5BVAA

Structure of flavin-dependent brominase bmp2
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
398
Chain Sequence
THYDVVIIGSGPAGSLCGIECRKKGLSVLCIEKEQFPRFHIGESLTGNAGQIIRDLGLAEDMDAAGFPDKPGVNVIGSLSKNEFFIPILAPTWQVRRSDFDDMIKRKAVEHGVEYKLGMVTDVIKDGEKVVGALYKAGVEHQVRSKVLVDASGQNTFLSRKGVAGKRQIEFFSQQIASFAHYKGVERDLPPFSTNTTILYSKQYHWSWIIPISPDTDSLGVVIPKDLYYKECKNPDDAIAWGMDHISPELKRRFKNAERQGDSQSMADFSYRIEPFVGDGWMCIGDAHRFLDPIFSYGVSFAMKEGIRAAEAIAQVVAGQDWKAPFYAYRDWSNGGQQIAADLIRYFWIYPIFFGYQMQNPDLRDEVIRLLGGCCFDCEGWKAPAIFRNAIEEYDRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords flavin-dependent halogenase
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces
total genus 146
structure length 398
sequence length 399
ec nomenclature
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bvaA00
2EQ7A 1JU2A 2XFUA 1NENA 4A6NB 2YR6A 4B66A 2GMJA 4BV6A 3RP8A 1VQWA 2Y6RA 1PN0A 3AE6A 1LPFA 1TDEA 2VQ7A 4Z2TA 1N1PA 5FMHA 4JY2A 1GRGA 1BZLA 4C3YA 5KOXA 3UTEA 3VRAA 1CC4A 3LOVA 4DNAA 2VVLG 4RG3A 4BJZA 5KOWA 4OPIA 4U8OA 2H88A 3S5WA 2WP5A 1DODA 1LQTA 2XLRA 3KVEA 4XXGA 2YLZA 1L9EA 1GTHA 2WP6A 4H4VA 3VRDB 2JB2A 3ICSA 4LU6A 3I6DA 3CGBA 2JB1A 4J36A 1B4VA 4TM4A 3GWDA 4H50A 5FS8A 1KDGA 4BK3A 3NRNA 3RP6A 4CNJA 1NHRA 2XFNA 5J7XA 3UKHA 3T37A 3F8RA 4CCQA 4RSLA 1ZDLA 1JRZA 2FJBA 3C4NA 3URHA 1OJDA 1P2HA 2X50A 3H4KA 5KRQA 4H4YA 1FECA 4OPLA 4U8MA 1S3BA 1TYPA 4REKA 3UP4A 2C66A 2XYOA 2GEWA 4GDPA 2WOVA 1VG9A 2B76A 4TM3A 4OCGA 3BNUA 3SGLA 2X99A 4BURA 4H2QA 3IF9A 3VR8A 4H4WA 4Z2RA 3ATRA 3AE5A 2AR8A 2GQFA 2VZ2A 3KA7A 1DJNA 1EL8A 3GD3A 1FL2A 4Z44A 3AEAA 3Q6JA 4OVIA 1QO8A 3AEEA 3GD4A 3L1RA 2F5ZA 1D5TA 4YTMA 4YWOA 3S61A 1PXAA 3AE1A 2BABA 4DSGA 2ZZCA 3C4AA 2C7GA 2ARDA 1OJCA 1OJTA 2C65A 1K0JA 4K5SA 2V6OA 3RNMA 2NPXA 5JCMA 4OPTA 3DA1A 1JOAA 3VRBA 3AE3A 3DJGX 2DKHA 3DK9A 4BK1A 3KD9A 2WU5A 5BRTA 1PBCA 2X3NA 1DJQA 4USQA 4J31A 3VR9A 4GF7A 1L9CA 3ICTA 4H4UA 1F8WA 1Y56B 3NGCX 4HB9A 4GDEA 1KSUA 5CKUA 1L0VA 4B64A 2BK5A 4O5QA 1BKWA 2VOUA 1ELIA 3LADA 3UOXA 3QVPA 4AOXA 1K0LA 4H4TA 3G5QA 4IA5A 1BGNA 3AECA 4ICYA 4U2SA 2YR5A 2WOIA 3NIXA 2O9ZA 5BUKA 3UKAA 4AOSA 3GYIA 3UP5A 3FIMB 3IHMA 1DNCA 2NVKX 3D1CA 1QLBA 4B69A 4Y4NA 1W4XA 2FJEA 2WQYA 3LXDA 4I58A 5JCKA 2XFOA 5M10A 3GWFA 4E0VA 3NYFA 3P4RA 1NHSA 4TLXA 4JN9A 1HYUA 3AE2A 4ZCCA 1VDCA 3GSIA 3ALJA 2W0HA 1NHPA 5FS9A 3SM8A 2WETA 3JSKA 4JNAA 3SFEA 1F8RA 2Q0KA 3UOZA 5GRTA 4A7AA 4AT0A 1XANA 4H4QA 3SQPA 2QAEA 4O5UA 4TM1A 2APGA 3UCLA 4Z24A 4YTPA 3AE8A 2WDQA 1LV0A 2YVJA 2VRLA 2XLSA 4UDQA 1LQUA 2I0ZA 2WS3A 5KVIA 1N4VA 2X8GA 2YG4A 2C64A 2YLSA 2BC0A 4J2WA 4JNQA 4U8NA 4Z43A 1NPXA 1D4EA 1O95A 4C5OA 5LV9A 3CGEA 1GOSA 4YSHA 4CNKA 3AYLA 2BS3A 2YG7A 2YWLA 1N4WA 3ADAB 4I59A 2BYBA 2V5ZA 3EAOA 4B67A 5BVAA 4CBQA 4NTCA 3DJEA 3SFDA 2OALA 1UKVG 4UP3A 4APNA 4BJYA 2WDVA 1CJ4A 3VQRA 1E1LA 5IQ1A 2B9XA 2ZZ0A 3ZYXA 4WX1A 4A9WA 3ITJA 4Z26A 4K5RA 3QSMA 4LIIA 4YSXA 1FCDA 1PHHA 2YLXA 2XFQA 3NT6A 4UDPA 3UOYA 3CNSA 4EIQA 4ZN0A 1IUWA 3K7MX 4U8KA 3H8IA 3KPFA 1N4UA 1DOCA 1CJ3A 3REDA 4H2NA 2AAQA 1DOBA 1PJ5A 3QFBA 5JCIA 1TDFA 1E1MA 1GTEA 2C70A 4EM3A 3UTFA 5J60A 4J57A 1PXBA 2CFYA 3B3RA 3D8XA 1VRQB 3OC4A 4U8JA 1AOGA 2A89A 1Y0PA 2GB0A 4YTNA 4P9SA 2TPRA 1B37A 3CPHG 4U2TA 2XDOA 3DGHA 1IJHA 1IUVA 1CJCA 3AEDA 2R0CA 1GRHA 4OPUA 1GXFA 2WPEA 1MOKA 2C67A 5EB5A 1REOA 4YKGA 3DH9A 3ZDNA 1XHCA 4H4SA 2WBAA 2RABA 2QA2A 5KWFA 4NEVA 4H4ZA 4EMIA 2B7RA 5C3JA 2WEUA 1GRFA 1M6IA 3ISHA 4YSZA 1XPQA 3C96A 3GMCA 4FK1C 4A99A 2BS4A 1GV4A 2CDUA 2PHHA 4EMJA 1E7PA 1E6EA 1KFYA 1V59A 2YM2A 3AE7A 3ICRA 1K0IA 1E1KA 2VVMA 2GF3A 2WP9A 3IHGA 4WCTA 5KXJA 4C74A 2EQ8A 1PBBA 3BI2A 1H83A 2GQWA 4EQRA 1GETA 3BI5A 3DMEA 2BS2A 4J33A 1ZKQA 2BK4A 4N9XA 1TRBA 4ECHA 2R0PA 1L9DA 2X8CA 3AYIA 2R0GA 3UKKA 3UTHA 4NEWA 1FEBA 1CBOA 5M0ZA 3G5SA 4AP3A 3NHOX 4FX9A 4OPGA 1MXTA 3NK0X 4IA6A 4OPCA 3EANA 4B1BA 2Q0LA 4H4RA 1PJ6A 2HQMA 3IWAA 3FMWA 3P4PA 4RG4A 2XVIA 1GT8A 2YLWA 3UKLA 3P4SA 2C76A 4J34A 3WE0A 1NAAA 1ZOVA 1JEHA 3PS9A 4K8DA 2B9WA 2WOWA 3HZLA 3PO7A 1GPEA 4PABA 3E1TA 4TLZA 3BNMA 2C75A 3K7TA 2YLRA 3NTAA 5EBKA 1GNDA 1D4DA 1YQ4A 2JBVA 1F8SA 3GDPA 2GR2A 1PXCA 3NG7X 4DGKA 3CTYA 4YSYA 2V61A 5KVHA 1GESA 1EBDA 1P2EA 1FOHA 4A5LA 4MJWA 5U63A 4DSHA 1COYA 2WPCA 3P4QA 1GERA 2QA1A 3NN0X 4KX6A 4U2LA 3QJ4A 2YM1A 3F8DA 2WPFA 1CC2A 1LJ1A 3K7QX 5IPYA 2OLNA 5EB4A 2BCGG 3BHFA 3AWIA 3G5RA 2RGHA 1YQ3A 2XLUA 3ALLA 1GREA 2GMHA 2XVHA 3P9UA 3ALMA 3ATQA 4UDRA 4GRTA 1EL5A 5FS7A 2E5VA 2Q7VA 3IC9A 1BWCA 2GR0A 2GR1A 3AD7B 4EQSA 1H6VA 2WDRA 3LZWA 1KF6A 4CRTA 4A6NA 4B65A 4Z2UA 1GALA 3M12A 2C3CA 4AT2A 3AYJA 3GRSA 1SEZA 2C73A 1ZP0A 3NYEA 1PJ7A 1E39A 4K2XA 1TYTA 2H89A 1PBFA 3LJPA 4PAAA 5HY5A 2FBWA 4U8IA 4M52A 3CNTA 2GH5A 2JAEA 1H84A 5U25A 4EM4A 3RHAA 3AD8B 2OA1A 1ZMDA 3AE9A 3BHKA 4IVOB 4EMWA 2E4GA 3LB8A 3V3OA 4H2PA 2YAUA 4NTEA 1IUSA 4C3XA 2B7SA 2WU2A 2GR3A 4Z25A 4U8LA 2QCUA 3II4A 5HHFA 5ER0A 3DK4A 5EOWA 2BK3A 4B68A 3PVCA 1JRYA 1S2YA 3GRTA 3NH3X 2XVEA 2XFPA 2YG5A 2YQUA 3AB1A 4H7UA 1RSGA 3DJJA 4X4JA 2EQ6A 1YKJA 2ZBWA 5C2TA 2E1MA 3CIRA 3QSSA 3KLJA 1PBEA 3CNJA 4LA1A 4H4XA 3RP7A 1CHUA 4TM0A 2J3NA 1ONFA 1NG4A 1RYIA 3ABVA 3CN8A 5HYMA 2IVDA 2BC1A 1VG0A 1O94A 2VRMA 3QSEA 5IQ4A 2XVJA 4C77A 1PS9A 4GCMA 3M0OA 2C72A 2OLOA 1F3PA 1KSSA 1KNPA 1YY5A 3AXBA 4X9NA 4Y4LA 1KNRA 4H4PA 4YT0A 3DGZA 2WHDA 5CQFA 3V76A 4D04A 1YQZA 1IUUA 3NKSA 2XCGA 3QFAA 4IVMB 1NG3A 3UTGA 2YG3A 4K7ZA 4A79A 1D7LA 3KU9A 1XDIA 2R45A 1DOEA 1X31B 2DKIA 3O0HA 5GSNA 4AP1A 2GRTA 2CVJA 1GRAA 1D4CA 1NDAA 3NYCA 4KPRA 4U8PA 2GAHB 2JKCA 3DK8A 4XWRA 4K22A 1Q1WA 2BCPA 1FEAA 1QJDA 1ZOYA 2UZZA 1M64A 1JNZA 2V3AA 3CPJG 3NTDA 5L46A 3EPTA 1H7XA 3AEBA 3B6DA 4XWZA 3UKQA 1GEUA 3AEFA 1TDKA 4JDRA 3FBSA 2XVFA 2R4EA 1Y56A 3GYJA 4BK2A 2JB3A 1H82A 1LTXR 4USRA 3DJDA 5DBJA 1ZY8A 1S3EA 3I3LA 3AD9B 3CPIG 3L8KA 1CC6A 1B8SA 2V60A 4ZCDA 1H81A 1JRXA 3BI4A 3NN6X 2GVCA 1H86A 2R46A 2XLTA 5TR3A 2EQ9A 1EL9A 2Q6UA 2V3BA 2YR4A 3CNDA 4Y4MA 3COXA 4D03A 4GR1A 4FK1A 4IV9A 2FJDA 2OAMA 4OPDA 5HXIA 3NNEA 2A87A 2BXSA 1TDOA 3CGDA 4EQWA 1JNRA 3EF6A 4J56A 2PYXA 2CULA 1Z6LA 1B5QA 2GAGB 2Y6QA 4CCRA 4A65A 5BULA 2XLPA 3K30A 1PBDA 4NTDA 5U1OA 4H2RA 3UKFA 1CJ2A 2Z5YA 3GDNA 2YVFA 5FS6A 3AEGA 3LZXA 1LVLA 2Z5XA 2RGOA 3NK1X 3CGCA 1PDHA 1GSNA 3NK2X 3UKPA 2YLTA 4CY8A 3FPZA 1H7WA 4EIPA 1ZMCA 1D7YA 4YKFA 3AE4A 1F6MA 2YVGA 1Q9IA 2ACZA 4YXDA 1IUTA 1OJAA 1BF3A 4B63A 2R4JA 1S2QA 2AQJA 3FG2P 3GMBA 4JQ9A 4ADWA 5JCLA 2VQBA 2YG6A 3NLCA 2WESA 1IUXA 3F8PA 2BA9A 4CY6A 4JY3A 4HA6A 2JK6A 1CF3A 4GUVA 1BGJA 2R9ZA 1Q1RA 1OJ9A 4FDCB 2A8XA 2GV8A 2TMDA 1ZX9A 5JCNA 2VVLA 2RGJA 2X8HA 1E1NA 1GRTA 3KKJA 1O5WA 2BXRA 2C3DA 1NEKA 1CL0A 3H8LA 1RP0A 2ZZBA 3Q9TA 3OZ2A 3UOVA 3R9UA 3M13A 3CNPA 2B9YA 4EQXA 3V3NA 1MO9A 1ZK7A 1GRBA 1K4QA 4NZHA 1NHQA 2IIDA 2FJAA 1TDNA 4X9MA 2IVEA 1EL7A 1DXLA 2BACA 3P1WA 3QVRA
chains in the Genus database with same CATH superfamily
2EQ7A 1JU2A 2XFUA 1NENA 4A6NB 2YR6A 4B66A 2GMJA 4BV6A 3RP8A 1VQWA 2Y6RA 1PN0A 3AE6A 1LPFA 1TDEA 2VQ7A 4Z2TA 1N1PA 5FMHA 4JY2A 1GRGA 1BZLA 4C3YA 5KOXA 3UTEA 3VRAA 1CC4A 3LOVA 4DNAA 3T2ZA 2VVLG 4RG3A 4BJZA 5KOWA 4OPIA 4U8OA 2H88A 3S5WA 2WP5A 1DODA 1LQTA 2XLRA 3KVEA 4XXGA 2YLZA 1L9EA 1GTHA 2WP6A 4H4VA 3VRDB 2JB2A 3ICSA 4LU6A 3I6DA 5KMPA 3CGBA 2JB1A 4J36A 1B4VA 4TM4A 3GWDA 4H50A 5FS8A 1KDGA 4BK3A 3NRNA 3RP6A 4CNJA 1NHRA 2XFNA 5J7XA 3UKHA 3T37A 3F8RA 4CCQA 4RSLA 1ZDLA 1JRZA 2FJBA 3C4NA 3URHA 1OJDA 1P2HA 2X50A 3H4KA 5KRQA 4H4YA 1FECA 4OPLA 4U8MA 1S3BA 1TYPA 4REKA 3UP4A 2C66A 2XYOA 2GEWA 4GDPA 2WOVA 1VG9A 2B76A 4TM3A 4OCGA 3BNUA 3SGLA 2X99A 4BURA 3HYXA 4H2QA 3IF9A 3VR8A 4H4WA 4Z2RA 3ATRA 3AE5A 2AR8A 2GQFA 2VZ2A 3KA7A 1DJNA 1EL8A 3GD3A 1FL2A 4G73A 3AEAA 4Z44A 3Q6JA 4OVIA 4NNJA 1QO8A 3AEEA 3GD4A 3L1RA 2F5ZA 1D5TA 4YTMA 4YWOA 3S61A 1PXAA 3AE1A 2BABA 4DSGA 2ZZCA 3C4AA 2C7GA 2ARDA 1OJCA 1OJTA 2C65A 3T2YA 1K0JA 4K5SA 2V6OA 3RNMA 2NPXA 5JCMA 4OPTA 3DA1A 1JOAA 3VRBA 3AE3A 3DJGX 2DKHA 3DK9A 4BK1A 3KD9A 2WU5A 5BRTA 1PBCA 2X3NA 1DJQA 4USQA 4J31A 3VR9A 4GF7A 1L9CA 3ICTA 4H4UA 1F8WA 1Y56B 3NGCX 4HB9A 4GDEA 1KSUA 5CKUA 1L0VA 4B64A 2BK5A 4O5QA 1BKWA 2VOUA 1ELIA 3LADA 3UOXA 3QVPA 4AOXA 1K0LA 4H4TA 3G5QA 4IA5A 1BGNA 3AECA 4ICYA 4U2SA 2YR5A 2WOIA 3NIXA 2O9ZA 5BUKA 3UKAA 4AOSA 3GYIA 3UP5A 5KMSA 4II3A 3FIMB 3IHMA 1DNCA 2NVKX 3D1CA 1QLBA 4B69A 4Y4NA 1W4XA 2FJEA 2WQYA 3LXDA 4I58A 5JCKA 2XFOA 5M10A 3GWFA 4E0VA 3NYFA 3P4RA 1NHSA 4TLXA 4JN9A 1HYUA 3AE2A 4ZCCA 1VDCA 3GSIA 3ALJA 2W0HA 1NHPA 5FS9A 3SM8A 2WETA 3JSKA 4JNAA 3SFEA 1F8RA 2Q0KA 3UOZA 5GRTA 4A7AA 4AT0A 1XANA 4H4QA 3SQPA 2QAEA 4O5UA 4TM1A 2APGA 3UCLA 4Z24A 4YTPA 3AE8A 2WDQA 1LV0A 2YVJA 2VRLA 2XLSA 4UDQA 1LQUA 2I0ZA 2WS3A 5KVIA 1N4VA 2X8GA 2YG4A 2C64A 2YLSA 2BC0A 4J2WA 4JNQA 4U8NA 4Z43A 1NPXA 1D4EA 1O95A 4C5OA 5LV9A 3CGEA 1GOSA 4YSHA 4CNKA 3AYLA 3HYWA 2BS3A 2YG7A 2YWLA 1N4WA 3ADAB 3SYIA 4I59A 2BYBA 2V5ZA 3EAOA 4B67A 5BVAA 4CBQA 4NTCA 3DJEA 3SFDA 2OALA 1UKVG 4UP3A 4APNA 4BJYA 2WDVA 1CJ4A 3VQRA 1E1LA 5IQ1A 2B9XA 2ZZ0A 3ZYXA 4WX1A 4A9WA 3ITJA 2BRYA 4Z26A 4K5RA 3QSMA 4LIIA 4YSXA 1FCDA 1PHHA 2YLXA 2XFQA 3NT6A 4UDPA 3UOYA 3CNSA 4EIQA 4ZN0A 1IUWA 3K7MX 4U8KA 3H8IA 3KPFA 1N4UA 1DOCA 1CJ3A 3REDA 4H2NA 2AAQA 1DOBA 1PJ5A 3QFBA 5JCIA 1TDFA 1E1MA 1GTEA 2C70A 4EM3A 3UTFA 5J60A 4J57A 1PXBA 2CFYA 3B3RA 3D8XA 1VRQB 3OC4A 4U8JA 1AOGA 2A89A 1Y0PA 2GB0A 4YTNA 4P9SA 2TPRA 1B37A 3CPHG 4U2TA 2XDOA 4G74A 3DGHA 1IJHA 4G9KA 1IUVA 1CJCA 3AEDA 3T31A 2R0CA 1GRHA 4OPUA 1GXFA 2WPEA 3SY4A 1MOKA 2C67A 5EB5A 1REOA 4YKGA 3DH9A 3ZDNA 1XHCA 4H4SA 2WBAA 2RABA 2QA2A 5KWFA 4NEVA 4H4ZA 4EMIA 2B7RA 5C3JA 2WEUA 1GRFA 1M6IA 3ISHA 4YSZA 1XPQA 3C96A 3GMCA 4FK1C 4A99A 2BS4A 1GV4A 2CDUA 2PHHA 4EMJA 1E7PA 1E6EA 1KFYA 1V59A 2YM2A 3AE7A 3ICRA 1K0IA 1E1KA 2VVMA 2GF3A 2WP9A 3IHGA 4WCTA 5KXJA 4C74A 2EQ8A 1PBBA 3BI2A 1H83A 2GQWA 4EQRA 1GETA 3BI5A 3DMEA 2BS2A 4J33A 3SZWA 1ZKQA 2BK4A 4N9XA 1TRBA 3CMMA 2R0PA 1L9DA 4ECHA 2X8CA 3AYIA 2R0GA 3UKKA 3SZ0A 3UTHA 4NEWA 1FEBA 1CBOA 5M0ZA 3G5SA 4AP3A 3NHOX 4FX9A 4OPGA 1MXTA 3NK0X 4IA6A 4OPCA 3EANA 4B1BA 2Q0LA 4H4RA 1PJ6A 2HQMA 3IWAA 3FMWA 3P4PA 4RG4A 2XVIA 1GT8A 2YLWA 3UKLA 3P4SA 2C76A 4J34A 3WE0A 1NAAA 1ZOVA 1JEHA 3PS9A 4K8DA 4NWZA 4II2A 2B9WA 2WOWA 3HZLA 3PO7A 1GPEA 4PABA 3E1TA 4TLZA 3BNMA 2C75A 3K7TA 2YLRA 3NTAA 5EBKA 1GNDA 1D4DA 1YQ4A 2JBVA 1F8SA 3GDPA 2GR2A 1PXCA 3NG7X 4DGKA 3CTYA 4YSYA 2V61A 5KVHA 1GESA 1EBDA 1P2EA 1FOHA 4A5LA 4MJWA 5U63A 4DSHA 1COYA 2WPCA 3P4QA 1GERA 2QA1A 3NN0X 4KX6A 4U2LA 3QJ4A 2YM1A 3F8DA 2WPFA 1CC2A 1LJ1A 3K7QX 5IPYA 2OLNA 5EB4A 2BCGG 4GAPA 3BHFA 3AWIA 3G5RA 2RGHA 1YQ3A 2XLUA 3ALLA 1GREA 2GMHA 2XVHA 3P9UA 3ALMA 3ATQA 4UDRA 4GRTA 1EL5A 5FS7A 2E5VA 3KPKA 2Q7VA 3IC9A 1BWCA 2GR0A 2GR1A 3AD7B 4EQSA 1H6VA 2WDRA 3LZWA 1KF6A 4CRTA 4A6NA 4B65A 4Z2UA 1GALA 3M12A 2C3CA 4AT2A 3AYJA 3GRSA 1SEZA 2C73A 1ZP0A 3NYEA 1PJ7A 1E39A 4K2XA 1TYTA 2H89A 1PBFA 3LJPA 4PAAA 5HY5A 2FBWA 4U8IA 4M52A 3CNTA 2GH5A 2JAEA 1H84A 5U25A 4EM4A 3RHAA 3AD8B 2OA1A 1ZMDA 3AE9A 3BHKA 4IVOB 4EMWA 2E4GA 3LB8A 3V3OA 4H2PA 2YAUA 4NTEA 1IUSA 4C3XA 2B7SA 2WU2A 2GR3A 4Z25A 4U8LA 2QCUA 3II4A 5HHFA 5ER0A 3DK4A 5EOWA 2BK3A 4B68A 3PVCA 1JRYA 1S2YA 3GRTA 3NH3X 2XVEA 2XFPA 2YG5A 2YQUA 3AB1A 4H7UA 1RSGA 3DJJA 3HYVA 4X4JA 3T0KA 2EQ6A 1YKJA 2ZBWA 5C2TA 2E1MA 3CIRA 3QSSA 3KLJA 1PBEA 3CNJA 4LA1A 4H4XA 3RP7A 1CHUA 4TM0A 2J3NA 1ONFA 1NG4A 1RYIA 3ABVA 3CN8A 5HYMA 2IVDA 2BC1A 1VG0A 3SZFA 1O94A 2VRMA 3QSEA 5IQ4A 2XVJA 4C77A 1PS9A 3GYXA 4GCMA 3M0OA 2C72A 2OLOA 1F3PA 1KSSA 1KNPA 1YY5A 3AXBA 4X9NA 4Y4LA 1KNRA 4H4PA 4YT0A 3DGZA 2WHDA 5CQFA 3V76A 4D04A 1YQZA 1IUUA 3NKSA 2XCGA 3QFAA 4IVMB 1NG3A 3UTGA 2YG3A 4G6GA 4K7ZA 4A79A 1D7LA 3KU9A 1XDIA 2R45A 1DOEA 1X31B 2DKIA 3O0HA 5GSNA 4AP1A 2GRTA 2BRAA 2CVJA 1GRAA 1D4CA 1NDAA 3NYCA 4KPRA 4U8PA 2GAHB 2JKCA 3DK8A 4XWRA 4K22A 1Q1WA 2BCPA 1FEAA 1QJDA 1ZOYA 2UZZA 1M64A 1JNZA 2V3AA 3CPJG 3NTDA 5L46A 4G6HA 3EPTA 1H7XA 3AEBA 3B6DA 4XWZA 3UKQA 1GEUA 3AEFA 1TDKA 4JDRA 3FBSA 2XVFA 2R4EA 1Y56A 3GYJA 4BK2A 2JB3A 1H82A 1LTXR 4USRA 3DJDA 5DBJA 1ZY8A 1S3EA 3I3LA 3AD9B 3SZCA 3CPIG 3L8KA 1CC6A 3SX6A 5KNLA 1B8SA 2V60A 4ZCDA 1H81A 1JRXA 3BI4A 3NN6X 2GVCA 1H86A 2R46A 2XLTA 5TR3A 2EQ9A 1EL9A 2Q6UA 2V3BA 2YR4A 3CNDA 4GAVA 4Y4MA 3COXA 4D03A 4GR1A 4FK1A 4IV9A 2FJDA 2OAMA 4OPDA 5HXIA 3NNEA 2A87A 2BXSA 1TDOA 3CGDA 4EQWA 1JNRA 3EF6A 4J56A 2PYXA 2CULA 1Z6LA 1B5QA 2GAGB 2Y6QA 4CCRA 4A65A 5BULA 2XLPA 3K30A 1PBDA 4NTDA 5KMRA 5U1OA 4H2RA 3UKFA 1CJ2A 2Z5YA 3GDNA 3SXIA 2YVFA 5FS6A 3AEGA 3LZXA 1LVLA 2Z5XA 2RGOA 3NK1X 3CGCA 1PDHA 1GSNA 3NK2X 3UKPA 2C4CA 2YLTA 4CY8A 3FPZA 1H7WA 4EIPA 1ZMCA 1D7YA 4YKFA 3AE4A 1F6MA 2YVGA 1Q9IA 2ACZA 4YXDA 1IUTA 1OJAA 1BF3A 4B63A 2R4JA 1S2QA 2AQJA 3FG2P 3GMBA 4JQ9A 3T14A 4ADWA 2VQBA 2YG6A 3NLCA 2WESA 3T2KA 5JCLA 1IUXA 3F8PA 2BA9A 4CY6A 4JY3A 4HA6A 2JK6A 1CF3A 4GUVA 1BGJA 2R9ZA 1Q1RA 1OJ9A 4FDCB 2A8XA 2GV8A 2TMDA 1ZX9A 5JCNA 5KMQA 2VVLA 2RGJA 2X8HA 1E1NA 1GRTA 3KKJA 1O5WA 2BXRA 2C3DA 1NEKA 1CL0A 3H8LA 1RP0A 2ZZBA 3Q9TA 3OZ2A 3UOVA 3R9UA 3M13A 3CNPA 2B9YA 4EQXA 3V3NA 1MO9A 1ZK7A 1GRBA 1K4QA 4NZHA 1NHQA 2IIDA 2FJAA 1TDNA 4X9MA 2IVEA 1EL7A 1DXLA 2BACA 3P1WA 3QVRA
chains in the Genus database with same CATH topology
2EQ7A 1JU2A 2XFUA 1NENA 4A6NB 2YR6A 4B66A 2GMJA 4BV6A 3RP8A 1VQWA 2Y6RA 1PN0A 3AE6A 1LPFA 1TDEA 2VQ7A 4Z2TA 1N1PA 5FMHA 4JY2A 1GRGA 1BZLA 4C3YA 5KOXA 3UTEA 3VRAA 1CC4A 3LOVA 4DNAA 3T2ZA 2VVLG 4RG3A 4BJZA 5KOWA 4OPIA 4U8OA 2H88A 3S5WA 2WP5A 1DODA 1LQTA 2XLRA 3KVEA 4XXGA 2YLZA 1L9EA 1GTHA 2WP6A 4H4VA 3VRDB 2JB2A 3ICSA 4LU6A 3I6DA 5KMPA 3CGBA 2JB1A 4J36A 1B4VA 4TM4A 3GWDA 4H50A 5FS8A 1KDGA 4BK3A 3NRNA 3RP6A 4CNJA 1NHRA 2XFNA 5J7XA 3UKHA 3T37A 3F8RA 4CCQA 4RSLA 1ZDLA 1JRZA 2FJBA 3C4NA 3URHA 1OJDA 1P2HA 2X50A 3H4KA 5KRQA 4H4YA 1FECA 4OPLA 4U8MA 1S3BA 1TYPA 4REKA 3UP4A 2C66A 2XYOA 2GEWA 4GDPA 2WOVA 1VG9A 2B76A 4TM3A 4OCGA 3BNUA 3SGLA 2X99A 4BURA 3HYXA 4H2QA 3IF9A 3VR8A 4H4WA 4Z2RA 3ATRA 3AE5A 2AR8A 2GQFA 2VZ2A 3KA7A 1DJNA 1EL8A 3GD3A 1FL2A 4G73A 3AEAA 4Z44A 3Q6JA 4OVIA 4NNJA 1QO8A 3AEEA 3GD4A 3L1RA 2F5ZA 1D5TA 4YTMA 4YWOA 3S61A 1PXAA 3AE1A 2BABA 4DSGA 2ZZCA 3C4AA 2C7GA 2ARDA 1OJCA 1OJTA 2C65A 3T2YA 1K0JA 4K5SA 2V6OA 3RNMA 2NPXA 5JCMA 4OPTA 3DA1A 1JOAA 3VRBA 3AE3A 3DJGX 2DKHA 3DK9A 4BK1A 3KD9A 2WU5A 5BRTA 1PBCA 2X3NA 1DJQA 4USQA 4J31A 3VR9A 4GF7A 1L9CA 3ICTA 4H4UA 1F8WA 1Y56B 3NGCX 4HB9A 4GDEA 1KSUA 5CKUA 1L0VA 4B64A 2BK5A 4O5QA 1BKWA 2VOUA 1ELIA 3LADA 3UOXA 3QVPA 4AOXA 1K0LA 4H4TA 3G5QA 4IA5A 1BGNA 3AECA 4ICYA 4U2SA 2YR5A 2WOIA 3NIXA 2O9ZA 5BUKA 3UKAA 4AOSA 3GYIA 3UP5A 5KMSA 4II3A 3FIMB 3IHMA 1DNCA 2NVKX 3D1CA 1QLBA 4B69A 4Y4NA 1W4XA 2FJEA 2WQYA 3LXDA 4I58A 5JCKA 2XFOA 5M10A 3GWFA 4E0VA 3NYFA 3P4RA 1NHSA 4TLXA 4JN9A 1HYUA 3AE2A 4ZCCA 1VDCA 3GSIA 3ALJA 2W0HA 1NHPA 5FS9A 3SM8A 2WETA 3JSKA 4JNAA 3SFEA 1F8RA 2Q0KA 3UOZA 5GRTA 4A7AA 4AT0A 1XANA 4H4QA 3SQPA 2QAEA 4O5UA 4TM1A 2APGA 3UCLA 4Z24A 4YTPA 3AE8A 2WDQA 1LV0A 2YVJA 2VRLA 2XLSA 4UDQA 1LQUA 2I0ZA 2WS3A 5KVIA 1N4VA 2X8GA 2YG4A 2C64A 2YLSA 2BC0A 4J2WA 4JNQA 4U8NA 4Z43A 1NPXA 1D4EA 1O95A 4C5OA 5LV9A 3CGEA 1GOSA 4YSHA 4CNKA 3AYLA 3HYWA 2BS3A 2YG7A 2YWLA 1N4WA 3ADAB 3SYIA 4I59A 2BYBA 2V5ZA 3EAOA 4B67A 5BVAA 4CBQA 4NTCA 3DJEA 3SFDA 2OALA 1UKVG 4UP3A 4APNA 4BJYA 2WDVA 1CJ4A 3VQRA 1E1LA 5IQ1A 2B9XA 2ZZ0A 3ZYXA 4WX1A 4A9WA 3ITJA 2BRYA 4Z26A 4K5RA 3QSMA 4LIIA 4YSXA 1FCDA 1PHHA 2YLXA 2XFQA 3NT6A 4UDPA 3UOYA 3CNSA 4EIQA 4ZN0A 1IUWA 3K7MX 4U8KA 3H8IA 3KPFA 1N4UA 1DOCA 1CJ3A 3REDA 4H2NA 2AAQA 1DOBA 1PJ5A 3QFBA 5JCIA 1TDFA 1E1MA 1GTEA 2C70A 4EM3A 3UTFA 5J60A 4J57A 1PXBA 2CFYA 3B3RA 3D8XA 1VRQB 3OC4A 4U8JA 1AOGA 2A89A 1Y0PA 2GB0A 4YTNA 4P9SA 2TPRA 1B37A 3CPHG 4U2TA 2XDOA 4G74A 3DGHA 1IJHA 4G9KA 1IUVA 1CJCA 3AEDA 3T31A 2R0CA 1GRHA 4OPUA 1GXFA 2WPEA 3SY4A 1MOKA 2C67A 5EB5A 1REOA 4YKGA 3DH9A 3ZDNA 1XHCA 4H4SA 2WBAA 2RABA 2QA2A 5KWFA 4NEVA 4H4ZA 4EMIA 2B7RA 5C3JA 2WEUA 1GRFA 1M6IA 3ISHA 4YSZA 1XPQA 3C96A 3GMCA 4FK1C 4A99A 2BS4A 1GV4A 2CDUA 2PHHA 4EMJA 1E7PA 1E6EA 1KFYA 1V59A 2YM2A 3AE7A 3ICRA 1K0IA 1E1KA 2VVMA 2GF3A 2WP9A 3IHGA 4WCTA 5KXJA 4C74A 2EQ8A 1PBBA 3BI2A 1H83A 2GQWA 4EQRA 1GETA 3BI5A 3DMEA 2BS2A 4J33A 3SZWA 1ZKQA 2BK4A 4N9XA 1TRBA 3CMMA 2R0PA 1L9DA 4ECHA 2X8CA 3AYIA 2R0GA 3UKKA 3SZ0A 3UTHA 4NEWA 1FEBA 1CBOA 5M0ZA 3G5SA 4AP3A 3NHOX 4FX9A 4OPGA 1MXTA 3NK0X 4IA6A 4OPCA 3EANA 4B1BA 2Q0LA 4H4RA 1PJ6A 2HQMA 3IWAA 3FMWA 3P4PA 4RG4A 2XVIA 1GT8A 2YLWA 3UKLA 3P4SA 2C76A 4J34A 3WE0A 1NAAA 1ZOVA 1JEHA 3PS9A 4K8DA 4NWZA 4II2A 2B9WA 2WOWA 3HZLA 3PO7A 1GPEA 4PABA 3E1TA 4TLZA 3BNMA 2C75A 3K7TA 2YLRA 3NTAA 5EBKA 1GNDA 1D4DA 1YQ4A 2JBVA 1F8SA 3GDPA 2GR2A 1PXCA 3NG7X 4DGKA 3CTYA 4YSYA 2V61A 5KVHA 1GESA 1EBDA 1P2EA 1FOHA 4A5LA 4MJWA 5U63A 4DSHA 1COYA 2WPCA 3P4QA 1GERA 2QA1A 3NN0X 4KX6A 4U2LA 3QJ4A 2YM1A 3F8DA 2WPFA 1CC2A 1LJ1A 3K7QX 5IPYA 2OLNA 5EB4A 2BCGG 4GAPA 3BHFA 3AWIA 3G5RA 2RGHA 1YQ3A 2XLUA 3ALLA 1GREA 2GMHA 2XVHA 3P9UA 3ALMA 3ATQA 4UDRA 4GRTA 1EL5A 5FS7A 2E5VA 3KPKA 2Q7VA 3IC9A 1BWCA 2GR0A 2GR1A 3AD7B 4EQSA 1H6VA 2WDRA 3LZWA 1KF6A 4CRTA 4A6NA 4B65A 4Z2UA 1GALA 3M12A 2C3CA 4AT2A 3AYJA 3GRSA 1SEZA 2C73A 1ZP0A 3NYEA 1PJ7A 1E39A 4K2XA 1TYTA 2H89A 1PBFA 3LJPA 4PAAA 5HY5A 2FBWA 4U8IA 4M52A 3CNTA 2GH5A 2JAEA 1H84A 5U25A 4EM4A 3RHAA 3AD8B 2OA1A 1ZMDA 3AE9A 3BHKA 4IVOB 4EMWA 2E4GA 3LB8A 3V3OA 4H2PA 2YAUA 4NTEA 1IUSA 4C3XA 2B7SA 2WU2A 2GR3A 4Z25A 4U8LA 2QCUA 3II4A 5HHFA 5ER0A 3DK4A 5EOWA 2BK3A 4B68A 3PVCA 1JRYA 1S2YA 3GRTA 3NH3X 2XVEA 2XFPA 2YG5A 2YQUA 3AB1A 4H7UA 1RSGA 3DJJA 3HYVA 4X4JA 3T0KA 2EQ6A 1YKJA 2ZBWA 5C2TA 2E1MA 3CIRA 3QSSA 3KLJA 1PBEA 3CNJA 4LA1A 4H4XA 3RP7A 1CHUA 4TM0A 2J3NA 1ONFA 1NG4A 1RYIA 3ABVA 3CN8A 5HYMA 2IVDA 2BC1A 1VG0A 3SZFA 1O94A 2VRMA 3QSEA 5IQ4A 2XVJA 4C77A 1PS9A 3GYXA 4GCMA 3M0OA 2C72A 2OLOA 1F3PA 1KSSA 1KNPA 1YY5A 3AXBA 4X9NA 4Y4LA 1KNRA 4H4PA 4YT0A 3DGZA 2WHDA 5CQFA 3V76A 4D04A 1YQZA 1IUUA 3NKSA 2XCGA 3QFAA 4IVMB 1NG3A 3UTGA 2YG3A 4G6GA 4K7ZA 4A79A 1D7LA 3KU9A 1XDIA 2R45A 1DOEA 1X31B 2DKIA 3O0HA 5GSNA 4AP1A 2GRTA 2BRAA 2CVJA 1GRAA 1D4CA 1NDAA 3NYCA 4KPRA 4U8PA 2GAHB 2JKCA 3DK8A 4XWRA 4K22A 1Q1WA 2BCPA 1FEAA 1QJDA 1ZOYA 2UZZA 1M64A 1JNZA 2V3AA 3CPJG 3NTDA 5L46A 4G6HA 3EPTA 1H7XA 3AEBA 3B6DA 4XWZA 3UKQA 1GEUA 3AEFA 1TDKA 4JDRA 3FBSA 2XVFA 2R4EA 1Y56A 3GYJA 4BK2A 2JB3A 1H82A 1LTXR 4USRA 3DJDA 5DBJA 1ZY8A 1S3EA 3I3LA 3AD9B 3SZCA 3CPIG 3L8KA 1CC6A 3SX6A 5KNLA 1B8SA 2V60A 4ZCDA 1H81A 1JRXA 3BI4A 3NN6X 2GVCA 1H86A 2R46A 2XLTA 5TR3A 2EQ9A 1EL9A 2Q6UA 2V3BA 2YR4A 3CNDA 4GAVA 4Y4MA 3COXA 4D03A 4GR1A 4FK1A 4IV9A 2FJDA 2OAMA 4OPDA 5HXIA 3NNEA 2A87A 2BXSA 1TDOA 3CGDA 4EQWA 1JNRA 3EF6A 4J56A 2PYXA 2CULA 1Z6LA 1B5QA 2GAGB 2Y6QA 4CCRA 4A65A 5BULA 2XLPA 3K30A 1PBDA 4NTDA 5KMRA 5U1OA 4H2RA 3UKFA 1CJ2A 2Z5YA 3GDNA 3SXIA 2YVFA 5FS6A 3AEGA 3LZXA 1LVLA 2Z5XA 2RGOA 3NK1X 3CGCA 1PDHA 1GSNA 3NK2X 3UKPA 2C4CA 2YLTA 4CY8A 3FPZA 1H7WA 4EIPA 1ZMCA 1D7YA 4YKFA 3AE4A 1F6MA 2YVGA 1Q9IA 2ACZA 4YXDA 1IUTA 1OJAA 1BF3A 4B63A 2R4JA 1S2QA 2AQJA 3FG2P 3GMBA 4JQ9A 3T14A 4ADWA 2VQBA 2YG6A 3NLCA 2WESA 3T2KA 5JCLA 1IUXA 3F8PA 2BA9A 4CY6A 4JY3A 4HA6A 2JK6A 1CF3A 4GUVA 1BGJA 2R9ZA 1Q1RA 1OJ9A 4FDCB 2A8XA 2GV8A 2TMDA 1ZX9A 5JCNA 5KMQA 2VVLA 2RGJA 2X8HA 1E1NA 1GRTA 3KKJA 1O5WA 2BXRA 2C3DA 1NEKA 1CL0A 3H8LA 1RP0A 2ZZBA 3Q9TA 3OZ2A 3UOVA 3R9UA 3M13A 3CNPA 2B9YA 4EQXA 3V3NA 1MO9A 1ZK7A 1GRBA 1K4QA 4NZHA 1NHQA 2IIDA 2FJAA 1TDNA 4X9MA 2IVEA 1EL7A 1DXLA 2BACA 3P1WA 3QVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EQ7 A;  1JU2 A;  2XFU A;  1NEN A;  4A6N B;  2YR6 A;  4B66 A;  2GMJ A;  4BV6 A;  3RP8 A;  1VQW A;  2Y6R A;  1PN0 A;  3AE6 A;  1LPF A;  1TDE A;  2VQ7 A;  4Z2T A;  1N1P A;  5FMH A;  4JY2 A;  1GRG A;  1BZL A;  4C3Y A;  5KOX A;  3UTE A;  3VRA A;  1CC4 A;  3LOV A;  4DNA A;  2VVL G;  4RG3 A;  4BJZ A;  5KOW A;  4OPI A;  4U8O A;  2H88 A;  3S5W A;  2WP5 A;  1DOD A;  1LQT A;  2XLR A;  3KVE A;  4XXG A;  2YLZ A;  1L9E A;  1GTH A;  2WP6 A;  4H4V A;  3VRD B;  2JB2 A;  3ICS A;  4LU6 A;  3I6D A;  3CGB A;  2JB1 A;  4J36 A;  1B4V A;  4TM4 A;  3GWD A;  4H50 A;  5FS8 A;  1KDG A;  4BK3 A;  3NRN A;  3RP6 A;  4CNJ A;  1NHR A;  2XFN A;  5J7X A;  3UKH A;  3T37 A;  3F8R A;  4CCQ A;  4RSL A;  1ZDL A;  1JRZ A;  2FJB A;  3C4N A;  3URH A;  1OJD A;  1P2H A;  2X50 A;  3H4K A;  5KRQ A;  4H4Y A;  1FEC A;  4OPL A;  4U8M A;  1S3B A;  1TYP A;  4REK A;  3UP4 A;  2C66 A;  2XYO A;  2GEW A;  4GDP A;  2WOV A;  1VG9 A;  2B76 A;  4TM3 A;  4OCG A;  3BNU A;  3SGL A;  2X99 A;  4BUR A;  4H2Q A;  3IF9 A;  3VR8 A;  4H4W A;  4Z2R A;  3ATR A;  3AE5 A;  2AR8 A;  2GQF A;  2VZ2 A;  3KA7 A;  1DJN A;  1EL8 A;  3GD3 A;  1FL2 A;  4Z44 A;  3AEA A;  3Q6J A;  4OVI A;  1QO8 A;  3AEE A;  3GD4 A;  3L1R A;  2F5Z A;  1D5T A;  4YTM A;  4YWO A;  3S61 A;  1PXA A;  3AE1 A;  2BAB A;  4DSG A;  2ZZC A;  3C4A A;  2C7G A;  2ARD A;  1OJC A;  1OJT A;  2C65 A;  1K0J A;  4K5S A;  2V6O A;  3RNM A;  2NPX A;  5JCM A;  4OPT A;  3DA1 A;  1JOA A;  3VRB A;  3AE3 A;  3DJG X;  2DKH A;  3DK9 A;  4BK1 A;  3KD9 A;  2WU5 A;  5BRT A;  1PBC A;  2X3N A;  1DJQ A;  4USQ A;  4J31 A;  3VR9 A;  4GF7 A;  1L9C A;  3ICT A;  4H4U A;  1F8W A;  1Y56 B;  3NGC X;  4HB9 A;  4GDE A;  1KSU A;  5CKU A;  1L0V A;  4B64 A;  2BK5 A;  4O5Q A;  1BKW A;  2VOU A;  1ELI A;  3LAD A;  3UOX A;  3QVP A;  4AOX A;  1K0L A;  4H4T A;  3G5Q A;  4IA5 A;  1BGN A;  3AEC A;  4ICY A;  4U2S A;  2YR5 A;  2WOI A;  3NIX A;  2O9Z A;  5BUK A;  3UKA A;  4AOS A;  3GYI A;  3UP5 A;  3FIM B;  3IHM A;  1DNC A;  2NVK X;  3D1C A;  1QLB A;  4B69 A;  4Y4N A;  1W4X A;  2FJE A;  2WQY A;  3LXD A;  4I58 A;  5JCK A;  2XFO A;  5M10 A;  3GWF A;  4E0V A;  3NYF A;  3P4R A;  1NHS A;  4TLX A;  4JN9 A;  1HYU A;  3AE2 A;  4ZCC A;  1VDC A;  3GSI A;  3ALJ A;  2W0H A;  1NHP A;  5FS9 A;  3SM8 A;  2WET A;  3JSK A;  4JNA A;  3SFE A;  1F8R A;  2Q0K A;  3UOZ A;  5GRT A;  4A7A A;  4AT0 A;  1XAN A;  4H4Q A;  3SQP A;  2QAE A;  4O5U A;  4TM1 A;  2APG A;  3UCL A;  4Z24 A;  4YTP A;  3AE8 A;  2WDQ A;  1LV0 A;  2YVJ A;  2VRL A;  2XLS A;  4UDQ A;  1LQU A;  2I0Z A;  2WS3 A;  5KVI A;  1N4V A;  2X8G A;  2YG4 A;  2C64 A;  2YLS A;  2BC0 A;  4J2W A;  4JNQ A;  4U8N A;  4Z43 A;  1NPX A;  1D4E A;  1O95 A;  4C5O A;  5LV9 A;  3CGE A;  1GOS A;  4YSH A;  4CNK A;  3AYL A;  2BS3 A;  2YG7 A;  2YWL A;  1N4W A;  3ADA B;  4I59 A;  2BYB A;  2V5Z A;  3EAO A;  4B67 A;  5BVA A;  4CBQ A;  4NTC A;  3DJE A;  3SFD A;  2OAL A;  1UKV G;  4UP3 A;  4APN A;  4BJY A;  2WDV A;  1CJ4 A;  3VQR A;  1E1L A;  5IQ1 A;  2B9X A;  2ZZ0 A;  3ZYX A;  4WX1 A;  4A9W A;  3ITJ A;  4Z26 A;  4K5R A;  3QSM A;  4LII A;  4YSX A;  1FCD A;  1PHH A;  2YLX A;  2XFQ A;  3NT6 A;  4UDP A;  3UOY A;  3CNS A;  4EIQ A;  4ZN0 A;  1IUW A;  3K7M X;  4U8K A;  3H8I A;  3KPF A;  1N4U A;  1DOC A;  1CJ3 A;  3RED A;  4H2N A;  2AAQ A;  1DOB A;  1PJ5 A;  3QFB A;  5JCI A;  1TDF A;  1E1M A;  1GTE A;  2C70 A;  4EM3 A;  3UTF A;  5J60 A;  4J57 A;  1PXB A;  2CFY A;  3B3R A;  3D8X A;  1VRQ B;  3OC4 A;  4U8J A;  1AOG A;  2A89 A;  1Y0P A;  2GB0 A;  4YTN A;  4P9S A;  2TPR A;  1B37 A;  3CPH G;  4U2T A;  2XDO A;  3DGH A;  1IJH A;  1IUV A;  1CJC A;  3AED A;  2R0C A;  1GRH A;  4OPU A;  1GXF A;  2WPE A;  1MOK A;  2C67 A;  5EB5 A;  1REO A;  4YKG A;  3DH9 A;  3ZDN A;  1XHC A;  4H4S A;  2WBA A;  2RAB A;  2QA2 A;  5KWF A;  4NEV A;  4H4Z A;  4EMI A;  2B7R A;  5C3J A;  2WEU A;  1GRF A;  1M6I A;  3ISH A;  4YSZ A;  1XPQ A;  3C96 A;  3GMC A;  4FK1 C;  4A99 A;  2BS4 A;  1GV4 A;  2CDU A;  2PHH A;  4EMJ A;  1E7P A;  1E6E A;  1KFY A;  1V59 A;  2YM2 A;  3AE7 A;  3ICR A;  1K0I A;  1E1K A;  2VVM A;  2GF3 A;  2WP9 A;  3IHG A;  4WCT A;  5KXJ A;  4C74 A;  2EQ8 A;  1PBB A;  3BI2 A;  1H83 A;  2GQW A;  4EQR A;  1GET A;  3BI5 A;  3DME A;  2BS2 A;  4J33 A;  1ZKQ A;  2BK4 A;  4N9X A;  1TRB A;  4ECH A;  2R0P A;  1L9D A;  2X8C A;  3AYI A;  2R0G A;  3UKK A;  3UTH A;  4NEW A;  1FEB A;  1CBO A;  5M0Z A;  3G5S A;  4AP3 A;  3NHO X;  4FX9 A;  4OPG A;  1MXT A;  3NK0 X;  4IA6 A;  4OPC A;  3EAN A;  4B1B A;  2Q0L A;  4H4R A;  1PJ6 A;  2HQM A;  3IWA A;  3FMW A;  3P4P A;  4RG4 A;  2XVI A;  1GT8 A;  2YLW A;  3UKL A;  3P4S A;  2C76 A;  4J34 A;  3WE0 A;  1NAA A;  1ZOV A;  1JEH A;  3PS9 A;  4K8D A;  2B9W A;  2WOW A;  3HZL A;  3PO7 A;  1GPE A;  4PAB A;  3E1T A;  4TLZ A;  3BNM A;  2C75 A;  3K7T A;  2YLR A;  3NTA A;  5EBK A;  1GND A;  1D4D A;  1YQ4 A;  2JBV A;  1F8S A;  3GDP A;  2GR2 A;  1PXC A;  3NG7 X;  4DGK A;  3CTY A;  4YSY A;  2V61 A;  5KVH A;  1GES A;  1EBD A;  1P2E A;  1FOH A;  4A5L A;  4MJW A;  5U63 A;  4DSH A;  1COY A;  2WPC A;  3P4Q A;  1GER A;  2QA1 A;  3NN0 X;  4KX6 A;  4U2L A;  3QJ4 A;  2YM1 A;  3F8D A;  2WPF A;  1CC2 A;  1LJ1 A;  3K7Q X;  5IPY A;  2OLN A;  5EB4 A;  2BCG G;  3BHF A;  3AWI A;  3G5R A;  2RGH A;  1YQ3 A;  2XLU A;  3ALL A;  1GRE A;  2GMH A;  2XVH A;  3P9U A;  3ALM A;  3ATQ A;  4UDR A;  4GRT A;  1EL5 A;  5FS7 A;  2E5V A;  2Q7V A;  3IC9 A;  1BWC A;  2GR0 A;  2GR1 A;  3AD7 B;  4EQS A;  1H6V A;  2WDR A;  3LZW A;  1KF6 A;  4CRT A;  4A6N A;  4B65 A;  4Z2U A;  1GAL A;  3M12 A;  2C3C A;  4AT2 A;  3AYJ A;  3GRS A;  1SEZ A;  2C73 A;  1ZP0 A;  3NYE A;  1PJ7 A;  1E39 A;  4K2X A;  1TYT A;  2H89 A;  1PBF A;  3LJP A;  4PAA A;  5HY5 A;  2FBW A;  4U8I A;  4M52 A;  3CNT A;  2GH5 A;  2JAE A;  1H84 A;  5U25 A;  4EM4 A;  3RHA A;  3AD8 B;  2OA1 A;  1ZMD A;  3AE9 A;  3BHK A;  4IVO B;  4EMW A;  2E4G A;  3LB8 A;  3V3O A;  4H2P A;  2YAU A;  4NTE A;  1IUS A;  4C3X A;  2B7S A;  2WU2 A;  2GR3 A;  4Z25 A;  4U8L A;  2QCU A;  3II4 A;  5HHF A;  5ER0 A;  3DK4 A;  5EOW A;  2BK3 A;  4B68 A;  3PVC A;  1JRY A;  1S2Y A;  3GRT A;  3NH3 X;  2XVE A;  2XFP A;  2YG5 A;  2YQU A;  3AB1 A;  4H7U A;  1RSG A;  3DJJ A;  4X4J A;  2EQ6 A;  1YKJ A;  2ZBW A;  5C2T A;  2E1M A;  3CIR A;  3QSS A;  3KLJ A;  1PBE A;  3CNJ A;  4LA1 A;  4H4X A;  3RP7 A;  1CHU A;  4TM0 A;  2J3N A;  1ONF A;  1NG4 A;  1RYI A;  3ABV A;  3CN8 A;  5HYM A;  2IVD A;  2BC1 A;  1VG0 A;  1O94 A;  2VRM A;  3QSE A;  5IQ4 A;  2XVJ A;  4C77 A;  1PS9 A;  4GCM A;  3M0O A;  2C72 A;  2OLO A;  1F3P A;  1KSS A;  1KNP A;  1YY5 A;  3AXB A;  4X9N A;  4Y4L A;  1KNR A;  4H4P A;  4YT0 A;  3DGZ A;  2WHD A;  5CQF A;  3V76 A;  4D04 A;  1YQZ A;  1IUU A;  3NKS A;  2XCG A;  3QFA A;  4IVM B;  1NG3 A;  3UTG A;  2YG3 A;  4K7Z A;  4A79 A;  1D7L A;  3KU9 A;  1XDI A;  2R45 A;  1DOE A;  1X31 B;  2DKI A;  3O0H A;  5GSN A;  4AP1 A;  2GRT A;  2CVJ A;  1GRA A;  1D4C A;  1NDA A;  3NYC A;  4KPR A;  4U8P A;  2GAH B;  2JKC A;  3DK8 A;  4XWR A;  4K22 A;  1Q1W A;  2BCP A;  1FEA A;  1QJD A;  1ZOY A;  2UZZ A;  1M64 A;  1JNZ A;  2V3A A;  3CPJ G;  3NTD A;  5L46 A;  3EPT A;  1H7X A;  3AEB A;  3B6D A;  4XWZ A;  3UKQ A;  1GEU A;  3AEF A;  1TDK A;  4JDR A;  3FBS A;  2XVF A;  2R4E A;  1Y56 A;  3GYJ A;  4BK2 A;  2JB3 A;  1H82 A;  1LTX R;  4USR A;  3DJD A;  5DBJ A;  1ZY8 A;  1S3E A;  3I3L A;  3AD9 B;  3CPI G;  3L8K A;  1CC6 A;  1B8S A;  2V60 A;  4ZCD A;  1H81 A;  1JRX A;  3BI4 A;  3NN6 X;  2GVC A;  1H86 A;  2R46 A;  2XLT A;  5TR3 A;  2EQ9 A;  1EL9 A;  2Q6U A;  2V3B A;  2YR4 A;  3CND A;  4Y4M A;  3COX A;  4D03 A;  4GR1 A;  4FK1 A;  4IV9 A;  2FJD A;  2OAM A;  4OPD A;  5HXI A;  3NNE A;  2A87 A;  2BXS A;  1TDO A;  3CGD A;  4EQW A;  1JNR A;  3EF6 A;  4J56 A;  2PYX A;  2CUL A;  1Z6L A;  1B5Q A;  2GAG B;  2Y6Q A;  4CCR A;  4A65 A;  5BUL A;  2XLP A;  3K30 A;  1PBD A;  4NTD A;  5U1O A;  4H2R A;  3UKF A;  1CJ2 A;  2Z5Y A;  3GDN A;  2YVF A;  5FS6 A;  3AEG A;  3LZX A;  1LVL A;  2Z5X A;  2RGO A;  3NK1 X;  3CGC A;  1PDH A;  1GSN A;  3NK2 X;  3UKP A;  2YLT A;  4CY8 A;  3FPZ A;  1H7W A;  4EIP A;  1ZMC A;  1D7Y A;  4YKF A;  3AE4 A;  1F6M A;  2YVG A;  1Q9I A;  2ACZ A;  4YXD A;  1IUT A;  1OJA A;  1BF3 A;  4B63 A;  2R4J A;  1S2Q A;  2AQJ A;  3FG2 P;  3GMB A;  4JQ9 A;  4ADW A;  5JCL A;  2VQB A;  2YG6 A;  3NLC A;  2WES A;  1IUX A;  3F8P A;  2BA9 A;  4CY6 A;  4JY3 A;  4HA6 A;  2JK6 A;  1CF3 A;  4GUV A;  1BGJ A;  2R9Z A;  1Q1R A;  1OJ9 A;  4FDC B;  2A8X A;  2GV8 A;  2TMD A;  1ZX9 A;  5JCN A;  2VVL A;  2RGJ A;  2X8H A;  1E1N A;  1GRT A;  3KKJ A;  1O5W A;  2BXR A;  2C3D A;  1NEK A;  1CL0 A;  3H8L A;  1RP0 A;  2ZZB A;  3Q9T A;  3OZ2 A;  3UOV A;  3R9U A;  3M13 A;  3CNP A;  2B9Y A;  4EQX A;  3V3N A;  1MO9 A;  1ZK7 A;  1GRB A;  1K4Q A;  4NZH A;  1NHQ A;  2IID A;  2FJA A;  1TDN A;  4X9M A;  2IVE A;  1EL7 A;  1DXL A;  2BAC A;  3P1W A;  3QVR A; 
#chains in the Genus database with same CATH topology
 2EQ7 A;  1JU2 A;  2XFU A;  1NEN A;  4A6N B;  2YR6 A;  4B66 A;  2GMJ A;  4BV6 A;  3RP8 A;  1VQW A;  2Y6R A;  1PN0 A;  3AE6 A;  1LPF A;  1TDE A;  2VQ7 A;  4Z2T A;  1N1P A;  5FMH A;  4JY2 A;  1GRG A;  1BZL A;  4C3Y A;  5KOX A;  3UTE A;  3VRA A;  1CC4 A;  3LOV A;  4DNA A;  3T2Z A;  2VVL G;  4RG3 A;  4BJZ A;  5KOW A;  4OPI A;  4U8O A;  2H88 A;  3S5W A;  2WP5 A;  1DOD A;  1LQT A;  2XLR A;  3KVE A;  4XXG A;  2YLZ A;  1L9E A;  1GTH A;  2WP6 A;  4H4V A;  3VRD B;  2JB2 A;  3ICS A;  4LU6 A;  3I6D A;  5KMP A;  3CGB A;  2JB1 A;  4J36 A;  1B4V A;  4TM4 A;  3GWD A;  4H50 A;  5FS8 A;  1KDG A;  4BK3 A;  3NRN A;  3RP6 A;  4CNJ A;  1NHR A;  2XFN A;  5J7X A;  3UKH A;  3T37 A;  3F8R A;  4CCQ A;  4RSL A;  1ZDL A;  1JRZ A;  2FJB A;  3C4N A;  3URH A;  1OJD A;  1P2H A;  2X50 A;  3H4K A;  5KRQ A;  4H4Y A;  1FEC A;  4OPL A;  4U8M A;  1S3B A;  1TYP A;  4REK A;  3UP4 A;  2C66 A;  2XYO A;  2GEW A;  4GDP A;  2WOV A;  1VG9 A;  2B76 A;  4TM3 A;  4OCG A;  3BNU A;  3SGL A;  2X99 A;  4BUR A;  3HYX A;  4H2Q A;  3IF9 A;  3VR8 A;  4H4W A;  4Z2R A;  3ATR A;  3AE5 A;  2AR8 A;  2GQF A;  2VZ2 A;  3KA7 A;  1DJN A;  1EL8 A;  3GD3 A;  1FL2 A;  4G73 A;  3AEA A;  4Z44 A;  3Q6J A;  4OVI A;  4NNJ A;  1QO8 A;  3AEE A;  3GD4 A;  3L1R A;  2F5Z A;  1D5T A;  4YTM A;  4YWO A;  3S61 A;  1PXA A;  3AE1 A;  2BAB A;  4DSG A;  2ZZC A;  3C4A A;  2C7G A;  2ARD A;  1OJC A;  1OJT A;  2C65 A;  3T2Y A;  1K0J A;  4K5S A;  2V6O A;  3RNM A;  2NPX A;  5JCM A;  4OPT A;  3DA1 A;  1JOA A;  3VRB A;  3AE3 A;  3DJG X;  2DKH A;  3DK9 A;  4BK1 A;  3KD9 A;  2WU5 A;  5BRT A;  1PBC A;  2X3N A;  1DJQ A;  4USQ A;  4J31 A;  3VR9 A;  4GF7 A;  1L9C A;  3ICT A;  4H4U A;  1F8W A;  1Y56 B;  3NGC X;  4HB9 A;  4GDE A;  1KSU A;  5CKU A;  1L0V A;  4B64 A;  2BK5 A;  4O5Q A;  1BKW A;  2VOU A;  1ELI A;  3LAD A;  3UOX A;  3QVP A;  4AOX A;  1K0L A;  4H4T A;  3G5Q A;  4IA5 A;  1BGN A;  3AEC A;  4ICY A;  4U2S A;  2YR5 A;  2WOI A;  3NIX A;  2O9Z A;  5BUK A;  3UKA A;  4AOS A;  3GYI A;  3UP5 A;  5KMS A;  4II3 A;  3FIM B;  3IHM A;  1DNC A;  2NVK X;  3D1C A;  1QLB A;  4B69 A;  4Y4N A;  1W4X A;  2FJE A;  2WQY A;  3LXD A;  4I58 A;  5JCK A;  2XFO A;  5M10 A;  3GWF A;  4E0V A;  3NYF A;  3P4R A;  1NHS A;  4TLX A;  4JN9 A;  1HYU A;  3AE2 A;  4ZCC A;  1VDC A;  3GSI A;  3ALJ A;  2W0H A;  1NHP A;  5FS9 A;  3SM8 A;  2WET A;  3JSK A;  4JNA A;  3SFE A;  1F8R A;  2Q0K A;  3UOZ A;  5GRT A;  4A7A A;  4AT0 A;  1XAN A;  4H4Q A;  3SQP A;  2QAE A;  4O5U A;  4TM1 A;  2APG A;  3UCL A;  4Z24 A;  4YTP A;  3AE8 A;  2WDQ A;  1LV0 A;  2YVJ A;  2VRL A;  2XLS A;  4UDQ A;  1LQU A;  2I0Z A;  2WS3 A;  5KVI A;  1N4V A;  2X8G A;  2YG4 A;  2C64 A;  2YLS A;  2BC0 A;  4J2W A;  4JNQ A;  4U8N A;  4Z43 A;  1NPX A;  1D4E A;  1O95 A;  4C5O A;  5LV9 A;  3CGE A;  1GOS A;  4YSH A;  4CNK A;  3AYL A;  3HYW A;  2BS3 A;  2YG7 A;  2YWL A;  1N4W A;  3ADA B;  3SYI A;  4I59 A;  2BYB A;  2V5Z A;  3EAO A;  4B67 A;  5BVA A;  4CBQ A;  4NTC A;  3DJE A;  3SFD A;  2OAL A;  1UKV G;  4UP3 A;  4APN A;  4BJY A;  2WDV A;  1CJ4 A;  3VQR A;  1E1L A;  5IQ1 A;  2B9X A;  2ZZ0 A;  3ZYX A;  4WX1 A;  4A9W A;  3ITJ A;  2BRY A;  4Z26 A;  4K5R A;  3QSM A;  4LII A;  4YSX A;  1FCD A;  1PHH A;  2YLX A;  2XFQ A;  3NT6 A;  4UDP A;  3UOY A;  3CNS A;  4EIQ A;  4ZN0 A;  1IUW A;  3K7M X;  4U8K A;  3H8I A;  3KPF A;  1N4U A;  1DOC A;  1CJ3 A;  3RED A;  4H2N A;  2AAQ A;  1DOB A;  1PJ5 A;  3QFB A;  5JCI A;  1TDF A;  1E1M A;  1GTE A;  2C70 A;  4EM3 A;  3UTF A;  5J60 A;  4J57 A;  1PXB A;  2CFY A;  3B3R A;  3D8X A;  1VRQ B;  3OC4 A;  4U8J A;  1AOG A;  2A89 A;  1Y0P A;  2GB0 A;  4YTN A;  4P9S A;  2TPR A;  1B37 A;  3CPH G;  4U2T A;  2XDO A;  4G74 A;  3DGH A;  1IJH A;  4G9K A;  1IUV A;  1CJC A;  3AED A;  3T31 A;  2R0C A;  1GRH A;  4OPU A;  1GXF A;  2WPE A;  3SY4 A;  1MOK A;  2C67 A;  5EB5 A;  1REO A;  4YKG A;  3DH9 A;  3ZDN A;  1XHC A;  4H4S A;  2WBA A;  2RAB A;  2QA2 A;  5KWF A;  4NEV A;  4H4Z A;  4EMI A;  2B7R A;  5C3J A;  2WEU A;  1GRF A;  1M6I A;  3ISH A;  4YSZ A;  1XPQ A;  3C96 A;  3GMC A;  4FK1 C;  4A99 A;  2BS4 A;  1GV4 A;  2CDU A;  2PHH A;  4EMJ A;  1E7P A;  1E6E A;  1KFY A;  1V59 A;  2YM2 A;  3AE7 A;  3ICR A;  1K0I A;  1E1K A;  2VVM A;  2GF3 A;  2WP9 A;  3IHG A;  4WCT A;  5KXJ A;  4C74 A;  2EQ8 A;  1PBB A;  3BI2 A;  1H83 A;  2GQW A;  4EQR A;  1GET A;  3BI5 A;  3DME A;  2BS2 A;  4J33 A;  3SZW A;  1ZKQ A;  2BK4 A;  4N9X A;  1TRB A;  3CMM A;  2R0P A;  1L9D A;  4ECH A;  2X8C A;  3AYI A;  2R0G A;  3UKK A;  3SZ0 A;  3UTH A;  4NEW A;  1FEB A;  1CBO A;  5M0Z A;  3G5S A;  4AP3 A;  3NHO X;  4FX9 A;  4OPG A;  1MXT A;  3NK0 X;  4IA6 A;  4OPC A;  3EAN A;  4B1B A;  2Q0L A;  4H4R A;  1PJ6 A;  2HQM A;  3IWA A;  3FMW A;  3P4P A;  4RG4 A;  2XVI A;  1GT8 A;  2YLW A;  3UKL A;  3P4S A;  2C76 A;  4J34 A;  3WE0 A;  1NAA A;  1ZOV A;  1JEH A;  3PS9 A;  4K8D A;  4NWZ A;  4II2 A;  2B9W A;  2WOW A;  3HZL A;  3PO7 A;  1GPE A;  4PAB A;  3E1T A;  4TLZ A;  3BNM A;  2C75 A;  3K7T A;  2YLR A;  3NTA A;  5EBK A;  1GND A;  1D4D A;  1YQ4 A;  2JBV A;  1F8S A;  3GDP A;  2GR2 A;  1PXC A;  3NG7 X;  4DGK A;  3CTY A;  4YSY A;  2V61 A;  5KVH A;  1GES A;  1EBD A;  1P2E A;  1FOH A;  4A5L A;  4MJW A;  5U63 A;  4DSH A;  1COY A;  2WPC A;  3P4Q A;  1GER A;  2QA1 A;  3NN0 X;  4KX6 A;  4U2L A;  3QJ4 A;  2YM1 A;  3F8D A;  2WPF A;  1CC2 A;  1LJ1 A;  3K7Q X;  5IPY A;  2OLN A;  5EB4 A;  2BCG G;  4GAP A;  3BHF A;  3AWI A;  3G5R A;  2RGH A;  1YQ3 A;  2XLU A;  3ALL A;  1GRE A;  2GMH A;  2XVH A;  3P9U A;  3ALM A;  3ATQ A;  4UDR A;  4GRT A;  1EL5 A;  5FS7 A;  2E5V A;  3KPK A;  2Q7V A;  3IC9 A;  1BWC A;  2GR0 A;  2GR1 A;  3AD7 B;  4EQS A;  1H6V A;  2WDR A;  3LZW A;  1KF6 A;  4CRT A;  4A6N A;  4B65 A;  4Z2U A;  1GAL A;  3M12 A;  2C3C A;  4AT2 A;  3AYJ A;  3GRS A;  1SEZ A;  2C73 A;  1ZP0 A;  3NYE A;  1PJ7 A;  1E39 A;  4K2X A;  1TYT A;  2H89 A;  1PBF A;  3LJP A;  4PAA A;  5HY5 A;  2FBW A;  4U8I A;  4M52 A;  3CNT A;  2GH5 A;  2JAE A;  1H84 A;  5U25 A;  4EM4 A;  3RHA A;  3AD8 B;  2OA1 A;  1ZMD A;  3AE9 A;  3BHK A;  4IVO B;  4EMW A;  2E4G A;  3LB8 A;  3V3O A;  4H2P A;  2YAU A;  4NTE A;  1IUS A;  4C3X A;  2B7S A;  2WU2 A;  2GR3 A;  4Z25 A;  4U8L A;  2QCU A;  3II4 A;  5HHF A;  5ER0 A;  3DK4 A;  5EOW A;  2BK3 A;  4B68 A;  3PVC A;  1JRY A;  1S2Y A;  3GRT A;  3NH3 X;  2XVE A;  2XFP A;  2YG5 A;  2YQU A;  3AB1 A;  4H7U A;  1RSG A;  3DJJ A;  3HYV A;  4X4J A;  3T0K A;  2EQ6 A;  1YKJ A;  2ZBW A;  5C2T A;  2E1M A;  3CIR A;  3QSS A;  3KLJ A;  1PBE A;  3CNJ A;  4LA1 A;  4H4X A;  3RP7 A;  1CHU A;  4TM0 A;  2J3N A;  1ONF A;  1NG4 A;  1RYI A;  3ABV A;  3CN8 A;  5HYM A;  2IVD A;  2BC1 A;  1VG0 A;  3SZF A;  1O94 A;  2VRM A;  3QSE A;  5IQ4 A;  2XVJ A;  4C77 A;  1PS9 A;  3GYX A;  4GCM A;  3M0O A;  2C72 A;  2OLO A;  1F3P A;  1KSS A;  1KNP A;  1YY5 A;  3AXB A;  4X9N A;  4Y4L A;  1KNR A;  4H4P A;  4YT0 A;  3DGZ A;  2WHD A;  5CQF A;  3V76 A;  4D04 A;  1YQZ A;  1IUU A;  3NKS A;  2XCG A;  3QFA A;  4IVM B;  1NG3 A;  3UTG A;  2YG3 A;  4G6G A;  4K7Z A;  4A79 A;  1D7L A;  3KU9 A;  1XDI A;  2R45 A;  1DOE A;  1X31 B;  2DKI A;  3O0H A;  5GSN A;  4AP1 A;  2GRT A;  2BRA A;  2CVJ A;  1GRA A;  1D4C A;  1NDA A;  3NYC A;  4KPR A;  4U8P A;  2GAH B;  2JKC A;  3DK8 A;  4XWR A;  4K22 A;  1Q1W A;  2BCP A;  1FEA A;  1QJD A;  1ZOY A;  2UZZ A;  1M64 A;  1JNZ A;  2V3A A;  3CPJ G;  3NTD A;  5L46 A;  4G6H A;  3EPT A;  1H7X A;  3AEB A;  3B6D A;  4XWZ A;  3UKQ A;  1GEU A;  3AEF A;  1TDK A;  4JDR A;  3FBS A;  2XVF A;  2R4E A;  1Y56 A;  3GYJ A;  4BK2 A;  2JB3 A;  1H82 A;  1LTX R;  4USR A;  3DJD A;  5DBJ A;  1ZY8 A;  1S3E A;  3I3L A;  3AD9 B;  3SZC A;  3CPI G;  3L8K A;  1CC6 A;  3SX6 A;  5KNL A;  1B8S A;  2V60 A;  4ZCD A;  1H81 A;  1JRX A;  3BI4 A;  3NN6 X;  2GVC A;  1H86 A;  2R46 A;  2XLT A;  5TR3 A;  2EQ9 A;  1EL9 A;  2Q6U A;  2V3B A;  2YR4 A;  3CND A;  4GAV A;  4Y4M A;  3COX A;  4D03 A;  4GR1 A;  4FK1 A;  4IV9 A;  2FJD A;  2OAM A;  4OPD A;  5HXI A;  3NNE A;  2A87 A;  2BXS A;  1TDO A;  3CGD A;  4EQW A;  1JNR A;  3EF6 A;  4J56 A;  2PYX A;  2CUL A;  1Z6L A;  1B5Q A;  2GAG B;  2Y6Q A;  4CCR A;  4A65 A;  5BUL A;  2XLP A;  3K30 A;  1PBD A;  4NTD A;  5KMR A;  5U1O A;  4H2R A;  3UKF A;  1CJ2 A;  2Z5Y A;  3GDN A;  3SXI A;  2YVF A;  5FS6 A;  3AEG A;  3LZX A;  1LVL A;  2Z5X A;  2RGO A;  3NK1 X;  3CGC A;  1PDH A;  1GSN A;  3NK2 X;  3UKP A;  2C4C A;  2YLT A;  4CY8 A;  3FPZ A;  1H7W A;  4EIP A;  1ZMC A;  1D7Y A;  4YKF A;  3AE4 A;  1F6M A;  2YVG A;  1Q9I A;  2ACZ A;  4YXD A;  1IUT A;  1OJA A;  1BF3 A;  4B63 A;  2R4J A;  1S2Q A;  2AQJ A;  3FG2 P;  3GMB A;  4JQ9 A;  3T14 A;  4ADW A;  2VQB A;  2YG6 A;  3NLC A;  2WES A;  3T2K A;  5JCL A;  1IUX A;  3F8P A;  2BA9 A;  4CY6 A;  4JY3 A;  4HA6 A;  2JK6 A;  1CF3 A;  4GUV A;  1BGJ A;  2R9Z A;  1Q1R A;  1OJ9 A;  4FDC B;  2A8X A;  2GV8 A;  2TMD A;  1ZX9 A;  5JCN A;  5KMQ A;  2VVL A;  2RGJ A;  2X8H A;  1E1N A;  1GRT A;  3KKJ A;  1O5W A;  2BXR A;  2C3D A;  1NEK A;  1CL0 A;  3H8L A;  1RP0 A;  2ZZB A;  3Q9T A;  3OZ2 A;  3UOV A;  3R9U A;  3M13 A;  3CNP A;  2B9Y A;  4EQX A;  3V3N A;  1MO9 A;  1ZK7 A;  1GRB A;  1K4Q A;  4NZH A;  1NHQ A;  2IID A;  2FJA A;  1TDN A;  4X9M A;  2IVE A;  1EL7 A;  1DXL A;  2BAC A;  3P1W A;  3QVR A; 
#chains in the Genus database with same CATH homology
 2EQ7 A;  1JU2 A;  2XFU A;  1NEN A;  4A6N B;  2YR6 A;  4B66 A;  2GMJ A;  4BV6 A;  3RP8 A;  1VQW A;  2Y6R A;  1PN0 A;  3AE6 A;  1LPF A;  1TDE A;  2VQ7 A;  4Z2T A;  1N1P A;  5FMH A;  4JY2 A;  1GRG A;  1BZL A;  4C3Y A;  5KOX A;  3UTE A;  3VRA A;  1CC4 A;  3LOV A;  4DNA A;  3T2Z A;  2VVL G;  4RG3 A;  4BJZ A;  5KOW A;  4OPI A;  4U8O A;  2H88 A;  3S5W A;  2WP5 A;  1DOD A;  1LQT A;  2XLR A;  3KVE A;  4XXG A;  2YLZ A;  1L9E A;  1GTH A;  2WP6 A;  4H4V A;  3VRD B;  2JB2 A;  3ICS A;  4LU6 A;  3I6D A;  5KMP A;  3CGB A;  2JB1 A;  4J36 A;  1B4V A;  4TM4 A;  3GWD A;  4H50 A;  5FS8 A;  1KDG A;  4BK3 A;  3NRN A;  3RP6 A;  4CNJ A;  1NHR A;  2XFN A;  5J7X A;  3UKH A;  3T37 A;  3F8R A;  4CCQ A;  4RSL A;  1ZDL A;  1JRZ A;  2FJB A;  3C4N A;  3URH A;  1OJD A;  1P2H A;  2X50 A;  3H4K A;  5KRQ A;  4H4Y A;  1FEC A;  4OPL A;  4U8M A;  1S3B A;  1TYP A;  4REK A;  3UP4 A;  2C66 A;  2XYO A;  2GEW A;  4GDP A;  2WOV A;  1VG9 A;  2B76 A;  4TM3 A;  4OCG A;  3BNU A;  3SGL A;  2X99 A;  4BUR A;  3HYX A;  4H2Q A;  3IF9 A;  3VR8 A;  4H4W A;  4Z2R A;  3ATR A;  3AE5 A;  2AR8 A;  2GQF A;  2VZ2 A;  3KA7 A;  1DJN A;  1EL8 A;  3GD3 A;  1FL2 A;  4G73 A;  3AEA A;  4Z44 A;  3Q6J A;  4OVI A;  4NNJ A;  1QO8 A;  3AEE A;  3GD4 A;  3L1R A;  2F5Z A;  1D5T A;  4YTM A;  4YWO A;  3S61 A;  1PXA A;  3AE1 A;  2BAB A;  4DSG A;  2ZZC A;  3C4A A;  2C7G A;  2ARD A;  1OJC A;  1OJT A;  2C65 A;  3T2Y A;  1K0J A;  4K5S A;  2V6O A;  3RNM A;  2NPX A;  5JCM A;  4OPT A;  3DA1 A;  1JOA A;  3VRB A;  3AE3 A;  3DJG X;  2DKH A;  3DK9 A;  4BK1 A;  3KD9 A;  2WU5 A;  5BRT A;  1PBC A;  2X3N A;  1DJQ A;  4USQ A;  4J31 A;  3VR9 A;  4GF7 A;  1L9C A;  3ICT A;  4H4U A;  1F8W A;  1Y56 B;  3NGC X;  4HB9 A;  4GDE A;  1KSU A;  5CKU A;  1L0V A;  4B64 A;  2BK5 A;  4O5Q A;  1BKW A;  2VOU A;  1ELI A;  3LAD A;  3UOX A;  3QVP A;  4AOX A;  1K0L A;  4H4T A;  3G5Q A;  4IA5 A;  1BGN A;  3AEC A;  4ICY A;  4U2S A;  2YR5 A;  2WOI A;  3NIX A;  2O9Z A;  5BUK A;  3UKA A;  4AOS A;  3GYI A;  3UP5 A;  5KMS A;  4II3 A;  3FIM B;  3IHM A;  1DNC A;  2NVK X;  3D1C A;  1QLB A;  4B69 A;  4Y4N A;  1W4X A;  2FJE A;  2WQY A;  3LXD A;  4I58 A;  5JCK A;  2XFO A;  5M10 A;  3GWF A;  4E0V A;  3NYF A;  3P4R A;  1NHS A;  4TLX A;  4JN9 A;  1HYU A;  3AE2 A;  4ZCC A;  1VDC A;  3GSI A;  3ALJ A;  2W0H A;  1NHP A;  5FS9 A;  3SM8 A;  2WET A;  3JSK A;  4JNA A;  3SFE A;  1F8R A;  2Q0K A;  3UOZ A;  5GRT A;  4A7A A;  4AT0 A;  1XAN A;  4H4Q A;  3SQP A;  2QAE A;  4O5U A;  4TM1 A;  2APG A;  3UCL A;  4Z24 A;  4YTP A;  3AE8 A;  2WDQ A;  1LV0 A;  2YVJ A;  2VRL A;  2XLS A;  4UDQ A;  1LQU A;  2I0Z A;  2WS3 A;  5KVI A;  1N4V A;  2X8G A;  2YG4 A;  2C64 A;  2YLS A;  2BC0 A;  4J2W A;  4JNQ A;  4U8N A;  4Z43 A;  1NPX A;  1D4E A;  1O95 A;  4C5O A;  5LV9 A;  3CGE A;  1GOS A;  4YSH A;  4CNK A;  3AYL A;  3HYW A;  2BS3 A;  2YG7 A;  2YWL A;  1N4W A;  3ADA B;  3SYI A;  4I59 A;  2BYB A;  2V5Z A;  3EAO A;  4B67 A;  5BVA A;  4CBQ A;  4NTC A;  3DJE A;  3SFD A;  2OAL A;  1UKV G;  4UP3 A;  4APN A;  4BJY A;  2WDV A;  1CJ4 A;  3VQR A;  1E1L A;  5IQ1 A;  2B9X A;  2ZZ0 A;  3ZYX A;  4WX1 A;  4A9W A;  3ITJ A;  2BRY A;  4Z26 A;  4K5R A;  3QSM A;  4LII A;  4YSX A;  1FCD A;  1PHH A;  2YLX A;  2XFQ A;  3NT6 A;  4UDP A;  3UOY A;  3CNS A;  4EIQ A;  4ZN0 A;  1IUW A;  3K7M X;  4U8K A;  3H8I A;  3KPF A;  1N4U A;  1DOC A;  1CJ3 A;  3RED A;  4H2N A;  2AAQ A;  1DOB A;  1PJ5 A;  3QFB A;  5JCI A;  1TDF A;  1E1M A;  1GTE A;  2C70 A;  4EM3 A;  3UTF A;  5J60 A;  4J57 A;  1PXB A;  2CFY A;  3B3R A;  3D8X A;  1VRQ B;  3OC4 A;  4U8J A;  1AOG A;  2A89 A;  1Y0P A;  2GB0 A;  4YTN A;  4P9S A;  2TPR A;  1B37 A;  3CPH G;  4U2T A;  2XDO A;  4G74 A;  3DGH A;  1IJH A;  4G9K A;  1IUV A;  1CJC A;  3AED A;  3T31 A;  2R0C A;  1GRH A;  4OPU A;  1GXF A;  2WPE A;  3SY4 A;  1MOK A;  2C67 A;  5EB5 A;  1REO A;  4YKG A;  3DH9 A;  3ZDN A;  1XHC A;  4H4S A;  2WBA A;  2RAB A;  2QA2 A;  5KWF A;  4NEV A;  4H4Z A;  4EMI A;  2B7R A;  5C3J A;  2WEU A;  1GRF A;  1M6I A;  3ISH A;  4YSZ A;  1XPQ A;  3C96 A;  3GMC A;  4FK1 C;  4A99 A;  2BS4 A;  1GV4 A;  2CDU A;  2PHH A;  4EMJ A;  1E7P A;  1E6E A;  1KFY A;  1V59 A;  2YM2 A;  3AE7 A;  3ICR A;  1K0I A;  1E1K A;  2VVM A;  2GF3 A;  2WP9 A;  3IHG A;  4WCT A;  5KXJ A;  4C74 A;  2EQ8 A;  1PBB A;  3BI2 A;  1H83 A;  2GQW A;  4EQR A;  1GET A;  3BI5 A;  3DME A;  2BS2 A;  4J33 A;  3SZW A;  1ZKQ A;  2BK4 A;  4N9X A;  1TRB A;  3CMM A;  2R0P A;  1L9D A;  4ECH A;  2X8C A;  3AYI A;  2R0G A;  3UKK A;  3SZ0 A;  3UTH A;  4NEW A;  1FEB A;  1CBO A;  5M0Z A;  3G5S A;  4AP3 A;  3NHO X;  4FX9 A;  4OPG A;  1MXT A;  3NK0 X;  4IA6 A;  4OPC A;  3EAN A;  4B1B A;  2Q0L A;  4H4R A;  1PJ6 A;  2HQM A;  3IWA A;  3FMW A;  3P4P A;  4RG4 A;  2XVI A;  1GT8 A;  2YLW A;  3UKL A;  3P4S A;  2C76 A;  4J34 A;  3WE0 A;  1NAA A;  1ZOV A;  1JEH A;  3PS9 A;  4K8D A;  4NWZ A;  4II2 A;  2B9W A;  2WOW A;  3HZL A;  3PO7 A;  1GPE A;  4PAB A;  3E1T A;  4TLZ A;  3BNM A;  2C75 A;  3K7T A;  2YLR A;  3NTA A;  5EBK A;  1GND A;  1D4D A;  1YQ4 A;  2JBV A;  1F8S A;  3GDP A;  2GR2 A;  1PXC A;  3NG7 X;  4DGK A;  3CTY A;  4YSY A;  2V61 A;  5KVH A;  1GES A;  1EBD A;  1P2E A;  1FOH A;  4A5L A;  4MJW A;  5U63 A;  4DSH A;  1COY A;  2WPC A;  3P4Q A;  1GER A;  2QA1 A;  3NN0 X;  4KX6 A;  4U2L A;  3QJ4 A;  2YM1 A;  3F8D A;  2WPF A;  1CC2 A;  1LJ1 A;  3K7Q X;  5IPY A;  2OLN A;  5EB4 A;  2BCG G;  4GAP A;  3BHF A;  3AWI A;  3G5R A;  2RGH A;  1YQ3 A;  2XLU A;  3ALL A;  1GRE A;  2GMH A;  2XVH A;  3P9U A;  3ALM A;  3ATQ A;  4UDR A;  4GRT A;  1EL5 A;  5FS7 A;  2E5V A;  3KPK A;  2Q7V A;  3IC9 A;  1BWC A;  2GR0 A;  2GR1 A;  3AD7 B;  4EQS A;  1H6V A;  2WDR A;  3LZW A;  1KF6 A;  4CRT A;  4A6N A;  4B65 A;  4Z2U A;  1GAL A;  3M12 A;  2C3C A;  4AT2 A;  3AYJ A;  3GRS A;  1SEZ A;  2C73 A;  1ZP0 A;  3NYE A;  1PJ7 A;  1E39 A;  4K2X A;  1TYT A;  2H89 A;  1PBF A;  3LJP A;  4PAA A;  5HY5 A;  2FBW A;  4U8I A;  4M52 A;  3CNT A;  2GH5 A;  2JAE A;  1H84 A;  5U25 A;  4EM4 A;  3RHA A;  3AD8 B;  2OA1 A;  1ZMD A;  3AE9 A;  3BHK A;  4IVO B;  4EMW A;  2E4G A;  3LB8 A;  3V3O A;  4H2P A;  2YAU A;  4NTE A;  1IUS A;  4C3X A;  2B7S A;  2WU2 A;  2GR3 A;  4Z25 A;  4U8L A;  2QCU A;  3II4 A;  5HHF A;  5ER0 A;  3DK4 A;  5EOW A;  2BK3 A;  4B68 A;  3PVC A;  1JRY A;  1S2Y A;  3GRT A;  3NH3 X;  2XVE A;  2XFP A;  2YG5 A;  2YQU A;  3AB1 A;  4H7U A;  1RSG A;  3DJJ A;  3HYV A;  4X4J A;  3T0K A;  2EQ6 A;  1YKJ A;  2ZBW A;  5C2T A;  2E1M A;  3CIR A;  3QSS A;  3KLJ A;  1PBE A;  3CNJ A;  4LA1 A;  4H4X A;  3RP7 A;  1CHU A;  4TM0 A;  2J3N A;  1ONF A;  1NG4 A;  1RYI A;  3ABV A;  3CN8 A;  5HYM A;  2IVD A;  2BC1 A;  1VG0 A;  3SZF A;  1O94 A;  2VRM A;  3QSE A;  5IQ4 A;  2XVJ A;  4C77 A;  1PS9 A;  3GYX A;  4GCM A;  3M0O A;  2C72 A;  2OLO A;  1F3P A;  1KSS A;  1KNP A;  1YY5 A;  3AXB A;  4X9N A;  4Y4L A;  1KNR A;  4H4P A;  4YT0 A;  3DGZ A;  2WHD A;  5CQF A;  3V76 A;  4D04 A;  1YQZ A;  1IUU A;  3NKS A;  2XCG A;  3QFA A;  4IVM B;  1NG3 A;  3UTG A;  2YG3 A;  4G6G A;  4K7Z A;  4A79 A;  1D7L A;  3KU9 A;  1XDI A;  2R45 A;  1DOE A;  1X31 B;  2DKI A;  3O0H A;  5GSN A;  4AP1 A;  2GRT A;  2BRA A;  2CVJ A;  1GRA A;  1D4C A;  1NDA A;  3NYC A;  4KPR A;  4U8P A;  2GAH B;  2JKC A;  3DK8 A;  4XWR A;  4K22 A;  1Q1W A;  2BCP A;  1FEA A;  1QJD A;  1ZOY A;  2UZZ A;  1M64 A;  1JNZ A;  2V3A A;  3CPJ G;  3NTD A;  5L46 A;  4G6H A;  3EPT A;  1H7X A;  3AEB A;  3B6D A;  4XWZ A;  3UKQ A;  1GEU A;  3AEF A;  1TDK A;  4JDR A;  3FBS A;  2XVF A;  2R4E A;  1Y56 A;  3GYJ A;  4BK2 A;  2JB3 A;  1H82 A;  1LTX R;  4USR A;  3DJD A;  5DBJ A;  1ZY8 A;  1S3E A;  3I3L A;  3AD9 B;  3SZC A;  3CPI G;  3L8K A;  1CC6 A;  3SX6 A;  5KNL A;  1B8S A;  2V60 A;  4ZCD A;  1H81 A;  1JRX A;  3BI4 A;  3NN6 X;  2GVC A;  1H86 A;  2R46 A;  2XLT A;  5TR3 A;  2EQ9 A;  1EL9 A;  2Q6U A;  2V3B A;  2YR4 A;  3CND A;  4GAV A;  4Y4M A;  3COX A;  4D03 A;  4GR1 A;  4FK1 A;  4IV9 A;  2FJD A;  2OAM A;  4OPD A;  5HXI A;  3NNE A;  2A87 A;  2BXS A;  1TDO A;  3CGD A;  4EQW A;  1JNR A;  3EF6 A;  4J56 A;  2PYX A;  2CUL A;  1Z6L A;  1B5Q A;  2GAG B;  2Y6Q A;  4CCR A;  4A65 A;  5BUL A;  2XLP A;  3K30 A;  1PBD A;  4NTD A;  5KMR A;  5U1O A;  4H2R A;  3UKF A;  1CJ2 A;  2Z5Y A;  3GDN A;  3SXI A;  2YVF A;  5FS6 A;  3AEG A;  3LZX A;  1LVL A;  2Z5X A;  2RGO A;  3NK1 X;  3CGC A;  1PDH A;  1GSN A;  3NK2 X;  3UKP A;  2C4C A;  2YLT A;  4CY8 A;  3FPZ A;  1H7W A;  4EIP A;  1ZMC A;  1D7Y A;  4YKF A;  3AE4 A;  1F6M A;  2YVG A;  1Q9I A;  2ACZ A;  4YXD A;  1IUT A;  1OJA A;  1BF3 A;  4B63 A;  2R4J A;  1S2Q A;  2AQJ A;  3FG2 P;  3GMB A;  4JQ9 A;  3T14 A;  4ADW A;  2VQB A;  2YG6 A;  3NLC A;  2WES A;  3T2K A;  5JCL A;  1IUX A;  3F8P A;  2BA9 A;  4CY6 A;  4JY3 A;  4HA6 A;  2JK6 A;  1CF3 A;  4GUV A;  1BGJ A;  2R9Z A;  1Q1R A;  1OJ9 A;  4FDC B;  2A8X A;  2GV8 A;  2TMD A;  1ZX9 A;  5JCN A;  5KMQ A;  2VVL A;  2RGJ A;  2X8H A;  1E1N A;  1GRT A;  3KKJ A;  1O5W A;  2BXR A;  2C3D A;  1NEK A;  1CL0 A;  3H8L A;  1RP0 A;  2ZZB A;  3Q9T A;  3OZ2 A;  3UOV A;  3R9U A;  3M13 A;  3CNP A;  2B9Y A;  4EQX A;  3V3N A;  1MO9 A;  1ZK7 A;  1GRB A;  1K4Q A;  4NZH A;  1NHQ A;  2IID A;  2FJA A;  1TDN A;  4X9M A;  2IVE A;  1EL7 A;  1DXL A;  2BAC A;  3P1W A;  3QVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...