4CCRA

Crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
313
structure length
311
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 91
structure length 311
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccrA02
1B4VA 4J56A 1CC6A 2AQJA 5IPYA 1YY5A 2FJDA 2NVKX 3ALJA 3AEAA 4ZCDA 2YLZA 4U2LA 4BK1A 3CGDA 1ZOVA 4U8JA 3HZLA 2C67A 1CJ3A 2GV8A 1GV4A 1GESA 3OZ2A 2YLRA 2A8XA 2WOIA 2HQMA 1NEKA 3AE8A 1PXAA 3UOVA 1XDIA 4X4JA 2R45A 2RGHA 5C3JA 1EBDA 2GAHB 4K7ZA 4O5UA 1S2QA 2F5ZA 3QFBA 5KVIA 3NTAA 2J3NA 3VRBA 4RG4A 2Q0LA 2BYBA 1GERA 1PBEA 3ABVA 2IIDA 1KF6A 1QJDA 5EB5A 1O95A 1H82A 1RP0A 2YR4A 4JQ9A 2X8HA 4TM3A 2YAUA 2CFYA 2TMDA 5EBKA 1XPQA 2V6OA 1TYTA 4H4SA 1PBBA 5L46A 5HXIA 3UCLA 1JOAA 4X9NA 3AYIA 5KOWA 2JB2A 1F6MA 2VVMA 1KNRA 3LADA 4OPGA 1L0VA 3V76A 4C74A 2XLUA 3L1RA 5ER0A 1NG3A 3AE4A 3D1CA 2WDRA 3K7QX 4DSGA 2GAGB 2JKCA 2XVEA 2RABA 2WEUA 3PS9A 2YM1A 4JN9A 3DH9A 4B69A 4ZN0A 3AEEA 1TDKA 3ADAB 4H50A 4GR1A 1UKVG 3UKLA 3DMEA 1GTHA 1N4UA 1PJ5A 2YM2A 1E1KA 3CTYA 2YVFA 3I6DA 1KFYA 1GT8A 2WU5A 2Y6RA 3NH3X 2WPFA 3SQPA 1IUVA 4M52A 2WP6A 4IVMB 1MO9A 3SM8A 2ACZA 3B6DA 1KNPA 3GSIA 2WQYA 2PHHA 3VRAA 4GCMA 3GMCA 2B7RA 1LQUA 2VRMA 5JCNA 3LXDA 3NT6A 2QA2A 1H84A 3RP7A 1NENA 1E1MA 1VQWA 4OPLA 4KX6A 1CBOA 3BI4A 4C3XA 1F8SA 1P2HA 3P4SA 3T37A 3O0HA 1H86A 2C73A 4K8DA 4GDPA 1GRAA 1ZP0A 2PYXA 1N4WA 3BNMA 1IUSA 1NG4A 3KKJA 2Z5XA 3KU9A 5M0ZA 2R0PA 4EQWA 3FIMB 5CQFA 4B68A 2VOUA 4CCQA 3DJGX 1EL7A 3NK0X 1OJTA 1GREA 1PHHA 4LU6A 1ZOYA 4K22A 1NHPA 1D4EA 3EANA 1NHRA 1GALA 1E39A 2Y6QA 3ATRA 2C3CA 3GWDA 3URHA 4DGKA 2WDQA 3UKPA 3QFAA 1K4QA 4UP3A 3BI5A 3AWIA 5KRQA 2B9XA 1IUUA 2WPCA 1NDAA 1JU2A 4EIQA 2VZ2A 1DOEA 3AEGA 3GMBA 3ALLA 3UKHA 1D5TA 4J33A 1CJ4A 2C66A 4TLZA 5LV9A 2GQWA 2XCGA 3ZDNA 3I3LA 1XHCA 3UKQA 4PABA 2FJAA 3LOVA 1TRBA 4H4YA 3EAOA 1JEHA 2C3DA 4H4XA 2OLNA 1E6EA 2VQBA 4N9XA 4TM4A 1DNCA 2QCUA 4BK3A 1GRFA 1FOHA 2H89A 3ICSA 1DOCA 2V61A 3DK4A 4UDPA 3CNDA 1OJAA 4K5RA 2FJBA 2XFNA 1GRBA 2E4GA 2V5ZA 3NYFA 2XLTA 5FS6A 2ZBWA 4YTPA 1LVLA 1L9DA 4GDEA 3KD9A 1D7LA 1BF3A 2EQ9A 2NPXA 4IA6A 2BC0A 3M0OA 3NNEA 5U63A 3EF6A 3UKKA 1FEAA 4JY3A 4X9MA 3DK8A 1CC2A 2A89A 2BK3A 4XXGA 3AE9A 4Z2UA 2QAEA 1H7WA 4RG3A 4EMJA 3F8RA 2RGOA 3CPHG 1IUXA 2JAEA 3CNJA 2GVCA 5KWFA 2BA9A 1BZLA 3DGZA 2BS3A 3CNTA 5FS8A 3L8KA 4H2PA 1GETA 3GRSA 1H6VA 1SEZA 2BXSA 2OALA 3S61A 3COXA 3E1TA 4H4TA 4CNJA 4YSHA 2BXRA 1K0JA 2JB1A 2WOWA 1ZMDA 2RGJA 1RYIA 3D8XA 5KVHA 1O94A 4IV9A 4CRTA 3EPTA 1MOKA 3ALMA 4D03A 1GRHA 2R0CA 1CF3A 1E1NA 2XLRA 1ZKQA 5J60A 3NHOX 1GRTA 4I58A 1O5WA 3P4QA 3DA1A 4EMWA 1BKWA 4EIPA 4YKGA 1P2EA 4ADWA 1GNDA 2BACA 2XYOA 4XWZA 1VG9A 3CNSA 3P4RA 3FMWA 2VRLA 1H81A 1E7PA 2R4JA 2V3BA 3NYCA 1PN0A 1X31B 4E0VA 4J31A 3AYLA 3IHGA 3GWFA 3K7TA 4Y4MA 4B66A 3NG7X 1DODA 1N4VA 1Y56A 3FG2P 4YTMA 2WDVA 4CY6A 1PDHA 3REDA 3NTDA 3B3RA 4JDRA 5FS9A 4BJYA 3AD8B 3V3OA 3PO7A 4A7AA 2FJEA 2WETA 4J34A 4EM3A 1KSSA 2YLXA 1S2YA 4EQRA 2C65A 2XFPA 2CULA 3CPJG 4H4UA 3NIXA 1OJ9A 3II4A 3UTHA 2B76A 2XFUA 4CNKA 4HA6A 1PBDA 2WPEA 1PXCA 4OPIA 5GSNA 4OPUA 3DGHA 2YWLA 4AP3A 4GRTA 4FDCB 3AEDA 2WBAA 1CC4A 4YSYA 2O9ZA 5DBJA 3Q9TA 3UTFA 1OJCA 4K2XA 5GRTA 4YT0A 2IVEA 3AYJA 2ZZBA 2TPRA 3VRDB 2CDUA 2GR3A 2OA1A 3H8LA 4BK2A 4J2WA 5JCMA 3NN6X 5KXJA 4U8KA 3UTEA 2XDOA 5BVAA 2Z5YA 3DJEA 2GR2A 3IWAA 5EB4A 1JNZA 3NYEA 4B65A 3JSKA 2EQ7A 3AE3A 3KPFA 4FK1A 4BURA 4NEWA 4CCRA 1K0LA 4FK1C 5M10A 2XVIA 1PJ7A 1DJNA 1Y0PA 2YR5A 4HB9A 4U2TA 3RHAA 2GMHA 2YVGA 2ZZCA 2BCPA 3G5QA 4NTCA 4H2NA 2IVDA 4DNAA 1DOBA 3QVRA 4U8LA 1M6IA 3CN8A 4H7UA 4AOXA 2X3NA 4B1BA 3UTGA 3UOXA 3AE6A 2XLSA 3ICRA 3QSSA 2YG3A 1DJQA 4WX1A 1N1PA 1Q9IA 4GUVA 4BV6A 5TR3A 3CNPA 3LJPA 4U8IA 3AECA 4AP1A 4B64A 3IHMA 3AE1A 4OPTA 5IQ4A 1ZMCA 4EQSA 1H83A 2JK6A 2YG4A 5J7XA 3FPZA 2YG7A 1LTXR 2Q6UA 3AXBA 3OC4A 4H4PA 2FBWA 4MJWA 1FL2A 1GSNA 4UDRA 1H7XA 2R0GA 4A6NA 4U8NA 4AT0A 4LIIA 2YR6A 3NK1X 1ZK7A 4TLXA 5BULA 3H4KA 5EOWA 2C76A 2V3AA 2GH5A 2YLWA 2UZZA 2YLSA 1Q1RA 3GD3A 2BC1A 1F8RA 2ZZ0A 4C3YA 4IVOB 3K7MX 1VDCA 4NTDA 1D4CA 2GR0A 2V60A 3QJ4A 1JRXA 1ZDLA 3AD7B 2X99A 2X8GA 5CKUA 3QSMA 2YLTA 3ZYXA 1KDGA 1COYA 2VQ7A 3K30A 4EMIA 1TDOA 5JCIA 3M12A 1L9EA 2GMJA 2W0HA 1GPEA 2XFOA 3S5WA 1Y56B 1AOGA 4A99A 1TDNA 3UKFA 2A87A 1YQ4A 3LZXA 2B7SA 4U8PA 2X8CA 2H88A 3NN0X 3WE0A 4OCGA 2OLOA 3DJJA 2B9WA 1QLBA 5HHFA 4A5LA 1KSUA 2R4EA 4H4WA 4AT2A 4OPDA 1D4DA 3AE2A 2Q7VA 4YKFA 4A79A 2I0ZA 3M13A 1D7YA 3AEBA 2R46A 4K5SA 2C70A 3BHFA 4YSZA 4Z2RA 4Z26A 1B37A 4CY8A 3VR8A 4YTNA 1V59A 1DXLA 2YG5A 5JCKA 1W4XA 1IUWA 1S3BA 2WHDA 3F8PA 5BRTA 3G5RA 4D04A 2GQFA 3RP8A 4U8OA 3SFDA 3ISHA 1Z6LA 2QA1A 4BJZA 1YQ3A 4ICYA 2E1MA 2VVLA 4O5QA 5IQ1A 4NTEA 3UP4A 4TM0A 1EL5A 2DKIA 2R9ZA 1Q1WA 2XLPA 1ZX9A 2YQUA 4OVIA 3DJDA 1FCDA 3R9UA 2OAMA 5BUKA 3UKAA 5HY5A 1IUTA 1BGJA 4PAAA 1ONFA 4Y4NA 5C2TA 1YKJA 1B8SA 2C75A 4APNA 2B9YA 1NHSA 1RSGA 3CGEA 3IC9A 1PJ6A 2C64A 2JBVA 2JB3A 4H2RA 3VR9A 2ARDA 4DSHA 2XVJA 1TDFA 2YG6A 4H2QA 1CJCA 3NGCX 4IA5A 4A65A 3NLCA 1NHQA 1NAAA 3AD9B 3FBSA 1EL8A 4P9SA 4C77A 3UOZA 1HYUA 2VVLG 2BK4A 2EQ8A 2WP9A 3NKSA 3AE7A 4U8MA 1REOA 1JNRA 2BCGG 1GTEA 4WCTA 2WU2A 3UOYA 3V3NA 4CBQA 4AOSA 4Z2TA 1LJ1A 3BNUA 2EQ6A 2XVHA 2BS2A 4J36A 3AE5A 4Z24A 1VG0A 3GDNA 2GEWA 3VQRA 3AEFA 4ECHA 1PBFA 1VRQB 1TDEA 4OPCA 1F8WA 3P9UA 4NZHA 3SGLA 4H4ZA 1PBCA 1XANA 1BWCA 5U25A 2GB0A 1GXFA 1CL0A 2AAQA 3C96A 2CVJA 3CPIG 3G5SA 1JRYA 1QO8A 2WESA 1L9CA 2GR1A 1M64A 4A6NB 3Q6JA 1F3PA 3P4PA 4JY2A 1TYPA 4TM1A 3CIRA 2APGA 4YSXA 1FEBA 1B5QA 3UP5A 2DKHA 2C7GA 3NRNA 5FMHA 4I59A 1LPFA 5U1OA 4EQXA 1LQTA 1K0IA 2C72A 3KVEA 4U2SA 3GD4A 2YVJA 3ITJA 4USRA 4A9WA 4USQA 1PS9A 3KLJA 2GRTA 3ATQA 3C4AA 1E1LA 1ZY8A 4NEVA 1GEUA 3H8IA 1IJHA 4XWRA 3DK9A 3GDPA 2AR8A 4UDQA 1EL9A 4KPRA 3LB8A 3BHKA 1NPXA 2WS3A 1CJ2A 2BK5A 3GYJA 1YQZA 3ICTA 3P1WA 1GOSA 4H4RA 1S3EA 4Y4LA 3GYIA 4Z44A 4J57A 1GRGA 4REKA 1CHUA 4YWOA 4B63A 2WP5A 4GF7A 3F8DA 1MXTA 2GF3A 5FS7A 4JNQA 4RSLA 4LA1A 2Q0KA 4Z43A 2BABA 3NK2X 4B67A 1LV0A 1JRZA 3RNMA 2XFQA 3PVCA 4ZCCA 4FX9A 3QSEA 4YXDA 4H4VA 4H4QA 3AB1A 3KA7A 1FECA 5KOXA 3BI2A 3C4NA 4Z25A 5HYMA 3CGBA 5JCLA 3CGCA 3LZWA 2E5VA 1BGNA 1ELIA 3IF9A 3QVPA 3GRTA 4JNAA 2WOVA 3RP6A 4EM4A 1OJDA 2BS4A 2X50A 2XVFA 4C5OA 1PXBA 3SFEA
chains in the Genus database with same CATH superfamily
1B4VA 4J56A 1CC6A 2AQJA 5IPYA 1YY5A 2FJDA 2NVKX 3ALJA 3AEAA 4ZCDA 2YLZA 4U2LA 4BK1A 3CGDA 1ZOVA 4U8JA 3HZLA 4G73A 2C67A 1CJ3A 2GV8A 5KMSA 3T14A 1GV4A 1GESA 3OZ2A 2YLRA 2A8XA 2WOIA 2HQMA 1NEKA 3AE8A 1PXAA 3UOVA 1XDIA 4X4JA 2R45A 2RGHA 5C3JA 1EBDA 2GAHB 4K7ZA 4O5UA 1S2QA 2F5ZA 3QFBA 5KVIA 3NTAA 2J3NA 3VRBA 4RG4A 2Q0LA 2BYBA 1GERA 1PBEA 3ABVA 2IIDA 1KF6A 1QJDA 5EB5A 3SXIA 1O95A 1H82A 1RP0A 2YR4A 4JQ9A 2X8HA 4TM3A 2YAUA 2CFYA 2TMDA 5EBKA 1XPQA 2V6OA 1TYTA 4H4SA 1PBBA 5L46A 5HXIA 3UCLA 1JOAA 4X9NA 3AYIA 5KOWA 2JB2A 1F6MA 5KMRA 2VVMA 1KNRA 3LADA 4OPGA 1L0VA 3V76A 4C74A 2XLUA 3L1RA 5ER0A 1NG3A 3AE4A 3D1CA 2WDRA 3K7QX 4DSGA 2GAGB 2JKCA 2XVEA 2RABA 2WEUA 3PS9A 2YM1A 4JN9A 3DH9A 4B69A 4ZN0A 3AEEA 1TDKA 3ADAB 4H50A 4GR1A 1UKVG 3UKLA 3DMEA 2BRYA 1GTHA 1N4UA 1PJ5A 2YM2A 1E1KA 3CTYA 2YVFA 3I6DA 1KFYA 5KNLA 1GT8A 2WU5A 2Y6RA 3SY4A 3NH3X 2WPFA 3SQPA 1IUVA 4M52A 2WP6A 4IVMB 1MO9A 3SM8A 2ACZA 3B6DA 1KNPA 3GSIA 2WQYA 2PHHA 3VRAA 4GCMA 3GMCA 2B7RA 1LQUA 2VRMA 5JCNA 3LXDA 3NT6A 2QA2A 1H84A 3RP7A 1NENA 1E1MA 1VQWA 4OPLA 4KX6A 1CBOA 3BI4A 4C3XA 1F8SA 1P2HA 3P4SA 3T37A 3O0HA 1H86A 2C73A 4K8DA 4GDPA 1GRAA 1ZP0A 2PYXA 1N4WA 3BNMA 1IUSA 1NG4A 3KKJA 2Z5XA 3KU9A 5M0ZA 2R0PA 4EQWA 3FIMB 5CQFA 4B68A 2VOUA 4CCQA 3DJGX 1EL7A 3NK0X 1OJTA 1GREA 1PHHA 4LU6A 1ZOYA 4K22A 1NHPA 1D4EA 3EANA 1NHRA 1GALA 1E39A 2Y6QA 3ATRA 2C3CA 3GWDA 3SZ0A 3URHA 4DGKA 2WDQA 3UKPA 3QFAA 1K4QA 4UP3A 3BI5A 3AWIA 5KRQA 2B9XA 1IUUA 2WPCA 5KMQA 1NDAA 1JU2A 4EIQA 2VZ2A 1DOEA 3AEGA 3GMBA 3ALLA 3UKHA 1D5TA 4J33A 4G6GA 1CJ4A 2C66A 4TLZA 5LV9A 2GQWA 2XCGA 3ZDNA 3I3LA 1XHCA 3UKQA 4PABA 2FJAA 3LOVA 1TRBA 4H4YA 3EAOA 1JEHA 2C3DA 4H4XA 2OLNA 1E6EA 2VQBA 4N9XA 4TM4A 1DNCA 2QCUA 4BK3A 1GRFA 1FOHA 2H89A 3ICSA 1DOCA 2V61A 3DK4A 4UDPA 3CNDA 1OJAA 4K5RA 2FJBA 2XFNA 1GRBA 2E4GA 2V5ZA 3NYFA 2XLTA 5FS6A 2ZBWA 4YTPA 1LVLA 1L9DA 4GDEA 3KD9A 1D7LA 1BF3A 2EQ9A 2NPXA 4IA6A 2BC0A 3M0OA 3NNEA 5U63A 3EF6A 3UKKA 1FEAA 4JY3A 4X9MA 3DK8A 1CC2A 2A89A 2BK3A 4XXGA 3AE9A 4Z2UA 2QAEA 1H7WA 4RG3A 4EMJA 3F8RA 2RGOA 3CPHG 1IUXA 2JAEA 3CNJA 2GVCA 5KWFA 2BA9A 4GAVA 1BZLA 3DGZA 2BS3A 3CNTA 5FS8A 3L8KA 4H2PA 1GETA 3GRSA 1H6VA 1SEZA 2BXSA 2OALA 3S61A 3COXA 3E1TA 4H4TA 4CNJA 4YSHA 2BXRA 1K0JA 2JB1A 2WOWA 1ZMDA 2RGJA 1RYIA 3D8XA 5KVHA 1O94A 4IV9A 4CRTA 3EPTA 1MOKA 3ALMA 4D03A 1GRHA 2R0CA 1CF3A 1E1NA 2XLRA 1ZKQA 5J60A 3NHOX 1GRTA 4I58A 1O5WA 3P4QA 3DA1A 3SX6A 4EMWA 1BKWA 4EIPA 4YKGA 1P2EA 4ADWA 1GNDA 2BACA 2XYOA 4XWZA 1VG9A 3CNSA 3P4RA 3FMWA 2VRLA 1H81A 1E7PA 2R4JA 2V3BA 3NYCA 1PN0A 1X31B 4E0VA 4J31A 3AYLA 3IHGA 3GWFA 3K7TA 4Y4MA 4B66A 3NG7X 1DODA 1N4VA 1Y56A 3FG2P 4YTMA 2WDVA 4CY6A 1PDHA 3REDA 3NTDA 3B3RA 4JDRA 5FS9A 4BJYA 3AD8B 3V3OA 3PO7A 3T2YA 4A7AA 2FJEA 2WETA 4J34A 4EM3A 1KSSA 2YLXA 1S2YA 4EQRA 2C65A 2XFPA 2CULA 3CPJG 4H4UA 3NIXA 1OJ9A 2BRAA 3II4A 3UTHA 2B76A 2XFUA 4CNKA 4HA6A 4NNJA 1PBDA 3HYVA 2WPEA 1PXCA 4OPIA 5GSNA 4OPUA 3DGHA 4II3A 2YWLA 4AP3A 4GRTA 4FDCB 3AEDA 2WBAA 1CC4A 4YSYA 2O9ZA 5DBJA 3Q9TA 3UTFA 1OJCA 4K2XA 5GRTA 4YT0A 2IVEA 3AYJA 2ZZBA 2TPRA 3VRDB 2CDUA 2GR3A 2OA1A 3H8LA 4BK2A 4J2WA 5JCMA 3NN6X 5KXJA 4U8KA 3UTEA 2XDOA 5BVAA 2Z5YA 3DJEA 2GR2A 3IWAA 5EB4A 1JNZA 3NYEA 4B65A 3JSKA 3SZCA 2EQ7A 3AE3A 3KPFA 4FK1A 4BURA 4NEWA 4CCRA 1K0LA 4FK1C 5M10A 2XVIA 3T31A 4NWZA 1PJ7A 1DJNA 1Y0PA 2YR5A 4HB9A 4U2TA 3RHAA 2GMHA 2YVGA 2ZZCA 2BCPA 3G5QA 4NTCA 4H2NA 2IVDA 4DNAA 1DOBA 3QVRA 4U8LA 1M6IA 3CN8A 4H7UA 4AOXA 2X3NA 4B1BA 3UTGA 3UOXA 3AE6A 2XLSA 3ICRA 3QSSA 2YG3A 1DJQA 4WX1A 1N1PA 1Q9IA 4GUVA 4BV6A 5TR3A 3CNPA 3LJPA 4U8IA 3AECA 4AP1A 4B64A 3IHMA 3AE1A 4OPTA 5IQ4A 1ZMCA 4EQSA 1H83A 2JK6A 2YG4A 5J7XA 3FPZA 2YG7A 1LTXR 2Q6UA 3AXBA 3OC4A 4H4PA 2FBWA 4MJWA 1FL2A 1GSNA 4UDRA 1H7XA 2R0GA 4A6NA 4U8NA 4AT0A 4LIIA 2YR6A 3NK1X 1ZK7A 4TLXA 5BULA 3H4KA 5EOWA 2C76A 2V3AA 2GH5A 2YLWA 2UZZA 2YLSA 1Q1RA 3GD3A 2BC1A 1F8RA 2ZZ0A 4C3YA 4IVOB 3K7MX 1VDCA 3GYXA 4NTDA 1D4CA 2GR0A 2V60A 3QJ4A 1JRXA 1ZDLA 3AD7B 2X99A 2X8GA 5CKUA 3QSMA 2YLTA 3ZYXA 1KDGA 1COYA 2VQ7A 3K30A 4EMIA 1TDOA 5JCIA 3M12A 1L9EA 2GMJA 2W0HA 1GPEA 2XFOA 3S5WA 1Y56B 1AOGA 4A99A 1TDNA 3UKFA 2A87A 1YQ4A 3LZXA 2B7SA 4U8PA 2X8CA 2H88A 3T2ZA 3NN0X 3WE0A 4OCGA 2OLOA 3DJJA 3HYWA 2B9WA 1QLBA 5HHFA 4A5LA 1KSUA 2R4EA 4H4WA 4AT2A 4OPDA 1D4DA 3AE2A 2Q7VA 4YKFA 4A79A 2I0ZA 3M13A 1D7YA 3AEBA 2R46A 4K5SA 2C70A 3BHFA 4YSZA 4Z2RA 4Z26A 1B37A 4CY8A 3VR8A 4GAPA 4YTNA 1V59A 1DXLA 2YG5A 5JCKA 1W4XA 1IUWA 1S3BA 2C4CA 2WHDA 3F8PA 5BRTA 3G5RA 3KPKA 4D04A 2GQFA 3RP8A 4U8OA 3SFDA 3ISHA 1Z6LA 2QA1A 4BJZA 1YQ3A 4ICYA 2E1MA 2VVLA 4II2A 4O5QA 4NTEA 5IQ1A 3UP4A 4TM0A 1EL5A 2DKIA 2R9ZA 1Q1WA 2XLPA 1ZX9A 2YQUA 4OVIA 3DJDA 1FCDA 3R9UA 2OAMA 5BUKA 3UKAA 5HY5A 1IUTA 1BGJA 4G9KA 1ONFA 4PAAA 4Y4NA 1YKJA 5C2TA 1B8SA 2C75A 4APNA 2B9YA 1NHSA 1RSGA 3CGEA 3IC9A 1PJ6A 2C64A 2JBVA 2JB3A 4H2RA 3VR9A 2ARDA 4DSHA 2XVJA 1TDFA 2YG6A 4H2QA 1CJCA 3NGCX 4IA5A 4A65A 3NLCA 1NHQA 1NAAA 3AD9B 3FBSA 1EL8A 4P9SA 4C77A 3UOZA 1HYUA 2VVLG 2BK4A 2EQ8A 2WP9A 3NKSA 4G74A 3AE7A 4U8MA 1REOA 1JNRA 2BCGG 1GTEA 4WCTA 2WU2A 3UOYA 3V3NA 4CBQA 4AOSA 4Z2TA 1LJ1A 3BNUA 2EQ6A 2XVHA 2BS2A 4J36A 3AE5A 4Z24A 1VG0A 3GDNA 2GEWA 3SYIA 3AEFA 3VQRA 4ECHA 1PBFA 1VRQB 1TDEA 4OPCA 1F8WA 3P9UA 4NZHA 3SGLA 4H4ZA 1PBCA 1XANA 4G6HA 3SZFA 1BWCA 5U25A 2GB0A 1GXFA 1CL0A 2AAQA 3C96A 2CVJA 3CPIG 3G5SA 1JRYA 1QO8A 2WESA 1L9CA 2GR1A 3CMMA 1M64A 4A6NB 3Q6JA 1F3PA 3P4PA 4JY2A 1TYPA 4TM1A 3CIRA 2APGA 4YSXA 1FEBA 1B5QA 3UP5A 2DKHA 2C7GA 3NRNA 5FMHA 4I59A 1LPFA 5U1OA 4EQXA 1LQTA 3T0KA 1K0IA 2C72A 3KVEA 4U2SA 3GD4A 2YVJA 3ITJA 4USRA 4A9WA 4USQA 1PS9A 3KLJA 2GRTA 3ATQA 3C4AA 1E1LA 1ZY8A 4NEVA 1GEUA 3H8IA 1IJHA 4XWRA 3DK9A 3GDPA 2AR8A 4UDQA 1EL9A 4KPRA 3LB8A 3BHKA 1NPXA 2WS3A 1CJ2A 2BK5A 3GYJA 1YQZA 3ICTA 3P1WA 1GOSA 4H4RA 1S3EA 4Y4LA 3GYIA 4Z44A 4J57A 1GRGA 4REKA 1CHUA 4YWOA 4B63A 2WP5A 4GF7A 3F8DA 1MXTA 2GF3A 3HYXA 5FS7A 4JNQA 4RSLA 4LA1A 2Q0KA 4Z43A 2BABA 3NK2X 4B67A 1LV0A 1JRZA 3RNMA 3SZWA 2XFQA 3PVCA 4ZCCA 4FX9A 3QSEA 4YXDA 4H4VA 4H4QA 3AB1A 3KA7A 3T2KA 5KMPA 1FECA 5KOXA 3BI2A 3C4NA 4Z25A 5HYMA 3CGBA 5JCLA 3CGCA 3LZWA 2E5VA 1BGNA 1ELIA 3IF9A 3QVPA 3GRTA 4JNAA 2WOVA 3RP6A 4EM4A 1OJDA 2BS4A 2X50A 2XVFA 4C5OA 1PXBA 3SFEA
chains in the Genus database with same CATH topology
1B4VA 4J56A 1CC6A 2AQJA 5IPYA 1YY5A 2FJDA 2NVKX 3ALJA 3AEAA 4ZCDA 2YLZA 4U2LA 4BK1A 3CGDA 1ZOVA 4U8JA 3HZLA 4G73A 2C67A 1CJ3A 2GV8A 5KMSA 3T14A 1GV4A 1GESA 3OZ2A 2YLRA 2A8XA 2WOIA 2HQMA 1NEKA 3AE8A 1PXAA 3UOVA 1XDIA 4X4JA 2R45A 2RGHA 5C3JA 1EBDA 2GAHB 4K7ZA 4O5UA 1S2QA 2F5ZA 3QFBA 5KVIA 3NTAA 2J3NA 3VRBA 4RG4A 2Q0LA 2BYBA 1GERA 1PBEA 3ABVA 2IIDA 1KF6A 1QJDA 5EB5A 3SXIA 1O95A 1H82A 1RP0A 2YR4A 4JQ9A 2X8HA 4TM3A 2YAUA 2CFYA 2TMDA 5EBKA 1XPQA 2V6OA 1TYTA 4H4SA 1PBBA 5L46A 5HXIA 3UCLA 1JOAA 4X9NA 3AYIA 5KOWA 2JB2A 1F6MA 5KMRA 2VVMA 1KNRA 3LADA 4OPGA 1L0VA 3V76A 4C74A 2XLUA 3L1RA 5ER0A 1NG3A 3AE4A 3D1CA 2WDRA 3K7QX 4DSGA 2GAGB 2JKCA 2XVEA 2RABA 2WEUA 3PS9A 2YM1A 4JN9A 3DH9A 4B69A 4ZN0A 3AEEA 1TDKA 3ADAB 4H50A 4GR1A 1UKVG 3UKLA 3DMEA 2BRYA 1GTHA 1N4UA 1PJ5A 2YM2A 1E1KA 3CTYA 2YVFA 3I6DA 1KFYA 5KNLA 1GT8A 2WU5A 2Y6RA 3SY4A 3NH3X 2WPFA 3SQPA 1IUVA 4M52A 2WP6A 4IVMB 1MO9A 3SM8A 2ACZA 3B6DA 1KNPA 3GSIA 2WQYA 2PHHA 3VRAA 4GCMA 3GMCA 2B7RA 1LQUA 2VRMA 5JCNA 3LXDA 3NT6A 2QA2A 1H84A 3RP7A 1NENA 1E1MA 1VQWA 4OPLA 4KX6A 1CBOA 3BI4A 4C3XA 1F8SA 1P2HA 3P4SA 3T37A 3O0HA 1H86A 2C73A 4K8DA 4GDPA 1GRAA 1ZP0A 2PYXA 1N4WA 3BNMA 1IUSA 1NG4A 3KKJA 2Z5XA 3KU9A 5M0ZA 2R0PA 4EQWA 3FIMB 5CQFA 4B68A 2VOUA 4CCQA 3DJGX 1EL7A 3NK0X 1OJTA 1GREA 1PHHA 4LU6A 1ZOYA 4K22A 1NHPA 1D4EA 3EANA 1NHRA 1GALA 1E39A 2Y6QA 3ATRA 2C3CA 3GWDA 3SZ0A 3URHA 4DGKA 2WDQA 3UKPA 3QFAA 1K4QA 4UP3A 3BI5A 3AWIA 5KRQA 2B9XA 1IUUA 2WPCA 5KMQA 1NDAA 1JU2A 4EIQA 2VZ2A 1DOEA 3AEGA 3GMBA 3ALLA 3UKHA 1D5TA 4J33A 4G6GA 1CJ4A 2C66A 4TLZA 5LV9A 2GQWA 2XCGA 3ZDNA 3I3LA 1XHCA 3UKQA 4PABA 2FJAA 3LOVA 1TRBA 4H4YA 3EAOA 1JEHA 2C3DA 4H4XA 2OLNA 1E6EA 2VQBA 4N9XA 4TM4A 1DNCA 2QCUA 4BK3A 1GRFA 1FOHA 2H89A 3ICSA 1DOCA 2V61A 3DK4A 4UDPA 3CNDA 1OJAA 4K5RA 2FJBA 2XFNA 1GRBA 2E4GA 2V5ZA 3NYFA 2XLTA 5FS6A 2ZBWA 4YTPA 1LVLA 1L9DA 4GDEA 3KD9A 1D7LA 1BF3A 2EQ9A 2NPXA 4IA6A 2BC0A 3M0OA 3NNEA 5U63A 3EF6A 3UKKA 1FEAA 4JY3A 4X9MA 3DK8A 1CC2A 2A89A 2BK3A 4XXGA 3AE9A 4Z2UA 2QAEA 1H7WA 4RG3A 4EMJA 3F8RA 2RGOA 3CPHG 1IUXA 2JAEA 3CNJA 2GVCA 5KWFA 2BA9A 4GAVA 1BZLA 3DGZA 2BS3A 3CNTA 5FS8A 3L8KA 4H2PA 1GETA 3GRSA 1H6VA 1SEZA 2BXSA 2OALA 3S61A 3COXA 3E1TA 4H4TA 4CNJA 4YSHA 2BXRA 1K0JA 2JB1A 2WOWA 1ZMDA 2RGJA 1RYIA 3D8XA 5KVHA 1O94A 4IV9A 4CRTA 3EPTA 1MOKA 3ALMA 4D03A 1GRHA 2R0CA 1CF3A 1E1NA 2XLRA 1ZKQA 5J60A 3NHOX 1GRTA 4I58A 1O5WA 3P4QA 3DA1A 3SX6A 4EMWA 1BKWA 4EIPA 4YKGA 1P2EA 4ADWA 1GNDA 2BACA 2XYOA 4XWZA 1VG9A 3CNSA 3P4RA 3FMWA 2VRLA 1H81A 1E7PA 2R4JA 2V3BA 3NYCA 1PN0A 1X31B 4E0VA 4J31A 3AYLA 3IHGA 3GWFA 3K7TA 4Y4MA 4B66A 3NG7X 1DODA 1N4VA 1Y56A 3FG2P 4YTMA 2WDVA 4CY6A 1PDHA 3REDA 3NTDA 3B3RA 4JDRA 5FS9A 4BJYA 3AD8B 3V3OA 3PO7A 3T2YA 4A7AA 2FJEA 2WETA 4J34A 4EM3A 1KSSA 2YLXA 1S2YA 4EQRA 2C65A 2XFPA 2CULA 3CPJG 4H4UA 3NIXA 1OJ9A 2BRAA 3II4A 3UTHA 2B76A 2XFUA 4CNKA 4HA6A 4NNJA 1PBDA 3HYVA 2WPEA 1PXCA 4OPIA 5GSNA 4OPUA 3DGHA 4II3A 2YWLA 4AP3A 4GRTA 4FDCB 3AEDA 2WBAA 1CC4A 4YSYA 2O9ZA 5DBJA 3Q9TA 3UTFA 1OJCA 4K2XA 5GRTA 4YT0A 2IVEA 3AYJA 2ZZBA 2TPRA 3VRDB 2CDUA 2GR3A 2OA1A 3H8LA 4BK2A 4J2WA 5JCMA 3NN6X 5KXJA 4U8KA 3UTEA 2XDOA 5BVAA 2Z5YA 3DJEA 2GR2A 3IWAA 5EB4A 1JNZA 3NYEA 4B65A 3JSKA 3SZCA 2EQ7A 3AE3A 3KPFA 4FK1A 4BURA 4NEWA 4CCRA 1K0LA 4FK1C 5M10A 2XVIA 3T31A 4NWZA 1PJ7A 1DJNA 1Y0PA 2YR5A 4HB9A 4U2TA 3RHAA 2GMHA 2YVGA 2ZZCA 2BCPA 3G5QA 4NTCA 4H2NA 2IVDA 4DNAA 1DOBA 3QVRA 4U8LA 1M6IA 3CN8A 4H7UA 4AOXA 2X3NA 4B1BA 3UTGA 3UOXA 3AE6A 2XLSA 3ICRA 3QSSA 2YG3A 1DJQA 4WX1A 1N1PA 1Q9IA 4GUVA 4BV6A 5TR3A 3CNPA 3LJPA 4U8IA 3AECA 4AP1A 4B64A 3IHMA 3AE1A 4OPTA 5IQ4A 1ZMCA 4EQSA 1H83A 2JK6A 2YG4A 5J7XA 3FPZA 2YG7A 1LTXR 2Q6UA 3AXBA 3OC4A 4H4PA 2FBWA 4MJWA 1FL2A 1GSNA 4UDRA 1H7XA 2R0GA 4A6NA 4U8NA 4AT0A 4LIIA 2YR6A 3NK1X 1ZK7A 4TLXA 5BULA 3H4KA 5EOWA 2C76A 2V3AA 2GH5A 2YLWA 2UZZA 2YLSA 1Q1RA 3GD3A 2BC1A 1F8RA 2ZZ0A 4C3YA 4IVOB 3K7MX 1VDCA 3GYXA 4NTDA 1D4CA 2GR0A 2V60A 3QJ4A 1JRXA 1ZDLA 3AD7B 2X99A 2X8GA 5CKUA 3QSMA 2YLTA 3ZYXA 1KDGA 1COYA 2VQ7A 3K30A 4EMIA 1TDOA 5JCIA 3M12A 1L9EA 2GMJA 2W0HA 1GPEA 2XFOA 3S5WA 1Y56B 1AOGA 4A99A 1TDNA 3UKFA 2A87A 1YQ4A 3LZXA 2B7SA 4U8PA 2X8CA 2H88A 3T2ZA 3NN0X 3WE0A 4OCGA 2OLOA 3DJJA 3HYWA 2B9WA 1QLBA 5HHFA 4A5LA 1KSUA 2R4EA 4H4WA 4AT2A 4OPDA 1D4DA 3AE2A 2Q7VA 4YKFA 4A79A 2I0ZA 3M13A 1D7YA 3AEBA 2R46A 4K5SA 2C70A 3BHFA 4YSZA 4Z2RA 4Z26A 1B37A 4CY8A 3VR8A 4GAPA 4YTNA 1V59A 1DXLA 2YG5A 5JCKA 1W4XA 1IUWA 1S3BA 2C4CA 2WHDA 3F8PA 5BRTA 3G5RA 3KPKA 4D04A 2GQFA 3RP8A 4U8OA 3SFDA 3ISHA 1Z6LA 2QA1A 4BJZA 1YQ3A 4ICYA 2E1MA 2VVLA 4II2A 4O5QA 4NTEA 5IQ1A 3UP4A 4TM0A 1EL5A 2DKIA 2R9ZA 1Q1WA 2XLPA 1ZX9A 2YQUA 4OVIA 3DJDA 1FCDA 3R9UA 2OAMA 5BUKA 3UKAA 5HY5A 1IUTA 1BGJA 4G9KA 1ONFA 4PAAA 4Y4NA 1YKJA 5C2TA 1B8SA 2C75A 4APNA 2B9YA 1NHSA 1RSGA 3CGEA 3IC9A 1PJ6A 2C64A 2JBVA 2JB3A 4H2RA 3VR9A 2ARDA 4DSHA 2XVJA 1TDFA 2YG6A 4H2QA 1CJCA 3NGCX 4IA5A 4A65A 3NLCA 1NHQA 1NAAA 3AD9B 3FBSA 1EL8A 4P9SA 4C77A 3UOZA 1HYUA 2VVLG 2BK4A 2EQ8A 2WP9A 3NKSA 4G74A 3AE7A 4U8MA 1REOA 1JNRA 2BCGG 1GTEA 4WCTA 2WU2A 3UOYA 3V3NA 4CBQA 4AOSA 4Z2TA 1LJ1A 3BNUA 2EQ6A 2XVHA 2BS2A 4J36A 3AE5A 4Z24A 1VG0A 3GDNA 2GEWA 3SYIA 3AEFA 3VQRA 4ECHA 1PBFA 1VRQB 1TDEA 4OPCA 1F8WA 3P9UA 4NZHA 3SGLA 4H4ZA 1PBCA 1XANA 4G6HA 3SZFA 1BWCA 5U25A 2GB0A 1GXFA 1CL0A 2AAQA 3C96A 2CVJA 3CPIG 3G5SA 1JRYA 1QO8A 2WESA 1L9CA 2GR1A 3CMMA 1M64A 4A6NB 3Q6JA 1F3PA 3P4PA 4JY2A 1TYPA 4TM1A 3CIRA 2APGA 4YSXA 1FEBA 1B5QA 3UP5A 2DKHA 2C7GA 3NRNA 5FMHA 4I59A 1LPFA 5U1OA 4EQXA 1LQTA 3T0KA 1K0IA 2C72A 3KVEA 4U2SA 3GD4A 2YVJA 3ITJA 4USRA 4A9WA 4USQA 1PS9A 3KLJA 2GRTA 3ATQA 3C4AA 1E1LA 1ZY8A 4NEVA 1GEUA 3H8IA 1IJHA 4XWRA 3DK9A 3GDPA 2AR8A 4UDQA 1EL9A 4KPRA 3LB8A 3BHKA 1NPXA 2WS3A 1CJ2A 2BK5A 3GYJA 1YQZA 3ICTA 3P1WA 1GOSA 4H4RA 1S3EA 4Y4LA 3GYIA 4Z44A 4J57A 1GRGA 4REKA 1CHUA 4YWOA 4B63A 2WP5A 4GF7A 3F8DA 1MXTA 2GF3A 3HYXA 5FS7A 4JNQA 4RSLA 4LA1A 2Q0KA 4Z43A 2BABA 3NK2X 4B67A 1LV0A 1JRZA 3RNMA 3SZWA 2XFQA 3PVCA 4ZCCA 4FX9A 3QSEA 4YXDA 4H4VA 4H4QA 3AB1A 3KA7A 3T2KA 5KMPA 1FECA 5KOXA 3BI2A 3C4NA 4Z25A 5HYMA 3CGBA 5JCLA 3CGCA 3LZWA 2E5VA 1BGNA 1ELIA 3IF9A 3QVPA 3GRTA 4JNAA 2WOVA 3RP6A 4EM4A 1OJDA 2BS4A 2X50A 2XVFA 4C5OA 1PXBA 3SFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4V A;  4J56 A;  1CC6 A;  2AQJ A;  5IPY A;  1YY5 A;  2FJD A;  2NVK X;  3ALJ A;  3AEA A;  4ZCD A;  2YLZ A;  4U2L A;  4BK1 A;  3CGD A;  1ZOV A;  4U8J A;  3HZL A;  2C67 A;  1CJ3 A;  2GV8 A;  1GV4 A;  1GES A;  3OZ2 A;  2YLR A;  2A8X A;  2WOI A;  2HQM A;  1NEK A;  3AE8 A;  1PXA A;  3UOV A;  1XDI A;  4X4J A;  2R45 A;  2RGH A;  5C3J A;  1EBD A;  2GAH B;  4K7Z A;  4O5U A;  1S2Q A;  2F5Z A;  3QFB A;  5KVI A;  3NTA A;  2J3N A;  3VRB A;  4RG4 A;  2Q0L A;  2BYB A;  1GER A;  1PBE A;  3ABV A;  2IID A;  1KF6 A;  1QJD A;  5EB5 A;  1O95 A;  1H82 A;  1RP0 A;  2YR4 A;  4JQ9 A;  2X8H A;  4TM3 A;  2YAU A;  2CFY A;  2TMD A;  5EBK A;  1XPQ A;  2V6O A;  1TYT A;  4H4S A;  1PBB A;  5L46 A;  5HXI A;  3UCL A;  1JOA A;  4X9N A;  3AYI A;  5KOW A;  2JB2 A;  1F6M A;  2VVM A;  1KNR A;  3LAD A;  4OPG A;  1L0V A;  3V76 A;  4C74 A;  2XLU A;  3L1R A;  5ER0 A;  1NG3 A;  3AE4 A;  3D1C A;  2WDR A;  3K7Q X;  4DSG A;  2GAG B;  2JKC A;  2XVE A;  2RAB A;  2WEU A;  3PS9 A;  2YM1 A;  4JN9 A;  3DH9 A;  4B69 A;  4ZN0 A;  3AEE A;  1TDK A;  3ADA B;  4H50 A;  4GR1 A;  1UKV G;  3UKL A;  3DME A;  1GTH A;  1N4U A;  1PJ5 A;  2YM2 A;  1E1K A;  3CTY A;  2YVF A;  3I6D A;  1KFY A;  1GT8 A;  2WU5 A;  2Y6R A;  3NH3 X;  2WPF A;  3SQP A;  1IUV A;  4M52 A;  2WP6 A;  4IVM B;  1MO9 A;  3SM8 A;  2ACZ A;  3B6D A;  1KNP A;  3GSI A;  2WQY A;  2PHH A;  3VRA A;  4GCM A;  3GMC A;  2B7R A;  1LQU A;  2VRM A;  5JCN A;  3LXD A;  3NT6 A;  2QA2 A;  1H84 A;  3RP7 A;  1NEN A;  1E1M A;  1VQW A;  4OPL A;  4KX6 A;  1CBO A;  3BI4 A;  4C3X A;  1F8S A;  1P2H A;  3P4S A;  3T37 A;  3O0H A;  1H86 A;  2C73 A;  4K8D A;  4GDP A;  1GRA A;  1ZP0 A;  2PYX A;  1N4W A;  3BNM A;  1IUS A;  1NG4 A;  3KKJ A;  2Z5X A;  3KU9 A;  5M0Z A;  2R0P A;  4EQW A;  3FIM B;  5CQF A;  4B68 A;  2VOU A;  4CCQ A;  3DJG X;  1EL7 A;  3NK0 X;  1OJT A;  1GRE A;  1PHH A;  4LU6 A;  1ZOY A;  4K22 A;  1NHP A;  1D4E A;  3EAN A;  1NHR A;  1GAL A;  1E39 A;  2Y6Q A;  3ATR A;  2C3C A;  3GWD A;  3URH A;  4DGK A;  2WDQ A;  3UKP A;  3QFA A;  1K4Q A;  4UP3 A;  3BI5 A;  3AWI A;  5KRQ A;  2B9X A;  1IUU A;  2WPC A;  1NDA A;  1JU2 A;  4EIQ A;  2VZ2 A;  1DOE A;  3AEG A;  3GMB A;  3ALL A;  3UKH A;  1D5T A;  4J33 A;  1CJ4 A;  2C66 A;  4TLZ A;  5LV9 A;  2GQW A;  2XCG A;  3ZDN A;  3I3L A;  1XHC A;  3UKQ A;  4PAB A;  2FJA A;  3LOV A;  1TRB A;  4H4Y A;  3EAO A;  1JEH A;  2C3D A;  4H4X A;  2OLN A;  1E6E A;  2VQB A;  4N9X A;  4TM4 A;  1DNC A;  2QCU A;  4BK3 A;  1GRF A;  1FOH A;  2H89 A;  3ICS A;  1DOC A;  2V61 A;  3DK4 A;  4UDP A;  3CND A;  1OJA A;  4K5R A;  2FJB A;  2XFN A;  1GRB A;  2E4G A;  2V5Z A;  3NYF A;  2XLT A;  5FS6 A;  2ZBW A;  4YTP A;  1LVL A;  1L9D A;  4GDE A;  3KD9 A;  1D7L A;  1BF3 A;  2EQ9 A;  2NPX A;  4IA6 A;  2BC0 A;  3M0O A;  3NNE A;  5U63 A;  3EF6 A;  3UKK A;  1FEA A;  4JY3 A;  4X9M A;  3DK8 A;  1CC2 A;  2A89 A;  2BK3 A;  4XXG A;  3AE9 A;  4Z2U A;  2QAE A;  1H7W A;  4RG3 A;  4EMJ A;  3F8R A;  2RGO A;  3CPH G;  1IUX A;  2JAE A;  3CNJ A;  2GVC A;  5KWF A;  2BA9 A;  1BZL A;  3DGZ A;  2BS3 A;  3CNT A;  5FS8 A;  3L8K A;  4H2P A;  1GET A;  3GRS A;  1H6V A;  1SEZ A;  2BXS A;  2OAL A;  3S61 A;  3COX A;  3E1T A;  4H4T A;  4CNJ A;  4YSH A;  2BXR A;  1K0J A;  2JB1 A;  2WOW A;  1ZMD A;  2RGJ A;  1RYI A;  3D8X A;  5KVH A;  1O94 A;  4IV9 A;  4CRT A;  3EPT A;  1MOK A;  3ALM A;  4D03 A;  1GRH A;  2R0C A;  1CF3 A;  1E1N A;  2XLR A;  1ZKQ A;  5J60 A;  3NHO X;  1GRT A;  4I58 A;  1O5W A;  3P4Q A;  3DA1 A;  4EMW A;  1BKW A;  4EIP A;  4YKG A;  1P2E A;  4ADW A;  1GND A;  2BAC A;  2XYO A;  4XWZ A;  1VG9 A;  3CNS A;  3P4R A;  3FMW A;  2VRL A;  1H81 A;  1E7P A;  2R4J A;  2V3B A;  3NYC A;  1PN0 A;  1X31 B;  4E0V A;  4J31 A;  3AYL A;  3IHG A;  3GWF A;  3K7T A;  4Y4M A;  4B66 A;  3NG7 X;  1DOD A;  1N4V A;  1Y56 A;  3FG2 P;  4YTM A;  2WDV A;  4CY6 A;  1PDH A;  3RED A;  3NTD A;  3B3R A;  4JDR A;  5FS9 A;  4BJY A;  3AD8 B;  3V3O A;  3PO7 A;  4A7A A;  2FJE A;  2WET A;  4J34 A;  4EM3 A;  1KSS A;  2YLX A;  1S2Y A;  4EQR A;  2C65 A;  2XFP A;  2CUL A;  3CPJ G;  4H4U A;  3NIX A;  1OJ9 A;  3II4 A;  3UTH A;  2B76 A;  2XFU A;  4CNK A;  4HA6 A;  1PBD A;  2WPE A;  1PXC A;  4OPI A;  5GSN A;  4OPU A;  3DGH A;  2YWL A;  4AP3 A;  4GRT A;  4FDC B;  3AED A;  2WBA A;  1CC4 A;  4YSY A;  2O9Z A;  5DBJ A;  3Q9T A;  3UTF A;  1OJC A;  4K2X A;  5GRT A;  4YT0 A;  2IVE A;  3AYJ A;  2ZZB A;  2TPR A;  3VRD B;  2CDU A;  2GR3 A;  2OA1 A;  3H8L A;  4BK2 A;  4J2W A;  5JCM A;  3NN6 X;  5KXJ A;  4U8K A;  3UTE A;  2XDO A;  5BVA A;  2Z5Y A;  3DJE A;  2GR2 A;  3IWA A;  5EB4 A;  1JNZ A;  3NYE A;  4B65 A;  3JSK A;  2EQ7 A;  3AE3 A;  3KPF A;  4FK1 A;  4BUR A;  4NEW A;  4CCR A;  1K0L A;  4FK1 C;  5M10 A;  2XVI A;  1PJ7 A;  1DJN A;  1Y0P A;  2YR5 A;  4HB9 A;  4U2T A;  3RHA A;  2GMH A;  2YVG A;  2ZZC A;  2BCP A;  3G5Q A;  4NTC A;  4H2N A;  2IVD A;  4DNA A;  1DOB A;  3QVR A;  4U8L A;  1M6I A;  3CN8 A;  4H7U A;  4AOX A;  2X3N A;  4B1B A;  3UTG A;  3UOX A;  3AE6 A;  2XLS A;  3ICR A;  3QSS A;  2YG3 A;  1DJQ A;  4WX1 A;  1N1P A;  1Q9I A;  4GUV A;  4BV6 A;  5TR3 A;  3CNP A;  3LJP A;  4U8I A;  3AEC A;  4AP1 A;  4B64 A;  3IHM A;  3AE1 A;  4OPT A;  5IQ4 A;  1ZMC A;  4EQS A;  1H83 A;  2JK6 A;  2YG4 A;  5J7X A;  3FPZ A;  2YG7 A;  1LTX R;  2Q6U A;  3AXB A;  3OC4 A;  4H4P A;  2FBW A;  4MJW A;  1FL2 A;  1GSN A;  4UDR A;  1H7X A;  2R0G A;  4A6N A;  4U8N A;  4AT0 A;  4LII A;  2YR6 A;  3NK1 X;  1ZK7 A;  4TLX A;  5BUL A;  3H4K A;  5EOW A;  2C76 A;  2V3A A;  2GH5 A;  2YLW A;  2UZZ A;  2YLS A;  1Q1R A;  3GD3 A;  2BC1 A;  1F8R A;  2ZZ0 A;  4C3Y A;  4IVO B;  3K7M X;  1VDC A;  4NTD A;  1D4C A;  2GR0 A;  2V60 A;  3QJ4 A;  1JRX A;  1ZDL A;  3AD7 B;  2X99 A;  2X8G A;  5CKU A;  3QSM A;  2YLT A;  3ZYX A;  1KDG A;  1COY A;  2VQ7 A;  3K30 A;  4EMI A;  1TDO A;  5JCI A;  3M12 A;  1L9E A;  2GMJ A;  2W0H A;  1GPE A;  2XFO A;  3S5W A;  1Y56 B;  1AOG A;  4A99 A;  1TDN A;  3UKF A;  2A87 A;  1YQ4 A;  3LZX A;  2B7S A;  4U8P A;  2X8C A;  2H88 A;  3NN0 X;  3WE0 A;  4OCG A;  2OLO A;  3DJJ A;  2B9W A;  1QLB A;  5HHF A;  4A5L A;  1KSU A;  2R4E A;  4H4W A;  4AT2 A;  4OPD A;  1D4D A;  3AE2 A;  2Q7V A;  4YKF A;  4A79 A;  2I0Z A;  3M13 A;  1D7Y A;  3AEB A;  2R46 A;  4K5S A;  2C70 A;  3BHF A;  4YSZ A;  4Z2R A;  4Z26 A;  1B37 A;  4CY8 A;  3VR8 A;  4YTN A;  1V59 A;  1DXL A;  2YG5 A;  5JCK A;  1W4X A;  1IUW A;  1S3B A;  2WHD A;  3F8P A;  5BRT A;  3G5R A;  4D04 A;  2GQF A;  3RP8 A;  4U8O A;  3SFD A;  3ISH A;  1Z6L A;  2QA1 A;  4BJZ A;  1YQ3 A;  4ICY A;  2E1M A;  2VVL A;  4O5Q A;  5IQ1 A;  4NTE A;  3UP4 A;  4TM0 A;  1EL5 A;  2DKI A;  2R9Z A;  1Q1W A;  2XLP A;  1ZX9 A;  2YQU A;  4OVI A;  3DJD A;  1FCD A;  3R9U A;  2OAM A;  5BUK A;  3UKA A;  5HY5 A;  1IUT A;  1BGJ A;  4PAA A;  1ONF A;  4Y4N A;  5C2T A;  1YKJ A;  1B8S A;  2C75 A;  4APN A;  2B9Y A;  1NHS A;  1RSG A;  3CGE A;  3IC9 A;  1PJ6 A;  2C64 A;  2JBV A;  2JB3 A;  4H2R A;  3VR9 A;  2ARD A;  4DSH A;  2XVJ A;  1TDF A;  2YG6 A;  4H2Q A;  1CJC A;  3NGC X;  4IA5 A;  4A65 A;  3NLC A;  1NHQ A;  1NAA A;  3AD9 B;  3FBS A;  1EL8 A;  4P9S A;  4C77 A;  3UOZ A;  1HYU A;  2VVL G;  2BK4 A;  2EQ8 A;  2WP9 A;  3NKS A;  3AE7 A;  4U8M A;  1REO A;  1JNR A;  2BCG G;  1GTE A;  4WCT A;  2WU2 A;  3UOY A;  3V3N A;  4CBQ A;  4AOS A;  4Z2T A;  1LJ1 A;  3BNU A;  2EQ6 A;  2XVH A;  2BS2 A;  4J36 A;  3AE5 A;  4Z24 A;  1VG0 A;  3GDN A;  2GEW A;  3VQR A;  3AEF A;  4ECH A;  1PBF A;  1VRQ B;  1TDE A;  4OPC A;  1F8W A;  3P9U A;  4NZH A;  3SGL A;  4H4Z A;  1PBC A;  1XAN A;  1BWC A;  5U25 A;  2GB0 A;  1GXF A;  1CL0 A;  2AAQ A;  3C96 A;  2CVJ A;  3CPI G;  3G5S A;  1JRY A;  1QO8 A;  2WES A;  1L9C A;  2GR1 A;  1M64 A;  4A6N B;  3Q6J A;  1F3P A;  3P4P A;  4JY2 A;  1TYP A;  4TM1 A;  3CIR A;  2APG A;  4YSX A;  1FEB A;  1B5Q A;  3UP5 A;  2DKH A;  2C7G A;  3NRN A;  5FMH A;  4I59 A;  1LPF A;  5U1O A;  4EQX A;  1LQT A;  1K0I A;  2C72 A;  3KVE A;  4U2S A;  3GD4 A;  2YVJ A;  3ITJ A;  4USR A;  4A9W A;  4USQ A;  1PS9 A;  3KLJ A;  2GRT A;  3ATQ A;  3C4A A;  1E1L A;  1ZY8 A;  4NEV A;  1GEU A;  3H8I A;  1IJH A;  4XWR A;  3DK9 A;  3GDP A;  2AR8 A;  4UDQ A;  1EL9 A;  4KPR A;  3LB8 A;  3BHK A;  1NPX A;  2WS3 A;  1CJ2 A;  2BK5 A;  3GYJ A;  1YQZ A;  3ICT A;  3P1W A;  1GOS A;  4H4R A;  1S3E A;  4Y4L A;  3GYI A;  4Z44 A;  4J57 A;  1GRG A;  4REK A;  1CHU A;  4YWO A;  4B63 A;  2WP5 A;  4GF7 A;  3F8D A;  1MXT A;  2GF3 A;  5FS7 A;  4JNQ A;  4RSL A;  4LA1 A;  2Q0K A;  4Z43 A;  2BAB A;  3NK2 X;  4B67 A;  1LV0 A;  1JRZ A;  3RNM A;  2XFQ A;  3PVC A;  4ZCC A;  4FX9 A;  3QSE A;  4YXD A;  4H4V A;  4H4Q A;  3AB1 A;  3KA7 A;  1FEC A;  5KOX A;  3BI2 A;  3C4N A;  4Z25 A;  5HYM A;  3CGB A;  5JCL A;  3CGC A;  3LZW A;  2E5V A;  1BGN A;  1ELI A;  3IF9 A;  3QVP A;  3GRT A;  4JNA A;  2WOV A;  3RP6 A;  4EM4 A;  1OJD A;  2BS4 A;  2X50 A;  2XVF A;  4C5O A;  1PXB A;  3SFE A; 
#chains in the Genus database with same CATH topology
 1B4V A;  4J56 A;  1CC6 A;  2AQJ A;  5IPY A;  1YY5 A;  2FJD A;  2NVK X;  3ALJ A;  3AEA A;  4ZCD A;  2YLZ A;  4U2L A;  4BK1 A;  3CGD A;  1ZOV A;  4U8J A;  3HZL A;  4G73 A;  2C67 A;  1CJ3 A;  2GV8 A;  5KMS A;  3T14 A;  1GV4 A;  1GES A;  3OZ2 A;  2YLR A;  2A8X A;  2WOI A;  2HQM A;  1NEK A;  3AE8 A;  1PXA A;  3UOV A;  1XDI A;  4X4J A;  2R45 A;  2RGH A;  5C3J A;  1EBD A;  2GAH B;  4K7Z A;  4O5U A;  1S2Q A;  2F5Z A;  3QFB A;  5KVI A;  3NTA A;  2J3N A;  3VRB A;  4RG4 A;  2Q0L A;  2BYB A;  1GER A;  1PBE A;  3ABV A;  2IID A;  1KF6 A;  1QJD A;  5EB5 A;  3SXI A;  1O95 A;  1H82 A;  1RP0 A;  2YR4 A;  4JQ9 A;  2X8H A;  4TM3 A;  2YAU A;  2CFY A;  2TMD A;  5EBK A;  1XPQ A;  2V6O A;  1TYT A;  4H4S A;  1PBB A;  5L46 A;  5HXI A;  3UCL A;  1JOA A;  4X9N A;  3AYI A;  5KOW A;  2JB2 A;  1F6M A;  5KMR A;  2VVM A;  1KNR A;  3LAD A;  4OPG A;  1L0V A;  3V76 A;  4C74 A;  2XLU A;  3L1R A;  5ER0 A;  1NG3 A;  3AE4 A;  3D1C A;  2WDR A;  3K7Q X;  4DSG A;  2GAG B;  2JKC A;  2XVE A;  2RAB A;  2WEU A;  3PS9 A;  2YM1 A;  4JN9 A;  3DH9 A;  4B69 A;  4ZN0 A;  3AEE A;  1TDK A;  3ADA B;  4H50 A;  4GR1 A;  1UKV G;  3UKL A;  3DME A;  2BRY A;  1GTH A;  1N4U A;  1PJ5 A;  2YM2 A;  1E1K A;  3CTY A;  2YVF A;  3I6D A;  1KFY A;  5KNL A;  1GT8 A;  2WU5 A;  2Y6R A;  3SY4 A;  3NH3 X;  2WPF A;  3SQP A;  1IUV A;  4M52 A;  2WP6 A;  4IVM B;  1MO9 A;  3SM8 A;  2ACZ A;  3B6D A;  1KNP A;  3GSI A;  2WQY A;  2PHH A;  3VRA A;  4GCM A;  3GMC A;  2B7R A;  1LQU A;  2VRM A;  5JCN A;  3LXD A;  3NT6 A;  2QA2 A;  1H84 A;  3RP7 A;  1NEN A;  1E1M A;  1VQW A;  4OPL A;  4KX6 A;  1CBO A;  3BI4 A;  4C3X A;  1F8S A;  1P2H A;  3P4S A;  3T37 A;  3O0H A;  1H86 A;  2C73 A;  4K8D A;  4GDP A;  1GRA A;  1ZP0 A;  2PYX A;  1N4W A;  3BNM A;  1IUS A;  1NG4 A;  3KKJ A;  2Z5X A;  3KU9 A;  5M0Z A;  2R0P A;  4EQW A;  3FIM B;  5CQF A;  4B68 A;  2VOU A;  4CCQ A;  3DJG X;  1EL7 A;  3NK0 X;  1OJT A;  1GRE A;  1PHH A;  4LU6 A;  1ZOY A;  4K22 A;  1NHP A;  1D4E A;  3EAN A;  1NHR A;  1GAL A;  1E39 A;  2Y6Q A;  3ATR A;  2C3C A;  3GWD A;  3SZ0 A;  3URH A;  4DGK A;  2WDQ A;  3UKP A;  3QFA A;  1K4Q A;  4UP3 A;  3BI5 A;  3AWI A;  5KRQ A;  2B9X A;  1IUU A;  2WPC A;  5KMQ A;  1NDA A;  1JU2 A;  4EIQ A;  2VZ2 A;  1DOE A;  3AEG A;  3GMB A;  3ALL A;  3UKH A;  1D5T A;  4J33 A;  4G6G A;  1CJ4 A;  2C66 A;  4TLZ A;  5LV9 A;  2GQW A;  2XCG A;  3ZDN A;  3I3L A;  1XHC A;  3UKQ A;  4PAB A;  2FJA A;  3LOV A;  1TRB A;  4H4Y A;  3EAO A;  1JEH A;  2C3D A;  4H4X A;  2OLN A;  1E6E A;  2VQB A;  4N9X A;  4TM4 A;  1DNC A;  2QCU A;  4BK3 A;  1GRF A;  1FOH A;  2H89 A;  3ICS A;  1DOC A;  2V61 A;  3DK4 A;  4UDP A;  3CND A;  1OJA A;  4K5R A;  2FJB A;  2XFN A;  1GRB A;  2E4G A;  2V5Z A;  3NYF A;  2XLT A;  5FS6 A;  2ZBW A;  4YTP A;  1LVL A;  1L9D A;  4GDE A;  3KD9 A;  1D7L A;  1BF3 A;  2EQ9 A;  2NPX A;  4IA6 A;  2BC0 A;  3M0O A;  3NNE A;  5U63 A;  3EF6 A;  3UKK A;  1FEA A;  4JY3 A;  4X9M A;  3DK8 A;  1CC2 A;  2A89 A;  2BK3 A;  4XXG A;  3AE9 A;  4Z2U A;  2QAE A;  1H7W A;  4RG3 A;  4EMJ A;  3F8R A;  2RGO A;  3CPH G;  1IUX A;  2JAE A;  3CNJ A;  2GVC A;  5KWF A;  2BA9 A;  4GAV A;  1BZL A;  3DGZ A;  2BS3 A;  3CNT A;  5FS8 A;  3L8K A;  4H2P A;  1GET A;  3GRS A;  1H6V A;  1SEZ A;  2BXS A;  2OAL A;  3S61 A;  3COX A;  3E1T A;  4H4T A;  4CNJ A;  4YSH A;  2BXR A;  1K0J A;  2JB1 A;  2WOW A;  1ZMD A;  2RGJ A;  1RYI A;  3D8X A;  5KVH A;  1O94 A;  4IV9 A;  4CRT A;  3EPT A;  1MOK A;  3ALM A;  4D03 A;  1GRH A;  2R0C A;  1CF3 A;  1E1N A;  2XLR A;  1ZKQ A;  5J60 A;  3NHO X;  1GRT A;  4I58 A;  1O5W A;  3P4Q A;  3DA1 A;  3SX6 A;  4EMW A;  1BKW A;  4EIP A;  4YKG A;  1P2E A;  4ADW A;  1GND A;  2BAC A;  2XYO A;  4XWZ A;  1VG9 A;  3CNS A;  3P4R A;  3FMW A;  2VRL A;  1H81 A;  1E7P A;  2R4J A;  2V3B A;  3NYC A;  1PN0 A;  1X31 B;  4E0V A;  4J31 A;  3AYL A;  3IHG A;  3GWF A;  3K7T A;  4Y4M A;  4B66 A;  3NG7 X;  1DOD A;  1N4V A;  1Y56 A;  3FG2 P;  4YTM A;  2WDV A;  4CY6 A;  1PDH A;  3RED A;  3NTD A;  3B3R A;  4JDR A;  5FS9 A;  4BJY A;  3AD8 B;  3V3O A;  3PO7 A;  3T2Y A;  4A7A A;  2FJE A;  2WET A;  4J34 A;  4EM3 A;  1KSS A;  2YLX A;  1S2Y A;  4EQR A;  2C65 A;  2XFP A;  2CUL A;  3CPJ G;  4H4U A;  3NIX A;  1OJ9 A;  2BRA A;  3II4 A;  3UTH A;  2B76 A;  2XFU A;  4CNK A;  4HA6 A;  4NNJ A;  1PBD A;  3HYV A;  2WPE A;  1PXC A;  4OPI A;  5GSN A;  4OPU A;  3DGH A;  4II3 A;  2YWL A;  4AP3 A;  4GRT A;  4FDC B;  3AED A;  2WBA A;  1CC4 A;  4YSY A;  2O9Z A;  5DBJ A;  3Q9T A;  3UTF A;  1OJC A;  4K2X A;  5GRT A;  4YT0 A;  2IVE A;  3AYJ A;  2ZZB A;  2TPR A;  3VRD B;  2CDU A;  2GR3 A;  2OA1 A;  3H8L A;  4BK2 A;  4J2W A;  5JCM A;  3NN6 X;  5KXJ A;  4U8K A;  3UTE A;  2XDO A;  5BVA A;  2Z5Y A;  3DJE A;  2GR2 A;  3IWA A;  5EB4 A;  1JNZ A;  3NYE A;  4B65 A;  3JSK A;  3SZC A;  2EQ7 A;  3AE3 A;  3KPF A;  4FK1 A;  4BUR A;  4NEW A;  4CCR A;  1K0L A;  4FK1 C;  5M10 A;  2XVI A;  3T31 A;  4NWZ A;  1PJ7 A;  1DJN A;  1Y0P A;  2YR5 A;  4HB9 A;  4U2T A;  3RHA A;  2GMH A;  2YVG A;  2ZZC A;  2BCP A;  3G5Q A;  4NTC A;  4H2N A;  2IVD A;  4DNA A;  1DOB A;  3QVR A;  4U8L A;  1M6I A;  3CN8 A;  4H7U A;  4AOX A;  2X3N A;  4B1B A;  3UTG A;  3UOX A;  3AE6 A;  2XLS A;  3ICR A;  3QSS A;  2YG3 A;  1DJQ A;  4WX1 A;  1N1P A;  1Q9I A;  4GUV A;  4BV6 A;  5TR3 A;  3CNP A;  3LJP A;  4U8I A;  3AEC A;  4AP1 A;  4B64 A;  3IHM A;  3AE1 A;  4OPT A;  5IQ4 A;  1ZMC A;  4EQS A;  1H83 A;  2JK6 A;  2YG4 A;  5J7X A;  3FPZ A;  2YG7 A;  1LTX R;  2Q6U A;  3AXB A;  3OC4 A;  4H4P A;  2FBW A;  4MJW A;  1FL2 A;  1GSN A;  4UDR A;  1H7X A;  2R0G A;  4A6N A;  4U8N A;  4AT0 A;  4LII A;  2YR6 A;  3NK1 X;  1ZK7 A;  4TLX A;  5BUL A;  3H4K A;  5EOW A;  2C76 A;  2V3A A;  2GH5 A;  2YLW A;  2UZZ A;  2YLS A;  1Q1R A;  3GD3 A;  2BC1 A;  1F8R A;  2ZZ0 A;  4C3Y A;  4IVO B;  3K7M X;  1VDC A;  3GYX A;  4NTD A;  1D4C A;  2GR0 A;  2V60 A;  3QJ4 A;  1JRX A;  1ZDL A;  3AD7 B;  2X99 A;  2X8G A;  5CKU A;  3QSM A;  2YLT A;  3ZYX A;  1KDG A;  1COY A;  2VQ7 A;  3K30 A;  4EMI A;  1TDO A;  5JCI A;  3M12 A;  1L9E A;  2GMJ A;  2W0H A;  1GPE A;  2XFO A;  3S5W A;  1Y56 B;  1AOG A;  4A99 A;  1TDN A;  3UKF A;  2A87 A;  1YQ4 A;  3LZX A;  2B7S A;  4U8P A;  2X8C A;  2H88 A;  3T2Z A;  3NN0 X;  3WE0 A;  4OCG A;  2OLO A;  3DJJ A;  3HYW A;  2B9W A;  1QLB A;  5HHF A;  4A5L A;  1KSU A;  2R4E A;  4H4W A;  4AT2 A;  4OPD A;  1D4D A;  3AE2 A;  2Q7V A;  4YKF A;  4A79 A;  2I0Z A;  3M13 A;  1D7Y A;  3AEB A;  2R46 A;  4K5S A;  2C70 A;  3BHF A;  4YSZ A;  4Z2R A;  4Z26 A;  1B37 A;  4CY8 A;  3VR8 A;  4GAP A;  4YTN A;  1V59 A;  1DXL A;  2YG5 A;  5JCK A;  1W4X A;  1IUW A;  1S3B A;  2C4C A;  2WHD A;  3F8P A;  5BRT A;  3G5R A;  3KPK A;  4D04 A;  2GQF A;  3RP8 A;  4U8O A;  3SFD A;  3ISH A;  1Z6L A;  2QA1 A;  4BJZ A;  1YQ3 A;  4ICY A;  2E1M A;  2VVL A;  4II2 A;  4O5Q A;  4NTE A;  5IQ1 A;  3UP4 A;  4TM0 A;  1EL5 A;  2DKI A;  2R9Z A;  1Q1W A;  2XLP A;  1ZX9 A;  2YQU A;  4OVI A;  3DJD A;  1FCD A;  3R9U A;  2OAM A;  5BUK A;  3UKA A;  5HY5 A;  1IUT A;  1BGJ A;  4G9K A;  1ONF A;  4PAA A;  4Y4N A;  1YKJ A;  5C2T A;  1B8S A;  2C75 A;  4APN A;  2B9Y A;  1NHS A;  1RSG A;  3CGE A;  3IC9 A;  1PJ6 A;  2C64 A;  2JBV A;  2JB3 A;  4H2R A;  3VR9 A;  2ARD A;  4DSH A;  2XVJ A;  1TDF A;  2YG6 A;  4H2Q A;  1CJC A;  3NGC X;  4IA5 A;  4A65 A;  3NLC A;  1NHQ A;  1NAA A;  3AD9 B;  3FBS A;  1EL8 A;  4P9S A;  4C77 A;  3UOZ A;  1HYU A;  2VVL G;  2BK4 A;  2EQ8 A;  2WP9 A;  3NKS A;  4G74 A;  3AE7 A;  4U8M A;  1REO A;  1JNR A;  2BCG G;  1GTE A;  4WCT A;  2WU2 A;  3UOY A;  3V3N A;  4CBQ A;  4AOS A;  4Z2T A;  1LJ1 A;  3BNU A;  2EQ6 A;  2XVH A;  2BS2 A;  4J36 A;  3AE5 A;  4Z24 A;  1VG0 A;  3GDN A;  2GEW A;  3SYI A;  3AEF A;  3VQR A;  4ECH A;  1PBF A;  1VRQ B;  1TDE A;  4OPC A;  1F8W A;  3P9U A;  4NZH A;  3SGL A;  4H4Z A;  1PBC A;  1XAN A;  4G6H A;  3SZF A;  1BWC A;  5U25 A;  2GB0 A;  1GXF A;  1CL0 A;  2AAQ A;  3C96 A;  2CVJ A;  3CPI G;  3G5S A;  1JRY A;  1QO8 A;  2WES A;  1L9C A;  2GR1 A;  3CMM A;  1M64 A;  4A6N B;  3Q6J A;  1F3P A;  3P4P A;  4JY2 A;  1TYP A;  4TM1 A;  3CIR A;  2APG A;  4YSX A;  1FEB A;  1B5Q A;  3UP5 A;  2DKH A;  2C7G A;  3NRN A;  5FMH A;  4I59 A;  1LPF A;  5U1O A;  4EQX A;  1LQT A;  3T0K A;  1K0I A;  2C72 A;  3KVE A;  4U2S A;  3GD4 A;  2YVJ A;  3ITJ A;  4USR A;  4A9W A;  4USQ A;  1PS9 A;  3KLJ A;  2GRT A;  3ATQ A;  3C4A A;  1E1L A;  1ZY8 A;  4NEV A;  1GEU A;  3H8I A;  1IJH A;  4XWR A;  3DK9 A;  3GDP A;  2AR8 A;  4UDQ A;  1EL9 A;  4KPR A;  3LB8 A;  3BHK A;  1NPX A;  2WS3 A;  1CJ2 A;  2BK5 A;  3GYJ A;  1YQZ A;  3ICT A;  3P1W A;  1GOS A;  4H4R A;  1S3E A;  4Y4L A;  3GYI A;  4Z44 A;  4J57 A;  1GRG A;  4REK A;  1CHU A;  4YWO A;  4B63 A;  2WP5 A;  4GF7 A;  3F8D A;  1MXT A;  2GF3 A;  3HYX A;  5FS7 A;  4JNQ A;  4RSL A;  4LA1 A;  2Q0K A;  4Z43 A;  2BAB A;  3NK2 X;  4B67 A;  1LV0 A;  1JRZ A;  3RNM A;  3SZW A;  2XFQ A;  3PVC A;  4ZCC A;  4FX9 A;  3QSE A;  4YXD A;  4H4V A;  4H4Q A;  3AB1 A;  3KA7 A;  3T2K A;  5KMP A;  1FEC A;  5KOX A;  3BI2 A;  3C4N A;  4Z25 A;  5HYM A;  3CGB A;  5JCL A;  3CGC A;  3LZW A;  2E5V A;  1BGN A;  1ELI A;  3IF9 A;  3QVP A;  3GRT A;  4JNA A;  2WOV A;  3RP6 A;  4EM4 A;  1OJD A;  2BS4 A;  2X50 A;  2XVF A;  4C5O A;  1PXB A;  3SFE A; 
#chains in the Genus database with same CATH homology
 1B4V A;  4J56 A;  1CC6 A;  2AQJ A;  5IPY A;  1YY5 A;  2FJD A;  2NVK X;  3ALJ A;  3AEA A;  4ZCD A;  2YLZ A;  4U2L A;  4BK1 A;  3CGD A;  1ZOV A;  4U8J A;  3HZL A;  4G73 A;  2C67 A;  1CJ3 A;  2GV8 A;  5KMS A;  3T14 A;  1GV4 A;  1GES A;  3OZ2 A;  2YLR A;  2A8X A;  2WOI A;  2HQM A;  1NEK A;  3AE8 A;  1PXA A;  3UOV A;  1XDI A;  4X4J A;  2R45 A;  2RGH A;  5C3J A;  1EBD A;  2GAH B;  4K7Z A;  4O5U A;  1S2Q A;  2F5Z A;  3QFB A;  5KVI A;  3NTA A;  2J3N A;  3VRB A;  4RG4 A;  2Q0L A;  2BYB A;  1GER A;  1PBE A;  3ABV A;  2IID A;  1KF6 A;  1QJD A;  5EB5 A;  3SXI A;  1O95 A;  1H82 A;  1RP0 A;  2YR4 A;  4JQ9 A;  2X8H A;  4TM3 A;  2YAU A;  2CFY A;  2TMD A;  5EBK A;  1XPQ A;  2V6O A;  1TYT A;  4H4S A;  1PBB A;  5L46 A;  5HXI A;  3UCL A;  1JOA A;  4X9N A;  3AYI A;  5KOW A;  2JB2 A;  1F6M A;  5KMR A;  2VVM A;  1KNR A;  3LAD A;  4OPG A;  1L0V A;  3V76 A;  4C74 A;  2XLU A;  3L1R A;  5ER0 A;  1NG3 A;  3AE4 A;  3D1C A;  2WDR A;  3K7Q X;  4DSG A;  2GAG B;  2JKC A;  2XVE A;  2RAB A;  2WEU A;  3PS9 A;  2YM1 A;  4JN9 A;  3DH9 A;  4B69 A;  4ZN0 A;  3AEE A;  1TDK A;  3ADA B;  4H50 A;  4GR1 A;  1UKV G;  3UKL A;  3DME A;  2BRY A;  1GTH A;  1N4U A;  1PJ5 A;  2YM2 A;  1E1K A;  3CTY A;  2YVF A;  3I6D A;  1KFY A;  5KNL A;  1GT8 A;  2WU5 A;  2Y6R A;  3SY4 A;  3NH3 X;  2WPF A;  3SQP A;  1IUV A;  4M52 A;  2WP6 A;  4IVM B;  1MO9 A;  3SM8 A;  2ACZ A;  3B6D A;  1KNP A;  3GSI A;  2WQY A;  2PHH A;  3VRA A;  4GCM A;  3GMC A;  2B7R A;  1LQU A;  2VRM A;  5JCN A;  3LXD A;  3NT6 A;  2QA2 A;  1H84 A;  3RP7 A;  1NEN A;  1E1M A;  1VQW A;  4OPL A;  4KX6 A;  1CBO A;  3BI4 A;  4C3X A;  1F8S A;  1P2H A;  3P4S A;  3T37 A;  3O0H A;  1H86 A;  2C73 A;  4K8D A;  4GDP A;  1GRA A;  1ZP0 A;  2PYX A;  1N4W A;  3BNM A;  1IUS A;  1NG4 A;  3KKJ A;  2Z5X A;  3KU9 A;  5M0Z A;  2R0P A;  4EQW A;  3FIM B;  5CQF A;  4B68 A;  2VOU A;  4CCQ A;  3DJG X;  1EL7 A;  3NK0 X;  1OJT A;  1GRE A;  1PHH A;  4LU6 A;  1ZOY A;  4K22 A;  1NHP A;  1D4E A;  3EAN A;  1NHR A;  1GAL A;  1E39 A;  2Y6Q A;  3ATR A;  2C3C A;  3GWD A;  3SZ0 A;  3URH A;  4DGK A;  2WDQ A;  3UKP A;  3QFA A;  1K4Q A;  4UP3 A;  3BI5 A;  3AWI A;  5KRQ A;  2B9X A;  1IUU A;  2WPC A;  5KMQ A;  1NDA A;  1JU2 A;  4EIQ A;  2VZ2 A;  1DOE A;  3AEG A;  3GMB A;  3ALL A;  3UKH A;  1D5T A;  4J33 A;  4G6G A;  1CJ4 A;  2C66 A;  4TLZ A;  5LV9 A;  2GQW A;  2XCG A;  3ZDN A;  3I3L A;  1XHC A;  3UKQ A;  4PAB A;  2FJA A;  3LOV A;  1TRB A;  4H4Y A;  3EAO A;  1JEH A;  2C3D A;  4H4X A;  2OLN A;  1E6E A;  2VQB A;  4N9X A;  4TM4 A;  1DNC A;  2QCU A;  4BK3 A;  1GRF A;  1FOH A;  2H89 A;  3ICS A;  1DOC A;  2V61 A;  3DK4 A;  4UDP A;  3CND A;  1OJA A;  4K5R A;  2FJB A;  2XFN A;  1GRB A;  2E4G A;  2V5Z A;  3NYF A;  2XLT A;  5FS6 A;  2ZBW A;  4YTP A;  1LVL A;  1L9D A;  4GDE A;  3KD9 A;  1D7L A;  1BF3 A;  2EQ9 A;  2NPX A;  4IA6 A;  2BC0 A;  3M0O A;  3NNE A;  5U63 A;  3EF6 A;  3UKK A;  1FEA A;  4JY3 A;  4X9M A;  3DK8 A;  1CC2 A;  2A89 A;  2BK3 A;  4XXG A;  3AE9 A;  4Z2U A;  2QAE A;  1H7W A;  4RG3 A;  4EMJ A;  3F8R A;  2RGO A;  3CPH G;  1IUX A;  2JAE A;  3CNJ A;  2GVC A;  5KWF A;  2BA9 A;  4GAV A;  1BZL A;  3DGZ A;  2BS3 A;  3CNT A;  5FS8 A;  3L8K A;  4H2P A;  1GET A;  3GRS A;  1H6V A;  1SEZ A;  2BXS A;  2OAL A;  3S61 A;  3COX A;  3E1T A;  4H4T A;  4CNJ A;  4YSH A;  2BXR A;  1K0J A;  2JB1 A;  2WOW A;  1ZMD A;  2RGJ A;  1RYI A;  3D8X A;  5KVH A;  1O94 A;  4IV9 A;  4CRT A;  3EPT A;  1MOK A;  3ALM A;  4D03 A;  1GRH A;  2R0C A;  1CF3 A;  1E1N A;  2XLR A;  1ZKQ A;  5J60 A;  3NHO X;  1GRT A;  4I58 A;  1O5W A;  3P4Q A;  3DA1 A;  3SX6 A;  4EMW A;  1BKW A;  4EIP A;  4YKG A;  1P2E A;  4ADW A;  1GND A;  2BAC A;  2XYO A;  4XWZ A;  1VG9 A;  3CNS A;  3P4R A;  3FMW A;  2VRL A;  1H81 A;  1E7P A;  2R4J A;  2V3B A;  3NYC A;  1PN0 A;  1X31 B;  4E0V A;  4J31 A;  3AYL A;  3IHG A;  3GWF A;  3K7T A;  4Y4M A;  4B66 A;  3NG7 X;  1DOD A;  1N4V A;  1Y56 A;  3FG2 P;  4YTM A;  2WDV A;  4CY6 A;  1PDH A;  3RED A;  3NTD A;  3B3R A;  4JDR A;  5FS9 A;  4BJY A;  3AD8 B;  3V3O A;  3PO7 A;  3T2Y A;  4A7A A;  2FJE A;  2WET A;  4J34 A;  4EM3 A;  1KSS A;  2YLX A;  1S2Y A;  4EQR A;  2C65 A;  2XFP A;  2CUL A;  3CPJ G;  4H4U A;  3NIX A;  1OJ9 A;  2BRA A;  3II4 A;  3UTH A;  2B76 A;  2XFU A;  4CNK A;  4HA6 A;  4NNJ A;  1PBD A;  3HYV A;  2WPE A;  1PXC A;  4OPI A;  5GSN A;  4OPU A;  3DGH A;  4II3 A;  2YWL A;  4AP3 A;  4GRT A;  4FDC B;  3AED A;  2WBA A;  1CC4 A;  4YSY A;  2O9Z A;  5DBJ A;  3Q9T A;  3UTF A;  1OJC A;  4K2X A;  5GRT A;  4YT0 A;  2IVE A;  3AYJ A;  2ZZB A;  2TPR A;  3VRD B;  2CDU A;  2GR3 A;  2OA1 A;  3H8L A;  4BK2 A;  4J2W A;  5JCM A;  3NN6 X;  5KXJ A;  4U8K A;  3UTE A;  2XDO A;  5BVA A;  2Z5Y A;  3DJE A;  2GR2 A;  3IWA A;  5EB4 A;  1JNZ A;  3NYE A;  4B65 A;  3JSK A;  3SZC A;  2EQ7 A;  3AE3 A;  3KPF A;  4FK1 A;  4BUR A;  4NEW A;  4CCR A;  1K0L A;  4FK1 C;  5M10 A;  2XVI A;  3T31 A;  4NWZ A;  1PJ7 A;  1DJN A;  1Y0P A;  2YR5 A;  4HB9 A;  4U2T A;  3RHA A;  2GMH A;  2YVG A;  2ZZC A;  2BCP A;  3G5Q A;  4NTC A;  4H2N A;  2IVD A;  4DNA A;  1DOB A;  3QVR A;  4U8L A;  1M6I A;  3CN8 A;  4H7U A;  4AOX A;  2X3N A;  4B1B A;  3UTG A;  3UOX A;  3AE6 A;  2XLS A;  3ICR A;  3QSS A;  2YG3 A;  1DJQ A;  4WX1 A;  1N1P A;  1Q9I A;  4GUV A;  4BV6 A;  5TR3 A;  3CNP A;  3LJP A;  4U8I A;  3AEC A;  4AP1 A;  4B64 A;  3IHM A;  3AE1 A;  4OPT A;  5IQ4 A;  1ZMC A;  4EQS A;  1H83 A;  2JK6 A;  2YG4 A;  5J7X A;  3FPZ A;  2YG7 A;  1LTX R;  2Q6U A;  3AXB A;  3OC4 A;  4H4P A;  2FBW A;  4MJW A;  1FL2 A;  1GSN A;  4UDR A;  1H7X A;  2R0G A;  4A6N A;  4U8N A;  4AT0 A;  4LII A;  2YR6 A;  3NK1 X;  1ZK7 A;  4TLX A;  5BUL A;  3H4K A;  5EOW A;  2C76 A;  2V3A A;  2GH5 A;  2YLW A;  2UZZ A;  2YLS A;  1Q1R A;  3GD3 A;  2BC1 A;  1F8R A;  2ZZ0 A;  4C3Y A;  4IVO B;  3K7M X;  1VDC A;  3GYX A;  4NTD A;  1D4C A;  2GR0 A;  2V60 A;  3QJ4 A;  1JRX A;  1ZDL A;  3AD7 B;  2X99 A;  2X8G A;  5CKU A;  3QSM A;  2YLT A;  3ZYX A;  1KDG A;  1COY A;  2VQ7 A;  3K30 A;  4EMI A;  1TDO A;  5JCI A;  3M12 A;  1L9E A;  2GMJ A;  2W0H A;  1GPE A;  2XFO A;  3S5W A;  1Y56 B;  1AOG A;  4A99 A;  1TDN A;  3UKF A;  2A87 A;  1YQ4 A;  3LZX A;  2B7S A;  4U8P A;  2X8C A;  2H88 A;  3T2Z A;  3NN0 X;  3WE0 A;  4OCG A;  2OLO A;  3DJJ A;  3HYW A;  2B9W A;  1QLB A;  5HHF A;  4A5L A;  1KSU A;  2R4E A;  4H4W A;  4AT2 A;  4OPD A;  1D4D A;  3AE2 A;  2Q7V A;  4YKF A;  4A79 A;  2I0Z A;  3M13 A;  1D7Y A;  3AEB A;  2R46 A;  4K5S A;  2C70 A;  3BHF A;  4YSZ A;  4Z2R A;  4Z26 A;  1B37 A;  4CY8 A;  3VR8 A;  4GAP A;  4YTN A;  1V59 A;  1DXL A;  2YG5 A;  5JCK A;  1W4X A;  1IUW A;  1S3B A;  2C4C A;  2WHD A;  3F8P A;  5BRT A;  3G5R A;  3KPK A;  4D04 A;  2GQF A;  3RP8 A;  4U8O A;  3SFD A;  3ISH A;  1Z6L A;  2QA1 A;  4BJZ A;  1YQ3 A;  4ICY A;  2E1M A;  2VVL A;  4II2 A;  4O5Q A;  4NTE A;  5IQ1 A;  3UP4 A;  4TM0 A;  1EL5 A;  2DKI A;  2R9Z A;  1Q1W A;  2XLP A;  1ZX9 A;  2YQU A;  4OVI A;  3DJD A;  1FCD A;  3R9U A;  2OAM A;  5BUK A;  3UKA A;  5HY5 A;  1IUT A;  1BGJ A;  4G9K A;  1ONF A;  4PAA A;  4Y4N A;  1YKJ A;  5C2T A;  1B8S A;  2C75 A;  4APN A;  2B9Y A;  1NHS A;  1RSG A;  3CGE A;  3IC9 A;  1PJ6 A;  2C64 A;  2JBV A;  2JB3 A;  4H2R A;  3VR9 A;  2ARD A;  4DSH A;  2XVJ A;  1TDF A;  2YG6 A;  4H2Q A;  1CJC A;  3NGC X;  4IA5 A;  4A65 A;  3NLC A;  1NHQ A;  1NAA A;  3AD9 B;  3FBS A;  1EL8 A;  4P9S A;  4C77 A;  3UOZ A;  1HYU A;  2VVL G;  2BK4 A;  2EQ8 A;  2WP9 A;  3NKS A;  4G74 A;  3AE7 A;  4U8M A;  1REO A;  1JNR A;  2BCG G;  1GTE A;  4WCT A;  2WU2 A;  3UOY A;  3V3N A;  4CBQ A;  4AOS A;  4Z2T A;  1LJ1 A;  3BNU A;  2EQ6 A;  2XVH A;  2BS2 A;  4J36 A;  3AE5 A;  4Z24 A;  1VG0 A;  3GDN A;  2GEW A;  3SYI A;  3AEF A;  3VQR A;  4ECH A;  1PBF A;  1VRQ B;  1TDE A;  4OPC A;  1F8W A;  3P9U A;  4NZH A;  3SGL A;  4H4Z A;  1PBC A;  1XAN A;  4G6H A;  3SZF A;  1BWC A;  5U25 A;  2GB0 A;  1GXF A;  1CL0 A;  2AAQ A;  3C96 A;  2CVJ A;  3CPI G;  3G5S A;  1JRY A;  1QO8 A;  2WES A;  1L9C A;  2GR1 A;  3CMM A;  1M64 A;  4A6N B;  3Q6J A;  1F3P A;  3P4P A;  4JY2 A;  1TYP A;  4TM1 A;  3CIR A;  2APG A;  4YSX A;  1FEB A;  1B5Q A;  3UP5 A;  2DKH A;  2C7G A;  3NRN A;  5FMH A;  4I59 A;  1LPF A;  5U1O A;  4EQX A;  1LQT A;  3T0K A;  1K0I A;  2C72 A;  3KVE A;  4U2S A;  3GD4 A;  2YVJ A;  3ITJ A;  4USR A;  4A9W A;  4USQ A;  1PS9 A;  3KLJ A;  2GRT A;  3ATQ A;  3C4A A;  1E1L A;  1ZY8 A;  4NEV A;  1GEU A;  3H8I A;  1IJH A;  4XWR A;  3DK9 A;  3GDP A;  2AR8 A;  4UDQ A;  1EL9 A;  4KPR A;  3LB8 A;  3BHK A;  1NPX A;  2WS3 A;  1CJ2 A;  2BK5 A;  3GYJ A;  1YQZ A;  3ICT A;  3P1W A;  1GOS A;  4H4R A;  1S3E A;  4Y4L A;  3GYI A;  4Z44 A;  4J57 A;  1GRG A;  4REK A;  1CHU A;  4YWO A;  4B63 A;  2WP5 A;  4GF7 A;  3F8D A;  1MXT A;  2GF3 A;  3HYX A;  5FS7 A;  4JNQ A;  4RSL A;  4LA1 A;  2Q0K A;  4Z43 A;  2BAB A;  3NK2 X;  4B67 A;  1LV0 A;  1JRZ A;  3RNM A;  3SZW A;  2XFQ A;  3PVC A;  4ZCC A;  4FX9 A;  3QSE A;  4YXD A;  4H4V A;  4H4Q A;  3AB1 A;  3KA7 A;  3T2K A;  5KMP A;  1FEC A;  5KOX A;  3BI2 A;  3C4N A;  4Z25 A;  5HYM A;  3CGB A;  5JCL A;  3CGC A;  3LZW A;  2E5V A;  1BGN A;  1ELI A;  3IF9 A;  3QVP A;  3GRT A;  4JNA A;  2WOV A;  3RP6 A;  4EM4 A;  1OJD A;  2BS4 A;  2X50 A;  2XVF A;  4C5O A;  1PXB A;  3SFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...