3OZ2A

Crystal structure of a geranylgeranyl bacteriochlorophyll reductase-like (ta0516) from thermoplasma acidophilum at 1.60 a resolution
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
397
structure length
397
Chain Sequence
GMETYDVLVVGGGPGGSTAARYAAKYGLKTLMIEKRPEIGSPVRCGEGLSKGILNEADIKADRSFIANEVKGARIYGPSEKRPIILQSEKAGNEVGYVLERDKFDKHLAALAAKAGADVWVKSPALGVIKENGKVAGAKIRHNNEIVDVRAKMVIAADGFESEFGRWAGLKSVILARNDIISALQYRMINVDVDPDYTDFYLGSIAPAGYIWVFPKGEGMANVGIGSSINWIHNRFELKNYLDRFIENHPGLKKGQDIQLVTGGVSVSKVKMPITMPGLMLVGDAARLIDPITGGGIANAIVSGMYAAQVTKEAIESNDYSPQMMQKYEKLIKERFERKHLRNWVAKEKLAMLSDDTLDKLVDIVSEQVLTTISVEAILKAIAEKYPEVVKELEDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into substrate specificity of geranylgeranyl reductases revealed by the structure of digeranylgeranylglycerophospholipid reductase, an essential enzyme in the biosynthesis of archaeal membrane lipids.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Flavoprotein, oxidoreductase
molecule keywords Digeranylgeranylglycerophospholipid reductase
total genus 124
structure length 397
sequence length 397
ec nomenclature ec 1.3.1.101: 2,3-bis-O-geranylgeranyl-sn-glycerol 1-phosphate reductase (NAD(P)H).
pdb deposition date 2010-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3oz2A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3oz2A01
4TM3A 4H4PA 2R4JA 3LOVA 3G5SA 4H4XA 3QFAA 3QVPA 2FBWA 1H7XA 2JBVA 1BGJA 5C2TA 1TYPA 3NK2X 1X31B 3UP5A 3KKJA 3UKLA 3ZNPA 4C77A 1PBFA 2EQ9A 5M10A 3ALMA 2BS3A 2QA2A 2JB1A 4OPTA 3SFDA 2WETA 2FJDA 2GMJA 2WP6A 4OPIA 4EQXA 3RP6A 1N4UA 1ZX9A 1IUXA 3VR9A 1MXTA 3FG2P 5BULA 2WQYA 5JCIA 4YJDA 1KSSA 2C70A 2BS4A 2BK5A 1XHCA 2YG5A 4YSZA 3BNUA 1H7WA 2VRMA 3ALLA 2EQ7A 1M6IA 1NHRA 1L0VA 2BA9A 1PXBA 2OLOA 2Q0LA 2YWLA 4YT0A 5KOXA 4NTCA 3DK4A 2Q7VA 1H81A 2WPFA 1GALA 4Z24A 4AP1A 3GD4A 4C3YA 1VRQB 4D04A 3EAOA 2JKCA 3NHOX 1W4XA 3LB8A 4U8JA 3LZWA 2VRLA 3CGBA 4A99A 1B5QA 1IUSA 3ZNOA 1OJTA 3V76A 2XVEA 1CJ3A 1BGNA 1CF3A 1REOA 2YG7A 4JNAA 1SEZA 2R0CA 1NHSA 1DJNA 1XDIA 1D7LA 1B37A 4A79A 1ZDLA 3II4A 3NN0X 3ALJA 2GH5A 3S61A 1OJAA 4OPLA 4B67A 1NHPA 1LQUA 4GR1A 3CNJA 2GR1A 2Y6RA 2YLWA 3B6DA 3E1TA 4C3XA 1GRFA 3ADAB 1DODA 1CJ2A 4B1BA 3F8DA 4H2PA 1QO8A 1GRGA 1LPFA 2JB3A 2WHDA 2X50A 3QVRA 4XWZA 1B8SA 4C74A 4AP3A 2GAHB 2IVDA 3RP8A 3LZXA 2BYBA 2W0HA 1NG3A 5KVHA 1L9CA 1GERA 1F8SA 1GRHA 1O5WA 3NRNA 2YLXA 3NTDA 1D5TA 5KOWA 3CGEA 2C76A 2OAMA 3DK9A 3DK8A 4H4SA 3DJEA 3UOZA 4YSXA 2VZ2A 3PO7A 4YJHA 1BKWA 3EF6A 2GQWA 1H86A 3KVEA 2YAUA 3AE5A 4JY3A 3QSEA 3G3EA 3UOVA 5C3JA 4CNKA 4PABA 2CDUA 5KWFA 2BS2A 3DJDA 2YQUA 1GNDA 2VOUA 3SQPA 3W4IA 1BWCA 2NVKX 4GDEA 2WESA 3AEDA 4DSGA 1FEBA 2APGA 3KLJA 1PXCA 3K7MX 2XLUA 2WP5A 4CRTA 4YTMA 4BK1A 2BCPA 5HXIA 1GSNA 3UKQA 4XXGA 1TDEA 2VQ7A 1GREA 2YLRA 2DKIA 1ZMDA 2E5VA 4GF7A 4USRA 2Z5XA 3CPIG 3H4KA 4TLXA 1N4WA 4AT2A 4Z2TA 4JN9A 2B7RA 4AOXA 5FS9A 1N4VA 3DJGX 3AE4A 4A6NB 3P4SA 1TDKA 3V3OA 2GV8A 1GTHA 4NZHA 5L46A 4BJYA 1UKVG 2FJAA 2E48A 1F6MA 1LJ1A 2ACZA 2ARDA 4B69A 1DOBA 2JK6A 2GMHA 2QAEA 3UKHA 1P2HA 3P1WA 3AEEA 4K22A 3OZ2A 2JAEA 3K7TA 5DBJA 4BV6A 2Z5YA 1P2EA 3AE3A 2WOVA 3ATRA 3H8IA 2HQMA 4U8IA 4PAAA 3UTEA 3LADA 4EIQA 2YVGA 3AE1A 1H82A 1YY5A 3BI5A 2GB0A 4LA1A 1LQTA 3UTGA 2B9WA 2Q0KA 2X3NA 2GVCA 1K4QA 3AE9A 1E7PA 1EL8A 2WP9A 3QSMA 2C65A 3R9UA 1V59A 2WS3A 2IVEA 3ICTA 2XVJA 3DGHA 3NK1X 4H50A 2Y6QA 5FS8A 2BXSA 4Z25A 1TYTA 3IHGA 1E1LA 1CL0A 2B7SA 2H88A 3CTYA 4RG4A 3OC4A 4Z2RA 3AD7B 4FX9A 3UKPA 2F5ZA 1BZLA 1YQZA 2YVJA 3K30A 4J56A 4EQSA 2XVIA 4WCTA 3AE8A 1DXLA 2XLTA 1E39A 5IQ1A 1GT8A 3AYJA 3CGCA 3L8KA 4H4UA 4CCQA 1JOAA 3AE7A 4J31A 3ABVA 2E82A 3IC9A 3LXDA 3NH3X 3BI4A 4IVOB 1JEHA 4ICYA 2YVFA 3KA7A 4RG3A 1LV0A 1CHUA 1NAAA 2VVMA 3F8RA 4H7UA 2WPEA 2ZZBA 4YJGB 1EL7A 4OCGA 4USQA 3NTAA 3T37A 2RABA 3BHKA 1GTEA 1KNRA 2YM1A 1XPQA 1JNZA 2FJEA 1PBCA 4U8NA 4EMWA 5FS7A 3DJJA 4IV9A 4B66A 4D03A 1DOEA 1C0KA 4ZCDA 3IF9A 4REKA 4Y4LA 3UKFA 4Z2UA 1ZK7A 2WPCA 4EM4A 4O5UA 4ZN0A 1Y56A 3AEGA 1D4DA 4E0VA 3GRTA 4OPUA 3NT6A 1KIFA 1PJ6A 4GDPA 4UP3A 5U63A 4EIPA 1FEAA 3UP4A 1CC2A 2V5ZA 3ZDNA 5JCKA 2R46A 1TDNA 3FBSA 3KD9A 4NEVA 2XYOA 1NENA 2C72A 2VVLA 4GCMA 4BURA 4TLZA 2WEUA 3AEAA 2ZZ0A 3I6DA 4M52A 3VRAA 3GSIA 3URHA 5JCNA 1E1NA 2A8XA 4H2QA 4DNAA 5EB4A 3C96A 1VDCA 5EB5A 3CPHG 1CJCA 4YKFA 4TM0A 5CQFA 2BC0A 3H8LA 3QSSA 4A7AA 3AYIA 2YR6A 3ZYXA 5GRTA 1FCDA 1JU2A 1H83A 1OJ9A 4HA6A 2YLTA 1DDOA 1JRYA 2R9ZA 3FPZA 4X9NA 4B63A 2V60A 4NTEA 3FMWA 3HZLA 3ISHA 1S3EA 2WU5A 4BK3A 3C4NA 4I59A 1EBDA 4U8LA 1PJ7A 3DGZA 3SFEA 1NDAA 2XVHA 3P9UA 4OPDA 1O95A 4EM3A 2AQJA 2O9ZA 3SM8A 2B9XA 3GWFA 3RNMA 4X9MA 1K0LA 1DJQA 4A5LA 4EQWA 2C3CA 2A87A 4AT0A 1Q1WA 3BNMA 3AWIA 4DGKA 4DSHA 1HYUA 4YTNA 4Z43A 4QFCA 2YM2A 3CIRA 4Z44A 3UKKA 4OVIA 5GSNA 4QFDA 4U2SA 2R0PA 2GF3A 3F8PA 2CVJA 3CGDA 1MOKA 4U8OA 4J57A 2GEWA 4H4YA 3KPFA 1ONFA 3AEFA 2ZZCA 4C5OA 3GWDA 1YQ4A 2WBAA 4MJWA 2R0GA 1EVIA 1D4EA 2WDRA 1F8RA 5FMHA 3B3RA 3AE2A 4Y4NA 1EL5A 1PXAA 3AD8B 1ZOVA 2XLRA 1S2QA 2ZBWA 4FK1A 4ZCCA 4UDRA 5HHFA 4TM4A 2BACA 1Y56B 3RP7A 2XFUA 3VR8A 4CBQA 4U2TA 3M0OA 2E49A 1F3PA 1JRXA 1GXFA 1H84A 5U25A 1DOCA 3Q6JA 1VG0A 2YG3A 3AECA 2YG6A 2XFOA 2A89A 4CY6A 3D1CA 4J2WA 1NG4A 3DMEA 1LVLA 2JB2A 2GR2A 5EOWA 4EMIA 1IUVA 1GESA 2XFNA 1ZY8A 4YSHA 2V3BA 2OALA 5BVAA 2C66A 4JY2A 4YSYA 2I0ZA 4K7ZA 2E4AA 1OJDA 3KU9A 3COXA 4FK1C 4H4ZA 3BI2A 4YWOA 3GYIA 4P9SA 4YJHB 4OPGA 1K0JA 2X99A 4TM1A 2EQ6A 3M13A 3L1RA 1IJHA 3P4QA 3Q9TA 4H2RA 3S5WA 1AN9A 3NIXA 4U2LA 3BHFA 1O94A 3AB1A 2RGHA 4XWRA 2PYXA 2XDOA 5M0ZA 4J36A 4AOSA 4RSLA 1TDFA 1OJCA 2BCGG 4EQRA 2RGJA 4YKGA 1GRBA 1VG9A 1H6VA 3EANA 4H4TA 4YJFA 1RSGA 4KPRA 4ADWA 3GDPA 4X4JA 2GR3A 5FS6A 1NHQA 3D8XA 2C73A 4CY8A 2AR8A 4B65A 2C7GA 1PN0A 4BJZA 4B68A 4A65A 1C0PA 1DAOA 2XVFA 4IA6A 3P4PA 4HB9A 4WX1A 4K2XA 3M12A 1GOSA 1KFYA 2WDVA 4YXDA 3NYFA 5KRQA 2YR5A 3VRDB 2EQ8A 5BRTA 4CCRA 3CNDA 4H4QA 2XFQA 3AE6A 5TR3A 2B9YA 1PBBA 4H4VA 4O5QA 1Z6LA 2NPXA 4NTDA 1PBEA 1CC4A 1C0LA 3NG7X 4K5RA 1PJ5A 1Q1RA 3UKAA 2CULA 4A9WA 1RYIA 4U8PA 3AEBA 1KF6A 1KSUA 3UOYA 2BXRA 3WGTA 1Y0PA 2WOWA 1GRAA 2TMDA 4OPCA 4FDCB 1NPXA 2GQFA 3GYJA 2Q6UA 1Q9IA 3NYEA 2C67A 2GRTA 1PBDA 4J33A 4I58A 3SGLA 3ZNNA 2VVLG 2WU2A 3LJPA 3NYCA 3CNPA 2FJBA 3ICRA 1EL9A 3NN6X 3CPJG 2DU8A 4JDRA 4U8MA 1CJ4A 1E1KA 2GR0A 1F8WA 3NKSA 3NNEA 3QFBA 1IUTA 1JNRA 5HYMA 2WOIA 1ZP0A 2IIDA 2V3AA 4H2NA 4N9XA 5IPYA 3IHMA 1FOHA 2B76A 2V61A 3QJ4A 1IUUA 3CNSA 3IWAA 1MO9A 3DH9A 5JCLA 1D7YA 3CUKA 1B4VA 3GDNA 5CKUA 4ECHA 3G5RA 2XFPA 1YQ3A 4UDQA 1S3BA 3DA1A 2R45A 5ER0A 2BC1A 2R4EA 1FECA 4U8KA 4JNQA 3W4KA 3UCLA 5JCMA 1D4CA 1VQWA 3P4RA 1BF3A 3W4JA 2VQBA 4YJFB 3RHAA 1TDOA 1S2YA 1M64A 3PS9A 1NEKA 1CC6A 4UDPA 3ITJA 3NLCA 2QCUA 1E1MA 2AAQA 1KDGA 5J7XA 4APNA 2H89A 1KNPA 4YTPA 5LV9A 1ZKQA 3WE0A 5KXJA 3FIMB 3GMCA 3CN8A 3NGCX 1GEUA 1GRTA 1JRZA 1CBOA 1FL2A 4K8DA 2OA1A 3GD3A 1K0IA 2XLPA 4LU6A 3AD9B 2CFYA 2BK4A 3JSKA 4EMJA 2YR4A 3UTFA 1QLBA 4B64A 2XCGA 2V6OA 5IQ4A 1N1PA 3UTHA 1L9EA 1PS9A 4IVMB 1RP0A 3AXBA 4J34A 3GRSA 5HY5A 4H4WA 3VRBA 2UZZA 3ZNQA 5KVIA 5J60A 1L9DA 2BK3A 4GRTA 1AOGA 4Y4MA 1ZOYA 4GUVA 3NK0X 3C4AA 1PDHA 1QJDA 3REDA 2WDQA 3ATQA 2PHHA 4NEWA 3V3NA 2GAGB 4A6NA 4KX6A 1PHHA 4YJGA 2C3DA 5EBKA 1LTXR 2BABA 1ELIA 3K7QX 3EPTA 4JQ9A 3PVCA 1IUWA 3VQRA 3I3LA 2YG4A 5BUKA 3UOXA 4BK2A 2X8GA 1XANA 2X8HA 1E6EA 1GPEA 3O0HA 4H4RA 5U1OA 1TRBA 4CNJA 1C0IA 3ICSA 1VE9A 2X8CA 4Z26A 1ZMCA 2DKHA 1DNCA 3G5QA 2E4GA 4K5SA 3CNTA 2C75A 2TPRA 1COYA 2YLZA 4LIIA 2J3NA 2XLSA 2OLNA 2QA1A 1GV4A 1YKJA 2C64A 2YLSA 2RGOA 2E1MA 1GETA 3AYLA 4IA5A 3GMBA
chains in the Genus database with same CATH superfamily
4TM3A 4H4PA 2R4JA 3LOVA 3G5SA 4H4XA 3QFAA 3QVPA 2FBWA 1H7XA 2JBVA 1BGJA 4II3A 5C2TA 1TYPA 3NK2X 1X31B 3UP5A 3SZ0A 3KKJA 3UKLA 3ZNPA 4C77A 1PBFA 2EQ9A 5M10A 3ALMA 2BS3A 3T14A 2QA2A 2JB1A 4OPTA 3SFDA 2WETA 2GMJA 2FJDA 2WP6A 4OPIA 4EQXA 3RP6A 1N4UA 1ZX9A 1IUXA 3SX6A 3VR9A 1MXTA 3FG2P 5BULA 2WQYA 5JCIA 4YJDA 1KSSA 2C70A 2BS4A 2BK5A 1XHCA 2YG5A 4YSZA 3T0KA 3BNUA 1H7WA 2VRMA 3ALLA 2EQ7A 1M6IA 1NHRA 1L0VA 2BA9A 1PXBA 2OLOA 2Q0LA 2YWLA 4YT0A 5KOXA 4NTCA 3DK4A 2Q7VA 1H81A 2WPFA 1GALA 4Z24A 4AP1A 3GD4A 4C3YA 1VRQB 4D04A 3EAOA 2JKCA 3NHOX 1W4XA 3LB8A 4U8JA 3LZWA 2VRLA 3CGBA 4A99A 1B5QA 1IUSA 3ZNOA 1OJTA 2BRYA 2XVEA 1CJ3A 3V76A 1BGNA 1CF3A 1REOA 2YG7A 4JNAA 1SEZA 2R0CA 1NHSA 1DJNA 1XDIA 1D7LA 1B37A 4A79A 1ZDLA 3II4A 3NN0X 3ALJA 2GH5A 3S61A 1OJAA 4OPLA 4B67A 1NHPA 1LQUA 4GR1A 3CNJA 2GR1A 2Y6RA 3E1TA 2YLWA 3B6DA 4C3XA 1GRFA 3ADAB 1DODA 1CJ2A 4B1BA 3F8DA 4H2PA 1QO8A 1GRGA 1LPFA 2JB3A 2WHDA 2X50A 3QVRA 4XWZA 1B8SA 4C74A 4AP3A 2GAHB 3RP8A 2IVDA 3LZXA 2BYBA 2W0HA 1NG3A 5KVHA 1L9CA 1GERA 1F8SA 1GRHA 1O5WA 3NRNA 2YLXA 3NTDA 1D5TA 5KOWA 3CGEA 2C76A 2OAMA 3DK9A 3DK8A 4H4SA 5KMSA 3DJEA 3UOZA 4YSXA 2VZ2A 3PO7A 4YJHA 1BKWA 3EF6A 2GQWA 5KMPA 1H86A 3KVEA 2YAUA 3AE5A 4JY3A 3QSEA 3G3EA 3UOVA 5C3JA 4CNKA 4PABA 2CDUA 5KWFA 2BS2A 3DJDA 2YQUA 1GNDA 2VOUA 3SQPA 3W4IA 1BWCA 2NVKX 4GDEA 2WESA 3AEDA 4DSGA 1FEBA 2APGA 3KLJA 1PXCA 3K7MX 2XLUA 2WP5A 4CRTA 4BK1A 4YTMA 5HXIA 2BCPA 1GSNA 3UKQA 4XXGA 1TDEA 2VQ7A 1GREA 2YLRA 2DKIA 1ZMDA 2E5VA 4GF7A 4USRA 2Z5XA 3CPIG 3H4KA 4TLXA 1N4WA 4AT2A 4NWZA 4Z2TA 4JN9A 2B7RA 4AOXA 5FS9A 1N4VA 3DJGX 3AE4A 4A6NB 3P4SA 1TDKA 3V3OA 2GV8A 1GTHA 4NZHA 4BJYA 5L46A 1UKVG 2FJAA 2E48A 1F6MA 1LJ1A 2ACZA 2ARDA 4B69A 1DOBA 2JK6A 2GMHA 2QAEA 3UKHA 1P2HA 3CMMA 3P1WA 3AEEA 4K22A 3OZ2A 2JAEA 3K7TA 5DBJA 3T2ZA 2Z5YA 1P2EA 3AE3A 2WOVA 3ATRA 3H8IA 2HQMA 4U8IA 4PAAA 3UTEA 4EIQA 3LADA 2YVGA 3AE1A 1H82A 1YY5A 3BI5A 2GB0A 4LA1A 1LQTA 3UTGA 2X3NA 2B9WA 2Q0KA 2GVCA 1K4QA 3AE9A 1E7PA 1EL8A 2WP9A 3QSMA 2C65A 3R9UA 1V59A 2WS3A 2IVEA 3ICTA 2XVJA 3DGHA 3NK1X 4H50A 2Y6QA 5FS8A 2BXSA 4Z25A 1TYTA 3IHGA 1E1LA 1CL0A 2B7SA 2H88A 3CTYA 4G9KA 4RG4A 3OC4A 4Z2RA 3AD7B 4FX9A 3UKPA 2F5ZA 1BZLA 1YQZA 2YVJA 3K30A 4J56A 4EQSA 2XVIA 4WCTA 3AE8A 1DXLA 2XLTA 1E39A 5IQ1A 1GT8A 3AYJA 3CGCA 3L8KA 4H4UA 4CCQA 1JOAA 3AE7A 4J31A 3ABVA 2E82A 3IC9A 3LXDA 3NH3X 3BI4A 4IVOB 1JEHA 4ICYA 2YVFA 3KA7A 4RG3A 1LV0A 1CHUA 1NAAA 2VVMA 3F8RA 4H7UA 2WPEA 2ZZBA 4YJGB 1EL7A 4OCGA 4USQA 3NTAA 3T37A 2RABA 3BHKA 1GTEA 1KNRA 2YM1A 1XPQA 1JNZA 2FJEA 1PBCA 4U8NA 4EMWA 5FS7A 3DJJA 4IV9A 4B66A 4D03A 1DOEA 1C0KA 4ZCDA 3IF9A 4REKA 4Y4LA 3HYVA 3UKFA 4Z2UA 1ZK7A 2WPCA 4EM4A 4O5UA 4ZN0A 1Y56A 3AEGA 1D4DA 4E0VA 3GRTA 4OPUA 3NT6A 1KIFA 1PJ6A 4GDPA 4EIPA 4UP3A 5U63A 1FEAA 3UP4A 1CC2A 2V5ZA 3ZDNA 5JCKA 2R46A 1TDNA 3FBSA 3KD9A 4NEVA 2XYOA 3T2YA 1NENA 2C72A 2VVLA 4GCMA 4BURA 4TLZA 2WEUA 3AEAA 2ZZ0A 3I6DA 4M52A 3VRAA 3GSIA 3URHA 5JCNA 1E1NA 4H2QA 2A8XA 3GYXA 5EB4A 4DNAA 3C96A 1VDCA 5EB5A 3CPHG 1CJCA 4YKFA 4TM0A 5CQFA 2BC0A 3H8LA 3QSSA 4A7AA 3AYIA 2YR6A 3ZYXA 5GRTA 1FCDA 3KPKA 1JU2A 1H83A 1OJ9A 3HYXA 4HA6A 2YLTA 1DDOA 1JRYA 2R9ZA 3FPZA 4X9NA 4B63A 2V60A 4NTEA 3FMWA 4BK3A 3HZLA 1S3EA 2WU5A 3ISHA 3C4NA 4I59A 1EBDA 4U8LA 1PJ7A 3DGZA 3SFEA 1NDAA 2XVHA 3P9UA 4OPDA 1O95A 4EM3A 2AQJA 2O9ZA 3SM8A 2B9XA 3GWFA 3RNMA 4X9MA 1K0LA 1DJQA 4A5LA 4EQWA 2C3CA 2A87A 4AT0A 1Q1WA 3BNMA 3AWIA 4DGKA 4G6HA 1HYUA 4DSHA 4YTNA 4QFCA 2YM2A 3CIRA 4Z44A 3UKKA 4Z43A 4OVIA 5GSNA 4QFDA 3SYIA 4U2SA 2R0PA 2GF3A 3F8PA 2CVJA 3CGDA 1MOKA 4U8OA 3SXIA 4J57A 2GEWA 4H4YA 3KPFA 1ONFA 3AEFA 2ZZCA 4C5OA 3GWDA 1YQ4A 2WBAA 4MJWA 2R0GA 1EVIA 1D4EA 2WDRA 1F8RA 5FMHA 3B3RA 3AE2A 4Y4NA 1EL5A 1PXAA 3AD8B 1ZOVA 2XLRA 1S2QA 2ZBWA 4FK1A 4ZCCA 4UDRA 5HHFA 3RP7A 2BACA 1Y56B 4NNJA 2XFUA 4TM4A 3VR8A 4CBQA 4U2TA 3M0OA 2E49A 1F3PA 1JRXA 1GXFA 1H84A 5U25A 1DOCA 3Q6JA 4II2A 1VG0A 2YG3A 3AECA 2YG6A 2XFOA 2A89A 4CY6A 3D1CA 4J2WA 1NG4A 3DMEA 1LVLA 2JB2A 2GR2A 5EOWA 4EMIA 5KMRA 1IUVA 1GESA 2XFNA 1ZY8A 4YSHA 2V3BA 2OALA 3T2KA 5BVAA 4JY2A 2C66A 4YSYA 2I0ZA 4K7ZA 2E4AA 1OJDA 3KU9A 3COXA 4FK1C 4H4ZA 3BI2A 4YWOA 3GYIA 4P9SA 4YJHB 4OPGA 1K0JA 2X99A 4TM1A 2EQ6A 3M13A 3L1RA 1IJHA 3P4QA 4H2RA 3Q9TA 3S5WA 1AN9A 3NIXA 4U2LA 3BHFA 1O94A 3AB1A 2RGHA 4XWRA 2PYXA 2XDOA 5M0ZA 4J36A 4AOSA 4RSLA 1TDFA 1OJCA 2BCGG 4EQRA 2RGJA 4YKGA 1GRBA 1VG9A 1H6VA 3EANA 4H4TA 4YJFA 1RSGA 4G73A 4G6GA 2BRAA 3GDPA 4KPRA 4X4JA 4ADWA 2GR3A 5FS6A 1NHQA 3D8XA 2C73A 4CY8A 2AR8A 4B65A 4BJZA 1PN0A 2C7GA 4B68A 4G74A 4A65A 1C0PA 1DAOA 2XVFA 4IA6A 3P4PA 4HB9A 4WX1A 4K2XA 3M12A 1GOSA 4GAVA 1KFYA 3SY4A 2WDVA 4YXDA 3NYFA 5KRQA 2YR5A 3VRDB 2EQ8A 3HYWA 4CCRA 5BRTA 3CNDA 4H4QA 2XFQA 3AE6A 5TR3A 2B9YA 1PBBA 4H4VA 4O5QA 1Z6LA 2NPXA 4NTDA 1PBEA 4BV6A 1CC4A 1C0LA 3NG7X 4K5RA 1PJ5A 1Q1RA 3UKAA 2CULA 4A9WA 1RYIA 4U8PA 3AEBA 1KF6A 1KSUA 3UOYA 2BXRA 3WGTA 1Y0PA 2WOWA 1GRAA 2TMDA 4OPCA 4FDCB 1NPXA 2GQFA 3GYJA 2Q6UA 1Q9IA 3SZFA 3NYEA 2C67A 2GRTA 1PBDA 4J33A 4I58A 3SGLA 3ZNNA 2VVLG 2WU2A 3LJPA 3NYCA 3CNPA 4GAPA 2FJBA 3ICRA 1EL9A 3NN6X 3CPJG 2DU8A 4JDRA 4U8MA 1CJ4A 1E1KA 2GR0A 1F8WA 3NKSA 3NNEA 5HYMA 1IUTA 1JNRA 3QFBA 2WOIA 1ZP0A 2IIDA 2V3AA 4H2NA 4N9XA 5IPYA 3IHMA 1FOHA 2B76A 2V61A 3QJ4A 1IUUA 3CNSA 3IWAA 5KMQA 1MO9A 3DH9A 5JCLA 1D7YA 3CUKA 1B4VA 3GDNA 5CKUA 4ECHA 3G5RA 2XFPA 1YQ3A 4UDQA 1S3BA 3DA1A 5KNLA 2R45A 5ER0A 2BC1A 2R4EA 1FECA 4U8KA 4JNQA 3W4KA 3UCLA 5JCMA 1D4CA 1VQWA 3P4RA 1BF3A 3W4JA 2VQBA 4YJFB 2C4CA 1TDOA 3RHAA 1S2YA 1M64A 3PS9A 1NEKA 1CC6A 4UDPA 3ITJA 3NLCA 2QCUA 1E1MA 2AAQA 1KDGA 5J7XA 4APNA 2H89A 1KNPA 4YTPA 5LV9A 1ZKQA 3WE0A 5KXJA 3GMCA 3FIMB 3CN8A 3NGCX 1GEUA 1GRTA 1JRZA 1CBOA 1FL2A 4K8DA 2OA1A 3GD3A 1K0IA 2XLPA 4LU6A 3AD9B 2CFYA 2BK4A 3JSKA 4EMJA 2YR4A 3UTFA 1QLBA 3SZWA 4B64A 2XCGA 2V6OA 5IQ4A 1N1PA 3UTHA 1L9EA 1PS9A 4IVMB 1RP0A 3T31A 3AXBA 4J34A 3GRSA 5HY5A 4H4WA 3VRBA 2UZZA 3ZNQA 5KVIA 3SZCA 1L9DA 5J60A 2BK3A 4GRTA 1AOGA 4Y4MA 1ZOYA 4GUVA 3NK0X 3C4AA 1PDHA 1QJDA 3REDA 2WDQA 3ATQA 2PHHA 4NEWA 3V3NA 2GAGB 4A6NA 4KX6A 1PHHA 4YJGA 2C3DA 5EBKA 1LTXR 2BABA 1ELIA 3K7QX 3EPTA 4JQ9A 3PVCA 1IUWA 3VQRA 3I3LA 2YG4A 5BUKA 3UOXA 4BK2A 2X8GA 1XANA 2X8HA 1E6EA 1GPEA 3O0HA 4H4RA 5U1OA 1TRBA 4CNJA 1C0IA 3ICSA 1VE9A 2X8CA 4Z26A 1ZMCA 2DKHA 1DNCA 3G5QA 2E4GA 4K5SA 3CNTA 2C75A 2TPRA 1COYA 2YLZA 4LIIA 2J3NA 2XLSA 2OLNA 2QA1A 1GV4A 1YKJA 2C64A 2YLSA 2RGOA 2E1MA 1GETA 3AYLA 4IA5A 3GMBA
chains in the Genus database with same CATH topology
4TM3A 4H4PA 2R4JA 3LOVA 3G5SA 4H4XA 3QFAA 3QVPA 2FBWA 1H7XA 2JBVA 1BGJA 4II3A 5C2TA 1TYPA 3NK2X 1X31B 3UP5A 3SZ0A 3KKJA 3UKLA 3ZNPA 4C77A 1PBFA 2EQ9A 5M10A 3ALMA 2BS3A 3T14A 2QA2A 2JB1A 4OPTA 3SFDA 2WETA 2FJDA 2GMJA 2WP6A 4OPIA 4EQXA 3RP6A 1N4UA 1ZX9A 1IUXA 3SX6A 3VR9A 1MXTA 3FG2P 5BULA 2WQYA 5JCIA 4YJDA 1KSSA 2C70A 2BS4A 2BK5A 1XHCA 2YG5A 4YSZA 3T0KA 3BNUA 1H7WA 2VRMA 3ALLA 2EQ7A 1M6IA 1NHRA 1L0VA 2BA9A 1PXBA 2OLOA 2Q0LA 2YWLA 4YT0A 5KOXA 4NTCA 3DK4A 2Q7VA 1H81A 2WPFA 1GALA 4Z24A 4AP1A 3GD4A 4C3YA 1VRQB 4D04A 3EAOA 2JKCA 3NHOX 1W4XA 3LB8A 4U8JA 3LZWA 2VRLA 3CGBA 4A99A 1B5QA 1IUSA 3ZNOA 1OJTA 2BRYA 2XVEA 1CJ3A 3V76A 1BGNA 1CF3A 1REOA 2YG7A 4JNAA 1SEZA 2R0CA 1NHSA 1DJNA 1XDIA 1D7LA 1B37A 4A79A 1ZDLA 3II4A 3NN0X 3ALJA 2GH5A 3S61A 1OJAA 4OPLA 4B67A 1NHPA 1LQUA 4GR1A 3CNJA 2GR1A 2Y6RA 2YLWA 3B6DA 3E1TA 4C3XA 1GRFA 3ADAB 1DODA 1CJ2A 4B1BA 3F8DA 4H2PA 1QO8A 1GRGA 1LPFA 2JB3A 2WHDA 2X50A 3QVRA 4XWZA 1B8SA 4C74A 4AP3A 2GAHB 2IVDA 3RP8A 3LZXA 2BYBA 2W0HA 1NG3A 5KVHA 1L9CA 1GERA 1F8SA 1GRHA 1O5WA 3NRNA 2YLXA 3NTDA 1D5TA 5KOWA 3CGEA 2C76A 2OAMA 3DK9A 3DK8A 4H4SA 5KMSA 3DJEA 3UOZA 4YSXA 2VZ2A 3PO7A 4YJHA 1BKWA 3EF6A 2GQWA 5KMPA 1H86A 3KVEA 2YAUA 3AE5A 4JY3A 3QSEA 3G3EA 3UOVA 5C3JA 4CNKA 4PABA 2CDUA 5KWFA 2BS2A 3DJDA 2YQUA 1GNDA 2VOUA 3SQPA 3W4IA 1BWCA 2NVKX 4GDEA 2WESA 3AEDA 4DSGA 1FEBA 2APGA 3KLJA 1PXCA 3K7MX 2XLUA 2WP5A 4CRTA 4YTMA 4BK1A 2BCPA 5HXIA 1GSNA 3UKQA 4XXGA 1TDEA 2VQ7A 1GREA 2YLRA 2DKIA 1ZMDA 2E5VA 4GF7A 4USRA 2Z5XA 3CPIG 3H4KA 4TLXA 1N4WA 4AT2A 4NWZA 4Z2TA 4JN9A 2B7RA 4AOXA 5FS9A 1N4VA 3DJGX 3AE4A 4A6NB 3P4SA 1TDKA 3V3OA 2GV8A 1GTHA 4NZHA 5L46A 4BJYA 1UKVG 2FJAA 2E48A 1F6MA 1LJ1A 2ACZA 2ARDA 4B69A 1DOBA 2JK6A 2GMHA 2QAEA 3UKHA 1P2HA 3CMMA 3P1WA 3AEEA 4K22A 3OZ2A 2JAEA 3K7TA 5DBJA 3T2ZA 2Z5YA 1P2EA 3AE3A 2WOVA 3ATRA 3H8IA 2HQMA 4U8IA 4PAAA 3UTEA 3LADA 4EIQA 2YVGA 3AE1A 1H82A 1YY5A 3BI5A 2GB0A 4LA1A 1LQTA 3UTGA 2B9WA 2Q0KA 2X3NA 2GVCA 1K4QA 3AE9A 1E7PA 1EL8A 2WP9A 3QSMA 2C65A 3R9UA 1V59A 2WS3A 2IVEA 3ICTA 2XVJA 3DGHA 3NK1X 4H50A 2Y6QA 5FS8A 2BXSA 4Z25A 1TYTA 3IHGA 1E1LA 1CL0A 2B7SA 2H88A 3CTYA 4G9KA 4RG4A 3OC4A 4Z2RA 3AD7B 4FX9A 3UKPA 2F5ZA 1BZLA 1YQZA 2YVJA 3K30A 4J56A 4EQSA 2XVIA 4WCTA 3AE8A 1DXLA 2XLTA 1E39A 5IQ1A 1GT8A 3AYJA 3CGCA 3L8KA 4H4UA 4CCQA 1JOAA 3AE7A 4J31A 3ABVA 2E82A 3IC9A 3LXDA 3NH3X 3BI4A 4IVOB 1JEHA 4ICYA 2YVFA 3KA7A 4RG3A 1LV0A 1CHUA 1NAAA 2VVMA 3F8RA 4H7UA 2WPEA 2ZZBA 4YJGB 1EL7A 4OCGA 4USQA 3NTAA 3T37A 2RABA 3BHKA 1GTEA 1KNRA 2YM1A 1XPQA 1JNZA 2FJEA 1PBCA 4U8NA 4EMWA 5FS7A 3DJJA 4IV9A 4B66A 4D03A 1DOEA 1C0KA 4ZCDA 3IF9A 4REKA 4Y4LA 3HYVA 3UKFA 4Z2UA 1ZK7A 2WPCA 4EM4A 4O5UA 4ZN0A 1Y56A 3AEGA 1D4DA 4E0VA 3GRTA 4OPUA 3NT6A 1KIFA 1PJ6A 4GDPA 4UP3A 5U63A 4EIPA 1FEAA 3UP4A 1CC2A 2V5ZA 3ZDNA 5JCKA 2R46A 1TDNA 3FBSA 3KD9A 4NEVA 2XYOA 3T2YA 1NENA 2C72A 2VVLA 4GCMA 4BURA 4TLZA 2WEUA 3AEAA 2ZZ0A 3I6DA 4M52A 3VRAA 3GSIA 3URHA 5JCNA 1E1NA 2A8XA 4H2QA 3GYXA 5EB4A 4DNAA 3C96A 1VDCA 5EB5A 3CPHG 1CJCA 4YKFA 4TM0A 5CQFA 2BC0A 3H8LA 3QSSA 4A7AA 3AYIA 2YR6A 3ZYXA 5GRTA 1FCDA 3KPKA 1JU2A 1H83A 1OJ9A 3HYXA 4HA6A 2YLTA 1DDOA 1JRYA 2R9ZA 3FPZA 4X9NA 4B63A 2V60A 4NTEA 3FMWA 3HZLA 3ISHA 1S3EA 2WU5A 4BK3A 3C4NA 4I59A 1EBDA 4U8LA 1PJ7A 3DGZA 3SFEA 1NDAA 2XVHA 3P9UA 4OPDA 1O95A 4EM3A 2AQJA 2O9ZA 3SM8A 2B9XA 3GWFA 3RNMA 4X9MA 1K0LA 1DJQA 4A5LA 4EQWA 2C3CA 2A87A 4AT0A 1Q1WA 3BNMA 3AWIA 4DGKA 4G6HA 1HYUA 4DSHA 4YTNA 4QFCA 2YM2A 3CIRA 4Z44A 3UKKA 4Z43A 4OVIA 5GSNA 4QFDA 3SYIA 4U2SA 2R0PA 2GF3A 3F8PA 2CVJA 3CGDA 1MOKA 4U8OA 3SXIA 4J57A 2GEWA 4H4YA 3KPFA 1ONFA 3AEFA 2ZZCA 4C5OA 3GWDA 1YQ4A 2WBAA 4MJWA 2R0GA 1EVIA 1D4EA 2WDRA 1F8RA 5FMHA 3B3RA 3AE2A 4Y4NA 1EL5A 1PXAA 3AD8B 1ZOVA 2XLRA 1S2QA 2ZBWA 4FK1A 4ZCCA 4UDRA 5HHFA 4TM4A 2BACA 1Y56B 4NNJA 2XFUA 3RP7A 3VR8A 4CBQA 4U2TA 3M0OA 2E49A 1F3PA 1JRXA 1GXFA 1H84A 5U25A 1DOCA 3Q6JA 4II2A 1VG0A 2YG3A 3AECA 2YG6A 2XFOA 2A89A 4CY6A 3D1CA 4J2WA 1NG4A 3DMEA 1LVLA 2JB2A 2GR2A 5EOWA 4EMIA 5KMRA 1IUVA 1GESA 2XFNA 1ZY8A 4YSHA 2V3BA 2OALA 3T2KA 5BVAA 2C66A 4JY2A 4YSYA 2I0ZA 4K7ZA 2E4AA 1OJDA 3KU9A 3COXA 4FK1C 4H4ZA 3BI2A 4YWOA 3GYIA 4P9SA 4YJHB 4OPGA 1K0JA 2X99A 4TM1A 2EQ6A 3M13A 3L1RA 1IJHA 3P4QA 3Q9TA 4H2RA 3S5WA 1AN9A 3NIXA 4U2LA 3BHFA 1O94A 3AB1A 2RGHA 4XWRA 2PYXA 2XDOA 5M0ZA 4J36A 4AOSA 4RSLA 1TDFA 1OJCA 2BCGG 4EQRA 2RGJA 4YKGA 1GRBA 1VG9A 1H6VA 3EANA 4H4TA 4YJFA 1RSGA 4G73A 4G6GA 2BRAA 3GDPA 4KPRA 4X4JA 4ADWA 2GR3A 5FS6A 1NHQA 3D8XA 2C73A 4CY8A 2AR8A 4B65A 2C7GA 1PN0A 4BJZA 4B68A 4G74A 4A65A 1C0PA 1DAOA 2XVFA 4IA6A 3P4PA 4HB9A 4WX1A 4K2XA 3M12A 1GOSA 4GAVA 1KFYA 3SY4A 2WDVA 4YXDA 3NYFA 5KRQA 2YR5A 3VRDB 2EQ8A 3HYWA 4CCRA 5BRTA 3CNDA 4H4QA 2XFQA 3AE6A 5TR3A 2B9YA 1PBBA 4H4VA 4O5QA 1Z6LA 2NPXA 4NTDA 1PBEA 4BV6A 1CC4A 1C0LA 3NG7X 4K5RA 1PJ5A 1Q1RA 3UKAA 2CULA 4A9WA 1RYIA 4U8PA 3AEBA 1KF6A 1KSUA 3UOYA 2BXRA 3WGTA 1Y0PA 2WOWA 1GRAA 2TMDA 4OPCA 4FDCB 1NPXA 2GQFA 3GYJA 2Q6UA 1Q9IA 3SZFA 3NYEA 2C67A 2GRTA 1PBDA 4J33A 4I58A 3SGLA 3ZNNA 2VVLG 2WU2A 3LJPA 3NYCA 3CNPA 4GAPA 2FJBA 3ICRA 1EL9A 3NN6X 3CPJG 2DU8A 4JDRA 4U8MA 1CJ4A 1E1KA 2GR0A 1F8WA 3NKSA 3NNEA 3QFBA 1IUTA 1JNRA 5HYMA 2WOIA 1ZP0A 2IIDA 2V3AA 4H2NA 4N9XA 5IPYA 3IHMA 1FOHA 2B76A 2V61A 3QJ4A 1IUUA 3CNSA 3IWAA 5KMQA 1MO9A 3DH9A 5JCLA 1D7YA 3CUKA 1B4VA 3GDNA 5CKUA 4ECHA 3G5RA 2XFPA 1YQ3A 4UDQA 1S3BA 3DA1A 5KNLA 2R45A 5ER0A 2BC1A 2R4EA 1FECA 4U8KA 4JNQA 3W4KA 3UCLA 5JCMA 1D4CA 1VQWA 3P4RA 1BF3A 3W4JA 2VQBA 4YJFB 2C4CA 1TDOA 3RHAA 1S2YA 1M64A 3PS9A 1NEKA 1CC6A 4UDPA 3ITJA 3NLCA 2QCUA 1E1MA 2AAQA 1KDGA 5J7XA 4APNA 2H89A 1KNPA 4YTPA 5LV9A 1ZKQA 3WE0A 5KXJA 3FIMB 3GMCA 3CN8A 3NGCX 1GEUA 1GRTA 1JRZA 1CBOA 1FL2A 4K8DA 2OA1A 3GD3A 1K0IA 2XLPA 4LU6A 3AD9B 2CFYA 2BK4A 3JSKA 4EMJA 2YR4A 3UTFA 1QLBA 3SZWA 4B64A 2XCGA 2V6OA 5IQ4A 1N1PA 3UTHA 1L9EA 1PS9A 4IVMB 1RP0A 3T31A 3AXBA 4J34A 3GRSA 5HY5A 4H4WA 3VRBA 2UZZA 3ZNQA 5KVIA 3SZCA 1L9DA 5J60A 2BK3A 4GRTA 1AOGA 4Y4MA 1ZOYA 4GUVA 3NK0X 3C4AA 1PDHA 1QJDA 3REDA 2WDQA 3ATQA 2PHHA 4NEWA 3V3NA 2GAGB 4A6NA 4KX6A 1PHHA 4YJGA 2C3DA 5EBKA 1LTXR 2BABA 1ELIA 3K7QX 3EPTA 4JQ9A 3PVCA 1IUWA 3VQRA 3I3LA 2YG4A 5BUKA 3UOXA 4BK2A 2X8GA 1XANA 2X8HA 1E6EA 1GPEA 3O0HA 4H4RA 5U1OA 1TRBA 4CNJA 1C0IA 3ICSA 1VE9A 2X8CA 4Z26A 1ZMCA 2DKHA 1DNCA 3G5QA 2E4GA 4K5SA 3CNTA 2C75A 2TPRA 1COYA 2YLZA 4LIIA 2J3NA 2XLSA 2OLNA 2QA1A 1GV4A 1YKJA 2C64A 2YLSA 2RGOA 2E1MA 1GETA 3AYLA 4IA5A 3GMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM3 A;  4H4P A;  2R4J A;  3LOV A;  3G5S A;  4H4X A;  3QFA A;  3QVP A;  2FBW A;  1H7X A;  2JBV A;  1BGJ A;  5C2T A;  1TYP A;  3NK2 X;  1X31 B;  3UP5 A;  3KKJ A;  3UKL A;  3ZNP A;  4C77 A;  1PBF A;  2EQ9 A;  5M10 A;  3ALM A;  2BS3 A;  2QA2 A;  2JB1 A;  4OPT A;  3SFD A;  2WET A;  2FJD A;  2GMJ A;  2WP6 A;  4OPI A;  4EQX A;  3RP6 A;  1N4U A;  1ZX9 A;  1IUX A;  3VR9 A;  1MXT A;  3FG2 P;  5BUL A;  2WQY A;  5JCI A;  4YJD A;  1KSS A;  2C70 A;  2BS4 A;  2BK5 A;  1XHC A;  2YG5 A;  4YSZ A;  3BNU A;  1H7W A;  2VRM A;  3ALL A;  2EQ7 A;  1M6I A;  1NHR A;  1L0V A;  2BA9 A;  1PXB A;  2OLO A;  2Q0L A;  2YWL A;  4YT0 A;  5KOX A;  4NTC A;  3DK4 A;  2Q7V A;  1H81 A;  2WPF A;  1GAL A;  4Z24 A;  4AP1 A;  3GD4 A;  4C3Y A;  1VRQ B;  4D04 A;  3EAO A;  2JKC A;  3NHO X;  1W4X A;  3LB8 A;  4U8J A;  3LZW A;  2VRL A;  3CGB A;  4A99 A;  1B5Q A;  1IUS A;  3ZNO A;  1OJT A;  3V76 A;  2XVE A;  1CJ3 A;  1BGN A;  1CF3 A;  1REO A;  2YG7 A;  4JNA A;  1SEZ A;  2R0C A;  1NHS A;  1DJN A;  1XDI A;  1D7L A;  1B37 A;  4A79 A;  1ZDL A;  3II4 A;  3NN0 X;  3ALJ A;  2GH5 A;  3S61 A;  1OJA A;  4OPL A;  4B67 A;  1NHP A;  1LQU A;  4GR1 A;  3CNJ A;  2GR1 A;  2Y6R A;  2YLW A;  3B6D A;  3E1T A;  4C3X A;  1GRF A;  3ADA B;  1DOD A;  1CJ2 A;  4B1B A;  3F8D A;  4H2P A;  1QO8 A;  1GRG A;  1LPF A;  2JB3 A;  2WHD A;  2X50 A;  3QVR A;  4XWZ A;  1B8S A;  4C74 A;  4AP3 A;  2GAH B;  2IVD A;  3RP8 A;  3LZX A;  2BYB A;  2W0H A;  1NG3 A;  5KVH A;  1L9C A;  1GER A;  1F8S A;  1GRH A;  1O5W A;  3NRN A;  2YLX A;  3NTD A;  1D5T A;  5KOW A;  3CGE A;  2C76 A;  2OAM A;  3DK9 A;  3DK8 A;  4H4S A;  3DJE A;  3UOZ A;  4YSX A;  2VZ2 A;  3PO7 A;  4YJH A;  1BKW A;  3EF6 A;  2GQW A;  1H86 A;  3KVE A;  2YAU A;  3AE5 A;  4JY3 A;  3QSE A;  3G3E A;  3UOV A;  5C3J A;  4CNK A;  4PAB A;  2CDU A;  5KWF A;  2BS2 A;  3DJD A;  2YQU A;  1GND A;  2VOU A;  3SQP A;  3W4I A;  1BWC A;  2NVK X;  4GDE A;  2WES A;  3AED A;  4DSG A;  1FEB A;  2APG A;  3KLJ A;  1PXC A;  3K7M X;  2XLU A;  2WP5 A;  4CRT A;  4YTM A;  4BK1 A;  2BCP A;  5HXI A;  1GSN A;  3UKQ A;  4XXG A;  1TDE A;  2VQ7 A;  1GRE A;  2YLR A;  2DKI A;  1ZMD A;  2E5V A;  4GF7 A;  4USR A;  2Z5X A;  3CPI G;  3H4K A;  4TLX A;  1N4W A;  4AT2 A;  4Z2T A;  4JN9 A;  2B7R A;  4AOX A;  5FS9 A;  1N4V A;  3DJG X;  3AE4 A;  4A6N B;  3P4S A;  1TDK A;  3V3O A;  2GV8 A;  1GTH A;  4NZH A;  5L46 A;  4BJY A;  1UKV G;  2FJA A;  2E48 A;  1F6M A;  1LJ1 A;  2ACZ A;  2ARD A;  4B69 A;  1DOB A;  2JK6 A;  2GMH A;  2QAE A;  3UKH A;  1P2H A;  3P1W A;  3AEE A;  4K22 A;  3OZ2 A;  2JAE A;  3K7T A;  5DBJ A;  4BV6 A;  2Z5Y A;  1P2E A;  3AE3 A;  2WOV A;  3ATR A;  3H8I A;  2HQM A;  4U8I A;  4PAA A;  3UTE A;  3LAD A;  4EIQ A;  2YVG A;  3AE1 A;  1H82 A;  1YY5 A;  3BI5 A;  2GB0 A;  4LA1 A;  1LQT A;  3UTG A;  2B9W A;  2Q0K A;  2X3N A;  2GVC A;  1K4Q A;  3AE9 A;  1E7P A;  1EL8 A;  2WP9 A;  3QSM A;  2C65 A;  3R9U A;  1V59 A;  2WS3 A;  2IVE A;  3ICT A;  2XVJ A;  3DGH A;  3NK1 X;  4H50 A;  2Y6Q A;  5FS8 A;  2BXS A;  4Z25 A;  1TYT A;  3IHG A;  1E1L A;  1CL0 A;  2B7S A;  2H88 A;  3CTY A;  4RG4 A;  3OC4 A;  4Z2R A;  3AD7 B;  4FX9 A;  3UKP A;  2F5Z A;  1BZL A;  1YQZ A;  2YVJ A;  3K30 A;  4J56 A;  4EQS A;  2XVI A;  4WCT A;  3AE8 A;  1DXL A;  2XLT A;  1E39 A;  5IQ1 A;  1GT8 A;  3AYJ A;  3CGC A;  3L8K A;  4H4U A;  4CCQ A;  1JOA A;  3AE7 A;  4J31 A;  3ABV A;  2E82 A;  3IC9 A;  3LXD A;  3NH3 X;  3BI4 A;  4IVO B;  1JEH A;  4ICY A;  2YVF A;  3KA7 A;  4RG3 A;  1LV0 A;  1CHU A;  1NAA A;  2VVM A;  3F8R A;  4H7U A;  2WPE A;  2ZZB A;  4YJG B;  1EL7 A;  4OCG A;  4USQ A;  3NTA A;  3T37 A;  2RAB A;  3BHK A;  1GTE A;  1KNR A;  2YM1 A;  1XPQ A;  1JNZ A;  2FJE A;  1PBC A;  4U8N A;  4EMW A;  5FS7 A;  3DJJ A;  4IV9 A;  4B66 A;  4D03 A;  1DOE A;  1C0K A;  4ZCD A;  3IF9 A;  4REK A;  4Y4L A;  3UKF A;  4Z2U A;  1ZK7 A;  2WPC A;  4EM4 A;  4O5U A;  4ZN0 A;  1Y56 A;  3AEG A;  1D4D A;  4E0V A;  3GRT A;  4OPU A;  3NT6 A;  1KIF A;  1PJ6 A;  4GDP A;  4UP3 A;  5U63 A;  4EIP A;  1FEA A;  3UP4 A;  1CC2 A;  2V5Z A;  3ZDN A;  5JCK A;  2R46 A;  1TDN A;  3FBS A;  3KD9 A;  4NEV A;  2XYO A;  1NEN A;  2C72 A;  2VVL A;  4GCM A;  4BUR A;  4TLZ A;  2WEU A;  3AEA A;  2ZZ0 A;  3I6D A;  4M52 A;  3VRA A;  3GSI A;  3URH A;  5JCN A;  1E1N A;  2A8X A;  4H2Q A;  4DNA A;  5EB4 A;  3C96 A;  1VDC A;  5EB5 A;  3CPH G;  1CJC A;  4YKF A;  4TM0 A;  5CQF A;  2BC0 A;  3H8L A;  3QSS A;  4A7A A;  3AYI A;  2YR6 A;  3ZYX A;  5GRT A;  1FCD A;  1JU2 A;  1H83 A;  1OJ9 A;  4HA6 A;  2YLT A;  1DDO A;  1JRY A;  2R9Z A;  3FPZ A;  4X9N A;  4B63 A;  2V60 A;  4NTE A;  3FMW A;  3HZL A;  3ISH A;  1S3E A;  2WU5 A;  4BK3 A;  3C4N A;  4I59 A;  1EBD A;  4U8L A;  1PJ7 A;  3DGZ A;  3SFE A;  1NDA A;  2XVH A;  3P9U A;  4OPD A;  1O95 A;  4EM3 A;  2AQJ A;  2O9Z A;  3SM8 A;  2B9X A;  3GWF A;  3RNM A;  4X9M A;  1K0L A;  1DJQ A;  4A5L A;  4EQW A;  2C3C A;  2A87 A;  4AT0 A;  1Q1W A;  3BNM A;  3AWI A;  4DGK A;  4DSH A;  1HYU A;  4YTN A;  4Z43 A;  4QFC A;  2YM2 A;  3CIR A;  4Z44 A;  3UKK A;  4OVI A;  5GSN A;  4QFD A;  4U2S A;  2R0P A;  2GF3 A;  3F8P A;  2CVJ A;  3CGD A;  1MOK A;  4U8O A;  4J57 A;  2GEW A;  4H4Y A;  3KPF A;  1ONF A;  3AEF A;  2ZZC A;  4C5O A;  3GWD A;  1YQ4 A;  2WBA A;  4MJW A;  2R0G A;  1EVI A;  1D4E A;  2WDR A;  1F8R A;  5FMH A;  3B3R A;  3AE2 A;  4Y4N A;  1EL5 A;  1PXA A;  3AD8 B;  1ZOV A;  2XLR A;  1S2Q A;  2ZBW A;  4FK1 A;  4ZCC A;  4UDR A;  5HHF A;  4TM4 A;  2BAC A;  1Y56 B;  3RP7 A;  2XFU A;  3VR8 A;  4CBQ A;  4U2T A;  3M0O A;  2E49 A;  1F3P A;  1JRX A;  1GXF A;  1H84 A;  5U25 A;  1DOC A;  3Q6J A;  1VG0 A;  2YG3 A;  3AEC A;  2YG6 A;  2XFO A;  2A89 A;  4CY6 A;  3D1C A;  4J2W A;  1NG4 A;  3DME A;  1LVL A;  2JB2 A;  2GR2 A;  5EOW A;  4EMI A;  1IUV A;  1GES A;  2XFN A;  1ZY8 A;  4YSH A;  2V3B A;  2OAL A;  5BVA A;  2C66 A;  4JY2 A;  4YSY A;  2I0Z A;  4K7Z A;  2E4A A;  1OJD A;  3KU9 A;  3COX A;  4FK1 C;  4H4Z A;  3BI2 A;  4YWO A;  3GYI A;  4P9S A;  4YJH B;  4OPG A;  1K0J A;  2X99 A;  4TM1 A;  2EQ6 A;  3M13 A;  3L1R A;  1IJH A;  3P4Q A;  3Q9T A;  4H2R A;  3S5W A;  1AN9 A;  3NIX A;  4U2L A;  3BHF A;  1O94 A;  3AB1 A;  2RGH A;  4XWR A;  2PYX A;  2XDO A;  5M0Z A;  4J36 A;  4AOS A;  4RSL A;  1TDF A;  1OJC A;  2BCG G;  4EQR A;  2RGJ A;  4YKG A;  1GRB A;  1VG9 A;  1H6V A;  3EAN A;  4H4T A;  4YJF A;  1RSG A;  4KPR A;  4ADW A;  3GDP A;  4X4J A;  2GR3 A;  5FS6 A;  1NHQ A;  3D8X A;  2C73 A;  4CY8 A;  2AR8 A;  4B65 A;  2C7G A;  1PN0 A;  4BJZ A;  4B68 A;  4A65 A;  1C0P A;  1DAO A;  2XVF A;  4IA6 A;  3P4P A;  4HB9 A;  4WX1 A;  4K2X A;  3M12 A;  1GOS A;  1KFY A;  2WDV A;  4YXD A;  3NYF A;  5KRQ A;  2YR5 A;  3VRD B;  2EQ8 A;  5BRT A;  4CCR A;  3CND A;  4H4Q A;  2XFQ A;  3AE6 A;  5TR3 A;  2B9Y A;  1PBB A;  4H4V A;  4O5Q A;  1Z6L A;  2NPX A;  4NTD A;  1PBE A;  1CC4 A;  1C0L A;  3NG7 X;  4K5R A;  1PJ5 A;  1Q1R A;  3UKA A;  2CUL A;  4A9W A;  1RYI A;  4U8P A;  3AEB A;  1KF6 A;  1KSU A;  3UOY A;  2BXR A;  3WGT A;  1Y0P A;  2WOW A;  1GRA A;  2TMD A;  4OPC A;  4FDC B;  1NPX A;  2GQF A;  3GYJ A;  2Q6U A;  1Q9I A;  3NYE A;  2C67 A;  2GRT A;  1PBD A;  4J33 A;  4I58 A;  3SGL A;  3ZNN A;  2VVL G;  2WU2 A;  3LJP A;  3NYC A;  3CNP A;  2FJB A;  3ICR A;  1EL9 A;  3NN6 X;  3CPJ G;  2DU8 A;  4JDR A;  4U8M A;  1CJ4 A;  1E1K A;  2GR0 A;  1F8W A;  3NKS A;  3NNE A;  3QFB A;  1IUT A;  1JNR A;  5HYM A;  2WOI A;  1ZP0 A;  2IID A;  2V3A A;  4H2N A;  4N9X A;  5IPY A;  3IHM A;  1FOH A;  2B76 A;  2V61 A;  3QJ4 A;  1IUU A;  3CNS A;  3IWA A;  1MO9 A;  3DH9 A;  5JCL A;  1D7Y A;  3CUK A;  1B4V A;  3GDN A;  5CKU A;  4ECH A;  3G5R A;  2XFP A;  1YQ3 A;  4UDQ A;  1S3B A;  3DA1 A;  2R45 A;  5ER0 A;  2BC1 A;  2R4E A;  1FEC A;  4U8K A;  4JNQ A;  3W4K A;  3UCL A;  5JCM A;  1D4C A;  1VQW A;  3P4R A;  1BF3 A;  3W4J A;  2VQB A;  4YJF B;  3RHA A;  1TDO A;  1S2Y A;  1M64 A;  3PS9 A;  1NEK A;  1CC6 A;  4UDP A;  3ITJ A;  3NLC A;  2QCU A;  1E1M A;  2AAQ A;  1KDG A;  5J7X A;  4APN A;  2H89 A;  1KNP A;  4YTP A;  5LV9 A;  1ZKQ A;  3WE0 A;  5KXJ A;  3FIM B;  3GMC A;  3CN8 A;  3NGC X;  1GEU A;  1GRT A;  1JRZ A;  1CBO A;  1FL2 A;  4K8D A;  2OA1 A;  3GD3 A;  1K0I A;  2XLP A;  4LU6 A;  3AD9 B;  2CFY A;  2BK4 A;  3JSK A;  4EMJ A;  2YR4 A;  3UTF A;  1QLB A;  4B64 A;  2XCG A;  2V6O A;  5IQ4 A;  1N1P A;  3UTH A;  1L9E A;  1PS9 A;  4IVM B;  1RP0 A;  3AXB A;  4J34 A;  3GRS A;  5HY5 A;  4H4W A;  3VRB A;  2UZZ A;  3ZNQ A;  5KVI A;  5J60 A;  1L9D A;  2BK3 A;  4GRT A;  1AOG A;  4Y4M A;  1ZOY A;  4GUV A;  3NK0 X;  3C4A A;  1PDH A;  1QJD A;  3RED A;  2WDQ A;  3ATQ A;  2PHH A;  4NEW A;  3V3N A;  2GAG B;  4A6N A;  4KX6 A;  1PHH A;  4YJG A;  2C3D A;  5EBK A;  1LTX R;  2BAB A;  1ELI A;  3K7Q X;  3EPT A;  4JQ9 A;  3PVC A;  1IUW A;  3VQR A;  3I3L A;  2YG4 A;  5BUK A;  3UOX A;  4BK2 A;  2X8G A;  1XAN A;  2X8H A;  1E6E A;  1GPE A;  3O0H A;  4H4R A;  5U1O A;  1TRB A;  4CNJ A;  1C0I A;  3ICS A;  1VE9 A;  2X8C A;  4Z26 A;  1ZMC A;  2DKH A;  1DNC A;  3G5Q A;  2E4G A;  4K5S A;  3CNT A;  2C75 A;  2TPR A;  1COY A;  2YLZ A;  4LII A;  2J3N A;  2XLS A;  2OLN A;  2QA1 A;  1GV4 A;  1YKJ A;  2C64 A;  2YLS A;  2RGO A;  2E1M A;  1GET A;  3AYL A;  4IA5 A;  3GMB A; 
#chains in the Genus database with same CATH topology
 4TM3 A;  4H4P A;  2R4J A;  3LOV A;  3G5S A;  4H4X A;  3QFA A;  3QVP A;  2FBW A;  1H7X A;  2JBV A;  1BGJ A;  4II3 A;  5C2T A;  1TYP A;  3NK2 X;  1X31 B;  3UP5 A;  3SZ0 A;  3KKJ A;  3UKL A;  3ZNP A;  4C77 A;  1PBF A;  2EQ9 A;  5M10 A;  3ALM A;  2BS3 A;  3T14 A;  2QA2 A;  2JB1 A;  4OPT A;  3SFD A;  2WET A;  2GMJ A;  2FJD A;  2WP6 A;  4OPI A;  4EQX A;  3RP6 A;  1N4U A;  1ZX9 A;  1IUX A;  3SX6 A;  3VR9 A;  1MXT A;  3FG2 P;  5BUL A;  2WQY A;  5JCI A;  4YJD A;  1KSS A;  2C70 A;  2BS4 A;  2BK5 A;  1XHC A;  2YG5 A;  4YSZ A;  3T0K A;  3BNU A;  1H7W A;  2VRM A;  3ALL A;  2EQ7 A;  1M6I A;  1NHR A;  1L0V A;  2BA9 A;  1PXB A;  2OLO A;  2Q0L A;  2YWL A;  4YT0 A;  5KOX A;  4NTC A;  3DK4 A;  2Q7V A;  1H81 A;  2WPF A;  1GAL A;  4Z24 A;  4AP1 A;  3GD4 A;  4C3Y A;  1VRQ B;  4D04 A;  3EAO A;  2JKC A;  3NHO X;  1W4X A;  3LB8 A;  4U8J A;  3LZW A;  2VRL A;  3CGB A;  4A99 A;  1B5Q A;  1IUS A;  3ZNO A;  1OJT A;  2BRY A;  2XVE A;  1CJ3 A;  3V76 A;  1BGN A;  1CF3 A;  1REO A;  2YG7 A;  4JNA A;  1SEZ A;  2R0C A;  1NHS A;  1DJN A;  1XDI A;  1D7L A;  1B37 A;  4A79 A;  1ZDL A;  3II4 A;  3NN0 X;  3ALJ A;  2GH5 A;  3S61 A;  1OJA A;  4OPL A;  4B67 A;  1NHP A;  1LQU A;  4GR1 A;  3CNJ A;  2GR1 A;  2Y6R A;  3E1T A;  2YLW A;  3B6D A;  4C3X A;  1GRF A;  3ADA B;  1DOD A;  1CJ2 A;  4B1B A;  3F8D A;  4H2P A;  1QO8 A;  1GRG A;  1LPF A;  2JB3 A;  2WHD A;  2X50 A;  3QVR A;  4XWZ A;  1B8S A;  4C74 A;  4AP3 A;  2GAH B;  3RP8 A;  2IVD A;  3LZX A;  2BYB A;  2W0H A;  1NG3 A;  5KVH A;  1L9C A;  1GER A;  1F8S A;  1GRH A;  1O5W A;  3NRN A;  2YLX A;  3NTD A;  1D5T A;  5KOW A;  3CGE A;  2C76 A;  2OAM A;  3DK9 A;  3DK8 A;  4H4S A;  5KMS A;  3DJE A;  3UOZ A;  4YSX A;  2VZ2 A;  3PO7 A;  4YJH A;  1BKW A;  3EF6 A;  2GQW A;  5KMP A;  1H86 A;  3KVE A;  2YAU A;  3AE5 A;  4JY3 A;  3QSE A;  3G3E A;  3UOV A;  5C3J A;  4CNK A;  4PAB A;  2CDU A;  5KWF A;  2BS2 A;  3DJD A;  2YQU A;  1GND A;  2VOU A;  3SQP A;  3W4I A;  1BWC A;  2NVK X;  4GDE A;  2WES A;  3AED A;  4DSG A;  1FEB A;  2APG A;  3KLJ A;  1PXC A;  3K7M X;  2XLU A;  2WP5 A;  4CRT A;  4BK1 A;  4YTM A;  5HXI A;  2BCP A;  1GSN A;  3UKQ A;  4XXG A;  1TDE A;  2VQ7 A;  1GRE A;  2YLR A;  2DKI A;  1ZMD A;  2E5V A;  4GF7 A;  4USR A;  2Z5X A;  3CPI G;  3H4K A;  4TLX A;  1N4W A;  4AT2 A;  4NWZ A;  4Z2T A;  4JN9 A;  2B7R A;  4AOX A;  5FS9 A;  1N4V A;  3DJG X;  3AE4 A;  4A6N B;  3P4S A;  1TDK A;  3V3O A;  2GV8 A;  1GTH A;  4NZH A;  4BJY A;  5L46 A;  1UKV G;  2FJA A;  2E48 A;  1F6M A;  1LJ1 A;  2ACZ A;  2ARD A;  4B69 A;  1DOB A;  2JK6 A;  2GMH A;  2QAE A;  3UKH A;  1P2H A;  3CMM A;  3P1W A;  3AEE A;  4K22 A;  3OZ2 A;  2JAE A;  3K7T A;  5DBJ A;  3T2Z A;  2Z5Y A;  1P2E A;  3AE3 A;  2WOV A;  3ATR A;  3H8I A;  2HQM A;  4U8I A;  4PAA A;  3UTE A;  4EIQ A;  3LAD A;  2YVG A;  3AE1 A;  1H82 A;  1YY5 A;  3BI5 A;  2GB0 A;  4LA1 A;  1LQT A;  3UTG A;  2X3N A;  2B9W A;  2Q0K A;  2GVC A;  1K4Q A;  3AE9 A;  1E7P A;  1EL8 A;  2WP9 A;  3QSM A;  2C65 A;  3R9U A;  1V59 A;  2WS3 A;  2IVE A;  3ICT A;  2XVJ A;  3DGH A;  3NK1 X;  4H50 A;  2Y6Q A;  5FS8 A;  2BXS A;  4Z25 A;  1TYT A;  3IHG A;  1E1L A;  1CL0 A;  2B7S A;  2H88 A;  3CTY A;  4G9K A;  4RG4 A;  3OC4 A;  4Z2R A;  3AD7 B;  4FX9 A;  3UKP A;  2F5Z A;  1BZL A;  1YQZ A;  2YVJ A;  3K30 A;  4J56 A;  4EQS A;  2XVI A;  4WCT A;  3AE8 A;  1DXL A;  2XLT A;  1E39 A;  5IQ1 A;  1GT8 A;  3AYJ A;  3CGC A;  3L8K A;  4H4U A;  4CCQ A;  1JOA A;  3AE7 A;  4J31 A;  3ABV A;  2E82 A;  3IC9 A;  3LXD A;  3NH3 X;  3BI4 A;  4IVO B;  1JEH A;  4ICY A;  2YVF A;  3KA7 A;  4RG3 A;  1LV0 A;  1CHU A;  1NAA A;  2VVM A;  3F8R A;  4H7U A;  2WPE A;  2ZZB A;  4YJG B;  1EL7 A;  4OCG A;  4USQ A;  3NTA A;  3T37 A;  2RAB A;  3BHK A;  1GTE A;  1KNR A;  2YM1 A;  1XPQ A;  1JNZ A;  2FJE A;  1PBC A;  4U8N A;  4EMW A;  5FS7 A;  3DJJ A;  4IV9 A;  4B66 A;  4D03 A;  1DOE A;  1C0K A;  4ZCD A;  3IF9 A;  4REK A;  4Y4L A;  3HYV A;  3UKF A;  4Z2U A;  1ZK7 A;  2WPC A;  4EM4 A;  4O5U A;  4ZN0 A;  1Y56 A;  3AEG A;  1D4D A;  4E0V A;  3GRT A;  4OPU A;  3NT6 A;  1KIF A;  1PJ6 A;  4GDP A;  4EIP A;  4UP3 A;  5U63 A;  1FEA A;  3UP4 A;  1CC2 A;  2V5Z A;  3ZDN A;  5JCK A;  2R46 A;  1TDN A;  3FBS A;  3KD9 A;  4NEV A;  2XYO A;  3T2Y A;  1NEN A;  2C72 A;  2VVL A;  4GCM A;  4BUR A;  4TLZ A;  2WEU A;  3AEA A;  2ZZ0 A;  3I6D A;  4M52 A;  3VRA A;  3GSI A;  3URH A;  5JCN A;  1E1N A;  4H2Q A;  2A8X A;  3GYX A;  5EB4 A;  4DNA A;  3C96 A;  1VDC A;  5EB5 A;  3CPH G;  1CJC A;  4YKF A;  4TM0 A;  5CQF A;  2BC0 A;  3H8L A;  3QSS A;  4A7A A;  3AYI A;  2YR6 A;  3ZYX A;  5GRT A;  1FCD A;  3KPK A;  1JU2 A;  1H83 A;  1OJ9 A;  3HYX A;  4HA6 A;  2YLT A;  1DDO A;  1JRY A;  2R9Z A;  3FPZ A;  4X9N A;  4B63 A;  2V60 A;  4NTE A;  3FMW A;  4BK3 A;  3HZL A;  1S3E A;  2WU5 A;  3ISH A;  3C4N A;  4I59 A;  1EBD A;  4U8L A;  1PJ7 A;  3DGZ A;  3SFE A;  1NDA A;  2XVH A;  3P9U A;  4OPD A;  1O95 A;  4EM3 A;  2AQJ A;  2O9Z A;  3SM8 A;  2B9X A;  3GWF A;  3RNM A;  4X9M A;  1K0L A;  1DJQ A;  4A5L A;  4EQW A;  2C3C A;  2A87 A;  4AT0 A;  1Q1W A;  3BNM A;  3AWI A;  4DGK A;  4G6H A;  1HYU A;  4DSH A;  4YTN A;  4QFC A;  2YM2 A;  3CIR A;  4Z44 A;  3UKK A;  4Z43 A;  4OVI A;  5GSN A;  4QFD A;  3SYI A;  4U2S A;  2R0P A;  2GF3 A;  3F8P A;  2CVJ A;  3CGD A;  1MOK A;  4U8O A;  3SXI A;  4J57 A;  2GEW A;  4H4Y A;  3KPF A;  1ONF A;  3AEF A;  2ZZC A;  4C5O A;  3GWD A;  1YQ4 A;  2WBA A;  4MJW A;  2R0G A;  1EVI A;  1D4E A;  2WDR A;  1F8R A;  5FMH A;  3B3R A;  3AE2 A;  4Y4N A;  1EL5 A;  1PXA A;  3AD8 B;  1ZOV A;  2XLR A;  1S2Q A;  2ZBW A;  4FK1 A;  4ZCC A;  4UDR A;  5HHF A;  3RP7 A;  2BAC A;  1Y56 B;  4NNJ A;  2XFU A;  4TM4 A;  3VR8 A;  4CBQ A;  4U2T A;  3M0O A;  2E49 A;  1F3P A;  1JRX A;  1GXF A;  1H84 A;  5U25 A;  1DOC A;  3Q6J A;  4II2 A;  1VG0 A;  2YG3 A;  3AEC A;  2YG6 A;  2XFO A;  2A89 A;  4CY6 A;  3D1C A;  4J2W A;  1NG4 A;  3DME A;  1LVL A;  2JB2 A;  2GR2 A;  5EOW A;  4EMI A;  5KMR A;  1IUV A;  1GES A;  2XFN A;  1ZY8 A;  4YSH A;  2V3B A;  2OAL A;  3T2K A;  5BVA A;  4JY2 A;  2C66 A;  4YSY A;  2I0Z A;  4K7Z A;  2E4A A;  1OJD A;  3KU9 A;  3COX A;  4FK1 C;  4H4Z A;  3BI2 A;  4YWO A;  3GYI A;  4P9S A;  4YJH B;  4OPG A;  1K0J A;  2X99 A;  4TM1 A;  2EQ6 A;  3M13 A;  3L1R A;  1IJH A;  3P4Q A;  4H2R A;  3Q9T A;  3S5W A;  1AN9 A;  3NIX A;  4U2L A;  3BHF A;  1O94 A;  3AB1 A;  2RGH A;  4XWR A;  2PYX A;  2XDO A;  5M0Z A;  4J36 A;  4AOS A;  4RSL A;  1TDF A;  1OJC A;  2BCG G;  4EQR A;  2RGJ A;  4YKG A;  1GRB A;  1VG9 A;  1H6V A;  3EAN A;  4H4T A;  4YJF A;  1RSG A;  4G73 A;  4G6G A;  2BRA A;  3GDP A;  4KPR A;  4X4J A;  4ADW A;  2GR3 A;  5FS6 A;  1NHQ A;  3D8X A;  2C73 A;  4CY8 A;  2AR8 A;  4B65 A;  4BJZ A;  1PN0 A;  2C7G A;  4B68 A;  4G74 A;  4A65 A;  1C0P A;  1DAO A;  2XVF A;  4IA6 A;  3P4P A;  4HB9 A;  4WX1 A;  4K2X A;  3M12 A;  1GOS A;  4GAV A;  1KFY A;  3SY4 A;  2WDV A;  4YXD A;  3NYF A;  5KRQ A;  2YR5 A;  3VRD B;  2EQ8 A;  3HYW A;  4CCR A;  5BRT A;  3CND A;  4H4Q A;  2XFQ A;  3AE6 A;  5TR3 A;  2B9Y A;  1PBB A;  4H4V A;  4O5Q A;  1Z6L A;  2NPX A;  4NTD A;  1PBE A;  4BV6 A;  1CC4 A;  1C0L A;  3NG7 X;  4K5R A;  1PJ5 A;  1Q1R A;  3UKA A;  2CUL A;  4A9W A;  1RYI A;  4U8P A;  3AEB A;  1KF6 A;  1KSU A;  3UOY A;  2BXR A;  3WGT A;  1Y0P A;  2WOW A;  1GRA A;  2TMD A;  4OPC A;  4FDC B;  1NPX A;  2GQF A;  3GYJ A;  2Q6U A;  1Q9I A;  3SZF A;  3NYE A;  2C67 A;  2GRT A;  1PBD A;  4J33 A;  4I58 A;  3SGL A;  3ZNN A;  2VVL G;  2WU2 A;  3LJP A;  3NYC A;  3CNP A;  4GAP A;  2FJB A;  3ICR A;  1EL9 A;  3NN6 X;  3CPJ G;  2DU8 A;  4JDR A;  4U8M A;  1CJ4 A;  1E1K A;  2GR0 A;  1F8W A;  3NKS A;  3NNE A;  5HYM A;  1IUT A;  1JNR A;  3QFB A;  2WOI A;  1ZP0 A;  2IID A;  2V3A A;  4H2N A;  4N9X A;  5IPY A;  3IHM A;  1FOH A;  2B76 A;  2V61 A;  3QJ4 A;  1IUU A;  3CNS A;  3IWA A;  5KMQ A;  1MO9 A;  3DH9 A;  5JCL A;  1D7Y A;  3CUK A;  1B4V A;  3GDN A;  5CKU A;  4ECH A;  3G5R A;  2XFP A;  1YQ3 A;  4UDQ A;  1S3B A;  3DA1 A;  5KNL A;  2R45 A;  5ER0 A;  2BC1 A;  2R4E A;  1FEC A;  4U8K A;  4JNQ A;  3W4K A;  3UCL A;  5JCM A;  1D4C A;  1VQW A;  3P4R A;  1BF3 A;  3W4J A;  2VQB A;  4YJF B;  2C4C A;  1TDO A;  3RHA A;  1S2Y A;  1M64 A;  3PS9 A;  1NEK A;  1CC6 A;  4UDP A;  3ITJ A;  3NLC A;  2QCU A;  1E1M A;  2AAQ A;  1KDG A;  5J7X A;  4APN A;  2H89 A;  1KNP A;  4YTP A;  5LV9 A;  1ZKQ A;  3WE0 A;  5KXJ A;  3GMC A;  3FIM B;  3CN8 A;  3NGC X;  1GEU A;  1GRT A;  1JRZ A;  1CBO A;  1FL2 A;  4K8D A;  2OA1 A;  3GD3 A;  1K0I A;  2XLP A;  4LU6 A;  3AD9 B;  2CFY A;  2BK4 A;  3JSK A;  4EMJ A;  2YR4 A;  3UTF A;  1QLB A;  3SZW A;  4B64 A;  2XCG A;  2V6O A;  5IQ4 A;  1N1P A;  3UTH A;  1L9E A;  1PS9 A;  4IVM B;  1RP0 A;  3T31 A;  3AXB A;  4J34 A;  3GRS A;  5HY5 A;  4H4W A;  3VRB A;  2UZZ A;  3ZNQ A;  5KVI A;  3SZC A;  1L9D A;  5J60 A;  2BK3 A;  4GRT A;  1AOG A;  4Y4M A;  1ZOY A;  4GUV A;  3NK0 X;  3C4A A;  1PDH A;  1QJD A;  3RED A;  2WDQ A;  3ATQ A;  2PHH A;  4NEW A;  3V3N A;  2GAG B;  4A6N A;  4KX6 A;  1PHH A;  4YJG A;  2C3D A;  5EBK A;  1LTX R;  2BAB A;  1ELI A;  3K7Q X;  3EPT A;  4JQ9 A;  3PVC A;  1IUW A;  3VQR A;  3I3L A;  2YG4 A;  5BUK A;  3UOX A;  4BK2 A;  2X8G A;  1XAN A;  2X8H A;  1E6E A;  1GPE A;  3O0H A;  4H4R A;  5U1O A;  1TRB A;  4CNJ A;  1C0I A;  3ICS A;  1VE9 A;  2X8C A;  4Z26 A;  1ZMC A;  2DKH A;  1DNC A;  3G5Q A;  2E4G A;  4K5S A;  3CNT A;  2C75 A;  2TPR A;  1COY A;  2YLZ A;  4LII A;  2J3N A;  2XLS A;  2OLN A;  2QA1 A;  1GV4 A;  1YKJ A;  2C64 A;  2YLS A;  2RGO A;  2E1M A;  1GET A;  3AYL A;  4IA5 A;  3GMB A; 
#chains in the Genus database with same CATH homology
 4TM3 A;  4H4P A;  2R4J A;  3LOV A;  3G5S A;  4H4X A;  3QFA A;  3QVP A;  2FBW A;  1H7X A;  2JBV A;  1BGJ A;  4II3 A;  5C2T A;  1TYP A;  3NK2 X;  1X31 B;  3UP5 A;  3SZ0 A;  3KKJ A;  3UKL A;  3ZNP A;  4C77 A;  1PBF A;  2EQ9 A;  5M10 A;  3ALM A;  2BS3 A;  3T14 A;  2QA2 A;  2JB1 A;  4OPT A;  3SFD A;  2WET A;  2FJD A;  2GMJ A;  2WP6 A;  4OPI A;  4EQX A;  3RP6 A;  1N4U A;  1ZX9 A;  1IUX A;  3SX6 A;  3VR9 A;  1MXT A;  3FG2 P;  5BUL A;  2WQY A;  5JCI A;  4YJD A;  1KSS A;  2C70 A;  2BS4 A;  2BK5 A;  1XHC A;  2YG5 A;  4YSZ A;  3T0K A;  3BNU A;  1H7W A;  2VRM A;  3ALL A;  2EQ7 A;  1M6I A;  1NHR A;  1L0V A;  2BA9 A;  1PXB A;  2OLO A;  2Q0L A;  2YWL A;  4YT0 A;  5KOX A;  4NTC A;  3DK4 A;  2Q7V A;  1H81 A;  2WPF A;  1GAL A;  4Z24 A;  4AP1 A;  3GD4 A;  4C3Y A;  1VRQ B;  4D04 A;  3EAO A;  2JKC A;  3NHO X;  1W4X A;  3LB8 A;  4U8J A;  3LZW A;  2VRL A;  3CGB A;  4A99 A;  1B5Q A;  1IUS A;  3ZNO A;  1OJT A;  2BRY A;  2XVE A;  1CJ3 A;  3V76 A;  1BGN A;  1CF3 A;  1REO A;  2YG7 A;  4JNA A;  1SEZ A;  2R0C A;  1NHS A;  1DJN A;  1XDI A;  1D7L A;  1B37 A;  4A79 A;  1ZDL A;  3II4 A;  3NN0 X;  3ALJ A;  2GH5 A;  3S61 A;  1OJA A;  4OPL A;  4B67 A;  1NHP A;  1LQU A;  4GR1 A;  3CNJ A;  2GR1 A;  2Y6R A;  2YLW A;  3B6D A;  3E1T A;  4C3X A;  1GRF A;  3ADA B;  1DOD A;  1CJ2 A;  4B1B A;  3F8D A;  4H2P A;  1QO8 A;  1GRG A;  1LPF A;  2JB3 A;  2WHD A;  2X50 A;  3QVR A;  4XWZ A;  1B8S A;  4C74 A;  4AP3 A;  2GAH B;  2IVD A;  3RP8 A;  3LZX A;  2BYB A;  2W0H A;  1NG3 A;  5KVH A;  1L9C A;  1GER A;  1F8S A;  1GRH A;  1O5W A;  3NRN A;  2YLX A;  3NTD A;  1D5T A;  5KOW A;  3CGE A;  2C76 A;  2OAM A;  3DK9 A;  3DK8 A;  4H4S A;  5KMS A;  3DJE A;  3UOZ A;  4YSX A;  2VZ2 A;  3PO7 A;  4YJH A;  1BKW A;  3EF6 A;  2GQW A;  5KMP A;  1H86 A;  3KVE A;  2YAU A;  3AE5 A;  4JY3 A;  3QSE A;  3G3E A;  3UOV A;  5C3J A;  4CNK A;  4PAB A;  2CDU A;  5KWF A;  2BS2 A;  3DJD A;  2YQU A;  1GND A;  2VOU A;  3SQP A;  3W4I A;  1BWC A;  2NVK X;  4GDE A;  2WES A;  3AED A;  4DSG A;  1FEB A;  2APG A;  3KLJ A;  1PXC A;  3K7M X;  2XLU A;  2WP5 A;  4CRT A;  4YTM A;  4BK1 A;  2BCP A;  5HXI A;  1GSN A;  3UKQ A;  4XXG A;  1TDE A;  2VQ7 A;  1GRE A;  2YLR A;  2DKI A;  1ZMD A;  2E5V A;  4GF7 A;  4USR A;  2Z5X A;  3CPI G;  3H4K A;  4TLX A;  1N4W A;  4AT2 A;  4NWZ A;  4Z2T A;  4JN9 A;  2B7R A;  4AOX A;  5FS9 A;  1N4V A;  3DJG X;  3AE4 A;  4A6N B;  3P4S A;  1TDK A;  3V3O A;  2GV8 A;  1GTH A;  4NZH A;  5L46 A;  4BJY A;  1UKV G;  2FJA A;  2E48 A;  1F6M A;  1LJ1 A;  2ACZ A;  2ARD A;  4B69 A;  1DOB A;  2JK6 A;  2GMH A;  2QAE A;  3UKH A;  1P2H A;  3CMM A;  3P1W A;  3AEE A;  4K22 A;  3OZ2 A;  2JAE A;  3K7T A;  5DBJ A;  3T2Z A;  2Z5Y A;  1P2E A;  3AE3 A;  2WOV A;  3ATR A;  3H8I A;  2HQM A;  4U8I A;  4PAA A;  3UTE A;  3LAD A;  4EIQ A;  2YVG A;  3AE1 A;  1H82 A;  1YY5 A;  3BI5 A;  2GB0 A;  4LA1 A;  1LQT A;  3UTG A;  2B9W A;  2Q0K A;  2X3N A;  2GVC A;  1K4Q A;  3AE9 A;  1E7P A;  1EL8 A;  2WP9 A;  3QSM A;  2C65 A;  3R9U A;  1V59 A;  2WS3 A;  2IVE A;  3ICT A;  2XVJ A;  3DGH A;  3NK1 X;  4H50 A;  2Y6Q A;  5FS8 A;  2BXS A;  4Z25 A;  1TYT A;  3IHG A;  1E1L A;  1CL0 A;  2B7S A;  2H88 A;  3CTY A;  4G9K A;  4RG4 A;  3OC4 A;  4Z2R A;  3AD7 B;  4FX9 A;  3UKP A;  2F5Z A;  1BZL A;  1YQZ A;  2YVJ A;  3K30 A;  4J56 A;  4EQS A;  2XVI A;  4WCT A;  3AE8 A;  1DXL A;  2XLT A;  1E39 A;  5IQ1 A;  1GT8 A;  3AYJ A;  3CGC A;  3L8K A;  4H4U A;  4CCQ A;  1JOA A;  3AE7 A;  4J31 A;  3ABV A;  2E82 A;  3IC9 A;  3LXD A;  3NH3 X;  3BI4 A;  4IVO B;  1JEH A;  4ICY A;  2YVF A;  3KA7 A;  4RG3 A;  1LV0 A;  1CHU A;  1NAA A;  2VVM A;  3F8R A;  4H7U A;  2WPE A;  2ZZB A;  4YJG B;  1EL7 A;  4OCG A;  4USQ A;  3NTA A;  3T37 A;  2RAB A;  3BHK A;  1GTE A;  1KNR A;  2YM1 A;  1XPQ A;  1JNZ A;  2FJE A;  1PBC A;  4U8N A;  4EMW A;  5FS7 A;  3DJJ A;  4IV9 A;  4B66 A;  4D03 A;  1DOE A;  1C0K A;  4ZCD A;  3IF9 A;  4REK A;  4Y4L A;  3HYV A;  3UKF A;  4Z2U A;  1ZK7 A;  2WPC A;  4EM4 A;  4O5U A;  4ZN0 A;  1Y56 A;  3AEG A;  1D4D A;  4E0V A;  3GRT A;  4OPU A;  3NT6 A;  1KIF A;  1PJ6 A;  4GDP A;  4UP3 A;  5U63 A;  4EIP A;  1FEA A;  3UP4 A;  1CC2 A;  2V5Z A;  3ZDN A;  5JCK A;  2R46 A;  1TDN A;  3FBS A;  3KD9 A;  4NEV A;  2XYO A;  3T2Y A;  1NEN A;  2C72 A;  2VVL A;  4GCM A;  4BUR A;  4TLZ A;  2WEU A;  3AEA A;  2ZZ0 A;  3I6D A;  4M52 A;  3VRA A;  3GSI A;  3URH A;  5JCN A;  1E1N A;  2A8X A;  4H2Q A;  3GYX A;  5EB4 A;  4DNA A;  3C96 A;  1VDC A;  5EB5 A;  3CPH G;  1CJC A;  4YKF A;  4TM0 A;  5CQF A;  2BC0 A;  3H8L A;  3QSS A;  4A7A A;  3AYI A;  2YR6 A;  3ZYX A;  5GRT A;  1FCD A;  3KPK A;  1JU2 A;  1H83 A;  1OJ9 A;  3HYX A;  4HA6 A;  2YLT A;  1DDO A;  1JRY A;  2R9Z A;  3FPZ A;  4X9N A;  4B63 A;  2V60 A;  4NTE A;  3FMW A;  3HZL A;  3ISH A;  1S3E A;  2WU5 A;  4BK3 A;  3C4N A;  4I59 A;  1EBD A;  4U8L A;  1PJ7 A;  3DGZ A;  3SFE A;  1NDA A;  2XVH A;  3P9U A;  4OPD A;  1O95 A;  4EM3 A;  2AQJ A;  2O9Z A;  3SM8 A;  2B9X A;  3GWF A;  3RNM A;  4X9M A;  1K0L A;  1DJQ A;  4A5L A;  4EQW A;  2C3C A;  2A87 A;  4AT0 A;  1Q1W A;  3BNM A;  3AWI A;  4DGK A;  4G6H A;  1HYU A;  4DSH A;  4YTN A;  4QFC A;  2YM2 A;  3CIR A;  4Z44 A;  3UKK A;  4Z43 A;  4OVI A;  5GSN A;  4QFD A;  3SYI A;  4U2S A;  2R0P A;  2GF3 A;  3F8P A;  2CVJ A;  3CGD A;  1MOK A;  4U8O A;  3SXI A;  4J57 A;  2GEW A;  4H4Y A;  3KPF A;  1ONF A;  3AEF A;  2ZZC A;  4C5O A;  3GWD A;  1YQ4 A;  2WBA A;  4MJW A;  2R0G A;  1EVI A;  1D4E A;  2WDR A;  1F8R A;  5FMH A;  3B3R A;  3AE2 A;  4Y4N A;  1EL5 A;  1PXA A;  3AD8 B;  1ZOV A;  2XLR A;  1S2Q A;  2ZBW A;  4FK1 A;  4ZCC A;  4UDR A;  5HHF A;  4TM4 A;  2BAC A;  1Y56 B;  4NNJ A;  2XFU A;  3RP7 A;  3VR8 A;  4CBQ A;  4U2T A;  3M0O A;  2E49 A;  1F3P A;  1JRX A;  1GXF A;  1H84 A;  5U25 A;  1DOC A;  3Q6J A;  4II2 A;  1VG0 A;  2YG3 A;  3AEC A;  2YG6 A;  2XFO A;  2A89 A;  4CY6 A;  3D1C A;  4J2W A;  1NG4 A;  3DME A;  1LVL A;  2JB2 A;  2GR2 A;  5EOW A;  4EMI A;  5KMR A;  1IUV A;  1GES A;  2XFN A;  1ZY8 A;  4YSH A;  2V3B A;  2OAL A;  3T2K A;  5BVA A;  2C66 A;  4JY2 A;  4YSY A;  2I0Z A;  4K7Z A;  2E4A A;  1OJD A;  3KU9 A;  3COX A;  4FK1 C;  4H4Z A;  3BI2 A;  4YWO A;  3GYI A;  4P9S A;  4YJH B;  4OPG A;  1K0J A;  2X99 A;  4TM1 A;  2EQ6 A;  3M13 A;  3L1R A;  1IJH A;  3P4Q A;  3Q9T A;  4H2R A;  3S5W A;  1AN9 A;  3NIX A;  4U2L A;  3BHF A;  1O94 A;  3AB1 A;  2RGH A;  4XWR A;  2PYX A;  2XDO A;  5M0Z A;  4J36 A;  4AOS A;  4RSL A;  1TDF A;  1OJC A;  2BCG G;  4EQR A;  2RGJ A;  4YKG A;  1GRB A;  1VG9 A;  1H6V A;  3EAN A;  4H4T A;  4YJF A;  1RSG A;  4G73 A;  4G6G A;  2BRA A;  3GDP A;  4KPR A;  4X4J A;  4ADW A;  2GR3 A;  5FS6 A;  1NHQ A;  3D8X A;  2C73 A;  4CY8 A;  2AR8 A;  4B65 A;  2C7G A;  1PN0 A;  4BJZ A;  4B68 A;  4G74 A;  4A65 A;  1C0P A;  1DAO A;  2XVF A;  4IA6 A;  3P4P A;  4HB9 A;  4WX1 A;  4K2X A;  3M12 A;  1GOS A;  4GAV A;  1KFY A;  3SY4 A;  2WDV A;  4YXD A;  3NYF A;  5KRQ A;  2YR5 A;  3VRD B;  2EQ8 A;  3HYW A;  4CCR A;  5BRT A;  3CND A;  4H4Q A;  2XFQ A;  3AE6 A;  5TR3 A;  2B9Y A;  1PBB A;  4H4V A;  4O5Q A;  1Z6L A;  2NPX A;  4NTD A;  1PBE A;  4BV6 A;  1CC4 A;  1C0L A;  3NG7 X;  4K5R A;  1PJ5 A;  1Q1R A;  3UKA A;  2CUL A;  4A9W A;  1RYI A;  4U8P A;  3AEB A;  1KF6 A;  1KSU A;  3UOY A;  2BXR A;  3WGT A;  1Y0P A;  2WOW A;  1GRA A;  2TMD A;  4OPC A;  4FDC B;  1NPX A;  2GQF A;  3GYJ A;  2Q6U A;  1Q9I A;  3SZF A;  3NYE A;  2C67 A;  2GRT A;  1PBD A;  4J33 A;  4I58 A;  3SGL A;  3ZNN A;  2VVL G;  2WU2 A;  3LJP A;  3NYC A;  3CNP A;  4GAP A;  2FJB A;  3ICR A;  1EL9 A;  3NN6 X;  3CPJ G;  2DU8 A;  4JDR A;  4U8M A;  1CJ4 A;  1E1K A;  2GR0 A;  1F8W A;  3NKS A;  3NNE A;  3QFB A;  1IUT A;  1JNR A;  5HYM A;  2WOI A;  1ZP0 A;  2IID A;  2V3A A;  4H2N A;  4N9X A;  5IPY A;  3IHM A;  1FOH A;  2B76 A;  2V61 A;  3QJ4 A;  1IUU A;  3CNS A;  3IWA A;  5KMQ A;  1MO9 A;  3DH9 A;  5JCL A;  1D7Y A;  3CUK A;  1B4V A;  3GDN A;  5CKU A;  4ECH A;  3G5R A;  2XFP A;  1YQ3 A;  4UDQ A;  1S3B A;  3DA1 A;  5KNL A;  2R45 A;  5ER0 A;  2BC1 A;  2R4E A;  1FEC A;  4U8K A;  4JNQ A;  3W4K A;  3UCL A;  5JCM A;  1D4C A;  1VQW A;  3P4R A;  1BF3 A;  3W4J A;  2VQB A;  4YJF B;  2C4C A;  1TDO A;  3RHA A;  1S2Y A;  1M64 A;  3PS9 A;  1NEK A;  1CC6 A;  4UDP A;  3ITJ A;  3NLC A;  2QCU A;  1E1M A;  2AAQ A;  1KDG A;  5J7X A;  4APN A;  2H89 A;  1KNP A;  4YTP A;  5LV9 A;  1ZKQ A;  3WE0 A;  5KXJ A;  3FIM B;  3GMC A;  3CN8 A;  3NGC X;  1GEU A;  1GRT A;  1JRZ A;  1CBO A;  1FL2 A;  4K8D A;  2OA1 A;  3GD3 A;  1K0I A;  2XLP A;  4LU6 A;  3AD9 B;  2CFY A;  2BK4 A;  3JSK A;  4EMJ A;  2YR4 A;  3UTF A;  1QLB A;  3SZW A;  4B64 A;  2XCG A;  2V6O A;  5IQ4 A;  1N1P A;  3UTH A;  1L9E A;  1PS9 A;  4IVM B;  1RP0 A;  3T31 A;  3AXB A;  4J34 A;  3GRS A;  5HY5 A;  4H4W A;  3VRB A;  2UZZ A;  3ZNQ A;  5KVI A;  3SZC A;  1L9D A;  5J60 A;  2BK3 A;  4GRT A;  1AOG A;  4Y4M A;  1ZOY A;  4GUV A;  3NK0 X;  3C4A A;  1PDH A;  1QJD A;  3RED A;  2WDQ A;  3ATQ A;  2PHH A;  4NEW A;  3V3N A;  2GAG B;  4A6N A;  4KX6 A;  1PHH A;  4YJG A;  2C3D A;  5EBK A;  1LTX R;  2BAB A;  1ELI A;  3K7Q X;  3EPT A;  4JQ9 A;  3PVC A;  1IUW A;  3VQR A;  3I3L A;  2YG4 A;  5BUK A;  3UOX A;  4BK2 A;  2X8G A;  1XAN A;  2X8H A;  1E6E A;  1GPE A;  3O0H A;  4H4R A;  5U1O A;  1TRB A;  4CNJ A;  1C0I A;  3ICS A;  1VE9 A;  2X8C A;  4Z26 A;  1ZMC A;  2DKH A;  1DNC A;  3G5Q A;  2E4G A;  4K5S A;  3CNT A;  2C75 A;  2TPR A;  1COY A;  2YLZ A;  4LII A;  2J3N A;  2XLS A;  2OLN A;  2QA1 A;  1GV4 A;  1YKJ A;  2C64 A;  2YLS A;  2RGO A;  2E1M A;  1GET A;  3AYL A;  4IA5 A;  3GMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...