4CCRA

Crystal structure of the thioredoxin reductase apoenzyme from entamoeba histolytica in the absence of the nadp cofactor
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
313
structure length
311
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 91
structure length 311
sequence length 313
chains with identical sequence B, C, D
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2013-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccrA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4ccrA02
2YWLA 5ER0A 1O95A 2ACZA 1H7WA 2YG7A 4O5UA 2YVJA 2XDOA 1D4DA 1IUVA 1E1NA 3C4NA 5HHFA 4YSZA 2YLWA 4FDCB 3FBSA 1Y0PA 4TM1A 1F8WA 3L8KA 2BABA 1DODA 4RSLA 2HQMA 1L9DA 3IHGA 4AT2A 2B9XA 1QJDA 3UOYA 1NHRA 3D1CA 2V61A 2FJBA 4CNJA 3KPFA 1B4VA 1LPFA 1GOSA 1S2YA 3B3RA 1ZMCA 4JY2A 3CNSA 2C70A 1ZX9A 4UDPA 4IA5A 5KOWA 1NENA 2WOIA 1H7XA 4K5RA 2F5ZA 3GSIA 3F8RA 4ECHA 2C72A 2OA1A 3DGHA 4BK3A 4USQA 2Z5XA 3E1TA 3PS9A 3QSEA 4BJZA 1CJ3A 3CGBA 4J31A 3GD3A 2BXSA 1PXBA 3AEBA 2EQ7A 2WHDA 3AE6A 4I59A 1NHQA 3HZLA 1N1PA 4B63A 2BS2A 4CCQA 1GREA 1K0IA 1YQZA 4GR1A 3BNMA 4CCRA 4EQSA 4AP3A 3AE8A 1F8RA 2TMDA 3V76A 4PABA 1JRZA 1OJ9A 3NNEA 1BGJA 3UOVA 2WU2A 5CKUA 4OPUA 2BA9A 3UTEA 1GRAA 3V3NA 4A7AA 1K0JA 3G5SA 1F8SA 2XFPA 4Z2TA 3F8PA 2VRLA 3RP8A 4B64A 1GXFA 1K0LA 3NK0X 1VDCA 3II4A 3CTYA 3AE4A 3IWAA 4YSXA 3LZXA 1GRFA 3ALJA 1TYPA 3DJDA 3GRSA 3H4KA 4AT0A 1D5TA 1NHPA 1HYUA 1KSSA 4I58A 4H4YA 4TM0A 3AEAA 5JCMA 5U1OA 3KLJA 2Q0LA 2YLXA 3IHMA 5J60A 3D8XA 2YR4A 3M13A 3BNUA 2X8GA 3QFBA 4GRTA 3WE0A 4NTCA 1JNRA 4A9WA 1EL9A 1FECA 2GF3A 1D4EA 3K7TA 3K7MX 1PBBA 1ZKQA 4NEVA 1GPEA 3NG7X 4CNKA 4NTEA 3AE9A 1YQ3A 3P4QA 1DOEA 3VRBA 3UKQA 4LIIA 4JQ9A 3KVEA 2Q7VA 3AEFA 3EANA 4BV6A 3NT6A 4U8NA 2YR5A 3LXDA 4ZCCA 3CIRA 3DA1A 2ARDA 3GWDA 2RABA 4XWZA 1TDKA 4KPRA 4Y4LA 2V5ZA 3ZYXA 3DMEA 4H4WA 2XFOA 4OPGA 1FL2A 3CPHG 2YQUA 2UZZA 5BULA 3GMCA 1CC2A 3M12A 4U8IA 2ZZBA 4NTDA 1PBFA 3NGCX 1FEAA 1KSUA 1OJTA 5HY5A 3GDPA 3URHA 3AEGA 1KDGA 2XLRA 4TLXA 4Z44A 2VQ7A 1ZP0A 4DSHA 4AP1A 1REOA 3FPZA 4YSHA 1GERA 3UCLA 1KNPA 5JCLA 1JOAA 3S5WA 5C2TA 4FK1A 5BVAA 2YG3A 1CC6A 1V59A 4YT0A 3QSMA 4UP3A 4H7UA 1NHSA 4FX9A 4EQWA 3OC4A 4D04A 4K22A 4OPTA 5JCKA 2A87A 2GQWA 4DSGA 4AOXA 4OPCA 5BRTA 4OPIA 2GQFA 3NYFA 2YVFA 1VG9A 5EBKA 3V3OA 2YG5A 2X3NA 3UTHA 2GR3A 1GALA 2V60A 2FJEA 1MXTA 2GVCA 4GUVA 3R9UA 1PXAA 4GF7A 3RNMA 5IQ4A 2GMJA 3AYLA 1D7YA 4CBQA 4EIQA 2GMHA 2O9ZA 3CNJA 2DKHA 4EQXA 1PDHA 3RHAA 4J33A 1P2EA 1TDFA 5HYMA 3ATQA 2YG6A 3FIMB 2C73A 2XCGA 3NYEA 2IIDA 2TPRA 3IF9A 3DJJA 1IJHA 2BYBA 2YLZA 4U8KA 3FMWA 3AB1A 2ZZCA 2GR0A 1ZY8A 4CY6A 1GESA 2QA2A 4OCGA 3DK8A 5TR3A 1CJ4A 1DJNA 3LB8A 4C3XA 2QA1A 5KXJA 4ADWA 1PBDA 2RGJA 4PAAA 2R4EA 2R45A 4UDQA 4H50A 1PJ5A 2JKCA 3UOZA 2C3CA 4RG4A 1VRQB 2C65A 5FMHA 1H82A 4OPDA 4LU6A 3CNDA 2IVEA 1QLBA 4N9XA 2FJDA 2AR8A 3AD9B 2VVLG 1BF3A 1Y56A 1ZDLA 1ZOYA 1DOCA 1E39A 5KVIA 2VZ2A 1W4XA 4OVIA 1M64A 5FS8A 1O94A 2GV8A 4IVOB 1BZLA 3SFDA 3L1RA 4YTNA 3EF6A 3JSKA 3DK4A 1Q1WA 3CNTA 4Y4MA 3NK2X 4E0VA 1E1LA 4K5SA 5GSNA 1IUSA 1OJCA 3ITJA 1JNZA 2B7SA 1EL7A 3GYJA 4AOSA 2OLOA 4EM4A 3VRDB 4NEWA 4Y4NA 4C74A 2JBVA 2E5VA 2WPEA 3UKHA 1RSGA 1NG4A 1N4VA 3NRNA 4H4QA 4U8PA 2GAHB 3VRAA 3VR8A 2CVJA 4B67A 2BC0A 5KRQA 1GRHA 2EQ8A 1F3PA 4A99A 5FS9A 2R4JA 2XLTA 3O0HA 4X4JA 3RP6A 3NH3X 2RGHA 4C77A 3ADAB 3AYJA 5JCIA 1DXLA 1PJ6A 2C64A 1H86A 1L0VA 3PVCA 4H4PA 1EBDA 5J7XA 2C66A 3UP4A 1UKVG 3UKAA 2VRMA 1KF6A 1IUWA 1SEZA 2R0PA 1XPQA 1EL8A 4Z43A 1GRTA 3QSSA 1O5WA 3H8LA 3ICRA 2Z5YA 3AE3A 3H8IA 3I3LA 5M10A 2C7GA 4Z26A 4B1BA 1NAAA 2XYOA 2Q0KA 1E6EA 1E1KA 2VQBA 4WX1A 3NIXA 2A8XA 3KU9A 4H4UA 2R0CA 2WP9A 4HB9A 4H4XA 4JDRA 4O5QA 1IUTA 1B5QA 4CY8A 1LQUA 4BJYA 2B9YA 2NPXA 2CFYA 5FS7A 2XLPA 1VG0A 5HXIA 1GT8A 3BHKA 3ISHA 3NYCA 1L9EA 1CHUA 1QO8A 4JY3A 4M52A 2IVDA 3NKSA 1PJ7A 2H88A 5U25A 4GCMA 4BURA 2YR6A 5L46A 4YTMA 4EMJA 2VVLA 4U2SA 4B66A 4H4VA 4EM3A 2BC1A 2YAUA 2R46A 1OJDA 1XDIA 1LV0A 2DKIA 4YWOA 2X99A 2BCPA 2OALA 3AYIA 1XANA 2AAQA 3SQPA 1PXCA 3GWFA 2WDVA 4U8LA 3K30A 4U8JA 3NLCA 1DOBA 2GEWA 2YLRA 1D7LA 4U8MA 5GRTA 1AOGA 4CRTA 1CJCA 1IUXA 1Q9IA 1FEBA 3NN6X 4IV9A 2R9ZA 2PHHA 3AE2A 4YTPA 1TRBA 1Y56B 2YM2A 3ICTA 4J34A 3Q9TA 4JN9A 1CL0A 3GYIA 1NEKA 2W0HA 3NTAA 2V3AA 3QVRA 1Q1RA 3ALLA 3F8DA 4MJWA 3COXA 1CF3A 3CGCA 5FS6A 3UKFA 5M0ZA 1S3BA 3CGDA 5EB4A 2XFQA 2XVHA 1GTEA 2X8CA 4H2RA 2XVEA 1TDNA 4LA1A 3T37A 2FJAA 3DK9A 4NZHA 3SM8A 1M6IA 2BK3A 3QFAA 4H4SA 2YLSA 5IQ1A 2C3DA 4B65A 3EAOA 4YKGA 2VVMA 4J57A 4B69A 1JU2A 1ELIA 1NG3A 3NK1X 4J2WA 4RG3A 3RP7A 1DJQA 1GNDA 4ZCDA 3UTFA 3BI2A 2H89A 1GEUA 2WPCA 1YKJA 2B7RA 2V6OA 1GETA 1B8SA 1TDEA 3I6DA 4DGKA 4U8OA 1LVLA 3P4PA 4BK1A 4C5OA 1ONFA 3G5QA 5KVHA 2BS3A 3DJGX 3P4SA 4YSYA 2WEUA 2E4GA 4BK2A 5JCNA 2GR2A 2Y6RA 2B9WA 3P4RA 3CPIG 4J36A 5EB5A 1P2HA 4H2NA 2QCUA 4UDRA 2WBAA 3CNPA 3NN0X 1ZMDA 2RGOA 4P9SA 3C96A 2J3NA 1JRYA 1B37A 4EMWA 2GH5A 1CBOA 2BK4A 2X50A 3UP5A 3NTDA 2WETA 1S2QA 4YXDA 5BUKA 3KD9A 4J56A 3AD8B 3AEEA 1MO9A 1F6MA 2XVJA 2YLTA 2WU5A 1PBCA 1K4QA 2V3BA 3OZ2A 1RP0A 2XFNA 1ZOVA 4A79A 4IA6A 1LTXR 1YQ4A 2GAGB 3AD7B 2C67A 4USRA 2AQJA 1BWCA 3B6DA 1ZK7A 1GRBA 3AE1A 1GV4A 1S3EA 4REKA 2A89A 4IVMB 3UTGA 1EL5A 3LADA 3SFEA 1GTHA 2JB1A 3LJPA 2VOUA 2GR1A 3GMBA 3Q6JA 3UKKA 3CPJG 4JNAA 4EIPA 4WCTA 1TYTA 1PBEA 4Z2RA 2E1MA 2WP6A 3LOVA 1E1MA 2B76A 4A6NB 3DJEA 1D4CA 2WOWA 4Z24A 2BS4A 3AE7A 2YVGA 1H83A 2WDQA 1MOKA 4OPLA 2JAEA 4B68A 2WOVA 4U2LA 2XFUA 2WESA 4Z25A 3FG2P 3DGZA 2XVFA 1PN0A 1YY5A 4XXGA 1NDAA 3NHOX 4HA6A 3PO7A 2YM1A 2XLSA 4K8DA 4DNAA 2WQYA 1L9CA 3ICSA 1NPXA 2GRTA 3M0OA 4H4TA 1LQTA 2BCGG 2XVIA 3AE5A 3SGLA 5LV9A 3S61A 5IPYA 2GB0A 1GSNA 3QVPA 4JNQA 4X9NA 4YKFA 3AECA 3C4AA 2EQ9A 2OAMA 2WP5A 1N4WA 4APNA 5C3JA 2EQ6A 4GDEA 5EOWA 4TM4A 4GDPA 4K2XA 2Y6QA 2I0ZA 4X9MA 4A65A 1OJAA 4EMIA 2BACA 1TDOA 2APGA 5KWFA 3LZWA 4FK1C 4U2TA 4EQRA 3KKJA 1FOHA 3GRTA 1H6VA 3UKPA 1VQWA 1X31B 1BKWA 3VR9A 4H2PA 4C3YA 4A6NA 3CGEA 5U63A 4TLZA 1PHHA 4XWRA 3GDNA 1CC4A 4ZN0A 1RYIA 2BXRA 3DH9A 3G5RA 2JK6A 2Q6UA 2WS3A 3BI5A 3BI4A 3VQRA 2R0GA 1BGNA 2NVKX 1KNRA 2XLUA 1JEHA 2CDUA 2CULA 3CN8A 1H81A 4Z2UA 3KA7A 3ATRA 1H84A 3AXBA 3P1WA 5KOXA 5DBJA 2C76A 4H4RA 1COYA 2PYXA 4H4ZA 3ZDNA 2FBWA 1DNCA 2JB2A 4KX6A 4H2QA 1CJ2A 2YG4A 3ABVA 3BHFA 3UKLA 3ALMA 1GRGA 2ZBWA 2WPFA 3REDA 1N4UA 2QAEA 3K7QX 4TM3A 3QJ4A 1PS9A 4A5LA 3AWIA 3GD4A 4K7ZA 5CQFA 2C75A 1E7PA 3IC9A 3P9UA 1JRXA 1LJ1A 1XHCA 2OLNA 1IUUA 1FCDA 2ZZ0A 3AEDA 3EPTA 2WDRA 2JB3A 1Z6LA 4ICYA 4D03A 2X8HA 2BK5A 3UOXA 1KFYA
chains in the Genus database with same CATH superfamily
2YWLA 3SX6A 5ER0A 1O95A 2ACZA 1H7WA 2YG7A 4O5UA 2YVJA 2XDOA 1D4DA 1IUVA 1E1NA 3C4NA 5HHFA 4YSZA 2YLWA 4FDCB 3FBSA 1Y0PA 4TM1A 1F8WA 3L8KA 2BABA 1DODA 4RSLA 2HQMA 1L9DA 3IHGA 4AT2A 2B9XA 1QJDA 3UOYA 1NHRA 3D1CA 2V61A 2FJBA 4CNJA 3KPFA 1B4VA 1LPFA 1GOSA 1S2YA 3B3RA 1ZMCA 2C4CA 3CNSA 2C70A 1ZX9A 4JY2A 4IA5A 4UDPA 5KOWA 1NENA 2WOIA 1H7XA 4K5RA 2F5ZA 3GSIA 3F8RA 4ECHA 2C72A 2OA1A 3DGHA 4BK3A 4USQA 2Z5XA 3E1TA 3PS9A 3QSEA 4BJZA 1CJ3A 3CGBA 4J31A 3GD3A 2BXSA 1PXBA 3AEBA 2EQ7A 2WHDA 3AE6A 4I59A 1NHQA 3HZLA 1N1PA 4B63A 2BS2A 4CCQA 1GREA 1K0IA 1YQZA 4GR1A 3BNMA 4CCRA 4EQSA 4AP3A 3AE8A 1F8RA 2TMDA 3V76A 4PABA 1JRZA 1OJ9A 3NNEA 1BGJA 3UOVA 2WU2A 5CKUA 4OPUA 2BA9A 3UTEA 1GRAA 3V3NA 4A7AA 1K0JA 3G5SA 1F8SA 2XFPA 4Z2TA 3F8PA 2VRLA 3RP8A 4B64A 1GXFA 1K0LA 3NK0X 1VDCA 3II4A 3CTYA 3AE4A 3IWAA 4YSXA 3LZXA 1GRFA 3ALJA 4GAPA 1TYPA 3SZFA 3DJDA 4NNJA 3GRSA 3H4KA 4AT0A 1D5TA 1NHPA 1HYUA 1KSSA 4I58A 4H4YA 4TM0A 3AEAA 5JCMA 5U1OA 3KLJA 2Q0LA 2YLXA 3IHMA 5J60A 3D8XA 2YR4A 3M13A 3BNUA 2X8GA 3QFBA 4GRTA 3WE0A 4NTCA 1JNRA 4A9WA 1EL9A 1FECA 2GF3A 1D4EA 3K7TA 3K7MX 1PBBA 1ZKQA 4NEVA 1GPEA 3NG7X 4CNKA 4NTEA 3AE9A 1YQ3A 3P4QA 4G74A 1DOEA 5KMSA 3VRBA 3UKQA 4LIIA 4JQ9A 3KVEA 2Q7VA 3AEFA 3EANA 4BV6A 3NT6A 4U8NA 2YR5A 3LXDA 4GAVA 4ZCCA 3CIRA 3DA1A 2ARDA 3GWDA 2RABA 4XWZA 1TDKA 4KPRA 4Y4LA 2V5ZA 3ZYXA 3DMEA 4H4WA 2XFOA 4OPGA 1FL2A 3CPHG 2YQUA 2UZZA 5BULA 3GMCA 1CC2A 3M12A 4U8IA 2ZZBA 4NTDA 1PBFA 3NGCX 1FEAA 1KSUA 1OJTA 2BRAA 5HY5A 3GDPA 3URHA 3AEGA 3HYXA 1KDGA 2XLRA 4TLXA 4Z44A 2VQ7A 1ZP0A 4DSHA 4AP1A 1REOA 3FPZA 3KPKA 4YSHA 1GERA 3UCLA 1KNPA 5JCLA 1JOAA 3S5WA 5C2TA 4FK1A 5BVAA 2YG3A 1CC6A 1V59A 4YT0A 3QSMA 4UP3A 4H7UA 4II2A 1NHSA 4FX9A 4EQWA 3OC4A 4D04A 4K22A 4OPTA 5JCKA 2A87A 2GQWA 2BRYA 3T2ZA 4DSGA 4AOXA 4OPCA 5BRTA 4OPIA 2GQFA 3NYFA 2YVFA 1VG9A 5EBKA 3V3OA 2YG5A 2X3NA 3UTHA 2GR3A 1GALA 2V60A 2FJEA 1MXTA 2GVCA 4GUVA 3R9UA 1PXAA 4GF7A 3RNMA 5IQ4A 2GMJA 3AYLA 1D7YA 4CBQA 4EIQA 2GMHA 2O9ZA 3CNJA 2DKHA 4EQXA 3T2KA 1PDHA 3RHAA 4J33A 1P2EA 1TDFA 5HYMA 3ATQA 2YG6A 3FIMB 2C73A 2XCGA 3NYEA 2IIDA 2TPRA 3IF9A 3DJJA 1IJHA 2BYBA 2YLZA 4U8KA 3FMWA 3AB1A 2ZZCA 2GR0A 1ZY8A 4CY6A 1GESA 2QA2A 4OCGA 3DK8A 5TR3A 1CJ4A 1DJNA 3LB8A 3CMMA 2QA1A 4C3XA 5KXJA 4ADWA 1PBDA 2RGJA 4PAAA 2R4EA 2R45A 4UDQA 4H50A 1PJ5A 2JKCA 3UOZA 4II3A 2C3CA 4RG4A 1VRQB 2C65A 5FMHA 1H82A 4OPDA 4LU6A 3CNDA 2IVEA 1QLBA 4N9XA 2FJDA 2AR8A 3AD9B 2VVLG 1BF3A 1Y56A 1ZDLA 1ZOYA 1DOCA 1E39A 5KVIA 2VZ2A 1W4XA 4OVIA 1M64A 5FS8A 1O94A 2GV8A 3HYWA 1BZLA 4IVOB 3L1RA 3SFDA 3EF6A 3JSKA 3DK4A 4YTNA 1Q1WA 3CNTA 4Y4MA 3NK2X 4E0VA 1E1LA 4K5SA 5GSNA 1IUSA 1OJCA 3ITJA 4G73A 1JNZA 2B7SA 5KMQA 1EL7A 3GYJA 4AOSA 2OLOA 4EM4A 3VRDB 4NEWA 4Y4NA 4C74A 2JBVA 2E5VA 2WPEA 3UKHA 1RSGA 1NG4A 1N4VA 3NRNA 4H4QA 4U8PA 2GAHB 3VRAA 3VR8A 2CVJA 4B67A 2BC0A 5KRQA 1GRHA 2EQ8A 1F3PA 4A99A 5FS9A 2R4JA 2XLTA 3O0HA 4X4JA 3RP6A 3NH3X 2RGHA 4C77A 3ADAB 3AYJA 3SZCA 5JCIA 1DXLA 1PJ6A 2C64A 1H86A 4G9KA 1L0VA 3PVCA 4H4PA 1EBDA 5J7XA 2C66A 3UP4A 1UKVG 3SYIA 3UKAA 2VRMA 1KF6A 1IUWA 1SEZA 2R0PA 1XPQA 1EL8A 4Z43A 1GRTA 3QSSA 1O5WA 3H8LA 3ICRA 2Z5YA 3AE3A 3H8IA 3I3LA 5M10A 2C7GA 4Z26A 4B1BA 1NAAA 2XYOA 2Q0KA 1E6EA 1E1KA 2VQBA 4WX1A 3NIXA 2A8XA 3KU9A 4H4UA 2R0CA 2WP9A 4HB9A 4H4XA 4JDRA 4O5QA 1IUTA 1B5QA 4CY8A 1LQUA 4BJYA 2B9YA 2NPXA 2CFYA 5FS7A 2XLPA 1VG0A 5HXIA 1GT8A 3BHKA 3ISHA 3NYCA 1L9EA 1CHUA 1QO8A 4JY3A 4M52A 2IVDA 3NKSA 1PJ7A 2H88A 5U25A 4GCMA 4BURA 2YR6A 5L46A 4YTMA 4EMJA 2VVLA 4U2SA 4B66A 4H4VA 3SZ0A 4EM3A 2BC1A 2YAUA 2R46A 1OJDA 1XDIA 1LV0A 2DKIA 4YWOA 2X99A 2BCPA 2OALA 3AYIA 1XANA 2AAQA 3SQPA 1PXCA 3GWFA 2WDVA 4G6GA 4U8LA 3K30A 4U8JA 3NLCA 1DOBA 2GEWA 2YLRA 1D7LA 4U8MA 5GRTA 1AOGA 4CRTA 1CJCA 1IUXA 1Q9IA 1FEBA 3NN6X 4IV9A 2R9ZA 2PHHA 3AE2A 4YTPA 1TRBA 1Y56B 2YM2A 3ICTA 4J34A 3Q9TA 4JN9A 1CL0A 3GYIA 3GYXA 1NEKA 2W0HA 3NTAA 2V3AA 3QVRA 1Q1RA 3ALLA 3F8DA 4MJWA 3COXA 1CF3A 3CGCA 5FS6A 3UKFA 5M0ZA 1S3BA 3CGDA 5EB4A 2XFQA 2XVHA 1GTEA 2X8CA 4H2RA 2XVEA 1TDNA 3SZWA 4LA1A 3T37A 2FJAA 3DK9A 4NZHA 3SM8A 1M6IA 5KMPA 2BK3A 3QFAA 4H4SA 2YLSA 5IQ1A 2C3DA 3T14A 4B65A 3EAOA 4YKGA 2VVMA 4J57A 4B69A 1JU2A 1ELIA 1NG3A 3NK1X 4J2WA 4RG3A 3RP7A 1DJQA 1GNDA 4ZCDA 3UTFA 3BI2A 2H89A 1GEUA 2WPCA 1YKJA 2B7RA 2V6OA 1GETA 1B8SA 1TDEA 3I6DA 4DGKA 4U8OA 1LVLA 3P4PA 4BK1A 4C5OA 1ONFA 3G5QA 5KVHA 2BS3A 3DJGX 3P4SA 4YSYA 2WEUA 2E4GA 4BK2A 5JCNA 2GR2A 2Y6RA 2B9WA 3P4RA 3CPIG 4J36A 5EB5A 1P2HA 4H2NA 2QCUA 4UDRA 2WBAA 3CNPA 3NN0X 1ZMDA 3SXIA 2RGOA 4P9SA 3C96A 2J3NA 1JRYA 3T31A 1B37A 4EMWA 2GH5A 1CBOA 2BK4A 2X50A 3UP5A 3NTDA 2WETA 1S2QA 4NWZA 3T0KA 4YXDA 3KD9A 4J56A 3AD8B 3AEEA 1MO9A 1F6MA 2XVJA 5BUKA 2YLTA 2WU5A 1PBCA 1K4QA 2V3BA 3OZ2A 1RP0A 2XFNA 1ZOVA 4A79A 4IA6A 1LTXR 1YQ4A 2GAGB 3AD7B 2C67A 4USRA 2AQJA 1BWCA 3B6DA 1ZK7A 1GRBA 3AE1A 1GV4A 1S3EA 4REKA 2A89A 4IVMB 3UTGA 1EL5A 3LADA 3SFEA 1GTHA 2JB1A 3LJPA 2VOUA 2GR1A 3GMBA 3Q6JA 5KNLA 3UKKA 3CPJG 4JNAA 4EIPA 4WCTA 1TYTA 1PBEA 4Z2RA 2E1MA 2WP6A 3LOVA 1E1MA 2B76A 4A6NB 3DJEA 1D4CA 5KMRA 2WOWA 4Z24A 2BS4A 3AE7A 2YVGA 1H83A 2WDQA 1MOKA 4OPLA 2JAEA 4B68A 2WOVA 4U2LA 2XFUA 2WESA 4Z25A 3FG2P 3DGZA 2XVFA 1PN0A 1YY5A 4XXGA 1NDAA 3NHOX 4HA6A 3PO7A 2YM1A 2XLSA 4K8DA 4DNAA 2WQYA 1L9CA 3ICSA 1NPXA 2GRTA 3M0OA 4H4TA 1LQTA 2BCGG 2XVIA 3AE5A 3SGLA 5LV9A 3S61A 5IPYA 2GB0A 1GSNA 3QVPA 4JNQA 4X9NA 4YKFA 3AECA 3C4AA 2EQ9A 2OAMA 2WP5A 1N4WA 4APNA 5C3JA 2EQ6A 4GDEA 5EOWA 4TM4A 4GDPA 4K2XA 2Y6QA 2I0ZA 4X9MA 4A65A 1OJAA 4EMIA 2BACA 1TDOA 2APGA 5KWFA 3LZWA 4FK1C 4U2TA 4EQRA 3KKJA 1FOHA 3GRTA 1H6VA 3UKPA 1VQWA 1X31B 1BKWA 3VR9A 4H2PA 4C3YA 4A6NA 3CGEA 5U63A 4TLZA 1PHHA 4XWRA 3GDNA 1CC4A 3T2YA 4ZN0A 1RYIA 2BXRA 3DH9A 3G5RA 4G6HA 2JK6A 2Q6UA 2WS3A 3BI5A 3BI4A 3VQRA 2R0GA 1BGNA 2NVKX 1KNRA 2XLUA 1JEHA 2CDUA 2CULA 3CN8A 1H81A 4Z2UA 3KA7A 3ATRA 1H84A 3AXBA 3P1WA 5KOXA 5DBJA 2C76A 4H4RA 1COYA 2PYXA 4H4ZA 3ZDNA 2FBWA 1DNCA 2JB2A 4KX6A 4H2QA 1CJ2A 2YG4A 3ABVA 3BHFA 3UKLA 3ALMA 1GRGA 2ZBWA 2WPFA 3REDA 1N4UA 2QAEA 3K7QX 4TM3A 3QJ4A 1PS9A 4A5LA 3AWIA 3GD4A 4K7ZA 5CQFA 2C75A 1E7PA 3IC9A 3P9UA 1JRXA 1LJ1A 1XHCA 2OLNA 1IUUA 1FCDA 2ZZ0A 3HYVA 3SY4A 3AEDA 3EPTA 2WDRA 2JB3A 1Z6LA 4ICYA 4D03A 2X8HA 2BK5A 3UOXA 1KFYA
chains in the Genus database with same CATH topology
2YWLA 3SX6A 5ER0A 1O95A 2ACZA 1H7WA 2YG7A 4O5UA 2YVJA 2XDOA 1D4DA 1IUVA 1E1NA 3C4NA 5HHFA 4YSZA 2YLWA 4FDCB 3FBSA 1Y0PA 4TM1A 1F8WA 3L8KA 2BABA 1DODA 4RSLA 2HQMA 1L9DA 3IHGA 4AT2A 2B9XA 1QJDA 3UOYA 1NHRA 3D1CA 2V61A 2FJBA 4CNJA 3KPFA 1B4VA 1LPFA 1GOSA 1S2YA 3B3RA 1ZMCA 2C4CA 3CNSA 2C70A 1ZX9A 4JY2A 4IA5A 4UDPA 5KOWA 1NENA 2WOIA 1H7XA 4K5RA 2F5ZA 3GSIA 3F8RA 4ECHA 2C72A 2OA1A 3DGHA 4BK3A 4USQA 2Z5XA 3E1TA 3PS9A 3QSEA 4BJZA 1CJ3A 3CGBA 4J31A 3GD3A 2BXSA 1PXBA 3AEBA 2EQ7A 2WHDA 3AE6A 4I59A 1NHQA 3HZLA 1N1PA 4B63A 2BS2A 4CCQA 1GREA 1K0IA 1YQZA 4GR1A 3BNMA 4CCRA 4EQSA 4AP3A 3AE8A 1F8RA 2TMDA 3V76A 4PABA 1JRZA 1OJ9A 3NNEA 1BGJA 3UOVA 2WU2A 5CKUA 4OPUA 2BA9A 3UTEA 1GRAA 3V3NA 4A7AA 1K0JA 3G5SA 1F8SA 2XFPA 4Z2TA 3F8PA 2VRLA 3RP8A 4B64A 1GXFA 1K0LA 3NK0X 1VDCA 3II4A 3CTYA 3AE4A 3IWAA 4YSXA 3LZXA 1GRFA 3ALJA 4GAPA 1TYPA 3SZFA 3DJDA 4NNJA 3GRSA 3H4KA 4AT0A 1D5TA 1NHPA 1HYUA 1KSSA 4I58A 4H4YA 4TM0A 3AEAA 5JCMA 5U1OA 3KLJA 2Q0LA 2YLXA 3IHMA 5J60A 3D8XA 2YR4A 3M13A 3BNUA 2X8GA 3QFBA 4GRTA 3WE0A 4NTCA 1JNRA 4A9WA 1EL9A 1FECA 2GF3A 1D4EA 3K7TA 3K7MX 1PBBA 1ZKQA 4NEVA 1GPEA 3NG7X 4CNKA 4NTEA 3AE9A 1YQ3A 3P4QA 4G74A 1DOEA 5KMSA 3VRBA 3UKQA 4LIIA 4JQ9A 3KVEA 2Q7VA 3AEFA 3EANA 4BV6A 3NT6A 4U8NA 2YR5A 3LXDA 4GAVA 4ZCCA 3CIRA 3DA1A 2ARDA 3GWDA 2RABA 4XWZA 1TDKA 4KPRA 4Y4LA 2V5ZA 3ZYXA 3DMEA 4H4WA 2XFOA 4OPGA 1FL2A 3CPHG 2YQUA 2UZZA 5BULA 3GMCA 1CC2A 3M12A 4U8IA 2ZZBA 4NTDA 1PBFA 3NGCX 1FEAA 1KSUA 1OJTA 2BRAA 5HY5A 3GDPA 3URHA 3AEGA 3HYXA 1KDGA 2XLRA 4TLXA 4Z44A 2VQ7A 1ZP0A 4DSHA 4AP1A 1REOA 3FPZA 3KPKA 4YSHA 1GERA 3UCLA 1KNPA 5JCLA 1JOAA 3S5WA 5C2TA 4FK1A 5BVAA 2YG3A 1CC6A 1V59A 4YT0A 3QSMA 4UP3A 4H7UA 4II2A 1NHSA 4FX9A 4EQWA 3OC4A 4D04A 4K22A 4OPTA 5JCKA 2A87A 2GQWA 2BRYA 3T2ZA 4DSGA 4AOXA 4OPCA 5BRTA 4OPIA 2GQFA 3NYFA 2YVFA 1VG9A 5EBKA 3V3OA 2YG5A 2X3NA 3UTHA 2GR3A 1GALA 2V60A 2FJEA 1MXTA 2GVCA 4GUVA 3R9UA 1PXAA 4GF7A 3RNMA 5IQ4A 2GMJA 3AYLA 1D7YA 4CBQA 4EIQA 2GMHA 2O9ZA 3CNJA 2DKHA 4EQXA 3T2KA 1PDHA 3RHAA 4J33A 1P2EA 1TDFA 5HYMA 3ATQA 2YG6A 3FIMB 2C73A 2XCGA 3NYEA 2IIDA 2TPRA 3IF9A 3DJJA 1IJHA 2BYBA 2YLZA 4U8KA 3FMWA 3AB1A 2ZZCA 2GR0A 1ZY8A 4CY6A 1GESA 2QA2A 4OCGA 3DK8A 5TR3A 1CJ4A 1DJNA 3LB8A 3CMMA 2QA1A 4C3XA 5KXJA 4ADWA 1PBDA 2RGJA 4PAAA 2R4EA 2R45A 4UDQA 4H50A 1PJ5A 2JKCA 3UOZA 4II3A 2C3CA 4RG4A 1VRQB 2C65A 5FMHA 1H82A 4OPDA 4LU6A 3CNDA 2IVEA 1QLBA 4N9XA 2FJDA 2AR8A 3AD9B 2VVLG 1BF3A 1Y56A 1ZDLA 1ZOYA 1DOCA 1E39A 5KVIA 2VZ2A 1W4XA 4OVIA 1M64A 5FS8A 1O94A 2GV8A 3HYWA 1BZLA 4IVOB 3L1RA 3SFDA 3EF6A 3JSKA 3DK4A 4YTNA 1Q1WA 3CNTA 4Y4MA 3NK2X 4E0VA 1E1LA 4K5SA 5GSNA 1IUSA 1OJCA 3ITJA 4G73A 1JNZA 2B7SA 5KMQA 1EL7A 3GYJA 4AOSA 2OLOA 4EM4A 3VRDB 4NEWA 4Y4NA 4C74A 2JBVA 2E5VA 2WPEA 3UKHA 1RSGA 1NG4A 1N4VA 3NRNA 4H4QA 4U8PA 2GAHB 3VRAA 3VR8A 2CVJA 4B67A 2BC0A 5KRQA 1GRHA 2EQ8A 1F3PA 4A99A 5FS9A 2R4JA 2XLTA 3O0HA 4X4JA 3RP6A 3NH3X 2RGHA 4C77A 3ADAB 3AYJA 3SZCA 5JCIA 1DXLA 1PJ6A 2C64A 1H86A 4G9KA 1L0VA 3PVCA 4H4PA 1EBDA 5J7XA 2C66A 3UP4A 1UKVG 3SYIA 3UKAA 2VRMA 1KF6A 1IUWA 1SEZA 2R0PA 1XPQA 1EL8A 4Z43A 1GRTA 3QSSA 1O5WA 3H8LA 3ICRA 2Z5YA 3AE3A 3H8IA 3I3LA 5M10A 2C7GA 4Z26A 4B1BA 1NAAA 2XYOA 2Q0KA 1E6EA 1E1KA 2VQBA 4WX1A 3NIXA 2A8XA 3KU9A 4H4UA 2R0CA 2WP9A 4HB9A 4H4XA 4JDRA 4O5QA 1IUTA 1B5QA 4CY8A 1LQUA 4BJYA 2B9YA 2NPXA 2CFYA 5FS7A 2XLPA 1VG0A 5HXIA 1GT8A 3BHKA 3ISHA 3NYCA 1L9EA 1CHUA 1QO8A 4JY3A 4M52A 2IVDA 3NKSA 1PJ7A 2H88A 5U25A 4GCMA 4BURA 2YR6A 5L46A 4YTMA 4EMJA 2VVLA 4U2SA 4B66A 4H4VA 3SZ0A 4EM3A 2BC1A 2YAUA 2R46A 1OJDA 1XDIA 1LV0A 2DKIA 4YWOA 2X99A 2BCPA 2OALA 3AYIA 1XANA 2AAQA 3SQPA 1PXCA 3GWFA 2WDVA 4G6GA 4U8LA 3K30A 4U8JA 3NLCA 1DOBA 2GEWA 2YLRA 1D7LA 4U8MA 5GRTA 1AOGA 4CRTA 1CJCA 1IUXA 1Q9IA 1FEBA 3NN6X 4IV9A 2R9ZA 2PHHA 3AE2A 4YTPA 1TRBA 1Y56B 2YM2A 3ICTA 4J34A 3Q9TA 4JN9A 1CL0A 3GYIA 3GYXA 1NEKA 2W0HA 3NTAA 2V3AA 3QVRA 1Q1RA 3ALLA 3F8DA 4MJWA 3COXA 1CF3A 3CGCA 5FS6A 3UKFA 5M0ZA 1S3BA 3CGDA 5EB4A 2XFQA 2XVHA 1GTEA 2X8CA 4H2RA 2XVEA 1TDNA 3SZWA 4LA1A 3T37A 2FJAA 3DK9A 4NZHA 3SM8A 1M6IA 5KMPA 2BK3A 3QFAA 4H4SA 2YLSA 5IQ1A 2C3DA 3T14A 4B65A 3EAOA 4YKGA 2VVMA 4J57A 4B69A 1JU2A 1ELIA 1NG3A 3NK1X 4J2WA 4RG3A 3RP7A 1DJQA 1GNDA 4ZCDA 3UTFA 3BI2A 2H89A 1GEUA 2WPCA 1YKJA 2B7RA 2V6OA 1GETA 1B8SA 1TDEA 3I6DA 4DGKA 4U8OA 1LVLA 3P4PA 4BK1A 4C5OA 1ONFA 3G5QA 5KVHA 2BS3A 3DJGX 3P4SA 4YSYA 2WEUA 2E4GA 4BK2A 5JCNA 2GR2A 2Y6RA 2B9WA 3P4RA 3CPIG 4J36A 5EB5A 1P2HA 4H2NA 2QCUA 4UDRA 2WBAA 3CNPA 3NN0X 1ZMDA 3SXIA 2RGOA 4P9SA 3C96A 2J3NA 1JRYA 3T31A 1B37A 4EMWA 2GH5A 1CBOA 2BK4A 2X50A 3UP5A 3NTDA 2WETA 1S2QA 4NWZA 3T0KA 4YXDA 3KD9A 4J56A 3AD8B 3AEEA 1MO9A 1F6MA 2XVJA 5BUKA 2YLTA 2WU5A 1PBCA 1K4QA 2V3BA 3OZ2A 1RP0A 2XFNA 1ZOVA 4A79A 4IA6A 1LTXR 1YQ4A 2GAGB 3AD7B 2C67A 4USRA 2AQJA 1BWCA 3B6DA 1ZK7A 1GRBA 3AE1A 1GV4A 1S3EA 4REKA 2A89A 4IVMB 3UTGA 1EL5A 3LADA 3SFEA 1GTHA 2JB1A 3LJPA 2VOUA 2GR1A 3GMBA 3Q6JA 5KNLA 3UKKA 3CPJG 4JNAA 4EIPA 4WCTA 1TYTA 1PBEA 4Z2RA 2E1MA 2WP6A 3LOVA 1E1MA 2B76A 4A6NB 3DJEA 1D4CA 5KMRA 2WOWA 4Z24A 2BS4A 3AE7A 2YVGA 1H83A 2WDQA 1MOKA 4OPLA 2JAEA 4B68A 2WOVA 4U2LA 2XFUA 2WESA 4Z25A 3FG2P 3DGZA 2XVFA 1PN0A 1YY5A 4XXGA 1NDAA 3NHOX 4HA6A 3PO7A 2YM1A 2XLSA 4K8DA 4DNAA 2WQYA 1L9CA 3ICSA 1NPXA 2GRTA 3M0OA 4H4TA 1LQTA 2BCGG 2XVIA 3AE5A 3SGLA 5LV9A 3S61A 5IPYA 2GB0A 1GSNA 3QVPA 4JNQA 4X9NA 4YKFA 3AECA 3C4AA 2EQ9A 2OAMA 2WP5A 1N4WA 4APNA 5C3JA 2EQ6A 4GDEA 5EOWA 4TM4A 4GDPA 4K2XA 2Y6QA 2I0ZA 4X9MA 4A65A 1OJAA 4EMIA 2BACA 1TDOA 2APGA 5KWFA 3LZWA 4FK1C 4U2TA 4EQRA 3KKJA 1FOHA 3GRTA 1H6VA 3UKPA 1VQWA 1X31B 1BKWA 3VR9A 4H2PA 4C3YA 4A6NA 3CGEA 5U63A 4TLZA 1PHHA 4XWRA 3GDNA 1CC4A 3T2YA 4ZN0A 1RYIA 2BXRA 3DH9A 3G5RA 4G6HA 2JK6A 2Q6UA 2WS3A 3BI5A 3BI4A 3VQRA 2R0GA 1BGNA 2NVKX 1KNRA 2XLUA 1JEHA 2CDUA 2CULA 3CN8A 1H81A 4Z2UA 3KA7A 3ATRA 1H84A 3AXBA 3P1WA 5KOXA 5DBJA 2C76A 4H4RA 1COYA 2PYXA 4H4ZA 3ZDNA 2FBWA 1DNCA 2JB2A 4KX6A 4H2QA 1CJ2A 2YG4A 3ABVA 3BHFA 3UKLA 3ALMA 1GRGA 2ZBWA 2WPFA 3REDA 1N4UA 2QAEA 3K7QX 4TM3A 3QJ4A 1PS9A 4A5LA 3AWIA 3GD4A 4K7ZA 5CQFA 2C75A 1E7PA 3IC9A 3P9UA 1JRXA 1LJ1A 1XHCA 2OLNA 1IUUA 1FCDA 2ZZ0A 3HYVA 3SY4A 3AEDA 3EPTA 2WDRA 2JB3A 1Z6LA 4ICYA 4D03A 2X8HA 2BK5A 3UOXA 1KFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YWL A;  5ER0 A;  1O95 A;  2ACZ A;  1H7W A;  2YG7 A;  4O5U A;  2YVJ A;  2XDO A;  1D4D A;  1IUV A;  1E1N A;  3C4N A;  5HHF A;  4YSZ A;  2YLW A;  4FDC B;  3FBS A;  1Y0P A;  4TM1 A;  1F8W A;  3L8K A;  2BAB A;  1DOD A;  4RSL A;  2HQM A;  1L9D A;  3IHG A;  4AT2 A;  2B9X A;  1QJD A;  3UOY A;  1NHR A;  3D1C A;  2V61 A;  2FJB A;  4CNJ A;  3KPF A;  1B4V A;  1LPF A;  1GOS A;  1S2Y A;  3B3R A;  1ZMC A;  4JY2 A;  3CNS A;  2C70 A;  1ZX9 A;  4UDP A;  4IA5 A;  5KOW A;  1NEN A;  2WOI A;  1H7X A;  4K5R A;  2F5Z A;  3GSI A;  3F8R A;  4ECH A;  2C72 A;  2OA1 A;  3DGH A;  4BK3 A;  4USQ A;  2Z5X A;  3E1T A;  3PS9 A;  3QSE A;  4BJZ A;  1CJ3 A;  3CGB A;  4J31 A;  3GD3 A;  2BXS A;  1PXB A;  3AEB A;  2EQ7 A;  2WHD A;  3AE6 A;  4I59 A;  1NHQ A;  3HZL A;  1N1P A;  4B63 A;  2BS2 A;  4CCQ A;  1GRE A;  1K0I A;  1YQZ A;  4GR1 A;  3BNM A;  4CCR A;  4EQS A;  4AP3 A;  3AE8 A;  1F8R A;  2TMD A;  3V76 A;  4PAB A;  1JRZ A;  1OJ9 A;  3NNE A;  1BGJ A;  3UOV A;  2WU2 A;  5CKU A;  4OPU A;  2BA9 A;  3UTE A;  1GRA A;  3V3N A;  4A7A A;  1K0J A;  3G5S A;  1F8S A;  2XFP A;  4Z2T A;  3F8P A;  2VRL A;  3RP8 A;  4B64 A;  1GXF A;  1K0L A;  3NK0 X;  1VDC A;  3II4 A;  3CTY A;  3AE4 A;  3IWA A;  4YSX A;  3LZX A;  1GRF A;  3ALJ A;  1TYP A;  3DJD A;  3GRS A;  3H4K A;  4AT0 A;  1D5T A;  1NHP A;  1HYU A;  1KSS A;  4I58 A;  4H4Y A;  4TM0 A;  3AEA A;  5JCM A;  5U1O A;  3KLJ A;  2Q0L A;  2YLX A;  3IHM A;  5J60 A;  3D8X A;  2YR4 A;  3M13 A;  3BNU A;  2X8G A;  3QFB A;  4GRT A;  3WE0 A;  4NTC A;  1JNR A;  4A9W A;  1EL9 A;  1FEC A;  2GF3 A;  1D4E A;  3K7T A;  3K7M X;  1PBB A;  1ZKQ A;  4NEV A;  1GPE A;  3NG7 X;  4CNK A;  4NTE A;  3AE9 A;  1YQ3 A;  3P4Q A;  1DOE A;  3VRB A;  3UKQ A;  4LII A;  4JQ9 A;  3KVE A;  2Q7V A;  3AEF A;  3EAN A;  4BV6 A;  3NT6 A;  4U8N A;  2YR5 A;  3LXD A;  4ZCC A;  3CIR A;  3DA1 A;  2ARD A;  3GWD A;  2RAB A;  4XWZ A;  1TDK A;  4KPR A;  4Y4L A;  2V5Z A;  3ZYX A;  3DME A;  4H4W A;  2XFO A;  4OPG A;  1FL2 A;  3CPH G;  2YQU A;  2UZZ A;  5BUL A;  3GMC A;  1CC2 A;  3M12 A;  4U8I A;  2ZZB A;  4NTD A;  1PBF A;  3NGC X;  1FEA A;  1KSU A;  1OJT A;  5HY5 A;  3GDP A;  3URH A;  3AEG A;  1KDG A;  2XLR A;  4TLX A;  4Z44 A;  2VQ7 A;  1ZP0 A;  4DSH A;  4AP1 A;  1REO A;  3FPZ A;  4YSH A;  1GER A;  3UCL A;  1KNP A;  5JCL A;  1JOA A;  3S5W A;  5C2T A;  4FK1 A;  5BVA A;  2YG3 A;  1CC6 A;  1V59 A;  4YT0 A;  3QSM A;  4UP3 A;  4H7U A;  1NHS A;  4FX9 A;  4EQW A;  3OC4 A;  4D04 A;  4K22 A;  4OPT A;  5JCK A;  2A87 A;  2GQW A;  4DSG A;  4AOX A;  4OPC A;  5BRT A;  4OPI A;  2GQF A;  3NYF A;  2YVF A;  1VG9 A;  5EBK A;  3V3O A;  2YG5 A;  2X3N A;  3UTH A;  2GR3 A;  1GAL A;  2V60 A;  2FJE A;  1MXT A;  2GVC A;  4GUV A;  3R9U A;  1PXA A;  4GF7 A;  3RNM A;  5IQ4 A;  2GMJ A;  3AYL A;  1D7Y A;  4CBQ A;  4EIQ A;  2GMH A;  2O9Z A;  3CNJ A;  2DKH A;  4EQX A;  1PDH A;  3RHA A;  4J33 A;  1P2E A;  1TDF A;  5HYM A;  3ATQ A;  2YG6 A;  3FIM B;  2C73 A;  2XCG A;  3NYE A;  2IID A;  2TPR A;  3IF9 A;  3DJJ A;  1IJH A;  2BYB A;  2YLZ A;  4U8K A;  3FMW A;  3AB1 A;  2ZZC A;  2GR0 A;  1ZY8 A;  4CY6 A;  1GES A;  2QA2 A;  4OCG A;  3DK8 A;  5TR3 A;  1CJ4 A;  1DJN A;  3LB8 A;  4C3X A;  2QA1 A;  5KXJ A;  4ADW A;  1PBD A;  2RGJ A;  4PAA A;  2R4E A;  2R45 A;  4UDQ A;  4H50 A;  1PJ5 A;  2JKC A;  3UOZ A;  2C3C A;  4RG4 A;  1VRQ B;  2C65 A;  5FMH A;  1H82 A;  4OPD A;  4LU6 A;  3CND A;  2IVE A;  1QLB A;  4N9X A;  2FJD A;  2AR8 A;  3AD9 B;  2VVL G;  1BF3 A;  1Y56 A;  1ZDL A;  1ZOY A;  1DOC A;  1E39 A;  5KVI A;  2VZ2 A;  1W4X A;  4OVI A;  1M64 A;  5FS8 A;  1O94 A;  2GV8 A;  4IVO B;  1BZL A;  3SFD A;  3L1R A;  4YTN A;  3EF6 A;  3JSK A;  3DK4 A;  1Q1W A;  3CNT A;  4Y4M A;  3NK2 X;  4E0V A;  1E1L A;  4K5S A;  5GSN A;  1IUS A;  1OJC A;  3ITJ A;  1JNZ A;  2B7S A;  1EL7 A;  3GYJ A;  4AOS A;  2OLO A;  4EM4 A;  3VRD B;  4NEW A;  4Y4N A;  4C74 A;  2JBV A;  2E5V A;  2WPE A;  3UKH A;  1RSG A;  1NG4 A;  1N4V A;  3NRN A;  4H4Q A;  4U8P A;  2GAH B;  3VRA A;  3VR8 A;  2CVJ A;  4B67 A;  2BC0 A;  5KRQ A;  1GRH A;  2EQ8 A;  1F3P A;  4A99 A;  5FS9 A;  2R4J A;  2XLT A;  3O0H A;  4X4J A;  3RP6 A;  3NH3 X;  2RGH A;  4C77 A;  3ADA B;  3AYJ A;  5JCI A;  1DXL A;  1PJ6 A;  2C64 A;  1H86 A;  1L0V A;  3PVC A;  4H4P A;  1EBD A;  5J7X A;  2C66 A;  3UP4 A;  1UKV G;  3UKA A;  2VRM A;  1KF6 A;  1IUW A;  1SEZ A;  2R0P A;  1XPQ A;  1EL8 A;  4Z43 A;  1GRT A;  3QSS A;  1O5W A;  3H8L A;  3ICR A;  2Z5Y A;  3AE3 A;  3H8I A;  3I3L A;  5M10 A;  2C7G A;  4Z26 A;  4B1B A;  1NAA A;  2XYO A;  2Q0K A;  1E6E A;  1E1K A;  2VQB A;  4WX1 A;  3NIX A;  2A8X A;  3KU9 A;  4H4U A;  2R0C A;  2WP9 A;  4HB9 A;  4H4X A;  4JDR A;  4O5Q A;  1IUT A;  1B5Q A;  4CY8 A;  1LQU A;  4BJY A;  2B9Y A;  2NPX A;  2CFY A;  5FS7 A;  2XLP A;  1VG0 A;  5HXI A;  1GT8 A;  3BHK A;  3ISH A;  3NYC A;  1L9E A;  1CHU A;  1QO8 A;  4JY3 A;  4M52 A;  2IVD A;  3NKS A;  1PJ7 A;  2H88 A;  5U25 A;  4GCM A;  4BUR A;  2YR6 A;  5L46 A;  4YTM A;  4EMJ A;  2VVL A;  4U2S A;  4B66 A;  4H4V A;  4EM3 A;  2BC1 A;  2YAU A;  2R46 A;  1OJD A;  1XDI A;  1LV0 A;  2DKI A;  4YWO A;  2X99 A;  2BCP A;  2OAL A;  3AYI A;  1XAN A;  2AAQ A;  3SQP A;  1PXC A;  3GWF A;  2WDV A;  4U8L A;  3K30 A;  4U8J A;  3NLC A;  1DOB A;  2GEW A;  2YLR A;  1D7L A;  4U8M A;  5GRT A;  1AOG A;  4CRT A;  1CJC A;  1IUX A;  1Q9I A;  1FEB A;  3NN6 X;  4IV9 A;  2R9Z A;  2PHH A;  3AE2 A;  4YTP A;  1TRB A;  1Y56 B;  2YM2 A;  3ICT A;  4J34 A;  3Q9T A;  4JN9 A;  1CL0 A;  3GYI A;  1NEK A;  2W0H A;  3NTA A;  2V3A A;  3QVR A;  1Q1R A;  3ALL A;  3F8D A;  4MJW A;  3COX A;  1CF3 A;  3CGC A;  5FS6 A;  3UKF A;  5M0Z A;  1S3B A;  3CGD A;  5EB4 A;  2XFQ A;  2XVH A;  1GTE A;  2X8C A;  4H2R A;  2XVE A;  1TDN A;  4LA1 A;  3T37 A;  2FJA A;  3DK9 A;  4NZH A;  3SM8 A;  1M6I A;  2BK3 A;  3QFA A;  4H4S A;  2YLS A;  5IQ1 A;  2C3D A;  4B65 A;  3EAO A;  4YKG A;  2VVM A;  4J57 A;  4B69 A;  1JU2 A;  1ELI A;  1NG3 A;  3NK1 X;  4J2W A;  4RG3 A;  3RP7 A;  1DJQ A;  1GND A;  4ZCD A;  3UTF A;  3BI2 A;  2H89 A;  1GEU A;  2WPC A;  1YKJ A;  2B7R A;  2V6O A;  1GET A;  1B8S A;  1TDE A;  3I6D A;  4DGK A;  4U8O A;  1LVL A;  3P4P A;  4BK1 A;  4C5O A;  1ONF A;  3G5Q A;  5KVH A;  2BS3 A;  3DJG X;  3P4S A;  4YSY A;  2WEU A;  2E4G A;  4BK2 A;  5JCN A;  2GR2 A;  2Y6R A;  2B9W A;  3P4R A;  3CPI G;  4J36 A;  5EB5 A;  1P2H A;  4H2N A;  2QCU A;  4UDR A;  2WBA A;  3CNP A;  3NN0 X;  1ZMD A;  2RGO A;  4P9S A;  3C96 A;  2J3N A;  1JRY A;  1B37 A;  4EMW A;  2GH5 A;  1CBO A;  2BK4 A;  2X50 A;  3UP5 A;  3NTD A;  2WET A;  1S2Q A;  4YXD A;  5BUK A;  3KD9 A;  4J56 A;  3AD8 B;  3AEE A;  1MO9 A;  1F6M A;  2XVJ A;  2YLT A;  2WU5 A;  1PBC A;  1K4Q A;  2V3B A;  3OZ2 A;  1RP0 A;  2XFN A;  1ZOV A;  4A79 A;  4IA6 A;  1LTX R;  1YQ4 A;  2GAG B;  3AD7 B;  2C67 A;  4USR A;  2AQJ A;  1BWC A;  3B6D A;  1ZK7 A;  1GRB A;  3AE1 A;  1GV4 A;  1S3E A;  4REK A;  2A89 A;  4IVM B;  3UTG A;  1EL5 A;  3LAD A;  3SFE A;  1GTH A;  2JB1 A;  3LJP A;  2VOU A;  2GR1 A;  3GMB A;  3Q6J A;  3UKK A;  3CPJ G;  4JNA A;  4EIP A;  4WCT A;  1TYT A;  1PBE A;  4Z2R A;  2E1M A;  2WP6 A;  3LOV A;  1E1M A;  2B76 A;  4A6N B;  3DJE A;  1D4C A;  2WOW A;  4Z24 A;  2BS4 A;  3AE7 A;  2YVG A;  1H83 A;  2WDQ A;  1MOK A;  4OPL A;  2JAE A;  4B68 A;  2WOV A;  4U2L A;  2XFU A;  2WES A;  4Z25 A;  3FG2 P;  3DGZ A;  2XVF A;  1PN0 A;  1YY5 A;  4XXG A;  1NDA A;  3NHO X;  4HA6 A;  3PO7 A;  2YM1 A;  2XLS A;  4K8D A;  4DNA A;  2WQY A;  1L9C A;  3ICS A;  1NPX A;  2GRT A;  3M0O A;  4H4T A;  1LQT A;  2BCG G;  2XVI A;  3AE5 A;  3SGL A;  5LV9 A;  3S61 A;  5IPY A;  2GB0 A;  1GSN A;  3QVP A;  4JNQ A;  4X9N A;  4YKF A;  3AEC A;  3C4A A;  2EQ9 A;  2OAM A;  2WP5 A;  1N4W A;  4APN A;  5C3J A;  2EQ6 A;  4GDE A;  5EOW A;  4TM4 A;  4GDP A;  4K2X A;  2Y6Q A;  2I0Z A;  4X9M A;  4A65 A;  1OJA A;  4EMI A;  2BAC A;  1TDO A;  2APG A;  5KWF A;  3LZW A;  4FK1 C;  4U2T A;  4EQR A;  3KKJ A;  1FOH A;  3GRT A;  1H6V A;  3UKP A;  1VQW A;  1X31 B;  1BKW A;  3VR9 A;  4H2P A;  4C3Y A;  4A6N A;  3CGE A;  5U63 A;  4TLZ A;  1PHH A;  4XWR A;  3GDN A;  1CC4 A;  4ZN0 A;  1RYI A;  2BXR A;  3DH9 A;  3G5R A;  2JK6 A;  2Q6U A;  2WS3 A;  3BI5 A;  3BI4 A;  3VQR A;  2R0G A;  1BGN A;  2NVK X;  1KNR A;  2XLU A;  1JEH A;  2CDU A;  2CUL A;  3CN8 A;  1H81 A;  4Z2U A;  3KA7 A;  3ATR A;  1H84 A;  3AXB A;  3P1W A;  5KOX A;  5DBJ A;  2C76 A;  4H4R A;  1COY A;  2PYX A;  4H4Z A;  3ZDN A;  2FBW A;  1DNC A;  2JB2 A;  4KX6 A;  4H2Q A;  1CJ2 A;  2YG4 A;  3ABV A;  3BHF A;  3UKL A;  3ALM A;  1GRG A;  2ZBW A;  2WPF A;  3RED A;  1N4U A;  2QAE A;  3K7Q X;  4TM3 A;  3QJ4 A;  1PS9 A;  4A5L A;  3AWI A;  3GD4 A;  4K7Z A;  5CQF A;  2C75 A;  1E7P A;  3IC9 A;  3P9U A;  1JRX A;  1LJ1 A;  1XHC A;  2OLN A;  1IUU A;  1FCD A;  2ZZ0 A;  3AED A;  3EPT A;  2WDR A;  2JB3 A;  1Z6L A;  4ICY A;  4D03 A;  2X8H A;  2BK5 A;  3UOX A;  1KFY A; 
#chains in the Genus database with same CATH topology
 2YWL A;  3SX6 A;  5ER0 A;  1O95 A;  2ACZ A;  1H7W A;  2YG7 A;  4O5U A;  2YVJ A;  2XDO A;  1D4D A;  1IUV A;  1E1N A;  3C4N A;  5HHF A;  4YSZ A;  2YLW A;  4FDC B;  3FBS A;  1Y0P A;  4TM1 A;  1F8W A;  3L8K A;  2BAB A;  1DOD A;  4RSL A;  2HQM A;  1L9D A;  3IHG A;  4AT2 A;  2B9X A;  1QJD A;  3UOY A;  1NHR A;  3D1C A;  2V61 A;  2FJB A;  4CNJ A;  3KPF A;  1B4V A;  1LPF A;  1GOS A;  1S2Y A;  3B3R A;  1ZMC A;  2C4C A;  3CNS A;  2C70 A;  1ZX9 A;  4JY2 A;  4IA5 A;  4UDP A;  5KOW A;  1NEN A;  2WOI A;  1H7X A;  4K5R A;  2F5Z A;  3GSI A;  3F8R A;  4ECH A;  2C72 A;  2OA1 A;  3DGH A;  4BK3 A;  4USQ A;  2Z5X A;  3E1T A;  3PS9 A;  3QSE A;  4BJZ A;  1CJ3 A;  3CGB A;  4J31 A;  3GD3 A;  2BXS A;  1PXB A;  3AEB A;  2EQ7 A;  2WHD A;  3AE6 A;  4I59 A;  1NHQ A;  3HZL A;  1N1P A;  4B63 A;  2BS2 A;  4CCQ A;  1GRE A;  1K0I A;  1YQZ A;  4GR1 A;  3BNM A;  4CCR A;  4EQS A;  4AP3 A;  3AE8 A;  1F8R A;  2TMD A;  3V76 A;  4PAB A;  1JRZ A;  1OJ9 A;  3NNE A;  1BGJ A;  3UOV A;  2WU2 A;  5CKU A;  4OPU A;  2BA9 A;  3UTE A;  1GRA A;  3V3N A;  4A7A A;  1K0J A;  3G5S A;  1F8S A;  2XFP A;  4Z2T A;  3F8P A;  2VRL A;  3RP8 A;  4B64 A;  1GXF A;  1K0L A;  3NK0 X;  1VDC A;  3II4 A;  3CTY A;  3AE4 A;  3IWA A;  4YSX A;  3LZX A;  1GRF A;  3ALJ A;  4GAP A;  1TYP A;  3SZF A;  3DJD A;  4NNJ A;  3GRS A;  3H4K A;  4AT0 A;  1D5T A;  1NHP A;  1HYU A;  1KSS A;  4I58 A;  4H4Y A;  4TM0 A;  3AEA A;  5JCM A;  5U1O A;  3KLJ A;  2Q0L A;  2YLX A;  3IHM A;  5J60 A;  3D8X A;  2YR4 A;  3M13 A;  3BNU A;  2X8G A;  3QFB A;  4GRT A;  3WE0 A;  4NTC A;  1JNR A;  4A9W A;  1EL9 A;  1FEC A;  2GF3 A;  1D4E A;  3K7T A;  3K7M X;  1PBB A;  1ZKQ A;  4NEV A;  1GPE A;  3NG7 X;  4CNK A;  4NTE A;  3AE9 A;  1YQ3 A;  3P4Q A;  4G74 A;  1DOE A;  5KMS A;  3VRB A;  3UKQ A;  4LII A;  4JQ9 A;  3KVE A;  2Q7V A;  3AEF A;  3EAN A;  4BV6 A;  3NT6 A;  4U8N A;  2YR5 A;  3LXD A;  4GAV A;  4ZCC A;  3CIR A;  3DA1 A;  2ARD A;  3GWD A;  2RAB A;  4XWZ A;  1TDK A;  4KPR A;  4Y4L A;  2V5Z A;  3ZYX A;  3DME A;  4H4W A;  2XFO A;  4OPG A;  1FL2 A;  3CPH G;  2YQU A;  2UZZ A;  5BUL A;  3GMC A;  1CC2 A;  3M12 A;  4U8I A;  2ZZB A;  4NTD A;  1PBF A;  3NGC X;  1FEA A;  1KSU A;  1OJT A;  2BRA A;  5HY5 A;  3GDP A;  3URH A;  3AEG A;  3HYX A;  1KDG A;  2XLR A;  4TLX A;  4Z44 A;  2VQ7 A;  1ZP0 A;  4DSH A;  4AP1 A;  1REO A;  3FPZ A;  3KPK A;  4YSH A;  1GER A;  3UCL A;  1KNP A;  5JCL A;  1JOA A;  3S5W A;  5C2T A;  4FK1 A;  5BVA A;  2YG3 A;  1CC6 A;  1V59 A;  4YT0 A;  3QSM A;  4UP3 A;  4H7U A;  4II2 A;  1NHS A;  4FX9 A;  4EQW A;  3OC4 A;  4D04 A;  4K22 A;  4OPT A;  5JCK A;  2A87 A;  2GQW A;  2BRY A;  3T2Z A;  4DSG A;  4AOX A;  4OPC A;  5BRT A;  4OPI A;  2GQF A;  3NYF A;  2YVF A;  1VG9 A;  5EBK A;  3V3O A;  2YG5 A;  2X3N A;  3UTH A;  2GR3 A;  1GAL A;  2V60 A;  2FJE A;  1MXT A;  2GVC A;  4GUV A;  3R9U A;  1PXA A;  4GF7 A;  3RNM A;  5IQ4 A;  2GMJ A;  3AYL A;  1D7Y A;  4CBQ A;  4EIQ A;  2GMH A;  2O9Z A;  3CNJ A;  2DKH A;  4EQX A;  3T2K A;  1PDH A;  3RHA A;  4J33 A;  1P2E A;  1TDF A;  5HYM A;  3ATQ A;  2YG6 A;  3FIM B;  2C73 A;  2XCG A;  3NYE A;  2IID A;  2TPR A;  3IF9 A;  3DJJ A;  1IJH A;  2BYB A;  2YLZ A;  4U8K A;  3FMW A;  3AB1 A;  2ZZC A;  2GR0 A;  1ZY8 A;  4CY6 A;  1GES A;  2QA2 A;  4OCG A;  3DK8 A;  5TR3 A;  1CJ4 A;  1DJN A;  3LB8 A;  3CMM A;  2QA1 A;  4C3X A;  5KXJ A;  4ADW A;  1PBD A;  2RGJ A;  4PAA A;  2R4E A;  2R45 A;  4UDQ A;  4H50 A;  1PJ5 A;  2JKC A;  3UOZ A;  4II3 A;  2C3C A;  4RG4 A;  1VRQ B;  2C65 A;  5FMH A;  1H82 A;  4OPD A;  4LU6 A;  3CND A;  2IVE A;  1QLB A;  4N9X A;  2FJD A;  2AR8 A;  3AD9 B;  2VVL G;  1BF3 A;  1Y56 A;  1ZDL A;  1ZOY A;  1DOC A;  1E39 A;  5KVI A;  2VZ2 A;  1W4X A;  4OVI A;  1M64 A;  5FS8 A;  1O94 A;  2GV8 A;  3HYW A;  1BZL A;  4IVO B;  3L1R A;  3SFD A;  3EF6 A;  3JSK A;  3DK4 A;  4YTN A;  1Q1W A;  3CNT A;  4Y4M A;  3NK2 X;  4E0V A;  1E1L A;  4K5S A;  5GSN A;  1IUS A;  1OJC A;  3ITJ A;  4G73 A;  1JNZ A;  2B7S A;  5KMQ A;  1EL7 A;  3GYJ A;  4AOS A;  2OLO A;  4EM4 A;  3VRD B;  4NEW A;  4Y4N A;  4C74 A;  2JBV A;  2E5V A;  2WPE A;  3UKH A;  1RSG A;  1NG4 A;  1N4V A;  3NRN A;  4H4Q A;  4U8P A;  2GAH B;  3VRA A;  3VR8 A;  2CVJ A;  4B67 A;  2BC0 A;  5KRQ A;  1GRH A;  2EQ8 A;  1F3P A;  4A99 A;  5FS9 A;  2R4J A;  2XLT A;  3O0H A;  4X4J A;  3RP6 A;  3NH3 X;  2RGH A;  4C77 A;  3ADA B;  3AYJ A;  3SZC A;  5JCI A;  1DXL A;  1PJ6 A;  2C64 A;  1H86 A;  4G9K A;  1L0V A;  3PVC A;  4H4P A;  1EBD A;  5J7X A;  2C66 A;  3UP4 A;  1UKV G;  3SYI A;  3UKA A;  2VRM A;  1KF6 A;  1IUW A;  1SEZ A;  2R0P A;  1XPQ A;  1EL8 A;  4Z43 A;  1GRT A;  3QSS A;  1O5W A;  3H8L A;  3ICR A;  2Z5Y A;  3AE3 A;  3H8I A;  3I3L A;  5M10 A;  2C7G A;  4Z26 A;  4B1B A;  1NAA A;  2XYO A;  2Q0K A;  1E6E A;  1E1K A;  2VQB A;  4WX1 A;  3NIX A;  2A8X A;  3KU9 A;  4H4U A;  2R0C A;  2WP9 A;  4HB9 A;  4H4X A;  4JDR A;  4O5Q A;  1IUT A;  1B5Q A;  4CY8 A;  1LQU A;  4BJY A;  2B9Y A;  2NPX A;  2CFY A;  5FS7 A;  2XLP A;  1VG0 A;  5HXI A;  1GT8 A;  3BHK A;  3ISH A;  3NYC A;  1L9E A;  1CHU A;  1QO8 A;  4JY3 A;  4M52 A;  2IVD A;  3NKS A;  1PJ7 A;  2H88 A;  5U25 A;  4GCM A;  4BUR A;  2YR6 A;  5L46 A;  4YTM A;  4EMJ A;  2VVL A;  4U2S A;  4B66 A;  4H4V A;  3SZ0 A;  4EM3 A;  2BC1 A;  2YAU A;  2R46 A;  1OJD A;  1XDI A;  1LV0 A;  2DKI A;  4YWO A;  2X99 A;  2BCP A;  2OAL A;  3AYI A;  1XAN A;  2AAQ A;  3SQP A;  1PXC A;  3GWF A;  2WDV A;  4G6G A;  4U8L A;  3K30 A;  4U8J A;  3NLC A;  1DOB A;  2GEW A;  2YLR A;  1D7L A;  4U8M A;  5GRT A;  1AOG A;  4CRT A;  1CJC A;  1IUX A;  1Q9I A;  1FEB A;  3NN6 X;  4IV9 A;  2R9Z A;  2PHH A;  3AE2 A;  4YTP A;  1TRB A;  1Y56 B;  2YM2 A;  3ICT A;  4J34 A;  3Q9T A;  4JN9 A;  1CL0 A;  3GYI A;  3GYX A;  1NEK A;  2W0H A;  3NTA A;  2V3A A;  3QVR A;  1Q1R A;  3ALL A;  3F8D A;  4MJW A;  3COX A;  1CF3 A;  3CGC A;  5FS6 A;  3UKF A;  5M0Z A;  1S3B A;  3CGD A;  5EB4 A;  2XFQ A;  2XVH A;  1GTE A;  2X8C A;  4H2R A;  2XVE A;  1TDN A;  3SZW A;  4LA1 A;  3T37 A;  2FJA A;  3DK9 A;  4NZH A;  3SM8 A;  1M6I A;  5KMP A;  2BK3 A;  3QFA A;  4H4S A;  2YLS A;  5IQ1 A;  2C3D A;  3T14 A;  4B65 A;  3EAO A;  4YKG A;  2VVM A;  4J57 A;  4B69 A;  1JU2 A;  1ELI A;  1NG3 A;  3NK1 X;  4J2W A;  4RG3 A;  3RP7 A;  1DJQ A;  1GND A;  4ZCD A;  3UTF A;  3BI2 A;  2H89 A;  1GEU A;  2WPC A;  1YKJ A;  2B7R A;  2V6O A;  1GET A;  1B8S A;  1TDE A;  3I6D A;  4DGK A;  4U8O A;  1LVL A;  3P4P A;  4BK1 A;  4C5O A;  1ONF A;  3G5Q A;  5KVH A;  2BS3 A;  3DJG X;  3P4S A;  4YSY A;  2WEU A;  2E4G A;  4BK2 A;  5JCN A;  2GR2 A;  2Y6R A;  2B9W A;  3P4R A;  3CPI G;  4J36 A;  5EB5 A;  1P2H A;  4H2N A;  2QCU A;  4UDR A;  2WBA A;  3CNP A;  3NN0 X;  1ZMD A;  3SXI A;  2RGO A;  4P9S A;  3C96 A;  2J3N A;  1JRY A;  3T31 A;  1B37 A;  4EMW A;  2GH5 A;  1CBO A;  2BK4 A;  2X50 A;  3UP5 A;  3NTD A;  2WET A;  1S2Q A;  4NWZ A;  3T0K A;  4YXD A;  3KD9 A;  4J56 A;  3AD8 B;  3AEE A;  1MO9 A;  1F6M A;  2XVJ A;  5BUK A;  2YLT A;  2WU5 A;  1PBC A;  1K4Q A;  2V3B A;  3OZ2 A;  1RP0 A;  2XFN A;  1ZOV A;  4A79 A;  4IA6 A;  1LTX R;  1YQ4 A;  2GAG B;  3AD7 B;  2C67 A;  4USR A;  2AQJ A;  1BWC A;  3B6D A;  1ZK7 A;  1GRB A;  3AE1 A;  1GV4 A;  1S3E A;  4REK A;  2A89 A;  4IVM B;  3UTG A;  1EL5 A;  3LAD A;  3SFE A;  1GTH A;  2JB1 A;  3LJP A;  2VOU A;  2GR1 A;  3GMB A;  3Q6J A;  5KNL A;  3UKK A;  3CPJ G;  4JNA A;  4EIP A;  4WCT A;  1TYT A;  1PBE A;  4Z2R A;  2E1M A;  2WP6 A;  3LOV A;  1E1M A;  2B76 A;  4A6N B;  3DJE A;  1D4C A;  5KMR A;  2WOW A;  4Z24 A;  2BS4 A;  3AE7 A;  2YVG A;  1H83 A;  2WDQ A;  1MOK A;  4OPL A;  2JAE A;  4B68 A;  2WOV A;  4U2L A;  2XFU A;  2WES A;  4Z25 A;  3FG2 P;  3DGZ A;  2XVF A;  1PN0 A;  1YY5 A;  4XXG A;  1NDA A;  3NHO X;  4HA6 A;  3PO7 A;  2YM1 A;  2XLS A;  4K8D A;  4DNA A;  2WQY A;  1L9C A;  3ICS A;  1NPX A;  2GRT A;  3M0O A;  4H4T A;  1LQT A;  2BCG G;  2XVI A;  3AE5 A;  3SGL A;  5LV9 A;  3S61 A;  5IPY A;  2GB0 A;  1GSN A;  3QVP A;  4JNQ A;  4X9N A;  4YKF A;  3AEC A;  3C4A A;  2EQ9 A;  2OAM A;  2WP5 A;  1N4W A;  4APN A;  5C3J A;  2EQ6 A;  4GDE A;  5EOW A;  4TM4 A;  4GDP A;  4K2X A;  2Y6Q A;  2I0Z A;  4X9M A;  4A65 A;  1OJA A;  4EMI A;  2BAC A;  1TDO A;  2APG A;  5KWF A;  3LZW A;  4FK1 C;  4U2T A;  4EQR A;  3KKJ A;  1FOH A;  3GRT A;  1H6V A;  3UKP A;  1VQW A;  1X31 B;  1BKW A;  3VR9 A;  4H2P A;  4C3Y A;  4A6N A;  3CGE A;  5U63 A;  4TLZ A;  1PHH A;  4XWR A;  3GDN A;  1CC4 A;  3T2Y A;  4ZN0 A;  1RYI A;  2BXR A;  3DH9 A;  3G5R A;  4G6H A;  2JK6 A;  2Q6U A;  2WS3 A;  3BI5 A;  3BI4 A;  3VQR A;  2R0G A;  1BGN A;  2NVK X;  1KNR A;  2XLU A;  1JEH A;  2CDU A;  2CUL A;  3CN8 A;  1H81 A;  4Z2U A;  3KA7 A;  3ATR A;  1H84 A;  3AXB A;  3P1W A;  5KOX A;  5DBJ A;  2C76 A;  4H4R A;  1COY A;  2PYX A;  4H4Z A;  3ZDN A;  2FBW A;  1DNC A;  2JB2 A;  4KX6 A;  4H2Q A;  1CJ2 A;  2YG4 A;  3ABV A;  3BHF A;  3UKL A;  3ALM A;  1GRG A;  2ZBW A;  2WPF A;  3RED A;  1N4U A;  2QAE A;  3K7Q X;  4TM3 A;  3QJ4 A;  1PS9 A;  4A5L A;  3AWI A;  3GD4 A;  4K7Z A;  5CQF A;  2C75 A;  1E7P A;  3IC9 A;  3P9U A;  1JRX A;  1LJ1 A;  1XHC A;  2OLN A;  1IUU A;  1FCD A;  2ZZ0 A;  3HYV A;  3SY4 A;  3AED A;  3EPT A;  2WDR A;  2JB3 A;  1Z6L A;  4ICY A;  4D03 A;  2X8H A;  2BK5 A;  3UOX A;  1KFY A; 
#chains in the Genus database with same CATH homology
 2YWL A;  3SX6 A;  5ER0 A;  1O95 A;  2ACZ A;  1H7W A;  2YG7 A;  4O5U A;  2YVJ A;  2XDO A;  1D4D A;  1IUV A;  1E1N A;  3C4N A;  5HHF A;  4YSZ A;  2YLW A;  4FDC B;  3FBS A;  1Y0P A;  4TM1 A;  1F8W A;  3L8K A;  2BAB A;  1DOD A;  4RSL A;  2HQM A;  1L9D A;  3IHG A;  4AT2 A;  2B9X A;  1QJD A;  3UOY A;  1NHR A;  3D1C A;  2V61 A;  2FJB A;  4CNJ A;  3KPF A;  1B4V A;  1LPF A;  1GOS A;  1S2Y A;  3B3R A;  1ZMC A;  2C4C A;  3CNS A;  2C70 A;  1ZX9 A;  4JY2 A;  4IA5 A;  4UDP A;  5KOW A;  1NEN A;  2WOI A;  1H7X A;  4K5R A;  2F5Z A;  3GSI A;  3F8R A;  4ECH A;  2C72 A;  2OA1 A;  3DGH A;  4BK3 A;  4USQ A;  2Z5X A;  3E1T A;  3PS9 A;  3QSE A;  4BJZ A;  1CJ3 A;  3CGB A;  4J31 A;  3GD3 A;  2BXS A;  1PXB A;  3AEB A;  2EQ7 A;  2WHD A;  3AE6 A;  4I59 A;  1NHQ A;  3HZL A;  1N1P A;  4B63 A;  2BS2 A;  4CCQ A;  1GRE A;  1K0I A;  1YQZ A;  4GR1 A;  3BNM A;  4CCR A;  4EQS A;  4AP3 A;  3AE8 A;  1F8R A;  2TMD A;  3V76 A;  4PAB A;  1JRZ A;  1OJ9 A;  3NNE A;  1BGJ A;  3UOV A;  2WU2 A;  5CKU A;  4OPU A;  2BA9 A;  3UTE A;  1GRA A;  3V3N A;  4A7A A;  1K0J A;  3G5S A;  1F8S A;  2XFP A;  4Z2T A;  3F8P A;  2VRL A;  3RP8 A;  4B64 A;  1GXF A;  1K0L A;  3NK0 X;  1VDC A;  3II4 A;  3CTY A;  3AE4 A;  3IWA A;  4YSX A;  3LZX A;  1GRF A;  3ALJ A;  4GAP A;  1TYP A;  3SZF A;  3DJD A;  4NNJ A;  3GRS A;  3H4K A;  4AT0 A;  1D5T A;  1NHP A;  1HYU A;  1KSS A;  4I58 A;  4H4Y A;  4TM0 A;  3AEA A;  5JCM A;  5U1O A;  3KLJ A;  2Q0L A;  2YLX A;  3IHM A;  5J60 A;  3D8X A;  2YR4 A;  3M13 A;  3BNU A;  2X8G A;  3QFB A;  4GRT A;  3WE0 A;  4NTC A;  1JNR A;  4A9W A;  1EL9 A;  1FEC A;  2GF3 A;  1D4E A;  3K7T A;  3K7M X;  1PBB A;  1ZKQ A;  4NEV A;  1GPE A;  3NG7 X;  4CNK A;  4NTE A;  3AE9 A;  1YQ3 A;  3P4Q A;  4G74 A;  1DOE A;  5KMS A;  3VRB A;  3UKQ A;  4LII A;  4JQ9 A;  3KVE A;  2Q7V A;  3AEF A;  3EAN A;  4BV6 A;  3NT6 A;  4U8N A;  2YR5 A;  3LXD A;  4GAV A;  4ZCC A;  3CIR A;  3DA1 A;  2ARD A;  3GWD A;  2RAB A;  4XWZ A;  1TDK A;  4KPR A;  4Y4L A;  2V5Z A;  3ZYX A;  3DME A;  4H4W A;  2XFO A;  4OPG A;  1FL2 A;  3CPH G;  2YQU A;  2UZZ A;  5BUL A;  3GMC A;  1CC2 A;  3M12 A;  4U8I A;  2ZZB A;  4NTD A;  1PBF A;  3NGC X;  1FEA A;  1KSU A;  1OJT A;  2BRA A;  5HY5 A;  3GDP A;  3URH A;  3AEG A;  3HYX A;  1KDG A;  2XLR A;  4TLX A;  4Z44 A;  2VQ7 A;  1ZP0 A;  4DSH A;  4AP1 A;  1REO A;  3FPZ A;  3KPK A;  4YSH A;  1GER A;  3UCL A;  1KNP A;  5JCL A;  1JOA A;  3S5W A;  5C2T A;  4FK1 A;  5BVA A;  2YG3 A;  1CC6 A;  1V59 A;  4YT0 A;  3QSM A;  4UP3 A;  4H7U A;  4II2 A;  1NHS A;  4FX9 A;  4EQW A;  3OC4 A;  4D04 A;  4K22 A;  4OPT A;  5JCK A;  2A87 A;  2GQW A;  2BRY A;  3T2Z A;  4DSG A;  4AOX A;  4OPC A;  5BRT A;  4OPI A;  2GQF A;  3NYF A;  2YVF A;  1VG9 A;  5EBK A;  3V3O A;  2YG5 A;  2X3N A;  3UTH A;  2GR3 A;  1GAL A;  2V60 A;  2FJE A;  1MXT A;  2GVC A;  4GUV A;  3R9U A;  1PXA A;  4GF7 A;  3RNM A;  5IQ4 A;  2GMJ A;  3AYL A;  1D7Y A;  4CBQ A;  4EIQ A;  2GMH A;  2O9Z A;  3CNJ A;  2DKH A;  4EQX A;  3T2K A;  1PDH A;  3RHA A;  4J33 A;  1P2E A;  1TDF A;  5HYM A;  3ATQ A;  2YG6 A;  3FIM B;  2C73 A;  2XCG A;  3NYE A;  2IID A;  2TPR A;  3IF9 A;  3DJJ A;  1IJH A;  2BYB A;  2YLZ A;  4U8K A;  3FMW A;  3AB1 A;  2ZZC A;  2GR0 A;  1ZY8 A;  4CY6 A;  1GES A;  2QA2 A;  4OCG A;  3DK8 A;  5TR3 A;  1CJ4 A;  1DJN A;  3LB8 A;  3CMM A;  2QA1 A;  4C3X A;  5KXJ A;  4ADW A;  1PBD A;  2RGJ A;  4PAA A;  2R4E A;  2R45 A;  4UDQ A;  4H50 A;  1PJ5 A;  2JKC A;  3UOZ A;  4II3 A;  2C3C A;  4RG4 A;  1VRQ B;  2C65 A;  5FMH A;  1H82 A;  4OPD A;  4LU6 A;  3CND A;  2IVE A;  1QLB A;  4N9X A;  2FJD A;  2AR8 A;  3AD9 B;  2VVL G;  1BF3 A;  1Y56 A;  1ZDL A;  1ZOY A;  1DOC A;  1E39 A;  5KVI A;  2VZ2 A;  1W4X A;  4OVI A;  1M64 A;  5FS8 A;  1O94 A;  2GV8 A;  3HYW A;  1BZL A;  4IVO B;  3L1R A;  3SFD A;  3EF6 A;  3JSK A;  3DK4 A;  4YTN A;  1Q1W A;  3CNT A;  4Y4M A;  3NK2 X;  4E0V A;  1E1L A;  4K5S A;  5GSN A;  1IUS A;  1OJC A;  3ITJ A;  4G73 A;  1JNZ A;  2B7S A;  5KMQ A;  1EL7 A;  3GYJ A;  4AOS A;  2OLO A;  4EM4 A;  3VRD B;  4NEW A;  4Y4N A;  4C74 A;  2JBV A;  2E5V A;  2WPE A;  3UKH A;  1RSG A;  1NG4 A;  1N4V A;  3NRN A;  4H4Q A;  4U8P A;  2GAH B;  3VRA A;  3VR8 A;  2CVJ A;  4B67 A;  2BC0 A;  5KRQ A;  1GRH A;  2EQ8 A;  1F3P A;  4A99 A;  5FS9 A;  2R4J A;  2XLT A;  3O0H A;  4X4J A;  3RP6 A;  3NH3 X;  2RGH A;  4C77 A;  3ADA B;  3AYJ A;  3SZC A;  5JCI A;  1DXL A;  1PJ6 A;  2C64 A;  1H86 A;  4G9K A;  1L0V A;  3PVC A;  4H4P A;  1EBD A;  5J7X A;  2C66 A;  3UP4 A;  1UKV G;  3SYI A;  3UKA A;  2VRM A;  1KF6 A;  1IUW A;  1SEZ A;  2R0P A;  1XPQ A;  1EL8 A;  4Z43 A;  1GRT A;  3QSS A;  1O5W A;  3H8L A;  3ICR A;  2Z5Y A;  3AE3 A;  3H8I A;  3I3L A;  5M10 A;  2C7G A;  4Z26 A;  4B1B A;  1NAA A;  2XYO A;  2Q0K A;  1E6E A;  1E1K A;  2VQB A;  4WX1 A;  3NIX A;  2A8X A;  3KU9 A;  4H4U A;  2R0C A;  2WP9 A;  4HB9 A;  4H4X A;  4JDR A;  4O5Q A;  1IUT A;  1B5Q A;  4CY8 A;  1LQU A;  4BJY A;  2B9Y A;  2NPX A;  2CFY A;  5FS7 A;  2XLP A;  1VG0 A;  5HXI A;  1GT8 A;  3BHK A;  3ISH A;  3NYC A;  1L9E A;  1CHU A;  1QO8 A;  4JY3 A;  4M52 A;  2IVD A;  3NKS A;  1PJ7 A;  2H88 A;  5U25 A;  4GCM A;  4BUR A;  2YR6 A;  5L46 A;  4YTM A;  4EMJ A;  2VVL A;  4U2S A;  4B66 A;  4H4V A;  3SZ0 A;  4EM3 A;  2BC1 A;  2YAU A;  2R46 A;  1OJD A;  1XDI A;  1LV0 A;  2DKI A;  4YWO A;  2X99 A;  2BCP A;  2OAL A;  3AYI A;  1XAN A;  2AAQ A;  3SQP A;  1PXC A;  3GWF A;  2WDV A;  4G6G A;  4U8L A;  3K30 A;  4U8J A;  3NLC A;  1DOB A;  2GEW A;  2YLR A;  1D7L A;  4U8M A;  5GRT A;  1AOG A;  4CRT A;  1CJC A;  1IUX A;  1Q9I A;  1FEB A;  3NN6 X;  4IV9 A;  2R9Z A;  2PHH A;  3AE2 A;  4YTP A;  1TRB A;  1Y56 B;  2YM2 A;  3ICT A;  4J34 A;  3Q9T A;  4JN9 A;  1CL0 A;  3GYI A;  3GYX A;  1NEK A;  2W0H A;  3NTA A;  2V3A A;  3QVR A;  1Q1R A;  3ALL A;  3F8D A;  4MJW A;  3COX A;  1CF3 A;  3CGC A;  5FS6 A;  3UKF A;  5M0Z A;  1S3B A;  3CGD A;  5EB4 A;  2XFQ A;  2XVH A;  1GTE A;  2X8C A;  4H2R A;  2XVE A;  1TDN A;  3SZW A;  4LA1 A;  3T37 A;  2FJA A;  3DK9 A;  4NZH A;  3SM8 A;  1M6I A;  5KMP A;  2BK3 A;  3QFA A;  4H4S A;  2YLS A;  5IQ1 A;  2C3D A;  3T14 A;  4B65 A;  3EAO A;  4YKG A;  2VVM A;  4J57 A;  4B69 A;  1JU2 A;  1ELI A;  1NG3 A;  3NK1 X;  4J2W A;  4RG3 A;  3RP7 A;  1DJQ A;  1GND A;  4ZCD A;  3UTF A;  3BI2 A;  2H89 A;  1GEU A;  2WPC A;  1YKJ A;  2B7R A;  2V6O A;  1GET A;  1B8S A;  1TDE A;  3I6D A;  4DGK A;  4U8O A;  1LVL A;  3P4P A;  4BK1 A;  4C5O A;  1ONF A;  3G5Q A;  5KVH A;  2BS3 A;  3DJG X;  3P4S A;  4YSY A;  2WEU A;  2E4G A;  4BK2 A;  5JCN A;  2GR2 A;  2Y6R A;  2B9W A;  3P4R A;  3CPI G;  4J36 A;  5EB5 A;  1P2H A;  4H2N A;  2QCU A;  4UDR A;  2WBA A;  3CNP A;  3NN0 X;  1ZMD A;  3SXI A;  2RGO A;  4P9S A;  3C96 A;  2J3N A;  1JRY A;  3T31 A;  1B37 A;  4EMW A;  2GH5 A;  1CBO A;  2BK4 A;  2X50 A;  3UP5 A;  3NTD A;  2WET A;  1S2Q A;  4NWZ A;  3T0K A;  4YXD A;  3KD9 A;  4J56 A;  3AD8 B;  3AEE A;  1MO9 A;  1F6M A;  2XVJ A;  5BUK A;  2YLT A;  2WU5 A;  1PBC A;  1K4Q A;  2V3B A;  3OZ2 A;  1RP0 A;  2XFN A;  1ZOV A;  4A79 A;  4IA6 A;  1LTX R;  1YQ4 A;  2GAG B;  3AD7 B;  2C67 A;  4USR A;  2AQJ A;  1BWC A;  3B6D A;  1ZK7 A;  1GRB A;  3AE1 A;  1GV4 A;  1S3E A;  4REK A;  2A89 A;  4IVM B;  3UTG A;  1EL5 A;  3LAD A;  3SFE A;  1GTH A;  2JB1 A;  3LJP A;  2VOU A;  2GR1 A;  3GMB A;  3Q6J A;  5KNL A;  3UKK A;  3CPJ G;  4JNA A;  4EIP A;  4WCT A;  1TYT A;  1PBE A;  4Z2R A;  2E1M A;  2WP6 A;  3LOV A;  1E1M A;  2B76 A;  4A6N B;  3DJE A;  1D4C A;  5KMR A;  2WOW A;  4Z24 A;  2BS4 A;  3AE7 A;  2YVG A;  1H83 A;  2WDQ A;  1MOK A;  4OPL A;  2JAE A;  4B68 A;  2WOV A;  4U2L A;  2XFU A;  2WES A;  4Z25 A;  3FG2 P;  3DGZ A;  2XVF A;  1PN0 A;  1YY5 A;  4XXG A;  1NDA A;  3NHO X;  4HA6 A;  3PO7 A;  2YM1 A;  2XLS A;  4K8D A;  4DNA A;  2WQY A;  1L9C A;  3ICS A;  1NPX A;  2GRT A;  3M0O A;  4H4T A;  1LQT A;  2BCG G;  2XVI A;  3AE5 A;  3SGL A;  5LV9 A;  3S61 A;  5IPY A;  2GB0 A;  1GSN A;  3QVP A;  4JNQ A;  4X9N A;  4YKF A;  3AEC A;  3C4A A;  2EQ9 A;  2OAM A;  2WP5 A;  1N4W A;  4APN A;  5C3J A;  2EQ6 A;  4GDE A;  5EOW A;  4TM4 A;  4GDP A;  4K2X A;  2Y6Q A;  2I0Z A;  4X9M A;  4A65 A;  1OJA A;  4EMI A;  2BAC A;  1TDO A;  2APG A;  5KWF A;  3LZW A;  4FK1 C;  4U2T A;  4EQR A;  3KKJ A;  1FOH A;  3GRT A;  1H6V A;  3UKP A;  1VQW A;  1X31 B;  1BKW A;  3VR9 A;  4H2P A;  4C3Y A;  4A6N A;  3CGE A;  5U63 A;  4TLZ A;  1PHH A;  4XWR A;  3GDN A;  1CC4 A;  3T2Y A;  4ZN0 A;  1RYI A;  2BXR A;  3DH9 A;  3G5R A;  4G6H A;  2JK6 A;  2Q6U A;  2WS3 A;  3BI5 A;  3BI4 A;  3VQR A;  2R0G A;  1BGN A;  2NVK X;  1KNR A;  2XLU A;  1JEH A;  2CDU A;  2CUL A;  3CN8 A;  1H81 A;  4Z2U A;  3KA7 A;  3ATR A;  1H84 A;  3AXB A;  3P1W A;  5KOX A;  5DBJ A;  2C76 A;  4H4R A;  1COY A;  2PYX A;  4H4Z A;  3ZDN A;  2FBW A;  1DNC A;  2JB2 A;  4KX6 A;  4H2Q A;  1CJ2 A;  2YG4 A;  3ABV A;  3BHF A;  3UKL A;  3ALM A;  1GRG A;  2ZBW A;  2WPF A;  3RED A;  1N4U A;  2QAE A;  3K7Q X;  4TM3 A;  3QJ4 A;  1PS9 A;  4A5L A;  3AWI A;  3GD4 A;  4K7Z A;  5CQF A;  2C75 A;  1E7P A;  3IC9 A;  3P9U A;  1JRX A;  1LJ1 A;  1XHC A;  2OLN A;  1IUU A;  1FCD A;  2ZZ0 A;  3HYV A;  3SY4 A;  3AED A;  3EPT A;  2WDR A;  2JB3 A;  1Z6L A;  4ICY A;  4D03 A;  2X8H A;  2BK5 A;  3UOX A;  1KFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...