3UP4A

Crystal structure of otemo complex with fad and nadp (form 3)
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
540
structure length
528
Chain Sequence
b'KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 183
structure length 528
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3up4A01
3AB1A 3BNMA 3F8PA 4JY2A 1BGNA 3EF6A 3RP6A 3GYIA 4YSYA 1E1KA 3CIRA 1S3BA 3G5SA 1NDAA 3UKPA 4Z2UA 2XCGA 2JB1A 1KSUA 3C4AA 3QSMA 4MJWA 3RNMA 1CL0A 1FL2A 1NPXA 2Y6QA 1TYTA 4XWZA 4A99A 4H4SA 4JN9A 2GH5A 3CPJG 2V3BA 4RSLA 4I59A 2B9YA 1B37A 2FJAA 2WOWA 1GREA 3SGLA 4AT2A 3AD9B 4ECHA 2APGA 2Q0KA 2W0HA 2V60A 5JCNA 2R45A 3FG2P 3NG7X 1H81A 2GMJA 4J31A 2R0GA 2XFNA 2WP5A 2YM1A 1GETA 1L9DA 4K2XA 3R9UA 1AOGA 3DGHA 3K30A 3FMWA 1NENA 1DOBA 4YSZA 4KPRA 1GOSA 5M0ZA 2XLSA 2YR5A 3FPZA 2VVLG 1MXTA 3UTEA 1JNZA 2OLNA 4P9SA 4EIQA 1S3EA 4Z2RA 4U8LA 4OVIA 3GWFA 2VVLA 3CGEA 3GDPA 2WU2A 2YLRA 3P4PA 3IWAA 2DKIA 1TDNA 4H4YA 3GDNA 2H89A 3LZXA 4OCGA 4PABA 1MO9A 3UP4A 1Q9IA 2B9WA 4CY8A 1CBOA 1DOCA 2YVJA 4TM1A 4U8MA 4APNA 4ZN0A 2EQ8A 3M0OA 2WDRA 4H4WA 4OPTA 3WE0A 4RG3A 3AEFA 2YR6A 3P1WA 1FECA 1RYIA 4K7ZA 2XVHA 3NYCA 5L46A 4X9MA 4A9WA 5EB5A 1YKJA 2XLRA 2RGOA 2VZ2A 4M52A 2ARDA 3S61A 1E39A 3V3OA 1CC4A 4K22A 3RP7A 4CY6A 1EL9A 2OLOA 1UKVG 2WESA 1RSGA 1XPQA 2Q6UA 2WBAA 3AXBA 5CQFA 2BS3A 2BXSA 1GRTA 1GEUA 5KVHA 1PJ6A 1Y56B 4H4VA 2Q7VA 2F5ZA 4LA1A 3C96A 3OZ2A 2E1MA 4U8NA 4EQWA 5HHFA 2Y6RA 3ZDNA 1GXFA 1PDHA 2RGJA 1H82A 4YTMA 1BGJA 4IVOB 1YQ3A 4AOSA 2QA2A 3QVRA 5IPYA 3KPFA 1PS9A 1Y0PA 4GCMA 4Z25A 1L0VA 5BRTA 3ABVA 5EOWA 1GRAA 3UKHA 2I0ZA 1LVLA 3UP5A 2GMHA 1LV0A 1ZMDA 2VRMA 3P4QA 2TPRA 4EMJA 5DBJA 1CHUA 2BACA 4IVMB 4C3XA 1PBDA 2TMDA 3AWIA 2X8GA 2GRTA 3ITJA 3GMBA 4GF7A 1IUVA 5JCIA 4XXGA 3CNSA 3PVCA 1EBDA 1GRFA 3UTGA 4J34A 5FMHA 1GT8A 3UTFA 2E4GA 2J3NA 4NTDA 2JAEA 3CGBA 1E1NA 2C64A 4YSXA 4B63A 1CC2A 1VG0A 4DSGA 3ATRA 3H8IA 3Q9TA 1B5QA 4O5QA 2XFUA 3BNUA 2R9ZA 1PJ5A 2YM2A 4JY3A 1NG4A 1B8SA 2WPFA 1KDGA 1P2EA 2BK3A 2FJEA 2GAGB 4TLXA 1Q1RA 2YAUA 4YKFA 3P9UA 3C4NA 4AP3A 4C5OA 2BXRA 1IUSA 1E7PA 1TYPA 3LOVA 4KX6A 3EAOA 5FS9A 2JK6A 4A65A 4EIPA 4LU6A 4EMIA 4YTPA 1FEAA 4REKA 4DSHA 3V76A 1FEBA 2OA1A 2GF3A 4OPGA 2VRLA 1DJNA 1QJDA 4O5UA 2WPEA 3AE1A 3AYIA 1PXCA 2GR2A 3CPIG 4H4TA 1DNCA 4A6NB 2QCUA 3BI2A 3CNJA 1N4WA 5BVAA 3LXDA 2WOIA 4H4XA 1ZOVA 3ICRA 2JB2A 4ICYA 4OPCA 1E1LA 4H4UA 5TR3A 2PHHA 1D5TA 2GQWA 3D1CA 4CBQA 4EQXA 1JRZA 1P2HA 1YQZA 2WPCA 3EPTA 5FS7A 1KSSA 1VG9A 1ZP0A 3IC9A 5KOWA 2O9ZA 3AYLA 3ALJA 4K5RA 1PBCA 2C66A 2XLUA 1IUUA 1E1MA 4OPUA 3UKFA 4BURA 1D7LA 1NHSA 4ZCDA 1PBEA 2YWLA 4DGKA 2FBWA 4B65A 4D03A 2YVFA 3NK1X 1F8WA 4YWOA 2R0CA 4GUVA 3G5QA 1H83A 4H4RA 4J56A 2X8CA 2BS4A 4Y4NA 1BKWA 1ZMCA 2BC1A 1PBFA 1YY5A 3JSKA 5EBKA 3AE7A 4I58A 1DXLA 3NH3X 3QSSA 4NTEA 1S2YA 1JRYA 1O5WA 5FS8A 2VVMA 3ISHA 4A7AA 4X4JA 1N1PA 3BHKA 4X9NA 1B4VA 1D4DA 2B9XA 2Q0LA 5JCMA 3P4SA 5J7XA 4U2TA 4H7UA 1F8RA 2R4EA 4U8KA 5GRTA 5JCKA 3AE3A 1GPEA 3M13A 1PN0A 5IQ1A 1OJTA 5IQ4A 4AP1A 2IVDA 1JNRA 1EL5A 2XLTA 4Y4LA 1GSNA 4EM3A 4EM4A 3KD9A 3B6DA 4CNKA 4BV6A 3DJDA 5KRQA 3REDA 2YQUA 3NTDA 2E5VA 2Z5XA 5KOXA 2OALA 3VQRA 2GQFA 3FIMB 3HZLA 1LPFA 5HYMA 3IHMA 3SFEA 4A79A 3NYEA 1JU2A 3ALMA 2BC0A 5ER0A 2GVCA 2V3AA 4BJZA 2AQJA 1L9CA 4N9XA 3DA1A 4GRTA 2XYOA 3KKJA 5U63A 1GTHA 1JOAA 1K0LA 1ZX9A 4IA5A 1Y56A 4H4QA 1FCDA 2NVKX 1CC6A 3UOVA 2V61A 2YG4A 4LIIA 1O95A 2X99A 4B68A 1GTEA 1PJ7A 4OPDA 4YTNA 1H86A 2B7RA 4U8IA 1XANA 1V59A 2ZZCA 4C74A 1OJ9A 3CGCA 1SEZA 3P4RA 4HB9A 1DJQA 2DKHA 3I3LA 2RGHA 4U8JA 1BF3A 1TDKA 1KNRA 3DJJA 2VOUA 3EANA 4HA6A 1CJCA 3NLCA 1DOEA 3T37A 1TDEA 1O94A 3KU9A 1NHPA 3ICSA 2C76A 3NIXA 3S5WA 3SQPA 4B67A 4BK2A 1IJHA 2AAQA 3ALLA 1N4UA 2WEUA 1ZKQA 2WP6A 2PYXA 2XVIA 3QSEA 3CNTA 5HY5A 3NTAA 3IF9A 4H50A 2WDQA 2XFOA 2B7SA 1NAAA 1JEHA 5J60A 3AD8B 3QFAA 3L1RA 2A89A 3NRNA 3VRBA 4TM3A 1LQUA 2CFYA 4NEVA 2X50A 2GR1A 3DH9A 1D4CA 2WETA 2WHDA 3LZWA 1QO8A 1M6IA 4Y4MA 4H2PA 1K0IA 5KXJA 3O0HA 4K5SA 4BK1A 1ELIA 1ZY8A 1TRBA 2YLZA 2XVEA 1IUWA 4CCQA 1NHRA 4DNAA 4Z26A 3ATQA 4U8OA 4H4ZA 3GYJA 3NK2X 2GEWA 2C75A 4B66A 3UOZA 2BA9A 2WDVA 3CPHG 1DODA 3NK0X 4IV9A 2EQ9A 1CJ3A 4U8PA 1LTXR 4YSHA 4B1BA 1VQWA 4J33A 1D7YA 2V6OA 4USRA 2C70A 1XDIA 4YT0A 4C3YA 5LV9A 2V5ZA 3QJ4A 4EQSA 2X8HA 3GRSA 1ZDLA 1LQTA 4K8DA 1VDCA 2XFQA 1Q1WA 1F8SA 1OJDA 4WCTA 3KA7A 3VR9A 2Z5YA 2R46A 2GR0A 2HQMA 1W4XA 3LJPA 3NN0X 1EL7A 1NEKA 4OPLA 4PAAA 3AE2A 5KVIA 2WS3A 2C7GA 5FS6A 1REOA 2CULA 3FBSA 1CJ4A 3CNDA 2XVFA 3PO7A 2FJBA 1KF6A 4NTCA 4CCRA 4JQ9A 3AEEA 4YXDA 2BS2A 2JKCA 1PXAA 3GWDA 4H2RA 3GMCA 2QA1A 3DK9A 4AOXA 5M10A 4UDRA 2ZBWA 3BI5A 2IVEA 4NZHA 5KWFA 1OJAA 3VRAA 3NN6X 5C3JA 2XFPA 1GV4A 2X3NA 1K0JA 1IUXA 3DK4A 3IHGA 4NEWA 5BUKA 3G5RA 2ZZBA 4JNQA 2B76A 1ZOYA 2XVJA 4GDEA 4GDPA 4Z43A 1PXBA 1E6EA 5BULA 2JBVA 3AECA 3AE9A 4E0VA 3BI4A 2C67A 3UOYA 5U25A 3DJGX 3ADAB 1CF3A 3UOXA 5CKUA 4Z24A 2VQBA 1H84A 3RHAA 2R4JA 3GSIA 2GB0A 3NNEA 3H8LA 2YLWA 2YR4A 3OC4A 1L9EA 3NYFA 2YG7A 3NT6A 3KLJA 2YLXA 3K7TA 4TM0A 3UKKA 3H4KA 1BWCA 4JDRA 1NG3A 3AYJA 1JRXA 4TM4A 2ACZA 1GRHA 3AE4A 3NHOX 4Z2TA 2A8XA 1S2QA 1GRGA 1TDFA 2CVJA 1F3PA 3BHFA 3V3NA 2YLTA 1HYUA 2BCGG 3E1TA 2BK5A 1OJCA 2XLPA 1K4QA 1N4VA 4GR1A 2GV8A 4B69A 3CTYA 3AEBA 2YLSA 3QFBA 1CJ2A 4H2QA 1KFYA 4FK1C 2YG6A 4J57A 4D04A 2ZZ0A 4FK1A 4WX1A 3KVEA 4UP3A 1PBBA 4USQA 2JB3A 2WP9A 5GSNA 3CGDA 3F8RA 3GD3A 2BABA 2IIDA 3URHA 4CNJA 1VRQB 1XHCA 3VR8A 4EMWA 4FDCB 1BZLA 1EL8A 2EQ6A 2WU5A 4H4PA 4B64A 4YKGA 2EQ7A 3CNPA 2YG3A 5C2TA 2A87A 2BCPA 3K7MX 4AT0A 3UCLA 2OAMA 3DGZA 1GALA 4XWRA 1YQ4A 5JCLA 2H88A 4JNAA 1Z6LA 1H7XA 1PHHA 1M64A 2AR8A 3COXA 3SM8A 4Z44A 4BJYA 3L8KA 3PS9A 4U2SA 2WQYA 3II4A 5EB4A 2WOVA 3VRDB 3M12A 1MOKA 1FOHA 1COYA 2GAHB 3AEAA 3AE6A 3LADA 4OPIA 4BK3A 3DMEA 4A5LA 3QVPA 4C77A 2YVGA 3DK8A 3F8DA 2R0PA 1LJ1A 2C72A 3AEGA 2FJDA 4UDPA 3AEDA 1IUTA 4J36A 3GD4A 4TLZA 4ADWA 1GNDA 2CDUA 1F6MA 1ONFA 3UKAA 3I6DA 3RP8A 1QLBA 4U2LA 3SFDA 4EQRA 3UKQA 2VQ7A 1TDOA 1ZK7A 5U1OA 1H7WA 2XDOA 4J2WA 3B3RA 3NGCX 4A6NA 1NHQA 2UZZA 3Q6JA 1GRBA 2GR3A 1RP0A 2YG5A 4IA6A 1D4EA 3AE8A 3K7QX 2QAEA 1GESA 3D8XA 4H2NA 4UDQA 2C3CA 2C65A 1KNPA 1X31B 1GERA 3DJEA 2C73A 3AD7B 3UTHA 5HXIA 3GRTA 3ZYXA 1H6VA 2C3DA 3CN8A 4ZCCA 3LB8A 3UKLA 2BK4A 2NPXA 3ICTA 3NKSA 4CRTA 4RG4A 4FX9A 2BYBA 2RABA 3AE5A
chains in the Genus database with same CATH superfamily
3AB1A 3BNMA 3F8PA 4JY2A 1BGNA 3EF6A 3RP6A 3GYIA 4YSYA 1E1KA 3CIRA 1S3BA 3G5SA 1NDAA 3UKPA 4Z2UA 2XCGA 2JB1A 1KSUA 3C4AA 3QSMA 4MJWA 3RNMA 1CL0A 1FL2A 1NPXA 2Y6QA 1TYTA 4XWZA 4A99A 4H4SA 4JN9A 2GH5A 3CPJG 2V3BA 4RSLA 4I59A 2B9YA 1B37A 2FJAA 2WOWA 1GREA 3SGLA 4AT2A 3AD9B 4ECHA 2APGA 2Q0KA 2W0HA 2V60A 5JCNA 2R45A 3FG2P 3NG7X 1H81A 2GMJA 4J31A 2R0GA 2XFNA 2WP5A 2YM1A 1GETA 1L9DA 4K2XA 3R9UA 1AOGA 3DGHA 3K30A 3FMWA 1NENA 1DOBA 3T2KA 4KPRA 1GOSA 4YSZA 5M0ZA 2XLSA 2YR5A 3FPZA 2VVLG 1MXTA 3UTEA 1JNZA 2OLNA 4P9SA 4EIQA 1S3EA 4Z2RA 4U8LA 2C4CA 4OVIA 3GWFA 2VVLA 3CGEA 3GDPA 2WU2A 2YLRA 3P4PA 3IWAA 2DKIA 1TDNA 4H4YA 3GDNA 2H89A 3LZXA 4OCGA 4PABA 1MO9A 3UP4A 1Q9IA 2B9WA 4CY8A 1CBOA 1DOCA 2YVJA 4TM1A 4U8MA 4APNA 4ZN0A 2EQ8A 3M0OA 2WDRA 4H4WA 4OPTA 3WE0A 4RG3A 3AEFA 2YR6A 3P1WA 1FECA 1RYIA 4K7ZA 2XVHA 3NYCA 5L46A 4X9MA 4A9WA 5EB5A 1YKJA 2XLRA 3SXIA 2RGOA 2VZ2A 4M52A 2ARDA 3S61A 1E39A 3V3OA 1CC4A 4K22A 3RP7A 4CY6A 1EL9A 2OLOA 1UKVG 2WESA 1RSGA 1XPQA 2Q6UA 2WBAA 3AXBA 4G9KA 5CQFA 2BS3A 2BXSA 1GRTA 1GEUA 5KVHA 1PJ6A 1Y56B 3HYVA 2Q7VA 2F5ZA 4H4VA 3C96A 3OZ2A 2E1MA 4LA1A 4U8NA 4EQWA 5HHFA 2Y6RA 3ZDNA 1GXFA 1PDHA 2RGJA 1H82A 4YTMA 1BGJA 4IVOB 3SY4A 1YQ3A 4AOSA 2QA2A 3QVRA 5IPYA 3KPFA 1PS9A 1Y0PA 4GCMA 4Z25A 1L0VA 5BRTA 3ABVA 5EOWA 1GRAA 3UKHA 2I0ZA 1LVLA 3UP5A 2GMHA 1LV0A 1ZMDA 2VRMA 3P4QA 2TPRA 4EMJA 5DBJA 1CHUA 2BACA 4IVMB 4C3XA 1PBDA 2TMDA 3AWIA 2X8GA 2GRTA 3ITJA 3GMBA 4GF7A 1IUVA 5JCIA 4XXGA 3CNSA 3PVCA 1EBDA 1GRFA 3UTGA 4J34A 5FMHA 1GT8A 3UTFA 2E4GA 2J3NA 4NTDA 2JAEA 3CGBA 1E1NA 2C64A 4YSXA 4B63A 1CC2A 1VG0A 4DSGA 3ATRA 3H8IA 3Q9TA 1B5QA 4O5QA 3SZ0A 2XFUA 3BNUA 2R9ZA 1PJ5A 2YM2A 4JY3A 1NG4A 1B8SA 2WPFA 1KDGA 1P2EA 2BK3A 2FJEA 2GAGB 4TLXA 1Q1RA 2YAUA 4YKFA 3P9UA 3C4NA 4AP3A 4C5OA 2BXRA 1IUSA 1E7PA 1TYPA 3LOVA 4KX6A 3EAOA 5FS9A 2JK6A 4A65A 4EIPA 4LU6A 4EMIA 4YTPA 1FEAA 4REKA 4DSHA 3V76A 1FEBA 2OA1A 2GF3A 4OPGA 2VRLA 1DJNA 1QJDA 4O5UA 2WPEA 3AE1A 3AYIA 1PXCA 2GR2A 3CPIG 4H4TA 1DNCA 4A6NB 2QCUA 3BI2A 3CNJA 1N4WA 5BVAA 3LXDA 2WOIA 4H4XA 1ZOVA 3ICRA 2JB2A 4ICYA 4OPCA 1E1LA 4H4UA 5TR3A 2PHHA 1D5TA 2GQWA 3D1CA 4CBQA 4EQXA 1JRZA 1P2HA 1YQZA 2WPCA 3EPTA 5FS7A 1KSSA 1VG9A 1ZP0A 3IC9A 5KOWA 2O9ZA 3AYLA 3ALJA 4K5RA 1PBCA 2C66A 2XLUA 1IUUA 1E1MA 4OPUA 3UKFA 4BURA 1D7LA 1NHSA 4ZCDA 1PBEA 2YWLA 4DGKA 2FBWA 4B65A 4D03A 2YVFA 3NK1X 1F8WA 4YWOA 2R0CA 4GUVA 3G5QA 1H83A 4H4RA 4J56A 2X8CA 2BS4A 4Y4NA 1BKWA 1ZMCA 2BC1A 1PBFA 1YY5A 3JSKA 5EBKA 3AE7A 2BRYA 4I58A 1DXLA 3NH3X 3QSSA 4NTEA 1S2YA 1JRYA 1O5WA 5FS8A 2VVMA 3ISHA 4A7AA 4X4JA 1N1PA 3BHKA 4X9NA 1B4VA 1D4DA 2B9XA 2Q0LA 5JCMA 5KMRA 3P4SA 5KMPA 5J7XA 4U2TA 4H7UA 1F8RA 2R4EA 4U8KA 5GRTA 5JCKA 3SZWA 3AE3A 1GPEA 3M13A 1PN0A 5IQ1A 1OJTA 5IQ4A 4AP1A 2IVDA 1JNRA 1EL5A 2XLTA 4Y4LA 1GSNA 4EM3A 4EM4A 3KD9A 3B6DA 4CNKA 4BV6A 3DJDA 5KRQA 3T31A 3REDA 2YQUA 3NTDA 2E5VA 2Z5XA 5KOXA 2OALA 3VQRA 2GQFA 3FIMB 3HZLA 1LPFA 5HYMA 3IHMA 3SFEA 4A79A 3NYEA 1JU2A 3ALMA 2BC0A 5ER0A 2GVCA 2V3AA 4BJZA 2AQJA 1L9CA 4N9XA 3DA1A 3KPKA 4GRTA 2XYOA 3KKJA 5U63A 1GTHA 1JOAA 1K0LA 1ZX9A 4IA5A 1Y56A 4H4QA 1FCDA 2NVKX 1CC6A 3UOVA 2V61A 2YG4A 4LIIA 1O95A 2X99A 4B68A 1GTEA 1PJ7A 4OPDA 4YTNA 1H86A 2B7RA 4U8IA 1XANA 1V59A 2ZZCA 4C74A 1OJ9A 3CGCA 1SEZA 3P4RA 4HB9A 2BRAA 1DJQA 2DKHA 3I3LA 2RGHA 4U8JA 1BF3A 1TDKA 1KNRA 3DJJA 2VOUA 3EANA 4HA6A 1CJCA 3NLCA 1DOEA 5KMQA 3T37A 1TDEA 1O94A 3KU9A 1NHPA 3ICSA 2C76A 3NIXA 3S5WA 3SQPA 4B67A 4BK2A 1IJHA 2AAQA 3ALLA 1N4UA 2WEUA 1ZKQA 2WP6A 2PYXA 2XVIA 3QSEA 3CNTA 3SX6A 5HY5A 3NTAA 3IF9A 4H50A 2WDQA 2XFOA 2B7SA 1NAAA 1JEHA 5J60A 3AD8B 3SZFA 3QFAA 3L1RA 2A89A 3NRNA 3VRBA 4TM3A 1LQUA 2CFYA 4NEVA 2X50A 2GR1A 3DH9A 1D4CA 2WETA 2WHDA 3LZWA 1QO8A 1M6IA 4Y4MA 5KNLA 4H2PA 1K0IA 5KXJA 3O0HA 4K5SA 4BK1A 1ELIA 1ZY8A 1TRBA 2YLZA 2XVEA 1IUWA 4CCQA 1NHRA 4DNAA 4Z26A 3ATQA 4U8OA 4H4ZA 3GYJA 3NK2X 2GEWA 2C75A 4B66A 3UOZA 2BA9A 2WDVA 3CPHG 1DODA 3NK0X 4IV9A 2EQ9A 1CJ3A 4U8PA 1LTXR 4YSHA 4B1BA 1VQWA 4J33A 1D7YA 2V6OA 4USRA 2C70A 3T2ZA 1XDIA 3HYXA 4G74A 4YT0A 4C3YA 5LV9A 2V5ZA 3QJ4A 4EQSA 2X8HA 3GRSA 1ZDLA 1LQTA 4K8DA 1VDCA 2XFQA 1Q1WA 1F8SA 1OJDA 4WCTA 3KA7A 3VR9A 2Z5YA 2R46A 2GR0A 2HQMA 1W4XA 3LJPA 3NN0X 1EL7A 1NEKA 4OPLA 4PAAA 3AE2A 5KVIA 2WS3A 2C7GA 5FS6A 1REOA 3T0KA 2CULA 4G6HA 3FBSA 1CJ4A 3CNDA 2XVFA 3PO7A 2FJBA 1KF6A 4NTCA 3SYIA 4CCRA 4JQ9A 3AEEA 4YXDA 2BS2A 2JKCA 1PXAA 4G6GA 3GWDA 4H2RA 3GMCA 2QA1A 3DK9A 4AOXA 3SZCA 4UDRA 5M10A 2ZBWA 3BI5A 2IVEA 4NZHA 5KWFA 1OJAA 3VRAA 3NN6X 5C3JA 2XFPA 1GV4A 2X3NA 1K0JA 1IUXA 3DK4A 3IHGA 4NEWA 5BUKA 3G5RA 2ZZBA 4JNQA 2B76A 1ZOYA 2XVJA 4GDEA 4GDPA 4Z43A 1PXBA 1E6EA 5BULA 2JBVA 3AECA 3AE9A 4II3A 4E0VA 3BI4A 2C67A 3UOYA 5U25A 3DJGX 3ADAB 1CF3A 3UOXA 5CKUA 4Z24A 2VQBA 1H84A 3RHAA 3T14A 2R4JA 3GSIA 2GB0A 3NNEA 3H8LA 2YLWA 2YR4A 3OC4A 1L9EA 3NYFA 2YG7A 3NT6A 3KLJA 2YLXA 3K7TA 4TM0A 3UKKA 3H4KA 1BWCA 4JDRA 1NG3A 3AYJA 1JRXA 4TM4A 2ACZA 1GRHA 3AE4A 3NHOX 4Z2TA 2A8XA 1S2QA 1GRGA 1TDFA 2CVJA 1F3PA 3BHFA 4NWZA 3V3NA 2YLTA 1HYUA 2BCGG 3E1TA 2BK5A 1OJCA 2XLPA 1K4QA 1N4VA 4GR1A 2GV8A 3HYWA 4B69A 3CTYA 3AEBA 2YLSA 3QFBA 1CJ2A 4H2QA 1KFYA 4FK1C 2YG6A 4J57A 4D04A 2ZZ0A 4FK1A 4WX1A 3KVEA 4UP3A 1PBBA 4USQA 2JB3A 2WP9A 5GSNA 3CGDA 3F8RA 3GD3A 2BABA 2IIDA 3URHA 4CNJA 1VRQB 1XHCA 3VR8A 4EMWA 4FDCB 1BZLA 1EL8A 4GAPA 2EQ6A 2WU5A 4GAVA 4H4PA 4B64A 4YKGA 2EQ7A 3CNPA 2YG3A 5C2TA 2A87A 3GYXA 2BCPA 3K7MX 4AT0A 3UCLA 2OAMA 3DGZA 1GALA 4XWRA 1YQ4A 5JCLA 2H88A 4JNAA 1Z6LA 1H7XA 1PHHA 1M64A 2AR8A 3COXA 3SM8A 4Z44A 4BJYA 3L8KA 3CMMA 3PS9A 4U2SA 2WQYA 3II4A 5EB4A 5KMSA 2WOVA 3VRDB 3M12A 1MOKA 1FOHA 1COYA 2GAHB 3AEAA 3AE6A 3LADA 4OPIA 4BK3A 3DMEA 4A5LA 3QVPA 4C77A 2YVGA 3DK8A 3F8DA 2R0PA 1LJ1A 2C72A 3AEGA 2FJDA 4UDPA 3AEDA 1IUTA 4J36A 3GD4A 4TLZA 4ADWA 1GNDA 2CDUA 1F6MA 4G73A 1ONFA 3UKAA 3I6DA 3RP8A 1QLBA 4U2LA 3SFDA 4EQRA 3UKQA 2VQ7A 1TDOA 1ZK7A 5U1OA 1H7WA 2XDOA 4J2WA 3B3RA 3NGCX 4A6NA 1NHQA 2UZZA 3Q6JA 1GRBA 2GR3A 1RP0A 2YG5A 3T2YA 4IA6A 1D4EA 3AE8A 3K7QX 2QAEA 1GESA 3D8XA 4H2NA 4UDQA 2C3CA 2C65A 1KNPA 1X31B 1GERA 3DJEA 2C73A 3AD7B 3UTHA 5HXIA 3GRTA 3ZYXA 1H6VA 2C3DA 3CN8A 4ZCCA 3LB8A 3UKLA 4NNJA 2BK4A 2NPXA 3ICTA 3NKSA 4CRTA 4RG4A 4FX9A 2BYBA 4II2A 2RABA 3AE5A
chains in the Genus database with same CATH topology
3AB1A 3BNMA 3F8PA 4JY2A 1BGNA 3EF6A 3RP6A 3GYIA 4YSYA 1E1KA 3CIRA 1S3BA 3G5SA 1NDAA 3UKPA 4Z2UA 2XCGA 2JB1A 1KSUA 3C4AA 3QSMA 4MJWA 3RNMA 1CL0A 1FL2A 1NPXA 2Y6QA 1TYTA 4XWZA 4A99A 4H4SA 4JN9A 2GH5A 3CPJG 2V3BA 4RSLA 4I59A 2B9YA 1B37A 2FJAA 2WOWA 1GREA 3SGLA 4AT2A 3AD9B 4ECHA 2APGA 2Q0KA 2W0HA 2V60A 5JCNA 2R45A 3FG2P 3NG7X 1H81A 2GMJA 4J31A 2R0GA 2XFNA 2WP5A 2YM1A 1GETA 1L9DA 4K2XA 3R9UA 1AOGA 3DGHA 3K30A 3FMWA 1NENA 1DOBA 3T2KA 4KPRA 1GOSA 4YSZA 5M0ZA 2XLSA 2YR5A 3FPZA 2VVLG 1MXTA 3UTEA 1JNZA 2OLNA 4P9SA 4EIQA 1S3EA 4Z2RA 4U8LA 2C4CA 4OVIA 3GWFA 2VVLA 3CGEA 3GDPA 2WU2A 2YLRA 3P4PA 3IWAA 2DKIA 1TDNA 4H4YA 3GDNA 2H89A 3LZXA 4OCGA 4PABA 1MO9A 3UP4A 1Q9IA 2B9WA 4CY8A 1CBOA 1DOCA 2YVJA 4TM1A 4U8MA 4APNA 4ZN0A 2EQ8A 3M0OA 2WDRA 4H4WA 4OPTA 3WE0A 4RG3A 3AEFA 2YR6A 3P1WA 1FECA 1RYIA 4K7ZA 2XVHA 3NYCA 5L46A 4X9MA 4A9WA 5EB5A 1YKJA 2XLRA 3SXIA 2RGOA 2VZ2A 4M52A 2ARDA 3S61A 1E39A 3V3OA 1CC4A 4K22A 3RP7A 4CY6A 1EL9A 2OLOA 1UKVG 2WESA 1RSGA 1XPQA 2Q6UA 2WBAA 3AXBA 4G9KA 5CQFA 2BS3A 2BXSA 1GRTA 1GEUA 5KVHA 1PJ6A 1Y56B 3HYVA 2Q7VA 2F5ZA 4H4VA 3C96A 3OZ2A 2E1MA 4LA1A 4U8NA 4EQWA 5HHFA 2Y6RA 3ZDNA 1GXFA 1PDHA 2RGJA 1H82A 4YTMA 1BGJA 4IVOB 3SY4A 1YQ3A 4AOSA 2QA2A 3QVRA 5IPYA 3KPFA 1PS9A 1Y0PA 4GCMA 4Z25A 1L0VA 5BRTA 3ABVA 5EOWA 1GRAA 3UKHA 2I0ZA 1LVLA 3UP5A 2GMHA 1LV0A 1ZMDA 2VRMA 3P4QA 2TPRA 4EMJA 5DBJA 1CHUA 2BACA 4IVMB 4C3XA 1PBDA 2TMDA 3AWIA 2X8GA 2GRTA 3ITJA 3GMBA 4GF7A 1IUVA 5JCIA 4XXGA 3CNSA 3PVCA 1EBDA 1GRFA 3UTGA 4J34A 5FMHA 1GT8A 3UTFA 2E4GA 2J3NA 4NTDA 2JAEA 3CGBA 1E1NA 2C64A 4YSXA 4B63A 1CC2A 1VG0A 4DSGA 3ATRA 3H8IA 3Q9TA 1B5QA 4O5QA 3SZ0A 2XFUA 3BNUA 2R9ZA 1PJ5A 2YM2A 4JY3A 1NG4A 1B8SA 2WPFA 1KDGA 1P2EA 2BK3A 2FJEA 2GAGB 4TLXA 1Q1RA 2YAUA 4YKFA 3P9UA 3C4NA 4AP3A 4C5OA 2BXRA 1IUSA 1E7PA 1TYPA 3LOVA 4KX6A 3EAOA 5FS9A 2JK6A 4A65A 4EIPA 4LU6A 4EMIA 4YTPA 1FEAA 4REKA 4DSHA 3V76A 1FEBA 2OA1A 2GF3A 4OPGA 2VRLA 1DJNA 1QJDA 4O5UA 2WPEA 3AE1A 3AYIA 1PXCA 2GR2A 3CPIG 4H4TA 1DNCA 4A6NB 2QCUA 3BI2A 3CNJA 1N4WA 5BVAA 3LXDA 2WOIA 4H4XA 1ZOVA 3ICRA 2JB2A 4ICYA 4OPCA 1E1LA 4H4UA 5TR3A 2PHHA 1D5TA 2GQWA 3D1CA 4CBQA 4EQXA 1JRZA 1P2HA 1YQZA 2WPCA 3EPTA 5FS7A 1KSSA 1VG9A 1ZP0A 3IC9A 5KOWA 2O9ZA 3AYLA 3ALJA 4K5RA 1PBCA 2C66A 2XLUA 1IUUA 1E1MA 4OPUA 3UKFA 4BURA 1D7LA 1NHSA 4ZCDA 1PBEA 2YWLA 4DGKA 2FBWA 4B65A 4D03A 2YVFA 3NK1X 1F8WA 4YWOA 2R0CA 4GUVA 3G5QA 1H83A 4H4RA 4J56A 2X8CA 2BS4A 4Y4NA 1BKWA 1ZMCA 2BC1A 1PBFA 1YY5A 3JSKA 5EBKA 3AE7A 2BRYA 4I58A 1DXLA 3NH3X 3QSSA 4NTEA 1S2YA 1JRYA 1O5WA 5FS8A 2VVMA 3ISHA 4A7AA 4X4JA 1N1PA 3BHKA 4X9NA 1B4VA 1D4DA 2B9XA 2Q0LA 5JCMA 5KMRA 3P4SA 5KMPA 5J7XA 4U2TA 4H7UA 1F8RA 2R4EA 4U8KA 5GRTA 5JCKA 3SZWA 3AE3A 1GPEA 3M13A 1PN0A 5IQ1A 1OJTA 5IQ4A 4AP1A 2IVDA 1JNRA 1EL5A 2XLTA 4Y4LA 1GSNA 4EM3A 4EM4A 3KD9A 3B6DA 4CNKA 4BV6A 3DJDA 5KRQA 3T31A 3REDA 2YQUA 3NTDA 2E5VA 2Z5XA 5KOXA 2OALA 3VQRA 2GQFA 3FIMB 3HZLA 1LPFA 5HYMA 3IHMA 3SFEA 4A79A 3NYEA 1JU2A 3ALMA 2BC0A 5ER0A 2GVCA 2V3AA 4BJZA 2AQJA 1L9CA 4N9XA 3DA1A 3KPKA 4GRTA 2XYOA 3KKJA 5U63A 1GTHA 1JOAA 1K0LA 1ZX9A 4IA5A 1Y56A 4H4QA 1FCDA 2NVKX 1CC6A 3UOVA 2V61A 2YG4A 4LIIA 1O95A 2X99A 4B68A 1GTEA 1PJ7A 4OPDA 4YTNA 1H86A 2B7RA 4U8IA 1XANA 1V59A 2ZZCA 4C74A 1OJ9A 3CGCA 1SEZA 3P4RA 4HB9A 2BRAA 1DJQA 2DKHA 3I3LA 2RGHA 4U8JA 1BF3A 1TDKA 1KNRA 3DJJA 2VOUA 3EANA 4HA6A 1CJCA 3NLCA 1DOEA 5KMQA 3T37A 1TDEA 1O94A 3KU9A 1NHPA 3ICSA 2C76A 3NIXA 3S5WA 3SQPA 4B67A 4BK2A 1IJHA 2AAQA 3ALLA 1N4UA 2WEUA 1ZKQA 2WP6A 2PYXA 2XVIA 3QSEA 3CNTA 3SX6A 5HY5A 3NTAA 3IF9A 4H50A 2WDQA 2XFOA 2B7SA 1NAAA 1JEHA 5J60A 3AD8B 3SZFA 3QFAA 3L1RA 2A89A 3NRNA 3VRBA 4TM3A 1LQUA 2CFYA 4NEVA 2X50A 2GR1A 3DH9A 1D4CA 2WETA 2WHDA 3LZWA 1QO8A 1M6IA 4Y4MA 5KNLA 4H2PA 1K0IA 5KXJA 3O0HA 4K5SA 4BK1A 1ELIA 1ZY8A 1TRBA 2YLZA 2XVEA 1IUWA 4CCQA 1NHRA 4DNAA 4Z26A 3ATQA 4U8OA 4H4ZA 3GYJA 3NK2X 2GEWA 2C75A 4B66A 3UOZA 2BA9A 2WDVA 3CPHG 1DODA 3NK0X 4IV9A 2EQ9A 1CJ3A 4U8PA 1LTXR 4YSHA 4B1BA 1VQWA 4J33A 1D7YA 2V6OA 4USRA 2C70A 3T2ZA 1XDIA 3HYXA 4G74A 4YT0A 4C3YA 5LV9A 2V5ZA 3QJ4A 4EQSA 2X8HA 3GRSA 1ZDLA 1LQTA 4K8DA 1VDCA 2XFQA 1Q1WA 1F8SA 1OJDA 4WCTA 3KA7A 3VR9A 2Z5YA 2R46A 2GR0A 2HQMA 1W4XA 3LJPA 3NN0X 1EL7A 1NEKA 4OPLA 4PAAA 3AE2A 5KVIA 2WS3A 2C7GA 5FS6A 1REOA 3T0KA 2CULA 4G6HA 3FBSA 1CJ4A 3CNDA 2XVFA 3PO7A 2FJBA 1KF6A 4NTCA 3SYIA 4CCRA 4JQ9A 3AEEA 4YXDA 2BS2A 2JKCA 1PXAA 4G6GA 3GWDA 4H2RA 3GMCA 2QA1A 3DK9A 4AOXA 3SZCA 4UDRA 5M10A 2ZBWA 3BI5A 2IVEA 4NZHA 5KWFA 1OJAA 3VRAA 3NN6X 5C3JA 2XFPA 1GV4A 2X3NA 1K0JA 1IUXA 3DK4A 3IHGA 4NEWA 5BUKA 3G5RA 2ZZBA 4JNQA 2B76A 1ZOYA 2XVJA 4GDEA 4GDPA 4Z43A 1PXBA 1E6EA 5BULA 2JBVA 3AECA 3AE9A 4II3A 4E0VA 3BI4A 2C67A 3UOYA 5U25A 3DJGX 3ADAB 1CF3A 3UOXA 5CKUA 4Z24A 2VQBA 1H84A 3RHAA 3T14A 2R4JA 3GSIA 2GB0A 3NNEA 3H8LA 2YLWA 2YR4A 3OC4A 1L9EA 3NYFA 2YG7A 3NT6A 3KLJA 2YLXA 3K7TA 4TM0A 3UKKA 3H4KA 1BWCA 4JDRA 1NG3A 3AYJA 1JRXA 4TM4A 2ACZA 1GRHA 3AE4A 3NHOX 4Z2TA 2A8XA 1S2QA 1GRGA 1TDFA 2CVJA 1F3PA 3BHFA 4NWZA 3V3NA 2YLTA 1HYUA 2BCGG 3E1TA 2BK5A 1OJCA 2XLPA 1K4QA 1N4VA 4GR1A 2GV8A 3HYWA 4B69A 3CTYA 3AEBA 2YLSA 3QFBA 1CJ2A 4H2QA 1KFYA 4FK1C 2YG6A 4J57A 4D04A 2ZZ0A 4FK1A 4WX1A 3KVEA 4UP3A 1PBBA 4USQA 2JB3A 2WP9A 5GSNA 3CGDA 3F8RA 3GD3A 2BABA 2IIDA 3URHA 4CNJA 1VRQB 1XHCA 3VR8A 4EMWA 4FDCB 1BZLA 1EL8A 4GAPA 2EQ6A 2WU5A 4GAVA 4H4PA 4B64A 4YKGA 2EQ7A 3CNPA 2YG3A 5C2TA 2A87A 3GYXA 2BCPA 3K7MX 4AT0A 3UCLA 2OAMA 3DGZA 1GALA 4XWRA 1YQ4A 5JCLA 2H88A 4JNAA 1Z6LA 1H7XA 1PHHA 1M64A 2AR8A 3COXA 3SM8A 4Z44A 4BJYA 3L8KA 3CMMA 3PS9A 4U2SA 2WQYA 3II4A 5EB4A 5KMSA 2WOVA 3VRDB 3M12A 1MOKA 1FOHA 1COYA 2GAHB 3AEAA 3AE6A 3LADA 4OPIA 4BK3A 3DMEA 4A5LA 3QVPA 4C77A 2YVGA 3DK8A 3F8DA 2R0PA 1LJ1A 2C72A 3AEGA 2FJDA 4UDPA 3AEDA 1IUTA 4J36A 3GD4A 4TLZA 4ADWA 1GNDA 2CDUA 1F6MA 4G73A 1ONFA 3UKAA 3I6DA 3RP8A 1QLBA 4U2LA 3SFDA 4EQRA 3UKQA 2VQ7A 1TDOA 1ZK7A 5U1OA 1H7WA 2XDOA 4J2WA 3B3RA 3NGCX 4A6NA 1NHQA 2UZZA 3Q6JA 1GRBA 2GR3A 1RP0A 2YG5A 3T2YA 4IA6A 1D4EA 3AE8A 3K7QX 2QAEA 1GESA 3D8XA 4H2NA 4UDQA 2C3CA 2C65A 1KNPA 1X31B 1GERA 3DJEA 2C73A 3AD7B 3UTHA 5HXIA 3GRTA 3ZYXA 1H6VA 2C3DA 3CN8A 4ZCCA 3LB8A 3UKLA 4NNJA 2BK4A 2NPXA 3ICTA 3NKSA 4CRTA 4RG4A 4FX9A 2BYBA 4II2A 2RABA 3AE5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AB1 A;  3BNM A;  3F8P A;  4JY2 A;  1BGN A;  3EF6 A;  3RP6 A;  3GYI A;  4YSY A;  1E1K A;  3CIR A;  1S3B A;  3G5S A;  1NDA A;  3UKP A;  4Z2U A;  2XCG A;  2JB1 A;  1KSU A;  3C4A A;  3QSM A;  4MJW A;  3RNM A;  1CL0 A;  1FL2 A;  1NPX A;  2Y6Q A;  1TYT A;  4XWZ A;  4A99 A;  4H4S A;  4JN9 A;  2GH5 A;  3CPJ G;  2V3B A;  4RSL A;  4I59 A;  2B9Y A;  1B37 A;  2FJA A;  2WOW A;  1GRE A;  3SGL A;  4AT2 A;  3AD9 B;  4ECH A;  2APG A;  2Q0K A;  2W0H A;  2V60 A;  5JCN A;  2R45 A;  3FG2 P;  3NG7 X;  1H81 A;  2GMJ A;  4J31 A;  2R0G A;  2XFN A;  2WP5 A;  2YM1 A;  1GET A;  1L9D A;  4K2X A;  3R9U A;  1AOG A;  3DGH A;  3K30 A;  3FMW A;  1NEN A;  1DOB A;  4YSZ A;  4KPR A;  1GOS A;  5M0Z A;  2XLS A;  2YR5 A;  3FPZ A;  2VVL G;  1MXT A;  3UTE A;  1JNZ A;  2OLN A;  4P9S A;  4EIQ A;  1S3E A;  4Z2R A;  4U8L A;  4OVI A;  3GWF A;  2VVL A;  3CGE A;  3GDP A;  2WU2 A;  2YLR A;  3P4P A;  3IWA A;  2DKI A;  1TDN A;  4H4Y A;  3GDN A;  2H89 A;  3LZX A;  4OCG A;  4PAB A;  1MO9 A;  3UP4 A;  1Q9I A;  2B9W A;  4CY8 A;  1CBO A;  1DOC A;  2YVJ A;  4TM1 A;  4U8M A;  4APN A;  4ZN0 A;  2EQ8 A;  3M0O A;  2WDR A;  4H4W A;  4OPT A;  3WE0 A;  4RG3 A;  3AEF A;  2YR6 A;  3P1W A;  1FEC A;  1RYI A;  4K7Z A;  2XVH A;  3NYC A;  5L46 A;  4X9M A;  4A9W A;  5EB5 A;  1YKJ A;  2XLR A;  2RGO A;  2VZ2 A;  4M52 A;  2ARD A;  3S61 A;  1E39 A;  3V3O A;  1CC4 A;  4K22 A;  3RP7 A;  4CY6 A;  1EL9 A;  2OLO A;  1UKV G;  2WES A;  1RSG A;  1XPQ A;  2Q6U A;  2WBA A;  3AXB A;  5CQF A;  2BS3 A;  2BXS A;  1GRT A;  1GEU A;  5KVH A;  1PJ6 A;  1Y56 B;  4H4V A;  2Q7V A;  2F5Z A;  4LA1 A;  3C96 A;  3OZ2 A;  2E1M A;  4U8N A;  4EQW A;  5HHF A;  2Y6R A;  3ZDN A;  1GXF A;  1PDH A;  2RGJ A;  1H82 A;  4YTM A;  1BGJ A;  4IVO B;  1YQ3 A;  4AOS A;  2QA2 A;  3QVR A;  5IPY A;  3KPF A;  1PS9 A;  1Y0P A;  4GCM A;  4Z25 A;  1L0V A;  5BRT A;  3ABV A;  5EOW A;  1GRA A;  3UKH A;  2I0Z A;  1LVL A;  3UP5 A;  2GMH A;  1LV0 A;  1ZMD A;  2VRM A;  3P4Q A;  2TPR A;  4EMJ A;  5DBJ A;  1CHU A;  2BAC A;  4IVM B;  4C3X A;  1PBD A;  2TMD A;  3AWI A;  2X8G A;  2GRT A;  3ITJ A;  3GMB A;  4GF7 A;  1IUV A;  5JCI A;  4XXG A;  3CNS A;  3PVC A;  1EBD A;  1GRF A;  3UTG A;  4J34 A;  5FMH A;  1GT8 A;  3UTF A;  2E4G A;  2J3N A;  4NTD A;  2JAE A;  3CGB A;  1E1N A;  2C64 A;  4YSX A;  4B63 A;  1CC2 A;  1VG0 A;  4DSG A;  3ATR A;  3H8I A;  3Q9T A;  1B5Q A;  4O5Q A;  2XFU A;  3BNU A;  2R9Z A;  1PJ5 A;  2YM2 A;  4JY3 A;  1NG4 A;  1B8S A;  2WPF A;  1KDG A;  1P2E A;  2BK3 A;  2FJE A;  2GAG B;  4TLX A;  1Q1R A;  2YAU A;  4YKF A;  3P9U A;  3C4N A;  4AP3 A;  4C5O A;  2BXR A;  1IUS A;  1E7P A;  1TYP A;  3LOV A;  4KX6 A;  3EAO A;  5FS9 A;  2JK6 A;  4A65 A;  4EIP A;  4LU6 A;  4EMI A;  4YTP A;  1FEA A;  4REK A;  4DSH A;  3V76 A;  1FEB A;  2OA1 A;  2GF3 A;  4OPG A;  2VRL A;  1DJN A;  1QJD A;  4O5U A;  2WPE A;  3AE1 A;  3AYI A;  1PXC A;  2GR2 A;  3CPI G;  4H4T A;  1DNC A;  4A6N B;  2QCU A;  3BI2 A;  3CNJ A;  1N4W A;  5BVA A;  3LXD A;  2WOI A;  4H4X A;  1ZOV A;  3ICR A;  2JB2 A;  4ICY A;  4OPC A;  1E1L A;  4H4U A;  5TR3 A;  2PHH A;  1D5T A;  2GQW A;  3D1C A;  4CBQ A;  4EQX A;  1JRZ A;  1P2H A;  1YQZ A;  2WPC A;  3EPT A;  5FS7 A;  1KSS A;  1VG9 A;  1ZP0 A;  3IC9 A;  5KOW A;  2O9Z A;  3AYL A;  3ALJ A;  4K5R A;  1PBC A;  2C66 A;  2XLU A;  1IUU A;  1E1M A;  4OPU A;  3UKF A;  4BUR A;  1D7L A;  1NHS A;  4ZCD A;  1PBE A;  2YWL A;  4DGK A;  2FBW A;  4B65 A;  4D03 A;  2YVF A;  3NK1 X;  1F8W A;  4YWO A;  2R0C A;  4GUV A;  3G5Q A;  1H83 A;  4H4R A;  4J56 A;  2X8C A;  2BS4 A;  4Y4N A;  1BKW A;  1ZMC A;  2BC1 A;  1PBF A;  1YY5 A;  3JSK A;  5EBK A;  3AE7 A;  4I58 A;  1DXL A;  3NH3 X;  3QSS A;  4NTE A;  1S2Y A;  1JRY A;  1O5W A;  5FS8 A;  2VVM A;  3ISH A;  4A7A A;  4X4J A;  1N1P A;  3BHK A;  4X9N A;  1B4V A;  1D4D A;  2B9X A;  2Q0L A;  5JCM A;  3P4S A;  5J7X A;  4U2T A;  4H7U A;  1F8R A;  2R4E A;  4U8K A;  5GRT A;  5JCK A;  3AE3 A;  1GPE A;  3M13 A;  1PN0 A;  5IQ1 A;  1OJT A;  5IQ4 A;  4AP1 A;  2IVD A;  1JNR A;  1EL5 A;  2XLT A;  4Y4L A;  1GSN A;  4EM3 A;  4EM4 A;  3KD9 A;  3B6D A;  4CNK A;  4BV6 A;  3DJD A;  5KRQ A;  3RED A;  2YQU A;  3NTD A;  2E5V A;  2Z5X A;  5KOX A;  2OAL A;  3VQR A;  2GQF A;  3FIM B;  3HZL A;  1LPF A;  5HYM A;  3IHM A;  3SFE A;  4A79 A;  3NYE A;  1JU2 A;  3ALM A;  2BC0 A;  5ER0 A;  2GVC A;  2V3A A;  4BJZ A;  2AQJ A;  1L9C A;  4N9X A;  3DA1 A;  4GRT A;  2XYO A;  3KKJ A;  5U63 A;  1GTH A;  1JOA A;  1K0L A;  1ZX9 A;  4IA5 A;  1Y56 A;  4H4Q A;  1FCD A;  2NVK X;  1CC6 A;  3UOV A;  2V61 A;  2YG4 A;  4LII A;  1O95 A;  2X99 A;  4B68 A;  1GTE A;  1PJ7 A;  4OPD A;  4YTN A;  1H86 A;  2B7R A;  4U8I A;  1XAN A;  1V59 A;  2ZZC A;  4C74 A;  1OJ9 A;  3CGC A;  1SEZ A;  3P4R A;  4HB9 A;  1DJQ A;  2DKH A;  3I3L A;  2RGH A;  4U8J A;  1BF3 A;  1TDK A;  1KNR A;  3DJJ A;  2VOU A;  3EAN A;  4HA6 A;  1CJC A;  3NLC A;  1DOE A;  3T37 A;  1TDE A;  1O94 A;  3KU9 A;  1NHP A;  3ICS A;  2C76 A;  3NIX A;  3S5W A;  3SQP A;  4B67 A;  4BK2 A;  1IJH A;  2AAQ A;  3ALL A;  1N4U A;  2WEU A;  1ZKQ A;  2WP6 A;  2PYX A;  2XVI A;  3QSE A;  3CNT A;  5HY5 A;  3NTA A;  3IF9 A;  4H50 A;  2WDQ A;  2XFO A;  2B7S A;  1NAA A;  1JEH A;  5J60 A;  3AD8 B;  3QFA A;  3L1R A;  2A89 A;  3NRN A;  3VRB A;  4TM3 A;  1LQU A;  2CFY A;  4NEV A;  2X50 A;  2GR1 A;  3DH9 A;  1D4C A;  2WET A;  2WHD A;  3LZW A;  1QO8 A;  1M6I A;  4Y4M A;  4H2P A;  1K0I A;  5KXJ A;  3O0H A;  4K5S A;  4BK1 A;  1ELI A;  1ZY8 A;  1TRB A;  2YLZ A;  2XVE A;  1IUW A;  4CCQ A;  1NHR A;  4DNA A;  4Z26 A;  3ATQ A;  4U8O A;  4H4Z A;  3GYJ A;  3NK2 X;  2GEW A;  2C75 A;  4B66 A;  3UOZ A;  2BA9 A;  2WDV A;  3CPH G;  1DOD A;  3NK0 X;  4IV9 A;  2EQ9 A;  1CJ3 A;  4U8P A;  1LTX R;  4YSH A;  4B1B A;  1VQW A;  4J33 A;  1D7Y A;  2V6O A;  4USR A;  2C70 A;  1XDI A;  4YT0 A;  4C3Y A;  5LV9 A;  2V5Z A;  3QJ4 A;  4EQS A;  2X8H A;  3GRS A;  1ZDL A;  1LQT A;  4K8D A;  1VDC A;  2XFQ A;  1Q1W A;  1F8S A;  1OJD A;  4WCT A;  3KA7 A;  3VR9 A;  2Z5Y A;  2R46 A;  2GR0 A;  2HQM A;  1W4X A;  3LJP A;  3NN0 X;  1EL7 A;  1NEK A;  4OPL A;  4PAA A;  3AE2 A;  5KVI A;  2WS3 A;  2C7G A;  5FS6 A;  1REO A;  2CUL A;  3FBS A;  1CJ4 A;  3CND A;  2XVF A;  3PO7 A;  2FJB A;  1KF6 A;  4NTC A;  4CCR A;  4JQ9 A;  3AEE A;  4YXD A;  2BS2 A;  2JKC A;  1PXA A;  3GWD A;  4H2R A;  3GMC A;  2QA1 A;  3DK9 A;  4AOX A;  5M10 A;  4UDR A;  2ZBW A;  3BI5 A;  2IVE A;  4NZH A;  5KWF A;  1OJA A;  3VRA A;  3NN6 X;  5C3J A;  2XFP A;  1GV4 A;  2X3N A;  1K0J A;  1IUX A;  3DK4 A;  3IHG A;  4NEW A;  5BUK A;  3G5R A;  2ZZB A;  4JNQ A;  2B76 A;  1ZOY A;  2XVJ A;  4GDE A;  4GDP A;  4Z43 A;  1PXB A;  1E6E A;  5BUL A;  2JBV A;  3AEC A;  3AE9 A;  4E0V A;  3BI4 A;  2C67 A;  3UOY A;  5U25 A;  3DJG X;  3ADA B;  1CF3 A;  3UOX A;  5CKU A;  4Z24 A;  2VQB A;  1H84 A;  3RHA A;  2R4J A;  3GSI A;  2GB0 A;  3NNE A;  3H8L A;  2YLW A;  2YR4 A;  3OC4 A;  1L9E A;  3NYF A;  2YG7 A;  3NT6 A;  3KLJ A;  2YLX A;  3K7T A;  4TM0 A;  3UKK A;  3H4K A;  1BWC A;  4JDR A;  1NG3 A;  3AYJ A;  1JRX A;  4TM4 A;  2ACZ A;  1GRH A;  3AE4 A;  3NHO X;  4Z2T A;  2A8X A;  1S2Q A;  1GRG A;  1TDF A;  2CVJ A;  1F3P A;  3BHF A;  3V3N A;  2YLT A;  1HYU A;  2BCG G;  3E1T A;  2BK5 A;  1OJC A;  2XLP A;  1K4Q A;  1N4V A;  4GR1 A;  2GV8 A;  4B69 A;  3CTY A;  3AEB A;  2YLS A;  3QFB A;  1CJ2 A;  4H2Q A;  1KFY A;  4FK1 C;  2YG6 A;  4J57 A;  4D04 A;  2ZZ0 A;  4FK1 A;  4WX1 A;  3KVE A;  4UP3 A;  1PBB A;  4USQ A;  2JB3 A;  2WP9 A;  5GSN A;  3CGD A;  3F8R A;  3GD3 A;  2BAB A;  2IID A;  3URH A;  4CNJ A;  1VRQ B;  1XHC A;  3VR8 A;  4EMW A;  4FDC B;  1BZL A;  1EL8 A;  2EQ6 A;  2WU5 A;  4H4P A;  4B64 A;  4YKG A;  2EQ7 A;  3CNP A;  2YG3 A;  5C2T A;  2A87 A;  2BCP A;  3K7M X;  4AT0 A;  3UCL A;  2OAM A;  3DGZ A;  1GAL A;  4XWR A;  1YQ4 A;  5JCL A;  2H88 A;  4JNA A;  1Z6L A;  1H7X A;  1PHH A;  1M64 A;  2AR8 A;  3COX A;  3SM8 A;  4Z44 A;  4BJY A;  3L8K A;  3PS9 A;  4U2S A;  2WQY A;  3II4 A;  5EB4 A;  2WOV A;  3VRD B;  3M12 A;  1MOK A;  1FOH A;  1COY A;  2GAH B;  3AEA A;  3AE6 A;  3LAD A;  4OPI A;  4BK3 A;  3DME A;  4A5L A;  3QVP A;  4C77 A;  2YVG A;  3DK8 A;  3F8D A;  2R0P A;  1LJ1 A;  2C72 A;  3AEG A;  2FJD A;  4UDP A;  3AED A;  1IUT A;  4J36 A;  3GD4 A;  4TLZ A;  4ADW A;  1GND A;  2CDU A;  1F6M A;  1ONF A;  3UKA A;  3I6D A;  3RP8 A;  1QLB A;  4U2L A;  3SFD A;  4EQR A;  3UKQ A;  2VQ7 A;  1TDO A;  1ZK7 A;  5U1O A;  1H7W A;  2XDO A;  4J2W A;  3B3R A;  3NGC X;  4A6N A;  1NHQ A;  2UZZ A;  3Q6J A;  1GRB A;  2GR3 A;  1RP0 A;  2YG5 A;  4IA6 A;  1D4E A;  3AE8 A;  3K7Q X;  2QAE A;  1GES A;  3D8X A;  4H2N A;  4UDQ A;  2C3C A;  2C65 A;  1KNP A;  1X31 B;  1GER A;  3DJE A;  2C73 A;  3AD7 B;  3UTH A;  5HXI A;  3GRT A;  3ZYX A;  1H6V A;  2C3D A;  3CN8 A;  4ZCC A;  3LB8 A;  3UKL A;  2BK4 A;  2NPX A;  3ICT A;  3NKS A;  4CRT A;  4RG4 A;  4FX9 A;  2BYB A;  2RAB A;  3AE5 A; 
#chains in the Genus database with same CATH topology
 3AB1 A;  3BNM A;  3F8P A;  4JY2 A;  1BGN A;  3EF6 A;  3RP6 A;  3GYI A;  4YSY A;  1E1K A;  3CIR A;  1S3B A;  3G5S A;  1NDA A;  3UKP A;  4Z2U A;  2XCG A;  2JB1 A;  1KSU A;  3C4A A;  3QSM A;  4MJW A;  3RNM A;  1CL0 A;  1FL2 A;  1NPX A;  2Y6Q A;  1TYT A;  4XWZ A;  4A99 A;  4H4S A;  4JN9 A;  2GH5 A;  3CPJ G;  2V3B A;  4RSL A;  4I59 A;  2B9Y A;  1B37 A;  2FJA A;  2WOW A;  1GRE A;  3SGL A;  4AT2 A;  3AD9 B;  4ECH A;  2APG A;  2Q0K A;  2W0H A;  2V60 A;  5JCN A;  2R45 A;  3FG2 P;  3NG7 X;  1H81 A;  2GMJ A;  4J31 A;  2R0G A;  2XFN A;  2WP5 A;  2YM1 A;  1GET A;  1L9D A;  4K2X A;  3R9U A;  1AOG A;  3DGH A;  3K30 A;  3FMW A;  1NEN A;  1DOB A;  3T2K A;  4KPR A;  1GOS A;  4YSZ A;  5M0Z A;  2XLS A;  2YR5 A;  3FPZ A;  2VVL G;  1MXT A;  3UTE A;  1JNZ A;  2OLN A;  4P9S A;  4EIQ A;  1S3E A;  4Z2R A;  4U8L A;  2C4C A;  4OVI A;  3GWF A;  2VVL A;  3CGE A;  3GDP A;  2WU2 A;  2YLR A;  3P4P A;  3IWA A;  2DKI A;  1TDN A;  4H4Y A;  3GDN A;  2H89 A;  3LZX A;  4OCG A;  4PAB A;  1MO9 A;  3UP4 A;  1Q9I A;  2B9W A;  4CY8 A;  1CBO A;  1DOC A;  2YVJ A;  4TM1 A;  4U8M A;  4APN A;  4ZN0 A;  2EQ8 A;  3M0O A;  2WDR A;  4H4W A;  4OPT A;  3WE0 A;  4RG3 A;  3AEF A;  2YR6 A;  3P1W A;  1FEC A;  1RYI A;  4K7Z A;  2XVH A;  3NYC A;  5L46 A;  4X9M A;  4A9W A;  5EB5 A;  1YKJ A;  2XLR A;  3SXI A;  2RGO A;  2VZ2 A;  4M52 A;  2ARD A;  3S61 A;  1E39 A;  3V3O A;  1CC4 A;  4K22 A;  3RP7 A;  4CY6 A;  1EL9 A;  2OLO A;  1UKV G;  2WES A;  1RSG A;  1XPQ A;  2Q6U A;  2WBA A;  3AXB A;  4G9K A;  5CQF A;  2BS3 A;  2BXS A;  1GRT A;  1GEU A;  5KVH A;  1PJ6 A;  1Y56 B;  3HYV A;  2Q7V A;  2F5Z A;  4H4V A;  3C96 A;  3OZ2 A;  2E1M A;  4LA1 A;  4U8N A;  4EQW A;  5HHF A;  2Y6R A;  3ZDN A;  1GXF A;  1PDH A;  2RGJ A;  1H82 A;  4YTM A;  1BGJ A;  4IVO B;  3SY4 A;  1YQ3 A;  4AOS A;  2QA2 A;  3QVR A;  5IPY A;  3KPF A;  1PS9 A;  1Y0P A;  4GCM A;  4Z25 A;  1L0V A;  5BRT A;  3ABV A;  5EOW A;  1GRA A;  3UKH A;  2I0Z A;  1LVL A;  3UP5 A;  2GMH A;  1LV0 A;  1ZMD A;  2VRM A;  3P4Q A;  2TPR A;  4EMJ A;  5DBJ A;  1CHU A;  2BAC A;  4IVM B;  4C3X A;  1PBD A;  2TMD A;  3AWI A;  2X8G A;  2GRT A;  3ITJ A;  3GMB A;  4GF7 A;  1IUV A;  5JCI A;  4XXG A;  3CNS A;  3PVC A;  1EBD A;  1GRF A;  3UTG A;  4J34 A;  5FMH A;  1GT8 A;  3UTF A;  2E4G A;  2J3N A;  4NTD A;  2JAE A;  3CGB A;  1E1N A;  2C64 A;  4YSX A;  4B63 A;  1CC2 A;  1VG0 A;  4DSG A;  3ATR A;  3H8I A;  3Q9T A;  1B5Q A;  4O5Q A;  3SZ0 A;  2XFU A;  3BNU A;  2R9Z A;  1PJ5 A;  2YM2 A;  4JY3 A;  1NG4 A;  1B8S A;  2WPF A;  1KDG A;  1P2E A;  2BK3 A;  2FJE A;  2GAG B;  4TLX A;  1Q1R A;  2YAU A;  4YKF A;  3P9U A;  3C4N A;  4AP3 A;  4C5O A;  2BXR A;  1IUS A;  1E7P A;  1TYP A;  3LOV A;  4KX6 A;  3EAO A;  5FS9 A;  2JK6 A;  4A65 A;  4EIP A;  4LU6 A;  4EMI A;  4YTP A;  1FEA A;  4REK A;  4DSH A;  3V76 A;  1FEB A;  2OA1 A;  2GF3 A;  4OPG A;  2VRL A;  1DJN A;  1QJD A;  4O5U A;  2WPE A;  3AE1 A;  3AYI A;  1PXC A;  2GR2 A;  3CPI G;  4H4T A;  1DNC A;  4A6N B;  2QCU A;  3BI2 A;  3CNJ A;  1N4W A;  5BVA A;  3LXD A;  2WOI A;  4H4X A;  1ZOV A;  3ICR A;  2JB2 A;  4ICY A;  4OPC A;  1E1L A;  4H4U A;  5TR3 A;  2PHH A;  1D5T A;  2GQW A;  3D1C A;  4CBQ A;  4EQX A;  1JRZ A;  1P2H A;  1YQZ A;  2WPC A;  3EPT A;  5FS7 A;  1KSS A;  1VG9 A;  1ZP0 A;  3IC9 A;  5KOW A;  2O9Z A;  3AYL A;  3ALJ A;  4K5R A;  1PBC A;  2C66 A;  2XLU A;  1IUU A;  1E1M A;  4OPU A;  3UKF A;  4BUR A;  1D7L A;  1NHS A;  4ZCD A;  1PBE A;  2YWL A;  4DGK A;  2FBW A;  4B65 A;  4D03 A;  2YVF A;  3NK1 X;  1F8W A;  4YWO A;  2R0C A;  4GUV A;  3G5Q A;  1H83 A;  4H4R A;  4J56 A;  2X8C A;  2BS4 A;  4Y4N A;  1BKW A;  1ZMC A;  2BC1 A;  1PBF A;  1YY5 A;  3JSK A;  5EBK A;  3AE7 A;  2BRY A;  4I58 A;  1DXL A;  3NH3 X;  3QSS A;  4NTE A;  1S2Y A;  1JRY A;  1O5W A;  5FS8 A;  2VVM A;  3ISH A;  4A7A A;  4X4J A;  1N1P A;  3BHK A;  4X9N A;  1B4V A;  1D4D A;  2B9X A;  2Q0L A;  5JCM A;  5KMR A;  3P4S A;  5KMP A;  5J7X A;  4U2T A;  4H7U A;  1F8R A;  2R4E A;  4U8K A;  5GRT A;  5JCK A;  3SZW A;  3AE3 A;  1GPE A;  3M13 A;  1PN0 A;  5IQ1 A;  1OJT A;  5IQ4 A;  4AP1 A;  2IVD A;  1JNR A;  1EL5 A;  2XLT A;  4Y4L A;  1GSN A;  4EM3 A;  4EM4 A;  3KD9 A;  3B6D A;  4CNK A;  4BV6 A;  3DJD A;  5KRQ A;  3T31 A;  3RED A;  2YQU A;  3NTD A;  2E5V A;  2Z5X A;  5KOX A;  2OAL A;  3VQR A;  2GQF A;  3FIM B;  3HZL A;  1LPF A;  5HYM A;  3IHM A;  3SFE A;  4A79 A;  3NYE A;  1JU2 A;  3ALM A;  2BC0 A;  5ER0 A;  2GVC A;  2V3A A;  4BJZ A;  2AQJ A;  1L9C A;  4N9X A;  3DA1 A;  3KPK A;  4GRT A;  2XYO A;  3KKJ A;  5U63 A;  1GTH A;  1JOA A;  1K0L A;  1ZX9 A;  4IA5 A;  1Y56 A;  4H4Q A;  1FCD A;  2NVK X;  1CC6 A;  3UOV A;  2V61 A;  2YG4 A;  4LII A;  1O95 A;  2X99 A;  4B68 A;  1GTE A;  1PJ7 A;  4OPD A;  4YTN A;  1H86 A;  2B7R A;  4U8I A;  1XAN A;  1V59 A;  2ZZC A;  4C74 A;  1OJ9 A;  3CGC A;  1SEZ A;  3P4R A;  4HB9 A;  2BRA A;  1DJQ A;  2DKH A;  3I3L A;  2RGH A;  4U8J A;  1BF3 A;  1TDK A;  1KNR A;  3DJJ A;  2VOU A;  3EAN A;  4HA6 A;  1CJC A;  3NLC A;  1DOE A;  5KMQ A;  3T37 A;  1TDE A;  1O94 A;  3KU9 A;  1NHP A;  3ICS A;  2C76 A;  3NIX A;  3S5W A;  3SQP A;  4B67 A;  4BK2 A;  1IJH A;  2AAQ A;  3ALL A;  1N4U A;  2WEU A;  1ZKQ A;  2WP6 A;  2PYX A;  2XVI A;  3QSE A;  3CNT A;  3SX6 A;  5HY5 A;  3NTA A;  3IF9 A;  4H50 A;  2WDQ A;  2XFO A;  2B7S A;  1NAA A;  1JEH A;  5J60 A;  3AD8 B;  3SZF A;  3QFA A;  3L1R A;  2A89 A;  3NRN A;  3VRB A;  4TM3 A;  1LQU A;  2CFY A;  4NEV A;  2X50 A;  2GR1 A;  3DH9 A;  1D4C A;  2WET A;  2WHD A;  3LZW A;  1QO8 A;  1M6I A;  4Y4M A;  5KNL A;  4H2P A;  1K0I A;  5KXJ A;  3O0H A;  4K5S A;  4BK1 A;  1ELI A;  1ZY8 A;  1TRB A;  2YLZ A;  2XVE A;  1IUW A;  4CCQ A;  1NHR A;  4DNA A;  4Z26 A;  3ATQ A;  4U8O A;  4H4Z A;  3GYJ A;  3NK2 X;  2GEW A;  2C75 A;  4B66 A;  3UOZ A;  2BA9 A;  2WDV A;  3CPH G;  1DOD A;  3NK0 X;  4IV9 A;  2EQ9 A;  1CJ3 A;  4U8P A;  1LTX R;  4YSH A;  4B1B A;  1VQW A;  4J33 A;  1D7Y A;  2V6O A;  4USR A;  2C70 A;  3T2Z A;  1XDI A;  3HYX A;  4G74 A;  4YT0 A;  4C3Y A;  5LV9 A;  2V5Z A;  3QJ4 A;  4EQS A;  2X8H A;  3GRS A;  1ZDL A;  1LQT A;  4K8D A;  1VDC A;  2XFQ A;  1Q1W A;  1F8S A;  1OJD A;  4WCT A;  3KA7 A;  3VR9 A;  2Z5Y A;  2R46 A;  2GR0 A;  2HQM A;  1W4X A;  3LJP A;  3NN0 X;  1EL7 A;  1NEK A;  4OPL A;  4PAA A;  3AE2 A;  5KVI A;  2WS3 A;  2C7G A;  5FS6 A;  1REO A;  3T0K A;  2CUL A;  4G6H A;  3FBS A;  1CJ4 A;  3CND A;  2XVF A;  3PO7 A;  2FJB A;  1KF6 A;  4NTC A;  3SYI A;  4CCR A;  4JQ9 A;  3AEE A;  4YXD A;  2BS2 A;  2JKC A;  1PXA A;  4G6G A;  3GWD A;  4H2R A;  3GMC A;  2QA1 A;  3DK9 A;  4AOX A;  3SZC A;  4UDR A;  5M10 A;  2ZBW A;  3BI5 A;  2IVE A;  4NZH A;  5KWF A;  1OJA A;  3VRA A;  3NN6 X;  5C3J A;  2XFP A;  1GV4 A;  2X3N A;  1K0J A;  1IUX A;  3DK4 A;  3IHG A;  4NEW A;  5BUK A;  3G5R A;  2ZZB A;  4JNQ A;  2B76 A;  1ZOY A;  2XVJ A;  4GDE A;  4GDP A;  4Z43 A;  1PXB A;  1E6E A;  5BUL A;  2JBV A;  3AEC A;  3AE9 A;  4II3 A;  4E0V A;  3BI4 A;  2C67 A;  3UOY A;  5U25 A;  3DJG X;  3ADA B;  1CF3 A;  3UOX A;  5CKU A;  4Z24 A;  2VQB A;  1H84 A;  3RHA A;  3T14 A;  2R4J A;  3GSI A;  2GB0 A;  3NNE A;  3H8L A;  2YLW A;  2YR4 A;  3OC4 A;  1L9E A;  3NYF A;  2YG7 A;  3NT6 A;  3KLJ A;  2YLX A;  3K7T A;  4TM0 A;  3UKK A;  3H4K A;  1BWC A;  4JDR A;  1NG3 A;  3AYJ A;  1JRX A;  4TM4 A;  2ACZ A;  1GRH A;  3AE4 A;  3NHO X;  4Z2T A;  2A8X A;  1S2Q A;  1GRG A;  1TDF A;  2CVJ A;  1F3P A;  3BHF A;  4NWZ A;  3V3N A;  2YLT A;  1HYU A;  2BCG G;  3E1T A;  2BK5 A;  1OJC A;  2XLP A;  1K4Q A;  1N4V A;  4GR1 A;  2GV8 A;  3HYW A;  4B69 A;  3CTY A;  3AEB A;  2YLS A;  3QFB A;  1CJ2 A;  4H2Q A;  1KFY A;  4FK1 C;  2YG6 A;  4J57 A;  4D04 A;  2ZZ0 A;  4FK1 A;  4WX1 A;  3KVE A;  4UP3 A;  1PBB A;  4USQ A;  2JB3 A;  2WP9 A;  5GSN A;  3CGD A;  3F8R A;  3GD3 A;  2BAB A;  2IID A;  3URH A;  4CNJ A;  1VRQ B;  1XHC A;  3VR8 A;  4EMW A;  4FDC B;  1BZL A;  1EL8 A;  4GAP A;  2EQ6 A;  2WU5 A;  4GAV A;  4H4P A;  4B64 A;  4YKG A;  2EQ7 A;  3CNP A;  2YG3 A;  5C2T A;  2A87 A;  3GYX A;  2BCP A;  3K7M X;  4AT0 A;  3UCL A;  2OAM A;  3DGZ A;  1GAL A;  4XWR A;  1YQ4 A;  5JCL A;  2H88 A;  4JNA A;  1Z6L A;  1H7X A;  1PHH A;  1M64 A;  2AR8 A;  3COX A;  3SM8 A;  4Z44 A;  4BJY A;  3L8K A;  3CMM A;  3PS9 A;  4U2S A;  2WQY A;  3II4 A;  5EB4 A;  5KMS A;  2WOV A;  3VRD B;  3M12 A;  1MOK A;  1FOH A;  1COY A;  2GAH B;  3AEA A;  3AE6 A;  3LAD A;  4OPI A;  4BK3 A;  3DME A;  4A5L A;  3QVP A;  4C77 A;  2YVG A;  3DK8 A;  3F8D A;  2R0P A;  1LJ1 A;  2C72 A;  3AEG A;  2FJD A;  4UDP A;  3AED A;  1IUT A;  4J36 A;  3GD4 A;  4TLZ A;  4ADW A;  1GND A;  2CDU A;  1F6M A;  4G73 A;  1ONF A;  3UKA A;  3I6D A;  3RP8 A;  1QLB A;  4U2L A;  3SFD A;  4EQR A;  3UKQ A;  2VQ7 A;  1TDO A;  1ZK7 A;  5U1O A;  1H7W A;  2XDO A;  4J2W A;  3B3R A;  3NGC X;  4A6N A;  1NHQ A;  2UZZ A;  3Q6J A;  1GRB A;  2GR3 A;  1RP0 A;  2YG5 A;  3T2Y A;  4IA6 A;  1D4E A;  3AE8 A;  3K7Q X;  2QAE A;  1GES A;  3D8X A;  4H2N A;  4UDQ A;  2C3C A;  2C65 A;  1KNP A;  1X31 B;  1GER A;  3DJE A;  2C73 A;  3AD7 B;  3UTH A;  5HXI A;  3GRT A;  3ZYX A;  1H6V A;  2C3D A;  3CN8 A;  4ZCC A;  3LB8 A;  3UKL A;  4NNJ A;  2BK4 A;  2NPX A;  3ICT A;  3NKS A;  4CRT A;  4RG4 A;  4FX9 A;  2BYB A;  4II2 A;  2RAB A;  3AE5 A; 
#chains in the Genus database with same CATH homology
 3AB1 A;  3BNM A;  3F8P A;  4JY2 A;  1BGN A;  3EF6 A;  3RP6 A;  3GYI A;  4YSY A;  1E1K A;  3CIR A;  1S3B A;  3G5S A;  1NDA A;  3UKP A;  4Z2U A;  2XCG A;  2JB1 A;  1KSU A;  3C4A A;  3QSM A;  4MJW A;  3RNM A;  1CL0 A;  1FL2 A;  1NPX A;  2Y6Q A;  1TYT A;  4XWZ A;  4A99 A;  4H4S A;  4JN9 A;  2GH5 A;  3CPJ G;  2V3B A;  4RSL A;  4I59 A;  2B9Y A;  1B37 A;  2FJA A;  2WOW A;  1GRE A;  3SGL A;  4AT2 A;  3AD9 B;  4ECH A;  2APG A;  2Q0K A;  2W0H A;  2V60 A;  5JCN A;  2R45 A;  3FG2 P;  3NG7 X;  1H81 A;  2GMJ A;  4J31 A;  2R0G A;  2XFN A;  2WP5 A;  2YM1 A;  1GET A;  1L9D A;  4K2X A;  3R9U A;  1AOG A;  3DGH A;  3K30 A;  3FMW A;  1NEN A;  1DOB A;  3T2K A;  4KPR A;  1GOS A;  4YSZ A;  5M0Z A;  2XLS A;  2YR5 A;  3FPZ A;  2VVL G;  1MXT A;  3UTE A;  1JNZ A;  2OLN A;  4P9S A;  4EIQ A;  1S3E A;  4Z2R A;  4U8L A;  2C4C A;  4OVI A;  3GWF A;  2VVL A;  3CGE A;  3GDP A;  2WU2 A;  2YLR A;  3P4P A;  3IWA A;  2DKI A;  1TDN A;  4H4Y A;  3GDN A;  2H89 A;  3LZX A;  4OCG A;  4PAB A;  1MO9 A;  3UP4 A;  1Q9I A;  2B9W A;  4CY8 A;  1CBO A;  1DOC A;  2YVJ A;  4TM1 A;  4U8M A;  4APN A;  4ZN0 A;  2EQ8 A;  3M0O A;  2WDR A;  4H4W A;  4OPT A;  3WE0 A;  4RG3 A;  3AEF A;  2YR6 A;  3P1W A;  1FEC A;  1RYI A;  4K7Z A;  2XVH A;  3NYC A;  5L46 A;  4X9M A;  4A9W A;  5EB5 A;  1YKJ A;  2XLR A;  3SXI A;  2RGO A;  2VZ2 A;  4M52 A;  2ARD A;  3S61 A;  1E39 A;  3V3O A;  1CC4 A;  4K22 A;  3RP7 A;  4CY6 A;  1EL9 A;  2OLO A;  1UKV G;  2WES A;  1RSG A;  1XPQ A;  2Q6U A;  2WBA A;  3AXB A;  4G9K A;  5CQF A;  2BS3 A;  2BXS A;  1GRT A;  1GEU A;  5KVH A;  1PJ6 A;  1Y56 B;  3HYV A;  2Q7V A;  2F5Z A;  4H4V A;  3C96 A;  3OZ2 A;  2E1M A;  4LA1 A;  4U8N A;  4EQW A;  5HHF A;  2Y6R A;  3ZDN A;  1GXF A;  1PDH A;  2RGJ A;  1H82 A;  4YTM A;  1BGJ A;  4IVO B;  3SY4 A;  1YQ3 A;  4AOS A;  2QA2 A;  3QVR A;  5IPY A;  3KPF A;  1PS9 A;  1Y0P A;  4GCM A;  4Z25 A;  1L0V A;  5BRT A;  3ABV A;  5EOW A;  1GRA A;  3UKH A;  2I0Z A;  1LVL A;  3UP5 A;  2GMH A;  1LV0 A;  1ZMD A;  2VRM A;  3P4Q A;  2TPR A;  4EMJ A;  5DBJ A;  1CHU A;  2BAC A;  4IVM B;  4C3X A;  1PBD A;  2TMD A;  3AWI A;  2X8G A;  2GRT A;  3ITJ A;  3GMB A;  4GF7 A;  1IUV A;  5JCI A;  4XXG A;  3CNS A;  3PVC A;  1EBD A;  1GRF A;  3UTG A;  4J34 A;  5FMH A;  1GT8 A;  3UTF A;  2E4G A;  2J3N A;  4NTD A;  2JAE A;  3CGB A;  1E1N A;  2C64 A;  4YSX A;  4B63 A;  1CC2 A;  1VG0 A;  4DSG A;  3ATR A;  3H8I A;  3Q9T A;  1B5Q A;  4O5Q A;  3SZ0 A;  2XFU A;  3BNU A;  2R9Z A;  1PJ5 A;  2YM2 A;  4JY3 A;  1NG4 A;  1B8S A;  2WPF A;  1KDG A;  1P2E A;  2BK3 A;  2FJE A;  2GAG B;  4TLX A;  1Q1R A;  2YAU A;  4YKF A;  3P9U A;  3C4N A;  4AP3 A;  4C5O A;  2BXR A;  1IUS A;  1E7P A;  1TYP A;  3LOV A;  4KX6 A;  3EAO A;  5FS9 A;  2JK6 A;  4A65 A;  4EIP A;  4LU6 A;  4EMI A;  4YTP A;  1FEA A;  4REK A;  4DSH A;  3V76 A;  1FEB A;  2OA1 A;  2GF3 A;  4OPG A;  2VRL A;  1DJN A;  1QJD A;  4O5U A;  2WPE A;  3AE1 A;  3AYI A;  1PXC A;  2GR2 A;  3CPI G;  4H4T A;  1DNC A;  4A6N B;  2QCU A;  3BI2 A;  3CNJ A;  1N4W A;  5BVA A;  3LXD A;  2WOI A;  4H4X A;  1ZOV A;  3ICR A;  2JB2 A;  4ICY A;  4OPC A;  1E1L A;  4H4U A;  5TR3 A;  2PHH A;  1D5T A;  2GQW A;  3D1C A;  4CBQ A;  4EQX A;  1JRZ A;  1P2H A;  1YQZ A;  2WPC A;  3EPT A;  5FS7 A;  1KSS A;  1VG9 A;  1ZP0 A;  3IC9 A;  5KOW A;  2O9Z A;  3AYL A;  3ALJ A;  4K5R A;  1PBC A;  2C66 A;  2XLU A;  1IUU A;  1E1M A;  4OPU A;  3UKF A;  4BUR A;  1D7L A;  1NHS A;  4ZCD A;  1PBE A;  2YWL A;  4DGK A;  2FBW A;  4B65 A;  4D03 A;  2YVF A;  3NK1 X;  1F8W A;  4YWO A;  2R0C A;  4GUV A;  3G5Q A;  1H83 A;  4H4R A;  4J56 A;  2X8C A;  2BS4 A;  4Y4N A;  1BKW A;  1ZMC A;  2BC1 A;  1PBF A;  1YY5 A;  3JSK A;  5EBK A;  3AE7 A;  2BRY A;  4I58 A;  1DXL A;  3NH3 X;  3QSS A;  4NTE A;  1S2Y A;  1JRY A;  1O5W A;  5FS8 A;  2VVM A;  3ISH A;  4A7A A;  4X4J A;  1N1P A;  3BHK A;  4X9N A;  1B4V A;  1D4D A;  2B9X A;  2Q0L A;  5JCM A;  5KMR A;  3P4S A;  5KMP A;  5J7X A;  4U2T A;  4H7U A;  1F8R A;  2R4E A;  4U8K A;  5GRT A;  5JCK A;  3SZW A;  3AE3 A;  1GPE A;  3M13 A;  1PN0 A;  5IQ1 A;  1OJT A;  5IQ4 A;  4AP1 A;  2IVD A;  1JNR A;  1EL5 A;  2XLT A;  4Y4L A;  1GSN A;  4EM3 A;  4EM4 A;  3KD9 A;  3B6D A;  4CNK A;  4BV6 A;  3DJD A;  5KRQ A;  3T31 A;  3RED A;  2YQU A;  3NTD A;  2E5V A;  2Z5X A;  5KOX A;  2OAL A;  3VQR A;  2GQF A;  3FIM B;  3HZL A;  1LPF A;  5HYM A;  3IHM A;  3SFE A;  4A79 A;  3NYE A;  1JU2 A;  3ALM A;  2BC0 A;  5ER0 A;  2GVC A;  2V3A A;  4BJZ A;  2AQJ A;  1L9C A;  4N9X A;  3DA1 A;  3KPK A;  4GRT A;  2XYO A;  3KKJ A;  5U63 A;  1GTH A;  1JOA A;  1K0L A;  1ZX9 A;  4IA5 A;  1Y56 A;  4H4Q A;  1FCD A;  2NVK X;  1CC6 A;  3UOV A;  2V61 A;  2YG4 A;  4LII A;  1O95 A;  2X99 A;  4B68 A;  1GTE A;  1PJ7 A;  4OPD A;  4YTN A;  1H86 A;  2B7R A;  4U8I A;  1XAN A;  1V59 A;  2ZZC A;  4C74 A;  1OJ9 A;  3CGC A;  1SEZ A;  3P4R A;  4HB9 A;  2BRA A;  1DJQ A;  2DKH A;  3I3L A;  2RGH A;  4U8J A;  1BF3 A;  1TDK A;  1KNR A;  3DJJ A;  2VOU A;  3EAN A;  4HA6 A;  1CJC A;  3NLC A;  1DOE A;  5KMQ A;  3T37 A;  1TDE A;  1O94 A;  3KU9 A;  1NHP A;  3ICS A;  2C76 A;  3NIX A;  3S5W A;  3SQP A;  4B67 A;  4BK2 A;  1IJH A;  2AAQ A;  3ALL A;  1N4U A;  2WEU A;  1ZKQ A;  2WP6 A;  2PYX A;  2XVI A;  3QSE A;  3CNT A;  3SX6 A;  5HY5 A;  3NTA A;  3IF9 A;  4H50 A;  2WDQ A;  2XFO A;  2B7S A;  1NAA A;  1JEH A;  5J60 A;  3AD8 B;  3SZF A;  3QFA A;  3L1R A;  2A89 A;  3NRN A;  3VRB A;  4TM3 A;  1LQU A;  2CFY A;  4NEV A;  2X50 A;  2GR1 A;  3DH9 A;  1D4C A;  2WET A;  2WHD A;  3LZW A;  1QO8 A;  1M6I A;  4Y4M A;  5KNL A;  4H2P A;  1K0I A;  5KXJ A;  3O0H A;  4K5S A;  4BK1 A;  1ELI A;  1ZY8 A;  1TRB A;  2YLZ A;  2XVE A;  1IUW A;  4CCQ A;  1NHR A;  4DNA A;  4Z26 A;  3ATQ A;  4U8O A;  4H4Z A;  3GYJ A;  3NK2 X;  2GEW A;  2C75 A;  4B66 A;  3UOZ A;  2BA9 A;  2WDV A;  3CPH G;  1DOD A;  3NK0 X;  4IV9 A;  2EQ9 A;  1CJ3 A;  4U8P A;  1LTX R;  4YSH A;  4B1B A;  1VQW A;  4J33 A;  1D7Y A;  2V6O A;  4USR A;  2C70 A;  3T2Z A;  1XDI A;  3HYX A;  4G74 A;  4YT0 A;  4C3Y A;  5LV9 A;  2V5Z A;  3QJ4 A;  4EQS A;  2X8H A;  3GRS A;  1ZDL A;  1LQT A;  4K8D A;  1VDC A;  2XFQ A;  1Q1W A;  1F8S A;  1OJD A;  4WCT A;  3KA7 A;  3VR9 A;  2Z5Y A;  2R46 A;  2GR0 A;  2HQM A;  1W4X A;  3LJP A;  3NN0 X;  1EL7 A;  1NEK A;  4OPL A;  4PAA A;  3AE2 A;  5KVI A;  2WS3 A;  2C7G A;  5FS6 A;  1REO A;  3T0K A;  2CUL A;  4G6H A;  3FBS A;  1CJ4 A;  3CND A;  2XVF A;  3PO7 A;  2FJB A;  1KF6 A;  4NTC A;  3SYI A;  4CCR A;  4JQ9 A;  3AEE A;  4YXD A;  2BS2 A;  2JKC A;  1PXA A;  4G6G A;  3GWD A;  4H2R A;  3GMC A;  2QA1 A;  3DK9 A;  4AOX A;  3SZC A;  4UDR A;  5M10 A;  2ZBW A;  3BI5 A;  2IVE A;  4NZH A;  5KWF A;  1OJA A;  3VRA A;  3NN6 X;  5C3J A;  2XFP A;  1GV4 A;  2X3N A;  1K0J A;  1IUX A;  3DK4 A;  3IHG A;  4NEW A;  5BUK A;  3G5R A;  2ZZB A;  4JNQ A;  2B76 A;  1ZOY A;  2XVJ A;  4GDE A;  4GDP A;  4Z43 A;  1PXB A;  1E6E A;  5BUL A;  2JBV A;  3AEC A;  3AE9 A;  4II3 A;  4E0V A;  3BI4 A;  2C67 A;  3UOY A;  5U25 A;  3DJG X;  3ADA B;  1CF3 A;  3UOX A;  5CKU A;  4Z24 A;  2VQB A;  1H84 A;  3RHA A;  3T14 A;  2R4J A;  3GSI A;  2GB0 A;  3NNE A;  3H8L A;  2YLW A;  2YR4 A;  3OC4 A;  1L9E A;  3NYF A;  2YG7 A;  3NT6 A;  3KLJ A;  2YLX A;  3K7T A;  4TM0 A;  3UKK A;  3H4K A;  1BWC A;  4JDR A;  1NG3 A;  3AYJ A;  1JRX A;  4TM4 A;  2ACZ A;  1GRH A;  3AE4 A;  3NHO X;  4Z2T A;  2A8X A;  1S2Q A;  1GRG A;  1TDF A;  2CVJ A;  1F3P A;  3BHF A;  4NWZ A;  3V3N A;  2YLT A;  1HYU A;  2BCG G;  3E1T A;  2BK5 A;  1OJC A;  2XLP A;  1K4Q A;  1N4V A;  4GR1 A;  2GV8 A;  3HYW A;  4B69 A;  3CTY A;  3AEB A;  2YLS A;  3QFB A;  1CJ2 A;  4H2Q A;  1KFY A;  4FK1 C;  2YG6 A;  4J57 A;  4D04 A;  2ZZ0 A;  4FK1 A;  4WX1 A;  3KVE A;  4UP3 A;  1PBB A;  4USQ A;  2JB3 A;  2WP9 A;  5GSN A;  3CGD A;  3F8R A;  3GD3 A;  2BAB A;  2IID A;  3URH A;  4CNJ A;  1VRQ B;  1XHC A;  3VR8 A;  4EMW A;  4FDC B;  1BZL A;  1EL8 A;  4GAP A;  2EQ6 A;  2WU5 A;  4GAV A;  4H4P A;  4B64 A;  4YKG A;  2EQ7 A;  3CNP A;  2YG3 A;  5C2T A;  2A87 A;  3GYX A;  2BCP A;  3K7M X;  4AT0 A;  3UCL A;  2OAM A;  3DGZ A;  1GAL A;  4XWR A;  1YQ4 A;  5JCL A;  2H88 A;  4JNA A;  1Z6L A;  1H7X A;  1PHH A;  1M64 A;  2AR8 A;  3COX A;  3SM8 A;  4Z44 A;  4BJY A;  3L8K A;  3CMM A;  3PS9 A;  4U2S A;  2WQY A;  3II4 A;  5EB4 A;  5KMS A;  2WOV A;  3VRD B;  3M12 A;  1MOK A;  1FOH A;  1COY A;  2GAH B;  3AEA A;  3AE6 A;  3LAD A;  4OPI A;  4BK3 A;  3DME A;  4A5L A;  3QVP A;  4C77 A;  2YVG A;  3DK8 A;  3F8D A;  2R0P A;  1LJ1 A;  2C72 A;  3AEG A;  2FJD A;  4UDP A;  3AED A;  1IUT A;  4J36 A;  3GD4 A;  4TLZ A;  4ADW A;  1GND A;  2CDU A;  1F6M A;  4G73 A;  1ONF A;  3UKA A;  3I6D A;  3RP8 A;  1QLB A;  4U2L A;  3SFD A;  4EQR A;  3UKQ A;  2VQ7 A;  1TDO A;  1ZK7 A;  5U1O A;  1H7W A;  2XDO A;  4J2W A;  3B3R A;  3NGC X;  4A6N A;  1NHQ A;  2UZZ A;  3Q6J A;  1GRB A;  2GR3 A;  1RP0 A;  2YG5 A;  3T2Y A;  4IA6 A;  1D4E A;  3AE8 A;  3K7Q X;  2QAE A;  1GES A;  3D8X A;  4H2N A;  4UDQ A;  2C3C A;  2C65 A;  1KNP A;  1X31 B;  1GER A;  3DJE A;  2C73 A;  3AD7 B;  3UTH A;  5HXI A;  3GRT A;  3ZYX A;  1H6V A;  2C3D A;  3CN8 A;  4ZCC A;  3LB8 A;  3UKL A;  4NNJ A;  2BK4 A;  2NPX A;  3ICT A;  3NKS A;  4CRT A;  4RG4 A;  4FX9 A;  2BYB A;  4II2 A;  2RAB A;  3AE5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...