3UP4A

Crystal structure of otemo complex with fad and nadp (form 3)
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
540
structure length
528
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSASRMPDIKGIDSFKGESFHSSRWPTGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 183
structure length 528
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3up4A01
1PDHA 4I58A 1IJHA 1H6VA 4IVMB 5GRTA 1PN0A 4YTPA 5IQ4A 2QCUA 2WP9A 3LZXA 3P4PA 1CF3A 5U1OA 1EL5A 1TYPA 3CPHG 2V60A 1TDEA 2BXSA 4H4TA 3WE0A 5KVIA 4LIIA 2XLTA 3ZYXA 3ICTA 1UKVG 4H4XA 4A9WA 3VRAA 1KNPA 4TM3A 3KLJA 1NPXA 4OPTA 1Q9IA 1H81A 2Q6UA 3CNSA 3D8XA 2Z5XA 3DK4A 4P9SA 1N4UA 1B37A 4BK2A 4EMWA 2WHDA 3NTAA 2WOIA 4Y4MA 5EB4A 4Z25A 4K5SA 4A65A 5CQFA 1V59A 3ICRA 3BNUA 1TDOA 3NYFA 3REDA 4A99A 2YLXA 1D4DA 4IVOB 1IUUA 1JNRA 2FBWA 2VOUA 3UKQA 3ISHA 3DGHA 4B63A 1PJ7A 1H84A 5C2TA 4A6NB 3T37A 5KVHA 4H4ZA 3RNMA 3O0HA 1ZMCA 3B6DA 3K30A 3RP8A 3CGEA 4B65A 2R46A 2C7GA 1LQTA 2VQBA 5FS6A 2BCGG 2YG5A 1E1NA 2TPRA 2YQUA 1VQWA 4CY8A 1ZOVA 2YWLA 2Q0KA 2XVIA 5KXJA 3CNDA 4KPRA 1OJTA 4O5QA 4EIPA 4EQSA 4EM4A 4X4JA 2WP6A 1ELIA 2VVMA 2VRMA 1KNRA 2XFQA 3UKFA 1GRHA 2BS2A 3ABVA 4USRA 4U2SA 4APNA 4XWRA 3KKJA 3EPTA 2GB0A 3NHOX 3AE8A 1GTHA 1OJDA 2XFOA 4J36A 1GETA 4YSXA 2AR8A 2BK5A 2YLZA 4N9XA 2XVHA 4EQRA 2GAGB 3CNJA 1TDFA 4YSYA 1QJDA 2ZBWA 1M64A 2EQ9A 1VG0A 4CRTA 5IPYA 5L46A 3QSMA 1KF6A 1GERA 2V5ZA 2XVEA 2OA1A 1NEKA 2X3NA 5U63A 4B69A 4GR1A 1EL9A 1L9CA 3GDPA 4IA5A 4UDQA 2OLOA 4GF7A 3AEBA 2VVLA 3CGDA 4REKA 4M52A 4USQA 2WDVA 2GR0A 1JOAA 2CFYA 4ECHA 1D4EA 4JN9A 1ZK7A 1LV0A 1LPFA 1NHQA 1F8RA 2Y6QA 3DA1A 3ALMA 3VRDB 2GVCA 3NRNA 1RP0A 2C67A 2JB1A 4J57A 1PHHA 4GDEA 1F3PA 3NK1X 2JB2A 4B66A 4Z26A 3IF9A 2GR1A 4YKFA 2FJEA 3HZLA 3RHAA 2ZZBA 2GF3A 1RSGA 3AEDA 3VR8A 4JNAA 2CVJA 1GPEA 4H2QA 1B5QA 4OPIA 1DXLA 4JQ9A 4U8MA 4CY6A 4GUVA 5JCLA 3QVPA 2WETA 5HY5A 2WPFA 1GTEA 3NGCX 5EOWA 2WS3A 3LB8A 1CJ4A 2O9ZA 3G5RA 2YG7A 2WDRA 1GESA 4Z2RA 1OJAA 3KVEA 4U8JA 2GEWA 2PYXA 4JY3A 3ICSA 3UKLA 4NEWA 1BGJA 4OPGA 4AP1A 4EMIA 4E0VA 2H88A 1GALA 3AD8B 4Z2UA 3GDNA 2Y6RA 3CNTA 4K7ZA 1DJNA 2YVJA 3UP4A 3ALJA 1CC2A 2XLRA 2OAMA 2GMJA 3GWDA 2XFNA 2VRLA 4K22A 2NPXA 1IUSA 4O5UA 4UDRA 4WX1A 2XVJA 4GDPA 4YWOA 1BKWA 3UP5A 2BA9A 4Z24A 1COYA 3IC9A 3LOVA 1OJCA 3F8RA 3AE1A 3NK0X 4AOXA 2PHHA 2VZ2A 2WPCA 4LU6A 1MOKA 2WOWA 3AYLA 3KD9A 2EQ6A 1ZKQA 1GNDA 3E1TA 1IUVA 4AT0A 4B68A 1M6IA 2R45A 2XDOA 4A7AA 5KOXA 2VVLG 5JCIA 1CBOA 1MO9A 5JCNA 3PO7A 1NHSA 3ATQA 5IQ1A 1BGNA 5GSNA 1D4CA 1FEAA 1EL7A 4ADWA 4FK1C 3BI4A 1FCDA 1E39A 1XHCA 1JRZA 2QA1A 2JK6A 4CNKA 3GYIA 4BJZA 2V6OA 3RP6A 2YLRA 2GR3A 1FL2A 1GT8A 2C3DA 3H8LA 4OPCA 3UKPA 4CNJA 2C70A 3COXA 4NTDA 1QLBA 1H7WA 3AEGA 3CGBA 3AE6A 1PXCA 4BV6A 4B67A 3NKSA 5EBKA 1MXTA 3EAOA 3BI5A 3P4QA 3S5WA 1SEZA 4NTCA 1GREA 2GQFA 4BURA 1W4XA 2F5ZA 3AE5A 2BC0A 3SFEA 2ACZA 4H4VA 3NIXA 5M10A 2EQ7A 1NHPA 3AE4A 3NK2X 2UZZA 2ARDA 1F6MA 2C64A 2E4GA 2WDQA 4IA6A 2GAHB 2YR5A 4OPDA 1D5TA 4H4RA 3V3NA 3JSKA 1XDIA 4BK3A 2XFUA 4C5OA 4TM1A 2BS3A 4U2LA 1ZP0A 3K7MX 2C72A 2OALA 3OZ2A 4I59A 2XYOA 4Z2TA 2J3NA 4H2NA 1IUXA 5M0ZA 3P1WA 4OPLA 4DSHA 4YTNA 4C3YA 1Z6LA 4LA1A 4KX6A 3ATRA 4YXDA 1JNZA 2X8CA 4RG3A 1DODA 1F8SA 2BABA 4EMJA 3CGCA 1P2HA 1PBEA 1E1LA 1E6EA 2E1MA 1L9EA 4AT2A 2V3AA 2AQJA 1JRXA 1S3BA 2XLPA 1YY5A 2C3CA 1CL0A 2QAEA 4UDPA 3SQPA 4YSHA 1D7YA 4H4PA 4U8LA 4H4YA 2FJBA 3ADAB 1PXBA 3GSIA 4H4UA 1GSNA 3FG2P 3FMWA 4K8DA 2JB3A 3CTYA 3BHKA 3C4NA 4WCTA 4J31A 1BF3A 3UKHA 3UCLA 4ZN0A 3PS9A 1IUWA 2XLUA 3UKAA 3DMEA 3UTHA 3CN8A 2QA2A 2BCPA 3L8KA 1IUTA 2YVFA 5KOWA 4PAAA 3NYCA 2DKHA 4MJWA 1O5WA 2YR4A 1CJCA 4J34A 3QSEA 2YM1A 4B1BA 3AD7B 4D03A 1O94A 2BACA 4OCGA 4UP3A 3UOZA 5LV9A 1GV4A 3I6DA 4GCMA 4NEVA 2JBVA 2BK3A 1DOCA 3AECA 3M0OA 4J33A 3II4A 2X8HA 5BULA 5J7XA 1PBDA 2C76A 4BK1A 5BVAA 3GD4A 1KDGA 1KFYA 1PXAA 2WEUA 2A8XA 1BWCA 2NVKX 3ZDNA 2V61A 4U8NA 2A89A 2V3BA 4XWZA 3B3RA 2B7SA 4H50A 3VRBA 1X31B 3GRSA 3LZWA 4K2XA 4OVIA 5TR3A 1DOEA 4IV9A 5ER0A 1YQ3A 2E5VA 3DH9A 1NDAA 3BI2A 2GR2A 2RABA 2YLWA 2APGA 4AP3A 3BNMA 4A79A 1JRYA 3AD9B 3NG7X 4CBQA 2FJDA 3QSSA 4TM0A 2YVGA 1DOBA 2Q7VA 3Q9TA 2R0CA 2YLTA 2DKIA 5KWFA 2B9YA 3DK9A 1S3EA 2WQYA 3EANA 4D04A 1KSSA 1F8WA 2JKCA 3NTDA 5BRTA 3OC4A 2YM2A 2IIDA 4DSGA 1GRFA 2OLNA 3S61A 4EQXA 1GXFA 4Y4LA 2WU2A 3AE9A 3P4RA 4U8KA 3AE3A 3SGLA 4EQWA 1FECA 1S2QA 4RG4A 4DGKA 1VDCA 1N4VA 5EB5A 3CPJG 4CCQA 5HYMA 4XXGA 1NAAA 4OPUA 3AEAA 1LJ1A 1CC4A 5FS9A 1K4QA 4YKGA 2B9XA 1ONFA 2FJAA 2GRTA 5HHFA 1PS9A 3NYEA 1NENA 1ZY8A 3LXDA 1EL8A 4C3XA 3M12A 3R9UA 3AE7A 3NN0X 1N1PA 3UTFA 1P2EA 3UTEA 1D7LA 1VRQB 3K7QX 3H8IA 4Z44A 3VR9A 2B76A 3Q6JA 3GWFA 3SFDA 1S2YA 2GMHA 4H4WA 2H89A 4U8OA 3NLCA 4TLZA 4J56A 3QJ4A 2CDUA 4K5RA 3VQRA 2XFPA 4J2WA 1B8SA 1O95A 1GRGA 2B9WA 3KU9A 3EF6A 4EIQA 4A5LA 3FIMB 4NTEA 3IWAA 1VG9A 1NG4A 3AYIA 3CPIG 1K0LA 3P9UA 3UKKA 3D1CA 1TDKA 1REOA 1N4WA 3GMCA 1GRBA 3RP7A 3UTGA 4X9NA 1PBCA 2WESA 3IHMA 2WU5A 4PABA 4TM4A 2Z5YA 2WBAA 4HA6A 1H7XA 2YG3A 1ZDLA 5FS7A 3PVCA 1E1KA 3AEFA 3M13A 5FS8A 3DJJA 5U25A 1XANA 1Y56B 1FEBA 1JEHA 3ALLA 1GRTA 2BS4A 3C96A 1PJ6A 1H83A 2IVEA 2WOVA 2HQMA 2X99A 2XCGA 3L1RA 4H2RA 2BYBA 2EQ8A 4H7UA 3I3LA 4JDRA 4H4SA 3F8DA 2Q0LA 4RSLA 4X9MA 3NN6X 1B4VA 3NT6A 4ICYA 1CC6A 5KRQA 2JAEA 1H82A 3ITJA 1YQ4A 4ZCCA 4HB9A 3URHA 4U8PA 4U8IA 1E1MA 3UOXA 1Q1WA 1PBFA 2YG4A 3DJEA 2RGJA 2W0HA 1K0JA 3K7TA 1AOGA 1H86A 4AOSA 3CIRA 3F8PA 2C65A 3UOVA 1PBBA 2YAUA 1NHRA 3NNEA 4FK1A 4FDCB 3FPZA 3GMBA 2BK4A 3AE2A 1L0VA 4B64A 2ZZCA 4C74A 4GRTA 4YSZA 3P4SA 1YKJA 2IVDA 5HXIA 1PJ5A 1LTXR 1TRBA 2A87A 2C73A 5BUKA 3IHGA 3KA7A 5C3JA 1CJ3A 2AAQA 2I0ZA 5JCMA 1EBDA 1DNCA 4FX9A 3DGZA 3DJGX 4YT0A 2X8GA 2YLSA 4A6NA 1L9DA 1E7PA 3CNPA 1JU2A 2ZZ0A 4TLXA 4H2PA 2GQWA 2BC1A 1ZOYA 1Y56A 1GEUA 1LQUA 1HYUA 2RGOA 3AEEA 5J60A 4JY2A 3QFAA 2BXRA 3NH3X 2WP5A 5FMHA 1QO8A 1Y0PA 4ZCDA 3AB1A 3DJDA 4Z43A 1GOSA 3SM8A 2YR6A 1FOHA 5JCKA 4C77A 3BHFA 5CKUA 2R4EA 3KPFA 2XVFA 2R9ZA 3QVRA 1ZX9A 2GH5A 5DBJA 1NG3A 3LADA 3V3OA 1CHUA 2VQ7A 2CULA 4CCRA 4DNAA 2XLSA 1K0IA 1RYIA 1GRAA 4H4QA 1TYTA 2X50A 2R0PA 2YG6A 3AYJA 4YTMA 3UOYA 3FBSA 1BZLA 3H4KA 4BJYA 1Q1RA 3V76A 2R0GA 2TMDA 4NZHA 1OJ9A 3LJPA 1CJ2A 2C66A 2B7RA 2C75A 2R4JA 1XPQA 3GYJA 1KSUA 3DK8A 4U2TA 1TDNA 3GRTA 3G5SA 2RGHA 3C4AA 4EM3A 4JNQA 4Y4NA 2GV8A 1DJQA 1YQZA 1ZMDA 1LVLA 3AXBA 3QFBA 3AWIA 3G5QA 2WPEA 3GD3A
chains in the Genus database with same CATH superfamily
1PDHA 4I58A 1IJHA 1H6VA 4IVMB 5GRTA 1PN0A 4YTPA 5IQ4A 2QCUA 2WP9A 3LZXA 3P4PA 1CF3A 5U1OA 1EL5A 1TYPA 3CPHG 2V60A 1TDEA 2BXSA 4H4TA 3WE0A 5KVIA 4LIIA 2XLTA 3ZYXA 3ICTA 1UKVG 4H4XA 4A9WA 3VRAA 1KNPA 4TM3A 3KLJA 1NPXA 4OPTA 1Q9IA 1H81A 2Q6UA 3CNSA 3D8XA 2Z5XA 3DK4A 4P9SA 1N4UA 1B37A 4BK2A 4EMWA 2WHDA 3NTAA 2WOIA 4Y4MA 5EB4A 4Z25A 4K5SA 4A65A 5CQFA 1V59A 3ICRA 3BNUA 1TDOA 3NYFA 3REDA 4A99A 2YLXA 1D4DA 4IVOB 1IUUA 1JNRA 2FBWA 2VOUA 3UKQA 3ISHA 3DGHA 4B63A 1PJ7A 1H84A 5C2TA 4A6NB 3T37A 5KVHA 4H4ZA 3CMMA 3O0HA 3RNMA 1ZMCA 3B6DA 3K30A 3RP8A 3CGEA 4B65A 2R46A 2C7GA 1LQTA 2VQBA 5FS6A 2BCGG 2YG5A 1E1NA 5KMPA 2TPRA 2YQUA 1VQWA 4CY8A 1ZOVA 2YWLA 2Q0KA 2XVIA 5KXJA 3CNDA 4KPRA 1OJTA 4O5QA 4EIPA 4EQSA 4EM4A 4X4JA 2WP6A 1ELIA 2VVMA 2VRMA 1KNRA 2XFQA 3UKFA 1GRHA 2BS2A 3ABVA 4USRA 4U2SA 4APNA 4XWRA 3KKJA 3EPTA 2GB0A 3NHOX 3AE8A 1GTHA 1OJDA 2XFOA 4J36A 1GETA 4YSXA 2AR8A 2BK5A 2YLZA 4N9XA 2XVHA 4EQRA 2GAGB 3CNJA 1TDFA 4YSYA 1QJDA 2ZBWA 1M64A 2EQ9A 1VG0A 4CRTA 5IPYA 3SZFA 5L46A 3QSMA 1KF6A 1GERA 2V5ZA 2XVEA 2OA1A 1NEKA 2X3NA 5U63A 4B69A 4GR1A 1EL9A 1L9CA 3GDPA 4IA5A 4UDQA 2OLOA 4GF7A 3AEBA 2VVLA 3CGDA 4REKA 4M52A 4USQA 2WDVA 2GR0A 1JOAA 2CFYA 4ECHA 1D4EA 4JN9A 3T2ZA 1ZK7A 1LV0A 1LPFA 1NHQA 1F8RA 2Y6QA 3DA1A 3ALMA 3VRDB 2GVCA 3NRNA 1RP0A 2C67A 2JB1A 4J57A 1PHHA 4GDEA 1F3PA 3NK1X 2JB2A 4B66A 4Z26A 3IF9A 2GR1A 4YKFA 2FJEA 3HZLA 3RHAA 2ZZBA 2GF3A 1RSGA 3AEDA 3VR8A 4JNAA 2CVJA 3T14A 1GPEA 4H2QA 1B5QA 4OPIA 1DXLA 4JQ9A 4U8MA 4CY6A 4GUVA 5JCLA 3QVPA 2WETA 5HY5A 2WPFA 1GTEA 3NGCX 5EOWA 2WS3A 3LB8A 1CJ4A 2O9ZA 2BRAA 3G5RA 2YG7A 2WDRA 1GESA 4Z2RA 1OJAA 3KVEA 4U8JA 2GEWA 2PYXA 3GYXA 4JY3A 3SY4A 3ICSA 3UKLA 4NEWA 1BGJA 4OPGA 4AP1A 4EMIA 4E0VA 2H88A 1GALA 3AD8B 4Z2UA 3GDNA 2Y6RA 3CNTA 4K7ZA 5KMSA 1DJNA 2YVJA 3UP4A 3ALJA 1CC2A 2XLRA 5KMRA 2OAMA 2GMJA 3GWDA 2C4CA 2VRLA 2XFNA 3HYVA 4K22A 2NPXA 4GAPA 1IUSA 4O5UA 4UDRA 4WX1A 2XVJA 4GDPA 4YWOA 1BKWA 3UP5A 2BA9A 4Z24A 1COYA 3IC9A 3LOVA 1OJCA 3F8RA 3AE1A 3NK0X 4GAVA 4AOXA 2PHHA 2VZ2A 2WPCA 4LU6A 1MOKA 2WOWA 3AYLA 3KD9A 2EQ6A 1ZKQA 1GNDA 3E1TA 1IUVA 4AT0A 3HYXA 4B68A 4G73A 1M6IA 2R45A 2XDOA 4A7AA 5KOXA 2VVLG 5JCIA 1CBOA 1MO9A 5JCNA 3PO7A 1NHSA 3ATQA 5IQ1A 1BGNA 5GSNA 1D4CA 1FEAA 1EL7A 4ADWA 4FK1C 3BI4A 1FCDA 1E39A 1XHCA 1JRZA 2QA1A 2JK6A 4CNKA 3GYIA 4BJZA 2V6OA 3RP6A 2YLRA 2GR3A 1FL2A 1GT8A 2C3DA 3H8LA 4OPCA 3UKPA 4CNJA 2C70A 3COXA 4NTDA 1QLBA 1H7WA 3AEGA 3CGBA 3AE6A 1PXCA 4BV6A 4B67A 3NKSA 5EBKA 1MXTA 3EAOA 3BI5A 3P4QA 3S5WA 1SEZA 4NTCA 1GREA 2GQFA 4BURA 1W4XA 2F5ZA 3AE5A 2BC0A 3SFEA 2ACZA 4H4VA 3NIXA 5KMQA 5M10A 2EQ7A 1NHPA 3AE4A 3SYIA 3NK2X 2UZZA 2ARDA 1F6MA 2C64A 2E4GA 2WDQA 4IA6A 2GAHB 2YR5A 4OPDA 1D5TA 4H4RA 3V3NA 3JSKA 1XDIA 4BK3A 2XFUA 4C5OA 4TM1A 2BS3A 4U2LA 1ZP0A 3K7MX 2C72A 2OALA 3OZ2A 4I59A 2XYOA 4Z2TA 2J3NA 4H2NA 1IUXA 5M0ZA 3P1WA 4OPLA 4DSHA 4YTNA 4C3YA 1Z6LA 4LA1A 4KX6A 3ATRA 4YXDA 1JNZA 2X8CA 4RG3A 1DODA 1F8SA 2BABA 4EMJA 3CGCA 1P2HA 1PBEA 1E1LA 1E6EA 2E1MA 1L9EA 4AT2A 2V3AA 2AQJA 1JRXA 1S3BA 2XLPA 1YY5A 2C3CA 1CL0A 2QAEA 4UDPA 3SQPA 4YSHA 1D7YA 4H4PA 4U8LA 4H4YA 2FJBA 3ADAB 1PXBA 3GSIA 4H4UA 1GSNA 3FG2P 3FMWA 4K8DA 2JB3A 3CTYA 3BHKA 3C4NA 4WCTA 4J31A 1BF3A 3UKHA 3UCLA 4ZN0A 3PS9A 1IUWA 2XLUA 3UKAA 3SX6A 3DMEA 3UTHA 3CN8A 2QA2A 2BCPA 3L8KA 1IUTA 2YVFA 5KOWA 4PAAA 3NYCA 2DKHA 4MJWA 1O5WA 2YR4A 1CJCA 4J34A 3QSEA 2YM1A 4B1BA 3AD7B 4D03A 1O94A 2BACA 4OCGA 4UP3A 3KPKA 3UOZA 5LV9A 1GV4A 3I6DA 4GCMA 4NEVA 2JBVA 2BK3A 1DOCA 3AECA 3M0OA 4J33A 3II4A 2X8HA 5BULA 5J7XA 1PBDA 2C76A 4BK1A 5BVAA 3GD4A 1KDGA 1KFYA 1PXAA 2WEUA 2A8XA 1BWCA 2NVKX 3ZDNA 2V61A 4U8NA 2A89A 2V3BA 4XWZA 3B3RA 2B7SA 4H50A 3VRBA 1X31B 3GRSA 3LZWA 4K2XA 4OVIA 5TR3A 1DOEA 4IV9A 5ER0A 1YQ3A 2E5VA 2BRYA 3DH9A 1NDAA 3BI2A 2GR2A 2RABA 2YLWA 2APGA 4AP3A 3BNMA 3SZ0A 1JRYA 4A79A 3AD9B 3NG7X 4CBQA 2FJDA 3QSSA 4TM0A 2YVGA 1DOBA 2Q7VA 3Q9TA 2R0CA 4NWZA 5KNLA 2YLTA 2DKIA 5KWFA 2B9YA 3DK9A 1S3EA 2WQYA 3EANA 4D04A 1KSSA 1F8WA 2JKCA 3NTDA 5BRTA 3OC4A 2YM2A 2IIDA 4DSGA 1GRFA 2OLNA 4G6HA 3S61A 3T2KA 4EQXA 1GXFA 4Y4LA 2WU2A 3AE9A 3P4RA 4U8KA 3AE3A 3SGLA 4EQWA 1FECA 1S2QA 4RG4A 4DGKA 1VDCA 1N4VA 5EB5A 3SZCA 3CPJG 3SXIA 3T31A 4CCQA 5HYMA 4XXGA 1NAAA 4OPUA 3AEAA 1LJ1A 1CC4A 5FS9A 1K4QA 4YKGA 2B9XA 1ONFA 2FJAA 2GRTA 5HHFA 1PS9A 3NYEA 1NENA 1ZY8A 4II3A 3LXDA 1EL8A 4C3XA 3M12A 3R9UA 3AE7A 3NN0X 1N1PA 3UTFA 1P2EA 3UTEA 1D7LA 1VRQB 3K7QX 3H8IA 4Z44A 3VR9A 2B76A 3Q6JA 3GWFA 3SFDA 1S2YA 2GMHA 4H4WA 2H89A 4U8OA 3NLCA 4TLZA 4J56A 3QJ4A 2CDUA 4K5RA 3VQRA 2XFPA 4J2WA 1B8SA 4II2A 1O95A 1GRGA 2B9WA 3KU9A 3EF6A 4EIQA 4A5LA 3FIMB 4NTEA 3IWAA 1VG9A 1NG4A 3AYIA 3CPIG 1K0LA 3P9UA 3UKKA 3D1CA 1TDKA 1REOA 1N4WA 3GMCA 1GRBA 3RP7A 3UTGA 4X9NA 1PBCA 2WESA 3IHMA 2WU5A 4PABA 4TM4A 2Z5YA 2WBAA 4HA6A 1H7XA 2YG3A 1ZDLA 5FS7A 3PVCA 1E1KA 3AEFA 3M13A 5FS8A 3DJJA 5U25A 1XANA 1Y56B 1FEBA 4G74A 1JEHA 3ALLA 1GRTA 2BS4A 3C96A 1PJ6A 1H83A 2IVEA 2WOVA 2HQMA 2X99A 2XCGA 3L1RA 4H2RA 2BYBA 2EQ8A 4H7UA 3I3LA 4JDRA 4H4SA 3F8DA 2Q0LA 4RSLA 4X9MA 3NN6X 1B4VA 3NT6A 4ICYA 1CC6A 5KRQA 2JAEA 3SZWA 1H82A 3ITJA 1YQ4A 3HYWA 4ZCCA 4HB9A 3URHA 4U8PA 4NNJA 4U8IA 1E1MA 3UOXA 1Q1WA 1PBFA 2YG4A 3DJEA 2RGJA 2W0HA 1K0JA 3K7TA 1AOGA 1H86A 4AOSA 3CIRA 3F8PA 2C65A 3UOVA 1PBBA 2YAUA 1NHRA 3NNEA 4FK1A 4FDCB 3FPZA 3GMBA 2BK4A 3AE2A 1L0VA 4B64A 2ZZCA 4C74A 4GRTA 4YSZA 3P4SA 1YKJA 2IVDA 5HXIA 1PJ5A 1LTXR 1TRBA 2A87A 2C73A 5BUKA 3IHGA 3KA7A 5C3JA 1CJ3A 2AAQA 2I0ZA 5JCMA 1EBDA 4G9KA 1DNCA 4FX9A 3DGZA 3DJGX 4YT0A 2X8GA 2YLSA 4G6GA 1L9DA 1E7PA 3CNPA 1JU2A 4A6NA 2ZZ0A 4TLXA 4H2PA 2GQWA 2BC1A 1ZOYA 1Y56A 1GEUA 1LQUA 1HYUA 2RGOA 3AEEA 5J60A 4JY2A 3QFAA 2BXRA 3NH3X 2WP5A 5FMHA 1QO8A 1Y0PA 4ZCDA 3T0KA 3AB1A 3DJDA 4Z43A 1GOSA 3SM8A 2YR6A 1FOHA 5JCKA 4C77A 3BHFA 5CKUA 2R4EA 3KPFA 2XVFA 2R9ZA 3QVRA 1ZX9A 2GH5A 5DBJA 1NG3A 3LADA 3V3OA 1CHUA 2VQ7A 2CULA 4CCRA 4DNAA 2XLSA 1K0IA 1RYIA 1GRAA 4H4QA 1TYTA 2X50A 2R0PA 2YG6A 3AYJA 4YTMA 3UOYA 3FBSA 1BZLA 3H4KA 4BJYA 1Q1RA 3V76A 2R0GA 2TMDA 4NZHA 1OJ9A 3LJPA 1CJ2A 2C66A 2B7RA 2C75A 2R4JA 1XPQA 3GYJA 1KSUA 3DK8A 4U2TA 1TDNA 3GRTA 3T2YA 3G5SA 2RGHA 3C4AA 4EM3A 4JNQA 4Y4NA 2GV8A 1DJQA 1YQZA 1ZMDA 1LVLA 3AXBA 3QFBA 3AWIA 3G5QA 2WPEA 3GD3A
chains in the Genus database with same CATH topology
1PDHA 4I58A 1IJHA 1H6VA 4IVMB 5GRTA 1PN0A 4YTPA 5IQ4A 2QCUA 2WP9A 3LZXA 3P4PA 1CF3A 5U1OA 1EL5A 1TYPA 3CPHG 2V60A 1TDEA 2BXSA 4H4TA 3WE0A 5KVIA 4LIIA 2XLTA 3ZYXA 3ICTA 1UKVG 4H4XA 4A9WA 3VRAA 1KNPA 4TM3A 3KLJA 1NPXA 4OPTA 1Q9IA 1H81A 2Q6UA 3CNSA 3D8XA 2Z5XA 3DK4A 4P9SA 1N4UA 1B37A 4BK2A 4EMWA 2WHDA 3NTAA 2WOIA 4Y4MA 5EB4A 4Z25A 4K5SA 4A65A 5CQFA 1V59A 3ICRA 3BNUA 1TDOA 3NYFA 3REDA 4A99A 2YLXA 1D4DA 4IVOB 1IUUA 1JNRA 2FBWA 2VOUA 3UKQA 3ISHA 3DGHA 4B63A 1PJ7A 1H84A 5C2TA 4A6NB 3T37A 5KVHA 4H4ZA 3CMMA 3O0HA 3RNMA 1ZMCA 3B6DA 3K30A 3RP8A 3CGEA 4B65A 2R46A 2C7GA 1LQTA 2VQBA 5FS6A 2BCGG 2YG5A 1E1NA 5KMPA 2TPRA 2YQUA 1VQWA 4CY8A 1ZOVA 2YWLA 2Q0KA 2XVIA 5KXJA 3CNDA 4KPRA 1OJTA 4O5QA 4EIPA 4EQSA 4EM4A 4X4JA 2WP6A 1ELIA 2VVMA 2VRMA 1KNRA 2XFQA 3UKFA 1GRHA 2BS2A 3ABVA 4USRA 4U2SA 4APNA 4XWRA 3KKJA 3EPTA 2GB0A 3NHOX 3AE8A 1GTHA 1OJDA 2XFOA 4J36A 1GETA 4YSXA 2AR8A 2BK5A 2YLZA 4N9XA 2XVHA 4EQRA 2GAGB 3CNJA 1TDFA 4YSYA 1QJDA 2ZBWA 1M64A 2EQ9A 1VG0A 4CRTA 5IPYA 3SZFA 5L46A 3QSMA 1KF6A 1GERA 2V5ZA 2XVEA 2OA1A 1NEKA 2X3NA 5U63A 4B69A 4GR1A 1EL9A 1L9CA 3GDPA 4IA5A 4UDQA 2OLOA 4GF7A 3AEBA 2VVLA 3CGDA 4REKA 4M52A 4USQA 2WDVA 2GR0A 1JOAA 2CFYA 4ECHA 1D4EA 4JN9A 3T2ZA 1ZK7A 1LV0A 1LPFA 1NHQA 1F8RA 2Y6QA 3DA1A 3ALMA 3VRDB 2GVCA 3NRNA 1RP0A 2C67A 2JB1A 4J57A 1PHHA 4GDEA 1F3PA 3NK1X 2JB2A 4B66A 4Z26A 3IF9A 2GR1A 4YKFA 2FJEA 3HZLA 3RHAA 2ZZBA 2GF3A 1RSGA 3AEDA 3VR8A 4JNAA 2CVJA 3T14A 1GPEA 4H2QA 1B5QA 4OPIA 1DXLA 4JQ9A 4U8MA 4CY6A 4GUVA 5JCLA 3QVPA 2WETA 5HY5A 2WPFA 1GTEA 3NGCX 5EOWA 2WS3A 3LB8A 1CJ4A 2O9ZA 2BRAA 3G5RA 2YG7A 2WDRA 1GESA 4Z2RA 1OJAA 3KVEA 4U8JA 2GEWA 2PYXA 3GYXA 4JY3A 3SY4A 3ICSA 3UKLA 4NEWA 1BGJA 4OPGA 4AP1A 4EMIA 4E0VA 2H88A 1GALA 3AD8B 4Z2UA 3GDNA 2Y6RA 3CNTA 4K7ZA 5KMSA 1DJNA 2YVJA 3UP4A 3ALJA 1CC2A 2XLRA 5KMRA 2OAMA 2GMJA 3GWDA 2C4CA 2VRLA 2XFNA 3HYVA 4K22A 2NPXA 4GAPA 1IUSA 4O5UA 4UDRA 4WX1A 2XVJA 4GDPA 4YWOA 1BKWA 3UP5A 2BA9A 4Z24A 1COYA 3IC9A 3LOVA 1OJCA 3F8RA 3AE1A 3NK0X 4GAVA 4AOXA 2PHHA 2VZ2A 2WPCA 4LU6A 1MOKA 2WOWA 3AYLA 3KD9A 2EQ6A 1ZKQA 1GNDA 3E1TA 1IUVA 4AT0A 3HYXA 4B68A 4G73A 1M6IA 2R45A 2XDOA 4A7AA 5KOXA 2VVLG 5JCIA 1CBOA 1MO9A 5JCNA 3PO7A 1NHSA 3ATQA 5IQ1A 1BGNA 5GSNA 1D4CA 1FEAA 1EL7A 4ADWA 4FK1C 3BI4A 1FCDA 1E39A 1XHCA 1JRZA 2QA1A 2JK6A 4CNKA 3GYIA 4BJZA 2V6OA 3RP6A 2YLRA 2GR3A 1FL2A 1GT8A 2C3DA 3H8LA 4OPCA 3UKPA 4CNJA 2C70A 3COXA 4NTDA 1QLBA 1H7WA 3AEGA 3CGBA 3AE6A 1PXCA 4BV6A 4B67A 3NKSA 5EBKA 1MXTA 3EAOA 3BI5A 3P4QA 3S5WA 1SEZA 4NTCA 1GREA 2GQFA 4BURA 1W4XA 2F5ZA 3AE5A 2BC0A 3SFEA 2ACZA 4H4VA 3NIXA 5KMQA 5M10A 2EQ7A 1NHPA 3AE4A 3SYIA 3NK2X 2UZZA 2ARDA 1F6MA 2C64A 2E4GA 2WDQA 4IA6A 2GAHB 2YR5A 4OPDA 1D5TA 4H4RA 3V3NA 3JSKA 1XDIA 4BK3A 2XFUA 4C5OA 4TM1A 2BS3A 4U2LA 1ZP0A 3K7MX 2C72A 2OALA 3OZ2A 4I59A 2XYOA 4Z2TA 2J3NA 4H2NA 1IUXA 5M0ZA 3P1WA 4OPLA 4DSHA 4YTNA 4C3YA 1Z6LA 4LA1A 4KX6A 3ATRA 4YXDA 1JNZA 2X8CA 4RG3A 1DODA 1F8SA 2BABA 4EMJA 3CGCA 1P2HA 1PBEA 1E1LA 1E6EA 2E1MA 1L9EA 4AT2A 2V3AA 2AQJA 1JRXA 1S3BA 2XLPA 1YY5A 2C3CA 1CL0A 2QAEA 4UDPA 3SQPA 4YSHA 1D7YA 4H4PA 4U8LA 4H4YA 2FJBA 3ADAB 1PXBA 3GSIA 4H4UA 1GSNA 3FG2P 3FMWA 4K8DA 2JB3A 3CTYA 3BHKA 3C4NA 4WCTA 4J31A 1BF3A 3UKHA 3UCLA 4ZN0A 3PS9A 1IUWA 2XLUA 3UKAA 3SX6A 3DMEA 3UTHA 3CN8A 2QA2A 2BCPA 3L8KA 1IUTA 2YVFA 5KOWA 4PAAA 3NYCA 2DKHA 4MJWA 1O5WA 2YR4A 1CJCA 4J34A 3QSEA 2YM1A 4B1BA 3AD7B 4D03A 1O94A 2BACA 4OCGA 4UP3A 3KPKA 3UOZA 5LV9A 1GV4A 3I6DA 4GCMA 4NEVA 2JBVA 2BK3A 1DOCA 3AECA 3M0OA 4J33A 3II4A 2X8HA 5BULA 5J7XA 1PBDA 2C76A 4BK1A 5BVAA 3GD4A 1KDGA 1KFYA 1PXAA 2WEUA 2A8XA 1BWCA 2NVKX 3ZDNA 2V61A 4U8NA 2A89A 2V3BA 4XWZA 3B3RA 2B7SA 4H50A 3VRBA 1X31B 3GRSA 3LZWA 4K2XA 4OVIA 5TR3A 1DOEA 4IV9A 5ER0A 1YQ3A 2E5VA 2BRYA 3DH9A 1NDAA 3BI2A 2GR2A 2RABA 2YLWA 2APGA 4AP3A 3BNMA 3SZ0A 1JRYA 4A79A 3AD9B 3NG7X 4CBQA 2FJDA 3QSSA 4TM0A 2YVGA 1DOBA 2Q7VA 3Q9TA 2R0CA 4NWZA 5KNLA 2YLTA 2DKIA 5KWFA 2B9YA 3DK9A 1S3EA 2WQYA 3EANA 4D04A 1KSSA 1F8WA 2JKCA 3NTDA 5BRTA 3OC4A 2YM2A 2IIDA 4DSGA 1GRFA 2OLNA 4G6HA 3S61A 3T2KA 4EQXA 1GXFA 4Y4LA 2WU2A 3AE9A 3P4RA 4U8KA 3AE3A 3SGLA 4EQWA 1FECA 1S2QA 4RG4A 4DGKA 1VDCA 1N4VA 5EB5A 3SZCA 3CPJG 3SXIA 3T31A 4CCQA 5HYMA 4XXGA 1NAAA 4OPUA 3AEAA 1LJ1A 1CC4A 5FS9A 1K4QA 4YKGA 2B9XA 1ONFA 2FJAA 2GRTA 5HHFA 1PS9A 3NYEA 1NENA 1ZY8A 4II3A 3LXDA 1EL8A 4C3XA 3M12A 3R9UA 3AE7A 3NN0X 1N1PA 3UTFA 1P2EA 3UTEA 1D7LA 1VRQB 3K7QX 3H8IA 4Z44A 3VR9A 2B76A 3Q6JA 3GWFA 3SFDA 1S2YA 2GMHA 4H4WA 2H89A 4U8OA 3NLCA 4TLZA 4J56A 3QJ4A 2CDUA 4K5RA 3VQRA 2XFPA 4J2WA 1B8SA 4II2A 1O95A 1GRGA 2B9WA 3KU9A 3EF6A 4EIQA 4A5LA 3FIMB 4NTEA 3IWAA 1VG9A 1NG4A 3AYIA 3CPIG 1K0LA 3P9UA 3UKKA 3D1CA 1TDKA 1REOA 1N4WA 3GMCA 1GRBA 3RP7A 3UTGA 4X9NA 1PBCA 2WESA 3IHMA 2WU5A 4PABA 4TM4A 2Z5YA 2WBAA 4HA6A 1H7XA 2YG3A 1ZDLA 5FS7A 3PVCA 1E1KA 3AEFA 3M13A 5FS8A 3DJJA 5U25A 1XANA 1Y56B 1FEBA 4G74A 1JEHA 3ALLA 1GRTA 2BS4A 3C96A 1PJ6A 1H83A 2IVEA 2WOVA 2HQMA 2X99A 2XCGA 3L1RA 4H2RA 2BYBA 2EQ8A 4H7UA 3I3LA 4JDRA 4H4SA 3F8DA 2Q0LA 4RSLA 4X9MA 3NN6X 1B4VA 3NT6A 4ICYA 1CC6A 5KRQA 2JAEA 3SZWA 1H82A 3ITJA 1YQ4A 3HYWA 4ZCCA 4HB9A 3URHA 4U8PA 4NNJA 4U8IA 1E1MA 3UOXA 1Q1WA 1PBFA 2YG4A 3DJEA 2RGJA 2W0HA 1K0JA 3K7TA 1AOGA 1H86A 4AOSA 3CIRA 3F8PA 2C65A 3UOVA 1PBBA 2YAUA 1NHRA 3NNEA 4FK1A 4FDCB 3FPZA 3GMBA 2BK4A 3AE2A 1L0VA 4B64A 2ZZCA 4C74A 4GRTA 4YSZA 3P4SA 1YKJA 2IVDA 5HXIA 1PJ5A 1LTXR 1TRBA 2A87A 2C73A 5BUKA 3IHGA 3KA7A 5C3JA 1CJ3A 2AAQA 2I0ZA 5JCMA 1EBDA 4G9KA 1DNCA 4FX9A 3DGZA 3DJGX 4YT0A 2X8GA 2YLSA 4G6GA 1L9DA 1E7PA 3CNPA 1JU2A 4A6NA 2ZZ0A 4TLXA 4H2PA 2GQWA 2BC1A 1ZOYA 1Y56A 1GEUA 1LQUA 1HYUA 2RGOA 3AEEA 5J60A 4JY2A 3QFAA 2BXRA 3NH3X 2WP5A 5FMHA 1QO8A 1Y0PA 4ZCDA 3T0KA 3AB1A 3DJDA 4Z43A 1GOSA 3SM8A 2YR6A 1FOHA 5JCKA 4C77A 3BHFA 5CKUA 2R4EA 3KPFA 2XVFA 2R9ZA 3QVRA 1ZX9A 2GH5A 5DBJA 1NG3A 3LADA 3V3OA 1CHUA 2VQ7A 2CULA 4CCRA 4DNAA 2XLSA 1K0IA 1RYIA 1GRAA 4H4QA 1TYTA 2X50A 2R0PA 2YG6A 3AYJA 4YTMA 3UOYA 3FBSA 1BZLA 3H4KA 4BJYA 1Q1RA 3V76A 2R0GA 2TMDA 4NZHA 1OJ9A 3LJPA 1CJ2A 2C66A 2B7RA 2C75A 2R4JA 1XPQA 3GYJA 1KSUA 3DK8A 4U2TA 1TDNA 3GRTA 3T2YA 3G5SA 2RGHA 3C4AA 4EM3A 4JNQA 4Y4NA 2GV8A 1DJQA 1YQZA 1ZMDA 1LVLA 3AXBA 3QFBA 3AWIA 3G5QA 2WPEA 3GD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDH A;  4I58 A;  1IJH A;  1H6V A;  4IVM B;  5GRT A;  1PN0 A;  4YTP A;  5IQ4 A;  2QCU A;  2WP9 A;  3LZX A;  3P4P A;  1CF3 A;  5U1O A;  1EL5 A;  1TYP A;  3CPH G;  2V60 A;  1TDE A;  2BXS A;  4H4T A;  3WE0 A;  5KVI A;  4LII A;  2XLT A;  3ZYX A;  3ICT A;  1UKV G;  4H4X A;  4A9W A;  3VRA A;  1KNP A;  4TM3 A;  3KLJ A;  1NPX A;  4OPT A;  1Q9I A;  1H81 A;  2Q6U A;  3CNS A;  3D8X A;  2Z5X A;  3DK4 A;  4P9S A;  1N4U A;  1B37 A;  4BK2 A;  4EMW A;  2WHD A;  3NTA A;  2WOI A;  4Y4M A;  5EB4 A;  4Z25 A;  4K5S A;  4A65 A;  5CQF A;  1V59 A;  3ICR A;  3BNU A;  1TDO A;  3NYF A;  3RED A;  4A99 A;  2YLX A;  1D4D A;  4IVO B;  1IUU A;  1JNR A;  2FBW A;  2VOU A;  3UKQ A;  3ISH A;  3DGH A;  4B63 A;  1PJ7 A;  1H84 A;  5C2T A;  4A6N B;  3T37 A;  5KVH A;  4H4Z A;  3RNM A;  3O0H A;  1ZMC A;  3B6D A;  3K30 A;  3RP8 A;  3CGE A;  4B65 A;  2R46 A;  2C7G A;  1LQT A;  2VQB A;  5FS6 A;  2BCG G;  2YG5 A;  1E1N A;  2TPR A;  2YQU A;  1VQW A;  4CY8 A;  1ZOV A;  2YWL A;  2Q0K A;  2XVI A;  5KXJ A;  3CND A;  4KPR A;  1OJT A;  4O5Q A;  4EIP A;  4EQS A;  4EM4 A;  4X4J A;  2WP6 A;  1ELI A;  2VVM A;  2VRM A;  1KNR A;  2XFQ A;  3UKF A;  1GRH A;  2BS2 A;  3ABV A;  4USR A;  4U2S A;  4APN A;  4XWR A;  3KKJ A;  3EPT A;  2GB0 A;  3NHO X;  3AE8 A;  1GTH A;  1OJD A;  2XFO A;  4J36 A;  1GET A;  4YSX A;  2AR8 A;  2BK5 A;  2YLZ A;  4N9X A;  2XVH A;  4EQR A;  2GAG B;  3CNJ A;  1TDF A;  4YSY A;  1QJD A;  2ZBW A;  1M64 A;  2EQ9 A;  1VG0 A;  4CRT A;  5IPY A;  5L46 A;  3QSM A;  1KF6 A;  1GER A;  2V5Z A;  2XVE A;  2OA1 A;  1NEK A;  2X3N A;  5U63 A;  4B69 A;  4GR1 A;  1EL9 A;  1L9C A;  3GDP A;  4IA5 A;  4UDQ A;  2OLO A;  4GF7 A;  3AEB A;  2VVL A;  3CGD A;  4REK A;  4M52 A;  4USQ A;  2WDV A;  2GR0 A;  1JOA A;  2CFY A;  4ECH A;  1D4E A;  4JN9 A;  1ZK7 A;  1LV0 A;  1LPF A;  1NHQ A;  1F8R A;  2Y6Q A;  3DA1 A;  3ALM A;  3VRD B;  2GVC A;  3NRN A;  1RP0 A;  2C67 A;  2JB1 A;  4J57 A;  1PHH A;  4GDE A;  1F3P A;  3NK1 X;  2JB2 A;  4B66 A;  4Z26 A;  3IF9 A;  2GR1 A;  4YKF A;  2FJE A;  3HZL A;  3RHA A;  2ZZB A;  2GF3 A;  1RSG A;  3AED A;  3VR8 A;  4JNA A;  2CVJ A;  1GPE A;  4H2Q A;  1B5Q A;  4OPI A;  1DXL A;  4JQ9 A;  4U8M A;  4CY6 A;  4GUV A;  5JCL A;  3QVP A;  2WET A;  5HY5 A;  2WPF A;  1GTE A;  3NGC X;  5EOW A;  2WS3 A;  3LB8 A;  1CJ4 A;  2O9Z A;  3G5R A;  2YG7 A;  2WDR A;  1GES A;  4Z2R A;  1OJA A;  3KVE A;  4U8J A;  2GEW A;  2PYX A;  4JY3 A;  3ICS A;  3UKL A;  4NEW A;  1BGJ A;  4OPG A;  4AP1 A;  4EMI A;  4E0V A;  2H88 A;  1GAL A;  3AD8 B;  4Z2U A;  3GDN A;  2Y6R A;  3CNT A;  4K7Z A;  1DJN A;  2YVJ A;  3UP4 A;  3ALJ A;  1CC2 A;  2XLR A;  2OAM A;  2GMJ A;  3GWD A;  2XFN A;  2VRL A;  4K22 A;  2NPX A;  1IUS A;  4O5U A;  4UDR A;  4WX1 A;  2XVJ A;  4GDP A;  4YWO A;  1BKW A;  3UP5 A;  2BA9 A;  4Z24 A;  1COY A;  3IC9 A;  3LOV A;  1OJC A;  3F8R A;  3AE1 A;  3NK0 X;  4AOX A;  2PHH A;  2VZ2 A;  2WPC A;  4LU6 A;  1MOK A;  2WOW A;  3AYL A;  3KD9 A;  2EQ6 A;  1ZKQ A;  1GND A;  3E1T A;  1IUV A;  4AT0 A;  4B68 A;  1M6I A;  2R45 A;  2XDO A;  4A7A A;  5KOX A;  2VVL G;  5JCI A;  1CBO A;  1MO9 A;  5JCN A;  3PO7 A;  1NHS A;  3ATQ A;  5IQ1 A;  1BGN A;  5GSN A;  1D4C A;  1FEA A;  1EL7 A;  4ADW A;  4FK1 C;  3BI4 A;  1FCD A;  1E39 A;  1XHC A;  1JRZ A;  2QA1 A;  2JK6 A;  4CNK A;  3GYI A;  4BJZ A;  2V6O A;  3RP6 A;  2YLR A;  2GR3 A;  1FL2 A;  1GT8 A;  2C3D A;  3H8L A;  4OPC A;  3UKP A;  4CNJ A;  2C70 A;  3COX A;  4NTD A;  1QLB A;  1H7W A;  3AEG A;  3CGB A;  3AE6 A;  1PXC A;  4BV6 A;  4B67 A;  3NKS A;  5EBK A;  1MXT A;  3EAO A;  3BI5 A;  3P4Q A;  3S5W A;  1SEZ A;  4NTC A;  1GRE A;  2GQF A;  4BUR A;  1W4X A;  2F5Z A;  3AE5 A;  2BC0 A;  3SFE A;  2ACZ A;  4H4V A;  3NIX A;  5M10 A;  2EQ7 A;  1NHP A;  3AE4 A;  3NK2 X;  2UZZ A;  2ARD A;  1F6M A;  2C64 A;  2E4G A;  2WDQ A;  4IA6 A;  2GAH B;  2YR5 A;  4OPD A;  1D5T A;  4H4R A;  3V3N A;  3JSK A;  1XDI A;  4BK3 A;  2XFU A;  4C5O A;  4TM1 A;  2BS3 A;  4U2L A;  1ZP0 A;  3K7M X;  2C72 A;  2OAL A;  3OZ2 A;  4I59 A;  2XYO A;  4Z2T A;  2J3N A;  4H2N A;  1IUX A;  5M0Z A;  3P1W A;  4OPL A;  4DSH A;  4YTN A;  4C3Y A;  1Z6L A;  4LA1 A;  4KX6 A;  3ATR A;  4YXD A;  1JNZ A;  2X8C A;  4RG3 A;  1DOD A;  1F8S A;  2BAB A;  4EMJ A;  3CGC A;  1P2H A;  1PBE A;  1E1L A;  1E6E A;  2E1M A;  1L9E A;  4AT2 A;  2V3A A;  2AQJ A;  1JRX A;  1S3B A;  2XLP A;  1YY5 A;  2C3C A;  1CL0 A;  2QAE A;  4UDP A;  3SQP A;  4YSH A;  1D7Y A;  4H4P A;  4U8L A;  4H4Y A;  2FJB A;  3ADA B;  1PXB A;  3GSI A;  4H4U A;  1GSN A;  3FG2 P;  3FMW A;  4K8D A;  2JB3 A;  3CTY A;  3BHK A;  3C4N A;  4WCT A;  4J31 A;  1BF3 A;  3UKH A;  3UCL A;  4ZN0 A;  3PS9 A;  1IUW A;  2XLU A;  3UKA A;  3DME A;  3UTH A;  3CN8 A;  2QA2 A;  2BCP A;  3L8K A;  1IUT A;  2YVF A;  5KOW A;  4PAA A;  3NYC A;  2DKH A;  4MJW A;  1O5W A;  2YR4 A;  1CJC A;  4J34 A;  3QSE A;  2YM1 A;  4B1B A;  3AD7 B;  4D03 A;  1O94 A;  2BAC A;  4OCG A;  4UP3 A;  3UOZ A;  5LV9 A;  1GV4 A;  3I6D A;  4GCM A;  4NEV A;  2JBV A;  2BK3 A;  1DOC A;  3AEC A;  3M0O A;  4J33 A;  3II4 A;  2X8H A;  5BUL A;  5J7X A;  1PBD A;  2C76 A;  4BK1 A;  5BVA A;  3GD4 A;  1KDG A;  1KFY A;  1PXA A;  2WEU A;  2A8X A;  1BWC A;  2NVK X;  3ZDN A;  2V61 A;  4U8N A;  2A89 A;  2V3B A;  4XWZ A;  3B3R A;  2B7S A;  4H50 A;  3VRB A;  1X31 B;  3GRS A;  3LZW A;  4K2X A;  4OVI A;  5TR3 A;  1DOE A;  4IV9 A;  5ER0 A;  1YQ3 A;  2E5V A;  3DH9 A;  1NDA A;  3BI2 A;  2GR2 A;  2RAB A;  2YLW A;  2APG A;  4AP3 A;  3BNM A;  4A79 A;  1JRY A;  3AD9 B;  3NG7 X;  4CBQ A;  2FJD A;  3QSS A;  4TM0 A;  2YVG A;  1DOB A;  2Q7V A;  3Q9T A;  2R0C A;  2YLT A;  2DKI A;  5KWF A;  2B9Y A;  3DK9 A;  1S3E A;  2WQY A;  3EAN A;  4D04 A;  1KSS A;  1F8W A;  2JKC A;  3NTD A;  5BRT A;  3OC4 A;  2YM2 A;  2IID A;  4DSG A;  1GRF A;  2OLN A;  3S61 A;  4EQX A;  1GXF A;  4Y4L A;  2WU2 A;  3AE9 A;  3P4R A;  4U8K A;  3AE3 A;  3SGL A;  4EQW A;  1FEC A;  1S2Q A;  4RG4 A;  4DGK A;  1VDC A;  1N4V A;  5EB5 A;  3CPJ G;  4CCQ A;  5HYM A;  4XXG A;  1NAA A;  4OPU A;  3AEA A;  1LJ1 A;  1CC4 A;  5FS9 A;  1K4Q A;  4YKG A;  2B9X A;  1ONF A;  2FJA A;  2GRT A;  5HHF A;  1PS9 A;  3NYE A;  1NEN A;  1ZY8 A;  3LXD A;  1EL8 A;  4C3X A;  3M12 A;  3R9U A;  3AE7 A;  3NN0 X;  1N1P A;  3UTF A;  1P2E A;  3UTE A;  1D7L A;  1VRQ B;  3K7Q X;  3H8I A;  4Z44 A;  3VR9 A;  2B76 A;  3Q6J A;  3GWF A;  3SFD A;  1S2Y A;  2GMH A;  4H4W A;  2H89 A;  4U8O A;  3NLC A;  4TLZ A;  4J56 A;  3QJ4 A;  2CDU A;  4K5R A;  3VQR A;  2XFP A;  4J2W A;  1B8S A;  1O95 A;  1GRG A;  2B9W A;  3KU9 A;  3EF6 A;  4EIQ A;  4A5L A;  3FIM B;  4NTE A;  3IWA A;  1VG9 A;  1NG4 A;  3AYI A;  3CPI G;  1K0L A;  3P9U A;  3UKK A;  3D1C A;  1TDK A;  1REO A;  1N4W A;  3GMC A;  1GRB A;  3RP7 A;  3UTG A;  4X9N A;  1PBC A;  2WES A;  3IHM A;  2WU5 A;  4PAB A;  4TM4 A;  2Z5Y A;  2WBA A;  4HA6 A;  1H7X A;  2YG3 A;  1ZDL A;  5FS7 A;  3PVC A;  1E1K A;  3AEF A;  3M13 A;  5FS8 A;  3DJJ A;  5U25 A;  1XAN A;  1Y56 B;  1FEB A;  1JEH A;  3ALL A;  1GRT A;  2BS4 A;  3C96 A;  1PJ6 A;  1H83 A;  2IVE A;  2WOV A;  2HQM A;  2X99 A;  2XCG A;  3L1R A;  4H2R A;  2BYB A;  2EQ8 A;  4H7U A;  3I3L A;  4JDR A;  4H4S A;  3F8D A;  2Q0L A;  4RSL A;  4X9M A;  3NN6 X;  1B4V A;  3NT6 A;  4ICY A;  1CC6 A;  5KRQ A;  2JAE A;  1H82 A;  3ITJ A;  1YQ4 A;  4ZCC A;  4HB9 A;  3URH A;  4U8P A;  4U8I A;  1E1M A;  3UOX A;  1Q1W A;  1PBF A;  2YG4 A;  3DJE A;  2RGJ A;  2W0H A;  1K0J A;  3K7T A;  1AOG A;  1H86 A;  4AOS A;  3CIR A;  3F8P A;  2C65 A;  3UOV A;  1PBB A;  2YAU A;  1NHR A;  3NNE A;  4FK1 A;  4FDC B;  3FPZ A;  3GMB A;  2BK4 A;  3AE2 A;  1L0V A;  4B64 A;  2ZZC A;  4C74 A;  4GRT A;  4YSZ A;  3P4S A;  1YKJ A;  2IVD A;  5HXI A;  1PJ5 A;  1LTX R;  1TRB A;  2A87 A;  2C73 A;  5BUK A;  3IHG A;  3KA7 A;  5C3J A;  1CJ3 A;  2AAQ A;  2I0Z A;  5JCM A;  1EBD A;  1DNC A;  4FX9 A;  3DGZ A;  3DJG X;  4YT0 A;  2X8G A;  2YLS A;  4A6N A;  1L9D A;  1E7P A;  3CNP A;  1JU2 A;  2ZZ0 A;  4TLX A;  4H2P A;  2GQW A;  2BC1 A;  1ZOY A;  1Y56 A;  1GEU A;  1LQU A;  1HYU A;  2RGO A;  3AEE A;  5J60 A;  4JY2 A;  3QFA A;  2BXR A;  3NH3 X;  2WP5 A;  5FMH A;  1QO8 A;  1Y0P A;  4ZCD A;  3AB1 A;  3DJD A;  4Z43 A;  1GOS A;  3SM8 A;  2YR6 A;  1FOH A;  5JCK A;  4C77 A;  3BHF A;  5CKU A;  2R4E A;  3KPF A;  2XVF A;  2R9Z A;  3QVR A;  1ZX9 A;  2GH5 A;  5DBJ A;  1NG3 A;  3LAD A;  3V3O A;  1CHU A;  2VQ7 A;  2CUL A;  4CCR A;  4DNA A;  2XLS A;  1K0I A;  1RYI A;  1GRA A;  4H4Q A;  1TYT A;  2X50 A;  2R0P A;  2YG6 A;  3AYJ A;  4YTM A;  3UOY A;  3FBS A;  1BZL A;  3H4K A;  4BJY A;  1Q1R A;  3V76 A;  2R0G A;  2TMD A;  4NZH A;  1OJ9 A;  3LJP A;  1CJ2 A;  2C66 A;  2B7R A;  2C75 A;  2R4J A;  1XPQ A;  3GYJ A;  1KSU A;  3DK8 A;  4U2T A;  1TDN A;  3GRT A;  3G5S A;  2RGH A;  3C4A A;  4EM3 A;  4JNQ A;  4Y4N A;  2GV8 A;  1DJQ A;  1YQZ A;  1ZMD A;  1LVL A;  3AXB A;  3QFB A;  3AWI A;  3G5Q A;  2WPE A;  3GD3 A; 
#chains in the Genus database with same CATH topology
 1PDH A;  4I58 A;  1IJH A;  1H6V A;  4IVM B;  5GRT A;  1PN0 A;  4YTP A;  5IQ4 A;  2QCU A;  2WP9 A;  3LZX A;  3P4P A;  1CF3 A;  5U1O A;  1EL5 A;  1TYP A;  3CPH G;  2V60 A;  1TDE A;  2BXS A;  4H4T A;  3WE0 A;  5KVI A;  4LII A;  2XLT A;  3ZYX A;  3ICT A;  1UKV G;  4H4X A;  4A9W A;  3VRA A;  1KNP A;  4TM3 A;  3KLJ A;  1NPX A;  4OPT A;  1Q9I A;  1H81 A;  2Q6U A;  3CNS A;  3D8X A;  2Z5X A;  3DK4 A;  4P9S A;  1N4U A;  1B37 A;  4BK2 A;  4EMW A;  2WHD A;  3NTA A;  2WOI A;  4Y4M A;  5EB4 A;  4Z25 A;  4K5S A;  4A65 A;  5CQF A;  1V59 A;  3ICR A;  3BNU A;  1TDO A;  3NYF A;  3RED A;  4A99 A;  2YLX A;  1D4D A;  4IVO B;  1IUU A;  1JNR A;  2FBW A;  2VOU A;  3UKQ A;  3ISH A;  3DGH A;  4B63 A;  1PJ7 A;  1H84 A;  5C2T A;  4A6N B;  3T37 A;  5KVH A;  4H4Z A;  3CMM A;  3O0H A;  3RNM A;  1ZMC A;  3B6D A;  3K30 A;  3RP8 A;  3CGE A;  4B65 A;  2R46 A;  2C7G A;  1LQT A;  2VQB A;  5FS6 A;  2BCG G;  2YG5 A;  1E1N A;  5KMP A;  2TPR A;  2YQU A;  1VQW A;  4CY8 A;  1ZOV A;  2YWL A;  2Q0K A;  2XVI A;  5KXJ A;  3CND A;  4KPR A;  1OJT A;  4O5Q A;  4EIP A;  4EQS A;  4EM4 A;  4X4J A;  2WP6 A;  1ELI A;  2VVM A;  2VRM A;  1KNR A;  2XFQ A;  3UKF A;  1GRH A;  2BS2 A;  3ABV A;  4USR A;  4U2S A;  4APN A;  4XWR A;  3KKJ A;  3EPT A;  2GB0 A;  3NHO X;  3AE8 A;  1GTH A;  1OJD A;  2XFO A;  4J36 A;  1GET A;  4YSX A;  2AR8 A;  2BK5 A;  2YLZ A;  4N9X A;  2XVH A;  4EQR A;  2GAG B;  3CNJ A;  1TDF A;  4YSY A;  1QJD A;  2ZBW A;  1M64 A;  2EQ9 A;  1VG0 A;  4CRT A;  5IPY A;  3SZF A;  5L46 A;  3QSM A;  1KF6 A;  1GER A;  2V5Z A;  2XVE A;  2OA1 A;  1NEK A;  2X3N A;  5U63 A;  4B69 A;  4GR1 A;  1EL9 A;  1L9C A;  3GDP A;  4IA5 A;  4UDQ A;  2OLO A;  4GF7 A;  3AEB A;  2VVL A;  3CGD A;  4REK A;  4M52 A;  4USQ A;  2WDV A;  2GR0 A;  1JOA A;  2CFY A;  4ECH A;  1D4E A;  4JN9 A;  3T2Z A;  1ZK7 A;  1LV0 A;  1LPF A;  1NHQ A;  1F8R A;  2Y6Q A;  3DA1 A;  3ALM A;  3VRD B;  2GVC A;  3NRN A;  1RP0 A;  2C67 A;  2JB1 A;  4J57 A;  1PHH A;  4GDE A;  1F3P A;  3NK1 X;  2JB2 A;  4B66 A;  4Z26 A;  3IF9 A;  2GR1 A;  4YKF A;  2FJE A;  3HZL A;  3RHA A;  2ZZB A;  2GF3 A;  1RSG A;  3AED A;  3VR8 A;  4JNA A;  2CVJ A;  3T14 A;  1GPE A;  4H2Q A;  1B5Q A;  4OPI A;  1DXL A;  4JQ9 A;  4U8M A;  4CY6 A;  4GUV A;  5JCL A;  3QVP A;  2WET A;  5HY5 A;  2WPF A;  1GTE A;  3NGC X;  5EOW A;  2WS3 A;  3LB8 A;  1CJ4 A;  2O9Z A;  2BRA A;  3G5R A;  2YG7 A;  2WDR A;  1GES A;  4Z2R A;  1OJA A;  3KVE A;  4U8J A;  2GEW A;  2PYX A;  3GYX A;  4JY3 A;  3SY4 A;  3ICS A;  3UKL A;  4NEW A;  1BGJ A;  4OPG A;  4AP1 A;  4EMI A;  4E0V A;  2H88 A;  1GAL A;  3AD8 B;  4Z2U A;  3GDN A;  2Y6R A;  3CNT A;  4K7Z A;  5KMS A;  1DJN A;  2YVJ A;  3UP4 A;  3ALJ A;  1CC2 A;  2XLR A;  5KMR A;  2OAM A;  2GMJ A;  3GWD A;  2C4C A;  2VRL A;  2XFN A;  3HYV A;  4K22 A;  2NPX A;  4GAP A;  1IUS A;  4O5U A;  4UDR A;  4WX1 A;  2XVJ A;  4GDP A;  4YWO A;  1BKW A;  3UP5 A;  2BA9 A;  4Z24 A;  1COY A;  3IC9 A;  3LOV A;  1OJC A;  3F8R A;  3AE1 A;  3NK0 X;  4GAV A;  4AOX A;  2PHH A;  2VZ2 A;  2WPC A;  4LU6 A;  1MOK A;  2WOW A;  3AYL A;  3KD9 A;  2EQ6 A;  1ZKQ A;  1GND A;  3E1T A;  1IUV A;  4AT0 A;  3HYX A;  4B68 A;  4G73 A;  1M6I A;  2R45 A;  2XDO A;  4A7A A;  5KOX A;  2VVL G;  5JCI A;  1CBO A;  1MO9 A;  5JCN A;  3PO7 A;  1NHS A;  3ATQ A;  5IQ1 A;  1BGN A;  5GSN A;  1D4C A;  1FEA A;  1EL7 A;  4ADW A;  4FK1 C;  3BI4 A;  1FCD A;  1E39 A;  1XHC A;  1JRZ A;  2QA1 A;  2JK6 A;  4CNK A;  3GYI A;  4BJZ A;  2V6O A;  3RP6 A;  2YLR A;  2GR3 A;  1FL2 A;  1GT8 A;  2C3D A;  3H8L A;  4OPC A;  3UKP A;  4CNJ A;  2C70 A;  3COX A;  4NTD A;  1QLB A;  1H7W A;  3AEG A;  3CGB A;  3AE6 A;  1PXC A;  4BV6 A;  4B67 A;  3NKS A;  5EBK A;  1MXT A;  3EAO A;  3BI5 A;  3P4Q A;  3S5W A;  1SEZ A;  4NTC A;  1GRE A;  2GQF A;  4BUR A;  1W4X A;  2F5Z A;  3AE5 A;  2BC0 A;  3SFE A;  2ACZ A;  4H4V A;  3NIX A;  5KMQ A;  5M10 A;  2EQ7 A;  1NHP A;  3AE4 A;  3SYI A;  3NK2 X;  2UZZ A;  2ARD A;  1F6M A;  2C64 A;  2E4G A;  2WDQ A;  4IA6 A;  2GAH B;  2YR5 A;  4OPD A;  1D5T A;  4H4R A;  3V3N A;  3JSK A;  1XDI A;  4BK3 A;  2XFU A;  4C5O A;  4TM1 A;  2BS3 A;  4U2L A;  1ZP0 A;  3K7M X;  2C72 A;  2OAL A;  3OZ2 A;  4I59 A;  2XYO A;  4Z2T A;  2J3N A;  4H2N A;  1IUX A;  5M0Z A;  3P1W A;  4OPL A;  4DSH A;  4YTN A;  4C3Y A;  1Z6L A;  4LA1 A;  4KX6 A;  3ATR A;  4YXD A;  1JNZ A;  2X8C A;  4RG3 A;  1DOD A;  1F8S A;  2BAB A;  4EMJ A;  3CGC A;  1P2H A;  1PBE A;  1E1L A;  1E6E A;  2E1M A;  1L9E A;  4AT2 A;  2V3A A;  2AQJ A;  1JRX A;  1S3B A;  2XLP A;  1YY5 A;  2C3C A;  1CL0 A;  2QAE A;  4UDP A;  3SQP A;  4YSH A;  1D7Y A;  4H4P A;  4U8L A;  4H4Y A;  2FJB A;  3ADA B;  1PXB A;  3GSI A;  4H4U A;  1GSN A;  3FG2 P;  3FMW A;  4K8D A;  2JB3 A;  3CTY A;  3BHK A;  3C4N A;  4WCT A;  4J31 A;  1BF3 A;  3UKH A;  3UCL A;  4ZN0 A;  3PS9 A;  1IUW A;  2XLU A;  3UKA A;  3SX6 A;  3DME A;  3UTH A;  3CN8 A;  2QA2 A;  2BCP A;  3L8K A;  1IUT A;  2YVF A;  5KOW A;  4PAA A;  3NYC A;  2DKH A;  4MJW A;  1O5W A;  2YR4 A;  1CJC A;  4J34 A;  3QSE A;  2YM1 A;  4B1B A;  3AD7 B;  4D03 A;  1O94 A;  2BAC A;  4OCG A;  4UP3 A;  3KPK A;  3UOZ A;  5LV9 A;  1GV4 A;  3I6D A;  4GCM A;  4NEV A;  2JBV A;  2BK3 A;  1DOC A;  3AEC A;  3M0O A;  4J33 A;  3II4 A;  2X8H A;  5BUL A;  5J7X A;  1PBD A;  2C76 A;  4BK1 A;  5BVA A;  3GD4 A;  1KDG A;  1KFY A;  1PXA A;  2WEU A;  2A8X A;  1BWC A;  2NVK X;  3ZDN A;  2V61 A;  4U8N A;  2A89 A;  2V3B A;  4XWZ A;  3B3R A;  2B7S A;  4H50 A;  3VRB A;  1X31 B;  3GRS A;  3LZW A;  4K2X A;  4OVI A;  5TR3 A;  1DOE A;  4IV9 A;  5ER0 A;  1YQ3 A;  2E5V A;  2BRY A;  3DH9 A;  1NDA A;  3BI2 A;  2GR2 A;  2RAB A;  2YLW A;  2APG A;  4AP3 A;  3BNM A;  3SZ0 A;  1JRY A;  4A79 A;  3AD9 B;  3NG7 X;  4CBQ A;  2FJD A;  3QSS A;  4TM0 A;  2YVG A;  1DOB A;  2Q7V A;  3Q9T A;  2R0C A;  4NWZ A;  5KNL A;  2YLT A;  2DKI A;  5KWF A;  2B9Y A;  3DK9 A;  1S3E A;  2WQY A;  3EAN A;  4D04 A;  1KSS A;  1F8W A;  2JKC A;  3NTD A;  5BRT A;  3OC4 A;  2YM2 A;  2IID A;  4DSG A;  1GRF A;  2OLN A;  4G6H A;  3S61 A;  3T2K A;  4EQX A;  1GXF A;  4Y4L A;  2WU2 A;  3AE9 A;  3P4R A;  4U8K A;  3AE3 A;  3SGL A;  4EQW A;  1FEC A;  1S2Q A;  4RG4 A;  4DGK A;  1VDC A;  1N4V A;  5EB5 A;  3SZC A;  3CPJ G;  3SXI A;  3T31 A;  4CCQ A;  5HYM A;  4XXG A;  1NAA A;  4OPU A;  3AEA A;  1LJ1 A;  1CC4 A;  5FS9 A;  1K4Q A;  4YKG A;  2B9X A;  1ONF A;  2FJA A;  2GRT A;  5HHF A;  1PS9 A;  3NYE A;  1NEN A;  1ZY8 A;  4II3 A;  3LXD A;  1EL8 A;  4C3X A;  3M12 A;  3R9U A;  3AE7 A;  3NN0 X;  1N1P A;  3UTF A;  1P2E A;  3UTE A;  1D7L A;  1VRQ B;  3K7Q X;  3H8I A;  4Z44 A;  3VR9 A;  2B76 A;  3Q6J A;  3GWF A;  3SFD A;  1S2Y A;  2GMH A;  4H4W A;  2H89 A;  4U8O A;  3NLC A;  4TLZ A;  4J56 A;  3QJ4 A;  2CDU A;  4K5R A;  3VQR A;  2XFP A;  4J2W A;  1B8S A;  4II2 A;  1O95 A;  1GRG A;  2B9W A;  3KU9 A;  3EF6 A;  4EIQ A;  4A5L A;  3FIM B;  4NTE A;  3IWA A;  1VG9 A;  1NG4 A;  3AYI A;  3CPI G;  1K0L A;  3P9U A;  3UKK A;  3D1C A;  1TDK A;  1REO A;  1N4W A;  3GMC A;  1GRB A;  3RP7 A;  3UTG A;  4X9N A;  1PBC A;  2WES A;  3IHM A;  2WU5 A;  4PAB A;  4TM4 A;  2Z5Y A;  2WBA A;  4HA6 A;  1H7X A;  2YG3 A;  1ZDL A;  5FS7 A;  3PVC A;  1E1K A;  3AEF A;  3M13 A;  5FS8 A;  3DJJ A;  5U25 A;  1XAN A;  1Y56 B;  1FEB A;  4G74 A;  1JEH A;  3ALL A;  1GRT A;  2BS4 A;  3C96 A;  1PJ6 A;  1H83 A;  2IVE A;  2WOV A;  2HQM A;  2X99 A;  2XCG A;  3L1R A;  4H2R A;  2BYB A;  2EQ8 A;  4H7U A;  3I3L A;  4JDR A;  4H4S A;  3F8D A;  2Q0L A;  4RSL A;  4X9M A;  3NN6 X;  1B4V A;  3NT6 A;  4ICY A;  1CC6 A;  5KRQ A;  2JAE A;  3SZW A;  1H82 A;  3ITJ A;  1YQ4 A;  3HYW A;  4ZCC A;  4HB9 A;  3URH A;  4U8P A;  4NNJ A;  4U8I A;  1E1M A;  3UOX A;  1Q1W A;  1PBF A;  2YG4 A;  3DJE A;  2RGJ A;  2W0H A;  1K0J A;  3K7T A;  1AOG A;  1H86 A;  4AOS A;  3CIR A;  3F8P A;  2C65 A;  3UOV A;  1PBB A;  2YAU A;  1NHR A;  3NNE A;  4FK1 A;  4FDC B;  3FPZ A;  3GMB A;  2BK4 A;  3AE2 A;  1L0V A;  4B64 A;  2ZZC A;  4C74 A;  4GRT A;  4YSZ A;  3P4S A;  1YKJ A;  2IVD A;  5HXI A;  1PJ5 A;  1LTX R;  1TRB A;  2A87 A;  2C73 A;  5BUK A;  3IHG A;  3KA7 A;  5C3J A;  1CJ3 A;  2AAQ A;  2I0Z A;  5JCM A;  1EBD A;  4G9K A;  1DNC A;  4FX9 A;  3DGZ A;  3DJG X;  4YT0 A;  2X8G A;  2YLS A;  4G6G A;  1L9D A;  1E7P A;  3CNP A;  1JU2 A;  4A6N A;  2ZZ0 A;  4TLX A;  4H2P A;  2GQW A;  2BC1 A;  1ZOY A;  1Y56 A;  1GEU A;  1LQU A;  1HYU A;  2RGO A;  3AEE A;  5J60 A;  4JY2 A;  3QFA A;  2BXR A;  3NH3 X;  2WP5 A;  5FMH A;  1QO8 A;  1Y0P A;  4ZCD A;  3T0K A;  3AB1 A;  3DJD A;  4Z43 A;  1GOS A;  3SM8 A;  2YR6 A;  1FOH A;  5JCK A;  4C77 A;  3BHF A;  5CKU A;  2R4E A;  3KPF A;  2XVF A;  2R9Z A;  3QVR A;  1ZX9 A;  2GH5 A;  5DBJ A;  1NG3 A;  3LAD A;  3V3O A;  1CHU A;  2VQ7 A;  2CUL A;  4CCR A;  4DNA A;  2XLS A;  1K0I A;  1RYI A;  1GRA A;  4H4Q A;  1TYT A;  2X50 A;  2R0P A;  2YG6 A;  3AYJ A;  4YTM A;  3UOY A;  3FBS A;  1BZL A;  3H4K A;  4BJY A;  1Q1R A;  3V76 A;  2R0G A;  2TMD A;  4NZH A;  1OJ9 A;  3LJP A;  1CJ2 A;  2C66 A;  2B7R A;  2C75 A;  2R4J A;  1XPQ A;  3GYJ A;  1KSU A;  3DK8 A;  4U2T A;  1TDN A;  3GRT A;  3T2Y A;  3G5S A;  2RGH A;  3C4A A;  4EM3 A;  4JNQ A;  4Y4N A;  2GV8 A;  1DJQ A;  1YQZ A;  1ZMD A;  1LVL A;  3AXB A;  3QFB A;  3AWI A;  3G5Q A;  2WPE A;  3GD3 A; 
#chains in the Genus database with same CATH homology
 1PDH A;  4I58 A;  1IJH A;  1H6V A;  4IVM B;  5GRT A;  1PN0 A;  4YTP A;  5IQ4 A;  2QCU A;  2WP9 A;  3LZX A;  3P4P A;  1CF3 A;  5U1O A;  1EL5 A;  1TYP A;  3CPH G;  2V60 A;  1TDE A;  2BXS A;  4H4T A;  3WE0 A;  5KVI A;  4LII A;  2XLT A;  3ZYX A;  3ICT A;  1UKV G;  4H4X A;  4A9W A;  3VRA A;  1KNP A;  4TM3 A;  3KLJ A;  1NPX A;  4OPT A;  1Q9I A;  1H81 A;  2Q6U A;  3CNS A;  3D8X A;  2Z5X A;  3DK4 A;  4P9S A;  1N4U A;  1B37 A;  4BK2 A;  4EMW A;  2WHD A;  3NTA A;  2WOI A;  4Y4M A;  5EB4 A;  4Z25 A;  4K5S A;  4A65 A;  5CQF A;  1V59 A;  3ICR A;  3BNU A;  1TDO A;  3NYF A;  3RED A;  4A99 A;  2YLX A;  1D4D A;  4IVO B;  1IUU A;  1JNR A;  2FBW A;  2VOU A;  3UKQ A;  3ISH A;  3DGH A;  4B63 A;  1PJ7 A;  1H84 A;  5C2T A;  4A6N B;  3T37 A;  5KVH A;  4H4Z A;  3CMM A;  3O0H A;  3RNM A;  1ZMC A;  3B6D A;  3K30 A;  3RP8 A;  3CGE A;  4B65 A;  2R46 A;  2C7G A;  1LQT A;  2VQB A;  5FS6 A;  2BCG G;  2YG5 A;  1E1N A;  5KMP A;  2TPR A;  2YQU A;  1VQW A;  4CY8 A;  1ZOV A;  2YWL A;  2Q0K A;  2XVI A;  5KXJ A;  3CND A;  4KPR A;  1OJT A;  4O5Q A;  4EIP A;  4EQS A;  4EM4 A;  4X4J A;  2WP6 A;  1ELI A;  2VVM A;  2VRM A;  1KNR A;  2XFQ A;  3UKF A;  1GRH A;  2BS2 A;  3ABV A;  4USR A;  4U2S A;  4APN A;  4XWR A;  3KKJ A;  3EPT A;  2GB0 A;  3NHO X;  3AE8 A;  1GTH A;  1OJD A;  2XFO A;  4J36 A;  1GET A;  4YSX A;  2AR8 A;  2BK5 A;  2YLZ A;  4N9X A;  2XVH A;  4EQR A;  2GAG B;  3CNJ A;  1TDF A;  4YSY A;  1QJD A;  2ZBW A;  1M64 A;  2EQ9 A;  1VG0 A;  4CRT A;  5IPY A;  3SZF A;  5L46 A;  3QSM A;  1KF6 A;  1GER A;  2V5Z A;  2XVE A;  2OA1 A;  1NEK A;  2X3N A;  5U63 A;  4B69 A;  4GR1 A;  1EL9 A;  1L9C A;  3GDP A;  4IA5 A;  4UDQ A;  2OLO A;  4GF7 A;  3AEB A;  2VVL A;  3CGD A;  4REK A;  4M52 A;  4USQ A;  2WDV A;  2GR0 A;  1JOA A;  2CFY A;  4ECH A;  1D4E A;  4JN9 A;  3T2Z A;  1ZK7 A;  1LV0 A;  1LPF A;  1NHQ A;  1F8R A;  2Y6Q A;  3DA1 A;  3ALM A;  3VRD B;  2GVC A;  3NRN A;  1RP0 A;  2C67 A;  2JB1 A;  4J57 A;  1PHH A;  4GDE A;  1F3P A;  3NK1 X;  2JB2 A;  4B66 A;  4Z26 A;  3IF9 A;  2GR1 A;  4YKF A;  2FJE A;  3HZL A;  3RHA A;  2ZZB A;  2GF3 A;  1RSG A;  3AED A;  3VR8 A;  4JNA A;  2CVJ A;  3T14 A;  1GPE A;  4H2Q A;  1B5Q A;  4OPI A;  1DXL A;  4JQ9 A;  4U8M A;  4CY6 A;  4GUV A;  5JCL A;  3QVP A;  2WET A;  5HY5 A;  2WPF A;  1GTE A;  3NGC X;  5EOW A;  2WS3 A;  3LB8 A;  1CJ4 A;  2O9Z A;  2BRA A;  3G5R A;  2YG7 A;  2WDR A;  1GES A;  4Z2R A;  1OJA A;  3KVE A;  4U8J A;  2GEW A;  2PYX A;  3GYX A;  4JY3 A;  3SY4 A;  3ICS A;  3UKL A;  4NEW A;  1BGJ A;  4OPG A;  4AP1 A;  4EMI A;  4E0V A;  2H88 A;  1GAL A;  3AD8 B;  4Z2U A;  3GDN A;  2Y6R A;  3CNT A;  4K7Z A;  5KMS A;  1DJN A;  2YVJ A;  3UP4 A;  3ALJ A;  1CC2 A;  2XLR A;  5KMR A;  2OAM A;  2GMJ A;  3GWD A;  2C4C A;  2VRL A;  2XFN A;  3HYV A;  4K22 A;  2NPX A;  4GAP A;  1IUS A;  4O5U A;  4UDR A;  4WX1 A;  2XVJ A;  4GDP A;  4YWO A;  1BKW A;  3UP5 A;  2BA9 A;  4Z24 A;  1COY A;  3IC9 A;  3LOV A;  1OJC A;  3F8R A;  3AE1 A;  3NK0 X;  4GAV A;  4AOX A;  2PHH A;  2VZ2 A;  2WPC A;  4LU6 A;  1MOK A;  2WOW A;  3AYL A;  3KD9 A;  2EQ6 A;  1ZKQ A;  1GND A;  3E1T A;  1IUV A;  4AT0 A;  3HYX A;  4B68 A;  4G73 A;  1M6I A;  2R45 A;  2XDO A;  4A7A A;  5KOX A;  2VVL G;  5JCI A;  1CBO A;  1MO9 A;  5JCN A;  3PO7 A;  1NHS A;  3ATQ A;  5IQ1 A;  1BGN A;  5GSN A;  1D4C A;  1FEA A;  1EL7 A;  4ADW A;  4FK1 C;  3BI4 A;  1FCD A;  1E39 A;  1XHC A;  1JRZ A;  2QA1 A;  2JK6 A;  4CNK A;  3GYI A;  4BJZ A;  2V6O A;  3RP6 A;  2YLR A;  2GR3 A;  1FL2 A;  1GT8 A;  2C3D A;  3H8L A;  4OPC A;  3UKP A;  4CNJ A;  2C70 A;  3COX A;  4NTD A;  1QLB A;  1H7W A;  3AEG A;  3CGB A;  3AE6 A;  1PXC A;  4BV6 A;  4B67 A;  3NKS A;  5EBK A;  1MXT A;  3EAO A;  3BI5 A;  3P4Q A;  3S5W A;  1SEZ A;  4NTC A;  1GRE A;  2GQF A;  4BUR A;  1W4X A;  2F5Z A;  3AE5 A;  2BC0 A;  3SFE A;  2ACZ A;  4H4V A;  3NIX A;  5KMQ A;  5M10 A;  2EQ7 A;  1NHP A;  3AE4 A;  3SYI A;  3NK2 X;  2UZZ A;  2ARD A;  1F6M A;  2C64 A;  2E4G A;  2WDQ A;  4IA6 A;  2GAH B;  2YR5 A;  4OPD A;  1D5T A;  4H4R A;  3V3N A;  3JSK A;  1XDI A;  4BK3 A;  2XFU A;  4C5O A;  4TM1 A;  2BS3 A;  4U2L A;  1ZP0 A;  3K7M X;  2C72 A;  2OAL A;  3OZ2 A;  4I59 A;  2XYO A;  4Z2T A;  2J3N A;  4H2N A;  1IUX A;  5M0Z A;  3P1W A;  4OPL A;  4DSH A;  4YTN A;  4C3Y A;  1Z6L A;  4LA1 A;  4KX6 A;  3ATR A;  4YXD A;  1JNZ A;  2X8C A;  4RG3 A;  1DOD A;  1F8S A;  2BAB A;  4EMJ A;  3CGC A;  1P2H A;  1PBE A;  1E1L A;  1E6E A;  2E1M A;  1L9E A;  4AT2 A;  2V3A A;  2AQJ A;  1JRX A;  1S3B A;  2XLP A;  1YY5 A;  2C3C A;  1CL0 A;  2QAE A;  4UDP A;  3SQP A;  4YSH A;  1D7Y A;  4H4P A;  4U8L A;  4H4Y A;  2FJB A;  3ADA B;  1PXB A;  3GSI A;  4H4U A;  1GSN A;  3FG2 P;  3FMW A;  4K8D A;  2JB3 A;  3CTY A;  3BHK A;  3C4N A;  4WCT A;  4J31 A;  1BF3 A;  3UKH A;  3UCL A;  4ZN0 A;  3PS9 A;  1IUW A;  2XLU A;  3UKA A;  3SX6 A;  3DME A;  3UTH A;  3CN8 A;  2QA2 A;  2BCP A;  3L8K A;  1IUT A;  2YVF A;  5KOW A;  4PAA A;  3NYC A;  2DKH A;  4MJW A;  1O5W A;  2YR4 A;  1CJC A;  4J34 A;  3QSE A;  2YM1 A;  4B1B A;  3AD7 B;  4D03 A;  1O94 A;  2BAC A;  4OCG A;  4UP3 A;  3KPK A;  3UOZ A;  5LV9 A;  1GV4 A;  3I6D A;  4GCM A;  4NEV A;  2JBV A;  2BK3 A;  1DOC A;  3AEC A;  3M0O A;  4J33 A;  3II4 A;  2X8H A;  5BUL A;  5J7X A;  1PBD A;  2C76 A;  4BK1 A;  5BVA A;  3GD4 A;  1KDG A;  1KFY A;  1PXA A;  2WEU A;  2A8X A;  1BWC A;  2NVK X;  3ZDN A;  2V61 A;  4U8N A;  2A89 A;  2V3B A;  4XWZ A;  3B3R A;  2B7S A;  4H50 A;  3VRB A;  1X31 B;  3GRS A;  3LZW A;  4K2X A;  4OVI A;  5TR3 A;  1DOE A;  4IV9 A;  5ER0 A;  1YQ3 A;  2E5V A;  2BRY A;  3DH9 A;  1NDA A;  3BI2 A;  2GR2 A;  2RAB A;  2YLW A;  2APG A;  4AP3 A;  3BNM A;  3SZ0 A;  1JRY A;  4A79 A;  3AD9 B;  3NG7 X;  4CBQ A;  2FJD A;  3QSS A;  4TM0 A;  2YVG A;  1DOB A;  2Q7V A;  3Q9T A;  2R0C A;  4NWZ A;  5KNL A;  2YLT A;  2DKI A;  5KWF A;  2B9Y A;  3DK9 A;  1S3E A;  2WQY A;  3EAN A;  4D04 A;  1KSS A;  1F8W A;  2JKC A;  3NTD A;  5BRT A;  3OC4 A;  2YM2 A;  2IID A;  4DSG A;  1GRF A;  2OLN A;  4G6H A;  3S61 A;  3T2K A;  4EQX A;  1GXF A;  4Y4L A;  2WU2 A;  3AE9 A;  3P4R A;  4U8K A;  3AE3 A;  3SGL A;  4EQW A;  1FEC A;  1S2Q A;  4RG4 A;  4DGK A;  1VDC A;  1N4V A;  5EB5 A;  3SZC A;  3CPJ G;  3SXI A;  3T31 A;  4CCQ A;  5HYM A;  4XXG A;  1NAA A;  4OPU A;  3AEA A;  1LJ1 A;  1CC4 A;  5FS9 A;  1K4Q A;  4YKG A;  2B9X A;  1ONF A;  2FJA A;  2GRT A;  5HHF A;  1PS9 A;  3NYE A;  1NEN A;  1ZY8 A;  4II3 A;  3LXD A;  1EL8 A;  4C3X A;  3M12 A;  3R9U A;  3AE7 A;  3NN0 X;  1N1P A;  3UTF A;  1P2E A;  3UTE A;  1D7L A;  1VRQ B;  3K7Q X;  3H8I A;  4Z44 A;  3VR9 A;  2B76 A;  3Q6J A;  3GWF A;  3SFD A;  1S2Y A;  2GMH A;  4H4W A;  2H89 A;  4U8O A;  3NLC A;  4TLZ A;  4J56 A;  3QJ4 A;  2CDU A;  4K5R A;  3VQR A;  2XFP A;  4J2W A;  1B8S A;  4II2 A;  1O95 A;  1GRG A;  2B9W A;  3KU9 A;  3EF6 A;  4EIQ A;  4A5L A;  3FIM B;  4NTE A;  3IWA A;  1VG9 A;  1NG4 A;  3AYI A;  3CPI G;  1K0L A;  3P9U A;  3UKK A;  3D1C A;  1TDK A;  1REO A;  1N4W A;  3GMC A;  1GRB A;  3RP7 A;  3UTG A;  4X9N A;  1PBC A;  2WES A;  3IHM A;  2WU5 A;  4PAB A;  4TM4 A;  2Z5Y A;  2WBA A;  4HA6 A;  1H7X A;  2YG3 A;  1ZDL A;  5FS7 A;  3PVC A;  1E1K A;  3AEF A;  3M13 A;  5FS8 A;  3DJJ A;  5U25 A;  1XAN A;  1Y56 B;  1FEB A;  4G74 A;  1JEH A;  3ALL A;  1GRT A;  2BS4 A;  3C96 A;  1PJ6 A;  1H83 A;  2IVE A;  2WOV A;  2HQM A;  2X99 A;  2XCG A;  3L1R A;  4H2R A;  2BYB A;  2EQ8 A;  4H7U A;  3I3L A;  4JDR A;  4H4S A;  3F8D A;  2Q0L A;  4RSL A;  4X9M A;  3NN6 X;  1B4V A;  3NT6 A;  4ICY A;  1CC6 A;  5KRQ A;  2JAE A;  3SZW A;  1H82 A;  3ITJ A;  1YQ4 A;  3HYW A;  4ZCC A;  4HB9 A;  3URH A;  4U8P A;  4NNJ A;  4U8I A;  1E1M A;  3UOX A;  1Q1W A;  1PBF A;  2YG4 A;  3DJE A;  2RGJ A;  2W0H A;  1K0J A;  3K7T A;  1AOG A;  1H86 A;  4AOS A;  3CIR A;  3F8P A;  2C65 A;  3UOV A;  1PBB A;  2YAU A;  1NHR A;  3NNE A;  4FK1 A;  4FDC B;  3FPZ A;  3GMB A;  2BK4 A;  3AE2 A;  1L0V A;  4B64 A;  2ZZC A;  4C74 A;  4GRT A;  4YSZ A;  3P4S A;  1YKJ A;  2IVD A;  5HXI A;  1PJ5 A;  1LTX R;  1TRB A;  2A87 A;  2C73 A;  5BUK A;  3IHG A;  3KA7 A;  5C3J A;  1CJ3 A;  2AAQ A;  2I0Z A;  5JCM A;  1EBD A;  4G9K A;  1DNC A;  4FX9 A;  3DGZ A;  3DJG X;  4YT0 A;  2X8G A;  2YLS A;  4G6G A;  1L9D A;  1E7P A;  3CNP A;  1JU2 A;  4A6N A;  2ZZ0 A;  4TLX A;  4H2P A;  2GQW A;  2BC1 A;  1ZOY A;  1Y56 A;  1GEU A;  1LQU A;  1HYU A;  2RGO A;  3AEE A;  5J60 A;  4JY2 A;  3QFA A;  2BXR A;  3NH3 X;  2WP5 A;  5FMH A;  1QO8 A;  1Y0P A;  4ZCD A;  3T0K A;  3AB1 A;  3DJD A;  4Z43 A;  1GOS A;  3SM8 A;  2YR6 A;  1FOH A;  5JCK A;  4C77 A;  3BHF A;  5CKU A;  2R4E A;  3KPF A;  2XVF A;  2R9Z A;  3QVR A;  1ZX9 A;  2GH5 A;  5DBJ A;  1NG3 A;  3LAD A;  3V3O A;  1CHU A;  2VQ7 A;  2CUL A;  4CCR A;  4DNA A;  2XLS A;  1K0I A;  1RYI A;  1GRA A;  4H4Q A;  1TYT A;  2X50 A;  2R0P A;  2YG6 A;  3AYJ A;  4YTM A;  3UOY A;  3FBS A;  1BZL A;  3H4K A;  4BJY A;  1Q1R A;  3V76 A;  2R0G A;  2TMD A;  4NZH A;  1OJ9 A;  3LJP A;  1CJ2 A;  2C66 A;  2B7R A;  2C75 A;  2R4J A;  1XPQ A;  3GYJ A;  1KSU A;  3DK8 A;  4U2T A;  1TDN A;  3GRT A;  3T2Y A;  3G5S A;  2RGH A;  3C4A A;  4EM3 A;  4JNQ A;  4Y4N A;  2GV8 A;  1DJQ A;  1YQZ A;  1ZMD A;  1LVL A;  3AXB A;  3QFB A;  3AWI A;  3G5Q A;  2WPE A;  3GD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...