3OZ2A

Crystal structure of a geranylgeranyl bacteriochlorophyll reductase-like (ta0516) from thermoplasma acidophilum at 1.60 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
397
structure length
397
Chain Sequence
GMETYDVLVVGGGPGGSTAARYAAKYGLKTLMIEKRPEIGSPVRCGEGLSKGILNEADIKADRSFIANEVKGARIYGPSEKRPIILQSEKAGNEVGYVLERDKFDKHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKMVIAADGFESEFGRWAGLKSVILARNDIISALQYRMINVDVDPDYTDFYLGSIAPAGYIWVFPKGEGMANVGIGSSINWIHNRFELKNYLDRFIENHPGLKKGQDIQLVTGGVSVSKVKMPITMPGLMLVGDAARLIDPITGGGIANAIVSGMYAAQVTKEAIESNDYSPQMMQKYEKLIKERFERKHLRNWVAKEKLAMLSDDTLDKLVDIVSEQVLTTISVEAILKAIAEKYPEVVKELEDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein, oxidoreductase
molecule keywords Digeranylgeranylglycerophospholipid reductase
publication title Insights into substrate specificity of geranylgeranyl reductases revealed by the structure of digeranylgeranylglycerophospholipid reductase, an essential enzyme in the biosynthesis of archaeal membrane lipids.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 124
structure length 397
sequence length 397
ec nomenclature ec 1.3.1.101: 2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase (NAD(P)H).
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3oz2A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oz2A01
3UTHA 3P1WA 1LJ1A 1ZX9A 2BC1A 4H4PA 4ECHA 5IPYA 1ELIA 3GRSA 4BK3A 2H88A 5KVHA 1JNRA 2YR4A 4BJZA 3ICSA 1VG9A 4JNQA 2J3NA 1N4UA 4H4RA 2BABA 1PBEA 3C4NA 3BNUA 1GOSA 2BXSA 4CNJA 3GYIA 1K0JA 1GT8A 4USRA 1Q9IA 2FJAA 1E7PA 2GMHA 2GR1A 1BGJA 4TM1A 4CCQA 4RG4A 3DK8A 2YR6A 3NH3X 4EQWA 1FOHA 3EF6A 1CHUA 3UKHA 1YQ4A 1COYA 2GMJA 3ICRA 1L0VA 3M0OA 3RP8A 4H2QA 1NEKA 5JCKA 4JDRA 2B7SA 4A7AA 2VRMA 2C75A 4JN9A 1L9EA 3S5WA 1BGNA 1BF3A 1H81A 4C3YA 3GDNA 2APGA 2OLOA 1KNRA 1JRXA 3IC9A 4OPCA 1S2YA 1F3PA 3D8XA 1HYUA 4GF7A 2YLZA 4H4WA 4Y4MA 2GAHB 3VRBA 2ZZ0A 2C67A 5FMHA 1GRHA 1KDGA 2R0GA 3NRNA 2XDOA 1ZOVA 1ZDLA 3NHOX 3ALMA 3H8LA 1SEZA 2Y6QA 3NN0X 2XVHA 2YG7A 1GRGA 3JSKA 1BWCA 1QLBA 2A89A 4CBQA 1DOCA 4AP3A 5GSNA 2BK4A 1PJ5A 3G5SA 1YQZA 3ZYXA 2XLRA 3UKLA 4TM4A 3EAOA 3DMEA 3R9UA 5LV9A 1PDHA 1OJCA 2WOVA 2GR0A 3AE9A 2TPRA 1CC6A 1GRBA 1GREA 3AE2A 5BVAA 1IUTA 4OCGA 3AE5A 1PJ6A 3F8RA 3C96A 1UKVG 3VRAA 4EQRA 1OJDA 1QJDA 5ER0A 2YLTA 1OJ9A 2R45A 1YQ3A 2WETA 4K8DA 1PBBA 2BS3A 2E1MA 4MJWA 1NDAA 4J34A 4LIIA 2GR3A 4A5LA 3CNTA 2EQ8A 2TMDA 2YLRA 1TDEA 3BHKA 4C77A 1M64A 1GTHA 3AEDA 2IIDA 3VR8A 2XLSA 1XHCA 2YG5A 1AN9A 4H7UA 5HHFA 4NTEA 3UP5A 2YVFA 2RABA 2WP6A 4UP3A 1S2QA 3K7MX 3AEFA 1LQUA 3NK2X 1ZMCA 2C64A 2UZZA 3G3EA 2IVEA 2VZ2A 4DSHA 3M12A 3AYJA 3OC4A 2R4EA 2WP9A 3GD4A 3NLCA 4JY3A 1EL5A 4H50A 3KLJA 4X9MA 1NG4A 2VQBA 2VRLA 4FDCB 2BA9A 1TDKA 4YJGB 1GRTA 3AXBA 2QA2A 5KWFA 2YG3A 3CNJA 3WE0A 2V3AA 4YWOA 3II4A 4YJHB 1X31B 3AB1A 3REDA 4B66A 3G5QA 2H89A 4YJHA 1E1MA 3UP4A 4D04A 5HYMA 3V3NA 2RGOA 4EQSA 1IUWA 2Z5YA 2FBWA 2Y6RA 1KIFA 2WBAA 1DXLA 4U8OA 2WPEA 3M13A 1ZK7A 4OPIA 2XFQA 4CCRA 4ZCDA 3UOYA 3KU9A 1L9CA 4O5QA 5BULA 4UDQA 4J36A 3FBSA 4UDRA 1PBFA 2A8XA 3L1RA 3T37A 3GMCA 4UDPA 5FS6A 1FEBA 4B68A 3GYJA 3NN6X 3UOXA 2XVJA 4U2SA 2YG6A 3UTFA 2NPXA 1FL2A 4U8IA 3VQRA 1PBCA 2XVIA 2YM2A 1ZY8A 2C3CA 1DODA 3FMWA 4NTDA 4YSYA 5KRQA 4I58A 4H2NA 5JCMA 2V60A 5FS9A 3LADA 1DJNA 2PHHA 4TM3A 1K0LA 4NEWA 1S3BA 4REKA 1DOEA 4GCMA 1D7LA 3UKAA 1Q1WA 2OA1A 1H86A 3V76A 2BS2A 1YKJA 4Z26A 3URHA 1DOBA 3UKKA 2FJBA 3CPIG 2EQ7A 2WEUA 3F8DA 4GR1A 4ZCCA 5TR3A 4HA6A 1VG0A 4I59A 4C74A 4Z25A 3P4PA 4ICYA 3ADAB 1CJ2A 4KX6A 2C7GA 2BCGG 3NYCA 1KSUA 3AYIA 4A9WA 1IUUA 3NYFA 1F6MA 1TYPA 4JNAA 4YTMA 4IVOB 1PJ7A 2VVLG 3AEGA 3FG2P 3QSMA 1H83A 1LV0A 1D7YA 3BNMA 4KPRA 4LA1A 2C3DA 1C0LA 4YSHA 3AE6A 4AP1A 4B1BA 1RYIA 2A87A 3PS9A 3UKPA 4JY2A 1CBOA 1F8SA 4J56A 1EL8A 3PVCA 2WDQA 4FK1A 5U63A 2XFOA 3UTGA 5EOWA 1GESA 2NVKX 2GV8A 4IA6A 1JRZA 1RP0A 5HY5A 2YLWA 4YTPA 3AD7B 3NK1X 3AD9B 4P9SA 2B7RA 4OPGA 4Z2TA 1TRBA 2ZBWA 3KKJA 4J31A 1KF6A 5J7XA 5CQFA 3RP6A 3ZNPA 1KNPA 2OAMA 3I3LA 1XPQA 3F8PA 3RNMA 2JAEA 2R0CA 3GSIA 1H7WA 2GR2A 2C73A 3WGTA 2BC0A 3ZNNA 3LJPA 1NHRA 2C70A 1VE9A 2XFPA 1PS9A 3GWDA 2HQMA 2F5ZA 3ICTA 3ABVA 1Q1RA 4E0VA 2V5ZA 3K7TA 3PO7A 2AR8A 2Q0LA 1GERA 5GRTA 1B8SA 3COXA 1QO8A 4OVIA 1B4VA 4YJDA 2YM1A 4LU6A 3BI2A 1C0PA 2YWLA 3GDPA 1NPXA 4WCTA 2YQUA 4Y4LA 4H4ZA 4N9XA 5HXIA 1VDCA 1CJ3A 3SGLA 2AAQA 1FEAA 4A79A 5CKUA 4Y4NA 2E5VA 2V3BA 1K0IA 3RHAA 1H82A 2CDUA 2WU2A 1OJAA 2R4JA 1XDIA 2X8GA 4CNKA 3CGEA 2GAGB 1Z6LA 4AT0A 3W4KA 1PXBA 1REOA 3DGHA 4Z43A 3NT6A 4APNA 2VVLA 4Z44A 1OJTA 2XLPA 4YJFB 5DBJA 3UTEA 4IVMB 2VOUA 4USQA 4GUVA 1AOGA 2WP5A 4YJFA 1V59A 3SQPA 4BV6A 1VQWA 2E48A 4AOSA 3QSSA 3ZNQA 4TLZA 3UKQA 1CC4A 1E1LA 4K5SA 5KXJA 3LZXA 4K7ZA 3S61A 4TM0A 4XWZA 4EIPA 4U8PA 2GVCA 3AE3A 1CJCA 4H4YA 4OPTA 5M0ZA 3SFEA 4BK2A 2E49A 4YJGA 1E6EA 3NNEA 2Q7VA 4NEVA 3Q6JA 2Z5XA 4X4JA 4B64A 3UCLA 1S3EA 2DKIA 2WQYA 4RSLA 2X50A 4FK1C 1GRAA 1W4XA 1D5TA 1FECA 4U8JA 4B65A 3K30A 4Z2UA 1K4QA 3ALJA 3DK9A 2X3NA 3AE4A 2CULA 2WOWA 1O5WA 3VR9A 2OLNA 3SM8A 2EQ6A 2JB3A 2JK6A 5KVIA 3CPHG 1PN0A 2VQ7A 2WHDA 1LTXR 1GETA 4U8LA 3GRTA 3ZDNA 3DA1A 3NTDA 1NHQA 4H2RA 2GRTA 1NHPA 1L9DA 2RGHA 3CUKA 2JBVA 2X99A 3RP7A 1ZKQA 4D03A 4YXDA 5M10A 2WOIA 1TDOA 2ACZA 3CNSA 1MOKA 2Q0KA 2WDVA 3AE7A 3P9UA 5FS7A 4A6NB 1YY5A 4DSGA 1NENA 5KOWA 2YLSA 1ZP0A 4CY8A 4A6NA 1GSNA 3DJGX 5C3JA 3KA7A 1GPEA 3CNDA 1N4WA 1TYTA 2GQWA 1DJQA 4FX9A 2CFYA 2WESA 2B9XA 2V6OA 1GNDA 1LPFA 4PABA 2QCUA 1E1NA 3AECA 1PXCA 2ARDA 4Z24A 1Y56B 1XANA 4X9NA 3BI4A 1C0KA 3IF9A 1Y56A 2BXRA 1TDFA 2WPCA 3DGZA 4H2PA 2IVDA 1GRFA 2JB2A 4B69A 4EMWA 2GQFA 1D4EA 2BYBA 2GF3A 3LOVA 4GDPA 3CGBA 1FCDA 3AD8B 1Y0PA 5L46A 2FJDA 1PXAA 1D4DA 3CIRA 1DDOA 4BK1A 5JCLA 2E82A 2AQJA 1DAOA 4EMIA 2WPFA 3AEEA 1ZOYA 1NG3A 1F8RA 2O9ZA 1JU2A 3CGDA 2C66A 4GRTA 3NYEA 3ISHA 4U2LA 4K5RA 2R9ZA 4OPUA 1BKWA 1F8WA 2XYOA 4IA5A 5U1OA 3KPFA 3UOVA 1B37A 5EB5A 3CPJG 3OZ2A 4H4XA 2GB0A 5KOXA 2XVFA 4EM3A 4C3XA 4J33A 3LB8A 2YLXA 1CF3A 4B67A 4YT0A 2BK5A 1M6IA 1JOAA 4BURA 4YSXA 3AEBA 3IWAA 2BK3A 1GV4A 3IHMA 4GDEA 4H4VA 5EB4A 4J57A 3CN8A 2R46A 4RG3A 3H8IA 2GEWA 3GD3A 3GWFA 4A65A 2YG4A 4H4SA 1P2HA 2XFNA 3ATQA 2V61A 5J60A 1CL0A 2OALA 2XCGA 4K2XA 3W4JA 4OPDA 2RGJA 1DNCA 3P4RA 3VRDB 4AT2A 3LZWA 2WU5A 2E4AA 5IQ1A 1N1PA 3NGCX 1JRYA 3D1CA 4ZN0A 4H4UA 1H84A 2XLTA 2E4GA 4XXGA 3FIMB 3EPTA 2FJEA 1MXTA 3FPZA 3G5RA 4CRTA 3AEAA 4EMJA 4JQ9A 4EQXA 1JEHA 1P2EA 3QSEA 2YVJA 1H6VA 4PAAA 2ZZBA 4HB9A 4J2WA 4XWRA 1PHHA 1ONFA 1VRQB 4U8MA 3NKSA 4ADWA 3QFAA 3AWIA 3ATRA 3C4AA 2ZZCA 4U2TA 1GXFA 3CTYA 3NK0X 1NHSA 1IUSA 4QFCA 1C0IA 1JNZA 3DJEA 2BACA 4YKGA 3NTAA 2BS4A 1O94A 4H4TA 5BRTA 1EBDA 3CNPA 2WDRA 3BI5A 3ITJA 4U8KA 1TDNA 4YTNA 3ALLA 4A99A 4QFDA 4NZHA 1IJHA 2B76A 2DKHA 1GEUA 1N4VA 1EL7A 2C76A 2R0PA 3E1TA 3AE8A 3KVEA 3P4QA 3AE1A 2VVMA 5IQ4A 3DJDA 3K7QX 4EM4A 4IV9A 4K22A 2JKCA 5C2TA 2DU8A 3AYLA 4M52A 1LQTA 3DH9A 3ZNOA 2EQ9A 3IHGA 3QJ4A 4U8NA 4C5OA 3P4SA 1IUXA 3I6DA 1D4CA 2B9WA 3DJJA 1IUVA 4DGKA 5JCNA 1H7XA 1NAAA 3EANA 5U25A 2QA1A 4Z2RA 3DK4A 1E39A 4NTCA 1BZLA 3BHFA 2YAUA 4O5UA 4AOXA 2XVEA 1CC2A 3QFBA 4EIQA 3H4KA 5JCIA 2YR5A 1GALA 1EVIA 3UOZA 1CJ4A 1B5QA 2PYXA 3W4IA 1MO9A 3KD9A 1GTEA 4YKFA 1LVLA 1RSGA 3QVPA 3QVRA 2GH5A 3O0HA 4OPLA 2QAEA 5BUKA 3GMBA 1E1KA 3NG7X 2JB1A 2X8HA 2XLUA 3B3RA 3L8KA 3NIXA 4CY6A 1PBDA 4H4QA 2XFUA 3CGCA 5FS8A 3HZLA 2WS3A 2X8CA 4TLXA 4BJYA 2B9YA 2W0HA 2C72A 3Q9TA 2Q6UA 1EL9A 2I0ZA 2BCPA 1KSSA 3LXDA 5EBKA 4DNAA 3V3OA 4B63A 4YSZA 1ZMDA 2C65A 4WX1A 3B6DA 3SFDA 2YVGA 1O95A 3UKFA 2CVJA 1KFYA
chains in the Genus database with same CATH superfamily
3UTHA 3P1WA 1LJ1A 1ZX9A 2BC1A 4H4PA 4ECHA 5IPYA 1ELIA 4BK3A 3GRSA 3SXIA 3T2KA 2H88A 5KVHA 1JNRA 2YR4A 4BJZA 3ICSA 1VG9A 3KPKA 2J3NA 4JNQA 1N4UA 4H4RA 2BABA 1PBEA 3C4NA 3BNUA 1GOSA 2BXSA 4CNJA 3GYIA 1K0JA 1GT8A 4USRA 1Q9IA 2GMHA 1E7PA 2FJAA 2GR1A 1BGJA 4NWZA 4TM1A 4CCQA 4RG4A 3DK8A 2YR6A 3NH3X 4EQWA 1FOHA 3EF6A 1CHUA 3UKHA 1YQ4A 1COYA 2GMJA 3ICRA 1L0VA 3M0OA 3RP8A 4H2QA 1NEKA 5JCKA 4JDRA 2B7SA 4A7AA 2VRMA 2C75A 4JN9A 1L9EA 3S5WA 1BGNA 1BF3A 1H81A 4C3YA 3GDNA 2APGA 2OLOA 1KNRA 1JRXA 3IC9A 4OPCA 1S2YA 1F3PA 3D8XA 1HYUA 4GF7A 2YLZA 4H4WA 4Y4MA 2GAHB 3VRBA 2ZZ0A 2C67A 5FMHA 2R0GA 1GRHA 1KDGA 3NRNA 2XDOA 1ZOVA 1ZDLA 3NHOX 3ALMA 3H8LA 1SEZA 2Y6QA 3NN0X 4GAPA 2XVHA 3CMMA 2YG7A 1GRGA 3JSKA 1BWCA 1QLBA 2A89A 4CBQA 1DOCA 4AP3A 4G6GA 5GSNA 2BK4A 1PJ5A 3G5SA 1YQZA 3ZYXA 2XLRA 3UKLA 4TM4A 3EAOA 3DMEA 3R9UA 5LV9A 1PDHA 1OJCA 2WOVA 2GR0A 3AE9A 2TPRA 1CC6A 1GRBA 1GREA 3AE2A 5BVAA 1IUTA 4OCGA 3AE5A 1PJ6A 3F8RA 3C96A 1UKVG 4G73A 3VRAA 4EQRA 1OJDA 2BRAA 1QJDA 5ER0A 2YLTA 1OJ9A 2R45A 1YQ3A 2WETA 4K8DA 1PBBA 2BS3A 2E1MA 4MJWA 1NDAA 4J34A 4LIIA 2GR3A 4A5LA 3CNTA 2EQ8A 2TMDA 2YLRA 1TDEA 4G6HA 3BHKA 4C77A 3T2ZA 1M64A 1GTHA 3AEDA 2IIDA 3VR8A 5KMPA 2XLSA 1XHCA 2YG5A 1AN9A 4H7UA 5HHFA 4NTEA 3UP5A 2YVFA 2RABA 2WP6A 4G9KA 4UP3A 1S2QA 3K7MX 3AEFA 1LQUA 3NK2X 1ZMCA 2C64A 2UZZA 3G3EA 2IVEA 2VZ2A 4DSHA 3M12A 3AYJA 3OC4A 2R4EA 4JY3A 2WP9A 3GD4A 3NLCA 2BRYA 1EL5A 3SZFA 4H50A 3KLJA 4X9MA 1NG4A 2VQBA 2VRLA 4FDCB 2BA9A 1TDKA 4YJGB 1GRTA 3AXBA 2QA2A 5KWFA 2YG3A 3CNJA 3WE0A 2V3AA 4YWOA 3II4A 4YJHB 1X31B 3AB1A 3REDA 3V76A 4B66A 3G5QA 2H89A 4YJHA 1E1MA 3UP4A 4D04A 5HYMA 3V3NA 2RGOA 4EQSA 1IUWA 2Z5YA 3T0KA 2FBWA 2Y6RA 1KIFA 2WBAA 1DXLA 4U8OA 2WPEA 3M13A 1ZK7A 4OPIA 2XFQA 4CCRA 3HYVA 4ZCDA 3UOYA 3KU9A 5KNLA 1L9CA 4O5QA 5BULA 4UDQA 4J36A 3FBSA 4UDRA 1PBFA 2A8XA 3L1RA 3T37A 3GMCA 4UDPA 5FS6A 1FEBA 4B68A 3GYJA 3NN6X 3UOXA 2XVJA 4U2SA 2YG6A 3UTFA 2NPXA 1FL2A 4U8IA 3VQRA 1PBCA 2XVIA 2YM2A 1ZY8A 2C3CA 1DODA 3FMWA 4NTDA 4YSYA 5KRQA 4I58A 4H2NA 5JCMA 2V60A 5FS9A 3LADA 1DJNA 2PHHA 4TM3A 1K0LA 4NEWA 1S3BA 4REKA 1DOEA 4GCMA 1D7LA 3UKAA 1Q1WA 2OA1A 1H86A 3SZ0A 2BS2A 1YKJA 4Z26A 3URHA 1DOBA 3UKKA 2FJBA 3CPIG 2EQ7A 2WEUA 3F8DA 4GR1A 4ZCCA 5TR3A 4HA6A 1VG0A 4I59A 4C74A 4Z25A 3P4PA 4ICYA 3ADAB 1CJ2A 4KX6A 2C7GA 2BCGG 3NYCA 1KSUA 3AYIA 3SX6A 4A9WA 1IUUA 3NYFA 1F6MA 1TYPA 4JNAA 4YTMA 4IVOB 3T14A 1PJ7A 2VVLG 3AEGA 3FG2P 3QSMA 1H83A 1LV0A 1D7YA 3BNMA 4KPRA 4LA1A 2C3DA 1C0LA 4YSHA 3AE6A 4AP1A 4B1BA 1RYIA 2A87A 3PS9A 3UKPA 4JY2A 1CBOA 1F8SA 4J56A 1EL8A 3PVCA 2WDQA 4FK1A 5U63A 2XFOA 3UTGA 5EOWA 1GESA 2NVKX 4IA6A 2GV8A 1JRZA 1RP0A 5HY5A 2YLWA 4GAVA 4YTPA 3AD7B 3NK1X 3AD9B 4P9SA 2B7RA 4OPGA 4Z2TA 1TRBA 2ZBWA 3KKJA 4J31A 1KF6A 5J7XA 5CQFA 3RP6A 3ZNPA 1KNPA 2OAMA 3I3LA 1XPQA 3F8PA 3RNMA 2R0CA 2JAEA 3GSIA 1H7WA 2GR2A 2C73A 3WGTA 2BC0A 3ZNNA 3LJPA 1NHRA 2C70A 1VE9A 2XFPA 1PS9A 3GYXA 3GWDA 2HQMA 2F5ZA 3ICTA 3ABVA 1Q1RA 4E0VA 2V5ZA 3K7TA 3PO7A 2AR8A 2Q0LA 1GERA 5GRTA 1B8SA 3COXA 1QO8A 4OVIA 1B4VA 4YJDA 2YM1A 4LU6A 3BI2A 1C0PA 2YWLA 3GDPA 3HYXA 1NPXA 4WCTA 2YQUA 4Y4LA 4H4ZA 4N9XA 5HXIA 1VDCA 1CJ3A 3SGLA 2AAQA 1FEAA 4A79A 5CKUA 4Y4NA 2E5VA 2V3BA 1K0IA 3RHAA 1H82A 2CDUA 2WU2A 1OJAA 2R4JA 1XDIA 2X8GA 4CNKA 3CGEA 2GAGB 1Z6LA 4AT0A 3W4KA 1PXBA 1REOA 3DGHA 4Z43A 3NT6A 4APNA 2VVLA 4Z44A 1OJTA 2XLPA 4YJFB 5DBJA 3UTEA 4IVMB 3HYWA 2VOUA 4USQA 4GUVA 1AOGA 2WP5A 4YJFA 1V59A 3SQPA 4BV6A 1VQWA 2E48A 4AOSA 3QSSA 3ZNQA 4TLZA 3UKQA 1CC4A 1E1LA 4K5SA 5KXJA 3LZXA 4K7ZA 3S61A 4TM0A 4XWZA 4EIPA 4U8PA 2GVCA 3AE3A 1CJCA 4H4YA 4OPTA 5M0ZA 4BK2A 3SFEA 2E49A 4YJGA 1E6EA 3NNEA 2Q7VA 4NEVA 3SZWA 3Q6JA 2Z5XA 4X4JA 4B64A 3UCLA 1S3EA 2DKIA 2WQYA 4RSLA 2X50A 4FK1C 5KMQA 1GRAA 1W4XA 1D5TA 1FECA 4U8JA 4B65A 3K30A 4Z2UA 3ALJA 1K4QA 3DK9A 2X3NA 3AE4A 2CULA 2WOWA 1O5WA 3VR9A 2OLNA 3SM8A 2EQ6A 2JB3A 2JK6A 5KVIA 4G74A 3CPHG 1PN0A 2VQ7A 2WHDA 1LTXR 1GETA 4U8LA 3GRTA 3ZDNA 3DA1A 4H2RA 1NHQA 3NTDA 4II2A 2GRTA 1NHPA 1L9DA 2RGHA 3CUKA 2JBVA 3RP7A 2X99A 1ZKQA 4D03A 4YXDA 5M10A 2WOIA 1TDOA 2ACZA 3CNSA 1MOKA 2Q0KA 2WDVA 3AE7A 3P9UA 5FS7A 4A6NB 1YY5A 4DSGA 1NENA 5KOWA 2YLSA 1ZP0A 4CY8A 4A6NA 1GSNA 3DJGX 5C3JA 3KA7A 1GPEA 3CNDA 1N4WA 1TYTA 2GQWA 1DJQA 4FX9A 3SYIA 2CFYA 2WESA 2B9XA 2V6OA 1GNDA 1LPFA 4PABA 2QCUA 1E1NA 3AECA 1PXCA 2ARDA 4Z24A 1Y56B 1XANA 4X9NA 3BI4A 1C0KA 3IF9A 4H2PA 1Y56A 1TDFA 2BXRA 2WPCA 3DGZA 2IVDA 1GRFA 2JB2A 4B69A 4EMWA 2GQFA 1D4EA 2BYBA 2GF3A 3LOVA 4GDPA 3CGBA 1FCDA 3AD8B 1Y0PA 5L46A 2FJDA 1PXAA 1D4DA 4BK1A 1DDOA 3CIRA 4II3A 5JCLA 2E82A 2AQJA 1DAOA 4EMIA 2WPFA 3AEEA 1ZOYA 1NG3A 1F8RA 2O9ZA 1JU2A 3CGDA 2C66A 4GRTA 3NYEA 3ISHA 4U2LA 4K5RA 2R9ZA 4OPUA 1BKWA 1F8WA 3SY4A 2XYOA 4IA5A 5U1OA 3KPFA 3UOVA 1B37A 5EB5A 3CPJG 3OZ2A 4H4XA 2GB0A 5KOXA 2XVFA 4EM3A 4C3XA 4J33A 3LB8A 2YLXA 1CF3A 4B67A 4YT0A 2BK5A 1M6IA 1JOAA 4BURA 4YSXA 3AEBA 3IWAA 2BK3A 1GV4A 3IHMA 4GDEA 4H4VA 5EB4A 4J57A 3CN8A 2R46A 4RG3A 3H8IA 2GEWA 3GD3A 3GWFA 3T31A 4A65A 2YG4A 4H4SA 1P2HA 2XFNA 3ATQA 2V61A 5J60A 1CL0A 2OALA 2XCGA 4K2XA 3W4JA 4OPDA 2RGJA 1DNCA 3P4RA 3VRDB 4AT2A 3LZWA 2WU5A 2E4AA 5IQ1A 1N1PA 3NGCX 1JRYA 3D1CA 4ZN0A 4H4UA 1H84A 2XLTA 2E4GA 4XXGA 3FIMB 3EPTA 2FJEA 1MXTA 3FPZA 3G5RA 4CRTA 3AEAA 4EMJA 4JQ9A 4EQXA 1JEHA 1P2EA 3QSEA 2YVJA 1H6VA 4PAAA 2ZZBA 4HB9A 4J2WA 4XWRA 1PHHA 1ONFA 1VRQB 4U8MA 3NKSA 4ADWA 3QFAA 3AWIA 3ATRA 3C4AA 2C4CA 2ZZCA 4U2TA 1GXFA 3CTYA 3NK0X 1NHSA 1IUSA 4QFCA 3T2YA 1C0IA 1JNZA 3DJEA 2BACA 4YKGA 3NTAA 2BS4A 1O94A 4H4TA 5BRTA 1EBDA 3CNPA 2WDRA 3BI5A 3ITJA 4U8KA 5KMRA 1TDNA 4YTNA 3ALLA 4A99A 4QFDA 4NZHA 1IJHA 2B76A 2DKHA 1N4VA 3E1TA 1EL7A 1GEUA 2R0PA 2C76A 3AE8A 3KVEA 3P4QA 3AE1A 2VVMA 5IQ4A 3DJDA 3K7QX 4EM4A 4K22A 4IV9A 2JKCA 5C2TA 2DU8A 3AYLA 4M52A 1LQTA 3DH9A 3ZNOA 2EQ9A 3IHGA 3QJ4A 4U8NA 4C5OA 3P4SA 1IUXA 3I6DA 1D4CA 2B9WA 3DJJA 1IUVA 4DGKA 5JCNA 1H7XA 4NNJA 1NAAA 3EANA 5U25A 2QA1A 4Z2RA 3DK4A 1E39A 4NTCA 1BZLA 3BHFA 2YAUA 4O5UA 4AOXA 2XVEA 1CC2A 4EIQA 3QFBA 3H4KA 5JCIA 2YR5A 1GALA 1EVIA 3UOZA 1CJ4A 1B5QA 2PYXA 3W4IA 1MO9A 3KD9A 1GTEA 4YKFA 1LVLA 1RSGA 3QVPA 3QVRA 5KMSA 2GH5A 3O0HA 4OPLA 2QAEA 3SZCA 5BUKA 3GMBA 1E1KA 3NG7X 2JB1A 2X8HA 2XLUA 3B3RA 3L8KA 3NIXA 4CY6A 1PBDA 4BJYA 2XFUA 3CGCA 4H4QA 3HZLA 2WS3A 2X8CA 4TLXA 5FS8A 2B9YA 2W0HA 2C72A 3Q9TA 2Q6UA 1EL9A 2I0ZA 2BCPA 1KSSA 3LXDA 5EBKA 4DNAA 3V3OA 4B63A 4YSZA 1ZMDA 2C65A 4WX1A 3B6DA 3SFDA 2YVGA 1O95A 3UKFA 2CVJA 1KFYA
chains in the Genus database with same CATH topology
3UTHA 3P1WA 1LJ1A 1ZX9A 2BC1A 4H4PA 4ECHA 5IPYA 1ELIA 3GRSA 4BK3A 3SXIA 3T2KA 2H88A 5KVHA 1JNRA 2YR4A 3KPKA 3ICSA 1VG9A 4JNQA 2J3NA 4BJZA 1N4UA 4H4RA 2BABA 1PBEA 3C4NA 3BNUA 1GOSA 2BXSA 4CNJA 3GYIA 1K0JA 1GT8A 4USRA 1Q9IA 2FJAA 1E7PA 2GMHA 2GR1A 1BGJA 4NWZA 4TM1A 4CCQA 4RG4A 3DK8A 2YR6A 3NH3X 4EQWA 1FOHA 3EF6A 1CHUA 3UKHA 1YQ4A 1COYA 2GMJA 3ICRA 1L0VA 3M0OA 3RP8A 4H2QA 1NEKA 5JCKA 4JDRA 2B7SA 4A7AA 2VRMA 2C75A 4JN9A 1L9EA 3S5WA 1BGNA 1BF3A 1H81A 4C3YA 3GDNA 2APGA 2OLOA 1KNRA 1JRXA 3IC9A 4OPCA 1S2YA 1F3PA 3D8XA 1HYUA 4GF7A 2YLZA 4H4WA 4Y4MA 2GAHB 3VRBA 2ZZ0A 2C67A 5FMHA 1GRHA 1KDGA 2R0GA 3NRNA 2XDOA 1ZOVA 1ZDLA 3NHOX 3ALMA 3H8LA 1SEZA 2Y6QA 3NN0X 4GAPA 2XVHA 3CMMA 2YG7A 1GRGA 3JSKA 1BWCA 1QLBA 2A89A 4CBQA 1DOCA 4AP3A 4G6GA 5GSNA 2BK4A 1PJ5A 3G5SA 1YQZA 3ZYXA 2XLRA 3UKLA 4TM4A 3EAOA 3DMEA 3R9UA 5LV9A 1PDHA 1OJCA 2WOVA 2GR0A 3AE9A 2TPRA 1CC6A 1GRBA 1GREA 3AE2A 5BVAA 1IUTA 4OCGA 3AE5A 1PJ6A 3F8RA 3C96A 1UKVG 4G73A 3VRAA 4EQRA 1OJDA 2BRAA 1QJDA 5ER0A 2YLTA 1OJ9A 2R45A 1YQ3A 2WETA 4K8DA 1PBBA 2BS3A 2E1MA 4MJWA 1NDAA 4J34A 4LIIA 2GR3A 4A5LA 3CNTA 2EQ8A 2TMDA 2YLRA 1TDEA 4G6HA 3BHKA 4C77A 3T2ZA 1M64A 1GTHA 3AEDA 2IIDA 3VR8A 5KMPA 2XLSA 1XHCA 2YG5A 1AN9A 4H7UA 5HHFA 4NTEA 3UP5A 2YVFA 2RABA 2WP6A 4G9KA 4UP3A 1S2QA 3K7MX 3AEFA 1LQUA 3NK2X 1ZMCA 2C64A 2UZZA 3G3EA 2IVEA 2VZ2A 4DSHA 3M12A 3AYJA 3OC4A 2R4EA 2WP9A 3GD4A 3NLCA 4JY3A 2BRYA 1EL5A 3SZFA 4H50A 3KLJA 4X9MA 1NG4A 2VQBA 2VRLA 4FDCB 2BA9A 1TDKA 4YJGB 1GRTA 3AXBA 2QA2A 5KWFA 2YG3A 3CNJA 3WE0A 2V3AA 4YWOA 3II4A 4YJHB 1X31B 3AB1A 3REDA 3V76A 4B66A 3G5QA 2H89A 4YJHA 1E1MA 3UP4A 4D04A 5HYMA 3V3NA 2RGOA 4EQSA 1IUWA 2Z5YA 3T0KA 2FBWA 2Y6RA 1KIFA 2WBAA 1DXLA 4U8OA 2WPEA 3M13A 1ZK7A 4OPIA 2XFQA 4CCRA 3HYVA 4ZCDA 3UOYA 3KU9A 5KNLA 1L9CA 4O5QA 5BULA 4UDQA 4J36A 3FBSA 4UDRA 1PBFA 2A8XA 3L1RA 3T37A 3GMCA 4UDPA 5FS6A 1FEBA 4B68A 3GYJA 3NN6X 3UOXA 2XVJA 4U2SA 2YG6A 3UTFA 2NPXA 1FL2A 4U8IA 3VQRA 1PBCA 2XVIA 2YM2A 1ZY8A 2C3CA 1DODA 3FMWA 4NTDA 4YSYA 5KRQA 4I58A 4H2NA 5JCMA 2V60A 5FS9A 3LADA 1DJNA 2PHHA 4TM3A 1K0LA 4NEWA 1S3BA 4REKA 1DOEA 4GCMA 1D7LA 3UKAA 1Q1WA 2OA1A 1H86A 3SZ0A 2BS2A 1YKJA 4Z26A 3URHA 1DOBA 3UKKA 2FJBA 3CPIG 2EQ7A 2WEUA 3F8DA 4GR1A 4ZCCA 5TR3A 4HA6A 1VG0A 4I59A 4C74A 4Z25A 3P4PA 4ICYA 3ADAB 1CJ2A 4KX6A 2C7GA 2BCGG 3NYCA 1KSUA 3AYIA 3SX6A 4A9WA 1IUUA 3NYFA 1F6MA 1TYPA 4JNAA 4YTMA 4IVOB 3T14A 1PJ7A 2VVLG 3AEGA 3FG2P 3QSMA 1H83A 1LV0A 1D7YA 3BNMA 4KPRA 4LA1A 2C3DA 1C0LA 4YSHA 3AE6A 4AP1A 4B1BA 1RYIA 2A87A 3PS9A 3UKPA 4JY2A 1CBOA 1F8SA 4J56A 1EL8A 3PVCA 2WDQA 4FK1A 5U63A 2XFOA 3UTGA 5EOWA 1GESA 2NVKX 2GV8A 4IA6A 1JRZA 1RP0A 5HY5A 2YLWA 4GAVA 4YTPA 3AD7B 3NK1X 3AD9B 4P9SA 2B7RA 4OPGA 4Z2TA 1TRBA 2ZBWA 3KKJA 4J31A 1KF6A 5J7XA 5CQFA 3RP6A 3ZNPA 1KNPA 2OAMA 3I3LA 1XPQA 3F8PA 3RNMA 2JAEA 2R0CA 3GSIA 1H7WA 2GR2A 2C73A 3WGTA 2BC0A 3ZNNA 3LJPA 1NHRA 2C70A 1VE9A 2XFPA 1PS9A 3GYXA 3GWDA 2HQMA 2F5ZA 3ICTA 3ABVA 1Q1RA 4E0VA 2V5ZA 3K7TA 3PO7A 2AR8A 2Q0LA 1GERA 5GRTA 1B8SA 3COXA 1QO8A 4OVIA 1B4VA 4YJDA 2YM1A 4LU6A 3BI2A 1C0PA 2YWLA 3GDPA 3HYXA 1NPXA 4WCTA 2YQUA 4Y4LA 4H4ZA 4N9XA 5HXIA 1VDCA 1CJ3A 3SGLA 2AAQA 1FEAA 4A79A 5CKUA 4Y4NA 2E5VA 2V3BA 1K0IA 3RHAA 1H82A 2CDUA 2WU2A 1OJAA 2R4JA 1XDIA 2X8GA 4CNKA 3CGEA 2GAGB 1Z6LA 4AT0A 3W4KA 1PXBA 1REOA 3DGHA 4Z43A 3NT6A 4APNA 2VVLA 4Z44A 1OJTA 2XLPA 4YJFB 5DBJA 3UTEA 4IVMB 3HYWA 2VOUA 4USQA 4GUVA 1AOGA 2WP5A 4YJFA 1V59A 3SQPA 4BV6A 1VQWA 2E48A 4AOSA 3QSSA 3ZNQA 4TLZA 3UKQA 1CC4A 1E1LA 4K5SA 5KXJA 3LZXA 4K7ZA 3S61A 4TM0A 4XWZA 4EIPA 4U8PA 2GVCA 3AE3A 1CJCA 4H4YA 4OPTA 5M0ZA 3SFEA 4BK2A 2E49A 4YJGA 1E6EA 3NNEA 2Q7VA 4NEVA 3SZWA 3Q6JA 2Z5XA 4X4JA 4B64A 3UCLA 1S3EA 2DKIA 2WQYA 4RSLA 2X50A 4FK1C 5KMQA 1GRAA 1W4XA 1D5TA 1FECA 4U8JA 4B65A 3K30A 4Z2UA 1K4QA 3ALJA 3DK9A 2X3NA 3AE4A 2CULA 2WOWA 1O5WA 3VR9A 2OLNA 3SM8A 2EQ6A 2JB3A 2JK6A 5KVIA 4G74A 3CPHG 1PN0A 2VQ7A 2WHDA 1LTXR 1GETA 4U8LA 3GRTA 3ZDNA 3DA1A 3NTDA 1NHQA 4H2RA 4II2A 2GRTA 1NHPA 1L9DA 2RGHA 3CUKA 2JBVA 2X99A 3RP7A 1ZKQA 4D03A 4YXDA 5M10A 2WOIA 1TDOA 2ACZA 3CNSA 1MOKA 2Q0KA 2WDVA 3AE7A 3P9UA 5FS7A 4A6NB 1YY5A 4DSGA 1NENA 5KOWA 2YLSA 1ZP0A 4CY8A 4A6NA 1GSNA 3DJGX 5C3JA 3KA7A 1GPEA 3CNDA 1N4WA 1TYTA 2GQWA 1DJQA 4FX9A 3SYIA 2CFYA 2WESA 2B9XA 2V6OA 1GNDA 1LPFA 4PABA 2QCUA 1E1NA 3AECA 1PXCA 2ARDA 4Z24A 1Y56B 1XANA 4X9NA 3BI4A 1C0KA 3IF9A 1Y56A 2BXRA 1TDFA 2WPCA 3DGZA 4H2PA 2IVDA 1GRFA 2JB2A 4B69A 4EMWA 2GQFA 1D4EA 2BYBA 2GF3A 3LOVA 4GDPA 3CGBA 1FCDA 3AD8B 1Y0PA 5L46A 2FJDA 1PXAA 1D4DA 3CIRA 1DDOA 4II3A 4BK1A 5JCLA 2E82A 2AQJA 1DAOA 4EMIA 2WPFA 3AEEA 1ZOYA 1NG3A 1F8RA 2O9ZA 1JU2A 3CGDA 2C66A 4GRTA 3NYEA 3ISHA 4U2LA 4K5RA 2R9ZA 4OPUA 1BKWA 1F8WA 3SY4A 2XYOA 4IA5A 5U1OA 3KPFA 3UOVA 1B37A 5EB5A 3CPJG 3OZ2A 4H4XA 2GB0A 5KOXA 2XVFA 4EM3A 4C3XA 4J33A 3LB8A 2YLXA 1CF3A 4B67A 4YT0A 2BK5A 1M6IA 1JOAA 4BURA 4YSXA 3AEBA 3IWAA 2BK3A 1GV4A 3IHMA 4GDEA 4H4VA 5EB4A 4J57A 3CN8A 2R46A 4RG3A 3H8IA 2GEWA 3GD3A 3GWFA 3T31A 4A65A 2YG4A 4H4SA 1P2HA 2XFNA 3ATQA 2V61A 5J60A 1CL0A 2OALA 2XCGA 4K2XA 3W4JA 4OPDA 2RGJA 1DNCA 3P4RA 3VRDB 4AT2A 3LZWA 2WU5A 2E4AA 5IQ1A 1N1PA 3NGCX 1JRYA 3D1CA 4ZN0A 4H4UA 1H84A 2XLTA 2E4GA 4XXGA 3FIMB 3EPTA 2FJEA 1MXTA 3FPZA 3G5RA 4CRTA 3AEAA 4EMJA 4JQ9A 4EQXA 1JEHA 1P2EA 3QSEA 2YVJA 1H6VA 4PAAA 2ZZBA 4HB9A 4J2WA 4XWRA 1PHHA 1ONFA 1VRQB 4U8MA 3NKSA 4ADWA 3QFAA 3AWIA 3ATRA 3C4AA 2C4CA 2ZZCA 4U2TA 1GXFA 3CTYA 3NK0X 1NHSA 1IUSA 4QFCA 3T2YA 1C0IA 1JNZA 3DJEA 2BACA 4YKGA 3NTAA 2BS4A 1O94A 4H4TA 5BRTA 1EBDA 3CNPA 2WDRA 3BI5A 3ITJA 4U8KA 5KMRA 1TDNA 4YTNA 3ALLA 4A99A 4QFDA 4NZHA 1IJHA 2B76A 2DKHA 1GEUA 1N4VA 1EL7A 2C76A 2R0PA 3E1TA 3AE8A 3KVEA 3P4QA 3AE1A 2VVMA 5IQ4A 3DJDA 3K7QX 4EM4A 4IV9A 4K22A 2JKCA 5C2TA 2DU8A 3AYLA 4M52A 1LQTA 3DH9A 3ZNOA 2EQ9A 3IHGA 3QJ4A 4U8NA 4C5OA 3P4SA 1IUXA 3I6DA 1D4CA 2B9WA 3DJJA 1IUVA 4DGKA 5JCNA 1H7XA 4NNJA 1NAAA 3EANA 5U25A 2QA1A 4Z2RA 3DK4A 1E39A 4NTCA 1BZLA 3BHFA 2YAUA 4O5UA 4AOXA 2XVEA 1CC2A 3QFBA 4EIQA 3H4KA 5JCIA 2YR5A 1GALA 1EVIA 3UOZA 1CJ4A 1B5QA 2PYXA 3W4IA 1MO9A 3KD9A 1GTEA 4YKFA 1LVLA 1RSGA 3QVPA 3QVRA 5KMSA 2GH5A 3O0HA 4OPLA 2QAEA 3SZCA 5BUKA 3GMBA 1E1KA 3NG7X 2JB1A 2X8HA 2XLUA 3B3RA 3L8KA 3NIXA 4CY6A 1PBDA 4H4QA 2XFUA 3CGCA 5FS8A 3HZLA 2WS3A 2X8CA 4TLXA 4BJYA 2B9YA 2W0HA 2C72A 3Q9TA 2Q6UA 1EL9A 2I0ZA 2BCPA 1KSSA 3LXDA 5EBKA 4DNAA 3V3OA 4B63A 4YSZA 1ZMDA 2C65A 4WX1A 3B6DA 3SFDA 2YVGA 1O95A 3UKFA 2CVJA 1KFYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UTH A;  3P1W A;  1LJ1 A;  1ZX9 A;  2BC1 A;  4H4P A;  4ECH A;  5IPY A;  1ELI A;  3GRS A;  4BK3 A;  2H88 A;  5KVH A;  1JNR A;  2YR4 A;  4BJZ A;  3ICS A;  1VG9 A;  4JNQ A;  2J3N A;  1N4U A;  4H4R A;  2BAB A;  1PBE A;  3C4N A;  3BNU A;  1GOS A;  2BXS A;  4CNJ A;  3GYI A;  1K0J A;  1GT8 A;  4USR A;  1Q9I A;  2FJA A;  1E7P A;  2GMH A;  2GR1 A;  1BGJ A;  4TM1 A;  4CCQ A;  4RG4 A;  3DK8 A;  2YR6 A;  3NH3 X;  4EQW A;  1FOH A;  3EF6 A;  1CHU A;  3UKH A;  1YQ4 A;  1COY A;  2GMJ A;  3ICR A;  1L0V A;  3M0O A;  3RP8 A;  4H2Q A;  1NEK A;  5JCK A;  4JDR A;  2B7S A;  4A7A A;  2VRM A;  2C75 A;  4JN9 A;  1L9E A;  3S5W A;  1BGN A;  1BF3 A;  1H81 A;  4C3Y A;  3GDN A;  2APG A;  2OLO A;  1KNR A;  1JRX A;  3IC9 A;  4OPC A;  1S2Y A;  1F3P A;  3D8X A;  1HYU A;  4GF7 A;  2YLZ A;  4H4W A;  4Y4M A;  2GAH B;  3VRB A;  2ZZ0 A;  2C67 A;  5FMH A;  1GRH A;  1KDG A;  2R0G A;  3NRN A;  2XDO A;  1ZOV A;  1ZDL A;  3NHO X;  3ALM A;  3H8L A;  1SEZ A;  2Y6Q A;  3NN0 X;  2XVH A;  2YG7 A;  1GRG A;  3JSK A;  1BWC A;  1QLB A;  2A89 A;  4CBQ A;  1DOC A;  4AP3 A;  5GSN A;  2BK4 A;  1PJ5 A;  3G5S A;  1YQZ A;  3ZYX A;  2XLR A;  3UKL A;  4TM4 A;  3EAO A;  3DME A;  3R9U A;  5LV9 A;  1PDH A;  1OJC A;  2WOV A;  2GR0 A;  3AE9 A;  2TPR A;  1CC6 A;  1GRB A;  1GRE A;  3AE2 A;  5BVA A;  1IUT A;  4OCG A;  3AE5 A;  1PJ6 A;  3F8R A;  3C96 A;  1UKV G;  3VRA A;  4EQR A;  1OJD A;  1QJD A;  5ER0 A;  2YLT A;  1OJ9 A;  2R45 A;  1YQ3 A;  2WET A;  4K8D A;  1PBB A;  2BS3 A;  2E1M A;  4MJW A;  1NDA A;  4J34 A;  4LII A;  2GR3 A;  4A5L A;  3CNT A;  2EQ8 A;  2TMD A;  2YLR A;  1TDE A;  3BHK A;  4C77 A;  1M64 A;  1GTH A;  3AED A;  2IID A;  3VR8 A;  2XLS A;  1XHC A;  2YG5 A;  1AN9 A;  4H7U A;  5HHF A;  4NTE A;  3UP5 A;  2YVF A;  2RAB A;  2WP6 A;  4UP3 A;  1S2Q A;  3K7M X;  3AEF A;  1LQU A;  3NK2 X;  1ZMC A;  2C64 A;  2UZZ A;  3G3E A;  2IVE A;  2VZ2 A;  4DSH A;  3M12 A;  3AYJ A;  3OC4 A;  2R4E A;  2WP9 A;  3GD4 A;  3NLC A;  4JY3 A;  1EL5 A;  4H50 A;  3KLJ A;  4X9M A;  1NG4 A;  2VQB A;  2VRL A;  4FDC B;  2BA9 A;  1TDK A;  4YJG B;  1GRT A;  3AXB A;  2QA2 A;  5KWF A;  2YG3 A;  3CNJ A;  3WE0 A;  2V3A A;  4YWO A;  3II4 A;  4YJH B;  1X31 B;  3AB1 A;  3RED A;  4B66 A;  3G5Q A;  2H89 A;  4YJH A;  1E1M A;  3UP4 A;  4D04 A;  5HYM A;  3V3N A;  2RGO A;  4EQS A;  1IUW A;  2Z5Y A;  2FBW A;  2Y6R A;  1KIF A;  2WBA A;  1DXL A;  4U8O A;  2WPE A;  3M13 A;  1ZK7 A;  4OPI A;  2XFQ A;  4CCR A;  4ZCD A;  3UOY A;  3KU9 A;  1L9C A;  4O5Q A;  5BUL A;  4UDQ A;  4J36 A;  3FBS A;  4UDR A;  1PBF A;  2A8X A;  3L1R A;  3T37 A;  3GMC A;  4UDP A;  5FS6 A;  1FEB A;  4B68 A;  3GYJ A;  3NN6 X;  3UOX A;  2XVJ A;  4U2S A;  2YG6 A;  3UTF A;  2NPX A;  1FL2 A;  4U8I A;  3VQR A;  1PBC A;  2XVI A;  2YM2 A;  1ZY8 A;  2C3C A;  1DOD A;  3FMW A;  4NTD A;  4YSY A;  5KRQ A;  4I58 A;  4H2N A;  5JCM A;  2V60 A;  5FS9 A;  3LAD A;  1DJN A;  2PHH A;  4TM3 A;  1K0L A;  4NEW A;  1S3B A;  4REK A;  1DOE A;  4GCM A;  1D7L A;  3UKA A;  1Q1W A;  2OA1 A;  1H86 A;  3V76 A;  2BS2 A;  1YKJ A;  4Z26 A;  3URH A;  1DOB A;  3UKK A;  2FJB A;  3CPI G;  2EQ7 A;  2WEU A;  3F8D A;  4GR1 A;  4ZCC A;  5TR3 A;  4HA6 A;  1VG0 A;  4I59 A;  4C74 A;  4Z25 A;  3P4P A;  4ICY A;  3ADA B;  1CJ2 A;  4KX6 A;  2C7G A;  2BCG G;  3NYC A;  1KSU A;  3AYI A;  4A9W A;  1IUU A;  3NYF A;  1F6M A;  1TYP A;  4JNA A;  4YTM A;  4IVO B;  1PJ7 A;  2VVL G;  3AEG A;  3FG2 P;  3QSM A;  1H83 A;  1LV0 A;  1D7Y A;  3BNM A;  4KPR A;  4LA1 A;  2C3D A;  1C0L A;  4YSH A;  3AE6 A;  4AP1 A;  4B1B A;  1RYI A;  2A87 A;  3PS9 A;  3UKP A;  4JY2 A;  1CBO A;  1F8S A;  4J56 A;  1EL8 A;  3PVC A;  2WDQ A;  4FK1 A;  5U63 A;  2XFO A;  3UTG A;  5EOW A;  1GES A;  2NVK X;  2GV8 A;  4IA6 A;  1JRZ A;  1RP0 A;  5HY5 A;  2YLW A;  4YTP A;  3AD7 B;  3NK1 X;  3AD9 B;  4P9S A;  2B7R A;  4OPG A;  4Z2T A;  1TRB A;  2ZBW A;  3KKJ A;  4J31 A;  1KF6 A;  5J7X A;  5CQF A;  3RP6 A;  3ZNP A;  1KNP A;  2OAM A;  3I3L A;  1XPQ A;  3F8P A;  3RNM A;  2JAE A;  2R0C A;  3GSI A;  1H7W A;  2GR2 A;  2C73 A;  3WGT A;  2BC0 A;  3ZNN A;  3LJP A;  1NHR A;  2C70 A;  1VE9 A;  2XFP A;  1PS9 A;  3GWD A;  2HQM A;  2F5Z A;  3ICT A;  3ABV A;  1Q1R A;  4E0V A;  2V5Z A;  3K7T A;  3PO7 A;  2AR8 A;  2Q0L A;  1GER A;  5GRT A;  1B8S A;  3COX A;  1QO8 A;  4OVI A;  1B4V A;  4YJD A;  2YM1 A;  4LU6 A;  3BI2 A;  1C0P A;  2YWL A;  3GDP A;  1NPX A;  4WCT A;  2YQU A;  4Y4L A;  4H4Z A;  4N9X A;  5HXI A;  1VDC A;  1CJ3 A;  3SGL A;  2AAQ A;  1FEA A;  4A79 A;  5CKU A;  4Y4N A;  2E5V A;  2V3B A;  1K0I A;  3RHA A;  1H82 A;  2CDU A;  2WU2 A;  1OJA A;  2R4J A;  1XDI A;  2X8G A;  4CNK A;  3CGE A;  2GAG B;  1Z6L A;  4AT0 A;  3W4K A;  1PXB A;  1REO A;  3DGH A;  4Z43 A;  3NT6 A;  4APN A;  2VVL A;  4Z44 A;  1OJT A;  2XLP A;  4YJF B;  5DBJ A;  3UTE A;  4IVM B;  2VOU A;  4USQ A;  4GUV A;  1AOG A;  2WP5 A;  4YJF A;  1V59 A;  3SQP A;  4BV6 A;  1VQW A;  2E48 A;  4AOS A;  3QSS A;  3ZNQ A;  4TLZ A;  3UKQ A;  1CC4 A;  1E1L A;  4K5S A;  5KXJ A;  3LZX A;  4K7Z A;  3S61 A;  4TM0 A;  4XWZ A;  4EIP A;  4U8P A;  2GVC A;  3AE3 A;  1CJC A;  4H4Y A;  4OPT A;  5M0Z A;  3SFE A;  4BK2 A;  2E49 A;  4YJG A;  1E6E A;  3NNE A;  2Q7V A;  4NEV A;  3Q6J A;  2Z5X A;  4X4J A;  4B64 A;  3UCL A;  1S3E A;  2DKI A;  2WQY A;  4RSL A;  2X50 A;  4FK1 C;  1GRA A;  1W4X A;  1D5T A;  1FEC A;  4U8J A;  4B65 A;  3K30 A;  4Z2U A;  1K4Q A;  3ALJ A;  3DK9 A;  2X3N A;  3AE4 A;  2CUL A;  2WOW A;  1O5W A;  3VR9 A;  2OLN A;  3SM8 A;  2EQ6 A;  2JB3 A;  2JK6 A;  5KVI A;  3CPH G;  1PN0 A;  2VQ7 A;  2WHD A;  1LTX R;  1GET A;  4U8L A;  3GRT A;  3ZDN A;  3DA1 A;  3NTD A;  1NHQ A;  4H2R A;  2GRT A;  1NHP A;  1L9D A;  2RGH A;  3CUK A;  2JBV A;  2X99 A;  3RP7 A;  1ZKQ A;  4D03 A;  4YXD A;  5M10 A;  2WOI A;  1TDO A;  2ACZ A;  3CNS A;  1MOK A;  2Q0K A;  2WDV A;  3AE7 A;  3P9U A;  5FS7 A;  4A6N B;  1YY5 A;  4DSG A;  1NEN A;  5KOW A;  2YLS A;  1ZP0 A;  4CY8 A;  4A6N A;  1GSN A;  3DJG X;  5C3J A;  3KA7 A;  1GPE A;  3CND A;  1N4W A;  1TYT A;  2GQW A;  1DJQ A;  4FX9 A;  2CFY A;  2WES A;  2B9X A;  2V6O A;  1GND A;  1LPF A;  4PAB A;  2QCU A;  1E1N A;  3AEC A;  1PXC A;  2ARD A;  4Z24 A;  1Y56 B;  1XAN A;  4X9N A;  3BI4 A;  1C0K A;  3IF9 A;  1Y56 A;  2BXR A;  1TDF A;  2WPC A;  3DGZ A;  4H2P A;  2IVD A;  1GRF A;  2JB2 A;  4B69 A;  4EMW A;  2GQF A;  1D4E A;  2BYB A;  2GF3 A;  3LOV A;  4GDP A;  3CGB A;  1FCD A;  3AD8 B;  1Y0P A;  5L46 A;  2FJD A;  1PXA A;  1D4D A;  3CIR A;  1DDO A;  4BK1 A;  5JCL A;  2E82 A;  2AQJ A;  1DAO A;  4EMI A;  2WPF A;  3AEE A;  1ZOY A;  1NG3 A;  1F8R A;  2O9Z A;  1JU2 A;  3CGD A;  2C66 A;  4GRT A;  3NYE A;  3ISH A;  4U2L A;  4K5R A;  2R9Z A;  4OPU A;  1BKW A;  1F8W A;  2XYO A;  4IA5 A;  5U1O A;  3KPF A;  3UOV A;  1B37 A;  5EB5 A;  3CPJ G;  3OZ2 A;  4H4X A;  2GB0 A;  5KOX A;  2XVF A;  4EM3 A;  4C3X A;  4J33 A;  3LB8 A;  2YLX A;  1CF3 A;  4B67 A;  4YT0 A;  2BK5 A;  1M6I A;  1JOA A;  4BUR A;  4YSX A;  3AEB A;  3IWA A;  2BK3 A;  1GV4 A;  3IHM A;  4GDE A;  4H4V A;  5EB4 A;  4J57 A;  3CN8 A;  2R46 A;  4RG3 A;  3H8I A;  2GEW A;  3GD3 A;  3GWF A;  4A65 A;  2YG4 A;  4H4S A;  1P2H A;  2XFN A;  3ATQ A;  2V61 A;  5J60 A;  1CL0 A;  2OAL A;  2XCG A;  4K2X A;  3W4J A;  4OPD A;  2RGJ A;  1DNC A;  3P4R A;  3VRD B;  4AT2 A;  3LZW A;  2WU5 A;  2E4A A;  5IQ1 A;  1N1P A;  3NGC X;  1JRY A;  3D1C A;  4ZN0 A;  4H4U A;  1H84 A;  2XLT A;  2E4G A;  4XXG A;  3FIM B;  3EPT A;  2FJE A;  1MXT A;  3FPZ A;  3G5R A;  4CRT A;  3AEA A;  4EMJ A;  4JQ9 A;  4EQX A;  1JEH A;  1P2E A;  3QSE A;  2YVJ A;  1H6V A;  4PAA A;  2ZZB A;  4HB9 A;  4J2W A;  4XWR A;  1PHH A;  1ONF A;  1VRQ B;  4U8M A;  3NKS A;  4ADW A;  3QFA A;  3AWI A;  3ATR A;  3C4A A;  2ZZC A;  4U2T A;  1GXF A;  3CTY A;  3NK0 X;  1NHS A;  1IUS A;  4QFC A;  1C0I A;  1JNZ A;  3DJE A;  2BAC A;  4YKG A;  3NTA A;  2BS4 A;  1O94 A;  4H4T A;  5BRT A;  1EBD A;  3CNP A;  2WDR A;  3BI5 A;  3ITJ A;  4U8K A;  1TDN A;  4YTN A;  3ALL A;  4A99 A;  4QFD A;  4NZH A;  1IJH A;  2B76 A;  2DKH A;  1GEU A;  1N4V A;  1EL7 A;  2C76 A;  2R0P A;  3E1T A;  3AE8 A;  3KVE A;  3P4Q A;  3AE1 A;  2VVM A;  5IQ4 A;  3DJD A;  3K7Q X;  4EM4 A;  4IV9 A;  4K22 A;  2JKC A;  5C2T A;  2DU8 A;  3AYL A;  4M52 A;  1LQT A;  3DH9 A;  3ZNO A;  2EQ9 A;  3IHG A;  3QJ4 A;  4U8N A;  4C5O A;  3P4S A;  1IUX A;  3I6D A;  1D4C A;  2B9W A;  3DJJ A;  1IUV A;  4DGK A;  5JCN A;  1H7X A;  1NAA A;  3EAN A;  5U25 A;  2QA1 A;  4Z2R A;  3DK4 A;  1E39 A;  4NTC A;  1BZL A;  3BHF A;  2YAU A;  4O5U A;  4AOX A;  2XVE A;  1CC2 A;  3QFB A;  4EIQ A;  3H4K A;  5JCI A;  2YR5 A;  1GAL A;  1EVI A;  3UOZ A;  1CJ4 A;  1B5Q A;  2PYX A;  3W4I A;  1MO9 A;  3KD9 A;  1GTE A;  4YKF A;  1LVL A;  1RSG A;  3QVP A;  3QVR A;  2GH5 A;  3O0H A;  4OPL A;  2QAE A;  5BUK A;  3GMB A;  1E1K A;  3NG7 X;  2JB1 A;  2X8H A;  2XLU A;  3B3R A;  3L8K A;  3NIX A;  4CY6 A;  1PBD A;  4H4Q A;  2XFU A;  3CGC A;  5FS8 A;  3HZL A;  2WS3 A;  2X8C A;  4TLX A;  4BJY A;  2B9Y A;  2W0H A;  2C72 A;  3Q9T A;  2Q6U A;  1EL9 A;  2I0Z A;  2BCP A;  1KSS A;  3LXD A;  5EBK A;  4DNA A;  3V3O A;  4B63 A;  4YSZ A;  1ZMD A;  2C65 A;  4WX1 A;  3B6D A;  3SFD A;  2YVG A;  1O95 A;  3UKF A;  2CVJ A;  1KFY A; 
#chains in the Genus database with same CATH topology
 3UTH A;  3P1W A;  1LJ1 A;  1ZX9 A;  2BC1 A;  4H4P A;  4ECH A;  5IPY A;  1ELI A;  4BK3 A;  3GRS A;  3SXI A;  3T2K A;  2H88 A;  5KVH A;  1JNR A;  2YR4 A;  4BJZ A;  3ICS A;  1VG9 A;  3KPK A;  2J3N A;  4JNQ A;  1N4U A;  4H4R A;  2BAB A;  1PBE A;  3C4N A;  3BNU A;  1GOS A;  2BXS A;  4CNJ A;  3GYI A;  1K0J A;  1GT8 A;  4USR A;  1Q9I A;  2GMH A;  1E7P A;  2FJA A;  2GR1 A;  1BGJ A;  4NWZ A;  4TM1 A;  4CCQ A;  4RG4 A;  3DK8 A;  2YR6 A;  3NH3 X;  4EQW A;  1FOH A;  3EF6 A;  1CHU A;  3UKH A;  1YQ4 A;  1COY A;  2GMJ A;  3ICR A;  1L0V A;  3M0O A;  3RP8 A;  4H2Q A;  1NEK A;  5JCK A;  4JDR A;  2B7S A;  4A7A A;  2VRM A;  2C75 A;  4JN9 A;  1L9E A;  3S5W A;  1BGN A;  1BF3 A;  1H81 A;  4C3Y A;  3GDN A;  2APG A;  2OLO A;  1KNR A;  1JRX A;  3IC9 A;  4OPC A;  1S2Y A;  1F3P A;  3D8X A;  1HYU A;  4GF7 A;  2YLZ A;  4H4W A;  4Y4M A;  2GAH B;  3VRB A;  2ZZ0 A;  2C67 A;  5FMH A;  2R0G A;  1GRH A;  1KDG A;  3NRN A;  2XDO A;  1ZOV A;  1ZDL A;  3NHO X;  3ALM A;  3H8L A;  1SEZ A;  2Y6Q A;  3NN0 X;  4GAP A;  2XVH A;  3CMM A;  2YG7 A;  1GRG A;  3JSK A;  1BWC A;  1QLB A;  2A89 A;  4CBQ A;  1DOC A;  4AP3 A;  4G6G A;  5GSN A;  2BK4 A;  1PJ5 A;  3G5S A;  1YQZ A;  3ZYX A;  2XLR A;  3UKL A;  4TM4 A;  3EAO A;  3DME A;  3R9U A;  5LV9 A;  1PDH A;  1OJC A;  2WOV A;  2GR0 A;  3AE9 A;  2TPR A;  1CC6 A;  1GRB A;  1GRE A;  3AE2 A;  5BVA A;  1IUT A;  4OCG A;  3AE5 A;  1PJ6 A;  3F8R A;  3C96 A;  1UKV G;  4G73 A;  3VRA A;  4EQR A;  1OJD A;  2BRA A;  1QJD A;  5ER0 A;  2YLT A;  1OJ9 A;  2R45 A;  1YQ3 A;  2WET A;  4K8D A;  1PBB A;  2BS3 A;  2E1M A;  4MJW A;  1NDA A;  4J34 A;  4LII A;  2GR3 A;  4A5L A;  3CNT A;  2EQ8 A;  2TMD A;  2YLR A;  1TDE A;  4G6H A;  3BHK A;  4C77 A;  3T2Z A;  1M64 A;  1GTH A;  3AED A;  2IID A;  3VR8 A;  5KMP A;  2XLS A;  1XHC A;  2YG5 A;  1AN9 A;  4H7U A;  5HHF A;  4NTE A;  3UP5 A;  2YVF A;  2RAB A;  2WP6 A;  4G9K A;  4UP3 A;  1S2Q A;  3K7M X;  3AEF A;  1LQU A;  3NK2 X;  1ZMC A;  2C64 A;  2UZZ A;  3G3E A;  2IVE A;  2VZ2 A;  4DSH A;  3M12 A;  3AYJ A;  3OC4 A;  2R4E A;  4JY3 A;  2WP9 A;  3GD4 A;  3NLC A;  2BRY A;  1EL5 A;  3SZF A;  4H50 A;  3KLJ A;  4X9M A;  1NG4 A;  2VQB A;  2VRL A;  4FDC B;  2BA9 A;  1TDK A;  4YJG B;  1GRT A;  3AXB A;  2QA2 A;  5KWF A;  2YG3 A;  3CNJ A;  3WE0 A;  2V3A A;  4YWO A;  3II4 A;  4YJH B;  1X31 B;  3AB1 A;  3RED A;  3V76 A;  4B66 A;  3G5Q A;  2H89 A;  4YJH A;  1E1M A;  3UP4 A;  4D04 A;  5HYM A;  3V3N A;  2RGO A;  4EQS A;  1IUW A;  2Z5Y A;  3T0K A;  2FBW A;  2Y6R A;  1KIF A;  2WBA A;  1DXL A;  4U8O A;  2WPE A;  3M13 A;  1ZK7 A;  4OPI A;  2XFQ A;  4CCR A;  3HYV A;  4ZCD A;  3UOY A;  3KU9 A;  5KNL A;  1L9C A;  4O5Q A;  5BUL A;  4UDQ A;  4J36 A;  3FBS A;  4UDR A;  1PBF A;  2A8X A;  3L1R A;  3T37 A;  3GMC A;  4UDP A;  5FS6 A;  1FEB A;  4B68 A;  3GYJ A;  3NN6 X;  3UOX A;  2XVJ A;  4U2S A;  2YG6 A;  3UTF A;  2NPX A;  1FL2 A;  4U8I A;  3VQR A;  1PBC A;  2XVI A;  2YM2 A;  1ZY8 A;  2C3C A;  1DOD A;  3FMW A;  4NTD A;  4YSY A;  5KRQ A;  4I58 A;  4H2N A;  5JCM A;  2V60 A;  5FS9 A;  3LAD A;  1DJN A;  2PHH A;  4TM3 A;  1K0L A;  4NEW A;  1S3B A;  4REK A;  1DOE A;  4GCM A;  1D7L A;  3UKA A;  1Q1W A;  2OA1 A;  1H86 A;  3SZ0 A;  2BS2 A;  1YKJ A;  4Z26 A;  3URH A;  1DOB A;  3UKK A;  2FJB A;  3CPI G;  2EQ7 A;  2WEU A;  3F8D A;  4GR1 A;  4ZCC A;  5TR3 A;  4HA6 A;  1VG0 A;  4I59 A;  4C74 A;  4Z25 A;  3P4P A;  4ICY A;  3ADA B;  1CJ2 A;  4KX6 A;  2C7G A;  2BCG G;  3NYC A;  1KSU A;  3AYI A;  3SX6 A;  4A9W A;  1IUU A;  3NYF A;  1F6M A;  1TYP A;  4JNA A;  4YTM A;  4IVO B;  3T14 A;  1PJ7 A;  2VVL G;  3AEG A;  3FG2 P;  3QSM A;  1H83 A;  1LV0 A;  1D7Y A;  3BNM A;  4KPR A;  4LA1 A;  2C3D A;  1C0L A;  4YSH A;  3AE6 A;  4AP1 A;  4B1B A;  1RYI A;  2A87 A;  3PS9 A;  3UKP A;  4JY2 A;  1CBO A;  1F8S A;  4J56 A;  1EL8 A;  3PVC A;  2WDQ A;  4FK1 A;  5U63 A;  2XFO A;  3UTG A;  5EOW A;  1GES A;  2NVK X;  4IA6 A;  2GV8 A;  1JRZ A;  1RP0 A;  5HY5 A;  2YLW A;  4GAV A;  4YTP A;  3AD7 B;  3NK1 X;  3AD9 B;  4P9S A;  2B7R A;  4OPG A;  4Z2T A;  1TRB A;  2ZBW A;  3KKJ A;  4J31 A;  1KF6 A;  5J7X A;  5CQF A;  3RP6 A;  3ZNP A;  1KNP A;  2OAM A;  3I3L A;  1XPQ A;  3F8P A;  3RNM A;  2R0C A;  2JAE A;  3GSI A;  1H7W A;  2GR2 A;  2C73 A;  3WGT A;  2BC0 A;  3ZNN A;  3LJP A;  1NHR A;  2C70 A;  1VE9 A;  2XFP A;  1PS9 A;  3GYX A;  3GWD A;  2HQM A;  2F5Z A;  3ICT A;  3ABV A;  1Q1R A;  4E0V A;  2V5Z A;  3K7T A;  3PO7 A;  2AR8 A;  2Q0L A;  1GER A;  5GRT A;  1B8S A;  3COX A;  1QO8 A;  4OVI A;  1B4V A;  4YJD A;  2YM1 A;  4LU6 A;  3BI2 A;  1C0P A;  2YWL A;  3GDP A;  3HYX A;  1NPX A;  4WCT A;  2YQU A;  4Y4L A;  4H4Z A;  4N9X A;  5HXI A;  1VDC A;  1CJ3 A;  3SGL A;  2AAQ A;  1FEA A;  4A79 A;  5CKU A;  4Y4N A;  2E5V A;  2V3B A;  1K0I A;  3RHA A;  1H82 A;  2CDU A;  2WU2 A;  1OJA A;  2R4J A;  1XDI A;  2X8G A;  4CNK A;  3CGE A;  2GAG B;  1Z6L A;  4AT0 A;  3W4K A;  1PXB A;  1REO A;  3DGH A;  4Z43 A;  3NT6 A;  4APN A;  2VVL A;  4Z44 A;  1OJT A;  2XLP A;  4YJF B;  5DBJ A;  3UTE A;  4IVM B;  3HYW A;  2VOU A;  4USQ A;  4GUV A;  1AOG A;  2WP5 A;  4YJF A;  1V59 A;  3SQP A;  4BV6 A;  1VQW A;  2E48 A;  4AOS A;  3QSS A;  3ZNQ A;  4TLZ A;  3UKQ A;  1CC4 A;  1E1L A;  4K5S A;  5KXJ A;  3LZX A;  4K7Z A;  3S61 A;  4TM0 A;  4XWZ A;  4EIP A;  4U8P A;  2GVC A;  3AE3 A;  1CJC A;  4H4Y A;  4OPT A;  5M0Z A;  4BK2 A;  3SFE A;  2E49 A;  4YJG A;  1E6E A;  3NNE A;  2Q7V A;  4NEV A;  3SZW A;  3Q6J A;  2Z5X A;  4X4J A;  4B64 A;  3UCL A;  1S3E A;  2DKI A;  2WQY A;  4RSL A;  2X50 A;  4FK1 C;  5KMQ A;  1GRA A;  1W4X A;  1D5T A;  1FEC A;  4U8J A;  4B65 A;  3K30 A;  4Z2U A;  3ALJ A;  1K4Q A;  3DK9 A;  2X3N A;  3AE4 A;  2CUL A;  2WOW A;  1O5W A;  3VR9 A;  2OLN A;  3SM8 A;  2EQ6 A;  2JB3 A;  2JK6 A;  5KVI A;  4G74 A;  3CPH G;  1PN0 A;  2VQ7 A;  2WHD A;  1LTX R;  1GET A;  4U8L A;  3GRT A;  3ZDN A;  3DA1 A;  4H2R A;  1NHQ A;  3NTD A;  4II2 A;  2GRT A;  1NHP A;  1L9D A;  2RGH A;  3CUK A;  2JBV A;  3RP7 A;  2X99 A;  1ZKQ A;  4D03 A;  4YXD A;  5M10 A;  2WOI A;  1TDO A;  2ACZ A;  3CNS A;  1MOK A;  2Q0K A;  2WDV A;  3AE7 A;  3P9U A;  5FS7 A;  4A6N B;  1YY5 A;  4DSG A;  1NEN A;  5KOW A;  2YLS A;  1ZP0 A;  4CY8 A;  4A6N A;  1GSN A;  3DJG X;  5C3J A;  3KA7 A;  1GPE A;  3CND A;  1N4W A;  1TYT A;  2GQW A;  1DJQ A;  4FX9 A;  3SYI A;  2CFY A;  2WES A;  2B9X A;  2V6O A;  1GND A;  1LPF A;  4PAB A;  2QCU A;  1E1N A;  3AEC A;  1PXC A;  2ARD A;  4Z24 A;  1Y56 B;  1XAN A;  4X9N A;  3BI4 A;  1C0K A;  3IF9 A;  4H2P A;  1Y56 A;  1TDF A;  2BXR A;  2WPC A;  3DGZ A;  2IVD A;  1GRF A;  2JB2 A;  4B69 A;  4EMW A;  2GQF A;  1D4E A;  2BYB A;  2GF3 A;  3LOV A;  4GDP A;  3CGB A;  1FCD A;  3AD8 B;  1Y0P A;  5L46 A;  2FJD A;  1PXA A;  1D4D A;  4BK1 A;  1DDO A;  3CIR A;  4II3 A;  5JCL A;  2E82 A;  2AQJ A;  1DAO A;  4EMI A;  2WPF A;  3AEE A;  1ZOY A;  1NG3 A;  1F8R A;  2O9Z A;  1JU2 A;  3CGD A;  2C66 A;  4GRT A;  3NYE A;  3ISH A;  4U2L A;  4K5R A;  2R9Z A;  4OPU A;  1BKW A;  1F8W A;  3SY4 A;  2XYO A;  4IA5 A;  5U1O A;  3KPF A;  3UOV A;  1B37 A;  5EB5 A;  3CPJ G;  3OZ2 A;  4H4X A;  2GB0 A;  5KOX A;  2XVF A;  4EM3 A;  4C3X A;  4J33 A;  3LB8 A;  2YLX A;  1CF3 A;  4B67 A;  4YT0 A;  2BK5 A;  1M6I A;  1JOA A;  4BUR A;  4YSX A;  3AEB A;  3IWA A;  2BK3 A;  1GV4 A;  3IHM A;  4GDE A;  4H4V A;  5EB4 A;  4J57 A;  3CN8 A;  2R46 A;  4RG3 A;  3H8I A;  2GEW A;  3GD3 A;  3GWF A;  3T31 A;  4A65 A;  2YG4 A;  4H4S A;  1P2H A;  2XFN A;  3ATQ A;  2V61 A;  5J60 A;  1CL0 A;  2OAL A;  2XCG A;  4K2X A;  3W4J A;  4OPD A;  2RGJ A;  1DNC A;  3P4R A;  3VRD B;  4AT2 A;  3LZW A;  2WU5 A;  2E4A A;  5IQ1 A;  1N1P A;  3NGC X;  1JRY A;  3D1C A;  4ZN0 A;  4H4U A;  1H84 A;  2XLT A;  2E4G A;  4XXG A;  3FIM B;  3EPT A;  2FJE A;  1MXT A;  3FPZ A;  3G5R A;  4CRT A;  3AEA A;  4EMJ A;  4JQ9 A;  4EQX A;  1JEH A;  1P2E A;  3QSE A;  2YVJ A;  1H6V A;  4PAA A;  2ZZB A;  4HB9 A;  4J2W A;  4XWR A;  1PHH A;  1ONF A;  1VRQ B;  4U8M A;  3NKS A;  4ADW A;  3QFA A;  3AWI A;  3ATR A;  3C4A A;  2C4C A;  2ZZC A;  4U2T A;  1GXF A;  3CTY A;  3NK0 X;  1NHS A;  1IUS A;  4QFC A;  3T2Y A;  1C0I A;  1JNZ A;  3DJE A;  2BAC A;  4YKG A;  3NTA A;  2BS4 A;  1O94 A;  4H4T A;  5BRT A;  1EBD A;  3CNP A;  2WDR A;  3BI5 A;  3ITJ A;  4U8K A;  5KMR A;  1TDN A;  4YTN A;  3ALL A;  4A99 A;  4QFD A;  4NZH A;  1IJH A;  2B76 A;  2DKH A;  1N4V A;  3E1T A;  1EL7 A;  1GEU A;  2R0P A;  2C76 A;  3AE8 A;  3KVE A;  3P4Q A;  3AE1 A;  2VVM A;  5IQ4 A;  3DJD A;  3K7Q X;  4EM4 A;  4K22 A;  4IV9 A;  2JKC A;  5C2T A;  2DU8 A;  3AYL A;  4M52 A;  1LQT A;  3DH9 A;  3ZNO A;  2EQ9 A;  3IHG A;  3QJ4 A;  4U8N A;  4C5O A;  3P4S A;  1IUX A;  3I6D A;  1D4C A;  2B9W A;  3DJJ A;  1IUV A;  4DGK A;  5JCN A;  1H7X A;  4NNJ A;  1NAA A;  3EAN A;  5U25 A;  2QA1 A;  4Z2R A;  3DK4 A;  1E39 A;  4NTC A;  1BZL A;  3BHF A;  2YAU A;  4O5U A;  4AOX A;  2XVE A;  1CC2 A;  4EIQ A;  3QFB A;  3H4K A;  5JCI A;  2YR5 A;  1GAL A;  1EVI A;  3UOZ A;  1CJ4 A;  1B5Q A;  2PYX A;  3W4I A;  1MO9 A;  3KD9 A;  1GTE A;  4YKF A;  1LVL A;  1RSG A;  3QVP A;  3QVR A;  5KMS A;  2GH5 A;  3O0H A;  4OPL A;  2QAE A;  3SZC A;  5BUK A;  3GMB A;  1E1K A;  3NG7 X;  2JB1 A;  2X8H A;  2XLU A;  3B3R A;  3L8K A;  3NIX A;  4CY6 A;  1PBD A;  4BJY A;  2XFU A;  3CGC A;  4H4Q A;  3HZL A;  2WS3 A;  2X8C A;  4TLX A;  5FS8 A;  2B9Y A;  2W0H A;  2C72 A;  3Q9T A;  2Q6U A;  1EL9 A;  2I0Z A;  2BCP A;  1KSS A;  3LXD A;  5EBK A;  4DNA A;  3V3O A;  4B63 A;  4YSZ A;  1ZMD A;  2C65 A;  4WX1 A;  3B6D A;  3SFD A;  2YVG A;  1O95 A;  3UKF A;  2CVJ A;  1KFY A; 
#chains in the Genus database with same CATH homology
 3UTH A;  3P1W A;  1LJ1 A;  1ZX9 A;  2BC1 A;  4H4P A;  4ECH A;  5IPY A;  1ELI A;  3GRS A;  4BK3 A;  3SXI A;  3T2K A;  2H88 A;  5KVH A;  1JNR A;  2YR4 A;  3KPK A;  3ICS A;  1VG9 A;  4JNQ A;  2J3N A;  4BJZ A;  1N4U A;  4H4R A;  2BAB A;  1PBE A;  3C4N A;  3BNU A;  1GOS A;  2BXS A;  4CNJ A;  3GYI A;  1K0J A;  1GT8 A;  4USR A;  1Q9I A;  2FJA A;  1E7P A;  2GMH A;  2GR1 A;  1BGJ A;  4NWZ A;  4TM1 A;  4CCQ A;  4RG4 A;  3DK8 A;  2YR6 A;  3NH3 X;  4EQW A;  1FOH A;  3EF6 A;  1CHU A;  3UKH A;  1YQ4 A;  1COY A;  2GMJ A;  3ICR A;  1L0V A;  3M0O A;  3RP8 A;  4H2Q A;  1NEK A;  5JCK A;  4JDR A;  2B7S A;  4A7A A;  2VRM A;  2C75 A;  4JN9 A;  1L9E A;  3S5W A;  1BGN A;  1BF3 A;  1H81 A;  4C3Y A;  3GDN A;  2APG A;  2OLO A;  1KNR A;  1JRX A;  3IC9 A;  4OPC A;  1S2Y A;  1F3P A;  3D8X A;  1HYU A;  4GF7 A;  2YLZ A;  4H4W A;  4Y4M A;  2GAH B;  3VRB A;  2ZZ0 A;  2C67 A;  5FMH A;  1GRH A;  1KDG A;  2R0G A;  3NRN A;  2XDO A;  1ZOV A;  1ZDL A;  3NHO X;  3ALM A;  3H8L A;  1SEZ A;  2Y6Q A;  3NN0 X;  4GAP A;  2XVH A;  3CMM A;  2YG7 A;  1GRG A;  3JSK A;  1BWC A;  1QLB A;  2A89 A;  4CBQ A;  1DOC A;  4AP3 A;  4G6G A;  5GSN A;  2BK4 A;  1PJ5 A;  3G5S A;  1YQZ A;  3ZYX A;  2XLR A;  3UKL A;  4TM4 A;  3EAO A;  3DME A;  3R9U A;  5LV9 A;  1PDH A;  1OJC A;  2WOV A;  2GR0 A;  3AE9 A;  2TPR A;  1CC6 A;  1GRB A;  1GRE A;  3AE2 A;  5BVA A;  1IUT A;  4OCG A;  3AE5 A;  1PJ6 A;  3F8R A;  3C96 A;  1UKV G;  4G73 A;  3VRA A;  4EQR A;  1OJD A;  2BRA A;  1QJD A;  5ER0 A;  2YLT A;  1OJ9 A;  2R45 A;  1YQ3 A;  2WET A;  4K8D A;  1PBB A;  2BS3 A;  2E1M A;  4MJW A;  1NDA A;  4J34 A;  4LII A;  2GR3 A;  4A5L A;  3CNT A;  2EQ8 A;  2TMD A;  2YLR A;  1TDE A;  4G6H A;  3BHK A;  4C77 A;  3T2Z A;  1M64 A;  1GTH A;  3AED A;  2IID A;  3VR8 A;  5KMP A;  2XLS A;  1XHC A;  2YG5 A;  1AN9 A;  4H7U A;  5HHF A;  4NTE A;  3UP5 A;  2YVF A;  2RAB A;  2WP6 A;  4G9K A;  4UP3 A;  1S2Q A;  3K7M X;  3AEF A;  1LQU A;  3NK2 X;  1ZMC A;  2C64 A;  2UZZ A;  3G3E A;  2IVE A;  2VZ2 A;  4DSH A;  3M12 A;  3AYJ A;  3OC4 A;  2R4E A;  2WP9 A;  3GD4 A;  3NLC A;  4JY3 A;  2BRY A;  1EL5 A;  3SZF A;  4H50 A;  3KLJ A;  4X9M A;  1NG4 A;  2VQB A;  2VRL A;  4FDC B;  2BA9 A;  1TDK A;  4YJG B;  1GRT A;  3AXB A;  2QA2 A;  5KWF A;  2YG3 A;  3CNJ A;  3WE0 A;  2V3A A;  4YWO A;  3II4 A;  4YJH B;  1X31 B;  3AB1 A;  3RED A;  3V76 A;  4B66 A;  3G5Q A;  2H89 A;  4YJH A;  1E1M A;  3UP4 A;  4D04 A;  5HYM A;  3V3N A;  2RGO A;  4EQS A;  1IUW A;  2Z5Y A;  3T0K A;  2FBW A;  2Y6R A;  1KIF A;  2WBA A;  1DXL A;  4U8O A;  2WPE A;  3M13 A;  1ZK7 A;  4OPI A;  2XFQ A;  4CCR A;  3HYV A;  4ZCD A;  3UOY A;  3KU9 A;  5KNL A;  1L9C A;  4O5Q A;  5BUL A;  4UDQ A;  4J36 A;  3FBS A;  4UDR A;  1PBF A;  2A8X A;  3L1R A;  3T37 A;  3GMC A;  4UDP A;  5FS6 A;  1FEB A;  4B68 A;  3GYJ A;  3NN6 X;  3UOX A;  2XVJ A;  4U2S A;  2YG6 A;  3UTF A;  2NPX A;  1FL2 A;  4U8I A;  3VQR A;  1PBC A;  2XVI A;  2YM2 A;  1ZY8 A;  2C3C A;  1DOD A;  3FMW A;  4NTD A;  4YSY A;  5KRQ A;  4I58 A;  4H2N A;  5JCM A;  2V60 A;  5FS9 A;  3LAD A;  1DJN A;  2PHH A;  4TM3 A;  1K0L A;  4NEW A;  1S3B A;  4REK A;  1DOE A;  4GCM A;  1D7L A;  3UKA A;  1Q1W A;  2OA1 A;  1H86 A;  3SZ0 A;  2BS2 A;  1YKJ A;  4Z26 A;  3URH A;  1DOB A;  3UKK A;  2FJB A;  3CPI G;  2EQ7 A;  2WEU A;  3F8D A;  4GR1 A;  4ZCC A;  5TR3 A;  4HA6 A;  1VG0 A;  4I59 A;  4C74 A;  4Z25 A;  3P4P A;  4ICY A;  3ADA B;  1CJ2 A;  4KX6 A;  2C7G A;  2BCG G;  3NYC A;  1KSU A;  3AYI A;  3SX6 A;  4A9W A;  1IUU A;  3NYF A;  1F6M A;  1TYP A;  4JNA A;  4YTM A;  4IVO B;  3T14 A;  1PJ7 A;  2VVL G;  3AEG A;  3FG2 P;  3QSM A;  1H83 A;  1LV0 A;  1D7Y A;  3BNM A;  4KPR A;  4LA1 A;  2C3D A;  1C0L A;  4YSH A;  3AE6 A;  4AP1 A;  4B1B A;  1RYI A;  2A87 A;  3PS9 A;  3UKP A;  4JY2 A;  1CBO A;  1F8S A;  4J56 A;  1EL8 A;  3PVC A;  2WDQ A;  4FK1 A;  5U63 A;  2XFO A;  3UTG A;  5EOW A;  1GES A;  2NVK X;  2GV8 A;  4IA6 A;  1JRZ A;  1RP0 A;  5HY5 A;  2YLW A;  4GAV A;  4YTP A;  3AD7 B;  3NK1 X;  3AD9 B;  4P9S A;  2B7R A;  4OPG A;  4Z2T A;  1TRB A;  2ZBW A;  3KKJ A;  4J31 A;  1KF6 A;  5J7X A;  5CQF A;  3RP6 A;  3ZNP A;  1KNP A;  2OAM A;  3I3L A;  1XPQ A;  3F8P A;  3RNM A;  2JAE A;  2R0C A;  3GSI A;  1H7W A;  2GR2 A;  2C73 A;  3WGT A;  2BC0 A;  3ZNN A;  3LJP A;  1NHR A;  2C70 A;  1VE9 A;  2XFP A;  1PS9 A;  3GYX A;  3GWD A;  2HQM A;  2F5Z A;  3ICT A;  3ABV A;  1Q1R A;  4E0V A;  2V5Z A;  3K7T A;  3PO7 A;  2AR8 A;  2Q0L A;  1GER A;  5GRT A;  1B8S A;  3COX A;  1QO8 A;  4OVI A;  1B4V A;  4YJD A;  2YM1 A;  4LU6 A;  3BI2 A;  1C0P A;  2YWL A;  3GDP A;  3HYX A;  1NPX A;  4WCT A;  2YQU A;  4Y4L A;  4H4Z A;  4N9X A;  5HXI A;  1VDC A;  1CJ3 A;  3SGL A;  2AAQ A;  1FEA A;  4A79 A;  5CKU A;  4Y4N A;  2E5V A;  2V3B A;  1K0I A;  3RHA A;  1H82 A;  2CDU A;  2WU2 A;  1OJA A;  2R4J A;  1XDI A;  2X8G A;  4CNK A;  3CGE A;  2GAG B;  1Z6L A;  4AT0 A;  3W4K A;  1PXB A;  1REO A;  3DGH A;  4Z43 A;  3NT6 A;  4APN A;  2VVL A;  4Z44 A;  1OJT A;  2XLP A;  4YJF B;  5DBJ A;  3UTE A;  4IVM B;  3HYW A;  2VOU A;  4USQ A;  4GUV A;  1AOG A;  2WP5 A;  4YJF A;  1V59 A;  3SQP A;  4BV6 A;  1VQW A;  2E48 A;  4AOS A;  3QSS A;  3ZNQ A;  4TLZ A;  3UKQ A;  1CC4 A;  1E1L A;  4K5S A;  5KXJ A;  3LZX A;  4K7Z A;  3S61 A;  4TM0 A;  4XWZ A;  4EIP A;  4U8P A;  2GVC A;  3AE3 A;  1CJC A;  4H4Y A;  4OPT A;  5M0Z A;  3SFE A;  4BK2 A;  2E49 A;  4YJG A;  1E6E A;  3NNE A;  2Q7V A;  4NEV A;  3SZW A;  3Q6J A;  2Z5X A;  4X4J A;  4B64 A;  3UCL A;  1S3E A;  2DKI A;  2WQY A;  4RSL A;  2X50 A;  4FK1 C;  5KMQ A;  1GRA A;  1W4X A;  1D5T A;  1FEC A;  4U8J A;  4B65 A;  3K30 A;  4Z2U A;  1K4Q A;  3ALJ A;  3DK9 A;  2X3N A;  3AE4 A;  2CUL A;  2WOW A;  1O5W A;  3VR9 A;  2OLN A;  3SM8 A;  2EQ6 A;  2JB3 A;  2JK6 A;  5KVI A;  4G74 A;  3CPH G;  1PN0 A;  2VQ7 A;  2WHD A;  1LTX R;  1GET A;  4U8L A;  3GRT A;  3ZDN A;  3DA1 A;  3NTD A;  1NHQ A;  4H2R A;  4II2 A;  2GRT A;  1NHP A;  1L9D A;  2RGH A;  3CUK A;  2JBV A;  2X99 A;  3RP7 A;  1ZKQ A;  4D03 A;  4YXD A;  5M10 A;  2WOI A;  1TDO A;  2ACZ A;  3CNS A;  1MOK A;  2Q0K A;  2WDV A;  3AE7 A;  3P9U A;  5FS7 A;  4A6N B;  1YY5 A;  4DSG A;  1NEN A;  5KOW A;  2YLS A;  1ZP0 A;  4CY8 A;  4A6N A;  1GSN A;  3DJG X;  5C3J A;  3KA7 A;  1GPE A;  3CND A;  1N4W A;  1TYT A;  2GQW A;  1DJQ A;  4FX9 A;  3SYI A;  2CFY A;  2WES A;  2B9X A;  2V6O A;  1GND A;  1LPF A;  4PAB A;  2QCU A;  1E1N A;  3AEC A;  1PXC A;  2ARD A;  4Z24 A;  1Y56 B;  1XAN A;  4X9N A;  3BI4 A;  1C0K A;  3IF9 A;  1Y56 A;  2BXR A;  1TDF A;  2WPC A;  3DGZ A;  4H2P A;  2IVD A;  1GRF A;  2JB2 A;  4B69 A;  4EMW A;  2GQF A;  1D4E A;  2BYB A;  2GF3 A;  3LOV A;  4GDP A;  3CGB A;  1FCD A;  3AD8 B;  1Y0P A;  5L46 A;  2FJD A;  1PXA A;  1D4D A;  3CIR A;  1DDO A;  4II3 A;  4BK1 A;  5JCL A;  2E82 A;  2AQJ A;  1DAO A;  4EMI A;  2WPF A;  3AEE A;  1ZOY A;  1NG3 A;  1F8R A;  2O9Z A;  1JU2 A;  3CGD A;  2C66 A;  4GRT A;  3NYE A;  3ISH A;  4U2L A;  4K5R A;  2R9Z A;  4OPU A;  1BKW A;  1F8W A;  3SY4 A;  2XYO A;  4IA5 A;  5U1O A;  3KPF A;  3UOV A;  1B37 A;  5EB5 A;  3CPJ G;  3OZ2 A;  4H4X A;  2GB0 A;  5KOX A;  2XVF A;  4EM3 A;  4C3X A;  4J33 A;  3LB8 A;  2YLX A;  1CF3 A;  4B67 A;  4YT0 A;  2BK5 A;  1M6I A;  1JOA A;  4BUR A;  4YSX A;  3AEB A;  3IWA A;  2BK3 A;  1GV4 A;  3IHM A;  4GDE A;  4H4V A;  5EB4 A;  4J57 A;  3CN8 A;  2R46 A;  4RG3 A;  3H8I A;  2GEW A;  3GD3 A;  3GWF A;  3T31 A;  4A65 A;  2YG4 A;  4H4S A;  1P2H A;  2XFN A;  3ATQ A;  2V61 A;  5J60 A;  1CL0 A;  2OAL A;  2XCG A;  4K2X A;  3W4J A;  4OPD A;  2RGJ A;  1DNC A;  3P4R A;  3VRD B;  4AT2 A;  3LZW A;  2WU5 A;  2E4A A;  5IQ1 A;  1N1P A;  3NGC X;  1JRY A;  3D1C A;  4ZN0 A;  4H4U A;  1H84 A;  2XLT A;  2E4G A;  4XXG A;  3FIM B;  3EPT A;  2FJE A;  1MXT A;  3FPZ A;  3G5R A;  4CRT A;  3AEA A;  4EMJ A;  4JQ9 A;  4EQX A;  1JEH A;  1P2E A;  3QSE A;  2YVJ A;  1H6V A;  4PAA A;  2ZZB A;  4HB9 A;  4J2W A;  4XWR A;  1PHH A;  1ONF A;  1VRQ B;  4U8M A;  3NKS A;  4ADW A;  3QFA A;  3AWI A;  3ATR A;  3C4A A;  2C4C A;  2ZZC A;  4U2T A;  1GXF A;  3CTY A;  3NK0 X;  1NHS A;  1IUS A;  4QFC A;  3T2Y A;  1C0I A;  1JNZ A;  3DJE A;  2BAC A;  4YKG A;  3NTA A;  2BS4 A;  1O94 A;  4H4T A;  5BRT A;  1EBD A;  3CNP A;  2WDR A;  3BI5 A;  3ITJ A;  4U8K A;  5KMR A;  1TDN A;  4YTN A;  3ALL A;  4A99 A;  4QFD A;  4NZH A;  1IJH A;  2B76 A;  2DKH A;  1GEU A;  1N4V A;  1EL7 A;  2C76 A;  2R0P A;  3E1T A;  3AE8 A;  3KVE A;  3P4Q A;  3AE1 A;  2VVM A;  5IQ4 A;  3DJD A;  3K7Q X;  4EM4 A;  4IV9 A;  4K22 A;  2JKC A;  5C2T A;  2DU8 A;  3AYL A;  4M52 A;  1LQT A;  3DH9 A;  3ZNO A;  2EQ9 A;  3IHG A;  3QJ4 A;  4U8N A;  4C5O A;  3P4S A;  1IUX A;  3I6D A;  1D4C A;  2B9W A;  3DJJ A;  1IUV A;  4DGK A;  5JCN A;  1H7X A;  4NNJ A;  1NAA A;  3EAN A;  5U25 A;  2QA1 A;  4Z2R A;  3DK4 A;  1E39 A;  4NTC A;  1BZL A;  3BHF A;  2YAU A;  4O5U A;  4AOX A;  2XVE A;  1CC2 A;  3QFB A;  4EIQ A;  3H4K A;  5JCI A;  2YR5 A;  1GAL A;  1EVI A;  3UOZ A;  1CJ4 A;  1B5Q A;  2PYX A;  3W4I A;  1MO9 A;  3KD9 A;  1GTE A;  4YKF A;  1LVL A;  1RSG A;  3QVP A;  3QVR A;  5KMS A;  2GH5 A;  3O0H A;  4OPL A;  2QAE A;  3SZC A;  5BUK A;  3GMB A;  1E1K A;  3NG7 X;  2JB1 A;  2X8H A;  2XLU A;  3B3R A;  3L8K A;  3NIX A;  4CY6 A;  1PBD A;  4H4Q A;  2XFU A;  3CGC A;  5FS8 A;  3HZL A;  2WS3 A;  2X8C A;  4TLX A;  4BJY A;  2B9Y A;  2W0H A;  2C72 A;  3Q9T A;  2Q6U A;  1EL9 A;  2I0Z A;  2BCP A;  1KSS A;  3LXD A;  5EBK A;  4DNA A;  3V3O A;  4B63 A;  4YSZ A;  1ZMD A;  2C65 A;  4WX1 A;  3B6D A;  3SFD A;  2YVG A;  1O95 A;  3UKF A;  2CVJ A;  1KFY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...