3UP4A

Crystal structure of otemo complex with fad and nadp (form 3)
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
540
structure length
528
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
molecule keywords OTEMO
total genus 183
structure length 528
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3up4A01
3UKQA 2IVEA 5JCKA 1GNDA 3VR8A 4OCGA 3KD9A 3NYFA 5M10A 3AE6A 4U2SA 2X50A 3S5WA 3KKJA 3UKHA 2IVDA 3RHAA 1JEHA 1PXAA 2X99A 1K0LA 1PHHA 2WS3A 3GRTA 4NTEA 1PJ7A 1NENA 2TPRA 2XVHA 4IA5A 4EMIA 2Y6QA 2AR8A 5C2TA 3DJDA 5KXJA 3E1TA 4H4YA 1TDFA 2XVEA 4JDRA 3ALMA 3QJ4A 4IVMB 1TDOA 4ECHA 1ZP0A 2V5ZA 3NHOX 4B1BA 4Y4LA 4WX1A 4YTNA 1LTXR 2YVGA 2YR4A 1KSUA 3SGLA 3PO7A 4H50A 4C77A 1HYUA 1NPXA 2VOUA 1FEAA 5HXIA 1GTHA 2XYOA 1PJ5A 3AB1A 4CRTA 1NHQA 4A7AA 1VDCA 5EOWA 1X31B 3UOXA 2RABA 3DK8A 2XVFA 3AYJA 2EQ9A 2GR0A 1Y0PA 1IUSA 1K0IA 3VRDB 4X4JA 4YWOA 4A99A 1H82A 4Z25A 1M6IA 4UP3A 2BCPA 4X9NA 3P4SA 3LJPA 3ICSA 2NVKX 4USRA 1LVLA 2I0ZA 1LJ1A 4BK3A 1DOCA 1ZX9A 5J60A 5FS6A 2WU2A 4Z2UA 4N9XA 4XWRA 1IUWA 2AQJA 1KSSA 1L0VA 2BYBA 1O94A 3L8KA 1DOBA 3ALJA 4YTPA 2BXRA 1W4XA 1H83A 1GTEA 2APGA 3ICTA 3CGEA 4DSHA 1E39A 2YG6A 1YY5A 1XHCA 3DJGX 4CY8A 3AYLA 1KDGA 2JK6A 3FIMB 4YSHA 4ZN0A 5BUKA 1AOGA 2ACZA 3UTHA 4AOSA 3ATRA 3L1RA 4CCQA 1ELIA 1MO9A 3LZXA 2TMDA 4Z44A 1H84A 3CNDA 1KFYA 4M52A 3GRSA 3NLCA 3IC9A 4J2WA 4ZCCA 5BRTA 4EMWA 3DH9A 1ZK7A 3ISHA 4AP3A 5IQ1A 1D4EA 5IPYA 3GMBA 3H8LA 3EF6A 3G5RA 2Y6RA 1GT8A 1PXBA 2YG3A 2CULA 2FBWA 4EM3A 2WP5A 3AD7B 3CNJA 3ZYXA 2BS2A 3I6DA 4FDCB 4EQWA 2GB0A 3QSEA 4GRTA 4X9MA 3UKKA 1CC4A 3ADAB 3AYIA 3F8RA 5U1OA 4FK1A 3V3NA 3NRNA 3IWAA 1H86A 3UKLA 5FS8A 4H4PA 1K4QA 3I3LA 4H4TA 1IJHA 1RP0A 3AE7A 5FMHA 4OPTA 1BGJA 3OC4A 4H2RA 3IF9A 1LPFA 2B7RA 4GF7A 4JY3A 4B67A 1ZKQA 2FJDA 2YLRA 4H4ZA 3G5SA 1ZOYA 3GWFA 2YG5A 4YSXA 3RNMA 2F5ZA 3ABVA 3UOYA 1GERA 2WBAA 2BCGG 2WPEA 3P1WA 3COXA 4A65A 1IUVA 2WDVA 1JU2A 2C64A 3KA7A 3PVCA 1KNRA 3GD4A 1P2HA 1S2YA 3UTFA 2J3NA 4C3YA 4CNKA 2V60A 3LB8A 4GR1A 4H2NA 3C96A 2Q0KA 1L9CA 2R9ZA 4J57A 1Q1WA 3D1CA 4USQA 3NTAA 2B9YA 4HA6A 3CNTA 5ER0A 2DKHA 3DJJA 1BKWA 4U8OA 2BS3A 1CJ3A 3ICRA 3NH3X 2E4GA 4PABA 3T37A 5KVIA 5C3JA 2GQFA 2X3NA 3LADA 2PYXA 1CHUA 3LXDA 4IA6A 4K7ZA 3NK2X 1BWCA 2H89A 4OPGA 3BNMA 4BV6A 4JNAA 3SFDA 4GCMA 2GF3A 5KVHA 5L46A 1SEZA 3K7QX 1PJ6A 2H88A 2OA1A 4TLXA 2GMJA 1TYPA 1VRQB 2CFYA 4U8JA 4WCTA 4D03A 3H8IA 1JNZA 3IHMA 1CBOA 1GRBA 1JNRA 3CPJG 2GMHA 2XFUA 4I58A 4OPLA 3UTEA 3K7TA 3NTDA 5JCLA 2C76A 2WDQA 3M13A 2OLOA 2BC0A 2YG4A 2GQWA 1DOEA 2RGJA 2VVMA 3QFAA 4CCRA 1OJTA 5FS9A 4I59A 4B69A 2QA1A 2VQ7A 4CBQA 2WPFA 3GDPA 3AWIA 3DK9A 4TM4A 1VQWA 4REKA 2Q6UA 2WETA 4H4QA 4P9SA 4A6NB 1MOKA 3BI4A 4B64A 3SQPA 2R0PA 2WHDA 4LIIA 1M64A 1KNPA 3V3OA 3AE2A 2V61A 4OVIA 2YLZA 4A6NA 3KLJA 4O5QA 5JCMA 2GH5A 1L9DA 2CVJA 2XFOA 4C74A 1CC6A 4H4RA 2YM2A 4YT0A 2YVFA 1PS9A 4FK1C 2YR6A 3NK0X 5EBKA 1LQUA 3UP5A 2BS4A 1OJCA 4TLZA 3CIRA 2E5VA 1YQ3A 3BHFA 4YKGA 1B4VA 5U25A 3KVEA 1ZDLA 3NYCA 2ZBWA 4EQSA 3R9UA 1DNCA 4J31A 1NG3A 4APNA 3UKPA 1CL0A 4DNAA 4K8DA 4EQXA 5KWFA 3AE8A 4NEWA 2YWLA 4A5LA 1PN0A 2IIDA 1RSGA 1ZY8A 2OALA 5DBJA 3AE9A 1JRZA 4LA1A 4RSLA 1CJ2A 2A8XA 2B7SA 1B37A 3VRAA 1GRGA 1D4CA 2Z5YA 2AAQA 4GDPA 3EANA 1QLBA 2VZ2A 3AEBA 3AE5A 2YLTA 4GUVA 5LV9A 3K30A 4H4SA 1PBFA 3QVPA 3SFEA 2WP6A 5HYMA 1JRXA 4H7UA 3UKFA 4YKFA 4DSGA 3RP6A 1GV4A 1GRHA 3FBSA 3AEGA 1GREA 1EL9A 3NIXA 2ZZ0A 2XFPA 4K5RA 1VG9A 1YQ4A 4OPUA 2GR1A 4YXDA 3F8DA 3CPIG 3UTGA 3C4AA 1GPEA 1TDKA 3GYIA 1PBDA 2C75A 1NHPA 1CF3A 3QFBA 4J36A 2JB1A 1NDAA 4JNQA 4KX6A 4AP1A 4D04A 4U8IA 4E0VA 1GOSA 4NTCA 3ITJA 1D7YA 2R4EA 2WESA 3Q9TA 2XLRA 2O9ZA 2UZZA 4BK2A 3CGCA 2GR2A 1ZMCA 2W0HA 3H4KA 1E1KA 1N4UA 1EL5A 4JQ9A 2BK5A 3AEEA 4AT0A 4Z24A 2Q0LA 2VVLA 1B5QA 1XDIA 2JBVA 1FECA 3AD9B 3UOZA 1ZMDA 4K22A 1VG0A 4YSZA 4JY2A 1KF6A 2XFNA 2B76A 4U8LA 2C70A 1TDNA 3DGHA 2BXSA 5JCIA 3G5QA 3M0OA 4EQRA 1B8SA 1D5TA 2X8GA 1FCDA 1CJCA 1FL2A 1CJ4A 3UCLA 3KU9A 4CY6A 1F8RA 2GAHB 4YSYA 1DXLA 5IQ4A 1JOAA 1L9EA 3P4QA 3VR9A 1GESA 1RYIA 2X8HA 3AECA 4KPRA 3NYEA 4B68A 4K2XA 3ZDNA 3DMEA 2V6OA 4IV9A 1TYTA 1XPQA 2YLWA 5U63A 5HY5A 3JSKA 2GR3A 2RGHA 4ADWA 1GSNA 1TDEA 1D7LA 3AD8B 1F8SA 3NT6A 2YLSA 4HB9A 3RP7A 1F8WA 1PBEA 3AEFA 4C3XA 2JB3A 2Q7VA 4U8NA 2V3AA 2GEWA 1Q9IA 4OPDA 1ONFA 4K5SA 4H4VA 4RG4A 4BJZA 5CKUA 4BJYA 2XVJA 1PBCA 3QSMA 4AOXA 3II4A 3CTYA 1GEUA 3DK4A 2GVCA 1MXTA 1N4VA 2WEUA 1E6EA 1OJDA 1REOA 2C73A 2ZZCA 3ATQA 1EL8A 1NG4A 1BZLA 4RG3A 1V59A 1FEBA 1Y56A 3QSSA 2YR5A 4B63A 4C5OA 2V3BA 3FPZA 2C67A 3CGDA 2BK4A 1EL7A 5KRQA 2NPXA 3CGBA 2C3CA 2R45A 2VQBA 3GD3A 3FMWA 3M12A 4XWZA 4AT2A 3O0HA 3RP8A 1F3PA 2BACA 1N4WA 1OJ9A 4U8PA 4EM4A 1E1MA 3GWDA 1EBDA 2R0CA 3B3RA 3P4PA 4U8MA 1H6VA 2YVJA 2QA2A 1NHSA 1GRTA 3AEDA 3GYJA 4O5UA 1UKVG 2BA9A 3Q6JA 3B6DA 1GALA 4H4UA 4BK1A 4EIQA 2XLSA 1E7PA 4TM1A 3CPHG 2E1MA 1K0JA 4Z2TA 4A79A 5CQFA 3URHA 1GETA 3BHKA 3FG2P 2R4JA 2GAGB 2VVLG 3GSIA 4LU6A 1H7WA 1O95A 2BC1A 3ALLA 1LQTA 2EQ7A 2YAUA 4UDPA 3S61A 3DA1A 3UKAA 2BABA 2FJEA 2XDOA 1BF3A 1O5WA 4MJWA 1S3BA 2A89A 2BK3A 4GDEA 1Z6LA 3D8XA 1E1LA 3NG7X 4U2LA 3REDA 4Z26A 2A87A 3V76A 2HQMA 4H2QA 1JRYA 2C3DA 4U2TA 2XLTA 4Y4NA 2XLPA 3F8PA 4IVOB 5GRTA 3DGZA 1QJDA 5GSNA 2C7GA 2WP9A 2YLXA 4UDQA 3NN0X 3AEAA 2WPCA 2C65A 3HZLA 5TR3A 4BURA 1XANA 4H4WA 1PDHA 5BVAA 3IHGA 2WOWA 2YG7A 3BI5A 4PAAA 3OZ2A 3GMCA 1COYA 3SM8A 2B9WA 3P4RA 1H7XA 3NGCX 1PXCA 2EQ8A 5M0ZA 4Z43A 4Y4MA 1Q1RA 4A9WA 1TRBA 5BULA 2Z5XA 3AE4A 2FJBA 4YTMA 1LV0A 2VRMA 5EB5A 2GV8A 2QCUA 1Y56B 5J7XA 1BGNA 1GXFA 1S2QA 2C66A 2VRLA 2WDRA 3KPFA 3NKSA 4UDRA 4XXGA 1CC2A 1NAAA 2XCGA 3EAOA 1N1PA 4J34A 1D4DA 4OPIA 2R0GA 1NHRA 4NEVA 3NK1X 4TM3A 2ARDA 1IUUA 1FOHA 3NNEA 1GRFA 2R46A 4JN9A 1DODA 2PHHA 4ZCDA 4DGKA 3AE1A 3GDNA 1P2EA 4B65A 1H81A 3BNUA 5KOXA 2OAMA 1IUTA 1QO8A 2JB2A 1YQZA 3PS9A 2JAEA 1GRAA 4J33A 1E1NA 1F6MA 3UOVA 3LOVA 1IUXA 3DJEA 2ZZBA 1ZOVA 4J56A 4NTDA 3C4NA 5FS7A 2CDUA 2XVIA 2EQ6A 1NEKA 3P9UA 2OLNA 3CNPA 4NZHA 1DJNA 3VRBA 3CNSA 4H2PA 1DJQA 2GRTA 2WOIA 2XLUA 4FX9A 4U8KA 5JCNA 2WU5A 3BI2A 3K7MX 3UP4A 2B9XA 3QVRA 2DKIA 4B66A 4EIPA 2YM1A 5EB4A 2RGOA 2FJAA 2XFQA 4OPCA 3LZWA 2WOVA 4H4XA 1PBBA 3AXBA 3EPTA 2WQYA 4ICYA 5KOWA 2QAEA 2C72A 4Z2RA 4EMJA 4CNJA 2JKCA 2YQUA 3VQRA 1OJAA 3CN8A 2X8CA 3NN6X 5HHFA 4TM0A 3AE3A 3WE0A 1S3EA 1YKJA
chains in the Genus database with same CATH superfamily
3UKQA 2IVEA 5JCKA 1GNDA 3VR8A 4OCGA 3KD9A 3NYFA 5M10A 3AE6A 4U2SA 2X50A 3S5WA 3KKJA 3UKHA 2IVDA 3RHAA 1JEHA 1PXAA 2X99A 1K0LA 1PHHA 2WS3A 3GRTA 4NTEA 1PJ7A 1NENA 2TPRA 2XVHA 4IA5A 4EMIA 2Y6QA 2C4CA 2AR8A 5C2TA 3DJDA 5KXJA 3E1TA 4H4YA 1TDFA 2XVEA 4JDRA 3ALMA 3QJ4A 4IVMB 1TDOA 4ECHA 1ZP0A 2V5ZA 3NHOX 4B1BA 4Y4LA 4WX1A 4YTNA 1LTXR 2YVGA 2YR4A 1KSUA 3SGLA 3PO7A 4H50A 4C77A 1HYUA 1NPXA 2VOUA 1FEAA 5HXIA 1GTHA 4GAVA 2XYOA 1PJ5A 3AB1A 5KMPA 4CRTA 1NHQA 4A7AA 1VDCA 5EOWA 1X31B 3UOXA 2RABA 3DK8A 2XVFA 3AYJA 2EQ9A 2GR0A 1Y0PA 1IUSA 1K0IA 3VRDB 4X4JA 4YWOA 4A99A 1H82A 4Z25A 1M6IA 4UP3A 2BCPA 4X9NA 3P4SA 3LJPA 3ICSA 2NVKX 4USRA 1LVLA 2I0ZA 1LJ1A 4BK3A 1DOCA 1ZX9A 5J60A 5FS6A 2WU2A 4Z2UA 4N9XA 4XWRA 1IUWA 2AQJA 1KSSA 3HYWA 2BYBA 1L0VA 1O94A 3L8KA 1DOBA 3ALJA 4YTPA 2BXRA 1W4XA 1H83A 1GTEA 2APGA 3ICTA 3CGEA 4DSHA 1E39A 4II3A 2YG6A 1YY5A 1XHCA 3DJGX 4CY8A 3AYLA 1KDGA 2JK6A 3FIMB 4YSHA 4ZN0A 5BUKA 1AOGA 5KMQA 2ACZA 3UTHA 4AOSA 3ATRA 2BRAA 3L1RA 1ELIA 1MO9A 3LZXA 4CCQA 2TMDA 4Z44A 1H84A 3CNDA 1KFYA 4M52A 3GRSA 3NLCA 3IC9A 4J2WA 4ZCCA 5BRTA 4EMWA 3DH9A 1ZK7A 4NWZA 3ISHA 3T2ZA 4AP3A 5IQ1A 1D4EA 5IPYA 3T2YA 3GMBA 3SZCA 3H8LA 3EF6A 3G5RA 2Y6RA 1GT8A 1PXBA 2YG3A 2CULA 2FBWA 4EM3A 3T2KA 2WP5A 3AD7B 3CNJA 3ZYXA 2BS2A 3I6DA 4FDCB 4EQWA 2GB0A 3QSEA 4GRTA 4X9MA 3UKKA 1CC4A 3ADAB 3AYIA 3F8RA 5U1OA 4FK1A 3V3NA 3NRNA 3IWAA 1H86A 3UKLA 5FS8A 4H4PA 1K4QA 3I3LA 4H4TA 1IJHA 1RP0A 3AE7A 5FMHA 4OPTA 1BGJA 3OC4A 4H2RA 3IF9A 1LPFA 2B7RA 4GF7A 4JY3A 4B67A 1ZKQA 2FJDA 2YLRA 4H4ZA 3G5SA 1ZOYA 3GWFA 2YG5A 4YSXA 3RNMA 2F5ZA 3ABVA 3UOYA 1GERA 2WBAA 2BCGG 2WPEA 3P1WA 3COXA 4A65A 1IUVA 2WDVA 1JU2A 2C64A 3KA7A 3PVCA 1KNRA 3GD4A 1P2HA 1S2YA 3UTFA 2J3NA 4C3YA 4CNKA 2V60A 3LB8A 4GR1A 4H2NA 3C96A 2Q0KA 1L9CA 2R9ZA 4J57A 1Q1WA 3D1CA 4USQA 3NTAA 2B9YA 4HA6A 3CNTA 5ER0A 2DKHA 3DJJA 1BKWA 4U8OA 2BS3A 1CJ3A 3ICRA 3NH3X 2E4GA 4PABA 3T31A 5KVIA 3T37A 2GQFA 2X3NA 3LADA 5C3JA 2PYXA 1CHUA 3LXDA 4IA6A 4K7ZA 3NK2X 1BWCA 3SZWA 2H89A 4OPGA 3BNMA 4BV6A 4JNAA 3SFDA 3HYXA 4GCMA 2GF3A 5KVHA 5L46A 1SEZA 3K7QX 1PJ6A 2H88A 2OA1A 4TLXA 2GMJA 1TYPA 1VRQB 2CFYA 4U8JA 4WCTA 4D03A 4II2A 3HYVA 3H8IA 1JNZA 3IHMA 1CBOA 1GRBA 1JNRA 3CPJG 2GMHA 2XFUA 4I58A 4OPLA 3UTEA 3K7TA 3NTDA 5JCLA 2C76A 2WDQA 3M13A 2OLOA 2BC0A 2YG4A 2GQWA 1DOEA 2RGJA 2VVMA 3QFAA 4CCRA 1OJTA 5FS9A 4I59A 4B69A 2QA1A 2VQ7A 4CBQA 2WPFA 3GDPA 3AWIA 3DK9A 4TM4A 1VQWA 4REKA 2Q6UA 2WETA 4H4QA 4P9SA 4A6NB 1MOKA 3SXIA 3BI4A 4B64A 3SQPA 2R0PA 2WHDA 4LIIA 1M64A 1KNPA 3V3OA 3AE2A 2V61A 4OVIA 2YLZA 4A6NA 3KLJA 4O5QA 5JCMA 2GH5A 1L9DA 2CVJA 2XFOA 3T14A 4C74A 1CC6A 4H4RA 2YM2A 4YT0A 2YVFA 1PS9A 4FK1C 2YR6A 3NK0X 3GYXA 5EBKA 1LQUA 3UP5A 2BS4A 1OJCA 4TLZA 3CIRA 2E5VA 1YQ3A 3BHFA 4YKGA 1B4VA 5U25A 3KVEA 1ZDLA 3NYCA 2ZBWA 4EQSA 3R9UA 1DNCA 4J31A 1NG3A 4APNA 3UKPA 1CL0A 4DNAA 4K8DA 4EQXA 5KWFA 3AE8A 4NEWA 2YWLA 4A5LA 5KMRA 1PN0A 2IIDA 1RSGA 1ZY8A 2OALA 5DBJA 3AE9A 1JRZA 4LA1A 4RSLA 1CJ2A 2A8XA 2B7SA 1B37A 3VRAA 1GRGA 1D4CA 2Z5YA 2AAQA 4GDPA 3EANA 1QLBA 2BRYA 2VZ2A 3AEBA 3AE5A 2YLTA 4GUVA 5LV9A 3K30A 4H4SA 1PBFA 3QVPA 3SFEA 2WP6A 5HYMA 1JRXA 4H7UA 3UKFA 4YKFA 4DSGA 3RP6A 1GV4A 1GRHA 3T0KA 3FBSA 3AEGA 1GREA 1EL9A 3NIXA 2ZZ0A 2XFPA 4K5RA 1VG9A 1YQ4A 4OPUA 2GR1A 4YXDA 3F8DA 3CPIG 3UTGA 3C4AA 1GPEA 1TDKA 3GYIA 1PBDA 2C75A 1NHPA 1CF3A 3QFBA 4J36A 2JB1A 1NDAA 4JNQA 4KX6A 4AP1A 4D04A 4U8IA 4E0VA 1GOSA 4NTCA 3ITJA 1D7YA 2R4EA 2WESA 3Q9TA 2XLRA 3KPKA 2O9ZA 2UZZA 4BK2A 3CGCA 2GR2A 1ZMCA 2W0HA 3H4KA 1E1KA 1N4UA 1EL5A 4JQ9A 2BK5A 3AEEA 4AT0A 4Z24A 2Q0LA 2VVLA 1B5QA 1XDIA 2JBVA 1FECA 3AD9B 3UOZA 1ZMDA 4K22A 1VG0A 4YSZA 4JY2A 1KF6A 2XFNA 2B76A 4U8LA 2C70A 1TDNA 3DGHA 2BXSA 5JCIA 3SYIA 3G5QA 3M0OA 4EQRA 1B8SA 1D5TA 2X8GA 1FCDA 1CJCA 1FL2A 1CJ4A 3UCLA 3KU9A 4CY6A 1F8RA 2GAHB 4YSYA 1DXLA 5IQ4A 1JOAA 1L9EA 3P4QA 3VR9A 1GESA 1RYIA 2X8HA 3AECA 4KPRA 3NYEA 4B68A 4K2XA 3ZDNA 3DMEA 2V6OA 4IV9A 1TYTA 1XPQA 2YLWA 5U63A 5HY5A 3JSKA 2GR3A 2RGHA 4ADWA 1GSNA 1TDEA 1D7LA 3AD8B 1F8SA 3NT6A 2YLSA 4HB9A 3RP7A 1F8WA 1PBEA 3AEFA 4G6GA 4C3XA 2JB3A 2Q7VA 4U8NA 2V3AA 2GEWA 1Q9IA 4OPDA 1ONFA 4K5SA 4H4VA 4RG4A 4BJZA 5CKUA 4BJYA 2XVJA 1PBCA 3QSMA 4AOXA 3II4A 3CTYA 1GEUA 3DK4A 2GVCA 1MXTA 1N4VA 2WEUA 1E6EA 1OJDA 1REOA 2C73A 2ZZCA 3ATQA 1EL8A 1NG4A 1BZLA 4RG3A 1V59A 1FEBA 1Y56A 3QSSA 2YR5A 4B63A 4C5OA 2V3BA 3FPZA 2C67A 3CGDA 2BK4A 1EL7A 5KRQA 2NPXA 3CGBA 2C3CA 2R45A 2VQBA 3GD3A 3FMWA 3M12A 4XWZA 4G73A 4AT2A 3O0HA 3RP8A 1F3PA 2BACA 1N4WA 1OJ9A 4U8PA 4G9KA 4EM4A 1E1MA 5KNLA 3GWDA 1EBDA 2R0CA 3B3RA 3P4PA 4U8MA 1H6VA 2YVJA 2QA2A 1NHSA 1GRTA 3AEDA 3GYJA 4O5UA 1UKVG 2BA9A 3Q6JA 3B6DA 1GALA 4H4UA 4BK1A 4EIQA 2XLSA 1E7PA 4TM1A 3CPHG 2E1MA 1K0JA 4Z2TA 4A79A 5CQFA 3URHA 1GETA 3BHKA 3FG2P 2R4JA 3SZFA 2GAGB 2VVLG 3GSIA 4LU6A 1H7WA 1O95A 2BC1A 3ALLA 1LQTA 2EQ7A 2YAUA 4UDPA 3S61A 3DA1A 3UKAA 2BABA 2FJEA 2XDOA 1BF3A 1O5WA 4MJWA 1S3BA 2A89A 2BK3A 4GDEA 1Z6LA 3D8XA 1E1LA 3NG7X 4U2LA 3REDA 4Z26A 2A87A 3V76A 2HQMA 4G6HA 1JRYA 2C3DA 4H2QA 2XLTA 4U2TA 4Y4NA 2XLPA 3F8PA 4IVOB 5GRTA 4G74A 3DGZA 1QJDA 5GSNA 2C7GA 2WP9A 2YLXA 4UDQA 3NN0X 3AEAA 2WPCA 2C65A 3HZLA 5TR3A 4BURA 1XANA 4H4WA 1PDHA 5BVAA 3IHGA 2WOWA 2YG7A 3BI5A 4PAAA 3OZ2A 3GMCA 1COYA 3SM8A 2B9WA 3P4RA 1H7XA 3NGCX 1PXCA 2EQ8A 5M0ZA 4Z43A 4Y4MA 4NNJA 1Q1RA 4A9WA 1TRBA 5BULA 2Z5XA 3AE4A 2FJBA 4YTMA 1LV0A 2VRMA 5EB5A 2GV8A 2QCUA 1Y56B 5J7XA 1BGNA 1GXFA 1S2QA 2C66A 2VRLA 2WDRA 3KPFA 3NKSA 4UDRA 4XXGA 1CC2A 1NAAA 2XCGA 3EAOA 1N1PA 4J34A 1D4DA 4OPIA 2R0GA 1NHRA 4NEVA 3NK1X 4TM3A 2ARDA 1IUUA 1FOHA 3NNEA 1GRFA 2R46A 4JN9A 1DODA 2PHHA 4ZCDA 4DGKA 3AE1A 3GDNA 3SZ0A 1P2EA 4B65A 1H81A 3BNUA 5KOXA 2OAMA 1IUTA 1QO8A 2JB2A 1YQZA 3PS9A 2JAEA 1GRAA 4J33A 1E1NA 1F6MA 3UOVA 5KMSA 3LOVA 1IUXA 3DJEA 2ZZBA 1ZOVA 4J56A 4NTDA 3C4NA 5FS7A 2CDUA 2XVIA 2EQ6A 1NEKA 3P9UA 2OLNA 3CNPA 4NZHA 1DJNA 3VRBA 3CNSA 4H2PA 1DJQA 2GRTA 2WOIA 2XLUA 4FX9A 4U8KA 5JCNA 2WU5A 3BI2A 3K7MX 3UP4A 2B9XA 3QVRA 2DKIA 4B66A 4EIPA 2YM1A 5EB4A 2RGOA 2FJAA 3SX6A 2XFQA 4OPCA 3LZWA 2WOVA 4H4XA 1PBBA 3AXBA 3EPTA 2WQYA 4ICYA 5KOWA 2QAEA 2C72A 4Z2RA 4EMJA 3CMMA 4CNJA 2JKCA 2YQUA 3VQRA 1OJAA 3CN8A 2X8CA 4GAPA 3NN6X 3SY4A 5HHFA 4TM0A 3AE3A 3WE0A 1S3EA 1YKJA
chains in the Genus database with same CATH topology
3UKQA 2IVEA 5JCKA 1GNDA 3VR8A 4OCGA 3KD9A 3NYFA 5M10A 3AE6A 4U2SA 2X50A 3S5WA 3KKJA 3UKHA 2IVDA 3RHAA 1JEHA 1PXAA 2X99A 1K0LA 1PHHA 2WS3A 3GRTA 4NTEA 1PJ7A 1NENA 2TPRA 2XVHA 4IA5A 4EMIA 2Y6QA 2C4CA 2AR8A 5C2TA 3DJDA 5KXJA 3E1TA 4H4YA 1TDFA 2XVEA 4JDRA 3ALMA 3QJ4A 4IVMB 1TDOA 4ECHA 1ZP0A 2V5ZA 3NHOX 4B1BA 4Y4LA 4WX1A 4YTNA 1LTXR 2YVGA 2YR4A 1KSUA 3SGLA 3PO7A 4H50A 4C77A 1HYUA 1NPXA 2VOUA 1FEAA 5HXIA 1GTHA 4GAVA 2XYOA 1PJ5A 3AB1A 5KMPA 4CRTA 1NHQA 4A7AA 1VDCA 5EOWA 1X31B 3UOXA 2RABA 3DK8A 2XVFA 3AYJA 2EQ9A 2GR0A 1Y0PA 1IUSA 1K0IA 3VRDB 4X4JA 4YWOA 4A99A 1H82A 4Z25A 1M6IA 4UP3A 2BCPA 4X9NA 3P4SA 3LJPA 3ICSA 2NVKX 4USRA 1LVLA 2I0ZA 1LJ1A 4BK3A 1DOCA 1ZX9A 5J60A 5FS6A 2WU2A 4Z2UA 4N9XA 4XWRA 1IUWA 2AQJA 1KSSA 3HYWA 2BYBA 1L0VA 1O94A 3L8KA 1DOBA 3ALJA 4YTPA 2BXRA 1W4XA 1H83A 1GTEA 2APGA 3ICTA 3CGEA 4DSHA 1E39A 4II3A 2YG6A 1YY5A 1XHCA 3DJGX 4CY8A 3AYLA 1KDGA 2JK6A 3FIMB 4YSHA 4ZN0A 5BUKA 1AOGA 5KMQA 2ACZA 3UTHA 4AOSA 3ATRA 2BRAA 3L1RA 1ELIA 1MO9A 3LZXA 4CCQA 2TMDA 4Z44A 1H84A 3CNDA 1KFYA 4M52A 3GRSA 3NLCA 3IC9A 4J2WA 4ZCCA 5BRTA 4EMWA 3DH9A 1ZK7A 4NWZA 3ISHA 3T2ZA 4AP3A 5IQ1A 1D4EA 5IPYA 3T2YA 3GMBA 3SZCA 3H8LA 3EF6A 3G5RA 2Y6RA 1GT8A 1PXBA 2YG3A 2CULA 2FBWA 4EM3A 3T2KA 2WP5A 3AD7B 3CNJA 3ZYXA 2BS2A 3I6DA 4FDCB 4EQWA 2GB0A 3QSEA 4GRTA 4X9MA 3UKKA 1CC4A 3ADAB 3AYIA 3F8RA 5U1OA 4FK1A 3V3NA 3NRNA 3IWAA 1H86A 3UKLA 5FS8A 4H4PA 1K4QA 3I3LA 4H4TA 1IJHA 1RP0A 3AE7A 5FMHA 4OPTA 1BGJA 3OC4A 4H2RA 3IF9A 1LPFA 2B7RA 4GF7A 4JY3A 4B67A 1ZKQA 2FJDA 2YLRA 4H4ZA 3G5SA 1ZOYA 3GWFA 2YG5A 4YSXA 3RNMA 2F5ZA 3ABVA 3UOYA 1GERA 2WBAA 2BCGG 2WPEA 3P1WA 3COXA 4A65A 1IUVA 2WDVA 1JU2A 2C64A 3KA7A 3PVCA 1KNRA 3GD4A 1P2HA 1S2YA 3UTFA 2J3NA 4C3YA 4CNKA 2V60A 3LB8A 4GR1A 4H2NA 3C96A 2Q0KA 1L9CA 2R9ZA 4J57A 1Q1WA 3D1CA 4USQA 3NTAA 2B9YA 4HA6A 3CNTA 5ER0A 2DKHA 3DJJA 1BKWA 4U8OA 2BS3A 1CJ3A 3ICRA 3NH3X 2E4GA 4PABA 3T31A 5KVIA 3T37A 2GQFA 2X3NA 3LADA 5C3JA 2PYXA 1CHUA 3LXDA 4IA6A 4K7ZA 3NK2X 1BWCA 3SZWA 2H89A 4OPGA 3BNMA 4BV6A 4JNAA 3SFDA 3HYXA 4GCMA 2GF3A 5KVHA 5L46A 1SEZA 3K7QX 1PJ6A 2H88A 2OA1A 4TLXA 2GMJA 1TYPA 1VRQB 2CFYA 4U8JA 4WCTA 4D03A 4II2A 3HYVA 3H8IA 1JNZA 3IHMA 1CBOA 1GRBA 1JNRA 3CPJG 2GMHA 2XFUA 4I58A 4OPLA 3UTEA 3K7TA 3NTDA 5JCLA 2C76A 2WDQA 3M13A 2OLOA 2BC0A 2YG4A 2GQWA 1DOEA 2RGJA 2VVMA 3QFAA 4CCRA 1OJTA 5FS9A 4I59A 4B69A 2QA1A 2VQ7A 4CBQA 2WPFA 3GDPA 3AWIA 3DK9A 4TM4A 1VQWA 4REKA 2Q6UA 2WETA 4H4QA 4P9SA 4A6NB 1MOKA 3SXIA 3BI4A 4B64A 3SQPA 2R0PA 2WHDA 4LIIA 1M64A 1KNPA 3V3OA 3AE2A 2V61A 4OVIA 2YLZA 4A6NA 3KLJA 4O5QA 5JCMA 2GH5A 1L9DA 2CVJA 2XFOA 3T14A 4C74A 1CC6A 4H4RA 2YM2A 4YT0A 2YVFA 1PS9A 4FK1C 2YR6A 3NK0X 3GYXA 5EBKA 1LQUA 3UP5A 2BS4A 1OJCA 4TLZA 3CIRA 2E5VA 1YQ3A 3BHFA 4YKGA 1B4VA 5U25A 3KVEA 1ZDLA 3NYCA 2ZBWA 4EQSA 3R9UA 1DNCA 4J31A 1NG3A 4APNA 3UKPA 1CL0A 4DNAA 4K8DA 4EQXA 5KWFA 3AE8A 4NEWA 2YWLA 4A5LA 5KMRA 1PN0A 2IIDA 1RSGA 1ZY8A 2OALA 5DBJA 3AE9A 1JRZA 4LA1A 4RSLA 1CJ2A 2A8XA 2B7SA 1B37A 3VRAA 1GRGA 1D4CA 2Z5YA 2AAQA 4GDPA 3EANA 1QLBA 2BRYA 2VZ2A 3AEBA 3AE5A 2YLTA 4GUVA 5LV9A 3K30A 4H4SA 1PBFA 3QVPA 3SFEA 2WP6A 5HYMA 1JRXA 4H7UA 3UKFA 4YKFA 4DSGA 3RP6A 1GV4A 1GRHA 3T0KA 3FBSA 3AEGA 1GREA 1EL9A 3NIXA 2ZZ0A 2XFPA 4K5RA 1VG9A 1YQ4A 4OPUA 2GR1A 4YXDA 3F8DA 3CPIG 3UTGA 3C4AA 1GPEA 1TDKA 3GYIA 1PBDA 2C75A 1NHPA 1CF3A 3QFBA 4J36A 2JB1A 1NDAA 4JNQA 4KX6A 4AP1A 4D04A 4U8IA 4E0VA 1GOSA 4NTCA 3ITJA 1D7YA 2R4EA 2WESA 3Q9TA 2XLRA 3KPKA 2O9ZA 2UZZA 4BK2A 3CGCA 2GR2A 1ZMCA 2W0HA 3H4KA 1E1KA 1N4UA 1EL5A 4JQ9A 2BK5A 3AEEA 4AT0A 4Z24A 2Q0LA 2VVLA 1B5QA 1XDIA 2JBVA 1FECA 3AD9B 3UOZA 1ZMDA 4K22A 1VG0A 4YSZA 4JY2A 1KF6A 2XFNA 2B76A 4U8LA 2C70A 1TDNA 3DGHA 2BXSA 5JCIA 3SYIA 3G5QA 3M0OA 4EQRA 1B8SA 1D5TA 2X8GA 1FCDA 1CJCA 1FL2A 1CJ4A 3UCLA 3KU9A 4CY6A 1F8RA 2GAHB 4YSYA 1DXLA 5IQ4A 1JOAA 1L9EA 3P4QA 3VR9A 1GESA 1RYIA 2X8HA 3AECA 4KPRA 3NYEA 4B68A 4K2XA 3ZDNA 3DMEA 2V6OA 4IV9A 1TYTA 1XPQA 2YLWA 5U63A 5HY5A 3JSKA 2GR3A 2RGHA 4ADWA 1GSNA 1TDEA 1D7LA 3AD8B 1F8SA 3NT6A 2YLSA 4HB9A 3RP7A 1F8WA 1PBEA 3AEFA 4G6GA 4C3XA 2JB3A 2Q7VA 4U8NA 2V3AA 2GEWA 1Q9IA 4OPDA 1ONFA 4K5SA 4H4VA 4RG4A 4BJZA 5CKUA 4BJYA 2XVJA 1PBCA 3QSMA 4AOXA 3II4A 3CTYA 1GEUA 3DK4A 2GVCA 1MXTA 1N4VA 2WEUA 1E6EA 1OJDA 1REOA 2C73A 2ZZCA 3ATQA 1EL8A 1NG4A 1BZLA 4RG3A 1V59A 1FEBA 1Y56A 3QSSA 2YR5A 4B63A 4C5OA 2V3BA 3FPZA 2C67A 3CGDA 2BK4A 1EL7A 5KRQA 2NPXA 3CGBA 2C3CA 2R45A 2VQBA 3GD3A 3FMWA 3M12A 4XWZA 4G73A 4AT2A 3O0HA 3RP8A 1F3PA 2BACA 1N4WA 1OJ9A 4U8PA 4G9KA 4EM4A 1E1MA 5KNLA 3GWDA 1EBDA 2R0CA 3B3RA 3P4PA 4U8MA 1H6VA 2YVJA 2QA2A 1NHSA 1GRTA 3AEDA 3GYJA 4O5UA 1UKVG 2BA9A 3Q6JA 3B6DA 1GALA 4H4UA 4BK1A 4EIQA 2XLSA 1E7PA 4TM1A 3CPHG 2E1MA 1K0JA 4Z2TA 4A79A 5CQFA 3URHA 1GETA 3BHKA 3FG2P 2R4JA 3SZFA 2GAGB 2VVLG 3GSIA 4LU6A 1H7WA 1O95A 2BC1A 3ALLA 1LQTA 2EQ7A 2YAUA 4UDPA 3S61A 3DA1A 3UKAA 2BABA 2FJEA 2XDOA 1BF3A 1O5WA 4MJWA 1S3BA 2A89A 2BK3A 4GDEA 1Z6LA 3D8XA 1E1LA 3NG7X 4U2LA 3REDA 4Z26A 2A87A 3V76A 2HQMA 4G6HA 1JRYA 2C3DA 4H2QA 2XLTA 4U2TA 4Y4NA 2XLPA 3F8PA 4IVOB 5GRTA 4G74A 3DGZA 1QJDA 5GSNA 2C7GA 2WP9A 2YLXA 4UDQA 3NN0X 3AEAA 2WPCA 2C65A 3HZLA 5TR3A 4BURA 1XANA 4H4WA 1PDHA 5BVAA 3IHGA 2WOWA 2YG7A 3BI5A 4PAAA 3OZ2A 3GMCA 1COYA 3SM8A 2B9WA 3P4RA 1H7XA 3NGCX 1PXCA 2EQ8A 5M0ZA 4Z43A 4Y4MA 4NNJA 1Q1RA 4A9WA 1TRBA 5BULA 2Z5XA 3AE4A 2FJBA 4YTMA 1LV0A 2VRMA 5EB5A 2GV8A 2QCUA 1Y56B 5J7XA 1BGNA 1GXFA 1S2QA 2C66A 2VRLA 2WDRA 3KPFA 3NKSA 4UDRA 4XXGA 1CC2A 1NAAA 2XCGA 3EAOA 1N1PA 4J34A 1D4DA 4OPIA 2R0GA 1NHRA 4NEVA 3NK1X 4TM3A 2ARDA 1IUUA 1FOHA 3NNEA 1GRFA 2R46A 4JN9A 1DODA 2PHHA 4ZCDA 4DGKA 3AE1A 3GDNA 3SZ0A 1P2EA 4B65A 1H81A 3BNUA 5KOXA 2OAMA 1IUTA 1QO8A 2JB2A 1YQZA 3PS9A 2JAEA 1GRAA 4J33A 1E1NA 1F6MA 3UOVA 5KMSA 3LOVA 1IUXA 3DJEA 2ZZBA 1ZOVA 4J56A 4NTDA 3C4NA 5FS7A 2CDUA 2XVIA 2EQ6A 1NEKA 3P9UA 2OLNA 3CNPA 4NZHA 1DJNA 3VRBA 3CNSA 4H2PA 1DJQA 2GRTA 2WOIA 2XLUA 4FX9A 4U8KA 5JCNA 2WU5A 3BI2A 3K7MX 3UP4A 2B9XA 3QVRA 2DKIA 4B66A 4EIPA 2YM1A 5EB4A 2RGOA 2FJAA 3SX6A 2XFQA 4OPCA 3LZWA 2WOVA 4H4XA 1PBBA 3AXBA 3EPTA 2WQYA 4ICYA 5KOWA 2QAEA 2C72A 4Z2RA 4EMJA 3CMMA 4CNJA 2JKCA 2YQUA 3VQRA 1OJAA 3CN8A 2X8CA 4GAPA 3NN6X 3SY4A 5HHFA 4TM0A 3AE3A 3WE0A 1S3EA 1YKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UKQ A;  2IVE A;  5JCK A;  1GND A;  3VR8 A;  4OCG A;  3KD9 A;  3NYF A;  5M10 A;  3AE6 A;  4U2S A;  2X50 A;  3S5W A;  3KKJ A;  3UKH A;  2IVD A;  3RHA A;  1JEH A;  1PXA A;  2X99 A;  1K0L A;  1PHH A;  2WS3 A;  3GRT A;  4NTE A;  1PJ7 A;  1NEN A;  2TPR A;  2XVH A;  4IA5 A;  4EMI A;  2Y6Q A;  2AR8 A;  5C2T A;  3DJD A;  5KXJ A;  3E1T A;  4H4Y A;  1TDF A;  2XVE A;  4JDR A;  3ALM A;  3QJ4 A;  4IVM B;  1TDO A;  4ECH A;  1ZP0 A;  2V5Z A;  3NHO X;  4B1B A;  4Y4L A;  4WX1 A;  4YTN A;  1LTX R;  2YVG A;  2YR4 A;  1KSU A;  3SGL A;  3PO7 A;  4H50 A;  4C77 A;  1HYU A;  1NPX A;  2VOU A;  1FEA A;  5HXI A;  1GTH A;  2XYO A;  1PJ5 A;  3AB1 A;  4CRT A;  1NHQ A;  4A7A A;  1VDC A;  5EOW A;  1X31 B;  3UOX A;  2RAB A;  3DK8 A;  2XVF A;  3AYJ A;  2EQ9 A;  2GR0 A;  1Y0P A;  1IUS A;  1K0I A;  3VRD B;  4X4J A;  4YWO A;  4A99 A;  1H82 A;  4Z25 A;  1M6I A;  4UP3 A;  2BCP A;  4X9N A;  3P4S A;  3LJP A;  3ICS A;  2NVK X;  4USR A;  1LVL A;  2I0Z A;  1LJ1 A;  4BK3 A;  1DOC A;  1ZX9 A;  5J60 A;  5FS6 A;  2WU2 A;  4Z2U A;  4N9X A;  4XWR A;  1IUW A;  2AQJ A;  1KSS A;  1L0V A;  2BYB A;  1O94 A;  3L8K A;  1DOB A;  3ALJ A;  4YTP A;  2BXR A;  1W4X A;  1H83 A;  1GTE A;  2APG A;  3ICT A;  3CGE A;  4DSH A;  1E39 A;  2YG6 A;  1YY5 A;  1XHC A;  3DJG X;  4CY8 A;  3AYL A;  1KDG A;  2JK6 A;  3FIM B;  4YSH A;  4ZN0 A;  5BUK A;  1AOG A;  2ACZ A;  3UTH A;  4AOS A;  3ATR A;  3L1R A;  4CCQ A;  1ELI A;  1MO9 A;  3LZX A;  2TMD A;  4Z44 A;  1H84 A;  3CND A;  1KFY A;  4M52 A;  3GRS A;  3NLC A;  3IC9 A;  4J2W A;  4ZCC A;  5BRT A;  4EMW A;  3DH9 A;  1ZK7 A;  3ISH A;  4AP3 A;  5IQ1 A;  1D4E A;  5IPY A;  3GMB A;  3H8L A;  3EF6 A;  3G5R A;  2Y6R A;  1GT8 A;  1PXB A;  2YG3 A;  2CUL A;  2FBW A;  4EM3 A;  2WP5 A;  3AD7 B;  3CNJ A;  3ZYX A;  2BS2 A;  3I6D A;  4FDC B;  4EQW A;  2GB0 A;  3QSE A;  4GRT A;  4X9M A;  3UKK A;  1CC4 A;  3ADA B;  3AYI A;  3F8R A;  5U1O A;  4FK1 A;  3V3N A;  3NRN A;  3IWA A;  1H86 A;  3UKL A;  5FS8 A;  4H4P A;  1K4Q A;  3I3L A;  4H4T A;  1IJH A;  1RP0 A;  3AE7 A;  5FMH A;  4OPT A;  1BGJ A;  3OC4 A;  4H2R A;  3IF9 A;  1LPF A;  2B7R A;  4GF7 A;  4JY3 A;  4B67 A;  1ZKQ A;  2FJD A;  2YLR A;  4H4Z A;  3G5S A;  1ZOY A;  3GWF A;  2YG5 A;  4YSX A;  3RNM A;  2F5Z A;  3ABV A;  3UOY A;  1GER A;  2WBA A;  2BCG G;  2WPE A;  3P1W A;  3COX A;  4A65 A;  1IUV A;  2WDV A;  1JU2 A;  2C64 A;  3KA7 A;  3PVC A;  1KNR A;  3GD4 A;  1P2H A;  1S2Y A;  3UTF A;  2J3N A;  4C3Y A;  4CNK A;  2V60 A;  3LB8 A;  4GR1 A;  4H2N A;  3C96 A;  2Q0K A;  1L9C A;  2R9Z A;  4J57 A;  1Q1W A;  3D1C A;  4USQ A;  3NTA A;  2B9Y A;  4HA6 A;  3CNT A;  5ER0 A;  2DKH A;  3DJJ A;  1BKW A;  4U8O A;  2BS3 A;  1CJ3 A;  3ICR A;  3NH3 X;  2E4G A;  4PAB A;  3T37 A;  5KVI A;  5C3J A;  2GQF A;  2X3N A;  3LAD A;  2PYX A;  1CHU A;  3LXD A;  4IA6 A;  4K7Z A;  3NK2 X;  1BWC A;  2H89 A;  4OPG A;  3BNM A;  4BV6 A;  4JNA A;  3SFD A;  4GCM A;  2GF3 A;  5KVH A;  5L46 A;  1SEZ A;  3K7Q X;  1PJ6 A;  2H88 A;  2OA1 A;  4TLX A;  2GMJ A;  1TYP A;  1VRQ B;  2CFY A;  4U8J A;  4WCT A;  4D03 A;  3H8I A;  1JNZ A;  3IHM A;  1CBO A;  1GRB A;  1JNR A;  3CPJ G;  2GMH A;  2XFU A;  4I58 A;  4OPL A;  3UTE A;  3K7T A;  3NTD A;  5JCL A;  2C76 A;  2WDQ A;  3M13 A;  2OLO A;  2BC0 A;  2YG4 A;  2GQW A;  1DOE A;  2RGJ A;  2VVM A;  3QFA A;  4CCR A;  1OJT A;  5FS9 A;  4I59 A;  4B69 A;  2QA1 A;  2VQ7 A;  4CBQ A;  2WPF A;  3GDP A;  3AWI A;  3DK9 A;  4TM4 A;  1VQW A;  4REK A;  2Q6U A;  2WET A;  4H4Q A;  4P9S A;  4A6N B;  1MOK A;  3BI4 A;  4B64 A;  3SQP A;  2R0P A;  2WHD A;  4LII A;  1M64 A;  1KNP A;  3V3O A;  3AE2 A;  2V61 A;  4OVI A;  2YLZ A;  4A6N A;  3KLJ A;  4O5Q A;  5JCM A;  2GH5 A;  1L9D A;  2CVJ A;  2XFO A;  4C74 A;  1CC6 A;  4H4R A;  2YM2 A;  4YT0 A;  2YVF A;  1PS9 A;  4FK1 C;  2YR6 A;  3NK0 X;  5EBK A;  1LQU A;  3UP5 A;  2BS4 A;  1OJC A;  4TLZ A;  3CIR A;  2E5V A;  1YQ3 A;  3BHF A;  4YKG A;  1B4V A;  5U25 A;  3KVE A;  1ZDL A;  3NYC A;  2ZBW A;  4EQS A;  3R9U A;  1DNC A;  4J31 A;  1NG3 A;  4APN A;  3UKP A;  1CL0 A;  4DNA A;  4K8D A;  4EQX A;  5KWF A;  3AE8 A;  4NEW A;  2YWL A;  4A5L A;  1PN0 A;  2IID A;  1RSG A;  1ZY8 A;  2OAL A;  5DBJ A;  3AE9 A;  1JRZ A;  4LA1 A;  4RSL A;  1CJ2 A;  2A8X A;  2B7S A;  1B37 A;  3VRA A;  1GRG A;  1D4C A;  2Z5Y A;  2AAQ A;  4GDP A;  3EAN A;  1QLB A;  2VZ2 A;  3AEB A;  3AE5 A;  2YLT A;  4GUV A;  5LV9 A;  3K30 A;  4H4S A;  1PBF A;  3QVP A;  3SFE A;  2WP6 A;  5HYM A;  1JRX A;  4H7U A;  3UKF A;  4YKF A;  4DSG A;  3RP6 A;  1GV4 A;  1GRH A;  3FBS A;  3AEG A;  1GRE A;  1EL9 A;  3NIX A;  2ZZ0 A;  2XFP A;  4K5R A;  1VG9 A;  1YQ4 A;  4OPU A;  2GR1 A;  4YXD A;  3F8D A;  3CPI G;  3UTG A;  3C4A A;  1GPE A;  1TDK A;  3GYI A;  1PBD A;  2C75 A;  1NHP A;  1CF3 A;  3QFB A;  4J36 A;  2JB1 A;  1NDA A;  4JNQ A;  4KX6 A;  4AP1 A;  4D04 A;  4U8I A;  4E0V A;  1GOS A;  4NTC A;  3ITJ A;  1D7Y A;  2R4E A;  2WES A;  3Q9T A;  2XLR A;  2O9Z A;  2UZZ A;  4BK2 A;  3CGC A;  2GR2 A;  1ZMC A;  2W0H A;  3H4K A;  1E1K A;  1N4U A;  1EL5 A;  4JQ9 A;  2BK5 A;  3AEE A;  4AT0 A;  4Z24 A;  2Q0L A;  2VVL A;  1B5Q A;  1XDI A;  2JBV A;  1FEC A;  3AD9 B;  3UOZ A;  1ZMD A;  4K22 A;  1VG0 A;  4YSZ A;  4JY2 A;  1KF6 A;  2XFN A;  2B76 A;  4U8L A;  2C70 A;  1TDN A;  3DGH A;  2BXS A;  5JCI A;  3G5Q A;  3M0O A;  4EQR A;  1B8S A;  1D5T A;  2X8G A;  1FCD A;  1CJC A;  1FL2 A;  1CJ4 A;  3UCL A;  3KU9 A;  4CY6 A;  1F8R A;  2GAH B;  4YSY A;  1DXL A;  5IQ4 A;  1JOA A;  1L9E A;  3P4Q A;  3VR9 A;  1GES A;  1RYI A;  2X8H A;  3AEC A;  4KPR A;  3NYE A;  4B68 A;  4K2X A;  3ZDN A;  3DME A;  2V6O A;  4IV9 A;  1TYT A;  1XPQ A;  2YLW A;  5U63 A;  5HY5 A;  3JSK A;  2GR3 A;  2RGH A;  4ADW A;  1GSN A;  1TDE A;  1D7L A;  3AD8 B;  1F8S A;  3NT6 A;  2YLS A;  4HB9 A;  3RP7 A;  1F8W A;  1PBE A;  3AEF A;  4C3X A;  2JB3 A;  2Q7V A;  4U8N A;  2V3A A;  2GEW A;  1Q9I A;  4OPD A;  1ONF A;  4K5S A;  4H4V A;  4RG4 A;  4BJZ A;  5CKU A;  4BJY A;  2XVJ A;  1PBC A;  3QSM A;  4AOX A;  3II4 A;  3CTY A;  1GEU A;  3DK4 A;  2GVC A;  1MXT A;  1N4V A;  2WEU A;  1E6E A;  1OJD A;  1REO A;  2C73 A;  2ZZC A;  3ATQ A;  1EL8 A;  1NG4 A;  1BZL A;  4RG3 A;  1V59 A;  1FEB A;  1Y56 A;  3QSS A;  2YR5 A;  4B63 A;  4C5O A;  2V3B A;  3FPZ A;  2C67 A;  3CGD A;  2BK4 A;  1EL7 A;  5KRQ A;  2NPX A;  3CGB A;  2C3C A;  2R45 A;  2VQB A;  3GD3 A;  3FMW A;  3M12 A;  4XWZ A;  4AT2 A;  3O0H A;  3RP8 A;  1F3P A;  2BAC A;  1N4W A;  1OJ9 A;  4U8P A;  4EM4 A;  1E1M A;  3GWD A;  1EBD A;  2R0C A;  3B3R A;  3P4P A;  4U8M A;  1H6V A;  2YVJ A;  2QA2 A;  1NHS A;  1GRT A;  3AED A;  3GYJ A;  4O5U A;  1UKV G;  2BA9 A;  3Q6J A;  3B6D A;  1GAL A;  4H4U A;  4BK1 A;  4EIQ A;  2XLS A;  1E7P A;  4TM1 A;  3CPH G;  2E1M A;  1K0J A;  4Z2T A;  4A79 A;  5CQF A;  3URH A;  1GET A;  3BHK A;  3FG2 P;  2R4J A;  2GAG B;  2VVL G;  3GSI A;  4LU6 A;  1H7W A;  1O95 A;  2BC1 A;  3ALL A;  1LQT A;  2EQ7 A;  2YAU A;  4UDP A;  3S61 A;  3DA1 A;  3UKA A;  2BAB A;  2FJE A;  2XDO A;  1BF3 A;  1O5W A;  4MJW A;  1S3B A;  2A89 A;  2BK3 A;  4GDE A;  1Z6L A;  3D8X A;  1E1L A;  3NG7 X;  4U2L A;  3RED A;  4Z26 A;  2A87 A;  3V76 A;  2HQM A;  4H2Q A;  1JRY A;  2C3D A;  4U2T A;  2XLT A;  4Y4N A;  2XLP A;  3F8P A;  4IVO B;  5GRT A;  3DGZ A;  1QJD A;  5GSN A;  2C7G A;  2WP9 A;  2YLX A;  4UDQ A;  3NN0 X;  3AEA A;  2WPC A;  2C65 A;  3HZL A;  5TR3 A;  4BUR A;  1XAN A;  4H4W A;  1PDH A;  5BVA A;  3IHG A;  2WOW A;  2YG7 A;  3BI5 A;  4PAA A;  3OZ2 A;  3GMC A;  1COY A;  3SM8 A;  2B9W A;  3P4R A;  1H7X A;  3NGC X;  1PXC A;  2EQ8 A;  5M0Z A;  4Z43 A;  4Y4M A;  1Q1R A;  4A9W A;  1TRB A;  5BUL A;  2Z5X A;  3AE4 A;  2FJB A;  4YTM A;  1LV0 A;  2VRM A;  5EB5 A;  2GV8 A;  2QCU A;  1Y56 B;  5J7X A;  1BGN A;  1GXF A;  1S2Q A;  2C66 A;  2VRL A;  2WDR A;  3KPF A;  3NKS A;  4UDR A;  4XXG A;  1CC2 A;  1NAA A;  2XCG A;  3EAO A;  1N1P A;  4J34 A;  1D4D A;  4OPI A;  2R0G A;  1NHR A;  4NEV A;  3NK1 X;  4TM3 A;  2ARD A;  1IUU A;  1FOH A;  3NNE A;  1GRF A;  2R46 A;  4JN9 A;  1DOD A;  2PHH A;  4ZCD A;  4DGK A;  3AE1 A;  3GDN A;  1P2E A;  4B65 A;  1H81 A;  3BNU A;  5KOX A;  2OAM A;  1IUT A;  1QO8 A;  2JB2 A;  1YQZ A;  3PS9 A;  2JAE A;  1GRA A;  4J33 A;  1E1N A;  1F6M A;  3UOV A;  3LOV A;  1IUX A;  3DJE A;  2ZZB A;  1ZOV A;  4J56 A;  4NTD A;  3C4N A;  5FS7 A;  2CDU A;  2XVI A;  2EQ6 A;  1NEK A;  3P9U A;  2OLN A;  3CNP A;  4NZH A;  1DJN A;  3VRB A;  3CNS A;  4H2P A;  1DJQ A;  2GRT A;  2WOI A;  2XLU A;  4FX9 A;  4U8K A;  5JCN A;  2WU5 A;  3BI2 A;  3K7M X;  3UP4 A;  2B9X A;  3QVR A;  2DKI A;  4B66 A;  4EIP A;  2YM1 A;  5EB4 A;  2RGO A;  2FJA A;  2XFQ A;  4OPC A;  3LZW A;  2WOV A;  4H4X A;  1PBB A;  3AXB A;  3EPT A;  2WQY A;  4ICY A;  5KOW A;  2QAE A;  2C72 A;  4Z2R A;  4EMJ A;  4CNJ A;  2JKC A;  2YQU A;  3VQR A;  1OJA A;  3CN8 A;  2X8C A;  3NN6 X;  5HHF A;  4TM0 A;  3AE3 A;  3WE0 A;  1S3E A;  1YKJ A; 
#chains in the Genus database with same CATH topology
 3UKQ A;  2IVE A;  5JCK A;  1GND A;  3VR8 A;  4OCG A;  3KD9 A;  3NYF A;  5M10 A;  3AE6 A;  4U2S A;  2X50 A;  3S5W A;  3KKJ A;  3UKH A;  2IVD A;  3RHA A;  1JEH A;  1PXA A;  2X99 A;  1K0L A;  1PHH A;  2WS3 A;  3GRT A;  4NTE A;  1PJ7 A;  1NEN A;  2TPR A;  2XVH A;  4IA5 A;  4EMI A;  2Y6Q A;  2C4C A;  2AR8 A;  5C2T A;  3DJD A;  5KXJ A;  3E1T A;  4H4Y A;  1TDF A;  2XVE A;  4JDR A;  3ALM A;  3QJ4 A;  4IVM B;  1TDO A;  4ECH A;  1ZP0 A;  2V5Z A;  3NHO X;  4B1B A;  4Y4L A;  4WX1 A;  4YTN A;  1LTX R;  2YVG A;  2YR4 A;  1KSU A;  3SGL A;  3PO7 A;  4H50 A;  4C77 A;  1HYU A;  1NPX A;  2VOU A;  1FEA A;  5HXI A;  1GTH A;  4GAV A;  2XYO A;  1PJ5 A;  3AB1 A;  5KMP A;  4CRT A;  1NHQ A;  4A7A A;  1VDC A;  5EOW A;  1X31 B;  3UOX A;  2RAB A;  3DK8 A;  2XVF A;  3AYJ A;  2EQ9 A;  2GR0 A;  1Y0P A;  1IUS A;  1K0I A;  3VRD B;  4X4J A;  4YWO A;  4A99 A;  1H82 A;  4Z25 A;  1M6I A;  4UP3 A;  2BCP A;  4X9N A;  3P4S A;  3LJP A;  3ICS A;  2NVK X;  4USR A;  1LVL A;  2I0Z A;  1LJ1 A;  4BK3 A;  1DOC A;  1ZX9 A;  5J60 A;  5FS6 A;  2WU2 A;  4Z2U A;  4N9X A;  4XWR A;  1IUW A;  2AQJ A;  1KSS A;  3HYW A;  2BYB A;  1L0V A;  1O94 A;  3L8K A;  1DOB A;  3ALJ A;  4YTP A;  2BXR A;  1W4X A;  1H83 A;  1GTE A;  2APG A;  3ICT A;  3CGE A;  4DSH A;  1E39 A;  4II3 A;  2YG6 A;  1YY5 A;  1XHC A;  3DJG X;  4CY8 A;  3AYL A;  1KDG A;  2JK6 A;  3FIM B;  4YSH A;  4ZN0 A;  5BUK A;  1AOG A;  5KMQ A;  2ACZ A;  3UTH A;  4AOS A;  3ATR A;  2BRA A;  3L1R A;  1ELI A;  1MO9 A;  3LZX A;  4CCQ A;  2TMD A;  4Z44 A;  1H84 A;  3CND A;  1KFY A;  4M52 A;  3GRS A;  3NLC A;  3IC9 A;  4J2W A;  4ZCC A;  5BRT A;  4EMW A;  3DH9 A;  1ZK7 A;  4NWZ A;  3ISH A;  3T2Z A;  4AP3 A;  5IQ1 A;  1D4E A;  5IPY A;  3T2Y A;  3GMB A;  3SZC A;  3H8L A;  3EF6 A;  3G5R A;  2Y6R A;  1GT8 A;  1PXB A;  2YG3 A;  2CUL A;  2FBW A;  4EM3 A;  3T2K A;  2WP5 A;  3AD7 B;  3CNJ A;  3ZYX A;  2BS2 A;  3I6D A;  4FDC B;  4EQW A;  2GB0 A;  3QSE A;  4GRT A;  4X9M A;  3UKK A;  1CC4 A;  3ADA B;  3AYI A;  3F8R A;  5U1O A;  4FK1 A;  3V3N A;  3NRN A;  3IWA A;  1H86 A;  3UKL A;  5FS8 A;  4H4P A;  1K4Q A;  3I3L A;  4H4T A;  1IJH A;  1RP0 A;  3AE7 A;  5FMH A;  4OPT A;  1BGJ A;  3OC4 A;  4H2R A;  3IF9 A;  1LPF A;  2B7R A;  4GF7 A;  4JY3 A;  4B67 A;  1ZKQ A;  2FJD A;  2YLR A;  4H4Z A;  3G5S A;  1ZOY A;  3GWF A;  2YG5 A;  4YSX A;  3RNM A;  2F5Z A;  3ABV A;  3UOY A;  1GER A;  2WBA A;  2BCG G;  2WPE A;  3P1W A;  3COX A;  4A65 A;  1IUV A;  2WDV A;  1JU2 A;  2C64 A;  3KA7 A;  3PVC A;  1KNR A;  3GD4 A;  1P2H A;  1S2Y A;  3UTF A;  2J3N A;  4C3Y A;  4CNK A;  2V60 A;  3LB8 A;  4GR1 A;  4H2N A;  3C96 A;  2Q0K A;  1L9C A;  2R9Z A;  4J57 A;  1Q1W A;  3D1C A;  4USQ A;  3NTA A;  2B9Y A;  4HA6 A;  3CNT A;  5ER0 A;  2DKH A;  3DJJ A;  1BKW A;  4U8O A;  2BS3 A;  1CJ3 A;  3ICR A;  3NH3 X;  2E4G A;  4PAB A;  3T31 A;  5KVI A;  3T37 A;  2GQF A;  2X3N A;  3LAD A;  5C3J A;  2PYX A;  1CHU A;  3LXD A;  4IA6 A;  4K7Z A;  3NK2 X;  1BWC A;  3SZW A;  2H89 A;  4OPG A;  3BNM A;  4BV6 A;  4JNA A;  3SFD A;  3HYX A;  4GCM A;  2GF3 A;  5KVH A;  5L46 A;  1SEZ A;  3K7Q X;  1PJ6 A;  2H88 A;  2OA1 A;  4TLX A;  2GMJ A;  1TYP A;  1VRQ B;  2CFY A;  4U8J A;  4WCT A;  4D03 A;  4II2 A;  3HYV A;  3H8I A;  1JNZ A;  3IHM A;  1CBO A;  1GRB A;  1JNR A;  3CPJ G;  2GMH A;  2XFU A;  4I58 A;  4OPL A;  3UTE A;  3K7T A;  3NTD A;  5JCL A;  2C76 A;  2WDQ A;  3M13 A;  2OLO A;  2BC0 A;  2YG4 A;  2GQW A;  1DOE A;  2RGJ A;  2VVM A;  3QFA A;  4CCR A;  1OJT A;  5FS9 A;  4I59 A;  4B69 A;  2QA1 A;  2VQ7 A;  4CBQ A;  2WPF A;  3GDP A;  3AWI A;  3DK9 A;  4TM4 A;  1VQW A;  4REK A;  2Q6U A;  2WET A;  4H4Q A;  4P9S A;  4A6N B;  1MOK A;  3SXI A;  3BI4 A;  4B64 A;  3SQP A;  2R0P A;  2WHD A;  4LII A;  1M64 A;  1KNP A;  3V3O A;  3AE2 A;  2V61 A;  4OVI A;  2YLZ A;  4A6N A;  3KLJ A;  4O5Q A;  5JCM A;  2GH5 A;  1L9D A;  2CVJ A;  2XFO A;  3T14 A;  4C74 A;  1CC6 A;  4H4R A;  2YM2 A;  4YT0 A;  2YVF A;  1PS9 A;  4FK1 C;  2YR6 A;  3NK0 X;  3GYX A;  5EBK A;  1LQU A;  3UP5 A;  2BS4 A;  1OJC A;  4TLZ A;  3CIR A;  2E5V A;  1YQ3 A;  3BHF A;  4YKG A;  1B4V A;  5U25 A;  3KVE A;  1ZDL A;  3NYC A;  2ZBW A;  4EQS A;  3R9U A;  1DNC A;  4J31 A;  1NG3 A;  4APN A;  3UKP A;  1CL0 A;  4DNA A;  4K8D A;  4EQX A;  5KWF A;  3AE8 A;  4NEW A;  2YWL A;  4A5L A;  5KMR A;  1PN0 A;  2IID A;  1RSG A;  1ZY8 A;  2OAL A;  5DBJ A;  3AE9 A;  1JRZ A;  4LA1 A;  4RSL A;  1CJ2 A;  2A8X A;  2B7S A;  1B37 A;  3VRA A;  1GRG A;  1D4C A;  2Z5Y A;  2AAQ A;  4GDP A;  3EAN A;  1QLB A;  2BRY A;  2VZ2 A;  3AEB A;  3AE5 A;  2YLT A;  4GUV A;  5LV9 A;  3K30 A;  4H4S A;  1PBF A;  3QVP A;  3SFE A;  2WP6 A;  5HYM A;  1JRX A;  4H7U A;  3UKF A;  4YKF A;  4DSG A;  3RP6 A;  1GV4 A;  1GRH A;  3T0K A;  3FBS A;  3AEG A;  1GRE A;  1EL9 A;  3NIX A;  2ZZ0 A;  2XFP A;  4K5R A;  1VG9 A;  1YQ4 A;  4OPU A;  2GR1 A;  4YXD A;  3F8D A;  3CPI G;  3UTG A;  3C4A A;  1GPE A;  1TDK A;  3GYI A;  1PBD A;  2C75 A;  1NHP A;  1CF3 A;  3QFB A;  4J36 A;  2JB1 A;  1NDA A;  4JNQ A;  4KX6 A;  4AP1 A;  4D04 A;  4U8I A;  4E0V A;  1GOS A;  4NTC A;  3ITJ A;  1D7Y A;  2R4E A;  2WES A;  3Q9T A;  2XLR A;  3KPK A;  2O9Z A;  2UZZ A;  4BK2 A;  3CGC A;  2GR2 A;  1ZMC A;  2W0H A;  3H4K A;  1E1K A;  1N4U A;  1EL5 A;  4JQ9 A;  2BK5 A;  3AEE A;  4AT0 A;  4Z24 A;  2Q0L A;  2VVL A;  1B5Q A;  1XDI A;  2JBV A;  1FEC A;  3AD9 B;  3UOZ A;  1ZMD A;  4K22 A;  1VG0 A;  4YSZ A;  4JY2 A;  1KF6 A;  2XFN A;  2B76 A;  4U8L A;  2C70 A;  1TDN A;  3DGH A;  2BXS A;  5JCI A;  3SYI A;  3G5Q A;  3M0O A;  4EQR A;  1B8S A;  1D5T A;  2X8G A;  1FCD A;  1CJC A;  1FL2 A;  1CJ4 A;  3UCL A;  3KU9 A;  4CY6 A;  1F8R A;  2GAH B;  4YSY A;  1DXL A;  5IQ4 A;  1JOA A;  1L9E A;  3P4Q A;  3VR9 A;  1GES A;  1RYI A;  2X8H A;  3AEC A;  4KPR A;  3NYE A;  4B68 A;  4K2X A;  3ZDN A;  3DME A;  2V6O A;  4IV9 A;  1TYT A;  1XPQ A;  2YLW A;  5U63 A;  5HY5 A;  3JSK A;  2GR3 A;  2RGH A;  4ADW A;  1GSN A;  1TDE A;  1D7L A;  3AD8 B;  1F8S A;  3NT6 A;  2YLS A;  4HB9 A;  3RP7 A;  1F8W A;  1PBE A;  3AEF A;  4G6G A;  4C3X A;  2JB3 A;  2Q7V A;  4U8N A;  2V3A A;  2GEW A;  1Q9I A;  4OPD A;  1ONF A;  4K5S A;  4H4V A;  4RG4 A;  4BJZ A;  5CKU A;  4BJY A;  2XVJ A;  1PBC A;  3QSM A;  4AOX A;  3II4 A;  3CTY A;  1GEU A;  3DK4 A;  2GVC A;  1MXT A;  1N4V A;  2WEU A;  1E6E A;  1OJD A;  1REO A;  2C73 A;  2ZZC A;  3ATQ A;  1EL8 A;  1NG4 A;  1BZL A;  4RG3 A;  1V59 A;  1FEB A;  1Y56 A;  3QSS A;  2YR5 A;  4B63 A;  4C5O A;  2V3B A;  3FPZ A;  2C67 A;  3CGD A;  2BK4 A;  1EL7 A;  5KRQ A;  2NPX A;  3CGB A;  2C3C A;  2R45 A;  2VQB A;  3GD3 A;  3FMW A;  3M12 A;  4XWZ A;  4G73 A;  4AT2 A;  3O0H A;  3RP8 A;  1F3P A;  2BAC A;  1N4W A;  1OJ9 A;  4U8P A;  4G9K A;  4EM4 A;  1E1M A;  5KNL A;  3GWD A;  1EBD A;  2R0C A;  3B3R A;  3P4P A;  4U8M A;  1H6V A;  2YVJ A;  2QA2 A;  1NHS A;  1GRT A;  3AED A;  3GYJ A;  4O5U A;  1UKV G;  2BA9 A;  3Q6J A;  3B6D A;  1GAL A;  4H4U A;  4BK1 A;  4EIQ A;  2XLS A;  1E7P A;  4TM1 A;  3CPH G;  2E1M A;  1K0J A;  4Z2T A;  4A79 A;  5CQF A;  3URH A;  1GET A;  3BHK A;  3FG2 P;  2R4J A;  3SZF A;  2GAG B;  2VVL G;  3GSI A;  4LU6 A;  1H7W A;  1O95 A;  2BC1 A;  3ALL A;  1LQT A;  2EQ7 A;  2YAU A;  4UDP A;  3S61 A;  3DA1 A;  3UKA A;  2BAB A;  2FJE A;  2XDO A;  1BF3 A;  1O5W A;  4MJW A;  1S3B A;  2A89 A;  2BK3 A;  4GDE A;  1Z6L A;  3D8X A;  1E1L A;  3NG7 X;  4U2L A;  3RED A;  4Z26 A;  2A87 A;  3V76 A;  2HQM A;  4G6H A;  1JRY A;  2C3D A;  4H2Q A;  2XLT A;  4U2T A;  4Y4N A;  2XLP A;  3F8P A;  4IVO B;  5GRT A;  4G74 A;  3DGZ A;  1QJD A;  5GSN A;  2C7G A;  2WP9 A;  2YLX A;  4UDQ A;  3NN0 X;  3AEA A;  2WPC A;  2C65 A;  3HZL A;  5TR3 A;  4BUR A;  1XAN A;  4H4W A;  1PDH A;  5BVA A;  3IHG A;  2WOW A;  2YG7 A;  3BI5 A;  4PAA A;  3OZ2 A;  3GMC A;  1COY A;  3SM8 A;  2B9W A;  3P4R A;  1H7X A;  3NGC X;  1PXC A;  2EQ8 A;  5M0Z A;  4Z43 A;  4Y4M A;  4NNJ A;  1Q1R A;  4A9W A;  1TRB A;  5BUL A;  2Z5X A;  3AE4 A;  2FJB A;  4YTM A;  1LV0 A;  2VRM A;  5EB5 A;  2GV8 A;  2QCU A;  1Y56 B;  5J7X A;  1BGN A;  1GXF A;  1S2Q A;  2C66 A;  2VRL A;  2WDR A;  3KPF A;  3NKS A;  4UDR A;  4XXG A;  1CC2 A;  1NAA A;  2XCG A;  3EAO A;  1N1P A;  4J34 A;  1D4D A;  4OPI A;  2R0G A;  1NHR A;  4NEV A;  3NK1 X;  4TM3 A;  2ARD A;  1IUU A;  1FOH A;  3NNE A;  1GRF A;  2R46 A;  4JN9 A;  1DOD A;  2PHH A;  4ZCD A;  4DGK A;  3AE1 A;  3GDN A;  3SZ0 A;  1P2E A;  4B65 A;  1H81 A;  3BNU A;  5KOX A;  2OAM A;  1IUT A;  1QO8 A;  2JB2 A;  1YQZ A;  3PS9 A;  2JAE A;  1GRA A;  4J33 A;  1E1N A;  1F6M A;  3UOV A;  5KMS A;  3LOV A;  1IUX A;  3DJE A;  2ZZB A;  1ZOV A;  4J56 A;  4NTD A;  3C4N A;  5FS7 A;  2CDU A;  2XVI A;  2EQ6 A;  1NEK A;  3P9U A;  2OLN A;  3CNP A;  4NZH A;  1DJN A;  3VRB A;  3CNS A;  4H2P A;  1DJQ A;  2GRT A;  2WOI A;  2XLU A;  4FX9 A;  4U8K A;  5JCN A;  2WU5 A;  3BI2 A;  3K7M X;  3UP4 A;  2B9X A;  3QVR A;  2DKI A;  4B66 A;  4EIP A;  2YM1 A;  5EB4 A;  2RGO A;  2FJA A;  3SX6 A;  2XFQ A;  4OPC A;  3LZW A;  2WOV A;  4H4X A;  1PBB A;  3AXB A;  3EPT A;  2WQY A;  4ICY A;  5KOW A;  2QAE A;  2C72 A;  4Z2R A;  4EMJ A;  3CMM A;  4CNJ A;  2JKC A;  2YQU A;  3VQR A;  1OJA A;  3CN8 A;  2X8C A;  4GAP A;  3NN6 X;  3SY4 A;  5HHF A;  4TM0 A;  3AE3 A;  3WE0 A;  1S3E A;  1YKJ A; 
#chains in the Genus database with same CATH homology
 3UKQ A;  2IVE A;  5JCK A;  1GND A;  3VR8 A;  4OCG A;  3KD9 A;  3NYF A;  5M10 A;  3AE6 A;  4U2S A;  2X50 A;  3S5W A;  3KKJ A;  3UKH A;  2IVD A;  3RHA A;  1JEH A;  1PXA A;  2X99 A;  1K0L A;  1PHH A;  2WS3 A;  3GRT A;  4NTE A;  1PJ7 A;  1NEN A;  2TPR A;  2XVH A;  4IA5 A;  4EMI A;  2Y6Q A;  2C4C A;  2AR8 A;  5C2T A;  3DJD A;  5KXJ A;  3E1T A;  4H4Y A;  1TDF A;  2XVE A;  4JDR A;  3ALM A;  3QJ4 A;  4IVM B;  1TDO A;  4ECH A;  1ZP0 A;  2V5Z A;  3NHO X;  4B1B A;  4Y4L A;  4WX1 A;  4YTN A;  1LTX R;  2YVG A;  2YR4 A;  1KSU A;  3SGL A;  3PO7 A;  4H50 A;  4C77 A;  1HYU A;  1NPX A;  2VOU A;  1FEA A;  5HXI A;  1GTH A;  4GAV A;  2XYO A;  1PJ5 A;  3AB1 A;  5KMP A;  4CRT A;  1NHQ A;  4A7A A;  1VDC A;  5EOW A;  1X31 B;  3UOX A;  2RAB A;  3DK8 A;  2XVF A;  3AYJ A;  2EQ9 A;  2GR0 A;  1Y0P A;  1IUS A;  1K0I A;  3VRD B;  4X4J A;  4YWO A;  4A99 A;  1H82 A;  4Z25 A;  1M6I A;  4UP3 A;  2BCP A;  4X9N A;  3P4S A;  3LJP A;  3ICS A;  2NVK X;  4USR A;  1LVL A;  2I0Z A;  1LJ1 A;  4BK3 A;  1DOC A;  1ZX9 A;  5J60 A;  5FS6 A;  2WU2 A;  4Z2U A;  4N9X A;  4XWR A;  1IUW A;  2AQJ A;  1KSS A;  3HYW A;  2BYB A;  1L0V A;  1O94 A;  3L8K A;  1DOB A;  3ALJ A;  4YTP A;  2BXR A;  1W4X A;  1H83 A;  1GTE A;  2APG A;  3ICT A;  3CGE A;  4DSH A;  1E39 A;  4II3 A;  2YG6 A;  1YY5 A;  1XHC A;  3DJG X;  4CY8 A;  3AYL A;  1KDG A;  2JK6 A;  3FIM B;  4YSH A;  4ZN0 A;  5BUK A;  1AOG A;  5KMQ A;  2ACZ A;  3UTH A;  4AOS A;  3ATR A;  2BRA A;  3L1R A;  1ELI A;  1MO9 A;  3LZX A;  4CCQ A;  2TMD A;  4Z44 A;  1H84 A;  3CND A;  1KFY A;  4M52 A;  3GRS A;  3NLC A;  3IC9 A;  4J2W A;  4ZCC A;  5BRT A;  4EMW A;  3DH9 A;  1ZK7 A;  4NWZ A;  3ISH A;  3T2Z A;  4AP3 A;  5IQ1 A;  1D4E A;  5IPY A;  3T2Y A;  3GMB A;  3SZC A;  3H8L A;  3EF6 A;  3G5R A;  2Y6R A;  1GT8 A;  1PXB A;  2YG3 A;  2CUL A;  2FBW A;  4EM3 A;  3T2K A;  2WP5 A;  3AD7 B;  3CNJ A;  3ZYX A;  2BS2 A;  3I6D A;  4FDC B;  4EQW A;  2GB0 A;  3QSE A;  4GRT A;  4X9M A;  3UKK A;  1CC4 A;  3ADA B;  3AYI A;  3F8R A;  5U1O A;  4FK1 A;  3V3N A;  3NRN A;  3IWA A;  1H86 A;  3UKL A;  5FS8 A;  4H4P A;  1K4Q A;  3I3L A;  4H4T A;  1IJH A;  1RP0 A;  3AE7 A;  5FMH A;  4OPT A;  1BGJ A;  3OC4 A;  4H2R A;  3IF9 A;  1LPF A;  2B7R A;  4GF7 A;  4JY3 A;  4B67 A;  1ZKQ A;  2FJD A;  2YLR A;  4H4Z A;  3G5S A;  1ZOY A;  3GWF A;  2YG5 A;  4YSX A;  3RNM A;  2F5Z A;  3ABV A;  3UOY A;  1GER A;  2WBA A;  2BCG G;  2WPE A;  3P1W A;  3COX A;  4A65 A;  1IUV A;  2WDV A;  1JU2 A;  2C64 A;  3KA7 A;  3PVC A;  1KNR A;  3GD4 A;  1P2H A;  1S2Y A;  3UTF A;  2J3N A;  4C3Y A;  4CNK A;  2V60 A;  3LB8 A;  4GR1 A;  4H2N A;  3C96 A;  2Q0K A;  1L9C A;  2R9Z A;  4J57 A;  1Q1W A;  3D1C A;  4USQ A;  3NTA A;  2B9Y A;  4HA6 A;  3CNT A;  5ER0 A;  2DKH A;  3DJJ A;  1BKW A;  4U8O A;  2BS3 A;  1CJ3 A;  3ICR A;  3NH3 X;  2E4G A;  4PAB A;  3T31 A;  5KVI A;  3T37 A;  2GQF A;  2X3N A;  3LAD A;  5C3J A;  2PYX A;  1CHU A;  3LXD A;  4IA6 A;  4K7Z A;  3NK2 X;  1BWC A;  3SZW A;  2H89 A;  4OPG A;  3BNM A;  4BV6 A;  4JNA A;  3SFD A;  3HYX A;  4GCM A;  2GF3 A;  5KVH A;  5L46 A;  1SEZ A;  3K7Q X;  1PJ6 A;  2H88 A;  2OA1 A;  4TLX A;  2GMJ A;  1TYP A;  1VRQ B;  2CFY A;  4U8J A;  4WCT A;  4D03 A;  4II2 A;  3HYV A;  3H8I A;  1JNZ A;  3IHM A;  1CBO A;  1GRB A;  1JNR A;  3CPJ G;  2GMH A;  2XFU A;  4I58 A;  4OPL A;  3UTE A;  3K7T A;  3NTD A;  5JCL A;  2C76 A;  2WDQ A;  3M13 A;  2OLO A;  2BC0 A;  2YG4 A;  2GQW A;  1DOE A;  2RGJ A;  2VVM A;  3QFA A;  4CCR A;  1OJT A;  5FS9 A;  4I59 A;  4B69 A;  2QA1 A;  2VQ7 A;  4CBQ A;  2WPF A;  3GDP A;  3AWI A;  3DK9 A;  4TM4 A;  1VQW A;  4REK A;  2Q6U A;  2WET A;  4H4Q A;  4P9S A;  4A6N B;  1MOK A;  3SXI A;  3BI4 A;  4B64 A;  3SQP A;  2R0P A;  2WHD A;  4LII A;  1M64 A;  1KNP A;  3V3O A;  3AE2 A;  2V61 A;  4OVI A;  2YLZ A;  4A6N A;  3KLJ A;  4O5Q A;  5JCM A;  2GH5 A;  1L9D A;  2CVJ A;  2XFO A;  3T14 A;  4C74 A;  1CC6 A;  4H4R A;  2YM2 A;  4YT0 A;  2YVF A;  1PS9 A;  4FK1 C;  2YR6 A;  3NK0 X;  3GYX A;  5EBK A;  1LQU A;  3UP5 A;  2BS4 A;  1OJC A;  4TLZ A;  3CIR A;  2E5V A;  1YQ3 A;  3BHF A;  4YKG A;  1B4V A;  5U25 A;  3KVE A;  1ZDL A;  3NYC A;  2ZBW A;  4EQS A;  3R9U A;  1DNC A;  4J31 A;  1NG3 A;  4APN A;  3UKP A;  1CL0 A;  4DNA A;  4K8D A;  4EQX A;  5KWF A;  3AE8 A;  4NEW A;  2YWL A;  4A5L A;  5KMR A;  1PN0 A;  2IID A;  1RSG A;  1ZY8 A;  2OAL A;  5DBJ A;  3AE9 A;  1JRZ A;  4LA1 A;  4RSL A;  1CJ2 A;  2A8X A;  2B7S A;  1B37 A;  3VRA A;  1GRG A;  1D4C A;  2Z5Y A;  2AAQ A;  4GDP A;  3EAN A;  1QLB A;  2BRY A;  2VZ2 A;  3AEB A;  3AE5 A;  2YLT A;  4GUV A;  5LV9 A;  3K30 A;  4H4S A;  1PBF A;  3QVP A;  3SFE A;  2WP6 A;  5HYM A;  1JRX A;  4H7U A;  3UKF A;  4YKF A;  4DSG A;  3RP6 A;  1GV4 A;  1GRH A;  3T0K A;  3FBS A;  3AEG A;  1GRE A;  1EL9 A;  3NIX A;  2ZZ0 A;  2XFP A;  4K5R A;  1VG9 A;  1YQ4 A;  4OPU A;  2GR1 A;  4YXD A;  3F8D A;  3CPI G;  3UTG A;  3C4A A;  1GPE A;  1TDK A;  3GYI A;  1PBD A;  2C75 A;  1NHP A;  1CF3 A;  3QFB A;  4J36 A;  2JB1 A;  1NDA A;  4JNQ A;  4KX6 A;  4AP1 A;  4D04 A;  4U8I A;  4E0V A;  1GOS A;  4NTC A;  3ITJ A;  1D7Y A;  2R4E A;  2WES A;  3Q9T A;  2XLR A;  3KPK A;  2O9Z A;  2UZZ A;  4BK2 A;  3CGC A;  2GR2 A;  1ZMC A;  2W0H A;  3H4K A;  1E1K A;  1N4U A;  1EL5 A;  4JQ9 A;  2BK5 A;  3AEE A;  4AT0 A;  4Z24 A;  2Q0L A;  2VVL A;  1B5Q A;  1XDI A;  2JBV A;  1FEC A;  3AD9 B;  3UOZ A;  1ZMD A;  4K22 A;  1VG0 A;  4YSZ A;  4JY2 A;  1KF6 A;  2XFN A;  2B76 A;  4U8L A;  2C70 A;  1TDN A;  3DGH A;  2BXS A;  5JCI A;  3SYI A;  3G5Q A;  3M0O A;  4EQR A;  1B8S A;  1D5T A;  2X8G A;  1FCD A;  1CJC A;  1FL2 A;  1CJ4 A;  3UCL A;  3KU9 A;  4CY6 A;  1F8R A;  2GAH B;  4YSY A;  1DXL A;  5IQ4 A;  1JOA A;  1L9E A;  3P4Q A;  3VR9 A;  1GES A;  1RYI A;  2X8H A;  3AEC A;  4KPR A;  3NYE A;  4B68 A;  4K2X A;  3ZDN A;  3DME A;  2V6O A;  4IV9 A;  1TYT A;  1XPQ A;  2YLW A;  5U63 A;  5HY5 A;  3JSK A;  2GR3 A;  2RGH A;  4ADW A;  1GSN A;  1TDE A;  1D7L A;  3AD8 B;  1F8S A;  3NT6 A;  2YLS A;  4HB9 A;  3RP7 A;  1F8W A;  1PBE A;  3AEF A;  4G6G A;  4C3X A;  2JB3 A;  2Q7V A;  4U8N A;  2V3A A;  2GEW A;  1Q9I A;  4OPD A;  1ONF A;  4K5S A;  4H4V A;  4RG4 A;  4BJZ A;  5CKU A;  4BJY A;  2XVJ A;  1PBC A;  3QSM A;  4AOX A;  3II4 A;  3CTY A;  1GEU A;  3DK4 A;  2GVC A;  1MXT A;  1N4V A;  2WEU A;  1E6E A;  1OJD A;  1REO A;  2C73 A;  2ZZC A;  3ATQ A;  1EL8 A;  1NG4 A;  1BZL A;  4RG3 A;  1V59 A;  1FEB A;  1Y56 A;  3QSS A;  2YR5 A;  4B63 A;  4C5O A;  2V3B A;  3FPZ A;  2C67 A;  3CGD A;  2BK4 A;  1EL7 A;  5KRQ A;  2NPX A;  3CGB A;  2C3C A;  2R45 A;  2VQB A;  3GD3 A;  3FMW A;  3M12 A;  4XWZ A;  4G73 A;  4AT2 A;  3O0H A;  3RP8 A;  1F3P A;  2BAC A;  1N4W A;  1OJ9 A;  4U8P A;  4G9K A;  4EM4 A;  1E1M A;  5KNL A;  3GWD A;  1EBD A;  2R0C A;  3B3R A;  3P4P A;  4U8M A;  1H6V A;  2YVJ A;  2QA2 A;  1NHS A;  1GRT A;  3AED A;  3GYJ A;  4O5U A;  1UKV G;  2BA9 A;  3Q6J A;  3B6D A;  1GAL A;  4H4U A;  4BK1 A;  4EIQ A;  2XLS A;  1E7P A;  4TM1 A;  3CPH G;  2E1M A;  1K0J A;  4Z2T A;  4A79 A;  5CQF A;  3URH A;  1GET A;  3BHK A;  3FG2 P;  2R4J A;  3SZF A;  2GAG B;  2VVL G;  3GSI A;  4LU6 A;  1H7W A;  1O95 A;  2BC1 A;  3ALL A;  1LQT A;  2EQ7 A;  2YAU A;  4UDP A;  3S61 A;  3DA1 A;  3UKA A;  2BAB A;  2FJE A;  2XDO A;  1BF3 A;  1O5W A;  4MJW A;  1S3B A;  2A89 A;  2BK3 A;  4GDE A;  1Z6L A;  3D8X A;  1E1L A;  3NG7 X;  4U2L A;  3RED A;  4Z26 A;  2A87 A;  3V76 A;  2HQM A;  4G6H A;  1JRY A;  2C3D A;  4H2Q A;  2XLT A;  4U2T A;  4Y4N A;  2XLP A;  3F8P A;  4IVO B;  5GRT A;  4G74 A;  3DGZ A;  1QJD A;  5GSN A;  2C7G A;  2WP9 A;  2YLX A;  4UDQ A;  3NN0 X;  3AEA A;  2WPC A;  2C65 A;  3HZL A;  5TR3 A;  4BUR A;  1XAN A;  4H4W A;  1PDH A;  5BVA A;  3IHG A;  2WOW A;  2YG7 A;  3BI5 A;  4PAA A;  3OZ2 A;  3GMC A;  1COY A;  3SM8 A;  2B9W A;  3P4R A;  1H7X A;  3NGC X;  1PXC A;  2EQ8 A;  5M0Z A;  4Z43 A;  4Y4M A;  4NNJ A;  1Q1R A;  4A9W A;  1TRB A;  5BUL A;  2Z5X A;  3AE4 A;  2FJB A;  4YTM A;  1LV0 A;  2VRM A;  5EB5 A;  2GV8 A;  2QCU A;  1Y56 B;  5J7X A;  1BGN A;  1GXF A;  1S2Q A;  2C66 A;  2VRL A;  2WDR A;  3KPF A;  3NKS A;  4UDR A;  4XXG A;  1CC2 A;  1NAA A;  2XCG A;  3EAO A;  1N1P A;  4J34 A;  1D4D A;  4OPI A;  2R0G A;  1NHR A;  4NEV A;  3NK1 X;  4TM3 A;  2ARD A;  1IUU A;  1FOH A;  3NNE A;  1GRF A;  2R46 A;  4JN9 A;  1DOD A;  2PHH A;  4ZCD A;  4DGK A;  3AE1 A;  3GDN A;  3SZ0 A;  1P2E A;  4B65 A;  1H81 A;  3BNU A;  5KOX A;  2OAM A;  1IUT A;  1QO8 A;  2JB2 A;  1YQZ A;  3PS9 A;  2JAE A;  1GRA A;  4J33 A;  1E1N A;  1F6M A;  3UOV A;  5KMS A;  3LOV A;  1IUX A;  3DJE A;  2ZZB A;  1ZOV A;  4J56 A;  4NTD A;  3C4N A;  5FS7 A;  2CDU A;  2XVI A;  2EQ6 A;  1NEK A;  3P9U A;  2OLN A;  3CNP A;  4NZH A;  1DJN A;  3VRB A;  3CNS A;  4H2P A;  1DJQ A;  2GRT A;  2WOI A;  2XLU A;  4FX9 A;  4U8K A;  5JCN A;  2WU5 A;  3BI2 A;  3K7M X;  3UP4 A;  2B9X A;  3QVR A;  2DKI A;  4B66 A;  4EIP A;  2YM1 A;  5EB4 A;  2RGO A;  2FJA A;  3SX6 A;  2XFQ A;  4OPC A;  3LZW A;  2WOV A;  4H4X A;  1PBB A;  3AXB A;  3EPT A;  2WQY A;  4ICY A;  5KOW A;  2QAE A;  2C72 A;  4Z2R A;  4EMJ A;  3CMM A;  4CNJ A;  2JKC A;  2YQU A;  3VQR A;  1OJA A;  3CN8 A;  2X8C A;  4GAP A;  3NN6 X;  3SY4 A;  5HHF A;  4TM0 A;  3AE3 A;  3WE0 A;  1S3E A;  1YKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...