3UP4A

Crystal structure of otemo complex with fad and nadp (form 3)
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
540
structure length
528
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 183
structure length 528
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3up4A01
5FS7A 2RGJA 3RNMA 3GWDA 2BC1A 3H8LA 2WOIA 1CJ4A 3IHGA 5IQ1A 4YT0A 5M10A 1BGJA 2GVCA 3COXA 1HYUA 2FBWA 2GR0A 1FL2A 5TR3A 1CJCA 3RP7A 2YVGA 3ABVA 3UKAA 2H89A 2BK5A 1B37A 2XLPA 4X9MA 5HXIA 3K7MX 3BI4A 2I0ZA 3AEEA 1TDFA 2JB2A 1GTHA 1M6IA 1IUXA 4H2QA 3C4AA 3UOYA 4GCMA 1AOGA 4X4JA 3AEFA 5JCKA 1YY5A 1IUSA 1K0JA 3NK0X 2X8HA 1NHQA 1CF3A 1CJ2A 1Q1WA 3BI5A 4GDEA 4IA6A 1S2YA 3SM8A 1MOKA 4NEWA 4TM0A 2AAQA 4GUVA 2DKIA 1GV4A 1RSGA 3DJDA 3GRTA 3SFEA 1K4QA 4C5OA 4YSYA 1DJQA 2GAGB 3FBSA 1DOEA 3ATQA 3AE3A 3H8IA 2GV8A 1BZLA 2VQBA 2YM2A 4H4RA 2B7SA 3GMCA 5BUKA 4HB9A 3GDNA 1D5TA 4B65A 3ICTA 1EBDA 4K22A 1N4VA 4AT0A 4WCTA 2YG4A 5U25A 2JBVA 3D8XA 1ZP0A 3LB8A 2WPFA 3UOZA 4AOXA 1JEHA 3F8RA 4EM4A 3GD3A 1L9EA 4DGKA 4JNAA 1LTXR 4YWOA 2V6OA 2YLWA 2YR6A 1KNRA 4IA5A 1DJNA 3CGCA 3LZWA 2C66A 5LV9A 1QO8A 3UKFA 2XLUA 3AE5A 4ECHA 3QVRA 4LU6A 3B3RA 1CJ3A 3Q9TA 1ZMCA 4NTCA 1CBOA 2ACZA 3BHFA 2WDVA 2WESA 3S5WA 1TDEA 2Z5XA 2ZZBA 3UOVA 4A65A 4CBQA 4J33A 1B5QA 1YKJA 2R46A 1D4CA 2ARDA 3M13A 1EL5A 4H4WA 4Y4LA 3V76A 1F8WA 1JOAA 2JK6A 2V61A 4YSXA 5JCNA 4H4QA 3OC4A 4ZCCA 3GRSA 2OALA 4C3XA 3NK1X 4H4VA 2BYBA 1TRBA 2VVLA 4M52A 4A6NA 4EQXA 5HHFA 4JN9A 2XFUA 1E39A 1H83A 3CNSA 1XHCA 1H81A 3VQRA 1F8SA 2Z5YA 3AB1A 3EF6A 3ADAB 4BV6A 1GSNA 1PBCA 1GXFA 2IVEA 4RSLA 1E1MA 4A5LA 1E1LA 4EIQA 1YQ3A 1B4VA 2XVFA 2WU5A 3CGEA 2YVJA 5KXJA 1FECA 3K7TA 1GT8A 4TM1A 2E5VA 3IWAA 3NN0X 2YG3A 2GR3A 4I59A 3VRBA 2B76A 4X9NA 3AYLA 2H88A 3UTFA 3AEDA 2F5ZA 2VZ2A 3M12A 4AT2A 1CHUA 3AE6A 2YAUA 1RYIA 1FEBA 2XVIA 1ZOVA 3DGHA 4GRTA 2OAMA 4U2TA 1ZK7A 1IUUA 3AD9B 5ER0A 4IVMB 3D1CA 3NHOX 2C67A 3QSMA 2JAEA 3HZLA 4JDRA 1PBEA 1GPEA 1DOBA 1NEKA 3L8KA 2QA2A 3GYJA 3BNMA 4AP3A 3ALLA 4U8PA 4YSHA 4Z25A 1JU2A 1TYTA 1XANA 2DKHA 3E1TA 4O5QA 4KPRA 4YTMA 2VVLG 1GRAA 1D7YA 3LXDA 5GRTA 3GYIA 4OPCA 3PO7A 4LIIA 1PN0A 1XDIA 4UDRA 3SFDA 1TDOA 4H4UA 2YWLA 4UDQA 1LQUA 3QFAA 3URHA 2WOWA 4H4XA 4REKA 4H4ZA 4K7ZA 2GQWA 4Z24A 4YTPA 4NEVA 3OZ2A 2BACA 4EIPA 2Q6UA 3C4NA 3PS9A 3FPZA 2HQMA 3UTGA 5EB5A 5J60A 2WBAA 3DGZA 4KX6A 4ADWA 4B1BA 4C3YA 4B63A 3IHMA 1GREA 4H4SA 3O0HA 3UOXA 2OA1A 2E4GA 4J31A 1K0IA 1MO9A 3NGCX 2BA9A 1F3PA 1GRFA 2VRLA 2APGA 2E1MA 1PBFA 2FJEA 4Z2UA 2XFQA 5FMHA 3QSEA 4JY3A 4N9XA 2XFNA 2TPRA 2GEWA 1W4XA 1NHSA 3S61A 5U63A 4YKGA 1O94A 2PHHA 1JNZA 3II4A 5BULA 1KDGA 3UP4A 5KWFA 1ZOYA 2WS3A 2C65A 2Y6QA 5IQ4A 4Z26A 2WEUA 3RP6A 4U2LA 3LOVA 4TLZA 3DK9A 2YLXA 3CPIG 1JRYA 2GB0A 4MJWA 5JCLA 3CPHG 3P4PA 4ZN0A 4Y4NA 2ZBWA 1KF6A 3ISHA 3JSKA 3UKPA 3UKHA 4EMJA 1NPXA 4EM3A 3DJGX 1GOSA 4O5UA 4C77A 3AECA 3DMEA 5FS9A 2BS2A 4YSZA 4J2WA 1PBDA 2GMHA 1B8SA 4Y4MA 2WOVA 4CY6A 4I58A 4XXGA 1OJTA 2WETA 4Z43A 3ICSA 5KRQA 2YR5A 3ICRA 1JNRA 3K7QX 4U8LA 2AQJA 4YKFA 3VR9A 1OJCA 2WHDA 2EQ6A 3B6DA 3EAOA 3IC9A 4TM3A 4CCRA 1V59A 2XDOA 3VRDB 3NLCA 4B64A 1PXAA 2B7RA 2YLZA 3AE4A 2ZZ0A 4K5RA 5M0ZA 3AE7A 2XVJA 2WQYA 4A9WA 3UTEA 4U8JA 2FJBA 1Y0PA 3FG2P 4DSGA 1KFYA 4AOSA 1IUWA 2GRTA 3AYJA 3H4KA 1Y56A 2GF3A 2A8XA 2YQUA 1BGNA 1VG9A 3DK8A 3Q6JA 4EMWA 3AEAA 5HYMA 3ITJA 5C2TA 1OJ9A 4WX1A 3RP8A 1PXCA 2Q0KA 1BKWA 3AD7B 4H50A 1TDNA 1S3EA 4B69A 1Q1RA 4GF7A 3UTHA 1NAAA 1ELIA 4TLXA 4UDPA 1FCDA 2BK3A 3AEGA 2RGOA 2B9YA 3DK4A 1EL9A 1GERA 3QFBA 2YG6A 3BNUA 1K0LA 2A89A 2X99A 3NKSA 4Z2RA 3IF9A 3LZXA 3P9UA 2WPEA 2RGHA 2JB3A 2OLNA 1H86A 2R0CA 2TMDA 3KPFA 3CN8A 5C3JA 1QLBA 2WDRA 3SQPA 4EQWA 4LA1A 1SEZA 3NYFA 1H7WA 1PJ7A 1UKVG 3AE2A 3T37A 1VG0A 3DH9A 3KKJA 4A6NB 3WE0A 1NG3A 3GDPA 2X50A 3CNTA 4JQ9A 4B68A 1REOA 2BS3A 1O95A 4BURA 4D03A 3ALJA 2YLTA 2GMJA 3CIRA 1ZMDA 4OPDA 2EQ8A 1KSSA 2GAHB 1P2HA 4YTNA 1D4EA 1D4DA 3GSIA 1O5WA 3L1RA 1Q9IA 1S2QA 1MXTA 5JCIA 2CULA 3DJEA 4CCQA 3BHKA 4CNJA 2BC0A 5U1OA 2YVFA 2VQ7A 3AWIA 5KOXA 1GNDA 2A87A 2XCGA 1ZKQA 2O9ZA 2YG5A 4BJZA 4B67A 2C70A 3UKQA 5JCMA 2YM1A 3EANA 5IPYA 5KVHA 3I3LA 1BF3A 1GRBA 4APNA 2UZZA 3CTYA 4RG3A 2XFOA 1H7XA 1DXLA 3KA7A 1OJDA 1L0VA 3AXBA 4BK1A 2YG7A 3VR8A 2BK4A 1JRXA 3CPJG 3CNDA 3R9UA 2XFPA 1ONFA 1PS9A 4U8NA 1XPQA 1LV0A 2BXRA 2QA1A 2Q7VA 3QVPA 4J36A 2XVHA 3NIXA 3SGLA 2R0GA 1GESA 3AD8B 2C72A 3DA1A 1P2EA 3NNEA 3NYEA 3EPTA 2WDQA 4JNQA 1YQ4A 4D04A 5DBJA 5CKUA 4PABA 2WP9A 3QJ4A 1DNCA 1E1NA 3UCLA 1GRGA 4UP3A 4GR1A 1TDKA 4FX9A 4E0VA 1GRTA 2BS4A 4FDCB 4NTEA 1F8RA 4A99A 4U8MA 1CL0A 5GSNA 4A79A 2IIDA 4FK1A 4EQRA 3ATRA 4Z44A 1E6EA 3NH3X 3UKKA 1PJ6A 2B9WA 2WPCA 4CNKA 2GR2A 1ZY8A 2XVEA 3ALMA 1N4WA 2RABA 2BCPA 3AE1A 3KVEA 1X31B 1D7LA 4DSHA 1LVLA 4K8DA 1GEUA 1GETA 3GWFA 1LQTA 2WU2A 5J7XA 3DJJA 4EQSA 2V3BA 2J3NA 3AE8A 5FS6A 2VVMA 2X3NA 4ICYA 4XWRA 3G5RA 1NG4A 4OPIA 2V3AA 2WP6A 3CNPA 3LJPA 4OPGA 1H6VA 2YLSA 3NYCA 1NDAA 4IV9A 4NTDA 4JY2A 1EL8A 4H7UA 1ZDLA 2XLTA 3CGDA 4OPUA 3G5QA 4HA6A 4K5SA 2CVJA 1EL7A 1IUTA 2QCUA 4H4TA 3ZYXA 5BRTA 3PVCA 3F8PA 5KOWA 2EQ9A 1IUVA 3NG7X 4H4PA 4PAAA 1PJ5A 2FJAA 4USQA 1LJ1A 1PXBA 5CQFA 2Y6RA 5KVIA 4BK3A 2AR8A 4H2NA 4CY8A 4EMIA 1LPFA 2IVDA 2GR1A 1IJHA 1NHPA 4OPLA 4P9SA 5EBKA 2R45A 3REDA 2X8GA 1RP0A 1ZX9A 3FMWA 1JRZA 5EOWA 2C7GA 3RHAA 1YQZA 2VOUA 1PDHA 2R4EA 2JB1A 3P1WA 2C73A 3CNJA 4RG4A 2GQFA 2FJDA 3M0OA 1DODA 2YR4A 4J34A 1GRHA 1VQWA 2BCGG 4OCGA 1N4UA 2YLRA 3I6DA 3NN6X 1COYA 3P4RA 3UP5A 4IVOB 4A7AA 2V60A 2CFYA 4B66A 4BJYA 4C74A 3AE9A 4J56A 2EQ7A 1KNPA 1S3BA 2CDUA 1N1PA 5FS8A 1BWCA 1TYPA 2R0PA 4USRA 1E7PA 4U8KA 1CC6A 2C76A 3NK2X 3C96A 2Q0LA 1CC4A 1CC2A 2B9XA 2PYXA 1L9DA 1Y56B 2NPXA 3AEBA 3AYIA 3GMBA 2OLOA 2R4JA 3KU9A 2C3DA 3NT6A 4H2RA 2XLRA 1VRQB 2WP5A 3P4QA 1KSUA 4U2SA 4GDPA 4U8OA 2GH5A 1QJDA 2XYOA 3GD4A 4Z2TA 4XWZA 3QSSA 3G5SA 2NVKX 2W0HA 3LADA 5L46A 1NENA 1H84A 1PBBA 3UKLA 4NZHA 2JKCA 1GTEA 1PHHA 3K30A 2VRMA 4ZCDA 5HY5A 2X8CA 2V5ZA 1VDCA 1DOCA 2BXSA 2QAEA 1OJAA 4U8IA 3V3OA 1NHRA 5BVAA 2C3CA 3NTAA 4OVIA 3F8DA 3KLJA 4BK2A 4DNAA 3P4SA 4K2XA 4OPTA 2C64A 5EB4A 4FK1C 1M64A 4CRTA 1FOHA 1FEAA 1L9CA 3VRAA 4H4YA 2BABA 3KD9A 4H2PA 1GALA 1Z6LA 4J57A 1E1KA 3V3NA 2ZZCA 4YXDA 2C75A 4AP1A 3FIMB 3BI2A 2XLSA 3NTDA 3CGBA 1H82A 1F6MA 4TM4A 3ZDNA 2R9ZA 3NRNA
chains in the Genus database with same CATH superfamily
5FS7A 2RGJA 3RNMA 3GWDA 2BC1A 3H8LA 2WOIA 1CJ4A 3IHGA 5IQ1A 4YT0A 5M10A 1BGJA 2GVCA 3COXA 1HYUA 2FBWA 2GR0A 2C4CA 1FL2A 5TR3A 1CJCA 3RP7A 2YVGA 3ABVA 3UKAA 2H89A 2BK5A 1B37A 2XLPA 4X9MA 5HXIA 3K7MX 3BI4A 2I0ZA 3AEEA 1TDFA 2JB2A 1GTHA 1M6IA 1IUXA 4H2QA 3C4AA 3UOYA 4GCMA 1AOGA 4X4JA 3AEFA 5JCKA 3T2YA 1YY5A 1IUSA 1K0JA 3NK0X 2X8HA 1NHQA 1CF3A 1CJ2A 1Q1WA 3BI5A 4GDEA 4IA6A 1S2YA 3SM8A 1MOKA 4NEWA 4TM0A 2AAQA 4GUVA 2DKIA 1GV4A 1RSGA 3DJDA 3GRTA 3SFEA 1K4QA 4C5OA 4YSYA 1DJQA 2GAGB 3FBSA 1DOEA 3ATQA 3AE3A 3H8IA 3KPKA 2GV8A 1BZLA 2VQBA 2YM2A 3SZ0A 4H4RA 2B7SA 3GMCA 5BUKA 4HB9A 3GDNA 1D5TA 4B65A 3ICTA 1EBDA 4K22A 1N4VA 4AT0A 4WCTA 2YG4A 5U25A 2JBVA 3D8XA 1ZP0A 3LB8A 2WPFA 3UOZA 4AOXA 1JEHA 3F8RA 4EM4A 3GD3A 1L9EA 4DGKA 4JNAA 1LTXR 4YWOA 2V6OA 2YLWA 2YR6A 1KNRA 4IA5A 1DJNA 3CGCA 3LZWA 2C66A 5LV9A 1QO8A 3UKFA 2XLUA 3AE5A 4ECHA 3QVRA 4LU6A 3B3RA 1CJ3A 3Q9TA 1ZMCA 4NTCA 1CBOA 2ACZA 3BHFA 2WDVA 2WESA 3S5WA 1TDEA 2Z5XA 2ZZBA 3UOVA 4A65A 4CBQA 4J33A 1B5QA 1YKJA 2R46A 1D4CA 2ARDA 3M13A 1EL5A 4H4WA 4Y4LA 3V76A 1F8WA 1JOAA 2JK6A 2V61A 4YSXA 5JCNA 4H4QA 3OC4A 4ZCCA 3GRSA 2OALA 4C3XA 3NK1X 4H4VA 2BYBA 1TRBA 2VVLA 4M52A 4A6NA 4EQXA 5HHFA 4JN9A 2XFUA 1E39A 1H83A 4G74A 3CNSA 1XHCA 1H81A 3VQRA 1F8SA 2Z5YA 3AB1A 3EF6A 3ADAB 4BV6A 1GSNA 1PBCA 3SZFA 1GXFA 2IVEA 4RSLA 1E1MA 4A5LA 1E1LA 4EIQA 1YQ3A 1B4VA 2XVFA 2WU5A 3CGEA 2YVJA 5KXJA 1FECA 3K7TA 1GT8A 4TM1A 2E5VA 3IWAA 3NN0X 2YG3A 2GR3A 4I59A 3VRBA 2B76A 4X9NA 3AYLA 2H88A 3UTFA 3AEDA 2F5ZA 2VZ2A 3M12A 4AT2A 1CHUA 3AE6A 2YAUA 1RYIA 1FEBA 2XVIA 1ZOVA 3DGHA 4GRTA 2OAMA 4U2TA 1ZK7A 1IUUA 3AD9B 5ER0A 4IVMB 3GYXA 3D1CA 3NHOX 2C67A 3QSMA 2JAEA 3HZLA 4JDRA 1PBEA 1GPEA 1DOBA 1NEKA 3L8KA 2QA2A 3GYJA 3BNMA 4AP3A 3ALLA 4U8PA 4YSHA 4Z25A 1JU2A 1TYTA 1XANA 2DKHA 3E1TA 4O5QA 4KPRA 3SXIA 4YTMA 2VVLG 1GRAA 1D7YA 3LXDA 5GRTA 3GYIA 4OPCA 3PO7A 4LIIA 1PN0A 1XDIA 4UDRA 3SFDA 1TDOA 4H4UA 2YWLA 4UDQA 1LQUA 3QFAA 4G73A 2WOWA 4H4XA 3URHA 4G9KA 4REKA 4H4ZA 4K7ZA 2GQWA 4Z24A 4YTPA 4G6GA 4NEVA 3OZ2A 2BACA 4EIPA 2Q6UA 3C4NA 3PS9A 3FPZA 2HQMA 3UTGA 5EB5A 5J60A 2WBAA 3DGZA 4KX6A 4ADWA 4B1BA 4C3YA 4B63A 3IHMA 1GREA 4H4SA 3O0HA 3UOXA 2OA1A 2E4GA 4J31A 1K0IA 1MO9A 3NGCX 2BA9A 1F3PA 1GRFA 2VRLA 2APGA 2E1MA 1PBFA 2FJEA 4II2A 4Z2UA 2XFQA 5FMHA 4NNJA 3QSEA 4JY3A 4N9XA 2XFNA 2TPRA 2GEWA 1W4XA 1NHSA 3S61A 5U63A 4YKGA 1O94A 2PHHA 1JNZA 3II4A 5BULA 1KDGA 3UP4A 5KWFA 1ZOYA 2WS3A 2C65A 2Y6QA 5IQ4A 4Z26A 2WEUA 3RP6A 4U2LA 3LOVA 4TLZA 3DK9A 2YLXA 3CPIG 1JRYA 2GB0A 3SZCA 4MJWA 5JCLA 3CPHG 3P4PA 4ZN0A 4Y4NA 2ZBWA 1KF6A 3ISHA 3JSKA 3UKPA 3UKHA 4EMJA 1NPXA 4EM3A 3DJGX 1GOSA 4O5UA 4C77A 3AECA 3DMEA 5FS9A 2BS2A 4YSZA 4J2WA 1PBDA 2GMHA 1B8SA 4Y4MA 2WOVA 4CY6A 4I58A 4XXGA 1OJTA 2WETA 4Z43A 3ICSA 5KRQA 2YR5A 3ICRA 1JNRA 3K7QX 4U8LA 2AQJA 4YKFA 3VR9A 1OJCA 2WHDA 2EQ6A 3B6DA 3EAOA 3IC9A 4TM3A 4CCRA 1V59A 2XDOA 3VRDB 3NLCA 4B64A 1PXAA 2B7RA 2YLZA 3AE4A 3SX6A 2ZZ0A 4K5RA 5M0ZA 3AE7A 2XVJA 2WQYA 4A9WA 3UTEA 4U8JA 2FJBA 1Y0PA 3FG2P 4DSGA 1KFYA 4AOSA 1IUWA 2GRTA 3AYJA 3H4KA 1Y56A 2GF3A 2A8XA 2YQUA 1BGNA 1VG9A 3DK8A 3Q6JA 4EMWA 3AEAA 5HYMA 3ITJA 5C2TA 1OJ9A 4WX1A 3RP8A 3T14A 1PXCA 2Q0KA 1BKWA 3AD7B 4H50A 3T2ZA 1TDNA 1S3EA 4B69A 4GAVA 1Q1RA 4GF7A 3UTHA 3SZWA 1NAAA 1ELIA 4TLXA 4UDPA 1FCDA 2BK3A 3AEGA 2RGOA 2B9YA 3DK4A 1EL9A 1GERA 3QFBA 3SYIA 2YG6A 3BNUA 1K0LA 2A89A 2X99A 3NKSA 4Z2RA 3IF9A 3LZXA 3P9UA 2WPEA 2RGHA 2JB3A 2OLNA 1H86A 2R0CA 2TMDA 3KPFA 3CN8A 5C3JA 4G6HA 1QLBA 2WDRA 3SQPA 4EQWA 4LA1A 1SEZA 3NYFA 1H7WA 1PJ7A 1UKVG 3AE2A 3T37A 1VG0A 3DH9A 3KKJA 4A6NB 3WE0A 1NG3A 4II3A 3GDPA 2X50A 3CNTA 4JQ9A 4B68A 1REOA 2BS3A 1O95A 4BURA 4D03A 3ALJA 2YLTA 2GMJA 3CIRA 1ZMDA 3HYXA 4OPDA 2EQ8A 1KSSA 2GAHB 1P2HA 4YTNA 1D4EA 1D4DA 3GSIA 1O5WA 3L1RA 1Q9IA 1S2QA 1MXTA 5JCIA 2CULA 3DJEA 4CCQA 3BHKA 4CNJA 2BC0A 5U1OA 2YVFA 2VQ7A 3AWIA 5KOXA 1GNDA 2A87A 2XCGA 1ZKQA 2O9ZA 2YG5A 4BJZA 4B67A 2C70A 3UKQA 5JCMA 2YM1A 3EANA 5IPYA 5KVHA 3I3LA 1BF3A 1GRBA 4APNA 2UZZA 3CTYA 4RG3A 2XFOA 1H7XA 1DXLA 3KA7A 1OJDA 1L0VA 3AXBA 4BK1A 2YG7A 3VR8A 2BK4A 1JRXA 3CPJG 3CNDA 3R9UA 2XFPA 1ONFA 1PS9A 3HYWA 4U8NA 1XPQA 1LV0A 2BXRA 2QA1A 2Q7VA 3QVPA 4J36A 2XVHA 3T2KA 3NIXA 3SGLA 2R0GA 1GESA 3AD8B 2C72A 3DA1A 1P2EA 3NNEA 3NYEA 3EPTA 2WDQA 4JNQA 1YQ4A 4D04A 5DBJA 5CKUA 4PABA 2WP9A 3QJ4A 1DNCA 1E1NA 3UCLA 1GRGA 4UP3A 4GR1A 1TDKA 4FX9A 4E0VA 1GRTA 2BS4A 4FDCB 4NTEA 1F8RA 4A99A 4U8MA 1CL0A 5GSNA 4A79A 2IIDA 4FK1A 4EQRA 3ATRA 4Z44A 1E6EA 3NH3X 3UKKA 1PJ6A 2B9WA 2WPCA 4CNKA 2GR2A 1ZY8A 2XVEA 3ALMA 1N4WA 2RABA 2BCPA 3AE1A 3KVEA 1X31B 1D7LA 4DSHA 1LVLA 4K8DA 5KMSA 1GEUA 1GETA 3GWFA 1LQTA 2WU2A 5KMQA 5J7XA 3DJJA 4EQSA 2V3BA 2J3NA 3AE8A 5FS6A 2VVMA 2X3NA 4ICYA 4XWRA 3G5RA 1NG4A 4OPIA 2V3AA 2WP6A 3CNPA 3LJPA 4OPGA 1H6VA 2YLSA 3NYCA 1NDAA 4IV9A 4NTDA 4JY2A 1EL8A 4H7UA 1ZDLA 2XLTA 3CGDA 4OPUA 3G5QA 4HA6A 4K5SA 2CVJA 1EL7A 1IUTA 2QCUA 4H4TA 3T31A 3ZYXA 5BRTA 5KMPA 3HYVA 3PVCA 3F8PA 5KOWA 2EQ9A 1IUVA 3NG7X 4GAPA 4H4PA 4PAAA 1PJ5A 2FJAA 4USQA 1LJ1A 1PXBA 5CQFA 2Y6RA 5KVIA 4BK3A 2AR8A 4H2NA 4CY8A 4EMIA 1LPFA 2IVDA 2GR1A 1IJHA 1NHPA 4OPLA 4P9SA 3T0KA 5EBKA 2R45A 3REDA 2X8GA 1RP0A 1ZX9A 3FMWA 1JRZA 5EOWA 2C7GA 3RHAA 1YQZA 2VOUA 1PDHA 2R4EA 2JB1A 3P1WA 2C73A 3CNJA 4RG4A 2GQFA 2FJDA 3M0OA 1DODA 2YR4A 4NWZA 4J34A 1GRHA 1VQWA 2BCGG 4OCGA 3SY4A 1N4UA 2YLRA 3I6DA 3NN6X 1COYA 3P4RA 3UP5A 4IVOB 4A7AA 2V60A 2CFYA 4B66A 4BJYA 4C74A 3AE9A 2BRAA 2EQ7A 4J56A 1KNPA 1S3BA 2CDUA 1N1PA 5FS8A 1BWCA 1TYPA 2R0PA 4USRA 1E7PA 4U8KA 1CC6A 2C76A 3NK2X 3C96A 2Q0LA 1CC4A 1CC2A 2B9XA 2PYXA 1L9DA 1Y56B 2NPXA 3AEBA 3AYIA 3CMMA 2OLOA 2R4JA 3GMBA 2C3DA 3KU9A 3NT6A 2XLRA 4H2RA 1VRQB 2WP5A 3P4QA 1KSUA 4U2SA 4GDPA 4U8OA 2GH5A 1QJDA 2XYOA 3GD4A 4Z2TA 4XWZA 3QSSA 3G5SA 2NVKX 2W0HA 3LADA 5L46A 1NENA 1H84A 1PBBA 3UKLA 4NZHA 2JKCA 1GTEA 1PHHA 3K30A 5KMRA 2VRMA 4ZCDA 5HY5A 2BRYA 2X8CA 2V5ZA 1VDCA 1DOCA 2BXSA 2QAEA 1OJAA 4U8IA 3V3OA 1NHRA 5BVAA 2C3CA 3NTAA 4OVIA 3F8DA 3KLJA 4BK2A 4DNAA 3P4SA 4K2XA 5KNLA 4OPTA 2C64A 5EB4A 4FK1C 1M64A 4CRTA 1FOHA 1FEAA 1L9CA 3VRAA 4H4YA 2BABA 3KD9A 4H2PA 1GALA 1Z6LA 4J57A 1E1KA 3V3NA 2ZZCA 4YXDA 2C75A 4AP1A 3FIMB 3BI2A 2XLSA 3NTDA 3CGBA 1H82A 1F6MA 4TM4A 3ZDNA 2R9ZA 3NRNA
chains in the Genus database with same CATH topology
5FS7A 2RGJA 3RNMA 3GWDA 2BC1A 3H8LA 2WOIA 1CJ4A 3IHGA 5IQ1A 4YT0A 5M10A 1BGJA 2GVCA 3COXA 1HYUA 2FBWA 2GR0A 2C4CA 1FL2A 5TR3A 1CJCA 3RP7A 2YVGA 3ABVA 3UKAA 2H89A 2BK5A 1B37A 2XLPA 4X9MA 5HXIA 3K7MX 3BI4A 2I0ZA 3AEEA 1TDFA 2JB2A 1GTHA 1M6IA 1IUXA 4H2QA 3C4AA 3UOYA 4GCMA 1AOGA 4X4JA 3AEFA 5JCKA 3T2YA 1YY5A 1IUSA 1K0JA 3NK0X 2X8HA 1NHQA 1CF3A 1CJ2A 1Q1WA 3BI5A 4GDEA 4IA6A 1S2YA 3SM8A 1MOKA 4NEWA 4TM0A 2AAQA 4GUVA 2DKIA 1GV4A 1RSGA 3DJDA 3GRTA 3SFEA 1K4QA 4C5OA 4YSYA 1DJQA 2GAGB 3FBSA 1DOEA 3ATQA 3AE3A 3H8IA 3KPKA 2GV8A 1BZLA 2VQBA 2YM2A 3SZ0A 4H4RA 2B7SA 3GMCA 5BUKA 4HB9A 3GDNA 1D5TA 4B65A 3ICTA 1EBDA 4K22A 1N4VA 4AT0A 4WCTA 2YG4A 5U25A 2JBVA 3D8XA 1ZP0A 3LB8A 2WPFA 3UOZA 4AOXA 1JEHA 3F8RA 4EM4A 3GD3A 1L9EA 4DGKA 4JNAA 1LTXR 4YWOA 2V6OA 2YLWA 2YR6A 1KNRA 4IA5A 1DJNA 3CGCA 3LZWA 2C66A 5LV9A 1QO8A 3UKFA 2XLUA 3AE5A 4ECHA 3QVRA 4LU6A 3B3RA 1CJ3A 3Q9TA 1ZMCA 4NTCA 1CBOA 2ACZA 3BHFA 2WDVA 2WESA 3S5WA 1TDEA 2Z5XA 2ZZBA 3UOVA 4A65A 4CBQA 4J33A 1B5QA 1YKJA 2R46A 1D4CA 2ARDA 3M13A 1EL5A 4H4WA 4Y4LA 3V76A 1F8WA 1JOAA 2JK6A 2V61A 4YSXA 5JCNA 4H4QA 3OC4A 4ZCCA 3GRSA 2OALA 4C3XA 3NK1X 4H4VA 2BYBA 1TRBA 2VVLA 4M52A 4A6NA 4EQXA 5HHFA 4JN9A 2XFUA 1E39A 1H83A 4G74A 3CNSA 1XHCA 1H81A 3VQRA 1F8SA 2Z5YA 3AB1A 3EF6A 3ADAB 4BV6A 1GSNA 1PBCA 3SZFA 1GXFA 2IVEA 4RSLA 1E1MA 4A5LA 1E1LA 4EIQA 1YQ3A 1B4VA 2XVFA 2WU5A 3CGEA 2YVJA 5KXJA 1FECA 3K7TA 1GT8A 4TM1A 2E5VA 3IWAA 3NN0X 2YG3A 2GR3A 4I59A 3VRBA 2B76A 4X9NA 3AYLA 2H88A 3UTFA 3AEDA 2F5ZA 2VZ2A 3M12A 4AT2A 1CHUA 3AE6A 2YAUA 1RYIA 1FEBA 2XVIA 1ZOVA 3DGHA 4GRTA 2OAMA 4U2TA 1ZK7A 1IUUA 3AD9B 5ER0A 4IVMB 3GYXA 3D1CA 3NHOX 2C67A 3QSMA 2JAEA 3HZLA 4JDRA 1PBEA 1GPEA 1DOBA 1NEKA 3L8KA 2QA2A 3GYJA 3BNMA 4AP3A 3ALLA 4U8PA 4YSHA 4Z25A 1JU2A 1TYTA 1XANA 2DKHA 3E1TA 4O5QA 4KPRA 3SXIA 4YTMA 2VVLG 1GRAA 1D7YA 3LXDA 5GRTA 3GYIA 4OPCA 3PO7A 4LIIA 1PN0A 1XDIA 4UDRA 3SFDA 1TDOA 4H4UA 2YWLA 4UDQA 1LQUA 3QFAA 4G73A 2WOWA 4H4XA 3URHA 4G9KA 4REKA 4H4ZA 4K7ZA 2GQWA 4Z24A 4YTPA 4G6GA 4NEVA 3OZ2A 2BACA 4EIPA 2Q6UA 3C4NA 3PS9A 3FPZA 2HQMA 3UTGA 5EB5A 5J60A 2WBAA 3DGZA 4KX6A 4ADWA 4B1BA 4C3YA 4B63A 3IHMA 1GREA 4H4SA 3O0HA 3UOXA 2OA1A 2E4GA 4J31A 1K0IA 1MO9A 3NGCX 2BA9A 1F3PA 1GRFA 2VRLA 2APGA 2E1MA 1PBFA 2FJEA 4II2A 4Z2UA 2XFQA 5FMHA 4NNJA 3QSEA 4JY3A 4N9XA 2XFNA 2TPRA 2GEWA 1W4XA 1NHSA 3S61A 5U63A 4YKGA 1O94A 2PHHA 1JNZA 3II4A 5BULA 1KDGA 3UP4A 5KWFA 1ZOYA 2WS3A 2C65A 2Y6QA 5IQ4A 4Z26A 2WEUA 3RP6A 4U2LA 3LOVA 4TLZA 3DK9A 2YLXA 3CPIG 1JRYA 2GB0A 3SZCA 4MJWA 5JCLA 3CPHG 3P4PA 4ZN0A 4Y4NA 2ZBWA 1KF6A 3ISHA 3JSKA 3UKPA 3UKHA 4EMJA 1NPXA 4EM3A 3DJGX 1GOSA 4O5UA 4C77A 3AECA 3DMEA 5FS9A 2BS2A 4YSZA 4J2WA 1PBDA 2GMHA 1B8SA 4Y4MA 2WOVA 4CY6A 4I58A 4XXGA 1OJTA 2WETA 4Z43A 3ICSA 5KRQA 2YR5A 3ICRA 1JNRA 3K7QX 4U8LA 2AQJA 4YKFA 3VR9A 1OJCA 2WHDA 2EQ6A 3B6DA 3EAOA 3IC9A 4TM3A 4CCRA 1V59A 2XDOA 3VRDB 3NLCA 4B64A 1PXAA 2B7RA 2YLZA 3AE4A 3SX6A 2ZZ0A 4K5RA 5M0ZA 3AE7A 2XVJA 2WQYA 4A9WA 3UTEA 4U8JA 2FJBA 1Y0PA 3FG2P 4DSGA 1KFYA 4AOSA 1IUWA 2GRTA 3AYJA 3H4KA 1Y56A 2GF3A 2A8XA 2YQUA 1BGNA 1VG9A 3DK8A 3Q6JA 4EMWA 3AEAA 5HYMA 3ITJA 5C2TA 1OJ9A 4WX1A 3RP8A 3T14A 1PXCA 2Q0KA 1BKWA 3AD7B 4H50A 3T2ZA 1TDNA 1S3EA 4B69A 4GAVA 1Q1RA 4GF7A 3UTHA 3SZWA 1NAAA 1ELIA 4TLXA 4UDPA 1FCDA 2BK3A 3AEGA 2RGOA 2B9YA 3DK4A 1EL9A 1GERA 3QFBA 3SYIA 2YG6A 3BNUA 1K0LA 2A89A 2X99A 3NKSA 4Z2RA 3IF9A 3LZXA 3P9UA 2WPEA 2RGHA 2JB3A 2OLNA 1H86A 2R0CA 2TMDA 3KPFA 3CN8A 5C3JA 4G6HA 1QLBA 2WDRA 3SQPA 4EQWA 4LA1A 1SEZA 3NYFA 1H7WA 1PJ7A 1UKVG 3AE2A 3T37A 1VG0A 3DH9A 3KKJA 4A6NB 3WE0A 1NG3A 4II3A 3GDPA 2X50A 3CNTA 4JQ9A 4B68A 1REOA 2BS3A 1O95A 4BURA 4D03A 3ALJA 2YLTA 2GMJA 3CIRA 1ZMDA 3HYXA 4OPDA 2EQ8A 1KSSA 2GAHB 1P2HA 4YTNA 1D4EA 1D4DA 3GSIA 1O5WA 3L1RA 1Q9IA 1S2QA 1MXTA 5JCIA 2CULA 3DJEA 4CCQA 3BHKA 4CNJA 2BC0A 5U1OA 2YVFA 2VQ7A 3AWIA 5KOXA 1GNDA 2A87A 2XCGA 1ZKQA 2O9ZA 2YG5A 4BJZA 4B67A 2C70A 3UKQA 5JCMA 2YM1A 3EANA 5IPYA 5KVHA 3I3LA 1BF3A 1GRBA 4APNA 2UZZA 3CTYA 4RG3A 2XFOA 1H7XA 1DXLA 3KA7A 1OJDA 1L0VA 3AXBA 4BK1A 2YG7A 3VR8A 2BK4A 1JRXA 3CPJG 3CNDA 3R9UA 2XFPA 1ONFA 1PS9A 3HYWA 4U8NA 1XPQA 1LV0A 2BXRA 2QA1A 2Q7VA 3QVPA 4J36A 2XVHA 3T2KA 3NIXA 3SGLA 2R0GA 1GESA 3AD8B 2C72A 3DA1A 1P2EA 3NNEA 3NYEA 3EPTA 2WDQA 4JNQA 1YQ4A 4D04A 5DBJA 5CKUA 4PABA 2WP9A 3QJ4A 1DNCA 1E1NA 3UCLA 1GRGA 4UP3A 4GR1A 1TDKA 4FX9A 4E0VA 1GRTA 2BS4A 4FDCB 4NTEA 1F8RA 4A99A 4U8MA 1CL0A 5GSNA 4A79A 2IIDA 4FK1A 4EQRA 3ATRA 4Z44A 1E6EA 3NH3X 3UKKA 1PJ6A 2B9WA 2WPCA 4CNKA 2GR2A 1ZY8A 2XVEA 3ALMA 1N4WA 2RABA 2BCPA 3AE1A 3KVEA 1X31B 1D7LA 4DSHA 1LVLA 4K8DA 5KMSA 1GEUA 1GETA 3GWFA 1LQTA 2WU2A 5KMQA 5J7XA 3DJJA 4EQSA 2V3BA 2J3NA 3AE8A 5FS6A 2VVMA 2X3NA 4ICYA 4XWRA 3G5RA 1NG4A 4OPIA 2V3AA 2WP6A 3CNPA 3LJPA 4OPGA 1H6VA 2YLSA 3NYCA 1NDAA 4IV9A 4NTDA 4JY2A 1EL8A 4H7UA 1ZDLA 2XLTA 3CGDA 4OPUA 3G5QA 4HA6A 4K5SA 2CVJA 1EL7A 1IUTA 2QCUA 4H4TA 3T31A 3ZYXA 5BRTA 5KMPA 3HYVA 3PVCA 3F8PA 5KOWA 2EQ9A 1IUVA 3NG7X 4GAPA 4H4PA 4PAAA 1PJ5A 2FJAA 4USQA 1LJ1A 1PXBA 5CQFA 2Y6RA 5KVIA 4BK3A 2AR8A 4H2NA 4CY8A 4EMIA 1LPFA 2IVDA 2GR1A 1IJHA 1NHPA 4OPLA 4P9SA 3T0KA 5EBKA 2R45A 3REDA 2X8GA 1RP0A 1ZX9A 3FMWA 1JRZA 5EOWA 2C7GA 3RHAA 1YQZA 2VOUA 1PDHA 2R4EA 2JB1A 3P1WA 2C73A 3CNJA 4RG4A 2GQFA 2FJDA 3M0OA 1DODA 2YR4A 4NWZA 4J34A 1GRHA 1VQWA 2BCGG 4OCGA 3SY4A 1N4UA 2YLRA 3I6DA 3NN6X 1COYA 3P4RA 3UP5A 4IVOB 4A7AA 2V60A 2CFYA 4B66A 4BJYA 4C74A 3AE9A 2BRAA 2EQ7A 4J56A 1KNPA 1S3BA 2CDUA 1N1PA 5FS8A 1BWCA 1TYPA 2R0PA 4USRA 1E7PA 4U8KA 1CC6A 2C76A 3NK2X 3C96A 2Q0LA 1CC4A 1CC2A 2B9XA 2PYXA 1L9DA 1Y56B 2NPXA 3AEBA 3AYIA 3CMMA 2OLOA 2R4JA 3GMBA 2C3DA 3KU9A 3NT6A 2XLRA 4H2RA 1VRQB 2WP5A 3P4QA 1KSUA 4U2SA 4GDPA 4U8OA 2GH5A 1QJDA 2XYOA 3GD4A 4Z2TA 4XWZA 3QSSA 3G5SA 2NVKX 2W0HA 3LADA 5L46A 1NENA 1H84A 1PBBA 3UKLA 4NZHA 2JKCA 1GTEA 1PHHA 3K30A 5KMRA 2VRMA 4ZCDA 5HY5A 2BRYA 2X8CA 2V5ZA 1VDCA 1DOCA 2BXSA 2QAEA 1OJAA 4U8IA 3V3OA 1NHRA 5BVAA 2C3CA 3NTAA 4OVIA 3F8DA 3KLJA 4BK2A 4DNAA 3P4SA 4K2XA 5KNLA 4OPTA 2C64A 5EB4A 4FK1C 1M64A 4CRTA 1FOHA 1FEAA 1L9CA 3VRAA 4H4YA 2BABA 3KD9A 4H2PA 1GALA 1Z6LA 4J57A 1E1KA 3V3NA 2ZZCA 4YXDA 2C75A 4AP1A 3FIMB 3BI2A 2XLSA 3NTDA 3CGBA 1H82A 1F6MA 4TM4A 3ZDNA 2R9ZA 3NRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FS7 A;  2RGJ A;  3RNM A;  3GWD A;  2BC1 A;  3H8L A;  2WOI A;  1CJ4 A;  3IHG A;  5IQ1 A;  4YT0 A;  5M10 A;  1BGJ A;  2GVC A;  3COX A;  1HYU A;  2FBW A;  2GR0 A;  1FL2 A;  5TR3 A;  1CJC A;  3RP7 A;  2YVG A;  3ABV A;  3UKA A;  2H89 A;  2BK5 A;  1B37 A;  2XLP A;  4X9M A;  5HXI A;  3K7M X;  3BI4 A;  2I0Z A;  3AEE A;  1TDF A;  2JB2 A;  1GTH A;  1M6I A;  1IUX A;  4H2Q A;  3C4A A;  3UOY A;  4GCM A;  1AOG A;  4X4J A;  3AEF A;  5JCK A;  1YY5 A;  1IUS A;  1K0J A;  3NK0 X;  2X8H A;  1NHQ A;  1CF3 A;  1CJ2 A;  1Q1W A;  3BI5 A;  4GDE A;  4IA6 A;  1S2Y A;  3SM8 A;  1MOK A;  4NEW A;  4TM0 A;  2AAQ A;  4GUV A;  2DKI A;  1GV4 A;  1RSG A;  3DJD A;  3GRT A;  3SFE A;  1K4Q A;  4C5O A;  4YSY A;  1DJQ A;  2GAG B;  3FBS A;  1DOE A;  3ATQ A;  3AE3 A;  3H8I A;  2GV8 A;  1BZL A;  2VQB A;  2YM2 A;  4H4R A;  2B7S A;  3GMC A;  5BUK A;  4HB9 A;  3GDN A;  1D5T A;  4B65 A;  3ICT A;  1EBD A;  4K22 A;  1N4V A;  4AT0 A;  4WCT A;  2YG4 A;  5U25 A;  2JBV A;  3D8X A;  1ZP0 A;  3LB8 A;  2WPF A;  3UOZ A;  4AOX A;  1JEH A;  3F8R A;  4EM4 A;  3GD3 A;  1L9E A;  4DGK A;  4JNA A;  1LTX R;  4YWO A;  2V6O A;  2YLW A;  2YR6 A;  1KNR A;  4IA5 A;  1DJN A;  3CGC A;  3LZW A;  2C66 A;  5LV9 A;  1QO8 A;  3UKF A;  2XLU A;  3AE5 A;  4ECH A;  3QVR A;  4LU6 A;  3B3R A;  1CJ3 A;  3Q9T A;  1ZMC A;  4NTC A;  1CBO A;  2ACZ A;  3BHF A;  2WDV A;  2WES A;  3S5W A;  1TDE A;  2Z5X A;  2ZZB A;  3UOV A;  4A65 A;  4CBQ A;  4J33 A;  1B5Q A;  1YKJ A;  2R46 A;  1D4C A;  2ARD A;  3M13 A;  1EL5 A;  4H4W A;  4Y4L A;  3V76 A;  1F8W A;  1JOA A;  2JK6 A;  2V61 A;  4YSX A;  5JCN A;  4H4Q A;  3OC4 A;  4ZCC A;  3GRS A;  2OAL A;  4C3X A;  3NK1 X;  4H4V A;  2BYB A;  1TRB A;  2VVL A;  4M52 A;  4A6N A;  4EQX A;  5HHF A;  4JN9 A;  2XFU A;  1E39 A;  1H83 A;  3CNS A;  1XHC A;  1H81 A;  3VQR A;  1F8S A;  2Z5Y A;  3AB1 A;  3EF6 A;  3ADA B;  4BV6 A;  1GSN A;  1PBC A;  1GXF A;  2IVE A;  4RSL A;  1E1M A;  4A5L A;  1E1L A;  4EIQ A;  1YQ3 A;  1B4V A;  2XVF A;  2WU5 A;  3CGE A;  2YVJ A;  5KXJ A;  1FEC A;  3K7T A;  1GT8 A;  4TM1 A;  2E5V A;  3IWA A;  3NN0 X;  2YG3 A;  2GR3 A;  4I59 A;  3VRB A;  2B76 A;  4X9N A;  3AYL A;  2H88 A;  3UTF A;  3AED A;  2F5Z A;  2VZ2 A;  3M12 A;  4AT2 A;  1CHU A;  3AE6 A;  2YAU A;  1RYI A;  1FEB A;  2XVI A;  1ZOV A;  3DGH A;  4GRT A;  2OAM A;  4U2T A;  1ZK7 A;  1IUU A;  3AD9 B;  5ER0 A;  4IVM B;  3D1C A;  3NHO X;  2C67 A;  3QSM A;  2JAE A;  3HZL A;  4JDR A;  1PBE A;  1GPE A;  1DOB A;  1NEK A;  3L8K A;  2QA2 A;  3GYJ A;  3BNM A;  4AP3 A;  3ALL A;  4U8P A;  4YSH A;  4Z25 A;  1JU2 A;  1TYT A;  1XAN A;  2DKH A;  3E1T A;  4O5Q A;  4KPR A;  4YTM A;  2VVL G;  1GRA A;  1D7Y A;  3LXD A;  5GRT A;  3GYI A;  4OPC A;  3PO7 A;  4LII A;  1PN0 A;  1XDI A;  4UDR A;  3SFD A;  1TDO A;  4H4U A;  2YWL A;  4UDQ A;  1LQU A;  3QFA A;  3URH A;  2WOW A;  4H4X A;  4REK A;  4H4Z A;  4K7Z A;  2GQW A;  4Z24 A;  4YTP A;  4NEV A;  3OZ2 A;  2BAC A;  4EIP A;  2Q6U A;  3C4N A;  3PS9 A;  3FPZ A;  2HQM A;  3UTG A;  5EB5 A;  5J60 A;  2WBA A;  3DGZ A;  4KX6 A;  4ADW A;  4B1B A;  4C3Y A;  4B63 A;  3IHM A;  1GRE A;  4H4S A;  3O0H A;  3UOX A;  2OA1 A;  2E4G A;  4J31 A;  1K0I A;  1MO9 A;  3NGC X;  2BA9 A;  1F3P A;  1GRF A;  2VRL A;  2APG A;  2E1M A;  1PBF A;  2FJE A;  4Z2U A;  2XFQ A;  5FMH A;  3QSE A;  4JY3 A;  4N9X A;  2XFN A;  2TPR A;  2GEW A;  1W4X A;  1NHS A;  3S61 A;  5U63 A;  4YKG A;  1O94 A;  2PHH A;  1JNZ A;  3II4 A;  5BUL A;  1KDG A;  3UP4 A;  5KWF A;  1ZOY A;  2WS3 A;  2C65 A;  2Y6Q A;  5IQ4 A;  4Z26 A;  2WEU A;  3RP6 A;  4U2L A;  3LOV A;  4TLZ A;  3DK9 A;  2YLX A;  3CPI G;  1JRY A;  2GB0 A;  4MJW A;  5JCL A;  3CPH G;  3P4P A;  4ZN0 A;  4Y4N A;  2ZBW A;  1KF6 A;  3ISH A;  3JSK A;  3UKP A;  3UKH A;  4EMJ A;  1NPX A;  4EM3 A;  3DJG X;  1GOS A;  4O5U A;  4C77 A;  3AEC A;  3DME A;  5FS9 A;  2BS2 A;  4YSZ A;  4J2W A;  1PBD A;  2GMH A;  1B8S A;  4Y4M A;  2WOV A;  4CY6 A;  4I58 A;  4XXG A;  1OJT A;  2WET A;  4Z43 A;  3ICS A;  5KRQ A;  2YR5 A;  3ICR A;  1JNR A;  3K7Q X;  4U8L A;  2AQJ A;  4YKF A;  3VR9 A;  1OJC A;  2WHD A;  2EQ6 A;  3B6D A;  3EAO A;  3IC9 A;  4TM3 A;  4CCR A;  1V59 A;  2XDO A;  3VRD B;  3NLC A;  4B64 A;  1PXA A;  2B7R A;  2YLZ A;  3AE4 A;  2ZZ0 A;  4K5R A;  5M0Z A;  3AE7 A;  2XVJ A;  2WQY A;  4A9W A;  3UTE A;  4U8J A;  2FJB A;  1Y0P A;  3FG2 P;  4DSG A;  1KFY A;  4AOS A;  1IUW A;  2GRT A;  3AYJ A;  3H4K A;  1Y56 A;  2GF3 A;  2A8X A;  2YQU A;  1BGN A;  1VG9 A;  3DK8 A;  3Q6J A;  4EMW A;  3AEA A;  5HYM A;  3ITJ A;  5C2T A;  1OJ9 A;  4WX1 A;  3RP8 A;  1PXC A;  2Q0K A;  1BKW A;  3AD7 B;  4H50 A;  1TDN A;  1S3E A;  4B69 A;  1Q1R A;  4GF7 A;  3UTH A;  1NAA A;  1ELI A;  4TLX A;  4UDP A;  1FCD A;  2BK3 A;  3AEG A;  2RGO A;  2B9Y A;  3DK4 A;  1EL9 A;  1GER A;  3QFB A;  2YG6 A;  3BNU A;  1K0L A;  2A89 A;  2X99 A;  3NKS A;  4Z2R A;  3IF9 A;  3LZX A;  3P9U A;  2WPE A;  2RGH A;  2JB3 A;  2OLN A;  1H86 A;  2R0C A;  2TMD A;  3KPF A;  3CN8 A;  5C3J A;  1QLB A;  2WDR A;  3SQP A;  4EQW A;  4LA1 A;  1SEZ A;  3NYF A;  1H7W A;  1PJ7 A;  1UKV G;  3AE2 A;  3T37 A;  1VG0 A;  3DH9 A;  3KKJ A;  4A6N B;  3WE0 A;  1NG3 A;  3GDP A;  2X50 A;  3CNT A;  4JQ9 A;  4B68 A;  1REO A;  2BS3 A;  1O95 A;  4BUR A;  4D03 A;  3ALJ A;  2YLT A;  2GMJ A;  3CIR A;  1ZMD A;  4OPD A;  2EQ8 A;  1KSS A;  2GAH B;  1P2H A;  4YTN A;  1D4E A;  1D4D A;  3GSI A;  1O5W A;  3L1R A;  1Q9I A;  1S2Q A;  1MXT A;  5JCI A;  2CUL A;  3DJE A;  4CCQ A;  3BHK A;  4CNJ A;  2BC0 A;  5U1O A;  2YVF A;  2VQ7 A;  3AWI A;  5KOX A;  1GND A;  2A87 A;  2XCG A;  1ZKQ A;  2O9Z A;  2YG5 A;  4BJZ A;  4B67 A;  2C70 A;  3UKQ A;  5JCM A;  2YM1 A;  3EAN A;  5IPY A;  5KVH A;  3I3L A;  1BF3 A;  1GRB A;  4APN A;  2UZZ A;  3CTY A;  4RG3 A;  2XFO A;  1H7X A;  1DXL A;  3KA7 A;  1OJD A;  1L0V A;  3AXB A;  4BK1 A;  2YG7 A;  3VR8 A;  2BK4 A;  1JRX A;  3CPJ G;  3CND A;  3R9U A;  2XFP A;  1ONF A;  1PS9 A;  4U8N A;  1XPQ A;  1LV0 A;  2BXR A;  2QA1 A;  2Q7V A;  3QVP A;  4J36 A;  2XVH A;  3NIX A;  3SGL A;  2R0G A;  1GES A;  3AD8 B;  2C72 A;  3DA1 A;  1P2E A;  3NNE A;  3NYE A;  3EPT A;  2WDQ A;  4JNQ A;  1YQ4 A;  4D04 A;  5DBJ A;  5CKU A;  4PAB A;  2WP9 A;  3QJ4 A;  1DNC A;  1E1N A;  3UCL A;  1GRG A;  4UP3 A;  4GR1 A;  1TDK A;  4FX9 A;  4E0V A;  1GRT A;  2BS4 A;  4FDC B;  4NTE A;  1F8R A;  4A99 A;  4U8M A;  1CL0 A;  5GSN A;  4A79 A;  2IID A;  4FK1 A;  4EQR A;  3ATR A;  4Z44 A;  1E6E A;  3NH3 X;  3UKK A;  1PJ6 A;  2B9W A;  2WPC A;  4CNK A;  2GR2 A;  1ZY8 A;  2XVE A;  3ALM A;  1N4W A;  2RAB A;  2BCP A;  3AE1 A;  3KVE A;  1X31 B;  1D7L A;  4DSH A;  1LVL A;  4K8D A;  1GEU A;  1GET A;  3GWF A;  1LQT A;  2WU2 A;  5J7X A;  3DJJ A;  4EQS A;  2V3B A;  2J3N A;  3AE8 A;  5FS6 A;  2VVM A;  2X3N A;  4ICY A;  4XWR A;  3G5R A;  1NG4 A;  4OPI A;  2V3A A;  2WP6 A;  3CNP A;  3LJP A;  4OPG A;  1H6V A;  2YLS A;  3NYC A;  1NDA A;  4IV9 A;  4NTD A;  4JY2 A;  1EL8 A;  4H7U A;  1ZDL A;  2XLT A;  3CGD A;  4OPU A;  3G5Q A;  4HA6 A;  4K5S A;  2CVJ A;  1EL7 A;  1IUT A;  2QCU A;  4H4T A;  3ZYX A;  5BRT A;  3PVC A;  3F8P A;  5KOW A;  2EQ9 A;  1IUV A;  3NG7 X;  4H4P A;  4PAA A;  1PJ5 A;  2FJA A;  4USQ A;  1LJ1 A;  1PXB A;  5CQF A;  2Y6R A;  5KVI A;  4BK3 A;  2AR8 A;  4H2N A;  4CY8 A;  4EMI A;  1LPF A;  2IVD A;  2GR1 A;  1IJH A;  1NHP A;  4OPL A;  4P9S A;  5EBK A;  2R45 A;  3RED A;  2X8G A;  1RP0 A;  1ZX9 A;  3FMW A;  1JRZ A;  5EOW A;  2C7G A;  3RHA A;  1YQZ A;  2VOU A;  1PDH A;  2R4E A;  2JB1 A;  3P1W A;  2C73 A;  3CNJ A;  4RG4 A;  2GQF A;  2FJD A;  3M0O A;  1DOD A;  2YR4 A;  4J34 A;  1GRH A;  1VQW A;  2BCG G;  4OCG A;  1N4U A;  2YLR A;  3I6D A;  3NN6 X;  1COY A;  3P4R A;  3UP5 A;  4IVO B;  4A7A A;  2V60 A;  2CFY A;  4B66 A;  4BJY A;  4C74 A;  3AE9 A;  4J56 A;  2EQ7 A;  1KNP A;  1S3B A;  2CDU A;  1N1P A;  5FS8 A;  1BWC A;  1TYP A;  2R0P A;  4USR A;  1E7P A;  4U8K A;  1CC6 A;  2C76 A;  3NK2 X;  3C96 A;  2Q0L A;  1CC4 A;  1CC2 A;  2B9X A;  2PYX A;  1L9D A;  1Y56 B;  2NPX A;  3AEB A;  3AYI A;  3GMB A;  2OLO A;  2R4J A;  3KU9 A;  2C3D A;  3NT6 A;  4H2R A;  2XLR A;  1VRQ B;  2WP5 A;  3P4Q A;  1KSU A;  4U2S A;  4GDP A;  4U8O A;  2GH5 A;  1QJD A;  2XYO A;  3GD4 A;  4Z2T A;  4XWZ A;  3QSS A;  3G5S A;  2NVK X;  2W0H A;  3LAD A;  5L46 A;  1NEN A;  1H84 A;  1PBB A;  3UKL A;  4NZH A;  2JKC A;  1GTE A;  1PHH A;  3K30 A;  2VRM A;  4ZCD A;  5HY5 A;  2X8C A;  2V5Z A;  1VDC A;  1DOC A;  2BXS A;  2QAE A;  1OJA A;  4U8I A;  3V3O A;  1NHR A;  5BVA A;  2C3C A;  3NTA A;  4OVI A;  3F8D A;  3KLJ A;  4BK2 A;  4DNA A;  3P4S A;  4K2X A;  4OPT A;  2C64 A;  5EB4 A;  4FK1 C;  1M64 A;  4CRT A;  1FOH A;  1FEA A;  1L9C A;  3VRA A;  4H4Y A;  2BAB A;  3KD9 A;  4H2P A;  1GAL A;  1Z6L A;  4J57 A;  1E1K A;  3V3N A;  2ZZC A;  4YXD A;  2C75 A;  4AP1 A;  3FIM B;  3BI2 A;  2XLS A;  3NTD A;  3CGB A;  1H82 A;  1F6M A;  4TM4 A;  3ZDN A;  2R9Z A;  3NRN A; 
#chains in the Genus database with same CATH topology
 5FS7 A;  2RGJ A;  3RNM A;  3GWD A;  2BC1 A;  3H8L A;  2WOI A;  1CJ4 A;  3IHG A;  5IQ1 A;  4YT0 A;  5M10 A;  1BGJ A;  2GVC A;  3COX A;  1HYU A;  2FBW A;  2GR0 A;  2C4C A;  1FL2 A;  5TR3 A;  1CJC A;  3RP7 A;  2YVG A;  3ABV A;  3UKA A;  2H89 A;  2BK5 A;  1B37 A;  2XLP A;  4X9M A;  5HXI A;  3K7M X;  3BI4 A;  2I0Z A;  3AEE A;  1TDF A;  2JB2 A;  1GTH A;  1M6I A;  1IUX A;  4H2Q A;  3C4A A;  3UOY A;  4GCM A;  1AOG A;  4X4J A;  3AEF A;  5JCK A;  3T2Y A;  1YY5 A;  1IUS A;  1K0J A;  3NK0 X;  2X8H A;  1NHQ A;  1CF3 A;  1CJ2 A;  1Q1W A;  3BI5 A;  4GDE A;  4IA6 A;  1S2Y A;  3SM8 A;  1MOK A;  4NEW A;  4TM0 A;  2AAQ A;  4GUV A;  2DKI A;  1GV4 A;  1RSG A;  3DJD A;  3GRT A;  3SFE A;  1K4Q A;  4C5O A;  4YSY A;  1DJQ A;  2GAG B;  3FBS A;  1DOE A;  3ATQ A;  3AE3 A;  3H8I A;  3KPK A;  2GV8 A;  1BZL A;  2VQB A;  2YM2 A;  3SZ0 A;  4H4R A;  2B7S A;  3GMC A;  5BUK A;  4HB9 A;  3GDN A;  1D5T A;  4B65 A;  3ICT A;  1EBD A;  4K22 A;  1N4V A;  4AT0 A;  4WCT A;  2YG4 A;  5U25 A;  2JBV A;  3D8X A;  1ZP0 A;  3LB8 A;  2WPF A;  3UOZ A;  4AOX A;  1JEH A;  3F8R A;  4EM4 A;  3GD3 A;  1L9E A;  4DGK A;  4JNA A;  1LTX R;  4YWO A;  2V6O A;  2YLW A;  2YR6 A;  1KNR A;  4IA5 A;  1DJN A;  3CGC A;  3LZW A;  2C66 A;  5LV9 A;  1QO8 A;  3UKF A;  2XLU A;  3AE5 A;  4ECH A;  3QVR A;  4LU6 A;  3B3R A;  1CJ3 A;  3Q9T A;  1ZMC A;  4NTC A;  1CBO A;  2ACZ A;  3BHF A;  2WDV A;  2WES A;  3S5W A;  1TDE A;  2Z5X A;  2ZZB A;  3UOV A;  4A65 A;  4CBQ A;  4J33 A;  1B5Q A;  1YKJ A;  2R46 A;  1D4C A;  2ARD A;  3M13 A;  1EL5 A;  4H4W A;  4Y4L A;  3V76 A;  1F8W A;  1JOA A;  2JK6 A;  2V61 A;  4YSX A;  5JCN A;  4H4Q A;  3OC4 A;  4ZCC A;  3GRS A;  2OAL A;  4C3X A;  3NK1 X;  4H4V A;  2BYB A;  1TRB A;  2VVL A;  4M52 A;  4A6N A;  4EQX A;  5HHF A;  4JN9 A;  2XFU A;  1E39 A;  1H83 A;  4G74 A;  3CNS A;  1XHC A;  1H81 A;  3VQR A;  1F8S A;  2Z5Y A;  3AB1 A;  3EF6 A;  3ADA B;  4BV6 A;  1GSN A;  1PBC A;  3SZF A;  1GXF A;  2IVE A;  4RSL A;  1E1M A;  4A5L A;  1E1L A;  4EIQ A;  1YQ3 A;  1B4V A;  2XVF A;  2WU5 A;  3CGE A;  2YVJ A;  5KXJ A;  1FEC A;  3K7T A;  1GT8 A;  4TM1 A;  2E5V A;  3IWA A;  3NN0 X;  2YG3 A;  2GR3 A;  4I59 A;  3VRB A;  2B76 A;  4X9N A;  3AYL A;  2H88 A;  3UTF A;  3AED A;  2F5Z A;  2VZ2 A;  3M12 A;  4AT2 A;  1CHU A;  3AE6 A;  2YAU A;  1RYI A;  1FEB A;  2XVI A;  1ZOV A;  3DGH A;  4GRT A;  2OAM A;  4U2T A;  1ZK7 A;  1IUU A;  3AD9 B;  5ER0 A;  4IVM B;  3GYX A;  3D1C A;  3NHO X;  2C67 A;  3QSM A;  2JAE A;  3HZL A;  4JDR A;  1PBE A;  1GPE A;  1DOB A;  1NEK A;  3L8K A;  2QA2 A;  3GYJ A;  3BNM A;  4AP3 A;  3ALL A;  4U8P A;  4YSH A;  4Z25 A;  1JU2 A;  1TYT A;  1XAN A;  2DKH A;  3E1T A;  4O5Q A;  4KPR A;  3SXI A;  4YTM A;  2VVL G;  1GRA A;  1D7Y A;  3LXD A;  5GRT A;  3GYI A;  4OPC A;  3PO7 A;  4LII A;  1PN0 A;  1XDI A;  4UDR A;  3SFD A;  1TDO A;  4H4U A;  2YWL A;  4UDQ A;  1LQU A;  3QFA A;  4G73 A;  2WOW A;  4H4X A;  3URH A;  4G9K A;  4REK A;  4H4Z A;  4K7Z A;  2GQW A;  4Z24 A;  4YTP A;  4G6G A;  4NEV A;  3OZ2 A;  2BAC A;  4EIP A;  2Q6U A;  3C4N A;  3PS9 A;  3FPZ A;  2HQM A;  3UTG A;  5EB5 A;  5J60 A;  2WBA A;  3DGZ A;  4KX6 A;  4ADW A;  4B1B A;  4C3Y A;  4B63 A;  3IHM A;  1GRE A;  4H4S A;  3O0H A;  3UOX A;  2OA1 A;  2E4G A;  4J31 A;  1K0I A;  1MO9 A;  3NGC X;  2BA9 A;  1F3P A;  1GRF A;  2VRL A;  2APG A;  2E1M A;  1PBF A;  2FJE A;  4II2 A;  4Z2U A;  2XFQ A;  5FMH A;  4NNJ A;  3QSE A;  4JY3 A;  4N9X A;  2XFN A;  2TPR A;  2GEW A;  1W4X A;  1NHS A;  3S61 A;  5U63 A;  4YKG A;  1O94 A;  2PHH A;  1JNZ A;  3II4 A;  5BUL A;  1KDG A;  3UP4 A;  5KWF A;  1ZOY A;  2WS3 A;  2C65 A;  2Y6Q A;  5IQ4 A;  4Z26 A;  2WEU A;  3RP6 A;  4U2L A;  3LOV A;  4TLZ A;  3DK9 A;  2YLX A;  3CPI G;  1JRY A;  2GB0 A;  3SZC A;  4MJW A;  5JCL A;  3CPH G;  3P4P A;  4ZN0 A;  4Y4N A;  2ZBW A;  1KF6 A;  3ISH A;  3JSK A;  3UKP A;  3UKH A;  4EMJ A;  1NPX A;  4EM3 A;  3DJG X;  1GOS A;  4O5U A;  4C77 A;  3AEC A;  3DME A;  5FS9 A;  2BS2 A;  4YSZ A;  4J2W A;  1PBD A;  2GMH A;  1B8S A;  4Y4M A;  2WOV A;  4CY6 A;  4I58 A;  4XXG A;  1OJT A;  2WET A;  4Z43 A;  3ICS A;  5KRQ A;  2YR5 A;  3ICR A;  1JNR A;  3K7Q X;  4U8L A;  2AQJ A;  4YKF A;  3VR9 A;  1OJC A;  2WHD A;  2EQ6 A;  3B6D A;  3EAO A;  3IC9 A;  4TM3 A;  4CCR A;  1V59 A;  2XDO A;  3VRD B;  3NLC A;  4B64 A;  1PXA A;  2B7R A;  2YLZ A;  3AE4 A;  3SX6 A;  2ZZ0 A;  4K5R A;  5M0Z A;  3AE7 A;  2XVJ A;  2WQY A;  4A9W A;  3UTE A;  4U8J A;  2FJB A;  1Y0P A;  3FG2 P;  4DSG A;  1KFY A;  4AOS A;  1IUW A;  2GRT A;  3AYJ A;  3H4K A;  1Y56 A;  2GF3 A;  2A8X A;  2YQU A;  1BGN A;  1VG9 A;  3DK8 A;  3Q6J A;  4EMW A;  3AEA A;  5HYM A;  3ITJ A;  5C2T A;  1OJ9 A;  4WX1 A;  3RP8 A;  3T14 A;  1PXC A;  2Q0K A;  1BKW A;  3AD7 B;  4H50 A;  3T2Z A;  1TDN A;  1S3E A;  4B69 A;  4GAV A;  1Q1R A;  4GF7 A;  3UTH A;  3SZW A;  1NAA A;  1ELI A;  4TLX A;  4UDP A;  1FCD A;  2BK3 A;  3AEG A;  2RGO A;  2B9Y A;  3DK4 A;  1EL9 A;  1GER A;  3QFB A;  3SYI A;  2YG6 A;  3BNU A;  1K0L A;  2A89 A;  2X99 A;  3NKS A;  4Z2R A;  3IF9 A;  3LZX A;  3P9U A;  2WPE A;  2RGH A;  2JB3 A;  2OLN A;  1H86 A;  2R0C A;  2TMD A;  3KPF A;  3CN8 A;  5C3J A;  4G6H A;  1QLB A;  2WDR A;  3SQP A;  4EQW A;  4LA1 A;  1SEZ A;  3NYF A;  1H7W A;  1PJ7 A;  1UKV G;  3AE2 A;  3T37 A;  1VG0 A;  3DH9 A;  3KKJ A;  4A6N B;  3WE0 A;  1NG3 A;  4II3 A;  3GDP A;  2X50 A;  3CNT A;  4JQ9 A;  4B68 A;  1REO A;  2BS3 A;  1O95 A;  4BUR A;  4D03 A;  3ALJ A;  2YLT A;  2GMJ A;  3CIR A;  1ZMD A;  3HYX A;  4OPD A;  2EQ8 A;  1KSS A;  2GAH B;  1P2H A;  4YTN A;  1D4E A;  1D4D A;  3GSI A;  1O5W A;  3L1R A;  1Q9I A;  1S2Q A;  1MXT A;  5JCI A;  2CUL A;  3DJE A;  4CCQ A;  3BHK A;  4CNJ A;  2BC0 A;  5U1O A;  2YVF A;  2VQ7 A;  3AWI A;  5KOX A;  1GND A;  2A87 A;  2XCG A;  1ZKQ A;  2O9Z A;  2YG5 A;  4BJZ A;  4B67 A;  2C70 A;  3UKQ A;  5JCM A;  2YM1 A;  3EAN A;  5IPY A;  5KVH A;  3I3L A;  1BF3 A;  1GRB A;  4APN A;  2UZZ A;  3CTY A;  4RG3 A;  2XFO A;  1H7X A;  1DXL A;  3KA7 A;  1OJD A;  1L0V A;  3AXB A;  4BK1 A;  2YG7 A;  3VR8 A;  2BK4 A;  1JRX A;  3CPJ G;  3CND A;  3R9U A;  2XFP A;  1ONF A;  1PS9 A;  3HYW A;  4U8N A;  1XPQ A;  1LV0 A;  2BXR A;  2QA1 A;  2Q7V A;  3QVP A;  4J36 A;  2XVH A;  3T2K A;  3NIX A;  3SGL A;  2R0G A;  1GES A;  3AD8 B;  2C72 A;  3DA1 A;  1P2E A;  3NNE A;  3NYE A;  3EPT A;  2WDQ A;  4JNQ A;  1YQ4 A;  4D04 A;  5DBJ A;  5CKU A;  4PAB A;  2WP9 A;  3QJ4 A;  1DNC A;  1E1N A;  3UCL A;  1GRG A;  4UP3 A;  4GR1 A;  1TDK A;  4FX9 A;  4E0V A;  1GRT A;  2BS4 A;  4FDC B;  4NTE A;  1F8R A;  4A99 A;  4U8M A;  1CL0 A;  5GSN A;  4A79 A;  2IID A;  4FK1 A;  4EQR A;  3ATR A;  4Z44 A;  1E6E A;  3NH3 X;  3UKK A;  1PJ6 A;  2B9W A;  2WPC A;  4CNK A;  2GR2 A;  1ZY8 A;  2XVE A;  3ALM A;  1N4W A;  2RAB A;  2BCP A;  3AE1 A;  3KVE A;  1X31 B;  1D7L A;  4DSH A;  1LVL A;  4K8D A;  5KMS A;  1GEU A;  1GET A;  3GWF A;  1LQT A;  2WU2 A;  5KMQ A;  5J7X A;  3DJJ A;  4EQS A;  2V3B A;  2J3N A;  3AE8 A;  5FS6 A;  2VVM A;  2X3N A;  4ICY A;  4XWR A;  3G5R A;  1NG4 A;  4OPI A;  2V3A A;  2WP6 A;  3CNP A;  3LJP A;  4OPG A;  1H6V A;  2YLS A;  3NYC A;  1NDA A;  4IV9 A;  4NTD A;  4JY2 A;  1EL8 A;  4H7U A;  1ZDL A;  2XLT A;  3CGD A;  4OPU A;  3G5Q A;  4HA6 A;  4K5S A;  2CVJ A;  1EL7 A;  1IUT A;  2QCU A;  4H4T A;  3T31 A;  3ZYX A;  5BRT A;  5KMP A;  3HYV A;  3PVC A;  3F8P A;  5KOW A;  2EQ9 A;  1IUV A;  3NG7 X;  4GAP A;  4H4P A;  4PAA A;  1PJ5 A;  2FJA A;  4USQ A;  1LJ1 A;  1PXB A;  5CQF A;  2Y6R A;  5KVI A;  4BK3 A;  2AR8 A;  4H2N A;  4CY8 A;  4EMI A;  1LPF A;  2IVD A;  2GR1 A;  1IJH A;  1NHP A;  4OPL A;  4P9S A;  3T0K A;  5EBK A;  2R45 A;  3RED A;  2X8G A;  1RP0 A;  1ZX9 A;  3FMW A;  1JRZ A;  5EOW A;  2C7G A;  3RHA A;  1YQZ A;  2VOU A;  1PDH A;  2R4E A;  2JB1 A;  3P1W A;  2C73 A;  3CNJ A;  4RG4 A;  2GQF A;  2FJD A;  3M0O A;  1DOD A;  2YR4 A;  4NWZ A;  4J34 A;  1GRH A;  1VQW A;  2BCG G;  4OCG A;  3SY4 A;  1N4U A;  2YLR A;  3I6D A;  3NN6 X;  1COY A;  3P4R A;  3UP5 A;  4IVO B;  4A7A A;  2V60 A;  2CFY A;  4B66 A;  4BJY A;  4C74 A;  3AE9 A;  2BRA A;  2EQ7 A;  4J56 A;  1KNP A;  1S3B A;  2CDU A;  1N1P A;  5FS8 A;  1BWC A;  1TYP A;  2R0P A;  4USR A;  1E7P A;  4U8K A;  1CC6 A;  2C76 A;  3NK2 X;  3C96 A;  2Q0L A;  1CC4 A;  1CC2 A;  2B9X A;  2PYX A;  1L9D A;  1Y56 B;  2NPX A;  3AEB A;  3AYI A;  3CMM A;  2OLO A;  2R4J A;  3GMB A;  2C3D A;  3KU9 A;  3NT6 A;  2XLR A;  4H2R A;  1VRQ B;  2WP5 A;  3P4Q A;  1KSU A;  4U2S A;  4GDP A;  4U8O A;  2GH5 A;  1QJD A;  2XYO A;  3GD4 A;  4Z2T A;  4XWZ A;  3QSS A;  3G5S A;  2NVK X;  2W0H A;  3LAD A;  5L46 A;  1NEN A;  1H84 A;  1PBB A;  3UKL A;  4NZH A;  2JKC A;  1GTE A;  1PHH A;  3K30 A;  5KMR A;  2VRM A;  4ZCD A;  5HY5 A;  2BRY A;  2X8C A;  2V5Z A;  1VDC A;  1DOC A;  2BXS A;  2QAE A;  1OJA A;  4U8I A;  3V3O A;  1NHR A;  5BVA A;  2C3C A;  3NTA A;  4OVI A;  3F8D A;  3KLJ A;  4BK2 A;  4DNA A;  3P4S A;  4K2X A;  5KNL A;  4OPT A;  2C64 A;  5EB4 A;  4FK1 C;  1M64 A;  4CRT A;  1FOH A;  1FEA A;  1L9C A;  3VRA A;  4H4Y A;  2BAB A;  3KD9 A;  4H2P A;  1GAL A;  1Z6L A;  4J57 A;  1E1K A;  3V3N A;  2ZZC A;  4YXD A;  2C75 A;  4AP1 A;  3FIM B;  3BI2 A;  2XLS A;  3NTD A;  3CGB A;  1H82 A;  1F6M A;  4TM4 A;  3ZDN A;  2R9Z A;  3NRN A; 
#chains in the Genus database with same CATH homology
 5FS7 A;  2RGJ A;  3RNM A;  3GWD A;  2BC1 A;  3H8L A;  2WOI A;  1CJ4 A;  3IHG A;  5IQ1 A;  4YT0 A;  5M10 A;  1BGJ A;  2GVC A;  3COX A;  1HYU A;  2FBW A;  2GR0 A;  2C4C A;  1FL2 A;  5TR3 A;  1CJC A;  3RP7 A;  2YVG A;  3ABV A;  3UKA A;  2H89 A;  2BK5 A;  1B37 A;  2XLP A;  4X9M A;  5HXI A;  3K7M X;  3BI4 A;  2I0Z A;  3AEE A;  1TDF A;  2JB2 A;  1GTH A;  1M6I A;  1IUX A;  4H2Q A;  3C4A A;  3UOY A;  4GCM A;  1AOG A;  4X4J A;  3AEF A;  5JCK A;  3T2Y A;  1YY5 A;  1IUS A;  1K0J A;  3NK0 X;  2X8H A;  1NHQ A;  1CF3 A;  1CJ2 A;  1Q1W A;  3BI5 A;  4GDE A;  4IA6 A;  1S2Y A;  3SM8 A;  1MOK A;  4NEW A;  4TM0 A;  2AAQ A;  4GUV A;  2DKI A;  1GV4 A;  1RSG A;  3DJD A;  3GRT A;  3SFE A;  1K4Q A;  4C5O A;  4YSY A;  1DJQ A;  2GAG B;  3FBS A;  1DOE A;  3ATQ A;  3AE3 A;  3H8I A;  3KPK A;  2GV8 A;  1BZL A;  2VQB A;  2YM2 A;  3SZ0 A;  4H4R A;  2B7S A;  3GMC A;  5BUK A;  4HB9 A;  3GDN A;  1D5T A;  4B65 A;  3ICT A;  1EBD A;  4K22 A;  1N4V A;  4AT0 A;  4WCT A;  2YG4 A;  5U25 A;  2JBV A;  3D8X A;  1ZP0 A;  3LB8 A;  2WPF A;  3UOZ A;  4AOX A;  1JEH A;  3F8R A;  4EM4 A;  3GD3 A;  1L9E A;  4DGK A;  4JNA A;  1LTX R;  4YWO A;  2V6O A;  2YLW A;  2YR6 A;  1KNR A;  4IA5 A;  1DJN A;  3CGC A;  3LZW A;  2C66 A;  5LV9 A;  1QO8 A;  3UKF A;  2XLU A;  3AE5 A;  4ECH A;  3QVR A;  4LU6 A;  3B3R A;  1CJ3 A;  3Q9T A;  1ZMC A;  4NTC A;  1CBO A;  2ACZ A;  3BHF A;  2WDV A;  2WES A;  3S5W A;  1TDE A;  2Z5X A;  2ZZB A;  3UOV A;  4A65 A;  4CBQ A;  4J33 A;  1B5Q A;  1YKJ A;  2R46 A;  1D4C A;  2ARD A;  3M13 A;  1EL5 A;  4H4W A;  4Y4L A;  3V76 A;  1F8W A;  1JOA A;  2JK6 A;  2V61 A;  4YSX A;  5JCN A;  4H4Q A;  3OC4 A;  4ZCC A;  3GRS A;  2OAL A;  4C3X A;  3NK1 X;  4H4V A;  2BYB A;  1TRB A;  2VVL A;  4M52 A;  4A6N A;  4EQX A;  5HHF A;  4JN9 A;  2XFU A;  1E39 A;  1H83 A;  4G74 A;  3CNS A;  1XHC A;  1H81 A;  3VQR A;  1F8S A;  2Z5Y A;  3AB1 A;  3EF6 A;  3ADA B;  4BV6 A;  1GSN A;  1PBC A;  3SZF A;  1GXF A;  2IVE A;  4RSL A;  1E1M A;  4A5L A;  1E1L A;  4EIQ A;  1YQ3 A;  1B4V A;  2XVF A;  2WU5 A;  3CGE A;  2YVJ A;  5KXJ A;  1FEC A;  3K7T A;  1GT8 A;  4TM1 A;  2E5V A;  3IWA A;  3NN0 X;  2YG3 A;  2GR3 A;  4I59 A;  3VRB A;  2B76 A;  4X9N A;  3AYL A;  2H88 A;  3UTF A;  3AED A;  2F5Z A;  2VZ2 A;  3M12 A;  4AT2 A;  1CHU A;  3AE6 A;  2YAU A;  1RYI A;  1FEB A;  2XVI A;  1ZOV A;  3DGH A;  4GRT A;  2OAM A;  4U2T A;  1ZK7 A;  1IUU A;  3AD9 B;  5ER0 A;  4IVM B;  3GYX A;  3D1C A;  3NHO X;  2C67 A;  3QSM A;  2JAE A;  3HZL A;  4JDR A;  1PBE A;  1GPE A;  1DOB A;  1NEK A;  3L8K A;  2QA2 A;  3GYJ A;  3BNM A;  4AP3 A;  3ALL A;  4U8P A;  4YSH A;  4Z25 A;  1JU2 A;  1TYT A;  1XAN A;  2DKH A;  3E1T A;  4O5Q A;  4KPR A;  3SXI A;  4YTM A;  2VVL G;  1GRA A;  1D7Y A;  3LXD A;  5GRT A;  3GYI A;  4OPC A;  3PO7 A;  4LII A;  1PN0 A;  1XDI A;  4UDR A;  3SFD A;  1TDO A;  4H4U A;  2YWL A;  4UDQ A;  1LQU A;  3QFA A;  4G73 A;  2WOW A;  4H4X A;  3URH A;  4G9K A;  4REK A;  4H4Z A;  4K7Z A;  2GQW A;  4Z24 A;  4YTP A;  4G6G A;  4NEV A;  3OZ2 A;  2BAC A;  4EIP A;  2Q6U A;  3C4N A;  3PS9 A;  3FPZ A;  2HQM A;  3UTG A;  5EB5 A;  5J60 A;  2WBA A;  3DGZ A;  4KX6 A;  4ADW A;  4B1B A;  4C3Y A;  4B63 A;  3IHM A;  1GRE A;  4H4S A;  3O0H A;  3UOX A;  2OA1 A;  2E4G A;  4J31 A;  1K0I A;  1MO9 A;  3NGC X;  2BA9 A;  1F3P A;  1GRF A;  2VRL A;  2APG A;  2E1M A;  1PBF A;  2FJE A;  4II2 A;  4Z2U A;  2XFQ A;  5FMH A;  4NNJ A;  3QSE A;  4JY3 A;  4N9X A;  2XFN A;  2TPR A;  2GEW A;  1W4X A;  1NHS A;  3S61 A;  5U63 A;  4YKG A;  1O94 A;  2PHH A;  1JNZ A;  3II4 A;  5BUL A;  1KDG A;  3UP4 A;  5KWF A;  1ZOY A;  2WS3 A;  2C65 A;  2Y6Q A;  5IQ4 A;  4Z26 A;  2WEU A;  3RP6 A;  4U2L A;  3LOV A;  4TLZ A;  3DK9 A;  2YLX A;  3CPI G;  1JRY A;  2GB0 A;  3SZC A;  4MJW A;  5JCL A;  3CPH G;  3P4P A;  4ZN0 A;  4Y4N A;  2ZBW A;  1KF6 A;  3ISH A;  3JSK A;  3UKP A;  3UKH A;  4EMJ A;  1NPX A;  4EM3 A;  3DJG X;  1GOS A;  4O5U A;  4C77 A;  3AEC A;  3DME A;  5FS9 A;  2BS2 A;  4YSZ A;  4J2W A;  1PBD A;  2GMH A;  1B8S A;  4Y4M A;  2WOV A;  4CY6 A;  4I58 A;  4XXG A;  1OJT A;  2WET A;  4Z43 A;  3ICS A;  5KRQ A;  2YR5 A;  3ICR A;  1JNR A;  3K7Q X;  4U8L A;  2AQJ A;  4YKF A;  3VR9 A;  1OJC A;  2WHD A;  2EQ6 A;  3B6D A;  3EAO A;  3IC9 A;  4TM3 A;  4CCR A;  1V59 A;  2XDO A;  3VRD B;  3NLC A;  4B64 A;  1PXA A;  2B7R A;  2YLZ A;  3AE4 A;  3SX6 A;  2ZZ0 A;  4K5R A;  5M0Z A;  3AE7 A;  2XVJ A;  2WQY A;  4A9W A;  3UTE A;  4U8J A;  2FJB A;  1Y0P A;  3FG2 P;  4DSG A;  1KFY A;  4AOS A;  1IUW A;  2GRT A;  3AYJ A;  3H4K A;  1Y56 A;  2GF3 A;  2A8X A;  2YQU A;  1BGN A;  1VG9 A;  3DK8 A;  3Q6J A;  4EMW A;  3AEA A;  5HYM A;  3ITJ A;  5C2T A;  1OJ9 A;  4WX1 A;  3RP8 A;  3T14 A;  1PXC A;  2Q0K A;  1BKW A;  3AD7 B;  4H50 A;  3T2Z A;  1TDN A;  1S3E A;  4B69 A;  4GAV A;  1Q1R A;  4GF7 A;  3UTH A;  3SZW A;  1NAA A;  1ELI A;  4TLX A;  4UDP A;  1FCD A;  2BK3 A;  3AEG A;  2RGO A;  2B9Y A;  3DK4 A;  1EL9 A;  1GER A;  3QFB A;  3SYI A;  2YG6 A;  3BNU A;  1K0L A;  2A89 A;  2X99 A;  3NKS A;  4Z2R A;  3IF9 A;  3LZX A;  3P9U A;  2WPE A;  2RGH A;  2JB3 A;  2OLN A;  1H86 A;  2R0C A;  2TMD A;  3KPF A;  3CN8 A;  5C3J A;  4G6H A;  1QLB A;  2WDR A;  3SQP A;  4EQW A;  4LA1 A;  1SEZ A;  3NYF A;  1H7W A;  1PJ7 A;  1UKV G;  3AE2 A;  3T37 A;  1VG0 A;  3DH9 A;  3KKJ A;  4A6N B;  3WE0 A;  1NG3 A;  4II3 A;  3GDP A;  2X50 A;  3CNT A;  4JQ9 A;  4B68 A;  1REO A;  2BS3 A;  1O95 A;  4BUR A;  4D03 A;  3ALJ A;  2YLT A;  2GMJ A;  3CIR A;  1ZMD A;  3HYX A;  4OPD A;  2EQ8 A;  1KSS A;  2GAH B;  1P2H A;  4YTN A;  1D4E A;  1D4D A;  3GSI A;  1O5W A;  3L1R A;  1Q9I A;  1S2Q A;  1MXT A;  5JCI A;  2CUL A;  3DJE A;  4CCQ A;  3BHK A;  4CNJ A;  2BC0 A;  5U1O A;  2YVF A;  2VQ7 A;  3AWI A;  5KOX A;  1GND A;  2A87 A;  2XCG A;  1ZKQ A;  2O9Z A;  2YG5 A;  4BJZ A;  4B67 A;  2C70 A;  3UKQ A;  5JCM A;  2YM1 A;  3EAN A;  5IPY A;  5KVH A;  3I3L A;  1BF3 A;  1GRB A;  4APN A;  2UZZ A;  3CTY A;  4RG3 A;  2XFO A;  1H7X A;  1DXL A;  3KA7 A;  1OJD A;  1L0V A;  3AXB A;  4BK1 A;  2YG7 A;  3VR8 A;  2BK4 A;  1JRX A;  3CPJ G;  3CND A;  3R9U A;  2XFP A;  1ONF A;  1PS9 A;  3HYW A;  4U8N A;  1XPQ A;  1LV0 A;  2BXR A;  2QA1 A;  2Q7V A;  3QVP A;  4J36 A;  2XVH A;  3T2K A;  3NIX A;  3SGL A;  2R0G A;  1GES A;  3AD8 B;  2C72 A;  3DA1 A;  1P2E A;  3NNE A;  3NYE A;  3EPT A;  2WDQ A;  4JNQ A;  1YQ4 A;  4D04 A;  5DBJ A;  5CKU A;  4PAB A;  2WP9 A;  3QJ4 A;  1DNC A;  1E1N A;  3UCL A;  1GRG A;  4UP3 A;  4GR1 A;  1TDK A;  4FX9 A;  4E0V A;  1GRT A;  2BS4 A;  4FDC B;  4NTE A;  1F8R A;  4A99 A;  4U8M A;  1CL0 A;  5GSN A;  4A79 A;  2IID A;  4FK1 A;  4EQR A;  3ATR A;  4Z44 A;  1E6E A;  3NH3 X;  3UKK A;  1PJ6 A;  2B9W A;  2WPC A;  4CNK A;  2GR2 A;  1ZY8 A;  2XVE A;  3ALM A;  1N4W A;  2RAB A;  2BCP A;  3AE1 A;  3KVE A;  1X31 B;  1D7L A;  4DSH A;  1LVL A;  4K8D A;  5KMS A;  1GEU A;  1GET A;  3GWF A;  1LQT A;  2WU2 A;  5KMQ A;  5J7X A;  3DJJ A;  4EQS A;  2V3B A;  2J3N A;  3AE8 A;  5FS6 A;  2VVM A;  2X3N A;  4ICY A;  4XWR A;  3G5R A;  1NG4 A;  4OPI A;  2V3A A;  2WP6 A;  3CNP A;  3LJP A;  4OPG A;  1H6V A;  2YLS A;  3NYC A;  1NDA A;  4IV9 A;  4NTD A;  4JY2 A;  1EL8 A;  4H7U A;  1ZDL A;  2XLT A;  3CGD A;  4OPU A;  3G5Q A;  4HA6 A;  4K5S A;  2CVJ A;  1EL7 A;  1IUT A;  2QCU A;  4H4T A;  3T31 A;  3ZYX A;  5BRT A;  5KMP A;  3HYV A;  3PVC A;  3F8P A;  5KOW A;  2EQ9 A;  1IUV A;  3NG7 X;  4GAP A;  4H4P A;  4PAA A;  1PJ5 A;  2FJA A;  4USQ A;  1LJ1 A;  1PXB A;  5CQF A;  2Y6R A;  5KVI A;  4BK3 A;  2AR8 A;  4H2N A;  4CY8 A;  4EMI A;  1LPF A;  2IVD A;  2GR1 A;  1IJH A;  1NHP A;  4OPL A;  4P9S A;  3T0K A;  5EBK A;  2R45 A;  3RED A;  2X8G A;  1RP0 A;  1ZX9 A;  3FMW A;  1JRZ A;  5EOW A;  2C7G A;  3RHA A;  1YQZ A;  2VOU A;  1PDH A;  2R4E A;  2JB1 A;  3P1W A;  2C73 A;  3CNJ A;  4RG4 A;  2GQF A;  2FJD A;  3M0O A;  1DOD A;  2YR4 A;  4NWZ A;  4J34 A;  1GRH A;  1VQW A;  2BCG G;  4OCG A;  3SY4 A;  1N4U A;  2YLR A;  3I6D A;  3NN6 X;  1COY A;  3P4R A;  3UP5 A;  4IVO B;  4A7A A;  2V60 A;  2CFY A;  4B66 A;  4BJY A;  4C74 A;  3AE9 A;  2BRA A;  2EQ7 A;  4J56 A;  1KNP A;  1S3B A;  2CDU A;  1N1P A;  5FS8 A;  1BWC A;  1TYP A;  2R0P A;  4USR A;  1E7P A;  4U8K A;  1CC6 A;  2C76 A;  3NK2 X;  3C96 A;  2Q0L A;  1CC4 A;  1CC2 A;  2B9X A;  2PYX A;  1L9D A;  1Y56 B;  2NPX A;  3AEB A;  3AYI A;  3CMM A;  2OLO A;  2R4J A;  3GMB A;  2C3D A;  3KU9 A;  3NT6 A;  2XLR A;  4H2R A;  1VRQ B;  2WP5 A;  3P4Q A;  1KSU A;  4U2S A;  4GDP A;  4U8O A;  2GH5 A;  1QJD A;  2XYO A;  3GD4 A;  4Z2T A;  4XWZ A;  3QSS A;  3G5S A;  2NVK X;  2W0H A;  3LAD A;  5L46 A;  1NEN A;  1H84 A;  1PBB A;  3UKL A;  4NZH A;  2JKC A;  1GTE A;  1PHH A;  3K30 A;  5KMR A;  2VRM A;  4ZCD A;  5HY5 A;  2BRY A;  2X8C A;  2V5Z A;  1VDC A;  1DOC A;  2BXS A;  2QAE A;  1OJA A;  4U8I A;  3V3O A;  1NHR A;  5BVA A;  2C3C A;  3NTA A;  4OVI A;  3F8D A;  3KLJ A;  4BK2 A;  4DNA A;  3P4S A;  4K2X A;  5KNL A;  4OPT A;  2C64 A;  5EB4 A;  4FK1 C;  1M64 A;  4CRT A;  1FOH A;  1FEA A;  1L9C A;  3VRA A;  4H4Y A;  2BAB A;  3KD9 A;  4H2P A;  1GAL A;  1Z6L A;  4J57 A;  1E1K A;  3V3N A;  2ZZC A;  4YXD A;  2C75 A;  4AP1 A;  3FIM B;  3BI2 A;  2XLS A;  3NTD A;  3CGB A;  1H82 A;  1F6M A;  4TM4 A;  3ZDN A;  2R9Z A;  3NRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...