5BVAA

Structure of flavin-dependent brominase bmp2
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
399
structure length
398
Chain Sequence
THYDVVIIGSGPAGSLCGIECRKKGLSVLCIEKEQFPRFHIGESLTGNAGQIIRDLGLAEDMDAAGFPDKPGVNVIGSLSKNEFFIPILAPTWQVRRSDFDDMIKRKAVEHGVEYKLGMVTDVIKDGEKVVGALYKAGVEHQVRSKVLVDASGQNTFLSRKGVAGKRQIEFFSQQIASFAHYKGVERDLPPFSTNTTILYSKQYHWSWIIPISPDTDSLGVVIPKDLYYKECKNPDDAIAWGMDHISPELKRRFKNAERQGDSQSMADFSYRIEPFVGDGWMCIGDAHRFLDPIFSYGVSFAMKEGIRAAEAIAQVVAGQDWKAPFYAYRDWSNGGQQIAADLIRYFWIYPIFFGYQMQNPDLRDEVIRLLGGCCFDCEGWKAPAIFRNAIEEYDRKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces
molecule tags Hydrolase
molecule keywords flavin-dependent halogenase
total genus 146
structure length 398
sequence length 399
ec nomenclature
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bvaA00
1GESA 3PO7A 3WE0A 4H4XA 3CNPA 3ATQA 5U1OA 5IPYA 4A99A 1GEUA 4U2SA 1KSSA 3CN8A 4JQ9A 5BVAA 5J60A 3GD4A 3EANA 4GDPA 2R46A 1K4QA 2ZZBA 5J7XA 1YY5A 1IUVA 4N9XA 4CBQA 1K0IA 2WOWA 1ZX9A 2IIDA 4KPRA 2GR0A 5L46A 2XLRA 3AEEA 2X8CA 3NN6X 5FS8A 3UKLA 4YTNA 1TRBA 3QFBA 2GMJA 1ZP0A 4MJWA 2RGJA 2XCGA 3AYJA 3NK0X 3NYEA 3E1TA 3SM8A 1IUWA 2WETA 3RP8A 1E1LA 3AE7A 3DGZA 3FMWA 2Z5XA 3DK9A 3IF9A 5CQFA 3SFEA 1D7LA 4IA5A 4EMJA 1E7PA 1QJDA 4AP3A 3KU9A 2O9ZA 3LB8A 3F8RA 4H4PA 1CJ2A 4U8LA 1L9DA 2XFNA 3C96A 4K22A 3CNJA 2VVLG 2XVIA 1IUUA 2A8XA 1GOSA 2VQ7A 5LV9A 2B7RA 4USRA 2XFQA 1GREA 3L8KA 4OPGA 1AOGA 2GR3A 2XVJA 2UZZA 1NENA 4H2QA 4REKA 1N4UA 2AR8A 4B69A 1JRYA 4JNAA 1OJAA 2VQBA 1FEBA 1VG9A 1ZOVA 3NNEA 3LZXA 2W0HA 1ELIA 2WOVA 2R0GA 3GMBA 4TM0A 4EMWA 3QVPA 4YTPA 1NAAA 3FBSA 2X3NA 2F5ZA 1GTEA 3P1WA 1N1PA 1VRQB 1PBDA 4Y4MA 4IVOB 3K7MX 3KPFA 4YT0A 5JCLA 3NRNA 2IVEA 3IHGA 2WBAA 3O0HA 2FBWA 3ZDNA 2C73A 2ZZ0A 3G5QA 4M52A 4AT2A 4YTMA 1Q1WA 2R0PA 3CGEA 3NIXA 5KVHA 1FECA 1GRBA 2BS3A 1M64A 3B3RA 3NLCA 3RHAA 2WDQA 1BZLA 3NHOX 1NHSA 5EB4A 4UDRA 1GETA 4EM4A 4XWRA 2WP6A 3UTGA 1B4VA 1NPXA 5TR3A 3UOXA 5KXJA 4X4JA 3UOZA 3AD9B 1Q9IA 4H4UA 1LPFA 3NT6A 5EOWA 3ADAB 3UKPA 1JRXA 3UP5A 4A79A 1ZY8A 4XWZA 2WU5A 4C3XA 1TDOA 3VRBA 5IQ1A 4WX1A 1X31B 3NN0X 1E39A 3G5SA 2E1MA 2WQYA 2RABA 2V6OA 4NEVA 1GRTA 4H4ZA 3I6DA 5JCKA 1PBBA 1YKJA 3UOVA 1FEAA 1S2YA 2C3DA 4Z24A 2PHHA 1L9CA 3R9UA 3F8PA 3P4QA 2YR4A 4I59A 4ADWA 4BJYA 1F8WA 1EL5A 3ATRA 3DGHA 3CNSA 3T37A 5C2TA 5EB5A 3IC9A 3NKSA 2XVHA 2EQ7A 3BHKA 1PXCA 2BS2A 2Q6UA 3QSSA 2EQ9A 2XDOA 4EQXA 1ZKQA 2WDVA 2FJBA 1CHUA 4U8OA 3CGDA 4AT0A 2CULA 3LADA 4A6NB 3OZ2A 1BWCA 3AXBA 1XDIA 2YG7A 2GB0A 3NK1X 1ZDLA 2GR2A 2R4EA 4H2RA 1W4XA 1PHHA 2BXSA 4PABA 4B66A 3D1CA 2WS3A 4H2PA 2CDUA 4A9WA 5BRTA 5ER0A 3BI2A 2QAEA 1XHCA 1BGNA 1N4VA 2FJEA 4U8KA 4NTDA 4C74A 5IQ4A 3LOVA 4HB9A 5KOWA 1JU2A 1GERA 1LQUA 3H4KA 5DBJA 3ZYXA 2YWLA 4EQRA 1EL7A 2GV8A 3KD9A 1NHRA 3ALMA 2ARDA 4OVIA 2X8HA 4U8IA 4B68A 2JB3A 3AD7B 4X9NA 1PJ7A 3QVRA 3GD3A 1MO9A 1NEKA 3UKHA 1GALA 3UTEA 4TLXA 2R0CA 1PS9A 3DMEA 3AEFA 1VG0A 2GQFA 1VDCA 1JNRA 1S2QA 1TDNA 1D7YA 1HYUA 4JN9A 1H7XA 1DODA 3FIMB 1ZMDA 2C65A 3NG7X 3CIRA 3DJGX 3UTFA 5C3JA 3VR8A 5HXIA 2V5ZA 1RSGA 2R45A 4Z2UA 2Q0LA 2CFYA 1YQ3A 2BK4A 1NHPA 2WDRA 1KFYA 4J36A 1PDHA 4CY6A 3DJEA 4A65A 2B7SA 3BI5A 2YLRA 3AD8B 1S3EA 3CPIG 1E1MA 1B37A 2QA1A 5KVIA 3JSKA 2H88A 1LTXR 4LU6A 3REDA 4D04A 4BK1A 3CNTA 1GRGA 4DNAA 3NH3X 3NTDA 3S61A 1NHQA 4ZCDA 2WEUA 4EIQA 3ICRA 2AAQA 3QSMA 5GSNA 5HYMA 3EPTA 3P4PA 4EM3A 1OJ9A 4DSHA 4OPTA 3UP4A 4B65A 4EMIA 4J57A 3D8XA 5FS7A 4KX6A 1XANA 4YSYA 3AWIA 4K7ZA 4IVMB 4USQA 4CNJA 1O95A 5JCMA 4ECHA 4H2NA 1DOEA 1P2HA 1KNRA 2RGHA 1S3BA 4GCMA 5M10A 1CJ4A 2B9XA 2Q0KA 2YVJA 4NTCA 4BK3A 1P2EA 3P4RA 4A6NA 2APGA 3KKJA 1CJ3A 3AYLA 4P9SA 2BK3A 3Q9TA 3V76A 4B64A 5U25A 1LQTA 1BGJA 4JY2A 3HZLA 3DA1A 4GR1A 1CJCA 1MXTA 2C7GA 1JNZA 3EAOA 4H4SA 1PBEA 2JAEA 2XVEA 4EQWA 1GRHA 4OPCA 2X8GA 3AEGA 4H4TA 4AOXA 4H50A 4Z2TA 4RG3A 1EL9A 4NEWA 2YG4A 1LV0A 2YLXA 1CBOA 2XLSA 3Q6JA 2OLOA 1E6EA 3DJJA 4J34A 2YLWA 3AE9A 4H4RA 4IV9A 4OPIA 3RP7A 3SFDA 2JB2A 3QSEA 4K5SA 3GWDA 4I58A 4C3YA 1COYA 2A89A 2BABA 1KNPA 2JKCA 2BXRA 2BCGG 4CY8A 2X99A 1GXFA 4Z2RA 5HY5A 1TYTA 2BA9A 1ZK7A 1DOCA 4FDCB 3ICTA 4FX9A 3BHFA 3K7QX 4YSXA 1IUXA 4U2TA 4LIIA 2BYBA 2C64A 2BK5A 1FOHA 2QCUA 4UDQA 4ICYA 2YVFA 2C76A 2FJAA 1GT8A 2YM2A 4Y4NA 1O5WA 3AB1A 4TM4A 4EIPA 3AE2A 4EQSA 2GH5A 2GEWA 2GMHA 4IA6A 4NTEA 1D4CA 2YVGA 3UTHA 4BJZA 4OPLA 4J56A 2Y6RA 3BNUA 1TDEA 2C70A 3URHA 1H83A 3FG2P 3ITJA 1MOKA 2I0ZA 4JDRA 1GPEA 2JB1A 3QJ4A 2AQJA 1NDAA 2IVDA 1CL0A 1FL2A 2YM1A 1CC6A 2Q7VA 2DKHA 4DSGA 3UKQA 4CCQA 4YKGA 3CNDA 1QLBA 2JK6A 3VRDB 2CVJA 3DK4A 2V3BA 1E1KA 2WU2A 3GWFA 1E1NA 2YLZA 2JBVA 3GYJA 5HHFA 2YAUA 4APNA 4B67A 3CGBA 4UDPA 2YR6A 5JCNA 3VQRA 4CRTA 1L9EA 2Z5YA 4U8NA 4BURA 1CC4A 1BF3A 3II4A 2WPCA 4B1BA 1H81A 2HQMA 3VR9A 3NGCX 3UKFA 1V59A 2WP9A 3AECA 4J31A 5JCIA 3CPJG 2GAHB 2YG6A 4AOSA 1H7WA 2C66A 3EF6A 1REOA 3K7TA 4UP3A 4A5LA 4Z25A 1IJHA 4RG4A 4GF7A 3M13A 5M0ZA 1K0JA 2V60A 3KVEA 1D4DA 4RSLA 2VVMA 2NVKX 3UKKA 1H84A 4OPUA 1NG4A 4Z43A 2C72A 1CC2A 5U63A 3LJPA 4CNKA 1N4WA 3AYIA 1IUSA 2C75A 2GAGB 1DNCA 1O94A 1YQZA 2B9WA 2YLSA 4GDEA 3P9UA 2VRMA 3KA7A 4H4YA 2QA2A 4C5OA 1DJQA 3NK2X 1GRFA 2C67A 3GDNA 2XFPA 3PS9A 3GSIA 3SQPA 2V61A 1K0LA 4GUVA 1JEHA 1F8RA 2Y6QA 3LXDA 2YG5A 4LA1A 2BS4A 4H4QA 1RP0A 1JRZA 1GV4A 3C4AA 1Y0PA 3AE3A 1RYIA 1OJCA 4Y4LA 3RP6A 4AP1A 1JOAA 2XYOA 5FS9A 3KLJA 5EBKA 1GSNA 1UKVG 2EQ6A 2R4JA 1YQ4A 2RGOA 3ALLA 1PJ6A 3GRTA 2NPXA 2WHDA 3AE5A 4FK1C 1SEZA 3V3OA 4J2WA 4Z26A 1KF6A 1CF3A 1KDGA 5GRTA 2C3CA 4ZCCA 5FMHA 4BK2A 2E5VA 2GVCA 2GRTA 3COXA 4K2XA 3CPHG 3GDPA 2X50A 3GRSA 2WP5A 2XLTA 4XXGA 1KSUA 4Z44A 2J3NA 3GYIA 3FPZA 1F3PA 2XLPA 4FK1A 4CCRA 3AE4A 4H7UA 1TYPA 1M6IA 2DKIA 2WOIA 2XFOA 4YSZA 2OLNA 1H82A 3ICSA 1TDKA 3M0OA 2B9YA 4OPDA 2WPEA 5BULA 4JNQA 1L0VA 1PN0A 3OC4A 2GR1A 4BV6A 5KRQA 4D03A 5KOXA 2A87A 1PBFA 3AEAA 4NZHA 2BCPA 2VVLA 2TMDA 1D5TA 3QFAA 1PBCA 1DXLA 4DGKA 2PYXA 3UKAA 2BC0A 2VOUA 3I3LA 5CKUA 2H89A 2B76A 1B5QA 1B8SA 2BACA 1BKWA 3K30A 4X9MA 3LZWA 1PJ5A 2OA1A 2WESA 3VRAA 5BUKA 2WPFA 1OJTA 1ZMCA 3DK8A 4K5RA 2XVFA 4TLZA 3G5RA 4YSHA 2FJDA 4H4WA 1DJNA 3IWAA 1OJDA 3H8IA 3P4SA 4K8DA 4U8PA 5KWFA 3AEDA 3NYCA 3IHMA 3F8DA 1IUTA 2ACZA 4WCTA 4GRTA 2GF3A 3GMCA 1Y56A 1GTHA 1DOBA 2EQ8A 4OCGA 1VQWA 3AE8A 3ISHA 4TM1A 4U2LA 1H6VA 2XLUA 1GNDA 4YWOA 2ZZCA 2BC1A 4TM3A 2E4GA 4U8JA 5FS6A 1PXBA 1PXAA 4O5UA 3BI4A 4HA6A 4PAAA 4C77A 3M12A 2GQWA 1EL8A 3RNMA 2OAMA 3ABVA 3C4NA 3AE1A 3CGCA 1EBDA 1Y56B 1D4EA 2YG3A 2ZBWA 2YR5A 2OALA 4YKFA 2R9ZA 1NG3A 3AEBA 4J33A 3UCLA 3SGLA 3ALJA 1LJ1A 2XFUA 1F6MA 1LVLA 3AE6A 3B6DA 3CTYA 4A7AA 2V3AA 1FCDA 1TDFA 3DJDA 3DH9A 3L1RA 3NTAA 4JY3A 4U8MA 3UOYA 3BNMA 1H86A 2VZ2A 4E0VA 4H4VA 3V3NA 1ONFA 4YXDA 3NYFA 1ZOYA 2YLTA 3PVCA 4O5QA 1QO8A 1F8SA 1XPQA 2YQUA 4B63A 2VRLA 1GRAA 1Q1RA 4ZN0A 3H8LA 3S5WA 1Z6LA 2TPRA
chains in the Genus database with same CATH superfamily
1GESA 3PO7A 3WE0A 4H4XA 3SZ0A 3CNPA 3ATQA 5U1OA 5IPYA 4A99A 1GEUA 4U2SA 1KSSA 3CN8A 4JQ9A 5BVAA 5J60A 3HYVA 3GD4A 3EANA 4GDPA 2R46A 1K4QA 2ZZBA 5J7XA 1YY5A 1IUVA 4N9XA 4CBQA 1K0IA 2WOWA 1ZX9A 2IIDA 4KPRA 2GR0A 5L46A 2XLRA 3AEEA 2X8CA 3NN6X 5FS8A 3UKLA 4YTNA 1TRBA 3QFBA 2GMJA 1ZP0A 4MJWA 2RGJA 2XCGA 3AYJA 3NK0X 3NYEA 3E1TA 3SM8A 1IUWA 2WETA 3T14A 3RP8A 1E1LA 3AE7A 3DGZA 3FMWA 2Z5XA 3DK9A 3IF9A 5CQFA 3SFEA 1D7LA 4IA5A 3SYIA 1E7PA 1QJDA 4AP3A 3KU9A 2O9ZA 3LB8A 3T2YA 3F8RA 4H4PA 1CJ2A 4U8LA 1L9DA 2XFNA 3C96A 4K22A 3CNJA 2VVLG 2XVIA 1IUUA 2A8XA 1GOSA 2VQ7A 5LV9A 2B7RA 4USRA 2XFQA 1GREA 4G9KA 3L8KA 4OPGA 1AOGA 2GR3A 2XVJA 2UZZA 1NENA 4H2QA 4REKA 1N4UA 2AR8A 4B69A 1JRYA 2BRYA 3T31A 5KMQA 4JNAA 1OJAA 2VQBA 1FEBA 1VG9A 1ZOVA 3NNEA 3LZXA 2W0HA 1ELIA 2WOVA 2R0GA 3GMBA 4TM0A 4EMWA 3QVPA 4YTPA 1NAAA 5KMSA 3FBSA 2X3NA 2F5ZA 1GTEA 3P1WA 1N1PA 1VRQB 1PBDA 4Y4MA 4IVOB 3K7MX 3KPFA 4YT0A 5JCLA 3NRNA 2IVEA 3IHGA 2WBAA 3O0HA 2FBWA 3ZDNA 2C73A 2ZZ0A 3G5QA 4M52A 4AT2A 4YTMA 1Q1WA 2R0PA 3CGEA 3NIXA 5KVHA 1FECA 1GRBA 5KMRA 2BS3A 1M64A 3B3RA 3NLCA 3RHAA 2WDQA 1BZLA 3NHOX 1NHSA 5EB4A 4UDRA 1GETA 4EM4A 4XWRA 2WP6A 3UTGA 1B4VA 1NPXA 5TR3A 3UOXA 5KXJA 4X4JA 3UOZA 3AD9B 1Q9IA 4H4UA 1LPFA 3NT6A 5EOWA 3ADAB 3UKPA 1JRXA 3UP5A 4A79A 1ZY8A 4XWZA 2WU5A 4C3XA 1TDOA 3VRBA 5IQ1A 4WX1A 1X31B 3NN0X 1E39A 3G5SA 2E1MA 2WQYA 2RABA 2V6OA 4NEVA 1GRTA 4H4ZA 3I6DA 5JCKA 1PBBA 1YKJA 3UOVA 1FEAA 1S2YA 2C3DA 4Z24A 2PHHA 1L9CA 3R9UA 3F8PA 3P4QA 2YR4A 4I59A 4ADWA 4BJYA 1F8WA 1EL5A 3ATRA 3DGHA 3CNSA 3T37A 5C2TA 5EB5A 3IC9A 3NKSA 2XVHA 2EQ7A 3BHKA 1PXCA 2BS2A 2Q6UA 3QSSA 2EQ9A 3HYXA 2XDOA 4EQXA 1ZKQA 2WDVA 2FJBA 1CHUA 4U8OA 3CGDA 4AT0A 2CULA 3LADA 4A6NB 3OZ2A 1BWCA 3AXBA 1XDIA 2YG7A 2GB0A 3NK1X 1ZDLA 2GR2A 2R4EA 4H2RA 1W4XA 1PHHA 2BXSA 4PABA 4B66A 3D1CA 2WS3A 4H2PA 2CDUA 3T2KA 4A9WA 5ER0A 3BI2A 2QAEA 5BRTA 1XHCA 1BGNA 1N4VA 2FJEA 4U8KA 4NTDA 4C74A 5IQ4A 3LOVA 4HB9A 5KOWA 1JU2A 1GERA 1LQUA 3H4KA 5DBJA 3ZYXA 2YWLA 4EQRA 1EL7A 2GV8A 3KD9A 1NHRA 3ALMA 2ARDA 4OVIA 2X8HA 4U8IA 4B68A 2JB3A 3AD7B 4X9NA 1PJ7A 3QVRA 3GD3A 1MO9A 1NEKA 3UKHA 1GALA 3UTEA 4TLXA 2R0CA 1PS9A 3DMEA 3AEFA 1VG0A 2GQFA 1VDCA 3T0KA 1JNRA 1S2QA 1TDNA 1D7YA 1HYUA 4JN9A 1H7XA 1DODA 3FIMB 1ZMDA 2C65A 3NG7X 3CIRA 3DJGX 3SXIA 3UTFA 5C3JA 3VR8A 4GAVA 5HXIA 2V5ZA 1RSGA 2R45A 4Z2UA 2Q0LA 2CFYA 1YQ3A 2BK4A 1NHPA 2WDRA 1KFYA 4J36A 1PDHA 3GYXA 3DJEA 4A65A 4CY6A 2B7SA 3BI5A 2YLRA 3AD8B 1S3EA 3CPIG 1E1MA 1B37A 2QA1A 5KVIA 3JSKA 2H88A 1LTXR 4LU6A 3REDA 4D04A 4BK1A 3CNTA 1GRGA 4DNAA 3NH3X 3NTDA 3S61A 1NHQA 4ZCDA 2WEUA 4EIQA 3ICRA 2AAQA 3QSMA 5GSNA 3SX6A 3EPTA 3P4PA 3SZWA 1OJ9A 4DSHA 4EM3A 5HYMA 4OPTA 3UP4A 4B65A 4EMIA 4J57A 3D8XA 5FS7A 4KX6A 1XANA 4YSYA 3HYWA 3AWIA 4K7ZA 4IVMB 4USQA 4CNJA 1O95A 5JCMA 4ECHA 4H2NA 1DOEA 1P2HA 1KNRA 2RGHA 1S3BA 5KMPA 4GCMA 5M10A 1CJ4A 2B9XA 2Q0KA 2YVJA 4NTCA 3SY4A 4BK3A 1P2EA 3P4RA 4A6NA 2APGA 3KKJA 1CJ3A 3AYLA 4P9SA 2BK3A 3Q9TA 3V76A 4B64A 5U25A 1LQTA 1BGJA 4JY2A 3HZLA 3DA1A 4GR1A 1CJCA 1MXTA 2C7GA 1JNZA 3EAOA 4H4SA 1PBEA 2JAEA 2XVEA 4EQWA 1GRHA 4OPCA 2X8GA 3AEGA 4H4TA 4AOXA 4H50A 4Z2TA 4RG3A 1EL9A 4NEWA 2YG4A 1LV0A 2YLXA 1CBOA 2XLSA 3Q6JA 2OLOA 1E6EA 3DJJA 4J34A 2YLWA 3AE9A 4H4RA 4IV9A 4OPIA 2BRAA 3SFDA 2JB2A 3QSEA 4K5SA 3GWDA 4I58A 4C3YA 1COYA 2A89A 2BABA 1KNPA 2JKCA 2BXRA 2BCGG 4CY8A 2X99A 1GXFA 4Z2RA 5HY5A 1TYTA 2BA9A 1ZK7A 1DOCA 4FDCB 3ICTA 4FX9A 3BHFA 3K7QX 4NNJA 4YSXA 1IUXA 4U2TA 4LIIA 2BYBA 2C64A 2BK5A 1FOHA 2QCUA 4UDQA 4ICYA 2YVFA 2C76A 2FJAA 1GT8A 2YM2A 4Y4NA 1O5WA 3AB1A 4TM4A 4EIPA 3AE2A 4EQSA 2GH5A 2GEWA 2GMHA 4IA6A 4NTEA 1D4CA 2YVGA 3UTHA 4BJZA 4OPLA 4J56A 2Y6RA 3BNUA 1TDEA 2C70A 3URHA 1H83A 3FG2P 3ITJA 1MOKA 2I0ZA 4G74A 1GPEA 4JDRA 2JB1A 3QJ4A 2AQJA 1NDAA 2IVDA 1CL0A 1FL2A 2YM1A 1CC6A 2Q7VA 2DKHA 4DSGA 3UKQA 4CCQA 4YKGA 3CNDA 1QLBA 2JK6A 3VRDB 2CVJA 3DK4A 2V3BA 1E1KA 2WU2A 3GWFA 1E1NA 2YLZA 2JBVA 3GYJA 5HHFA 2YAUA 4APNA 4B67A 3SZFA 3CGBA 4UDPA 2YR6A 5JCNA 3VQRA 4CRTA 1L9EA 2Z5YA 4U8NA 4BURA 1CC4A 1BF3A 3CMMA 3II4A 2WPCA 4B1BA 1H81A 2HQMA 3VR9A 3NGCX 3UKFA 1V59A 2WP9A 3AECA 4J31A 5JCIA 3CPJG 2GAHB 2YG6A 4G73A 4AOSA 1H7WA 2C66A 3EF6A 1REOA 3K7TA 4UP3A 4EMJA 4A5LA 4Z25A 1IJHA 4RG4A 4GF7A 3M13A 5M0ZA 1K0JA 2V60A 3KVEA 1D4DA 4RSLA 2VVMA 2NVKX 3UKKA 1H84A 4OPUA 1NG4A 4Z43A 2C72A 1CC2A 5U63A 3LJPA 4CNKA 1N4WA 3AYIA 1IUSA 2C75A 2GAGB 1DNCA 1O94A 1YQZA 2B9WA 2YLSA 4GDEA 3P9UA 2VRMA 3KA7A 4H4YA 4II2A 2QA2A 4C5OA 1DJQA 3NK2X 1GRFA 2C67A 3GDNA 2XFPA 3PS9A 3GSIA 3SQPA 2V61A 1K0LA 4NWZA 4GUVA 1JEHA 1F8RA 2Y6QA 3LXDA 2YG5A 4LA1A 2BS4A 4H4QA 1RP0A 1JRZA 1GV4A 3C4AA 1Y0PA 3AE3A 1RYIA 1OJCA 4Y4LA 3RP6A 4AP1A 1JOAA 2XYOA 5FS9A 3KLJA 4G6HA 5EBKA 1GSNA 3KPKA 1UKVG 2EQ6A 2R4JA 1YQ4A 2RGOA 3ALLA 1PJ6A 3GRTA 2NPXA 2WHDA 3AE5A 4FK1C 1SEZA 3V3OA 4J2WA 4Z26A 1KF6A 1CF3A 1KDGA 5GRTA 2C3CA 4ZCCA 5FMHA 4BK2A 2E5VA 2GVCA 2GRTA 3COXA 4K2XA 3CPHG 3GDPA 2X50A 3GRSA 2WP5A 2XLTA 4XXGA 1KSUA 4Z44A 2J3NA 3GYIA 3FPZA 1F3PA 2XLPA 4FK1A 4CCRA 3AE4A 4H7UA 1TYPA 1M6IA 2DKIA 2WOIA 2XFOA 4YSZA 2OLNA 1H82A 3ICSA 1TDKA 3M0OA 2B9YA 4OPDA 2WPEA 5BULA 4JNQA 1L0VA 1PN0A 3OC4A 2GR1A 4BV6A 5KRQA 4D03A 5KOXA 2A87A 1PBFA 3AEAA 4NZHA 2BCPA 2VVLA 2TMDA 1D5TA 3QFAA 1PBCA 1DXLA 4DGKA 2PYXA 3UKAA 2BC0A 2VOUA 3I3LA 5CKUA 2H89A 2B76A 3SZCA 1B5QA 1B8SA 2BACA 1BKWA 3K30A 4X9MA 3LZWA 1PJ5A 2OA1A 2WESA 4II3A 3VRAA 5BUKA 2WPFA 1OJTA 1ZMCA 3DK8A 4K5RA 2XVFA 4TLZA 5KNLA 3G5RA 4YSHA 2FJDA 4H4WA 1DJNA 3T2ZA 3IWAA 1OJDA 3H8IA 3P4SA 4K8DA 4U8PA 5KWFA 3AEDA 3NYCA 3IHMA 3F8DA 1IUTA 2ACZA 4WCTA 4GRTA 4GAPA 2GF3A 3GMCA 1Y56A 1GTHA 1DOBA 2EQ8A 4OCGA 1VQWA 3AE8A 3ISHA 4TM1A 4U2LA 1H6VA 2XLUA 1GNDA 4YWOA 2ZZCA 2BC1A 4TM3A 2E4GA 4U8JA 5FS6A 1PXBA 1PXAA 4O5UA 3BI4A 4HA6A 4PAAA 4C77A 3M12A 2GQWA 1EL8A 3RNMA 2OAMA 3ABVA 3C4NA 3AE1A 3CGCA 1EBDA 1Y56B 3RP7A 2C4CA 1D4EA 2YG3A 2ZBWA 2YR5A 2OALA 4YKFA 2R9ZA 1NG3A 3AEBA 4J33A 3UCLA 3SGLA 3ALJA 1LJ1A 2XFUA 1F6MA 1LVLA 3AE6A 3B6DA 3CTYA 4A7AA 2V3AA 1FCDA 1TDFA 3DJDA 3DH9A 3L1RA 3NTAA 4G6GA 4JY3A 4U8MA 3BNMA 3UOYA 1H86A 2VZ2A 4E0VA 4H4VA 3V3NA 1ONFA 4YXDA 3NYFA 1ZOYA 2YLTA 3PVCA 4O5QA 1QO8A 1F8SA 1XPQA 2YQUA 4B63A 2VRLA 1GRAA 1Q1RA 4ZN0A 3H8LA 3S5WA 1Z6LA 2TPRA
chains in the Genus database with same CATH topology
1GESA 3PO7A 3WE0A 4H4XA 3SZ0A 3CNPA 3ATQA 5U1OA 5IPYA 4A99A 1GEUA 4U2SA 1KSSA 3CN8A 4JQ9A 5BVAA 5J60A 3HYVA 3GD4A 3EANA 4GDPA 2R46A 1K4QA 2ZZBA 5J7XA 1YY5A 1IUVA 4N9XA 4CBQA 1K0IA 2WOWA 1ZX9A 2IIDA 4KPRA 2GR0A 5L46A 2XLRA 3AEEA 2X8CA 3NN6X 5FS8A 3UKLA 4YTNA 1TRBA 3QFBA 2GMJA 1ZP0A 4MJWA 2RGJA 2XCGA 3AYJA 3NK0X 3NYEA 3E1TA 3SM8A 1IUWA 2WETA 3T14A 3RP8A 1E1LA 3AE7A 3DGZA 3FMWA 2Z5XA 3DK9A 3IF9A 5CQFA 3SFEA 1D7LA 4IA5A 3SYIA 1E7PA 1QJDA 4AP3A 3KU9A 2O9ZA 3LB8A 3T2YA 3F8RA 4H4PA 1CJ2A 4U8LA 1L9DA 2XFNA 3C96A 4K22A 3CNJA 2VVLG 2XVIA 1IUUA 2A8XA 1GOSA 2VQ7A 5LV9A 2B7RA 4USRA 2XFQA 1GREA 4G9KA 3L8KA 4OPGA 1AOGA 2GR3A 2XVJA 2UZZA 1NENA 4H2QA 4REKA 1N4UA 2AR8A 4B69A 1JRYA 2BRYA 3T31A 5KMQA 4JNAA 1OJAA 2VQBA 1FEBA 1VG9A 1ZOVA 3NNEA 3LZXA 2W0HA 1ELIA 2WOVA 2R0GA 3GMBA 4TM0A 4EMWA 3QVPA 4YTPA 1NAAA 5KMSA 3FBSA 2X3NA 2F5ZA 1GTEA 3P1WA 1N1PA 1VRQB 1PBDA 4Y4MA 4IVOB 3K7MX 3KPFA 4YT0A 5JCLA 3NRNA 2IVEA 3IHGA 2WBAA 3O0HA 2FBWA 3ZDNA 2C73A 2ZZ0A 3G5QA 4M52A 4AT2A 4YTMA 1Q1WA 2R0PA 3CGEA 3NIXA 5KVHA 1FECA 1GRBA 5KMRA 2BS3A 1M64A 3B3RA 3NLCA 3RHAA 2WDQA 1BZLA 3NHOX 1NHSA 5EB4A 4UDRA 1GETA 4EM4A 4XWRA 2WP6A 3UTGA 1B4VA 1NPXA 5TR3A 3UOXA 5KXJA 4X4JA 3UOZA 3AD9B 1Q9IA 4H4UA 1LPFA 3NT6A 5EOWA 3ADAB 3UKPA 1JRXA 3UP5A 4A79A 1ZY8A 4XWZA 2WU5A 4C3XA 1TDOA 3VRBA 5IQ1A 4WX1A 1X31B 3NN0X 1E39A 3G5SA 2E1MA 2WQYA 2RABA 2V6OA 4NEVA 1GRTA 4H4ZA 3I6DA 5JCKA 1PBBA 1YKJA 3UOVA 1FEAA 1S2YA 2C3DA 4Z24A 2PHHA 1L9CA 3R9UA 3F8PA 3P4QA 2YR4A 4I59A 4ADWA 4BJYA 1F8WA 1EL5A 3ATRA 3DGHA 3CNSA 3T37A 5C2TA 5EB5A 3IC9A 3NKSA 2XVHA 2EQ7A 3BHKA 1PXCA 2BS2A 2Q6UA 3QSSA 2EQ9A 3HYXA 2XDOA 4EQXA 1ZKQA 2WDVA 2FJBA 1CHUA 4U8OA 3CGDA 4AT0A 2CULA 3LADA 4A6NB 3OZ2A 1BWCA 3AXBA 1XDIA 2YG7A 2GB0A 3NK1X 1ZDLA 2GR2A 2R4EA 4H2RA 1W4XA 1PHHA 2BXSA 4PABA 4B66A 3D1CA 2WS3A 4H2PA 2CDUA 3T2KA 4A9WA 5ER0A 3BI2A 2QAEA 5BRTA 1XHCA 1BGNA 1N4VA 2FJEA 4U8KA 4NTDA 4C74A 5IQ4A 3LOVA 4HB9A 5KOWA 1JU2A 1GERA 1LQUA 3H4KA 5DBJA 3ZYXA 2YWLA 4EQRA 1EL7A 2GV8A 3KD9A 1NHRA 3ALMA 2ARDA 4OVIA 2X8HA 4U8IA 4B68A 2JB3A 3AD7B 4X9NA 1PJ7A 3QVRA 3GD3A 1MO9A 1NEKA 3UKHA 1GALA 3UTEA 4TLXA 2R0CA 1PS9A 3DMEA 3AEFA 1VG0A 2GQFA 1VDCA 3T0KA 1JNRA 1S2QA 1TDNA 1D7YA 1HYUA 4JN9A 1H7XA 1DODA 3FIMB 1ZMDA 2C65A 3NG7X 3CIRA 3DJGX 3SXIA 3UTFA 5C3JA 3VR8A 4GAVA 5HXIA 2V5ZA 1RSGA 2R45A 4Z2UA 2Q0LA 2CFYA 1YQ3A 2BK4A 1NHPA 2WDRA 1KFYA 4J36A 1PDHA 3GYXA 3DJEA 4A65A 4CY6A 2B7SA 3BI5A 2YLRA 3AD8B 1S3EA 3CPIG 1E1MA 1B37A 2QA1A 5KVIA 3JSKA 2H88A 1LTXR 4LU6A 3REDA 4D04A 4BK1A 3CNTA 1GRGA 4DNAA 3NH3X 3NTDA 3S61A 1NHQA 4ZCDA 2WEUA 4EIQA 3ICRA 2AAQA 3QSMA 5GSNA 3SX6A 3EPTA 3P4PA 3SZWA 1OJ9A 4DSHA 4EM3A 5HYMA 4OPTA 3UP4A 4B65A 4EMIA 4J57A 3D8XA 5FS7A 4KX6A 1XANA 4YSYA 3HYWA 3AWIA 4K7ZA 4IVMB 4USQA 4CNJA 1O95A 5JCMA 4ECHA 4H2NA 1DOEA 1P2HA 1KNRA 2RGHA 1S3BA 5KMPA 4GCMA 5M10A 1CJ4A 2B9XA 2Q0KA 2YVJA 4NTCA 3SY4A 4BK3A 1P2EA 3P4RA 4A6NA 2APGA 3KKJA 1CJ3A 3AYLA 4P9SA 2BK3A 3Q9TA 3V76A 4B64A 5U25A 1LQTA 1BGJA 4JY2A 3HZLA 3DA1A 4GR1A 1CJCA 1MXTA 2C7GA 1JNZA 3EAOA 4H4SA 1PBEA 2JAEA 2XVEA 4EQWA 1GRHA 4OPCA 2X8GA 3AEGA 4H4TA 4AOXA 4H50A 4Z2TA 4RG3A 1EL9A 4NEWA 2YG4A 1LV0A 2YLXA 1CBOA 2XLSA 3Q6JA 2OLOA 1E6EA 3DJJA 4J34A 2YLWA 3AE9A 4H4RA 4IV9A 4OPIA 2BRAA 3SFDA 2JB2A 3QSEA 4K5SA 3GWDA 4I58A 4C3YA 1COYA 2A89A 2BABA 1KNPA 2JKCA 2BXRA 2BCGG 4CY8A 2X99A 1GXFA 4Z2RA 5HY5A 1TYTA 2BA9A 1ZK7A 1DOCA 4FDCB 3ICTA 4FX9A 3BHFA 3K7QX 4NNJA 4YSXA 1IUXA 4U2TA 4LIIA 2BYBA 2C64A 2BK5A 1FOHA 2QCUA 4UDQA 4ICYA 2YVFA 2C76A 2FJAA 1GT8A 2YM2A 4Y4NA 1O5WA 3AB1A 4TM4A 4EIPA 3AE2A 4EQSA 2GH5A 2GEWA 2GMHA 4IA6A 4NTEA 1D4CA 2YVGA 3UTHA 4BJZA 4OPLA 4J56A 2Y6RA 3BNUA 1TDEA 2C70A 3URHA 1H83A 3FG2P 3ITJA 1MOKA 2I0ZA 4G74A 1GPEA 4JDRA 2JB1A 3QJ4A 2AQJA 1NDAA 2IVDA 1CL0A 1FL2A 2YM1A 1CC6A 2Q7VA 2DKHA 4DSGA 3UKQA 4CCQA 4YKGA 3CNDA 1QLBA 2JK6A 3VRDB 2CVJA 3DK4A 2V3BA 1E1KA 2WU2A 3GWFA 1E1NA 2YLZA 2JBVA 3GYJA 5HHFA 2YAUA 4APNA 4B67A 3SZFA 3CGBA 4UDPA 2YR6A 5JCNA 3VQRA 4CRTA 1L9EA 2Z5YA 4U8NA 4BURA 1CC4A 1BF3A 3CMMA 3II4A 2WPCA 4B1BA 1H81A 2HQMA 3VR9A 3NGCX 3UKFA 1V59A 2WP9A 3AECA 4J31A 5JCIA 3CPJG 2GAHB 2YG6A 4G73A 4AOSA 1H7WA 2C66A 3EF6A 1REOA 3K7TA 4UP3A 4EMJA 4A5LA 4Z25A 1IJHA 4RG4A 4GF7A 3M13A 5M0ZA 1K0JA 2V60A 3KVEA 1D4DA 4RSLA 2VVMA 2NVKX 3UKKA 1H84A 4OPUA 1NG4A 4Z43A 2C72A 1CC2A 5U63A 3LJPA 4CNKA 1N4WA 3AYIA 1IUSA 2C75A 2GAGB 1DNCA 1O94A 1YQZA 2B9WA 2YLSA 4GDEA 3P9UA 2VRMA 3KA7A 4H4YA 4II2A 2QA2A 4C5OA 1DJQA 3NK2X 1GRFA 2C67A 3GDNA 2XFPA 3PS9A 3GSIA 3SQPA 2V61A 1K0LA 4NWZA 4GUVA 1JEHA 1F8RA 2Y6QA 3LXDA 2YG5A 4LA1A 2BS4A 4H4QA 1RP0A 1JRZA 1GV4A 3C4AA 1Y0PA 3AE3A 1RYIA 1OJCA 4Y4LA 3RP6A 4AP1A 1JOAA 2XYOA 5FS9A 3KLJA 4G6HA 5EBKA 1GSNA 3KPKA 1UKVG 2EQ6A 2R4JA 1YQ4A 2RGOA 3ALLA 1PJ6A 3GRTA 2NPXA 2WHDA 3AE5A 4FK1C 1SEZA 3V3OA 4J2WA 4Z26A 1KF6A 1CF3A 1KDGA 5GRTA 2C3CA 4ZCCA 5FMHA 4BK2A 2E5VA 2GVCA 2GRTA 3COXA 4K2XA 3CPHG 3GDPA 2X50A 3GRSA 2WP5A 2XLTA 4XXGA 1KSUA 4Z44A 2J3NA 3GYIA 3FPZA 1F3PA 2XLPA 4FK1A 4CCRA 3AE4A 4H7UA 1TYPA 1M6IA 2DKIA 2WOIA 2XFOA 4YSZA 2OLNA 1H82A 3ICSA 1TDKA 3M0OA 2B9YA 4OPDA 2WPEA 5BULA 4JNQA 1L0VA 1PN0A 3OC4A 2GR1A 4BV6A 5KRQA 4D03A 5KOXA 2A87A 1PBFA 3AEAA 4NZHA 2BCPA 2VVLA 2TMDA 1D5TA 3QFAA 1PBCA 1DXLA 4DGKA 2PYXA 3UKAA 2BC0A 2VOUA 3I3LA 5CKUA 2H89A 2B76A 3SZCA 1B5QA 1B8SA 2BACA 1BKWA 3K30A 4X9MA 3LZWA 1PJ5A 2OA1A 2WESA 4II3A 3VRAA 5BUKA 2WPFA 1OJTA 1ZMCA 3DK8A 4K5RA 2XVFA 4TLZA 5KNLA 3G5RA 4YSHA 2FJDA 4H4WA 1DJNA 3T2ZA 3IWAA 1OJDA 3H8IA 3P4SA 4K8DA 4U8PA 5KWFA 3AEDA 3NYCA 3IHMA 3F8DA 1IUTA 2ACZA 4WCTA 4GRTA 4GAPA 2GF3A 3GMCA 1Y56A 1GTHA 1DOBA 2EQ8A 4OCGA 1VQWA 3AE8A 3ISHA 4TM1A 4U2LA 1H6VA 2XLUA 1GNDA 4YWOA 2ZZCA 2BC1A 4TM3A 2E4GA 4U8JA 5FS6A 1PXBA 1PXAA 4O5UA 3BI4A 4HA6A 4PAAA 4C77A 3M12A 2GQWA 1EL8A 3RNMA 2OAMA 3ABVA 3C4NA 3AE1A 3CGCA 1EBDA 1Y56B 3RP7A 2C4CA 1D4EA 2YG3A 2ZBWA 2YR5A 2OALA 4YKFA 2R9ZA 1NG3A 3AEBA 4J33A 3UCLA 3SGLA 3ALJA 1LJ1A 2XFUA 1F6MA 1LVLA 3AE6A 3B6DA 3CTYA 4A7AA 2V3AA 1FCDA 1TDFA 3DJDA 3DH9A 3L1RA 3NTAA 4G6GA 4JY3A 4U8MA 3BNMA 3UOYA 1H86A 2VZ2A 4E0VA 4H4VA 3V3NA 1ONFA 4YXDA 3NYFA 1ZOYA 2YLTA 3PVCA 4O5QA 1QO8A 1F8SA 1XPQA 2YQUA 4B63A 2VRLA 1GRAA 1Q1RA 4ZN0A 3H8LA 3S5WA 1Z6LA 2TPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GES A;  3PO7 A;  3WE0 A;  4H4X A;  3CNP A;  3ATQ A;  5U1O A;  5IPY A;  4A99 A;  1GEU A;  4U2S A;  1KSS A;  3CN8 A;  4JQ9 A;  5BVA A;  5J60 A;  3GD4 A;  3EAN A;  4GDP A;  2R46 A;  1K4Q A;  2ZZB A;  5J7X A;  1YY5 A;  1IUV A;  4N9X A;  4CBQ A;  1K0I A;  2WOW A;  1ZX9 A;  2IID A;  4KPR A;  2GR0 A;  5L46 A;  2XLR A;  3AEE A;  2X8C A;  3NN6 X;  5FS8 A;  3UKL A;  4YTN A;  1TRB A;  3QFB A;  2GMJ A;  1ZP0 A;  4MJW A;  2RGJ A;  2XCG A;  3AYJ A;  3NK0 X;  3NYE A;  3E1T A;  3SM8 A;  1IUW A;  2WET A;  3RP8 A;  1E1L A;  3AE7 A;  3DGZ A;  3FMW A;  2Z5X A;  3DK9 A;  3IF9 A;  5CQF A;  3SFE A;  1D7L A;  4IA5 A;  4EMJ A;  1E7P A;  1QJD A;  4AP3 A;  3KU9 A;  2O9Z A;  3LB8 A;  3F8R A;  4H4P A;  1CJ2 A;  4U8L A;  1L9D A;  2XFN A;  3C96 A;  4K22 A;  3CNJ A;  2VVL G;  2XVI A;  1IUU A;  2A8X A;  1GOS A;  2VQ7 A;  5LV9 A;  2B7R A;  4USR A;  2XFQ A;  1GRE A;  3L8K A;  4OPG A;  1AOG A;  2GR3 A;  2XVJ A;  2UZZ A;  1NEN A;  4H2Q A;  4REK A;  1N4U A;  2AR8 A;  4B69 A;  1JRY A;  4JNA A;  1OJA A;  2VQB A;  1FEB A;  1VG9 A;  1ZOV A;  3NNE A;  3LZX A;  2W0H A;  1ELI A;  2WOV A;  2R0G A;  3GMB A;  4TM0 A;  4EMW A;  3QVP A;  4YTP A;  1NAA A;  3FBS A;  2X3N A;  2F5Z A;  1GTE A;  3P1W A;  1N1P A;  1VRQ B;  1PBD A;  4Y4M A;  4IVO B;  3K7M X;  3KPF A;  4YT0 A;  5JCL A;  3NRN A;  2IVE A;  3IHG A;  2WBA A;  3O0H A;  2FBW A;  3ZDN A;  2C73 A;  2ZZ0 A;  3G5Q A;  4M52 A;  4AT2 A;  4YTM A;  1Q1W A;  2R0P A;  3CGE A;  3NIX A;  5KVH A;  1FEC A;  1GRB A;  2BS3 A;  1M64 A;  3B3R A;  3NLC A;  3RHA A;  2WDQ A;  1BZL A;  3NHO X;  1NHS A;  5EB4 A;  4UDR A;  1GET A;  4EM4 A;  4XWR A;  2WP6 A;  3UTG A;  1B4V A;  1NPX A;  5TR3 A;  3UOX A;  5KXJ A;  4X4J A;  3UOZ A;  3AD9 B;  1Q9I A;  4H4U A;  1LPF A;  3NT6 A;  5EOW A;  3ADA B;  3UKP A;  1JRX A;  3UP5 A;  4A79 A;  1ZY8 A;  4XWZ A;  2WU5 A;  4C3X A;  1TDO A;  3VRB A;  5IQ1 A;  4WX1 A;  1X31 B;  3NN0 X;  1E39 A;  3G5S A;  2E1M A;  2WQY A;  2RAB A;  2V6O A;  4NEV A;  1GRT A;  4H4Z A;  3I6D A;  5JCK A;  1PBB A;  1YKJ A;  3UOV A;  1FEA A;  1S2Y A;  2C3D A;  4Z24 A;  2PHH A;  1L9C A;  3R9U A;  3F8P A;  3P4Q A;  2YR4 A;  4I59 A;  4ADW A;  4BJY A;  1F8W A;  1EL5 A;  3ATR A;  3DGH A;  3CNS A;  3T37 A;  5C2T A;  5EB5 A;  3IC9 A;  3NKS A;  2XVH A;  2EQ7 A;  3BHK A;  1PXC A;  2BS2 A;  2Q6U A;  3QSS A;  2EQ9 A;  2XDO A;  4EQX A;  1ZKQ A;  2WDV A;  2FJB A;  1CHU A;  4U8O A;  3CGD A;  4AT0 A;  2CUL A;  3LAD A;  4A6N B;  3OZ2 A;  1BWC A;  3AXB A;  1XDI A;  2YG7 A;  2GB0 A;  3NK1 X;  1ZDL A;  2GR2 A;  2R4E A;  4H2R A;  1W4X A;  1PHH A;  2BXS A;  4PAB A;  4B66 A;  3D1C A;  2WS3 A;  4H2P A;  2CDU A;  4A9W A;  5BRT A;  5ER0 A;  3BI2 A;  2QAE A;  1XHC A;  1BGN A;  1N4V A;  2FJE A;  4U8K A;  4NTD A;  4C74 A;  5IQ4 A;  3LOV A;  4HB9 A;  5KOW A;  1JU2 A;  1GER A;  1LQU A;  3H4K A;  5DBJ A;  3ZYX A;  2YWL A;  4EQR A;  1EL7 A;  2GV8 A;  3KD9 A;  1NHR A;  3ALM A;  2ARD A;  4OVI A;  2X8H A;  4U8I A;  4B68 A;  2JB3 A;  3AD7 B;  4X9N A;  1PJ7 A;  3QVR A;  3GD3 A;  1MO9 A;  1NEK A;  3UKH A;  1GAL A;  3UTE A;  4TLX A;  2R0C A;  1PS9 A;  3DME A;  3AEF A;  1VG0 A;  2GQF A;  1VDC A;  1JNR A;  1S2Q A;  1TDN A;  1D7Y A;  1HYU A;  4JN9 A;  1H7X A;  1DOD A;  3FIM B;  1ZMD A;  2C65 A;  3NG7 X;  3CIR A;  3DJG X;  3UTF A;  5C3J A;  3VR8 A;  5HXI A;  2V5Z A;  1RSG A;  2R45 A;  4Z2U A;  2Q0L A;  2CFY A;  1YQ3 A;  2BK4 A;  1NHP A;  2WDR A;  1KFY A;  4J36 A;  1PDH A;  4CY6 A;  3DJE A;  4A65 A;  2B7S A;  3BI5 A;  2YLR A;  3AD8 B;  1S3E A;  3CPI G;  1E1M A;  1B37 A;  2QA1 A;  5KVI A;  3JSK A;  2H88 A;  1LTX R;  4LU6 A;  3RED A;  4D04 A;  4BK1 A;  3CNT A;  1GRG A;  4DNA A;  3NH3 X;  3NTD A;  3S61 A;  1NHQ A;  4ZCD A;  2WEU A;  4EIQ A;  3ICR A;  2AAQ A;  3QSM A;  5GSN A;  5HYM A;  3EPT A;  3P4P A;  4EM3 A;  1OJ9 A;  4DSH A;  4OPT A;  3UP4 A;  4B65 A;  4EMI A;  4J57 A;  3D8X A;  5FS7 A;  4KX6 A;  1XAN A;  4YSY A;  3AWI A;  4K7Z A;  4IVM B;  4USQ A;  4CNJ A;  1O95 A;  5JCM A;  4ECH A;  4H2N A;  1DOE A;  1P2H A;  1KNR A;  2RGH A;  1S3B A;  4GCM A;  5M10 A;  1CJ4 A;  2B9X A;  2Q0K A;  2YVJ A;  4NTC A;  4BK3 A;  1P2E A;  3P4R A;  4A6N A;  2APG A;  3KKJ A;  1CJ3 A;  3AYL A;  4P9S A;  2BK3 A;  3Q9T A;  3V76 A;  4B64 A;  5U25 A;  1LQT A;  1BGJ A;  4JY2 A;  3HZL A;  3DA1 A;  4GR1 A;  1CJC A;  1MXT A;  2C7G A;  1JNZ A;  3EAO A;  4H4S A;  1PBE A;  2JAE A;  2XVE A;  4EQW A;  1GRH A;  4OPC A;  2X8G A;  3AEG A;  4H4T A;  4AOX A;  4H50 A;  4Z2T A;  4RG3 A;  1EL9 A;  4NEW A;  2YG4 A;  1LV0 A;  2YLX A;  1CBO A;  2XLS A;  3Q6J A;  2OLO A;  1E6E A;  3DJJ A;  4J34 A;  2YLW A;  3AE9 A;  4H4R A;  4IV9 A;  4OPI A;  3RP7 A;  3SFD A;  2JB2 A;  3QSE A;  4K5S A;  3GWD A;  4I58 A;  4C3Y A;  1COY A;  2A89 A;  2BAB A;  1KNP A;  2JKC A;  2BXR A;  2BCG G;  4CY8 A;  2X99 A;  1GXF A;  4Z2R A;  5HY5 A;  1TYT A;  2BA9 A;  1ZK7 A;  1DOC A;  4FDC B;  3ICT A;  4FX9 A;  3BHF A;  3K7Q X;  4YSX A;  1IUX A;  4U2T A;  4LII A;  2BYB A;  2C64 A;  2BK5 A;  1FOH A;  2QCU A;  4UDQ A;  4ICY A;  2YVF A;  2C76 A;  2FJA A;  1GT8 A;  2YM2 A;  4Y4N A;  1O5W A;  3AB1 A;  4TM4 A;  4EIP A;  3AE2 A;  4EQS A;  2GH5 A;  2GEW A;  2GMH A;  4IA6 A;  4NTE A;  1D4C A;  2YVG A;  3UTH A;  4BJZ A;  4OPL A;  4J56 A;  2Y6R A;  3BNU A;  1TDE A;  2C70 A;  3URH A;  1H83 A;  3FG2 P;  3ITJ A;  1MOK A;  2I0Z A;  4JDR A;  1GPE A;  2JB1 A;  3QJ4 A;  2AQJ A;  1NDA A;  2IVD A;  1CL0 A;  1FL2 A;  2YM1 A;  1CC6 A;  2Q7V A;  2DKH A;  4DSG A;  3UKQ A;  4CCQ A;  4YKG A;  3CND A;  1QLB A;  2JK6 A;  3VRD B;  2CVJ A;  3DK4 A;  2V3B A;  1E1K A;  2WU2 A;  3GWF A;  1E1N A;  2YLZ A;  2JBV A;  3GYJ A;  5HHF A;  2YAU A;  4APN A;  4B67 A;  3CGB A;  4UDP A;  2YR6 A;  5JCN A;  3VQR A;  4CRT A;  1L9E A;  2Z5Y A;  4U8N A;  4BUR A;  1CC4 A;  1BF3 A;  3II4 A;  2WPC A;  4B1B A;  1H81 A;  2HQM A;  3VR9 A;  3NGC X;  3UKF A;  1V59 A;  2WP9 A;  3AEC A;  4J31 A;  5JCI A;  3CPJ G;  2GAH B;  2YG6 A;  4AOS A;  1H7W A;  2C66 A;  3EF6 A;  1REO A;  3K7T A;  4UP3 A;  4A5L A;  4Z25 A;  1IJH A;  4RG4 A;  4GF7 A;  3M13 A;  5M0Z A;  1K0J A;  2V60 A;  3KVE A;  1D4D A;  4RSL A;  2VVM A;  2NVK X;  3UKK A;  1H84 A;  4OPU A;  1NG4 A;  4Z43 A;  2C72 A;  1CC2 A;  5U63 A;  3LJP A;  4CNK A;  1N4W A;  3AYI A;  1IUS A;  2C75 A;  2GAG B;  1DNC A;  1O94 A;  1YQZ A;  2B9W A;  2YLS A;  4GDE A;  3P9U A;  2VRM A;  3KA7 A;  4H4Y A;  2QA2 A;  4C5O A;  1DJQ A;  3NK2 X;  1GRF A;  2C67 A;  3GDN A;  2XFP A;  3PS9 A;  3GSI A;  3SQP A;  2V61 A;  1K0L A;  4GUV A;  1JEH A;  1F8R A;  2Y6Q A;  3LXD A;  2YG5 A;  4LA1 A;  2BS4 A;  4H4Q A;  1RP0 A;  1JRZ A;  1GV4 A;  3C4A A;  1Y0P A;  3AE3 A;  1RYI A;  1OJC A;  4Y4L A;  3RP6 A;  4AP1 A;  1JOA A;  2XYO A;  5FS9 A;  3KLJ A;  5EBK A;  1GSN A;  1UKV G;  2EQ6 A;  2R4J A;  1YQ4 A;  2RGO A;  3ALL A;  1PJ6 A;  3GRT A;  2NPX A;  2WHD A;  3AE5 A;  4FK1 C;  1SEZ A;  3V3O A;  4J2W A;  4Z26 A;  1KF6 A;  1CF3 A;  1KDG A;  5GRT A;  2C3C A;  4ZCC A;  5FMH A;  4BK2 A;  2E5V A;  2GVC A;  2GRT A;  3COX A;  4K2X A;  3CPH G;  3GDP A;  2X50 A;  3GRS A;  2WP5 A;  2XLT A;  4XXG A;  1KSU A;  4Z44 A;  2J3N A;  3GYI A;  3FPZ A;  1F3P A;  2XLP A;  4FK1 A;  4CCR A;  3AE4 A;  4H7U A;  1TYP A;  1M6I A;  2DKI A;  2WOI A;  2XFO A;  4YSZ A;  2OLN A;  1H82 A;  3ICS A;  1TDK A;  3M0O A;  2B9Y A;  4OPD A;  2WPE A;  5BUL A;  4JNQ A;  1L0V A;  1PN0 A;  3OC4 A;  2GR1 A;  4BV6 A;  5KRQ A;  4D03 A;  5KOX A;  2A87 A;  1PBF A;  3AEA A;  4NZH A;  2BCP A;  2VVL A;  2TMD A;  1D5T A;  3QFA A;  1PBC A;  1DXL A;  4DGK A;  2PYX A;  3UKA A;  2BC0 A;  2VOU A;  3I3L A;  5CKU A;  2H89 A;  2B76 A;  1B5Q A;  1B8S A;  2BAC A;  1BKW A;  3K30 A;  4X9M A;  3LZW A;  1PJ5 A;  2OA1 A;  2WES A;  3VRA A;  5BUK A;  2WPF A;  1OJT A;  1ZMC A;  3DK8 A;  4K5R A;  2XVF A;  4TLZ A;  3G5R A;  4YSH A;  2FJD A;  4H4W A;  1DJN A;  3IWA A;  1OJD A;  3H8I A;  3P4S A;  4K8D A;  4U8P A;  5KWF A;  3AED A;  3NYC A;  3IHM A;  3F8D A;  1IUT A;  2ACZ A;  4WCT A;  4GRT A;  2GF3 A;  3GMC A;  1Y56 A;  1GTH A;  1DOB A;  2EQ8 A;  4OCG A;  1VQW A;  3AE8 A;  3ISH A;  4TM1 A;  4U2L A;  1H6V A;  2XLU A;  1GND A;  4YWO A;  2ZZC A;  2BC1 A;  4TM3 A;  2E4G A;  4U8J A;  5FS6 A;  1PXB A;  1PXA A;  4O5U A;  3BI4 A;  4HA6 A;  4PAA A;  4C77 A;  3M12 A;  2GQW A;  1EL8 A;  3RNM A;  2OAM A;  3ABV A;  3C4N A;  3AE1 A;  3CGC A;  1EBD A;  1Y56 B;  1D4E A;  2YG3 A;  2ZBW A;  2YR5 A;  2OAL A;  4YKF A;  2R9Z A;  1NG3 A;  3AEB A;  4J33 A;  3UCL A;  3SGL A;  3ALJ A;  1LJ1 A;  2XFU A;  1F6M A;  1LVL A;  3AE6 A;  3B6D A;  3CTY A;  4A7A A;  2V3A A;  1FCD A;  1TDF A;  3DJD A;  3DH9 A;  3L1R A;  3NTA A;  4JY3 A;  4U8M A;  3UOY A;  3BNM A;  1H86 A;  2VZ2 A;  4E0V A;  4H4V A;  3V3N A;  1ONF A;  4YXD A;  3NYF A;  1ZOY A;  2YLT A;  3PVC A;  4O5Q A;  1QO8 A;  1F8S A;  1XPQ A;  2YQU A;  4B63 A;  2VRL A;  1GRA A;  1Q1R A;  4ZN0 A;  3H8L A;  3S5W A;  1Z6L A;  2TPR A; 
#chains in the Genus database with same CATH topology
 1GES A;  3PO7 A;  3WE0 A;  4H4X A;  3SZ0 A;  3CNP A;  3ATQ A;  5U1O A;  5IPY A;  4A99 A;  1GEU A;  4U2S A;  1KSS A;  3CN8 A;  4JQ9 A;  5BVA A;  5J60 A;  3HYV A;  3GD4 A;  3EAN A;  4GDP A;  2R46 A;  1K4Q A;  2ZZB A;  5J7X A;  1YY5 A;  1IUV A;  4N9X A;  4CBQ A;  1K0I A;  2WOW A;  1ZX9 A;  2IID A;  4KPR A;  2GR0 A;  5L46 A;  2XLR A;  3AEE A;  2X8C A;  3NN6 X;  5FS8 A;  3UKL A;  4YTN A;  1TRB A;  3QFB A;  2GMJ A;  1ZP0 A;  4MJW A;  2RGJ A;  2XCG A;  3AYJ A;  3NK0 X;  3NYE A;  3E1T A;  3SM8 A;  1IUW A;  2WET A;  3T14 A;  3RP8 A;  1E1L A;  3AE7 A;  3DGZ A;  3FMW A;  2Z5X A;  3DK9 A;  3IF9 A;  5CQF A;  3SFE A;  1D7L A;  4IA5 A;  3SYI A;  1E7P A;  1QJD A;  4AP3 A;  3KU9 A;  2O9Z A;  3LB8 A;  3T2Y A;  3F8R A;  4H4P A;  1CJ2 A;  4U8L A;  1L9D A;  2XFN A;  3C96 A;  4K22 A;  3CNJ A;  2VVL G;  2XVI A;  1IUU A;  2A8X A;  1GOS A;  2VQ7 A;  5LV9 A;  2B7R A;  4USR A;  2XFQ A;  1GRE A;  4G9K A;  3L8K A;  4OPG A;  1AOG A;  2GR3 A;  2XVJ A;  2UZZ A;  1NEN A;  4H2Q A;  4REK A;  1N4U A;  2AR8 A;  4B69 A;  1JRY A;  2BRY A;  3T31 A;  5KMQ A;  4JNA A;  1OJA A;  2VQB A;  1FEB A;  1VG9 A;  1ZOV A;  3NNE A;  3LZX A;  2W0H A;  1ELI A;  2WOV A;  2R0G A;  3GMB A;  4TM0 A;  4EMW A;  3QVP A;  4YTP A;  1NAA A;  5KMS A;  3FBS A;  2X3N A;  2F5Z A;  1GTE A;  3P1W A;  1N1P A;  1VRQ B;  1PBD A;  4Y4M A;  4IVO B;  3K7M X;  3KPF A;  4YT0 A;  5JCL A;  3NRN A;  2IVE A;  3IHG A;  2WBA A;  3O0H A;  2FBW A;  3ZDN A;  2C73 A;  2ZZ0 A;  3G5Q A;  4M52 A;  4AT2 A;  4YTM A;  1Q1W A;  2R0P A;  3CGE A;  3NIX A;  5KVH A;  1FEC A;  1GRB A;  5KMR A;  2BS3 A;  1M64 A;  3B3R A;  3NLC A;  3RHA A;  2WDQ A;  1BZL A;  3NHO X;  1NHS A;  5EB4 A;  4UDR A;  1GET A;  4EM4 A;  4XWR A;  2WP6 A;  3UTG A;  1B4V A;  1NPX A;  5TR3 A;  3UOX A;  5KXJ A;  4X4J A;  3UOZ A;  3AD9 B;  1Q9I A;  4H4U A;  1LPF A;  3NT6 A;  5EOW A;  3ADA B;  3UKP A;  1JRX A;  3UP5 A;  4A79 A;  1ZY8 A;  4XWZ A;  2WU5 A;  4C3X A;  1TDO A;  3VRB A;  5IQ1 A;  4WX1 A;  1X31 B;  3NN0 X;  1E39 A;  3G5S A;  2E1M A;  2WQY A;  2RAB A;  2V6O A;  4NEV A;  1GRT A;  4H4Z A;  3I6D A;  5JCK A;  1PBB A;  1YKJ A;  3UOV A;  1FEA A;  1S2Y A;  2C3D A;  4Z24 A;  2PHH A;  1L9C A;  3R9U A;  3F8P A;  3P4Q A;  2YR4 A;  4I59 A;  4ADW A;  4BJY A;  1F8W A;  1EL5 A;  3ATR A;  3DGH A;  3CNS A;  3T37 A;  5C2T A;  5EB5 A;  3IC9 A;  3NKS A;  2XVH A;  2EQ7 A;  3BHK A;  1PXC A;  2BS2 A;  2Q6U A;  3QSS A;  2EQ9 A;  3HYX A;  2XDO A;  4EQX A;  1ZKQ A;  2WDV A;  2FJB A;  1CHU A;  4U8O A;  3CGD A;  4AT0 A;  2CUL A;  3LAD A;  4A6N B;  3OZ2 A;  1BWC A;  3AXB A;  1XDI A;  2YG7 A;  2GB0 A;  3NK1 X;  1ZDL A;  2GR2 A;  2R4E A;  4H2R A;  1W4X A;  1PHH A;  2BXS A;  4PAB A;  4B66 A;  3D1C A;  2WS3 A;  4H2P A;  2CDU A;  3T2K A;  4A9W A;  5ER0 A;  3BI2 A;  2QAE A;  5BRT A;  1XHC A;  1BGN A;  1N4V A;  2FJE A;  4U8K A;  4NTD A;  4C74 A;  5IQ4 A;  3LOV A;  4HB9 A;  5KOW A;  1JU2 A;  1GER A;  1LQU A;  3H4K A;  5DBJ A;  3ZYX A;  2YWL A;  4EQR A;  1EL7 A;  2GV8 A;  3KD9 A;  1NHR A;  3ALM A;  2ARD A;  4OVI A;  2X8H A;  4U8I A;  4B68 A;  2JB3 A;  3AD7 B;  4X9N A;  1PJ7 A;  3QVR A;  3GD3 A;  1MO9 A;  1NEK A;  3UKH A;  1GAL A;  3UTE A;  4TLX A;  2R0C A;  1PS9 A;  3DME A;  3AEF A;  1VG0 A;  2GQF A;  1VDC A;  3T0K A;  1JNR A;  1S2Q A;  1TDN A;  1D7Y A;  1HYU A;  4JN9 A;  1H7X A;  1DOD A;  3FIM B;  1ZMD A;  2C65 A;  3NG7 X;  3CIR A;  3DJG X;  3SXI A;  3UTF A;  5C3J A;  3VR8 A;  4GAV A;  5HXI A;  2V5Z A;  1RSG A;  2R45 A;  4Z2U A;  2Q0L A;  2CFY A;  1YQ3 A;  2BK4 A;  1NHP A;  2WDR A;  1KFY A;  4J36 A;  1PDH A;  3GYX A;  3DJE A;  4A65 A;  4CY6 A;  2B7S A;  3BI5 A;  2YLR A;  3AD8 B;  1S3E A;  3CPI G;  1E1M A;  1B37 A;  2QA1 A;  5KVI A;  3JSK A;  2H88 A;  1LTX R;  4LU6 A;  3RED A;  4D04 A;  4BK1 A;  3CNT A;  1GRG A;  4DNA A;  3NH3 X;  3NTD A;  3S61 A;  1NHQ A;  4ZCD A;  2WEU A;  4EIQ A;  3ICR A;  2AAQ A;  3QSM A;  5GSN A;  3SX6 A;  3EPT A;  3P4P A;  3SZW A;  1OJ9 A;  4DSH A;  4EM3 A;  5HYM A;  4OPT A;  3UP4 A;  4B65 A;  4EMI A;  4J57 A;  3D8X A;  5FS7 A;  4KX6 A;  1XAN A;  4YSY A;  3HYW A;  3AWI A;  4K7Z A;  4IVM B;  4USQ A;  4CNJ A;  1O95 A;  5JCM A;  4ECH A;  4H2N A;  1DOE A;  1P2H A;  1KNR A;  2RGH A;  1S3B A;  5KMP A;  4GCM A;  5M10 A;  1CJ4 A;  2B9X A;  2Q0K A;  2YVJ A;  4NTC A;  3SY4 A;  4BK3 A;  1P2E A;  3P4R A;  4A6N A;  2APG A;  3KKJ A;  1CJ3 A;  3AYL A;  4P9S A;  2BK3 A;  3Q9T A;  3V76 A;  4B64 A;  5U25 A;  1LQT A;  1BGJ A;  4JY2 A;  3HZL A;  3DA1 A;  4GR1 A;  1CJC A;  1MXT A;  2C7G A;  1JNZ A;  3EAO A;  4H4S A;  1PBE A;  2JAE A;  2XVE A;  4EQW A;  1GRH A;  4OPC A;  2X8G A;  3AEG A;  4H4T A;  4AOX A;  4H50 A;  4Z2T A;  4RG3 A;  1EL9 A;  4NEW A;  2YG4 A;  1LV0 A;  2YLX A;  1CBO A;  2XLS A;  3Q6J A;  2OLO A;  1E6E A;  3DJJ A;  4J34 A;  2YLW A;  3AE9 A;  4H4R A;  4IV9 A;  4OPI A;  2BRA A;  3SFD A;  2JB2 A;  3QSE A;  4K5S A;  3GWD A;  4I58 A;  4C3Y A;  1COY A;  2A89 A;  2BAB A;  1KNP A;  2JKC A;  2BXR A;  2BCG G;  4CY8 A;  2X99 A;  1GXF A;  4Z2R A;  5HY5 A;  1TYT A;  2BA9 A;  1ZK7 A;  1DOC A;  4FDC B;  3ICT A;  4FX9 A;  3BHF A;  3K7Q X;  4NNJ A;  4YSX A;  1IUX A;  4U2T A;  4LII A;  2BYB A;  2C64 A;  2BK5 A;  1FOH A;  2QCU A;  4UDQ A;  4ICY A;  2YVF A;  2C76 A;  2FJA A;  1GT8 A;  2YM2 A;  4Y4N A;  1O5W A;  3AB1 A;  4TM4 A;  4EIP A;  3AE2 A;  4EQS A;  2GH5 A;  2GEW A;  2GMH A;  4IA6 A;  4NTE A;  1D4C A;  2YVG A;  3UTH A;  4BJZ A;  4OPL A;  4J56 A;  2Y6R A;  3BNU A;  1TDE A;  2C70 A;  3URH A;  1H83 A;  3FG2 P;  3ITJ A;  1MOK A;  2I0Z A;  4G74 A;  1GPE A;  4JDR A;  2JB1 A;  3QJ4 A;  2AQJ A;  1NDA A;  2IVD A;  1CL0 A;  1FL2 A;  2YM1 A;  1CC6 A;  2Q7V A;  2DKH A;  4DSG A;  3UKQ A;  4CCQ A;  4YKG A;  3CND A;  1QLB A;  2JK6 A;  3VRD B;  2CVJ A;  3DK4 A;  2V3B A;  1E1K A;  2WU2 A;  3GWF A;  1E1N A;  2YLZ A;  2JBV A;  3GYJ A;  5HHF A;  2YAU A;  4APN A;  4B67 A;  3SZF A;  3CGB A;  4UDP A;  2YR6 A;  5JCN A;  3VQR A;  4CRT A;  1L9E A;  2Z5Y A;  4U8N A;  4BUR A;  1CC4 A;  1BF3 A;  3CMM A;  3II4 A;  2WPC A;  4B1B A;  1H81 A;  2HQM A;  3VR9 A;  3NGC X;  3UKF A;  1V59 A;  2WP9 A;  3AEC A;  4J31 A;  5JCI A;  3CPJ G;  2GAH B;  2YG6 A;  4G73 A;  4AOS A;  1H7W A;  2C66 A;  3EF6 A;  1REO A;  3K7T A;  4UP3 A;  4EMJ A;  4A5L A;  4Z25 A;  1IJH A;  4RG4 A;  4GF7 A;  3M13 A;  5M0Z A;  1K0J A;  2V60 A;  3KVE A;  1D4D A;  4RSL A;  2VVM A;  2NVK X;  3UKK A;  1H84 A;  4OPU A;  1NG4 A;  4Z43 A;  2C72 A;  1CC2 A;  5U63 A;  3LJP A;  4CNK A;  1N4W A;  3AYI A;  1IUS A;  2C75 A;  2GAG B;  1DNC A;  1O94 A;  1YQZ A;  2B9W A;  2YLS A;  4GDE A;  3P9U A;  2VRM A;  3KA7 A;  4H4Y A;  4II2 A;  2QA2 A;  4C5O A;  1DJQ A;  3NK2 X;  1GRF A;  2C67 A;  3GDN A;  2XFP A;  3PS9 A;  3GSI A;  3SQP A;  2V61 A;  1K0L A;  4NWZ A;  4GUV A;  1JEH A;  1F8R A;  2Y6Q A;  3LXD A;  2YG5 A;  4LA1 A;  2BS4 A;  4H4Q A;  1RP0 A;  1JRZ A;  1GV4 A;  3C4A A;  1Y0P A;  3AE3 A;  1RYI A;  1OJC A;  4Y4L A;  3RP6 A;  4AP1 A;  1JOA A;  2XYO A;  5FS9 A;  3KLJ A;  4G6H A;  5EBK A;  1GSN A;  3KPK A;  1UKV G;  2EQ6 A;  2R4J A;  1YQ4 A;  2RGO A;  3ALL A;  1PJ6 A;  3GRT A;  2NPX A;  2WHD A;  3AE5 A;  4FK1 C;  1SEZ A;  3V3O A;  4J2W A;  4Z26 A;  1KF6 A;  1CF3 A;  1KDG A;  5GRT A;  2C3C A;  4ZCC A;  5FMH A;  4BK2 A;  2E5V A;  2GVC A;  2GRT A;  3COX A;  4K2X A;  3CPH G;  3GDP A;  2X50 A;  3GRS A;  2WP5 A;  2XLT A;  4XXG A;  1KSU A;  4Z44 A;  2J3N A;  3GYI A;  3FPZ A;  1F3P A;  2XLP A;  4FK1 A;  4CCR A;  3AE4 A;  4H7U A;  1TYP A;  1M6I A;  2DKI A;  2WOI A;  2XFO A;  4YSZ A;  2OLN A;  1H82 A;  3ICS A;  1TDK A;  3M0O A;  2B9Y A;  4OPD A;  2WPE A;  5BUL A;  4JNQ A;  1L0V A;  1PN0 A;  3OC4 A;  2GR1 A;  4BV6 A;  5KRQ A;  4D03 A;  5KOX A;  2A87 A;  1PBF A;  3AEA A;  4NZH A;  2BCP A;  2VVL A;  2TMD A;  1D5T A;  3QFA A;  1PBC A;  1DXL A;  4DGK A;  2PYX A;  3UKA A;  2BC0 A;  2VOU A;  3I3L A;  5CKU A;  2H89 A;  2B76 A;  3SZC A;  1B5Q A;  1B8S A;  2BAC A;  1BKW A;  3K30 A;  4X9M A;  3LZW A;  1PJ5 A;  2OA1 A;  2WES A;  4II3 A;  3VRA A;  5BUK A;  2WPF A;  1OJT A;  1ZMC A;  3DK8 A;  4K5R A;  2XVF A;  4TLZ A;  5KNL A;  3G5R A;  4YSH A;  2FJD A;  4H4W A;  1DJN A;  3T2Z A;  3IWA A;  1OJD A;  3H8I A;  3P4S A;  4K8D A;  4U8P A;  5KWF A;  3AED A;  3NYC A;  3IHM A;  3F8D A;  1IUT A;  2ACZ A;  4WCT A;  4GRT A;  4GAP A;  2GF3 A;  3GMC A;  1Y56 A;  1GTH A;  1DOB A;  2EQ8 A;  4OCG A;  1VQW A;  3AE8 A;  3ISH A;  4TM1 A;  4U2L A;  1H6V A;  2XLU A;  1GND A;  4YWO A;  2ZZC A;  2BC1 A;  4TM3 A;  2E4G A;  4U8J A;  5FS6 A;  1PXB A;  1PXA A;  4O5U A;  3BI4 A;  4HA6 A;  4PAA A;  4C77 A;  3M12 A;  2GQW A;  1EL8 A;  3RNM A;  2OAM A;  3ABV A;  3C4N A;  3AE1 A;  3CGC A;  1EBD A;  1Y56 B;  3RP7 A;  2C4C A;  1D4E A;  2YG3 A;  2ZBW A;  2YR5 A;  2OAL A;  4YKF A;  2R9Z A;  1NG3 A;  3AEB A;  4J33 A;  3UCL A;  3SGL A;  3ALJ A;  1LJ1 A;  2XFU A;  1F6M A;  1LVL A;  3AE6 A;  3B6D A;  3CTY A;  4A7A A;  2V3A A;  1FCD A;  1TDF A;  3DJD A;  3DH9 A;  3L1R A;  3NTA A;  4G6G A;  4JY3 A;  4U8M A;  3BNM A;  3UOY A;  1H86 A;  2VZ2 A;  4E0V A;  4H4V A;  3V3N A;  1ONF A;  4YXD A;  3NYF A;  1ZOY A;  2YLT A;  3PVC A;  4O5Q A;  1QO8 A;  1F8S A;  1XPQ A;  2YQU A;  4B63 A;  2VRL A;  1GRA A;  1Q1R A;  4ZN0 A;  3H8L A;  3S5W A;  1Z6L A;  2TPR A; 
#chains in the Genus database with same CATH homology
 1GES A;  3PO7 A;  3WE0 A;  4H4X A;  3SZ0 A;  3CNP A;  3ATQ A;  5U1O A;  5IPY A;  4A99 A;  1GEU A;  4U2S A;  1KSS A;  3CN8 A;  4JQ9 A;  5BVA A;  5J60 A;  3HYV A;  3GD4 A;  3EAN A;  4GDP A;  2R46 A;  1K4Q A;  2ZZB A;  5J7X A;  1YY5 A;  1IUV A;  4N9X A;  4CBQ A;  1K0I A;  2WOW A;  1ZX9 A;  2IID A;  4KPR A;  2GR0 A;  5L46 A;  2XLR A;  3AEE A;  2X8C A;  3NN6 X;  5FS8 A;  3UKL A;  4YTN A;  1TRB A;  3QFB A;  2GMJ A;  1ZP0 A;  4MJW A;  2RGJ A;  2XCG A;  3AYJ A;  3NK0 X;  3NYE A;  3E1T A;  3SM8 A;  1IUW A;  2WET A;  3T14 A;  3RP8 A;  1E1L A;  3AE7 A;  3DGZ A;  3FMW A;  2Z5X A;  3DK9 A;  3IF9 A;  5CQF A;  3SFE A;  1D7L A;  4IA5 A;  3SYI A;  1E7P A;  1QJD A;  4AP3 A;  3KU9 A;  2O9Z A;  3LB8 A;  3T2Y A;  3F8R A;  4H4P A;  1CJ2 A;  4U8L A;  1L9D A;  2XFN A;  3C96 A;  4K22 A;  3CNJ A;  2VVL G;  2XVI A;  1IUU A;  2A8X A;  1GOS A;  2VQ7 A;  5LV9 A;  2B7R A;  4USR A;  2XFQ A;  1GRE A;  4G9K A;  3L8K A;  4OPG A;  1AOG A;  2GR3 A;  2XVJ A;  2UZZ A;  1NEN A;  4H2Q A;  4REK A;  1N4U A;  2AR8 A;  4B69 A;  1JRY A;  2BRY A;  3T31 A;  5KMQ A;  4JNA A;  1OJA A;  2VQB A;  1FEB A;  1VG9 A;  1ZOV A;  3NNE A;  3LZX A;  2W0H A;  1ELI A;  2WOV A;  2R0G A;  3GMB A;  4TM0 A;  4EMW A;  3QVP A;  4YTP A;  1NAA A;  5KMS A;  3FBS A;  2X3N A;  2F5Z A;  1GTE A;  3P1W A;  1N1P A;  1VRQ B;  1PBD A;  4Y4M A;  4IVO B;  3K7M X;  3KPF A;  4YT0 A;  5JCL A;  3NRN A;  2IVE A;  3IHG A;  2WBA A;  3O0H A;  2FBW A;  3ZDN A;  2C73 A;  2ZZ0 A;  3G5Q A;  4M52 A;  4AT2 A;  4YTM A;  1Q1W A;  2R0P A;  3CGE A;  3NIX A;  5KVH A;  1FEC A;  1GRB A;  5KMR A;  2BS3 A;  1M64 A;  3B3R A;  3NLC A;  3RHA A;  2WDQ A;  1BZL A;  3NHO X;  1NHS A;  5EB4 A;  4UDR A;  1GET A;  4EM4 A;  4XWR A;  2WP6 A;  3UTG A;  1B4V A;  1NPX A;  5TR3 A;  3UOX A;  5KXJ A;  4X4J A;  3UOZ A;  3AD9 B;  1Q9I A;  4H4U A;  1LPF A;  3NT6 A;  5EOW A;  3ADA B;  3UKP A;  1JRX A;  3UP5 A;  4A79 A;  1ZY8 A;  4XWZ A;  2WU5 A;  4C3X A;  1TDO A;  3VRB A;  5IQ1 A;  4WX1 A;  1X31 B;  3NN0 X;  1E39 A;  3G5S A;  2E1M A;  2WQY A;  2RAB A;  2V6O A;  4NEV A;  1GRT A;  4H4Z A;  3I6D A;  5JCK A;  1PBB A;  1YKJ A;  3UOV A;  1FEA A;  1S2Y A;  2C3D A;  4Z24 A;  2PHH A;  1L9C A;  3R9U A;  3F8P A;  3P4Q A;  2YR4 A;  4I59 A;  4ADW A;  4BJY A;  1F8W A;  1EL5 A;  3ATR A;  3DGH A;  3CNS A;  3T37 A;  5C2T A;  5EB5 A;  3IC9 A;  3NKS A;  2XVH A;  2EQ7 A;  3BHK A;  1PXC A;  2BS2 A;  2Q6U A;  3QSS A;  2EQ9 A;  3HYX A;  2XDO A;  4EQX A;  1ZKQ A;  2WDV A;  2FJB A;  1CHU A;  4U8O A;  3CGD A;  4AT0 A;  2CUL A;  3LAD A;  4A6N B;  3OZ2 A;  1BWC A;  3AXB A;  1XDI A;  2YG7 A;  2GB0 A;  3NK1 X;  1ZDL A;  2GR2 A;  2R4E A;  4H2R A;  1W4X A;  1PHH A;  2BXS A;  4PAB A;  4B66 A;  3D1C A;  2WS3 A;  4H2P A;  2CDU A;  3T2K A;  4A9W A;  5ER0 A;  3BI2 A;  2QAE A;  5BRT A;  1XHC A;  1BGN A;  1N4V A;  2FJE A;  4U8K A;  4NTD A;  4C74 A;  5IQ4 A;  3LOV A;  4HB9 A;  5KOW A;  1JU2 A;  1GER A;  1LQU A;  3H4K A;  5DBJ A;  3ZYX A;  2YWL A;  4EQR A;  1EL7 A;  2GV8 A;  3KD9 A;  1NHR A;  3ALM A;  2ARD A;  4OVI A;  2X8H A;  4U8I A;  4B68 A;  2JB3 A;  3AD7 B;  4X9N A;  1PJ7 A;  3QVR A;  3GD3 A;  1MO9 A;  1NEK A;  3UKH A;  1GAL A;  3UTE A;  4TLX A;  2R0C A;  1PS9 A;  3DME A;  3AEF A;  1VG0 A;  2GQF A;  1VDC A;  3T0K A;  1JNR A;  1S2Q A;  1TDN A;  1D7Y A;  1HYU A;  4JN9 A;  1H7X A;  1DOD A;  3FIM B;  1ZMD A;  2C65 A;  3NG7 X;  3CIR A;  3DJG X;  3SXI A;  3UTF A;  5C3J A;  3VR8 A;  4GAV A;  5HXI A;  2V5Z A;  1RSG A;  2R45 A;  4Z2U A;  2Q0L A;  2CFY A;  1YQ3 A;  2BK4 A;  1NHP A;  2WDR A;  1KFY A;  4J36 A;  1PDH A;  3GYX A;  3DJE A;  4A65 A;  4CY6 A;  2B7S A;  3BI5 A;  2YLR A;  3AD8 B;  1S3E A;  3CPI G;  1E1M A;  1B37 A;  2QA1 A;  5KVI A;  3JSK A;  2H88 A;  1LTX R;  4LU6 A;  3RED A;  4D04 A;  4BK1 A;  3CNT A;  1GRG A;  4DNA A;  3NH3 X;  3NTD A;  3S61 A;  1NHQ A;  4ZCD A;  2WEU A;  4EIQ A;  3ICR A;  2AAQ A;  3QSM A;  5GSN A;  3SX6 A;  3EPT A;  3P4P A;  3SZW A;  1OJ9 A;  4DSH A;  4EM3 A;  5HYM A;  4OPT A;  3UP4 A;  4B65 A;  4EMI A;  4J57 A;  3D8X A;  5FS7 A;  4KX6 A;  1XAN A;  4YSY A;  3HYW A;  3AWI A;  4K7Z A;  4IVM B;  4USQ A;  4CNJ A;  1O95 A;  5JCM A;  4ECH A;  4H2N A;  1DOE A;  1P2H A;  1KNR A;  2RGH A;  1S3B A;  5KMP A;  4GCM A;  5M10 A;  1CJ4 A;  2B9X A;  2Q0K A;  2YVJ A;  4NTC A;  3SY4 A;  4BK3 A;  1P2E A;  3P4R A;  4A6N A;  2APG A;  3KKJ A;  1CJ3 A;  3AYL A;  4P9S A;  2BK3 A;  3Q9T A;  3V76 A;  4B64 A;  5U25 A;  1LQT A;  1BGJ A;  4JY2 A;  3HZL A;  3DA1 A;  4GR1 A;  1CJC A;  1MXT A;  2C7G A;  1JNZ A;  3EAO A;  4H4S A;  1PBE A;  2JAE A;  2XVE A;  4EQW A;  1GRH A;  4OPC A;  2X8G A;  3AEG A;  4H4T A;  4AOX A;  4H50 A;  4Z2T A;  4RG3 A;  1EL9 A;  4NEW A;  2YG4 A;  1LV0 A;  2YLX A;  1CBO A;  2XLS A;  3Q6J A;  2OLO A;  1E6E A;  3DJJ A;  4J34 A;  2YLW A;  3AE9 A;  4H4R A;  4IV9 A;  4OPI A;  2BRA A;  3SFD A;  2JB2 A;  3QSE A;  4K5S A;  3GWD A;  4I58 A;  4C3Y A;  1COY A;  2A89 A;  2BAB A;  1KNP A;  2JKC A;  2BXR A;  2BCG G;  4CY8 A;  2X99 A;  1GXF A;  4Z2R A;  5HY5 A;  1TYT A;  2BA9 A;  1ZK7 A;  1DOC A;  4FDC B;  3ICT A;  4FX9 A;  3BHF A;  3K7Q X;  4NNJ A;  4YSX A;  1IUX A;  4U2T A;  4LII A;  2BYB A;  2C64 A;  2BK5 A;  1FOH A;  2QCU A;  4UDQ A;  4ICY A;  2YVF A;  2C76 A;  2FJA A;  1GT8 A;  2YM2 A;  4Y4N A;  1O5W A;  3AB1 A;  4TM4 A;  4EIP A;  3AE2 A;  4EQS A;  2GH5 A;  2GEW A;  2GMH A;  4IA6 A;  4NTE A;  1D4C A;  2YVG A;  3UTH A;  4BJZ A;  4OPL A;  4J56 A;  2Y6R A;  3BNU A;  1TDE A;  2C70 A;  3URH A;  1H83 A;  3FG2 P;  3ITJ A;  1MOK A;  2I0Z A;  4G74 A;  1GPE A;  4JDR A;  2JB1 A;  3QJ4 A;  2AQJ A;  1NDA A;  2IVD A;  1CL0 A;  1FL2 A;  2YM1 A;  1CC6 A;  2Q7V A;  2DKH A;  4DSG A;  3UKQ A;  4CCQ A;  4YKG A;  3CND A;  1QLB A;  2JK6 A;  3VRD B;  2CVJ A;  3DK4 A;  2V3B A;  1E1K A;  2WU2 A;  3GWF A;  1E1N A;  2YLZ A;  2JBV A;  3GYJ A;  5HHF A;  2YAU A;  4APN A;  4B67 A;  3SZF A;  3CGB A;  4UDP A;  2YR6 A;  5JCN A;  3VQR A;  4CRT A;  1L9E A;  2Z5Y A;  4U8N A;  4BUR A;  1CC4 A;  1BF3 A;  3CMM A;  3II4 A;  2WPC A;  4B1B A;  1H81 A;  2HQM A;  3VR9 A;  3NGC X;  3UKF A;  1V59 A;  2WP9 A;  3AEC A;  4J31 A;  5JCI A;  3CPJ G;  2GAH B;  2YG6 A;  4G73 A;  4AOS A;  1H7W A;  2C66 A;  3EF6 A;  1REO A;  3K7T A;  4UP3 A;  4EMJ A;  4A5L A;  4Z25 A;  1IJH A;  4RG4 A;  4GF7 A;  3M13 A;  5M0Z A;  1K0J A;  2V60 A;  3KVE A;  1D4D A;  4RSL A;  2VVM A;  2NVK X;  3UKK A;  1H84 A;  4OPU A;  1NG4 A;  4Z43 A;  2C72 A;  1CC2 A;  5U63 A;  3LJP A;  4CNK A;  1N4W A;  3AYI A;  1IUS A;  2C75 A;  2GAG B;  1DNC A;  1O94 A;  1YQZ A;  2B9W A;  2YLS A;  4GDE A;  3P9U A;  2VRM A;  3KA7 A;  4H4Y A;  4II2 A;  2QA2 A;  4C5O A;  1DJQ A;  3NK2 X;  1GRF A;  2C67 A;  3GDN A;  2XFP A;  3PS9 A;  3GSI A;  3SQP A;  2V61 A;  1K0L A;  4NWZ A;  4GUV A;  1JEH A;  1F8R A;  2Y6Q A;  3LXD A;  2YG5 A;  4LA1 A;  2BS4 A;  4H4Q A;  1RP0 A;  1JRZ A;  1GV4 A;  3C4A A;  1Y0P A;  3AE3 A;  1RYI A;  1OJC A;  4Y4L A;  3RP6 A;  4AP1 A;  1JOA A;  2XYO A;  5FS9 A;  3KLJ A;  4G6H A;  5EBK A;  1GSN A;  3KPK A;  1UKV G;  2EQ6 A;  2R4J A;  1YQ4 A;  2RGO A;  3ALL A;  1PJ6 A;  3GRT A;  2NPX A;  2WHD A;  3AE5 A;  4FK1 C;  1SEZ A;  3V3O A;  4J2W A;  4Z26 A;  1KF6 A;  1CF3 A;  1KDG A;  5GRT A;  2C3C A;  4ZCC A;  5FMH A;  4BK2 A;  2E5V A;  2GVC A;  2GRT A;  3COX A;  4K2X A;  3CPH G;  3GDP A;  2X50 A;  3GRS A;  2WP5 A;  2XLT A;  4XXG A;  1KSU A;  4Z44 A;  2J3N A;  3GYI A;  3FPZ A;  1F3P A;  2XLP A;  4FK1 A;  4CCR A;  3AE4 A;  4H7U A;  1TYP A;  1M6I A;  2DKI A;  2WOI A;  2XFO A;  4YSZ A;  2OLN A;  1H82 A;  3ICS A;  1TDK A;  3M0O A;  2B9Y A;  4OPD A;  2WPE A;  5BUL A;  4JNQ A;  1L0V A;  1PN0 A;  3OC4 A;  2GR1 A;  4BV6 A;  5KRQ A;  4D03 A;  5KOX A;  2A87 A;  1PBF A;  3AEA A;  4NZH A;  2BCP A;  2VVL A;  2TMD A;  1D5T A;  3QFA A;  1PBC A;  1DXL A;  4DGK A;  2PYX A;  3UKA A;  2BC0 A;  2VOU A;  3I3L A;  5CKU A;  2H89 A;  2B76 A;  3SZC A;  1B5Q A;  1B8S A;  2BAC A;  1BKW A;  3K30 A;  4X9M A;  3LZW A;  1PJ5 A;  2OA1 A;  2WES A;  4II3 A;  3VRA A;  5BUK A;  2WPF A;  1OJT A;  1ZMC A;  3DK8 A;  4K5R A;  2XVF A;  4TLZ A;  5KNL A;  3G5R A;  4YSH A;  2FJD A;  4H4W A;  1DJN A;  3T2Z A;  3IWA A;  1OJD A;  3H8I A;  3P4S A;  4K8D A;  4U8P A;  5KWF A;  3AED A;  3NYC A;  3IHM A;  3F8D A;  1IUT A;  2ACZ A;  4WCT A;  4GRT A;  4GAP A;  2GF3 A;  3GMC A;  1Y56 A;  1GTH A;  1DOB A;  2EQ8 A;  4OCG A;  1VQW A;  3AE8 A;  3ISH A;  4TM1 A;  4U2L A;  1H6V A;  2XLU A;  1GND A;  4YWO A;  2ZZC A;  2BC1 A;  4TM3 A;  2E4G A;  4U8J A;  5FS6 A;  1PXB A;  1PXA A;  4O5U A;  3BI4 A;  4HA6 A;  4PAA A;  4C77 A;  3M12 A;  2GQW A;  1EL8 A;  3RNM A;  2OAM A;  3ABV A;  3C4N A;  3AE1 A;  3CGC A;  1EBD A;  1Y56 B;  3RP7 A;  2C4C A;  1D4E A;  2YG3 A;  2ZBW A;  2YR5 A;  2OAL A;  4YKF A;  2R9Z A;  1NG3 A;  3AEB A;  4J33 A;  3UCL A;  3SGL A;  3ALJ A;  1LJ1 A;  2XFU A;  1F6M A;  1LVL A;  3AE6 A;  3B6D A;  3CTY A;  4A7A A;  2V3A A;  1FCD A;  1TDF A;  3DJD A;  3DH9 A;  3L1R A;  3NTA A;  4G6G A;  4JY3 A;  4U8M A;  3BNM A;  3UOY A;  1H86 A;  2VZ2 A;  4E0V A;  4H4V A;  3V3N A;  1ONF A;  4YXD A;  3NYF A;  1ZOY A;  2YLT A;  3PVC A;  4O5Q A;  1QO8 A;  1F8S A;  1XPQ A;  2YQU A;  4B63 A;  2VRL A;  1GRA A;  1Q1R A;  4ZN0 A;  3H8L A;  3S5W A;  1Z6L A;  2TPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...