ACZ A;  2Q6U A;  2X99 A;  3QVR A;  4JNA A;  2YR4 A;  1Z6L A;  2QAE A;  2WDQ A;  2XFQ A;  2EQ9 A;  2ZZ0 A;  3AEF A;  2WES A;  1DJQ A;  2EQ6 A;  3AXB A;  3VQR A;  2YG7 A;  3AEG A;  1K0L A;  2FJE A;  3P4R A;  3RP6 A;  1IUU A;  4NEV A;  2VOU A;  4LA1 A;  2OLO A;  2YLT A;  1N4U A;  4YXD A;  3NIX A;  2WHD A;  1ZX9 A;  2B9W A;  2R9Z A;  2WP9 A;  3UOV A;  1DOC A;  1D7Y A;  3ALM A;  1M64 A;  4Z2R A;  2XVI A;  2YG3 A;  3Q9T A;  3L8K A;  2WP5 A;  4GR1 A;  5J60 A;  2BCP A;  3C96 A;  4Z24 A;  1NHQ A;  3FIM B;  4CNK A;  5KOX A;  1Q1R A;  4E0V A;  2C75 A;  4PAB A;  4B69 A;  2WQY A;  4RG4 A;  4U2S A;  1JOA A;  3FBS A;  4YTM A;  2XFN A;  4H2P A;  2GAG B;  3KPF A;  1VQW A;  3H8L A;  3QSE A;  3I6D A;  4GDP A;  2A8X A;  4EIP A;  1XAN A;  5JCK A;  3S61 A;  2C66 A;  3C4A A;  2WDV A;  3NLC A;  1O95 A;  1FEA A;  2BK4 A;  3D1C A;  4H4P A;  3NRN A;  3UP5 A;  1P2E A;  2YR6 A;  2W0H A;  3AWI A;  3F8P A;  1OJC A;  1NAA A;  4H2R A;  5C2T A;  3G5S A;  2VRL A;  4JQ9 A;  4YSZ A;  2C3D A;  4B65 A;  1GRB A;  1F8R A;  2WOI A;  4J31 A;  1OJA A;  3CPJ G;  3CNJ A;  3AD8 B;  4U8M A;  5GSN A;  2Z5Y A;  3QSS A;  1S3E A;  2XLU A;  4A99 A;  3NG7 X;  3GWF A;  1COY A;  2BXR A;  1CC2 A;  3VRB A;  3RNM A;  1GOS A;  1QJD A;  4Z2U A;  2YQU A;  2BCG G;  1TDN A;  3NTD A;  1AOG A;  2V3A A;  3AEC A;  2X3N A;  4YTN A;  4FDC B;  2BXS A;  5EOW A;  3LOV A;  4NZH A;  2RGH A;  4ADW A;  4OVI A;  4XWZ A;  4X9M A;  4Z43 A;  1RP0 A;  1E7P A;  4RG3 A;  3GYJ A;  3UKK A;  4RSL A;  4JNQ A;  1DNC A;  4TLX A;  4CCQ A;  1B8S A;  2C67 A;  1ZKQ A;  2Q0K A;  4HA6 A;  1KNP A;  5FS7 A;  1PDH A;  4Y4M A;  5BRT A;  4UDP A;  4YTP A;  2JBV A;  1NEK A;  1L9C A;  2XLT A;  1KSS A;  2EQ8 A;  2GMH A;  2YAU A;  4B64 A;  4C74 A;  1L9E A;  3DGH A;  3R9U A;  2XVJ A;  4NTC A;  1EL9 A;  4A65 A;  4YSH A;  1PBF A;  3EF6 A;  1B4V A;  3H8I A;  5BUL A;  5JCM A;  5M10 A;  2WPF A;  1JEH A;  2R45 A;  4AOS A;  1RYI A;  3UKA A;  3ICS A;  1GRF A;  2JK6 A;  2AAQ A;  2VZ2 A;  3RHA A;  1TYT A;  1FEC A;  2AQJ A;  2YG5 A;  3RP7 A;  3P4S A;  2GV8 A;  4B67 A;  5ER0 A;  1O5W A;  3KA7 A;  3NGC X;  1GRH A;  4UP3 A;  5U63 A;  1PS9 A;  2B9Y A;  3VRD B;  3AEE A;  3BNM A;  4DGK A;  4P9S A;  4YSY A;  3EAO A;  1FOH A;  3NN6 X;  3QFB A;  4OPC A;  3ITJ A;  5CKU A;  3VR8 A;  1ZP0 A;  1IJH A;  1PJ6 A;  2FJD A;  3UKF A;  2C72 A;  1W4X A;  4J34 A;  2GH5 A;  1ZOV A;  2WS3 A;  3ALJ A;  3AYI A;  3B3R A;  2CVJ A;  4UDR A;  4Z44 A;  4B1B A;  1ELI A;  1L9D A;  1LTX R;  5HHF A;  3UKP A;  5IPY A;  1DOD A;  4GUV A;  2IVD A;  1UKV G;  3BI5 A;  1CC4 A;  3AED A;  4U8P A;  1RSG A;  2V60 A;  4IV9 A;  2WDR A;  1EL5 A;  1F8W A;  2BC1 A;  2Y6R A;  5CQF A;  4U8I A;  1BGN A;  1NG3 A;  1Y56 B;  4K8D A;  4A9W A;  1NPX A;  5FS8 A;  1OJD A;  4NEW A;  1BF3 A;  3QVP A;  3DGZ A;  3AEB A;  4LII A;  1PHH A;  2A87 A;  3UTE A;  1VDC A;  4OCG A;  3HZL A;  3ABV A;  2VQB A;  4A5L A;  2V5Z A;  2YVJ A;  4HB9 A;  1IUW A;  1GTE A;  4K5R A;  1GES A;  1ZMC A;  1DOB A;  1BKW A;  2O9Z A;  2R46 A;  3QJ4 A;  2C70 A;  2VVL G;  2BAC A;  1ONF A;  2YLZ A;  2IID A;  1YY5 A;  1GRT A;  1H86 A;  3NK2 X;  3L1R A;  4TM1 A;  3UTF A;  3AD7 B; 
#chains in the Genus database with same CATH topology
 2C64 A;  1JRZ A;  2ZZB A;  3UKH A;  2V3B A;  2GR3 A;  1EL8 A;  1GPE A;  1N1P A;  1S2Q A;  1TRB A;  4CCR A;  4NTE A;  3UP4 A;  4H4Q A;  3AE5 A;  1VG9 A;  2CDU A;  4Z25 A;  1D7L A;  1YQ3 A;  4CY8 A;  2V61 A;  4BUR A;  3T37 A;  1DJN A;  2YLS A;  2VVM A;  3SFD A;  3LXD A;  3NKS A;  3V76 A;  3SZW A;  4TLZ A;  1YQ4 A;  3NTA A;  4GDE A;  1PXA A;  3DK9 A;  1CL0 A;  2BRA A;  5HYM A;  3KVE A;  1H81 A;  3GDP A;  3NK1 X;  3ZYX A;  2WPE A;  5EB5 A;  4A6N A;  4LU6 A;  3CPH G;  3NH3 X;  4ICY A;  4OPL A;  4AP3 A;  2ZZC A;  5KWF A;  2APG A;  2YVG A;  3UTH A;  2TPR A;  4H4S A;  1VRQ B;  3AE8 A;  2XFO A;  1CHU A;  3JSK A;  4OPU A;  3GSI A;  4J36 A;  5EBK A;  1NHR A;  4K22 A;  3LZW A;  1CBO A;  4H4T A;  2VVL A;  3T14 A;  4APN A;  2DKH A;  1ZMD A;  2FBW A;  4JY3 A;  3DJE A;  1JNR A;  3B6D A;  4H4U A;  2GQF A;  4U8N A;  1IUX A;  3KLJ A;  1O94 A;  3DA1 A;  5FS6 A;  2GAH B;  1E1M A;  2Q7V A;  4BJY A;  1LV0 A;  1F3P A;  2F5Z A;  3AE6 A;  4X4J A;  3IC9 A;  2B7S A;  2JB3 A;  2CUL A;  4JN9 A;  1GET A;  4XWR A;  3SQP A;  2RGO A;  2X8H A;  2PYX A;  2GR1 A;  3CNT A;  4II2 A;  4ZCD A;  5FS9 A;  3FPZ A;  1D4E A;  2WEU A;  3CNP A;  5KOW A;  5BUK A;  3SXI A;  1XDI A;  2BS2 A;  4YKG A;  1LQT A;  2TMD A;  3GRT A;  2Z5X A;  4ZCC A;  2H88 A;  3CND A;  4DNA A;  4H4W A;  3DJD A;  3LB8 A;  3UKL A;  3VRA A;  2WBA A;  3GMB A;  2WPC A;  3RP8 A;  1PBC A;  3DME A;  4YT0 A;  5LV9 A;  2JB1 A;  5GRT A;  1Q1W A;  3KU9 A;  5KVH A;  3ADA B;  1LJ1 A;  3ALL A;  2XLP A;  2Y6Q A;  3E1T A;  1D5T A;  1N4V A;  1JU2 A;  2BA9 A;  3II4 A;  4H7U A;  3RED A;  3G5Q A;  4OPD A;  2YLX A;  2I0Z A;  2YVF A;  1GRA A;  3NYC A;  2B76 A;  2XCG A;  1V59 A;  3BNU A;  3IF9 A;  3AE3 A;  3S5W A;  1YKJ A;  2X8G A;  2BC0 A;  1F8S A;  4H50 A;  2YLW A;  2XYO A;  3HYW A;  4C77 A;  1N4W A;  2RGJ A;  3NNE A;  2XDO A;  2C3C A;  4WX1 A;  4EM4 A;  5JCN A;  1LPF A;  2YLR A;  2YM2 A;  2GR2 A;  4GCM A;  1L0V A;  4J33 A;  2XFP A;  1XPQ A;  4AT2 A;  3G5R A;  1E39 A;  3P9U A;  2BYB A;  3UOZ A;  3IWA A;  2Q0L A;  4Z26 A;  3NYF A;  3ISH A;  4USQ A;  4U8J A;  3AEA A;  1F6M A;  4OPG A;  2UZZ A;  3LZX A;  2QA1 A;  3OZ2 A;  1GTH A;  1H6V A;  4A6N B;  3BI2 A;  1REO A;  2GQW A;  2V6O A;  3AYL A;  2BS3 A;  3GMC A;  4EMI A;  5KRQ A;  4I58 A;  3CGC A;  4IVO B;  3SM8 A;  3CTY A;  4DSH A;  1ZDL A;  3K7T A;  4CY6 A;  1IUT A;  1HYU A;  4REK A;  4B63 A;  4D03 A;  2BAB A;  1JRY A;  4MJW A;  1CJC A;  4CNJ A;  2JB2 A;  1TDE A;  3LJP A;  1JRX A;  2B7R A;  1NG4 A;  5TR3 A;  3BI4 A;  5M0Z A;  2BK3 A;  4N9X A;  3C4N A;  2HQM A;  1SEZ A;  3LAD A;  4D04 A;  4JY2 A;  3SZC A;  2WOW A;  4GAP A;  4FK1 A;  1CF3 A;  3UKQ A;  3SYI A;  3COX A;  4AT0 A;  3P4Q A;  1D4C A;  4BV6 A;  5IQ4 A;  3AE2 A;  1PJ7 A;  4K2X A;  2C65 A;  4EQX A;  3NN0 X;  1H84 A;  4G9K A;  1GSN A;  4EMJ A;  4J56 A;  5C3J A;  2E1M A;  3PS9 A;  3T0K A;  2X8C A;  3CGD A;  4K7Z A;  1B37 A;  3URH A;  3ICR A;  4GF7 A;  1PBD A;  3QFA A;  4G6H A;  3VR9 A;  3IHG A;  3I3L A;  5HY5 A;  1VG0 A;  2R0C A;  3K7M X;  4YSX A;  2YM1 A;  1S3B A;  2WET A;  3CGB A;  3OC4 A;  3KPK A;  2ARD A;  3EPT A;  1GRE A;  2C76 A;  3AD9 B;  5U25 A;  4EQS A;  3SZ0 A;  4BK1 A;  2WOV A;  4B68 A;  5KMS A;  4H4X A;  5KNL A;  4EIQ A;  1H7X A;  2R4E A;  3FG2 P;  3WE0 A;  4H2N A;  5J7X A;  4A7A A;  3GYX A;  1FL2 A;  4EQW A;  1BWC A;  2FJA A;  3EAN A;  1TDK A;  4U2L A;  2R4J A;  2GR0 A;  4XXG A;  3AB1 A;  4C3Y A;  1TDO A;  4AP1 A;  4A79 A;  2GEW A;  1E1K A;  2RAB A;  2A89 A;  3KD9 A;  4AOX A;  4H4R A;  3GDN A;  1PBB A;  1GEU A;  2OAM A;  3AE1 A;  3GYI A;  2CFY A;  1BZL A;  2NVK X;  1EL7 A;  1FEB A;  1CJ3 A;  1JNZ A;  2YWL A;  1KF6 A;  3PVC A;  4FK1 C;  4GAV A;  1E6E A;  4X9N A;  2OA1 A;  1NHP A;  2XLR A;  4K5S A;  3M0O A;  3GRS A;  1OJT A;  4YKF A;  2B9X A;  4KPR A;  1NEN A;  1CC6 A;  1CJ4 A;  3CN8 A;  3BHF A;  5JCI A;  1PJ5 A;  4IA5 A;  2PHH A;  2XVE A;  1PXC A;  4TM3 A;  4EQR A;  2VQ7 A;  4O5U A;  2JAE A;  1MO9 A;  2C73 A;  1ZOY A;  2GB0 A;  4J2W A;  4H4V A;  1QO8 A;  1GV4 A;  2ZBW A;  3T31 A;  1Y56 A;  3F8R A;  2DKI A;  4U8O A;  5U1O A;  4WCT A;  1S2Y A;  3GD3 A;  4U8K A;  5EB4 A;  4GRT A;  5DBJ A;  4O5Q A;  2GMJ A;  5L46 A;  1ZK7 A;  2C7G A;  1K0J A;  4FX9 A;  4BK2 A;  3M13 A;  4CBQ A;  2X50 A;  1MOK A;  3DK8 A;  4Y4N A;  3PO7 A;  2OLN A;  4JDR A;  1GT8 A;  1KDG A;  2YG4 A;  3KKJ A;  1NHS A;  2E4G A;  3O0H A;  1DOE A;  3AE9 A;  3AE4 A;  3ATQ A;  2BS4 A;  2FJB A;  3CNS A;  3ICT A;  2WU2 A;  4U2T A;  1E1N A;  4EM3 A;  1FCD A;  3D8X A;  4OPT A;  4IVM B;  3BHK A;  1H7W A;  4NNJ A;  4C3X A;  1TYP A;  1BGJ A;  1ZY8 A;  3QSM A;  1QLB A;  1H82 A;  5KVI A;  2AR8 A;  1IUS A;  5IQ1 A;  3UTG A;  4H4Y A;  4OPI A;  1P2H A;  5KMP A;  3H4K A;  1B5Q A;  1PXB A;  1GRG A;  3FMW A;  4YWO A;  1YQZ A;  1PBE A;  1XHC A;  1GER A;  3DJJ A;  4KX6 A;  4EMW A;  2J3N A;  3HYV A;  1KFY A;  3GD4 A;  3NT6 A;  1LVL A;  3SX6 A;  4Y4L A;  3V3O A;  2VRM A;  4NTD A;  1GXF A;  2OAL A;  3CGE A;  2GF3 A;  2YG6 A;  3DK4 A;  4TM0 A;  3SGL A;  3ATR A;  3CIR A;  1K0I A;  2BK5 A;  5JCL A;  1GAL A;  3SFE A;  3ZDN A;  2EQ7 A;  1X31 B;  3GWD A;  2R0G A;  3CPI G;  4BJZ A;  3F8D A;  3T2Y A;  3P4P A;  1IUV A;  4DSG A;  4ECH A;  3V3N A;  1GND A;  4H4Z A;  4NWZ A;  2QCU A;  1DXL A;  1CJ2 A;  2XLS A;  4TM4 A;  4USR A;  1H83 A;  1OJ9 A;  1TDF A;  1Q9I A;  1MXT A;  2GRT A;  2XVH A;  3NK0 X;  4ZN0 A;  3NHO X;  2IVE A;  3UCL A;  1NDA A;  2XVF A;  2R0P A;  1KSU A;  4J57 A;  3P1W A;  4PAA A;  2WU5 A;  3NYE A;  2E5V A;  2H89 A;  5FMH A;  1KNR A;  3AE7 A;  1M6I A;  3Q6J A;  2YR5 A;  4I59 A;  5BVA A;  2XFU A;  4UDQ A;  4BK3 A;  2WP6 A;  4Z2T A;  3K7Q X;  2QA2 A;  3IHM A;  4B66 A;  2BRY A;  1E1L A;  3DJG X;  4U8L A;  1LQU A;  3K30 A;  4CRT A;  4C5O A;  4M52 A;  5HXI A;  2GVC A;  3UOX A;  1PN0 A;  1EBD A;  1K4Q A;  2JKC A;  4IA6 A;  3AYJ A;  1D4D A;  2NPX A;  3UOY A;  3M12 A;  3DH9 A;  4H2Q A;  3T2Z A;  1Y0P A;  2ACZ A;  2Q6U A;  2X99 A;  3QVR A;  4JNA A;  2YR4 A;  1Z6L A;  2QAE A;  2WDQ A;  2XFQ A;  2EQ9 A;  2ZZ0 A;  3AEF A;  2WES A;  4G74 A;  1DJQ A;  2EQ6 A;  3AXB A;  3VQR A;  2YG7 A;  3AEG A;  3HYX A;  1K0L A;  2FJE A;  3P4R A;  3RP6 A;  1IUU A;  4NEV A;  2VOU A;  4LA1 A;  2OLO A;  2YLT A;  1N4U A;  4YXD A;  3NIX A;  2WHD A;  1ZX9 A;  2B9W A;  2R9Z A;  2WP9 A;  3UOV A;  1DOC A;  1D7Y A;  3ALM A;  1M64 A;  3CMM A;  2XVI A;  2YG3 A;  3Q9T A;  4Z2R A;  3L8K A;  2WP5 A;  4GR1 A;  3SY4 A;  5J60 A;  2BCP A;  3C96 A;  4Z24 A;  1NHQ A;  3FIM B;  4CNK A;  5KOX A;  4G73 A;  1Q1R A;  4E0V A;  2C75 A;  4PAB A;  4B69 A;  2WQY A;  4RG4 A;  4U2S A;  1JOA A;  3FBS A;  4YTM A;  2XFN A;  4H2P A;  2GAG B;  3KPF A;  1VQW A;  3H8L A;  3QSE A;  3I6D A;  4GDP A;  2A8X A;  4EIP A;  1XAN A;  5JCK A;  3S61 A;  2C66 A;  3C4A A;  2WDV A;  3NLC A;  1O95 A;  1FEA A;  2BK4 A;  3D1C A;  4H4P A;  3NRN A;  3UP5 A;  1P2E A;  2YR6 A;  2W0H A;  3AWI A;  3F8P A;  1OJC A;  4G6G A;  1NAA A;  4H2R A;  5C2T A;  3G5S A;  2VRL A;  4JQ9 A;  4YSZ A;  2C3D A;  4B65 A;  1GRB A;  2C4C A;  1F8R A;  2WOI A;  4J31 A;  1OJA A;  3CPJ G;  3CNJ A;  3AD8 B;  4U8M A;  5GSN A;  2Z5Y A;  3QSS A;  1S3E A;  2XLU A;  4A99 A;  3NG7 X;  3GWF A;  1COY A;  2BXR A;  1CC2 A;  3VRB A;  3RNM A;  1GOS A;  1QJD A;  4Z2U A;  2YQU A;  2BCG G;  1TDN A;  3NTD A;  1AOG A;  2V3A A;  3AEC A;  2X3N A;  4YTN A;  4FDC B;  2BXS A;  5EOW A;  3LOV A;  4NZH A;  2RGH A;  4ADW A;  4OVI A;  4XWZ A;  4X9M A;  4Z43 A;  1RP0 A;  1E7P A;  4RG3 A;  3GYJ A;  3UKK A;  4RSL A;  4JNQ A;  1DNC A;  4TLX A;  4CCQ A;  1B8S A;  2C67 A;  1ZKQ A;  2Q0K A;  4HA6 A;  4II3 A;  5KMR A;  1KNP A;  5FS7 A;  1PDH A;  4Y4M A;  5BRT A;  4UDP A;  4YTP A;  2JBV A;  1NEK A;  1L9C A;  2XLT A;  1KSS A;  2EQ8 A;  2GMH A;  2YAU A;  4B64 A;  4C74 A;  1L9E A;  3DGH A;  3R9U A;  2XVJ A;  4NTC A;  1EL9 A;  4A65 A;  4YSH A;  1PBF A;  3EF6 A;  1B4V A;  3H8I A;  5BUL A;  5JCM A;  5M10 A;  2WPF A;  5KXJ A;  1JEH A;  2R45 A;  4AOS A;  1RYI A;  3UKA A;  3ICS A;  1GRF A;  2JK6 A;  2AAQ A;  2VZ2 A;  3RHA A;  1TYT A;  1FEC A;  2AQJ A;  2YG5 A;  3RP7 A;  3P4S A;  2GV8 A;  4B67 A;  5ER0 A;  1O5W A;  3KA7 A;  3NGC X;  1GRH A;  4UP3 A;  5U63 A;  1PS9 A;  2B9Y A;  3VRD B;  3AEE A;  3BNM A;  4DGK A;  4P9S A;  4YSY A;  3EAO A;  1FOH A;  3NN6 X;  3QFB A;  4OPC A;  3ITJ A;  5CKU A;  3VR8 A;  1ZP0 A;  1IJH A;  1PJ6 A;  2FJD A;  3UKF A;  2C72 A;  1W4X A;  4J34 A;  2GH5 A;  1ZOV A;  2WS3 A;  3ALJ A;  3AYI A;  3B3R A;  2CVJ A;  4UDR A;  4Z44 A;  4B1B A;  1ELI A;  1L9D A;  1LTX R;  5HHF A;  3UKP A;  5IPY A;  1DOD A;  4GUV A;  2IVD A;  1UKV G;  3BI5 A;  1CC4 A;  3AED A;  4U8P A;  1RSG A;  2V60 A;  4IV9 A;  2WDR A;  1EL5 A;  1F8W A;  2BC1 A;  2Y6R A;  5CQF A;  4U8I A;  1BGN A;  1NG3 A;  1Y56 B;  4K8D A;  4A9W A;  1NPX A;  5FS8 A;  1OJD A;  4NEW A;  1BF3 A;  3QVP A;  3DGZ A;  3AEB A;  4LII A;  1PHH A;  2A87 A;  3UTE A;  1VDC A;  4OCG A;  5KMQ A;  3HZL A;  3ABV A;  2VQB A;  4A5L A;  2V5Z A;  2YVJ A;  4HB9 A;  1IUW A;  3T2K A;  1GTE A;  4K5R A;  1GES A;  1ZMC A;  1DOB A;  3SZF A;  1BKW A;  2O9Z A;  2R46 A;  3QJ4 A;  2C70 A;  2VVL G;  2BAC A;  1ONF A;  2YLZ A;  2IID A;  1YY5 A;  1GRT A;  1H86 A;  3NK2 X;  3L1R A;  4TM1 A;  3UTF A;  3AD7 B; 
#chains in the Genus database with same CATH homology
 2C64 A;  1JRZ A;  2ZZB A;  3UKH A;  2V3B A;  2GR3 A;  1EL8 A;  1GPE A;  1N1P A;  1S2Q A;  1TRB A;  4CCR A;  4NTE A;  3UP4 A;  4H4Q A;  3AE5 A;  1VG9 A;  2CDU A;  4Z25 A;  1D7L A;  1YQ3 A;  4CY8 A;  2V61 A;  4BUR A;  3T37 A;  1DJN A;  2YLS A;  2VVM A;  3SFD A;  3LXD A;  3NKS A;  3V76 A;  3SZW A;  4TLZ A;  1YQ4 A;  3NTA A;  4GDE A;  1PXA A;  3DK9 A;  1CL0 A;  2BRA A;  5HYM A;  3KVE A;  1H81 A;  3GDP A;  3NK1 X;  3ZYX A;  2WPE A;  5EB5 A;  4A6N A;  4LU6 A;  3CPH G;  3NH3 X;  4ICY A;  4OPL A;  4AP3 A;  2ZZC A;  5KWF A;  2APG A;  2YVG A;  3UTH A;  2TPR A;  4H4S A;  1VRQ B;  3AE8 A;  2XFO A;  1CHU A;  3JSK A;  4OPU A;  3GSI A;  4J36 A;  5EBK A;  1NHR A;  4K22 A;  3LZW A;  1CBO A;  4H4T A;  2VVL A;  3T14 A;  4APN A;  2DKH A;  1ZMD A;  2FBW A;  4JY3 A;  3DJE A;  1JNR A;  3B6D A;  4H4U A;  2GQF A;  4U8N A;  1IUX A;  3KLJ A;  1O94 A;  3DA1 A;  5FS6 A;  2GAH B;  1E1M A;  2Q7V A;  4BJY A;  1LV0 A;  1F3P A;  2F5Z A;  3AE6 A;  4X4J A;  3IC9 A;  2B7S A;  2JB3 A;  2CUL A;  4JN9 A;  1GET A;  4XWR A;  3SQP A;  2RGO A;  2X8H A;  2PYX A;  2GR1 A;  3CNT A;  4II2 A;  4ZCD A;  5FS9 A;  3FPZ A;  1D4E A;  2WEU A;  3CNP A;  5KOW A;  5BUK A;  3SXI A;  1XDI A;  2BS2 A;  4YKG A;  1LQT A;  2TMD A;  3GRT A;  2Z5X A;  4ZCC A;  2H88 A;  3CND A;  4DNA A;  4H4W A;  3DJD A;  3LB8 A;  3UKL A;  3VRA A;  2WBA A;  3GMB A;  2WPC A;  3RP8 A;  1PBC A;  3DME A;  4YT0 A;  5LV9 A;  2JB1 A;  5GRT A;  1Q1W A;  3KU9 A;  5KVH A;  3ADA B;  1LJ1 A;  3ALL A;  2XLP A;  2Y6Q A;  3E1T A;  1D5T A;  1N4V A;  1JU2 A;  2BA9 A;  3II4 A;  4H7U A;  3RED A;  3G5Q A;  4OPD A;  2YLX A;  2I0Z A;  2YVF A;  1GRA A;  3NYC A;  2B76 A;  2XCG A;  1V59 A;  3BNU A;  3IF9 A;  3AE3 A;  3S5W A;  1YKJ A;  2X8G A;  2BC0 A;  1F8S A;  4H50 A;  2YLW A;  2XYO A;  3HYW A;  4C77 A;  1N4W A;  2RGJ A;  3NNE A;  2XDO A;  2C3C A;  4WX1 A;  4EM4 A;  5JCN A;  1LPF A;  2YLR A;  2YM2 A;  2GR2 A;  4GCM A;  1L0V A;  4J33 A;  2XFP A;  1XPQ A;  4AT2 A;  3G5R A;  1E39 A;  3P9U A;  2BYB A;  3UOZ A;  3IWA A;  2Q0L A;  4Z26 A;  3NYF A;  3ISH A;  4USQ A;  4U8J A;  3AEA A;  1F6M A;  4OPG A;  2UZZ A;  3LZX A;  2QA1 A;  3OZ2 A;  1GTH A;  1H6V A;  4A6N B;  3BI2 A;  1REO A;  2GQW A;  2V6O A;  3AYL A;  2BS3 A;  3GMC A;  4EMI A;  5KRQ A;  4I58 A;  3CGC A;  4IVO B;  3SM8 A;  3CTY A;  4DSH A;  1ZDL A;  3K7T A;  4CY6 A;  1IUT A;  1HYU A;  4REK A;  4B63 A;  4D03 A;  2BAB A;  1JRY A;  4MJW A;  1CJC A;  4CNJ A;  2JB2 A;  1TDE A;  3LJP A;  1JRX A;  2B7R A;  1NG4 A;  5TR3 A;  3BI4 A;  5M0Z A;  2BK3 A;  4N9X A;  3C4N A;  2HQM A;  1SEZ A;  3LAD A;  4D04 A;  4JY2 A;  3SZC A;  2WOW A;  4GAP A;  4FK1 A;  1CF3 A;  3UKQ A;  3SYI A;  3COX A;  4AT0 A;  3P4Q A;  1D4C A;  4BV6 A;  5IQ4 A;  3AE2 A;  1PJ7 A;  4K2X A;  2C65 A;  4EQX A;  3NN0 X;  1H84 A;  4G9K A;  1GSN A;  4EMJ A;  4J56 A;  5C3J A;  2E1M A;  3PS9 A;  3T0K A;  2X8C A;  3CGD A;  4K7Z A;  1B37 A;  3URH A;  3ICR A;  4GF7 A;  1PBD A;  3QFA A;  4G6H A;  3VR9 A;  3IHG A;  3I3L A;  5HY5 A;  1VG0 A;  2R0C A;  3K7M X;  4YSX A;  2YM1 A;  1S3B A;  2WET A;  3CGB A;  3OC4 A;  3KPK A;  2ARD A;  3EPT A;  1GRE A;  2C76 A;  3AD9 B;  5U25 A;  4EQS A;  3SZ0 A;  4BK1 A;  2WOV A;  4B68 A;  5KMS A;  4H4X A;  5KNL A;  4EIQ A;  1H7X A;  2R4E A;  3FG2 P;  3WE0 A;  4H2N A;  5J7X A;  4A7A A;  3GYX A;  1FL2 A;  4EQW A;  1BWC A;  2FJA A;  3EAN A;  1TDK A;  4U2L A;  2R4J A;  2GR0 A;  4XXG A;  3AB1 A;  4C3Y A;  1TDO A;  4AP1 A;  4A79 A;  2GEW A;  1E1K A;  2RAB A;  2A89 A;  3KD9 A;  4AOX A;  4H4R A;  3GDN A;  1PBB A;  1GEU A;  2OAM A;  3AE1 A;  3GYI A;  2CFY A;  1BZL A;  2NVK X;  1EL7 A;  1FEB A;  1CJ3 A;  1JNZ A;  2YWL A;  1KF6 A;  3PVC A;  4FK1 C;  4GAV A;  1E6E A;  4X9N A;  2OA1 A;  1NHP A;  2XLR A;  4K5S A;  3M0O A;  3GRS A;  1OJT A;  4YKF A;  2B9X A;  4KPR A;  1NEN A;  1CC6 A;  1CJ4 A;  3CN8 A;  3BHF A;  5JCI A;  1PJ5 A;  4IA5 A;  2PHH A;  2XVE A;  1PXC A;  4TM3 A;  4EQR A;  2VQ7 A;  4O5U A;  2JAE A;  1MO9 A;  2C73 A;  1ZOY A;  2GB0 A;  4J2W A;  4H4V A;  1QO8 A;  1GV4 A;  2ZBW A;  3T31 A;  1Y56 A;  3F8R A;  2DKI A;  4U8O A;  5U1O A;  4WCT A;  1S2Y A;  3GD3 A;  4U8K A;  5EB4 A;  4GRT A;  5DBJ A;  4O5Q A;  2GMJ A;  5L46 A;  1ZK7 A;  2C7G A;  1K0J A;  4FX9 A;  4BK2 A;  3M13 A;  4CBQ A;  2X50 A;  1MOK A;  3DK8 A;  4Y4N A;  3PO7 A;  2OLN A;  4JDR A;  1GT8 A;  1KDG A;  2YG4 A;  3KKJ A;  1NHS A;  2E4G A;  3O0H A;  1DOE A;  3AE9 A;  3AE4 A;  3ATQ A;  2BS4 A;  2FJB A;  3CNS A;  3ICT A;  2WU2 A;  4U2T A;  1E1N A;  4EM3 A;  1FCD A;  3D8X A;  4OPT A;  4IVM B;  3BHK A;  1H7W A;  4NNJ A;  4C3X A;  1TYP A;  1BGJ A;  1ZY8 A;  3QSM A;  1QLB A;  1H82 A;  5KVI A;  2AR8 A;  1IUS A;  5IQ1 A;  3UTG A;  4H4Y A;  4OPI A;  1P2H A;  5KMP A;  3H4K A;  1B5Q A;  1PXB A;  1GRG A;  3FMW A;  4YWO A;  1YQZ A;  1PBE A;  1XHC A;  1GER A;  3DJJ A;  4KX6 A;  4EMW A;  2J3N A;  3HYV A;  1KFY A;  3GD4 A;  3NT6 A;  1LVL A;  3SX6 A;  4Y4L A;  3V3O A;  2VRM A;  4NTD A;  1GXF A;  2OAL A;  3CGE A;  2GF3 A;  2YG6 A;  3DK4 A;  4TM0 A;  3SGL A;  3ATR A;  3CIR A;  1K0I A;  2BK5 A;  5JCL A;  1GAL A;  3SFE A;  3ZDN A;  2EQ7 A;  1X31 B;  3GWD A;  2R0G A;  3CPI G;  4BJZ A;  3F8D A;  3T2Y A;  3P4P A;  1IUV A;  4DSG A;  4ECH A;  3V3N A;  1GND A;  4H4Z A;  4NWZ A;  2QCU A;  1DXL A;  1CJ2 A;  2XLS A;  4TM4 A;  4USR A;  1H83 A;  1OJ9 A;  1TDF A;  1Q9I A;  1MXT A;  2GRT A;  2XVH A;  3NK0 X;  4ZN0 A;  3NHO X;  2IVE A;  3UCL A;  1NDA A;  2XVF A;  2R0P A;  1KSU A;  4J57 A;  3P1W A;  4PAA A;  2WU5 A;  3NYE A;  2E5V A;  2H89 A;  5FMH A;  1KNR A;  3AE7 A;  1M6I A;  3Q6J A;  2YR5 A;  4I59 A;  5BVA A;  2XFU A;  4UDQ A;  4BK3 A;  2WP6 A;  4Z2T A;  3K7Q X;  2QA2 A;  3IHM A;  4B66 A;  2BRY A;  1E1L A;  3DJG X;  4U8L A;  1LQU A;  3K30 A;  4CRT A;  4C5O A;  4M52 A;  5HXI A;  2GVC A;  3UOX A;  1PN0 A;  1EBD A;  1K4Q A;  2JKC A;  4IA6 A;  3AYJ A;  1D4D A;  2NPX A;  3UOY A;  3M12 A;  3DH9 A;  4H2Q A;  3T2Z A;  1Y0P A;  2ACZ A;  2Q6U A;  2X99 A;  3QVR A;  4JNA A;  2YR4 A;  1Z6L A;  2QAE A;  2WDQ A;  2XFQ A;  2EQ9 A;  2ZZ0 A;  3AEF A;  2WES A;  4G74 A;  1DJQ A;  2EQ6 A;  3AXB A;  3VQR A;  2YG7 A;  3AEG A;  3HYX A;  1K0L A;  2FJE A;  3P4R A;  3RP6 A;  1IUU A;  4NEV A;  2VOU A;  4LA1 A;  2OLO A;  2YLT A;  1N4U A;  4YXD A;  3NIX A;  2WHD A;  1ZX9 A;  2B9W A;  2R9Z A;  2WP9 A;  3UOV A;  1DOC A;  1D7Y A;  3ALM A;  1M64 A;  3CMM A;  2XVI A;  2YG3 A;  3Q9T A;  4Z2R A;  3L8K A;  2WP5 A;  4GR1 A;  3SY4 A;  5J60 A;  2BCP A;  3C96 A;  4Z24 A;  1NHQ A;  3FIM B;  4CNK A;  5KOX A;  4G73 A;  1Q1R A;  4E0V A;  2C75 A;  4PAB A;  4B69 A;  2WQY A;  4RG4 A;  4U2S A;  1JOA A;  3FBS A;  4YTM A;  2XFN A;  4H2P A;  2GAG B;  3KPF A;  1VQW A;  3H8L A;  3QSE A;  3I6D A;  4GDP A;  2A8X A;  4EIP A;  1XAN A;  5JCK A;  3S61 A;  2C66 A;  3C4A A;  2WDV A;  3NLC A;  1O95 A;  1FEA A;  2BK4 A;  3D1C A;  4H4P A;  3NRN A;  3UP5 A;  1P2E A;  2YR6 A;  2W0H A;  3AWI A;  3F8P A;  1OJC A;  4G6G A;  1NAA A;  4H2R A;  5C2T A;  3G5S A;  2VRL A;  4JQ9 A;  4YSZ A;  2C3D A;  4B65 A;  1GRB A;  2C4C A;  1F8R A;  2WOI A;  4J31 A;  1OJA A;  3CPJ G;  3CNJ A;  3AD8 B;  4U8M A;  5GSN A;  2Z5Y A;  3QSS A;  1S3E A;  2XLU A;  4A99 A;  3NG7 X;  3GWF A;  1COY A;  2BXR A;  1CC2 A;  3VRB A;  3RNM A;  1GOS A;  1QJD A;  4Z2U A;  2YQU A;  2BCG G;  1TDN A;  3NTD A;  1AOG A;  2V3A A;  3AEC A;  2X3N A;  4YTN A;  4FDC B;  2BXS A;  5EOW A;  3LOV A;  4NZH A;  2RGH A;  4ADW A;  4OVI A;  4XWZ A;  4X9M A;  4Z43 A;  1RP0 A;  1E7P A;  4RG3 A;  3GYJ A;  3UKK A;  4RSL A;  4JNQ A;  1DNC A;  4TLX A;  4CCQ A;  1B8S A;  2C67 A;  1ZKQ A;  2Q0K A;  4HA6 A;  4II3 A;  5KMR A;  1KNP A;  5FS7 A;  1PDH A;  4Y4M A;  5BRT A;  4UDP A;  4YTP A;  2JBV A;  1NEK A;  1L9C A;  2XLT A;  1KSS A;  2EQ8 A;  2GMH A;  2YAU A;  4B64 A;  4C74 A;  1L9E A;  3DGH A;  3R9U A;  2XVJ A;  4NTC A;  1EL9 A;  4A65 A;  4YSH A;  1PBF A;  3EF6 A;  1B4V A;  3H8I A;  5BUL A;  5JCM A;  5M10 A;  2WPF A;  5KXJ A;  1JEH A;  2R45 A;  4AOS A;  1RYI A;  3UKA A;  3ICS A;  1GRF A;  2JK6 A;  2AAQ A;  2VZ2 A;  3RHA A;  1TYT A;  1FEC A;  2AQJ A;  2YG5 A;  3RP7 A;  3P4S A;  2GV8 A;  4B67 A;  5ER0 A;  1O5W A;  3KA7 A;  3NGC X;  1GRH A;  4UP3 A;  5U63 A;  1PS9 A;  2B9Y A;  3VRD B;  3AEE A;  3BNM A;  4DGK A;  4P9S A;  4YSY A;  3EAO A;  1FOH A;  3NN6 X;  3QFB A;  4OPC A;  3ITJ A;  5CKU A;  3VR8 A;  1ZP0 A;  1IJH A;  1PJ6 A;  2FJD A;  3UKF A;  2C72 A;  1W4X A;  4J34 A;  2GH5 A;  1ZOV A;  2WS3 A;  3ALJ A;  3AYI A;  3B3R A;  2CVJ A;  4UDR A;  4Z44 A;  4B1B A;  1ELI A;  1L9D A;  1LTX R;  5HHF A;  3UKP A;  5IPY A;  1DOD A;  4GUV A;  2IVD A;  1UKV G;  3BI5 A;  1CC4 A;  3AED A;  4U8P A;  1RSG A;  2V60 A;  4IV9 A;  2WDR A;  1EL5 A;  1F8W A;  2BC1 A;  2Y6R A;  5CQF A;  4U8I A;  1BGN A;  1NG3 A;  1Y56 B;  4K8D A;  4A9W A;  1NPX A;  5FS8 A;  1OJD A;  4NEW A;  1BF3 A;  3QVP A;  3DGZ A;  3AEB A;  4LII A;  1PHH A;  2A87 A;  3UTE A;  1VDC A;  4OCG A;  5KMQ A;  3HZL A;  3ABV A;  2VQB A;  4A5L A;  2V5Z A;  2YVJ A;  4HB9 A;  1IUW A;  3T2K A;  1GTE A;  4K5R A;  1GES A;  1ZMC A;  1DOB A;  3SZF A;  1BKW A;  2O9Z A;  2R46 A;  3QJ4 A;  2C70 A;  2VVL G;  2BAC A;  1ONF A;  2YLZ A;  2IID A;  1YY5 A;  1GRT A;  1H86 A;  3NK2 X;  3L1R A;  4TM1 A;  3UTF A;  3AD7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...