3NHOX

Complex of 6-hydroxy-l-nicotine oxidase with product bound at active site
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 139
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nhoX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nhoX02
2XLSA 2YG5A 4OPGA 2EQ9A 3R9UA 2TPRA 4M52A 2WPCA 1O5WA 3M12A 4OPCA 2W0HA 2WDVA 4EQWA 2PHHA 3ALJA 4NZHA 4J57A 1LV0A 3L8KA 3NYEA 2Y6QA 3F8RA 1AOGA 1KNPA 4BK3A 4FDCB 4KX6A 3SGLA 3AE4A 5CQFA 3IC9A 1KF6A 5JCKA 2VQBA 2A8XA 2YQUA 1GEUA 3AEEA 3F8DA 4ZN0A 2BK5A 4A79A 1S2YA 3IHGA 5FS9A 1L0VA 1B37A 2WU2A 4TM0A 3ISHA 3NG7X 4IVOB 1M64A 4LIIA 2R0CA 5L46A 1NG3A 2V3AA 4I58A 4FK1C 2CFYA 4TM4A 1Q1RA 1BF3A 3HZLA 2WP6A 2Q0LA 2IVEA 3UCLA 5C2TA 5JCIA 4IV9A 1EL5A 1H84A 2OLNA 1KSUA 4IVMB 1BGJA 1IUSA 3KD9A 3NK2X 3K7QX 1H82A 3VRDB 4AOXA 4B67A 2O9ZA 3LJPA 2WS3A 1JRYA 1XHCA 4H4TA 3FG2P 2XVJA 4B66A 2V6OA 4J33A 4CNKA 4CCRA 3BNMA 1P2HA 2OAMA 3ITJA 3S5WA 1B5QA 2XFNA 1KFYA 1B4VA 1KNRA 3O0HA 4ECHA 3I3LA 1GPEA 3NLCA 1F8RA 2FJAA 2WP5A 1OJCA 2JBVA 2XVHA 1ONFA 5KRQA 4Z2UA 1L9EA 2BXRA 1PBBA 2GQWA 2OA1A 3COXA 4USQA 1NG4A 4A6NB 3CPHG 3CN8A 3SQPA 4TM1A 2IIDA 2RGOA 2BA9A 4H4RA 1ZMCA 4H2NA 1VDCA 2XDOA 5GRTA 4H4VA 3OC4A 1LJ1A 3REDA 3RNMA 4GF7A 4NTCA 2AAQA 2GEWA 3NTAA 4JY2A 4AOSA 3NIXA 1D7YA 4J2WA 4WCTA 3FBSA 2C64A 3CNTA 4X9MA 3VR8A 3UOZA 4ADWA 4USRA 4H2PA 2C66A 5TR3A 4UP3A 2R45A 4O5QA 2XVIA 1DJNA 4GUVA 1TRBA 4HB9A 1EL9A 4CY6A 1KDGA 4UDQA 2OALA 1CJCA 1E1KA 2C75A 3GRTA 4E0VA 2AR8A 3SFEA 2V3BA 3Q9TA 1S2QA 3G5SA 2R4EA 2VVLG 1REOA 1NENA 1CHUA 3DGHA 2WOVA 3UOVA 3P1WA 1GETA 1TDNA 2C65A 2BC0A 2YVFA 2I0ZA 3K7TA 1Q9IA 2GR0A 2CULA 3ATRA 5M0ZA 2QAEA 3ADAB 3CIRA 3L1RA 1PXCA 4U8NA 3AWIA 4TLXA 2UZZA 1IUVA 1VRQB 2GMHA 2FJEA 3SM8A 4CNJA 3GWFA 3KVEA 4YTPA 2YG3A 4OPDA 1GRBA 4YSYA 5KOXA 1FOHA 4YT0A 2V5ZA 1IUWA 2TMDA 4H4YA 3UKPA 1LQUA 2BK4A 3CNSA 3RP6A 1FL2A 1N4VA 2C70A 2VQ7A 5KVIA 2WQYA 4EMIA 3UTFA 2XFUA 1DOEA 1PHHA 4FX9A 2BABA 3M0OA 4K8DA 2WOWA 3B6DA 3QSSA 4OCGA 1LTXR 2X50A 3DGZA 1PJ7A 4U8LA 4Z25A 1GSNA 4H4QA 5JCLA 1Y0PA 3G5QA 2QA1A 4K2XA 5M10A 1BGNA 3AXBA 4BK1A 3CGCA 3CPJG 1DOCA 4EMJA 1D4CA 1QO8A 1TDKA 1CC4A 4UDPA 3V76A 2VVMA 4O5UA 1IUUA 4DGKA 4ZCDA 2EQ7A 1GXFA 2R46A 1FECA 3LZXA 1TYTA 2BS3A 1PBFA 1CJ2A 1SEZA 3NRNA 4WX1A 3KA7A 3ATQA 2E1MA 2R0PA 2WDQA 1VG9A 4BJYA 1ZDLA 2JK6A 4U2SA 1DJQA 5U25A 4H50A 3PVCA 1RYIA 2BK3A 4APNA 2WBAA 1S3EA 2RGHA 2XLRA 1X31B 1D4EA 3EPTA 2ZBWA 4Y4MA 4H7UA 3F8PA 1L9DA 1BKWA 2ZZCA 4C77A 2C7GA 3ALMA 1M6IA 1YKJA 2C67A 5KWFA 1GRFA 2YG6A 2YLRA 3LADA 1LPFA 1GRHA 2XVEA 4H4PA 2X99A 4REKA 4U8PA 3URHA 3C96A 5BRTA 1YQ3A 4B1BA 1CC2A 1RP0A 4JY3A 2YLWA 3CNDA 2BACA 3GDPA 4RG4A 3AYLA 5KVHA 4ZCCA 3UKQA 2YM1A 1PBDA 5EB5A 2BCGG 2HQMA 2YG7A 3IHMA 4DSGA 4H2QA 5U1OA 3LZWA 3DJEA 3DJGX 3FIMB 4BK2A 1KSSA 2FJBA 1YY5A 2GQFA 1GREA 2PYXA 3AEFA 1ELIA 2GRTA 3P4PA 2YR6A 3DK8A 4GDPA 1FEAA 1IUXA 1K0IA 1Z6LA 3H8LA 4CCQA 1GRTA 1PXAA 2WEUA 4HA6A 1D4DA 1V59A 4GDEA 2H89A 1EL7A 4RSLA 2GAHB 2WU5A 3II4A 2A89A 3DK9A 5BULA 4KPRA 1GNDA 1VG0A 4B65A 3AE9A 2BC1A 4Z44A 4FK1A 4XXGA 4AT0A 4H4XA 2VRMA 3GYJA 3CGDA 3NNEA 2WESA 3AEGA 1N4WA 3AE3A 4IA6A 5HYMA 2F5ZA 1JEHA 2WP9A 3QSMA 5GSNA 1Y56B 3DA1A 2GF3A 4TM3A 4A99A 3M13A 3AECA 2B9XA 4Y4NA 3GMBA 3AEAA 2Q7VA 4J34A 1NAAA 3I6DA 3VRAA 4XWRA 4H2RA 1CC6A 2Z5XA 2XLTA 2E4GA 1GTEA 4K22A 2Q6UA 3AE8A 5J60A 4B69A 3IWAA 3P4RA 1N4UA 4OPTA 4OPUA 4OVIA 3UOXA 2WDRA 3DMEA 2ACZA 4EM4A 3S61A 2YLSA 5FS8A 3CNJA 3V3NA 3NN6X 3NT6A 2X3NA 3D8XA 3ICRA 2YLTA 1YQ4A 2C3DA 3RP7A 3AE7A 2GAGB 2X8GA 1L9CA 2YWLA 1ZX9A 4ICYA 3AYIA 4J31A 1FEBA 4GRTA 4U8OA 3CTYA 1MOKA 1JU2A 4I59A 3ZYXA 2R9ZA 3ALLA 2A87A 1F3PA 3QSEA 4PABA 5C3JA 3VRBA 2B7SA 4TLZA 4H4SA 1NHQA 3UTEA 4BURA 2YVJA 4PAAA 4YTMA 3NK1X 4B63A 5JCNA 2Y6RA 3AD7B 3UKFA 2QCUA 3AE6A 1O95A 3QVPA 4NTEA 5FMHA 4BJZA 2CDUA 2V60A 3UOYA 2JAEA 4B64A 4A9WA 1BWCA 4P9SA 2BS2A 5IPYA 4AP1A 4Z26A 2YM2A 3KPFA 4MJWA 4JNAA 3GD3A 2Z5YA 2H88A 2VOUA 1NDAA 1LQTA 4EIPA 4Z43A 4K5SA 2XFPA 1ZY8A 1GALA 1EBDA 4H4UA 2CVJA 4LA1A 4YKGA 5HY5A 4A65A 2XLPA 4YSZA 3AEBA 3KU9A 1EL8A 3KLJA 1FCDA 2WHDA 2RGJA 1RSGA 5LV9A 3UTGA 1CL0A 1K0LA 2DKIA 3FMWA 1S3BA 1MO9A 3NGCX 4BV6A 1COYA 1P2EA 2XYOA 2YLXA 2YR4A 3H4KA 1H7XA 2AQJA 3OZ2A 4JNQA 1JNZA 3NHOX 1ZOYA 2GVCA 5BVAA 1DXLA 2GB0A 3DJJA 4X9NA 5IQ1A 4Z24A 3GSIA 1E39A 1GRAA 1K0JA 2EQ6A 1UKVG 1PXBA 1PJ6A 1XANA 2JB1A 2Q0KA 2XLUA 3P9UA 3P4SA 4OPLA 5J7XA 4C5OA 4YTNA 2VVLA 3CPIG 3SFDA 4A6NA 4C3YA 3G5RA 3DJDA 3BNUA 2OLOA 1NHSA 1DNCA 4U8JA 1ZP0A 1H81A 1E1MA 3D1CA 2WOIA 1QJDA 2WETA 2NVKX 5FS7A 4CRTA 3BI4A 3RP8A 2WPEA 5EOWA 1N1PA 1O94A 3KKJA 1CJ3A 4EIQA 3EF6A 3UKHA 1PBEA 2X8CA 4EQRA 4AP3A 1D5TA 1PS9A 4B68A 2YG4A 4UDRA 1IJHA 1PN0A 1ZMDA 4U8KA 5HXIA 3LXDA 1OJAA 2APGA 3B3RA 2XFOA 1XPQA 2VZ2A 2C73A 1JNRA 2B76A 1TDEA 2C76A 3DH9A 5BUKA 1F8SA 1H7WA 3E1TA 4DNAA 1ZK7A 2ZZ0A 3GYIA 2B9WA 4U2TA 3AD9B 3P4QA 1E1LA 3QJ4A 4U8IA 3T37A 3NYCA 4GCMA 4GR1A 4JDRA 4RG3A 3WE0A 1GERA 1E1NA 1W4XA 3GRSA 2JB3A 1JRXA 3NYFA 4X4JA 3UP5A 5EBKA 1LVLA 2GR3A 4AT2A 2C72A 2BS4A 1NPXA 2GH5A 2J3NA 2XVFA 1E6EA 1F6MA 3GDNA 5IQ4A 3V3OA 2B9YA 2QA2A 1Y56A 4IA5A 2EQ8A 3C4AA 1PDHA 4CY8A 3NN0X 3K30A 1H83A 1TDOA 2NPXA 3AB1A 4YKFA 1E7PA 1GV4A 5JCMA 4N9XA 5KOWA 1GOSA 3BI2A 3UP4A 4U2LA 2ARDA 4CBQA 2ZZBA 3PO7A 3GWDA 3VQRA 1NHPA 3AE2A 2DKHA 3ICTA 2B7RA 2XCGA 2XFQA 3C4NA 1DOBA 2YVGA 1GTHA 4NEVA 5FS6A 3FPZA 1JOAA 2YR5A 2JKCA 3AEDA 2JB2A 4JN9A 4XWZA 3UKKA 3NKSA 4D03A 3CGBA 2IVDA 2RABA 3NH3X 1OJDA 3BHKA 2R4JA 3EAOA 5EB4A 2C3CA 3NTDA 2FJDA 3JSKA 4OPIA 5HHFA 3AD8B 4YSXA 1CJ4A 4D04A 2GR1A 3ZDNA 5U63A 2V61A 1HYUA 1DODA 4J36A 1D7LA 3K7MX 3VR9A 4C74A 1Q1WA 3QFBA 1B8SA 3ABVA 1ZOVA 3ICSA 1PJ5A 1CBOA 1VQWA 1OJTA 5KXJA 1GRGA 2BCPA 4LU6A 3DK4A 1GT8A 3EANA 1K4QA 3NK0X 3RHAA 4NEWA 3UKLA 2BXSA 3BI5A 1JRZA 2R0GA 1TDFA 3CNPA 5ER0A 4A7AA 4K7ZA 4A5LA 2E5VA 3AE5A 1XDIA 3QFAA 4YWOA 3PS9A 3LOVA 1MXTA 4EMWA 2GMJA 4EQXA 5DBJA 2YAUA 1NHRA 3Q6JA 4JQ9A 4K5RA 4DSHA 4H4WA 1OJ9A 1PBCA 1GESA 4U8MA 4EM3A 4H4ZA 3BHFA 4EQSA 2WPFA 3AE1A 3UTHA 1BZLA 4YSHA 4YXDA 4Y4LA 2BYBA 1QLBA 4Z2TA 4NTDA 3QVRA 1IUTA 2GR2A 2X8HA 1CF3A 1H86A 1YQZA 5CKUA 2YLZA 3GMCA 4Z2RA 3LB8A 1H6VA 4J56A 4C3XA 3AYJA 1NEKA 3UKAA 3CGEA 1F8WA 1TYPA 2VRLA 1ZKQA 2GV8A 3GD4A 3IF9A 2FBWA 3H8IA
chains in the Genus database with same CATH superfamily
2XLSA 2YG5A 4OPGA 4B1BA 2EQ9A 3R9UA 2TPRA 4M52A 2WPCA 1O5WA 3M12A 4OPCA 3SZFA 2W0HA 2WDVA 4EQWA 2PHHA 3ALJA 4NZHA 4J57A 1LV0A 3L8KA 3NYEA 2Y6QA 3F8RA 1AOGA 1KNPA 4BK3A 4FDCB 4KX6A 3SGLA 3AE4A 5CQFA 3IC9A 1KF6A 5JCKA 3SXIA 2VQBA 2A8XA 2YQUA 3SYIA 1GEUA 3AEEA 3F8DA 4ZN0A 2BK5A 4A79A 1S2YA 3IHGA 5FS9A 1L0VA 1B37A 2WU2A 4TM0A 3ISHA 3NG7X 4IVOB 1M64A 4LIIA 2R0CA 5L46A 1NG3A 2V3AA 4I58A 3HYVA 4FK1C 2CFYA 4TM4A 1Q1RA 1BF3A 3HZLA 4G6GA 2WP6A 2Q0LA 2IVEA 3UCLA 5C2TA 5JCIA 4IV9A 1EL5A 1H84A 2OLNA 1KSUA 4IVMB 1BGJA 1IUSA 3KD9A 3NK2X 3K7QX 1H82A 3VRDB 4AOXA 4B67A 2O9ZA 3LJPA 2WS3A 1JRYA 1XHCA 4H4TA 3FG2P 2XVJA 4B66A 2V6OA 4J33A 4CNKA 4CCRA 3BNMA 1P2HA 2OAMA 3ITJA 3S5WA 1B5QA 2XFNA 1KFYA 1B4VA 1KNRA 3O0HA 4ECHA 3I3LA 1GPEA 3NLCA 1F8RA 2FJAA 2WP5A 1OJCA 2JBVA 5KMPA 2XVHA 1ONFA 5KRQA 4Z2UA 1L9EA 2BXRA 1PBBA 4GAVA 2GQWA 2OA1A 3COXA 4USQA 1NG4A 4A6NB 3CPHG 3CN8A 3SQPA 4TM1A 2IIDA 2RGOA 2BA9A 4H4RA 1ZMCA 4H2NA 1VDCA 2XDOA 5GRTA 4H4VA 3OC4A 1LJ1A 3REDA 3RNMA 4GF7A 4NTCA 2AAQA 2GEWA 3NTAA 4JY2A 4AOSA 3NIXA 1D7YA 4J2WA 4WCTA 3FBSA 2C64A 3CNTA 4X9MA 3VR8A 3UOZA 4ADWA 4USRA 4H2PA 2C66A 5TR3A 4UP3A 2R45A 4O5QA 2XVIA 1DJNA 4GUVA 1TRBA 4HB9A 1EL9A 4CY6A 1KDGA 4UDQA 2OALA 1CJCA 1E1KA 2C75A 3GRTA 4E0VA 2AR8A 3SFEA 2V3BA 3Q9TA 1S2QA 3G5SA 2R4EA 2VVLG 1REOA 5KNLA 1NENA 1CHUA 3DGHA 2WOVA 3UOVA 3P1WA 1GETA 1TDNA 2C65A 3HYWA 2BC0A 2YVFA 2I0ZA 3K7TA 1Q9IA 2GR0A 2CULA 3ATRA 5M0ZA 2QAEA 3ADAB 3CIRA 3L1RA 1PXCA 4U8NA 3AWIA 4TLXA 2UZZA 1IUVA 1VRQB 2GMHA 2FJEA 3SM8A 4CNJA 3GWFA 3KVEA 4YTPA 2YG3A 4OPDA 1GRBA 4YSYA 5KOXA 1FOHA 4YT0A 2V5ZA 1IUWA 2TMDA 4H4YA 3UKPA 1LQUA 2BK4A 3CNSA 3RP6A 1FL2A 1N4VA 2C70A 2VQ7A 5KVIA 2WQYA 4EMIA 3UTFA 2XFUA 1DOEA 1PHHA 4FX9A 2BABA 3M0OA 4K8DA 2WOWA 3HYXA 4GAPA 3B6DA 3QSSA 3GYXA 4OCGA 1LTXR 2X50A 3DGZA 1PJ7A 4U8LA 4Z25A 1GSNA 4H4QA 5JCLA 1Y0PA 3G5QA 2QA1A 4K2XA 5M10A 1BGNA 3AXBA 4BK1A 3CGCA 3CPJG 1DOCA 4EMJA 1D4CA 1QO8A 1TDKA 1CC4A 4UDPA 3V76A 2VVMA 4O5UA 1IUUA 4DGKA 4ZCDA 2EQ7A 1GXFA 2R46A 1FECA 3LZXA 1TYTA 2BS3A 1PBFA 1CJ2A 1SEZA 3NRNA 4WX1A 3KA7A 3ATQA 2E1MA 2R0PA 2WDQA 1VG9A 4BJYA 1ZDLA 2JK6A 4U2SA 1DJQA 5U25A 4H50A 3PVCA 1RYIA 2BK3A 4APNA 2WBAA 1S3EA 2RGHA 2XLRA 1X31B 1D4EA 3EPTA 2ZBWA 4Y4MA 4H7UA 3F8PA 1L9DA 1BKWA 2ZZCA 4C77A 2C7GA 3ALMA 1M6IA 1YKJA 2C67A 5KWFA 1GRFA 2YG6A 2YLRA 3LADA 1LPFA 1GRHA 2XVEA 4H4PA 2X99A 4REKA 4U8PA 3URHA 3C96A 5BRTA 1YQ3A 3SZWA 1CC2A 1RP0A 4JY3A 2YLWA 3CNDA 2BACA 3GDPA 4RG4A 3AYLA 5KVHA 4ZCCA 2BRYA 3UKQA 2YM1A 1PBDA 5EB5A 2BCGG 2HQMA 2YG7A 3IHMA 3T0KA 4H2QA 4II3A 4DSGA 5U1OA 3LZWA 3DJEA 3DJGX 3FIMB 4BK2A 1KSSA 2FJBA 1YY5A 2GQFA 1GREA 2PYXA 3AEFA 1ELIA 2GRTA 3P4PA 2YR6A 3DK8A 4GDPA 1FEAA 1IUXA 3SY4A 1K0IA 1Z6LA 3H8LA 4CCQA 1GRTA 1PXAA 2WEUA 4HA6A 3T2YA 1D4DA 1V59A 4GDEA 2H89A 1EL7A 4RSLA 2GAHB 2WU5A 3II4A 2A89A 3DK9A 5BULA 4KPRA 1GNDA 1VG0A 4B65A 3AE9A 2BC1A 4Z44A 4FK1A 4XXGA 4AT0A 4H4XA 2VRMA 3GYJA 3CGDA 3NNEA 3T14A 2WESA 3AEGA 1N4WA 3AE3A 4IA6A 5HYMA 2F5ZA 1JEHA 2WP9A 3QSMA 5GSNA 1Y56B 3DA1A 2GF3A 4TM3A 4A99A 3M13A 3AECA 2B9XA 4Y4NA 3GMBA 3AEAA 2Q7VA 4J34A 1NAAA 3I6DA 3VRAA 4XWRA 4H2RA 1CC6A 2Z5XA 2XLTA 2E4GA 1GTEA 4K22A 2Q6UA 4II2A 3AE8A 5J60A 4B69A 3IWAA 3P4RA 1N4UA 4OPTA 4OPUA 4OVIA 3UOXA 2WDRA 3DMEA 2ACZA 4EM4A 3S61A 2YLSA 5FS8A 3CNJA 3V3NA 3NN6X 3NT6A 2X3NA 3D8XA 3ICRA 4NWZA 2YLTA 1YQ4A 2C3DA 3RP7A 3AE7A 3SZ0A 2GAGB 2X8GA 1L9CA 2YWLA 1ZX9A 4ICYA 3AYIA 4J31A 1FEBA 4GRTA 4U8OA 3CTYA 1MOKA 1JU2A 4I59A 3ZYXA 2R9ZA 3ALLA 2A87A 1F3PA 3QSEA 4PABA 5C3JA 3VRBA 2B7SA 4TLZA 4H4SA 1NHQA 3UTEA 4BURA 2YVJA 4PAAA 4YTMA 3NK1X 4B63A 5JCNA 2Y6RA 3AD7B 3UKFA 2QCUA 3AE6A 1O95A 3QVPA 4NTEA 5FMHA 4BJZA 2CDUA 2V60A 3UOYA 2JAEA 4B64A 4A9WA 1BWCA 4P9SA 2BS2A 5IPYA 4AP1A 4Z26A 2YM2A 3T2KA 3KPFA 4MJWA 4JNAA 3GD3A 2Z5YA 2H88A 2VOUA 5KMSA 1NDAA 1LQTA 4EIPA 4Z43A 4K5SA 2XFPA 5KMRA 1ZY8A 1GALA 1EBDA 4H4UA 2CVJA 4LA1A 4YKGA 5HY5A 4A65A 2XLPA 4YSZA 3AEBA 3KU9A 1EL8A 3KLJA 1FCDA 2WHDA 2RGJA 1RSGA 5LV9A 3UTGA 1CL0A 1K0LA 2DKIA 3FMWA 1S3BA 1MO9A 3NGCX 4BV6A 1COYA 1P2EA 2XYOA 2YLXA 2YR4A 3H4KA 1H7XA 2AQJA 3OZ2A 4JNQA 1JNZA 3NHOX 1ZOYA 2GVCA 5BVAA 1DXLA 2GB0A 3DJJA 4X9NA 5IQ1A 4Z24A 3GSIA 3SZCA 1E39A 1GRAA 1K0JA 2EQ6A 1UKVG 1PXBA 1PJ6A 1XANA 2JB1A 2Q0KA 2XLUA 3CMMA 3P9UA 3P4SA 4OPLA 5J7XA 4C5OA 4YTNA 2VVLA 3CPIG 3SFDA 4A6NA 4C3YA 3G5RA 3DJDA 3BNUA 2OLOA 1NHSA 1DNCA 4U8JA 1ZP0A 1H81A 1E1MA 3D1CA 2WOIA 1QJDA 2WETA 2NVKX 5FS7A 4CRTA 3BI4A 3RP8A 2WPEA 5EOWA 1N1PA 1O94A 3KKJA 1CJ3A 5KMQA 4EIQA 3EF6A 3UKHA 1PBEA 2X8CA 4EQRA 4AP3A 1D5TA 1PS9A 4B68A 2YG4A 4UDRA 2BRAA 1IJHA 1PN0A 1ZMDA 4U8KA 5HXIA 3LXDA 1OJAA 2APGA 3B3RA 4G6HA 2XFOA 1XPQA 2VZ2A 2C73A 1JNRA 2B76A 1TDEA 2C76A 3DH9A 5BUKA 1F8SA 1H7WA 3E1TA 4DNAA 1ZK7A 2ZZ0A 3GYIA 2B9WA 4U2TA 3AD9B 3P4QA 1E1LA 3QJ4A 4U8IA 3T37A 3NYCA 4GCMA 4GR1A 4JDRA 4RG3A 3WE0A 1GERA 1E1NA 1W4XA 3GRSA 2JB3A 3KPKA 1JRXA 3NYFA 4X4JA 3UP5A 5EBKA 1LVLA 2GR3A 4AT2A 2C72A 2BS4A 1NPXA 2GH5A 2J3NA 2XVFA 1E6EA 1F6MA 3GDNA 5IQ4A 3V3OA 2B9YA 2QA2A 1Y56A 4G73A 4IA5A 2EQ8A 3C4AA 1PDHA 4CY8A 3NN0X 3K30A 1H83A 1TDOA 2NPXA 3AB1A 4YKFA 1E7PA 1GV4A 5JCMA 4N9XA 5KOWA 1GOSA 3BI2A 3UP4A 4U2LA 2ARDA 4CBQA 2ZZBA 3PO7A 3GWDA 4NNJA 3VQRA 1NHPA 3AE2A 2DKHA 3ICTA 2B7RA 2XCGA 2XFQA 3C4NA 1DOBA 2YVGA 1GTHA 4NEVA 5FS6A 3FPZA 1JOAA 2YR5A 2JKCA 3AEDA 2JB2A 4JN9A 4XWZA 3UKKA 3NKSA 4D03A 3CGBA 2IVDA 2RABA 3NH3X 1OJDA 3BHKA 2R4JA 3EAOA 5EB4A 2C3CA 3NTDA 2FJDA 3JSKA 4OPIA 5HHFA 3AD8B 4YSXA 1CJ4A 4D04A 2GR1A 3SX6A 3ZDNA 5U63A 2V61A 1HYUA 1DODA 4J36A 1D7LA 3K7MX 3VR9A 4C74A 1Q1WA 3QFBA 1B8SA 3ABVA 1ZOVA 3ICSA 1PJ5A 1CBOA 1VQWA 1OJTA 5KXJA 1GRGA 2BCPA 4LU6A 3DK4A 1GT8A 3EANA 1K4QA 3NK0X 3RHAA 4NEWA 3UKLA 2BXSA 3BI5A 1JRZA 2R0GA 1TDFA 3CNPA 5ER0A 4A7AA 4K7ZA 4A5LA 3T2ZA 2E5VA 3AE5A 3T31A 1XDIA 3QFAA 4YWOA 3PS9A 3LOVA 1MXTA 4EMWA 2GMJA 4EQXA 5DBJA 2YAUA 1NHRA 3Q6JA 4JQ9A 4K5RA 4DSHA 4H4WA 1OJ9A 1PBCA 1GESA 4U8MA 4EM3A 4H4ZA 2C4CA 3BHFA 4EQSA 2WPFA 3AE1A 3UTHA 1BZLA 4YSHA 4YXDA 4Y4LA 2BYBA 1QLBA 4Z2TA 4NTDA 3QVRA 1IUTA 2GR2A 2X8HA 1CF3A 1H86A 1YQZA 5CKUA 2YLZA 3GMCA 4Z2RA 3LB8A 1H6VA 4J56A 4C3XA 3AYJA 1NEKA 4G9KA 3UKAA 3CGEA 1F8WA 4G74A 1TYPA 2VRLA 1ZKQA 2GV8A 3GD4A 3IF9A 2FBWA 3H8IA
chains in the Genus database with same CATH topology
2XLSA 2YG5A 4OPGA 4B1BA 2EQ9A 3R9UA 2TPRA 4M52A 2WPCA 1O5WA 3M12A 4OPCA 3SZFA 2W0HA 2WDVA 4EQWA 2PHHA 3ALJA 4NZHA 4J57A 1LV0A 3L8KA 3NYEA 2Y6QA 3F8RA 1AOGA 1KNPA 4BK3A 4FDCB 4KX6A 3SGLA 3AE4A 5CQFA 3IC9A 1KF6A 5JCKA 3SXIA 2VQBA 2A8XA 2YQUA 3SYIA 1GEUA 3AEEA 3F8DA 4ZN0A 2BK5A 4A79A 1S2YA 3IHGA 5FS9A 1L0VA 1B37A 2WU2A 4TM0A 3ISHA 3NG7X 4IVOB 1M64A 4LIIA 2R0CA 5L46A 1NG3A 2V3AA 4I58A 3HYVA 4FK1C 2CFYA 4TM4A 1Q1RA 1BF3A 3HZLA 4G6GA 2WP6A 2Q0LA 2IVEA 3UCLA 5C2TA 5JCIA 4IV9A 1EL5A 1H84A 2OLNA 1KSUA 4IVMB 1BGJA 1IUSA 3KD9A 3NK2X 3K7QX 1H82A 3VRDB 4AOXA 4B67A 2O9ZA 3LJPA 2WS3A 1JRYA 1XHCA 4H4TA 3FG2P 2XVJA 4B66A 2V6OA 4J33A 4CNKA 4CCRA 3BNMA 1P2HA 2OAMA 3ITJA 3S5WA 1B5QA 2XFNA 1KFYA 1B4VA 1KNRA 3O0HA 4ECHA 3I3LA 1GPEA 3NLCA 1F8RA 2FJAA 2WP5A 1OJCA 2JBVA 5KMPA 2XVHA 1ONFA 5KRQA 4Z2UA 1L9EA 2BXRA 1PBBA 4GAVA 2GQWA 2OA1A 3COXA 4USQA 1NG4A 4A6NB 3CPHG 3CN8A 3SQPA 4TM1A 2IIDA 2RGOA 2BA9A 4H4RA 1ZMCA 4H2NA 1VDCA 2XDOA 5GRTA 4H4VA 3OC4A 1LJ1A 3REDA 3RNMA 4GF7A 4NTCA 2AAQA 2GEWA 3NTAA 4JY2A 4AOSA 3NIXA 1D7YA 4J2WA 4WCTA 3FBSA 2C64A 3CNTA 4X9MA 3VR8A 3UOZA 4ADWA 4USRA 4H2PA 2C66A 5TR3A 4UP3A 2R45A 4O5QA 2XVIA 1DJNA 4GUVA 1TRBA 4HB9A 1EL9A 4CY6A 1KDGA 4UDQA 2OALA 1CJCA 1E1KA 2C75A 3GRTA 4E0VA 2AR8A 3SFEA 2V3BA 3Q9TA 1S2QA 3G5SA 2R4EA 2VVLG 1REOA 5KNLA 1NENA 1CHUA 3DGHA 2WOVA 3UOVA 3P1WA 1GETA 1TDNA 2C65A 3HYWA 2BC0A 2YVFA 2I0ZA 3K7TA 1Q9IA 2GR0A 2CULA 3ATRA 5M0ZA 2QAEA 3ADAB 3CIRA 3L1RA 1PXCA 4U8NA 3AWIA 4TLXA 2UZZA 1IUVA 1VRQB 2GMHA 2FJEA 3SM8A 4CNJA 3GWFA 3KVEA 4YTPA 2YG3A 4OPDA 1GRBA 4YSYA 5KOXA 1FOHA 4YT0A 2V5ZA 1IUWA 2TMDA 4H4YA 3UKPA 1LQUA 2BK4A 3CNSA 3RP6A 1FL2A 1N4VA 2C70A 2VQ7A 5KVIA 2WQYA 4EMIA 3UTFA 2XFUA 1DOEA 1PHHA 4FX9A 2BABA 3M0OA 4K8DA 2WOWA 3HYXA 4GAPA 3B6DA 3QSSA 3GYXA 4OCGA 1LTXR 2X50A 3DGZA 1PJ7A 4U8LA 4Z25A 1GSNA 4H4QA 5JCLA 1Y0PA 3G5QA 2QA1A 4K2XA 5M10A 1BGNA 3AXBA 4BK1A 3CGCA 3CPJG 1DOCA 4EMJA 1D4CA 1QO8A 1TDKA 1CC4A 4UDPA 3V76A 2VVMA 4O5UA 1IUUA 4DGKA 4ZCDA 2EQ7A 1GXFA 2R46A 1FECA 3LZXA 1TYTA 2BS3A 1PBFA 1CJ2A 1SEZA 3NRNA 4WX1A 3KA7A 3ATQA 2E1MA 2R0PA 2WDQA 1VG9A 4BJYA 1ZDLA 2JK6A 4U2SA 1DJQA 5U25A 4H50A 3PVCA 1RYIA 2BK3A 4APNA 2WBAA 1S3EA 2RGHA 2XLRA 1X31B 1D4EA 3EPTA 2ZBWA 4Y4MA 4H7UA 3F8PA 1L9DA 1BKWA 2ZZCA 4C77A 2C7GA 3ALMA 1M6IA 1YKJA 2C67A 5KWFA 1GRFA 2YG6A 2YLRA 3LADA 1LPFA 1GRHA 2XVEA 4H4PA 2X99A 4REKA 4U8PA 3URHA 3C96A 5BRTA 1YQ3A 3SZWA 1CC2A 1RP0A 4JY3A 2YLWA 3CNDA 2BACA 3GDPA 4RG4A 3AYLA 5KVHA 4ZCCA 2BRYA 3UKQA 2YM1A 1PBDA 5EB5A 2BCGG 2HQMA 2YG7A 3IHMA 3T0KA 4H2QA 4II3A 4DSGA 5U1OA 3LZWA 3DJEA 3DJGX 3FIMB 4BK2A 1KSSA 2FJBA 1YY5A 2GQFA 1GREA 2PYXA 3AEFA 1ELIA 2GRTA 3P4PA 2YR6A 3DK8A 4GDPA 1FEAA 1IUXA 3SY4A 1K0IA 1Z6LA 3H8LA 4CCQA 1GRTA 1PXAA 2WEUA 4HA6A 3T2YA 1D4DA 1V59A 4GDEA 2H89A 1EL7A 4RSLA 2GAHB 2WU5A 3II4A 2A89A 3DK9A 5BULA 4KPRA 1GNDA 1VG0A 4B65A 3AE9A 2BC1A 4Z44A 4FK1A 4XXGA 4AT0A 4H4XA 2VRMA 3GYJA 3CGDA 3NNEA 3T14A 2WESA 3AEGA 1N4WA 3AE3A 4IA6A 5HYMA 2F5ZA 1JEHA 2WP9A 3QSMA 5GSNA 1Y56B 3DA1A 2GF3A 4TM3A 4A99A 3M13A 3AECA 2B9XA 4Y4NA 3GMBA 3AEAA 2Q7VA 4J34A 1NAAA 3I6DA 3VRAA 4XWRA 4H2RA 1CC6A 2Z5XA 2XLTA 2E4GA 1GTEA 4K22A 2Q6UA 4II2A 3AE8A 5J60A 4B69A 3IWAA 3P4RA 1N4UA 4OPTA 4OPUA 4OVIA 3UOXA 2WDRA 3DMEA 2ACZA 4EM4A 3S61A 2YLSA 5FS8A 3CNJA 3V3NA 3NN6X 3NT6A 2X3NA 3D8XA 3ICRA 4NWZA 2YLTA 1YQ4A 2C3DA 3RP7A 3AE7A 3SZ0A 2GAGB 2X8GA 1L9CA 2YWLA 1ZX9A 4ICYA 3AYIA 4J31A 1FEBA 4GRTA 4U8OA 3CTYA 1MOKA 1JU2A 4I59A 3ZYXA 2R9ZA 3ALLA 2A87A 1F3PA 3QSEA 4PABA 5C3JA 3VRBA 2B7SA 4TLZA 4H4SA 1NHQA 3UTEA 4BURA 2YVJA 4PAAA 4YTMA 3NK1X 4B63A 5JCNA 2Y6RA 3AD7B 3UKFA 2QCUA 3AE6A 1O95A 3QVPA 4NTEA 5FMHA 4BJZA 2CDUA 2V60A 3UOYA 2JAEA 4B64A 4A9WA 1BWCA 4P9SA 2BS2A 5IPYA 4AP1A 4Z26A 2YM2A 3T2KA 3KPFA 4MJWA 4JNAA 3GD3A 2Z5YA 2H88A 2VOUA 5KMSA 1NDAA 1LQTA 4EIPA 4Z43A 4K5SA 2XFPA 5KMRA 1ZY8A 1GALA 1EBDA 4H4UA 2CVJA 4LA1A 4YKGA 5HY5A 4A65A 2XLPA 4YSZA 3AEBA 3KU9A 1EL8A 3KLJA 1FCDA 2WHDA 2RGJA 1RSGA 5LV9A 3UTGA 1CL0A 1K0LA 2DKIA 3FMWA 1S3BA 1MO9A 3NGCX 4BV6A 1COYA 1P2EA 2XYOA 2YLXA 2YR4A 3H4KA 1H7XA 2AQJA 3OZ2A 4JNQA 1JNZA 3NHOX 1ZOYA 2GVCA 5BVAA 1DXLA 2GB0A 3DJJA 4X9NA 5IQ1A 4Z24A 3GSIA 3SZCA 1E39A 1GRAA 1K0JA 2EQ6A 1UKVG 1PXBA 1PJ6A 1XANA 2JB1A 2Q0KA 2XLUA 3CMMA 3P9UA 3P4SA 4OPLA 5J7XA 4C5OA 4YTNA 2VVLA 3CPIG 3SFDA 4A6NA 4C3YA 3G5RA 3DJDA 3BNUA 2OLOA 1NHSA 1DNCA 4U8JA 1ZP0A 1H81A 1E1MA 3D1CA 2WOIA 1QJDA 2WETA 2NVKX 5FS7A 4CRTA 3BI4A 3RP8A 2WPEA 5EOWA 1N1PA 1O94A 3KKJA 1CJ3A 5KMQA 4EIQA 3EF6A 3UKHA 1PBEA 2X8CA 4EQRA 4AP3A 1D5TA 1PS9A 4B68A 2YG4A 4UDRA 2BRAA 1IJHA 1PN0A 1ZMDA 4U8KA 5HXIA 3LXDA 1OJAA 2APGA 3B3RA 4G6HA 2XFOA 1XPQA 2VZ2A 2C73A 1JNRA 2B76A 1TDEA 2C76A 3DH9A 5BUKA 1F8SA 1H7WA 3E1TA 4DNAA 1ZK7A 2ZZ0A 3GYIA 2B9WA 4U2TA 3AD9B 3P4QA 1E1LA 3QJ4A 4U8IA 3T37A 3NYCA 4GCMA 4GR1A 4JDRA 4RG3A 3WE0A 1GERA 1E1NA 1W4XA 3GRSA 2JB3A 3KPKA 1JRXA 3NYFA 4X4JA 3UP5A 5EBKA 1LVLA 2GR3A 4AT2A 2C72A 2BS4A 1NPXA 2GH5A 2J3NA 2XVFA 1E6EA 1F6MA 3GDNA 5IQ4A 3V3OA 2B9YA 2QA2A 1Y56A 4G73A 4IA5A 2EQ8A 3C4AA 1PDHA 4CY8A 3NN0X 3K30A 1H83A 1TDOA 2NPXA 3AB1A 4YKFA 1E7PA 1GV4A 5JCMA 4N9XA 5KOWA 1GOSA 3BI2A 3UP4A 4U2LA 2ARDA 4CBQA 2ZZBA 3PO7A 3GWDA 4NNJA 3VQRA 1NHPA 3AE2A 2DKHA 3ICTA 2B7RA 2XCGA 2XFQA 3C4NA 1DOBA 2YVGA 1GTHA 4NEVA 5FS6A 3FPZA 1JOAA 2YR5A 2JKCA 3AEDA 2JB2A 4JN9A 4XWZA 3UKKA 3NKSA 4D03A 3CGBA 2IVDA 2RABA 3NH3X 1OJDA 3BHKA 2R4JA 3EAOA 5EB4A 2C3CA 3NTDA 2FJDA 3JSKA 4OPIA 5HHFA 3AD8B 4YSXA 1CJ4A 4D04A 2GR1A 3SX6A 3ZDNA 5U63A 2V61A 1HYUA 1DODA 4J36A 1D7LA 3K7MX 3VR9A 4C74A 1Q1WA 3QFBA 1B8SA 3ABVA 1ZOVA 3ICSA 1PJ5A 1CBOA 1VQWA 1OJTA 5KXJA 1GRGA 2BCPA 4LU6A 3DK4A 1GT8A 3EANA 1K4QA 3NK0X 3RHAA 4NEWA 3UKLA 2BXSA 3BI5A 1JRZA 2R0GA 1TDFA 3CNPA 5ER0A 4A7AA 4K7ZA 4A5LA 3T2ZA 2E5VA 3AE5A 3T31A 1XDIA 3QFAA 4YWOA 3PS9A 3LOVA 1MXTA 4EMWA 2GMJA 4EQXA 5DBJA 2YAUA 1NHRA 3Q6JA 4JQ9A 4K5RA 4DSHA 4H4WA 1OJ9A 1PBCA 1GESA 4U8MA 4EM3A 4H4ZA 2C4CA 3BHFA 4EQSA 2WPFA 3AE1A 3UTHA 1BZLA 4YSHA 4YXDA 4Y4LA 2BYBA 1QLBA 4Z2TA 4NTDA 3QVRA 1IUTA 2GR2A 2X8HA 1CF3A 1H86A 1YQZA 5CKUA 2YLZA 3GMCA 4Z2RA 3LB8A 1H6VA 4J56A 4C3XA 3AYJA 1NEKA 4G9KA 3UKAA 3CGEA 1F8WA 4G74A 1TYPA 2VRLA 1ZKQA 2GV8A 3GD4A 3IF9A 2FBWA 3H8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XLS A;  2YG5 A;  4OPG A;  2EQ9 A;  3R9U A;  2TPR A;  4M52 A;  2WPC A;  1O5W A;  3M12 A;  4OPC A;  2W0H A;  2WDV A;  4EQW A;  2PHH A;  3ALJ A;  4NZH A;  4J57 A;  1LV0 A;  3L8K A;  3NYE A;  2Y6Q A;  3F8R A;  1AOG A;  1KNP A;  4BK3 A;  4FDC B;  4KX6 A;  3SGL A;  3AE4 A;  5CQF A;  3IC9 A;  1KF6 A;  5JCK A;  2VQB A;  2A8X A;  2YQU A;  1GEU A;  3AEE A;  3F8D A;  4ZN0 A;  2BK5 A;  4A79 A;  1S2Y A;  3IHG A;  5FS9 A;  1L0V A;  1B37 A;  2WU2 A;  4TM0 A;  3ISH A;  3NG7 X;  4IVO B;  1M64 A;  4LII A;  2R0C A;  5L46 A;  1NG3 A;  2V3A A;  4I58 A;  4FK1 C;  2CFY A;  4TM4 A;  1Q1R A;  1BF3 A;  3HZL A;  2WP6 A;  2Q0L A;  2IVE A;  3UCL A;  5C2T A;  5JCI A;  4IV9 A;  1EL5 A;  1H84 A;  2OLN A;  1KSU A;  4IVM B;  1BGJ A;  1IUS A;  3KD9 A;  3NK2 X;  3K7Q X;  1H82 A;  3VRD B;  4AOX A;  4B67 A;  2O9Z A;  3LJP A;  2WS3 A;  1JRY A;  1XHC A;  4H4T A;  3FG2 P;  2XVJ A;  4B66 A;  2V6O A;  4J33 A;  4CNK A;  4CCR A;  3BNM A;  1P2H A;  2OAM A;  3ITJ A;  3S5W A;  1B5Q A;  2XFN A;  1KFY A;  1B4V A;  1KNR A;  3O0H A;  4ECH A;  3I3L A;  1GPE A;  3NLC A;  1F8R A;  2FJA A;  2WP5 A;  1OJC A;  2JBV A;  2XVH A;  1ONF A;  5KRQ A;  4Z2U A;  1L9E A;  2BXR A;  1PBB A;  2GQW A;  2OA1 A;  3COX A;  4USQ A;  1NG4 A;  4A6N B;  3CPH G;  3CN8 A;  3SQP A;  4TM1 A;  2IID A;  2RGO A;  2BA9 A;  4H4R A;  1ZMC A;  4H2N A;  1VDC A;  2XDO A;  5GRT A;  4H4V A;  3OC4 A;  1LJ1 A;  3RED A;  3RNM A;  4GF7 A;  4NTC A;  2AAQ A;  2GEW A;  3NTA A;  4JY2 A;  4AOS A;  3NIX A;  1D7Y A;  4J2W A;  4WCT A;  3FBS A;  2C64 A;  3CNT A;  4X9M A;  3VR8 A;  3UOZ A;  4ADW A;  4USR A;  4H2P A;  2C66 A;  5TR3 A;  4UP3 A;  2R45 A;  4O5Q A;  2XVI A;  1DJN A;  4GUV A;  1TRB A;  4HB9 A;  1EL9 A;  4CY6 A;  1KDG A;  4UDQ A;  2OAL A;  1CJC A;  1E1K A;  2C75 A;  3GRT A;  4E0V A;  2AR8 A;  3SFE A;  2V3B A;  3Q9T A;  1S2Q A;  3G5S A;  2R4E A;  2VVL G;  1REO A;  1NEN A;  1CHU A;  3DGH A;  2WOV A;  3UOV A;  3P1W A;  1GET A;  1TDN A;  2C65 A;  2BC0 A;  2YVF A;  2I0Z A;  3K7T A;  1Q9I A;  2GR0 A;  2CUL A;  3ATR A;  5M0Z A;  2QAE A;  3ADA B;  3CIR A;  3L1R A;  1PXC A;  4U8N A;  3AWI A;  4TLX A;  2UZZ A;  1IUV A;  1VRQ B;  2GMH A;  2FJE A;  3SM8 A;  4CNJ A;  3GWF A;  3KVE A;  4YTP A;  2YG3 A;  4OPD A;  1GRB A;  4YSY A;  5KOX A;  1FOH A;  4YT0 A;  2V5Z A;  1IUW A;  2TMD A;  4H4Y A;  3UKP A;  1LQU A;  2BK4 A;  3CNS A;  3RP6 A;  1FL2 A;  1N4V A;  2C70 A;  2VQ7 A;  5KVI A;  2WQY A;  4EMI A;  3UTF A;  2XFU A;  1DOE A;  1PHH A;  4FX9 A;  2BAB A;  3M0O A;  4K8D A;  2WOW A;  3B6D A;  3QSS A;  4OCG A;  1LTX R;  2X50 A;  3DGZ A;  1PJ7 A;  4U8L A;  4Z25 A;  1GSN A;  4H4Q A;  5JCL A;  1Y0P A;  3G5Q A;  2QA1 A;  4K2X A;  5M10 A;  1BGN A;  3AXB A;  4BK1 A;  3CGC A;  3CPJ G;  1DOC A;  4EMJ A;  1D4C A;  1QO8 A;  1TDK A;  1CC4 A;  4UDP A;  3V76 A;  2VVM A;  4O5U A;  1IUU A;  4DGK A;  4ZCD A;  2EQ7 A;  1GXF A;  2R46 A;  1FEC A;  3LZX A;  1TYT A;  2BS3 A;  1PBF A;  1CJ2 A;  1SEZ A;  3NRN A;  4WX1 A;  3KA7 A;  3ATQ A;  2E1M A;  2R0P A;  2WDQ A;  1VG9 A;  4BJY A;  1ZDL A;  2JK6 A;  4U2S A;  1DJQ A;  5U25 A;  4H50 A;  3PVC A;  1RYI A;  2BK3 A;  4APN A;  2WBA A;  1S3E A;  2RGH A;  2XLR A;  1X31 B;  1D4E A;  3EPT A;  2ZBW A;  4Y4M A;  4H7U A;  3F8P A;  1L9D A;  1BKW A;  2ZZC A;  4C77 A;  2C7G A;  3ALM A;  1M6I A;  1YKJ A;  2C67 A;  5KWF A;  1GRF A;  2YG6 A;  2YLR A;  3LAD A;  1LPF A;  1GRH A;  2XVE A;  4H4P A;  2X99 A;  4REK A;  4U8P A;  3URH A;  3C96 A;  5BRT A;  1YQ3 A;  4B1B A;  1CC2 A;  1RP0 A;  4JY3 A;  2YLW A;  3CND A;  2BAC A;  3GDP A;  4RG4 A;  3AYL A;  5KVH A;  4ZCC A;  3UKQ A;  2YM1 A;  1PBD A;  5EB5 A;  2BCG G;  2HQM A;  2YG7 A;  3IHM A;  4DSG A;  4H2Q A;  5U1O A;  3LZW A;  3DJE A;  3DJG X;  3FIM B;  4BK2 A;  1KSS A;  2FJB A;  1YY5 A;  2GQF A;  1GRE A;  2PYX A;  3AEF A;  1ELI A;  2GRT A;  3P4P A;  2YR6 A;  3DK8 A;  4GDP A;  1FEA A;  1IUX A;  1K0I A;  1Z6L A;  3H8L A;  4CCQ A;  1GRT A;  1PXA A;  2WEU A;  4HA6 A;  1D4D A;  1V59 A;  4GDE A;  2H89 A;  1EL7 A;  4RSL A;  2GAH B;  2WU5 A;  3II4 A;  2A89 A;  3DK9 A;  5BUL A;  4KPR A;  1GND A;  1VG0 A;  4B65 A;  3AE9 A;  2BC1 A;  4Z44 A;  4FK1 A;  4XXG A;  4AT0 A;  4H4X A;  2VRM A;  3GYJ A;  3CGD A;  3NNE A;  2WES A;  3AEG A;  1N4W A;  3AE3 A;  4IA6 A;  5HYM A;  2F5Z A;  1JEH A;  2WP9 A;  3QSM A;  5GSN A;  1Y56 B;  3DA1 A;  2GF3 A;  4TM3 A;  4A99 A;  3M13 A;  3AEC A;  2B9X A;  4Y4N A;  3GMB A;  3AEA A;  2Q7V A;  4J34 A;  1NAA A;  3I6D A;  3VRA A;  4XWR A;  4H2R A;  1CC6 A;  2Z5X A;  2XLT A;  2E4G A;  1GTE A;  4K22 A;  2Q6U A;  3AE8 A;  5J60 A;  4B69 A;  3IWA A;  3P4R A;  1N4U A;  4OPT A;  4OPU A;  4OVI A;  3UOX A;  2WDR A;  3DME A;  2ACZ A;  4EM4 A;  3S61 A;  2YLS A;  5FS8 A;  3CNJ A;  3V3N A;  3NN6 X;  3NT6 A;  2X3N A;  3D8X A;  3ICR A;  2YLT A;  1YQ4 A;  2C3D A;  3RP7 A;  3AE7 A;  2GAG B;  2X8G A;  1L9C A;  2YWL A;  1ZX9 A;  4ICY A;  3AYI A;  4J31 A;  1FEB A;  4GRT A;  4U8O A;  3CTY A;  1MOK A;  1JU2 A;  4I59 A;  3ZYX A;  2R9Z A;  3ALL A;  2A87 A;  1F3P A;  3QSE A;  4PAB A;  5C3J A;  3VRB A;  2B7S A;  4TLZ A;  4H4S A;  1NHQ A;  3UTE A;  4BUR A;  2YVJ A;  4PAA A;  4YTM A;  3NK1 X;  4B63 A;  5JCN A;  2Y6R A;  3AD7 B;  3UKF A;  2QCU A;  3AE6 A;  1O95 A;  3QVP A;  4NTE A;  5FMH A;  4BJZ A;  2CDU A;  2V60 A;  3UOY A;  2JAE A;  4B64 A;  4A9W A;  1BWC A;  4P9S A;  2BS2 A;  5IPY A;  4AP1 A;  4Z26 A;  2YM2 A;  3KPF A;  4MJW A;  4JNA A;  3GD3 A;  2Z5Y A;  2H88 A;  2VOU A;  1NDA A;  1LQT A;  4EIP A;  4Z43 A;  4K5S A;  2XFP A;  1ZY8 A;  1GAL A;  1EBD A;  4H4U A;  2CVJ A;  4LA1 A;  4YKG A;  5HY5 A;  4A65 A;  2XLP A;  4YSZ A;  3AEB A;  3KU9 A;  1EL8 A;  3KLJ A;  1FCD A;  2WHD A;  2RGJ A;  1RSG A;  5LV9 A;  3UTG A;  1CL0 A;  1K0L A;  2DKI A;  3FMW A;  1S3B A;  1MO9 A;  3NGC X;  4BV6 A;  1COY A;  1P2E A;  2XYO A;  2YLX A;  2YR4 A;  3H4K A;  1H7X A;  2AQJ A;  3OZ2 A;  4JNQ A;  1JNZ A;  3NHO X;  1ZOY A;  2GVC A;  5BVA A;  1DXL A;  2GB0 A;  3DJJ A;  4X9N A;  5IQ1 A;  4Z24 A;  3GSI A;  1E39 A;  1GRA A;  1K0J A;  2EQ6 A;  1UKV G;  1PXB A;  1PJ6 A;  1XAN A;  2JB1 A;  2Q0K A;  2XLU A;  3P9U A;  3P4S A;  4OPL A;  5J7X A;  4C5O A;  4YTN A;  2VVL A;  3CPI G;  3SFD A;  4A6N A;  4C3Y A;  3G5R A;  3DJD A;  3BNU A;  2OLO A;  1NHS A;  1DNC A;  4U8J A;  1ZP0 A;  1H81 A;  1E1M A;  3D1C A;  2WOI A;  1QJD A;  2WET A;  2NVK X;  5FS7 A;  4CRT A;  3BI4 A;  3RP8 A;  2WPE A;  5EOW A;  1N1P A;  1O94 A;  3KKJ A;  1CJ3 A;  4EIQ A;  3EF6 A;  3UKH A;  1PBE A;  2X8C A;  4EQR A;  4AP3 A;  1D5T A;  1PS9 A;  4B68 A;  2YG4 A;  4UDR A;  1IJH A;  1PN0 A;  1ZMD A;  4U8K A;  5HXI A;  3LXD A;  1OJA A;  2APG A;  3B3R A;  2XFO A;  1XPQ A;  2VZ2 A;  2C73 A;  1JNR A;  2B76 A;  1TDE A;  2C76 A;  3DH9 A;  5BUK A;  1F8S A;  1H7W A;  3E1T A;  4DNA A;  1ZK7 A;  2ZZ0 A;  3GYI A;  2B9W A;  4U2T A;  3AD9 B;  3P4Q A;  1E1L A;  3QJ4 A;  4U8I A;  3T37 A;  3NYC A;  4GCM A;  4GR1 A;  4JDR A;  4RG3 A;  3WE0 A;  1GER A;  1E1N A;  1W4X A;  3GRS A;  2JB3 A;  1JRX A;  3NYF A;  4X4J A;  3UP5 A;  5EBK A;  1LVL A;  2GR3 A;  4AT2 A;  2C72 A;  2BS4 A;  1NPX A;  2GH5 A;  2J3N A;  2XVF A;  1E6E A;  1F6M A;  3GDN A;  5IQ4 A;  3V3O A;  2B9Y A;  2QA2 A;  1Y56 A;  4IA5 A;  2EQ8 A;  3C4A A;  1PDH A;  4CY8 A;  3NN0 X;  3K30 A;  1H83 A;  1TDO A;  2NPX A;  3AB1 A;  4YKF A;  1E7P A;  1GV4 A;  5JCM A;  4N9X A;  5KOW A;  1GOS A;  3BI2 A;  3UP4 A;  4U2L A;  2ARD A;  4CBQ A;  2ZZB A;  3PO7 A;  3GWD A;  3VQR A;  1NHP A;  3AE2 A;  2DKH A;  3ICT A;  2B7R A;  2XCG A;  2XFQ A;  3C4N A;  1DOB A;  2YVG A;  1GTH A;  4NEV A;  5FS6 A;  3FPZ A;  1JOA A;  2YR5 A;  2JKC A;  3AED A;  2JB2 A;  4JN9 A;  4XWZ A;  3UKK A;  3NKS A;  4D03 A;  3CGB A;  2IVD A;  2RAB A;  3NH3 X;  1OJD A;  3BHK A;  2R4J A;  3EAO A;  5EB4 A;  2C3C A;  3NTD A;  2FJD A;  3JSK A;  4OPI A;  5HHF A;  3AD8 B;  4YSX A;  1CJ4 A;  4D04 A;  2GR1 A;  3ZDN A;  5U63 A;  2V61 A;  1HYU A;  1DOD A;  4J36 A;  1D7L A;  3K7M X;  3VR9 A;  4C74 A;  1Q1W A;  3QFB A;  1B8S A;  3ABV A;  1ZOV A;  3ICS A;  1PJ5 A;  1CBO A;  1VQW A;  1OJT A;  5KXJ A;  1GRG A;  2BCP A;  4LU6 A;  3DK4 A;  1GT8 A;  3EAN A;  1K4Q A;  3NK0 X;  3RHA A;  4NEW A;  3UKL A;  2BXS A;  3BI5 A;  1JRZ A;  2R0G A;  1TDF A;  3CNP A;  5ER0 A;  4A7A A;  4K7Z A;  4A5L A;  2E5V A;  3AE5 A;  1XDI A;  3QFA A;  4YWO A;  3PS9 A;  3LOV A;  1MXT A;  4EMW A;  2GMJ A;  4EQX A;  5DBJ A;  2YAU A;  1NHR A;  3Q6J A;  4JQ9 A;  4K5R A;  4DSH A;  4H4W A;  1OJ9 A;  1PBC A;  1GES A;  4U8M A;  4EM3 A;  4H4Z A;  3BHF A;  4EQS A;  2WPF A;  3AE1 A;  3UTH A;  1BZL A;  4YSH A;  4YXD A;  4Y4L A;  2BYB A;  1QLB A;  4Z2T A;  4NTD A;  3QVR A;  1IUT A;  2GR2 A;  2X8H A;  1CF3 A;  1H86 A;  1YQZ A;  5CKU A;  2YLZ A;  3GMC A;  4Z2R A;  3LB8 A;  1H6V A;  4J56 A;  4C3X A;  3AYJ A;  1NEK A;  3UKA A;  3CGE A;  1F8W A;  1TYP A;  2VRL A;  1ZKQ A;  2GV8 A;  3GD4 A;  3IF9 A;  2FBW A;  3H8I A; 
#chains in the Genus database with same CATH topology
 2XLS A;  2YG5 A;  4OPG A;  4B1B A;  2EQ9 A;  3R9U A;  2TPR A;  4M52 A;  2WPC A;  1O5W A;  3M12 A;  4OPC A;  3SZF A;  2W0H A;  2WDV A;  4EQW A;  2PHH A;  3ALJ A;  4NZH A;  4J57 A;  1LV0 A;  3L8K A;  3NYE A;  2Y6Q A;  3F8R A;  1AOG A;  1KNP A;  4BK3 A;  4FDC B;  4KX6 A;  3SGL A;  3AE4 A;  5CQF A;  3IC9 A;  1KF6 A;  5JCK A;  3SXI A;  2VQB A;  2A8X A;  2YQU A;  3SYI A;  1GEU A;  3AEE A;  3F8D A;  4ZN0 A;  2BK5 A;  4A79 A;  1S2Y A;  3IHG A;  5FS9 A;  1L0V A;  1B37 A;  2WU2 A;  4TM0 A;  3ISH A;  3NG7 X;  4IVO B;  1M64 A;  4LII A;  2R0C A;  5L46 A;  1NG3 A;  2V3A A;  4I58 A;  3HYV A;  4FK1 C;  2CFY A;  4TM4 A;  1Q1R A;  1BF3 A;  3HZL A;  4G6G A;  2WP6 A;  2Q0L A;  2IVE A;  3UCL A;  5C2T A;  5JCI A;  4IV9 A;  1EL5 A;  1H84 A;  2OLN A;  1KSU A;  4IVM B;  1BGJ A;  1IUS A;  3KD9 A;  3NK2 X;  3K7Q X;  1H82 A;  3VRD B;  4AOX A;  4B67 A;  2O9Z A;  3LJP A;  2WS3 A;  1JRY A;  1XHC A;  4H4T A;  3FG2 P;  2XVJ A;  4B66 A;  2V6O A;  4J33 A;  4CNK A;  4CCR A;  3BNM A;  1P2H A;  2OAM A;  3ITJ A;  3S5W A;  1B5Q A;  2XFN A;  1KFY A;  1B4V A;  1KNR A;  3O0H A;  4ECH A;  3I3L A;  1GPE A;  3NLC A;  1F8R A;  2FJA A;  2WP5 A;  1OJC A;  2JBV A;  5KMP A;  2XVH A;  1ONF A;  5KRQ A;  4Z2U A;  1L9E A;  2BXR A;  1PBB A;  4GAV A;  2GQW A;  2OA1 A;  3COX A;  4USQ A;  1NG4 A;  4A6N B;  3CPH G;  3CN8 A;  3SQP A;  4TM1 A;  2IID A;  2RGO A;  2BA9 A;  4H4R A;  1ZMC A;  4H2N A;  1VDC A;  2XDO A;  5GRT A;  4H4V A;  3OC4 A;  1LJ1 A;  3RED A;  3RNM A;  4GF7 A;  4NTC A;  2AAQ A;  2GEW A;  3NTA A;  4JY2 A;  4AOS A;  3NIX A;  1D7Y A;  4J2W A;  4WCT A;  3FBS A;  2C64 A;  3CNT A;  4X9M A;  3VR8 A;  3UOZ A;  4ADW A;  4USR A;  4H2P A;  2C66 A;  5TR3 A;  4UP3 A;  2R45 A;  4O5Q A;  2XVI A;  1DJN A;  4GUV A;  1TRB A;  4HB9 A;  1EL9 A;  4CY6 A;  1KDG A;  4UDQ A;  2OAL A;  1CJC A;  1E1K A;  2C75 A;  3GRT A;  4E0V A;  2AR8 A;  3SFE A;  2V3B A;  3Q9T A;  1S2Q A;  3G5S A;  2R4E A;  2VVL G;  1REO A;  5KNL A;  1NEN A;  1CHU A;  3DGH A;  2WOV A;  3UOV A;  3P1W A;  1GET A;  1TDN A;  2C65 A;  3HYW A;  2BC0 A;  2YVF A;  2I0Z A;  3K7T A;  1Q9I A;  2GR0 A;  2CUL A;  3ATR A;  5M0Z A;  2QAE A;  3ADA B;  3CIR A;  3L1R A;  1PXC A;  4U8N A;  3AWI A;  4TLX A;  2UZZ A;  1IUV A;  1VRQ B;  2GMH A;  2FJE A;  3SM8 A;  4CNJ A;  3GWF A;  3KVE A;  4YTP A;  2YG3 A;  4OPD A;  1GRB A;  4YSY A;  5KOX A;  1FOH A;  4YT0 A;  2V5Z A;  1IUW A;  2TMD A;  4H4Y A;  3UKP A;  1LQU A;  2BK4 A;  3CNS A;  3RP6 A;  1FL2 A;  1N4V A;  2C70 A;  2VQ7 A;  5KVI A;  2WQY A;  4EMI A;  3UTF A;  2XFU A;  1DOE A;  1PHH A;  4FX9 A;  2BAB A;  3M0O A;  4K8D A;  2WOW A;  3HYX A;  4GAP A;  3B6D A;  3QSS A;  3GYX A;  4OCG A;  1LTX R;  2X50 A;  3DGZ A;  1PJ7 A;  4U8L A;  4Z25 A;  1GSN A;  4H4Q A;  5JCL A;  1Y0P A;  3G5Q A;  2QA1 A;  4K2X A;  5M10 A;  1BGN A;  3AXB A;  4BK1 A;  3CGC A;  3CPJ G;  1DOC A;  4EMJ A;  1D4C A;  1QO8 A;  1TDK A;  1CC4 A;  4UDP A;  3V76 A;  2VVM A;  4O5U A;  1IUU A;  4DGK A;  4ZCD A;  2EQ7 A;  1GXF A;  2R46 A;  1FEC A;  3LZX A;  1TYT A;  2BS3 A;  1PBF A;  1CJ2 A;  1SEZ A;  3NRN A;  4WX1 A;  3KA7 A;  3ATQ A;  2E1M A;  2R0P A;  2WDQ A;  1VG9 A;  4BJY A;  1ZDL A;  2JK6 A;  4U2S A;  1DJQ A;  5U25 A;  4H50 A;  3PVC A;  1RYI A;  2BK3 A;  4APN A;  2WBA A;  1S3E A;  2RGH A;  2XLR A;  1X31 B;  1D4E A;  3EPT A;  2ZBW A;  4Y4M A;  4H7U A;  3F8P A;  1L9D A;  1BKW A;  2ZZC A;  4C77 A;  2C7G A;  3ALM A;  1M6I A;  1YKJ A;  2C67 A;  5KWF A;  1GRF A;  2YG6 A;  2YLR A;  3LAD A;  1LPF A;  1GRH A;  2XVE A;  4H4P A;  2X99 A;  4REK A;  4U8P A;  3URH A;  3C96 A;  5BRT A;  1YQ3 A;  3SZW A;  1CC2 A;  1RP0 A;  4JY3 A;  2YLW A;  3CND A;  2BAC A;  3GDP A;  4RG4 A;  3AYL A;  5KVH A;  4ZCC A;  2BRY A;  3UKQ A;  2YM1 A;  1PBD A;  5EB5 A;  2BCG G;  2HQM A;  2YG7 A;  3IHM A;  3T0K A;  4H2Q A;  4II3 A;  4DSG A;  5U1O A;  3LZW A;  3DJE A;  3DJG X;  3FIM B;  4BK2 A;  1KSS A;  2FJB A;  1YY5 A;  2GQF A;  1GRE A;  2PYX A;  3AEF A;  1ELI A;  2GRT A;  3P4P A;  2YR6 A;  3DK8 A;  4GDP A;  1FEA A;  1IUX A;  3SY4 A;  1K0I A;  1Z6L A;  3H8L A;  4CCQ A;  1GRT A;  1PXA A;  2WEU A;  4HA6 A;  3T2Y A;  1D4D A;  1V59 A;  4GDE A;  2H89 A;  1EL7 A;  4RSL A;  2GAH B;  2WU5 A;  3II4 A;  2A89 A;  3DK9 A;  5BUL A;  4KPR A;  1GND A;  1VG0 A;  4B65 A;  3AE9 A;  2BC1 A;  4Z44 A;  4FK1 A;  4XXG A;  4AT0 A;  4H4X A;  2VRM A;  3GYJ A;  3CGD A;  3NNE A;  3T14 A;  2WES A;  3AEG A;  1N4W A;  3AE3 A;  4IA6 A;  5HYM A;  2F5Z A;  1JEH A;  2WP9 A;  3QSM A;  5GSN A;  1Y56 B;  3DA1 A;  2GF3 A;  4TM3 A;  4A99 A;  3M13 A;  3AEC A;  2B9X A;  4Y4N A;  3GMB A;  3AEA A;  2Q7V A;  4J34 A;  1NAA A;  3I6D A;  3VRA A;  4XWR A;  4H2R A;  1CC6 A;  2Z5X A;  2XLT A;  2E4G A;  1GTE A;  4K22 A;  2Q6U A;  4II2 A;  3AE8 A;  5J60 A;  4B69 A;  3IWA A;  3P4R A;  1N4U A;  4OPT A;  4OPU A;  4OVI A;  3UOX A;  2WDR A;  3DME A;  2ACZ A;  4EM4 A;  3S61 A;  2YLS A;  5FS8 A;  3CNJ A;  3V3N A;  3NN6 X;  3NT6 A;  2X3N A;  3D8X A;  3ICR A;  4NWZ A;  2YLT A;  1YQ4 A;  2C3D A;  3RP7 A;  3AE7 A;  3SZ0 A;  2GAG B;  2X8G A;  1L9C A;  2YWL A;  1ZX9 A;  4ICY A;  3AYI A;  4J31 A;  1FEB A;  4GRT A;  4U8O A;  3CTY A;  1MOK A;  1JU2 A;  4I59 A;  3ZYX A;  2R9Z A;  3ALL A;  2A87 A;  1F3P A;  3QSE A;  4PAB A;  5C3J A;  3VRB A;  2B7S A;  4TLZ A;  4H4S A;  1NHQ A;  3UTE A;  4BUR A;  2YVJ A;  4PAA A;  4YTM A;  3NK1 X;  4B63 A;  5JCN A;  2Y6R A;  3AD7 B;  3UKF A;  2QCU A;  3AE6 A;  1O95 A;  3QVP A;  4NTE A;  5FMH A;  4BJZ A;  2CDU A;  2V60 A;  3UOY A;  2JAE A;  4B64 A;  4A9W A;  1BWC A;  4P9S A;  2BS2 A;  5IPY A;  4AP1 A;  4Z26 A;  2YM2 A;  3T2K A;  3KPF A;  4MJW A;  4JNA A;  3GD3 A;  2Z5Y A;  2H88 A;  2VOU A;  5KMS A;  1NDA A;  1LQT A;  4EIP A;  4Z43 A;  4K5S A;  2XFP A;  5KMR A;  1ZY8 A;  1GAL A;  1EBD A;  4H4U A;  2CVJ A;  4LA1 A;  4YKG A;  5HY5 A;  4A65 A;  2XLP A;  4YSZ A;  3AEB A;  3KU9 A;  1EL8 A;  3KLJ A;  1FCD A;  2WHD A;  2RGJ A;  1RSG A;  5LV9 A;  3UTG A;  1CL0 A;  1K0L A;  2DKI A;  3FMW A;  1S3B A;  1MO9 A;  3NGC X;  4BV6 A;  1COY A;  1P2E A;  2XYO A;  2YLX A;  2YR4 A;  3H4K A;  1H7X A;  2AQJ A;  3OZ2 A;  4JNQ A;  1JNZ A;  3NHO X;  1ZOY A;  2GVC A;  5BVA A;  1DXL A;  2GB0 A;  3DJJ A;  4X9N A;  5IQ1 A;  4Z24 A;  3GSI A;  3SZC A;  1E39 A;  1GRA A;  1K0J A;  2EQ6 A;  1UKV G;  1PXB A;  1PJ6 A;  1XAN A;  2JB1 A;  2Q0K A;  2XLU A;  3CMM A;  3P9U A;  3P4S A;  4OPL A;  5J7X A;  4C5O A;  4YTN A;  2VVL A;  3CPI G;  3SFD A;  4A6N A;  4C3Y A;  3G5R A;  3DJD A;  3BNU A;  2OLO A;  1NHS A;  1DNC A;  4U8J A;  1ZP0 A;  1H81 A;  1E1M A;  3D1C A;  2WOI A;  1QJD A;  2WET A;  2NVK X;  5FS7 A;  4CRT A;  3BI4 A;  3RP8 A;  2WPE A;  5EOW A;  1N1P A;  1O94 A;  3KKJ A;  1CJ3 A;  5KMQ A;  4EIQ A;  3EF6 A;  3UKH A;  1PBE A;  2X8C A;  4EQR A;  4AP3 A;  1D5T A;  1PS9 A;  4B68 A;  2YG4 A;  4UDR A;  2BRA A;  1IJH A;  1PN0 A;  1ZMD A;  4U8K A;  5HXI A;  3LXD A;  1OJA A;  2APG A;  3B3R A;  4G6H A;  2XFO A;  1XPQ A;  2VZ2 A;  2C73 A;  1JNR A;  2B76 A;  1TDE A;  2C76 A;  3DH9 A;  5BUK A;  1F8S A;  1H7W A;  3E1T A;  4DNA A;  1ZK7 A;  2ZZ0 A;  3GYI A;  2B9W A;  4U2T A;  3AD9 B;  3P4Q A;  1E1L A;  3QJ4 A;  4U8I A;  3T37 A;  3NYC A;  4GCM A;  4GR1 A;  4JDR A;  4RG3 A;  3WE0 A;  1GER A;  1E1N A;  1W4X A;  3GRS A;  2JB3 A;  3KPK A;  1JRX A;  3NYF A;  4X4J A;  3UP5 A;  5EBK A;  1LVL A;  2GR3 A;  4AT2 A;  2C72 A;  2BS4 A;  1NPX A;  2GH5 A;  2J3N A;  2XVF A;  1E6E A;  1F6M A;  3GDN A;  5IQ4 A;  3V3O A;  2B9Y A;  2QA2 A;  1Y56 A;  4G73 A;  4IA5 A;  2EQ8 A;  3C4A A;  1PDH A;  4CY8 A;  3NN0 X;  3K30 A;  1H83 A;  1TDO A;  2NPX A;  3AB1 A;  4YKF A;  1E7P A;  1GV4 A;  5JCM A;  4N9X A;  5KOW A;  1GOS A;  3BI2 A;  3UP4 A;  4U2L A;  2ARD A;  4CBQ A;  2ZZB A;  3PO7 A;  3GWD A;  4NNJ A;  3VQR A;  1NHP A;  3AE2 A;  2DKH A;  3ICT A;  2B7R A;  2XCG A;  2XFQ A;  3C4N A;  1DOB A;  2YVG A;  1GTH A;  4NEV A;  5FS6 A;  3FPZ A;  1JOA A;  2YR5 A;  2JKC A;  3AED A;  2JB2 A;  4JN9 A;  4XWZ A;  3UKK A;  3NKS A;  4D03 A;  3CGB A;  2IVD A;  2RAB A;  3NH3 X;  1OJD A;  3BHK A;  2R4J A;  3EAO A;  5EB4 A;  2C3C A;  3NTD A;  2FJD A;  3JSK A;  4OPI A;  5HHF A;  3AD8 B;  4YSX A;  1CJ4 A;  4D04 A;  2GR1 A;  3SX6 A;  3ZDN A;  5U63 A;  2V61 A;  1HYU A;  1DOD A;  4J36 A;  1D7L A;  3K7M X;  3VR9 A;  4C74 A;  1Q1W A;  3QFB A;  1B8S A;  3ABV A;  1ZOV A;  3ICS A;  1PJ5 A;  1CBO A;  1VQW A;  1OJT A;  5KXJ A;  1GRG A;  2BCP A;  4LU6 A;  3DK4 A;  1GT8 A;  3EAN A;  1K4Q A;  3NK0 X;  3RHA A;  4NEW A;  3UKL A;  2BXS A;  3BI5 A;  1JRZ A;  2R0G A;  1TDF A;  3CNP A;  5ER0 A;  4A7A A;  4K7Z A;  4A5L A;  3T2Z A;  2E5V A;  3AE5 A;  3T31 A;  1XDI A;  3QFA A;  4YWO A;  3PS9 A;  3LOV A;  1MXT A;  4EMW A;  2GMJ A;  4EQX A;  5DBJ A;  2YAU A;  1NHR A;  3Q6J A;  4JQ9 A;  4K5R A;  4DSH A;  4H4W A;  1OJ9 A;  1PBC A;  1GES A;  4U8M A;  4EM3 A;  4H4Z A;  2C4C A;  3BHF A;  4EQS A;  2WPF A;  3AE1 A;  3UTH A;  1BZL A;  4YSH A;  4YXD A;  4Y4L A;  2BYB A;  1QLB A;  4Z2T A;  4NTD A;  3QVR A;  1IUT A;  2GR2 A;  2X8H A;  1CF3 A;  1H86 A;  1YQZ A;  5CKU A;  2YLZ A;  3GMC A;  4Z2R A;  3LB8 A;  1H6V A;  4J56 A;  4C3X A;  3AYJ A;  1NEK A;  4G9K A;  3UKA A;  3CGE A;  1F8W A;  4G74 A;  1TYP A;  2VRL A;  1ZKQ A;  2GV8 A;  3GD4 A;  3IF9 A;  2FBW A;  3H8I A; 
#chains in the Genus database with same CATH homology
 2XLS A;  2YG5 A;  4OPG A;  4B1B A;  2EQ9 A;  3R9U A;  2TPR A;  4M52 A;  2WPC A;  1O5W A;  3M12 A;  4OPC A;  3SZF A;  2W0H A;  2WDV A;  4EQW A;  2PHH A;  3ALJ A;  4NZH A;  4J57 A;  1LV0 A;  3L8K A;  3NYE A;  2Y6Q A;  3F8R A;  1AOG A;  1KNP A;  4BK3 A;  4FDC B;  4KX6 A;  3SGL A;  3AE4 A;  5CQF A;  3IC9 A;  1KF6 A;  5JCK A;  3SXI A;  2VQB A;  2A8X A;  2YQU A;  3SYI A;  1GEU A;  3AEE A;  3F8D A;  4ZN0 A;  2BK5 A;  4A79 A;  1S2Y A;  3IHG A;  5FS9 A;  1L0V A;  1B37 A;  2WU2 A;  4TM0 A;  3ISH A;  3NG7 X;  4IVO B;  1M64 A;  4LII A;  2R0C A;  5L46 A;  1NG3 A;  2V3A A;  4I58 A;  3HYV A;  4FK1 C;  2CFY A;  4TM4 A;  1Q1R A;  1BF3 A;  3HZL A;  4G6G A;  2WP6 A;  2Q0L A;  2IVE A;  3UCL A;  5C2T A;  5JCI A;  4IV9 A;  1EL5 A;  1H84 A;  2OLN A;  1KSU A;  4IVM B;  1BGJ A;  1IUS A;  3KD9 A;  3NK2 X;  3K7Q X;  1H82 A;  3VRD B;  4AOX A;  4B67 A;  2O9Z A;  3LJP A;  2WS3 A;  1JRY A;  1XHC A;  4H4T A;  3FG2 P;  2XVJ A;  4B66 A;  2V6O A;  4J33 A;  4CNK A;  4CCR A;  3BNM A;  1P2H A;  2OAM A;  3ITJ A;  3S5W A;  1B5Q A;  2XFN A;  1KFY A;  1B4V A;  1KNR A;  3O0H A;  4ECH A;  3I3L A;  1GPE A;  3NLC A;  1F8R A;  2FJA A;  2WP5 A;  1OJC A;  2JBV A;  5KMP A;  2XVH A;  1ONF A;  5KRQ A;  4Z2U A;  1L9E A;  2BXR A;  1PBB A;  4GAV A;  2GQW A;  2OA1 A;  3COX A;  4USQ A;  1NG4 A;  4A6N B;  3CPH G;  3CN8 A;  3SQP A;  4TM1 A;  2IID A;  2RGO A;  2BA9 A;  4H4R A;  1ZMC A;  4H2N A;  1VDC A;  2XDO A;  5GRT A;  4H4V A;  3OC4 A;  1LJ1 A;  3RED A;  3RNM A;  4GF7 A;  4NTC A;  2AAQ A;  2GEW A;  3NTA A;  4JY2 A;  4AOS A;  3NIX A;  1D7Y A;  4J2W A;  4WCT A;  3FBS A;  2C64 A;  3CNT A;  4X9M A;  3VR8 A;  3UOZ A;  4ADW A;  4USR A;  4H2P A;  2C66 A;  5TR3 A;  4UP3 A;  2R45 A;  4O5Q A;  2XVI A;  1DJN A;  4GUV A;  1TRB A;  4HB9 A;  1EL9 A;  4CY6 A;  1KDG A;  4UDQ A;  2OAL A;  1CJC A;  1E1K A;  2C75 A;  3GRT A;  4E0V A;  2AR8 A;  3SFE A;  2V3B A;  3Q9T A;  1S2Q A;  3G5S A;  2R4E A;  2VVL G;  1REO A;  5KNL A;  1NEN A;  1CHU A;  3DGH A;  2WOV A;  3UOV A;  3P1W A;  1GET A;  1TDN A;  2C65 A;  3HYW A;  2BC0 A;  2YVF A;  2I0Z A;  3K7T A;  1Q9I A;  2GR0 A;  2CUL A;  3ATR A;  5M0Z A;  2QAE A;  3ADA B;  3CIR A;  3L1R A;  1PXC A;  4U8N A;  3AWI A;  4TLX A;  2UZZ A;  1IUV A;  1VRQ B;  2GMH A;  2FJE A;  3SM8 A;  4CNJ A;  3GWF A;  3KVE A;  4YTP A;  2YG3 A;  4OPD A;  1GRB A;  4YSY A;  5KOX A;  1FOH A;  4YT0 A;  2V5Z A;  1IUW A;  2TMD A;  4H4Y A;  3UKP A;  1LQU A;  2BK4 A;  3CNS A;  3RP6 A;  1FL2 A;  1N4V A;  2C70 A;  2VQ7 A;  5KVI A;  2WQY A;  4EMI A;  3UTF A;  2XFU A;  1DOE A;  1PHH A;  4FX9 A;  2BAB A;  3M0O A;  4K8D A;  2WOW A;  3HYX A;  4GAP A;  3B6D A;  3QSS A;  3GYX A;  4OCG A;  1LTX R;  2X50 A;  3DGZ A;  1PJ7 A;  4U8L A;  4Z25 A;  1GSN A;  4H4Q A;  5JCL A;  1Y0P A;  3G5Q A;  2QA1 A;  4K2X A;  5M10 A;  1BGN A;  3AXB A;  4BK1 A;  3CGC A;  3CPJ G;  1DOC A;  4EMJ A;  1D4C A;  1QO8 A;  1TDK A;  1CC4 A;  4UDP A;  3V76 A;  2VVM A;  4O5U A;  1IUU A;  4DGK A;  4ZCD A;  2EQ7 A;  1GXF A;  2R46 A;  1FEC A;  3LZX A;  1TYT A;  2BS3 A;  1PBF A;  1CJ2 A;  1SEZ A;  3NRN A;  4WX1 A;  3KA7 A;  3ATQ A;  2E1M A;  2R0P A;  2WDQ A;  1VG9 A;  4BJY A;  1ZDL A;  2JK6 A;  4U2S A;  1DJQ A;  5U25 A;  4H50 A;  3PVC A;  1RYI A;  2BK3 A;  4APN A;  2WBA A;  1S3E A;  2RGH A;  2XLR A;  1X31 B;  1D4E A;  3EPT A;  2ZBW A;  4Y4M A;  4H7U A;  3F8P A;  1L9D A;  1BKW A;  2ZZC A;  4C77 A;  2C7G A;  3ALM A;  1M6I A;  1YKJ A;  2C67 A;  5KWF A;  1GRF A;  2YG6 A;  2YLR A;  3LAD A;  1LPF A;  1GRH A;  2XVE A;  4H4P A;  2X99 A;  4REK A;  4U8P A;  3URH A;  3C96 A;  5BRT A;  1YQ3 A;  3SZW A;  1CC2 A;  1RP0 A;  4JY3 A;  2YLW A;  3CND A;  2BAC A;  3GDP A;  4RG4 A;  3AYL A;  5KVH A;  4ZCC A;  2BRY A;  3UKQ A;  2YM1 A;  1PBD A;  5EB5 A;  2BCG G;  2HQM A;  2YG7 A;  3IHM A;  3T0K A;  4H2Q A;  4II3 A;  4DSG A;  5U1O A;  3LZW A;  3DJE A;  3DJG X;  3FIM B;  4BK2 A;  1KSS A;  2FJB A;  1YY5 A;  2GQF A;  1GRE A;  2PYX A;  3AEF A;  1ELI A;  2GRT A;  3P4P A;  2YR6 A;  3DK8 A;  4GDP A;  1FEA A;  1IUX A;  3SY4 A;  1K0I A;  1Z6L A;  3H8L A;  4CCQ A;  1GRT A;  1PXA A;  2WEU A;  4HA6 A;  3T2Y A;  1D4D A;  1V59 A;  4GDE A;  2H89 A;  1EL7 A;  4RSL A;  2GAH B;  2WU5 A;  3II4 A;  2A89 A;  3DK9 A;  5BUL A;  4KPR A;  1GND A;  1VG0 A;  4B65 A;  3AE9 A;  2BC1 A;  4Z44 A;  4FK1 A;  4XXG A;  4AT0 A;  4H4X A;  2VRM A;  3GYJ A;  3CGD A;  3NNE A;  3T14 A;  2WES A;  3AEG A;  1N4W A;  3AE3 A;  4IA6 A;  5HYM A;  2F5Z A;  1JEH A;  2WP9 A;  3QSM A;  5GSN A;  1Y56 B;  3DA1 A;  2GF3 A;  4TM3 A;  4A99 A;  3M13 A;  3AEC A;  2B9X A;  4Y4N A;  3GMB A;  3AEA A;  2Q7V A;  4J34 A;  1NAA A;  3I6D A;  3VRA A;  4XWR A;  4H2R A;  1CC6 A;  2Z5X A;  2XLT A;  2E4G A;  1GTE A;  4K22 A;  2Q6U A;  4II2 A;  3AE8 A;  5J60 A;  4B69 A;  3IWA A;  3P4R A;  1N4U A;  4OPT A;  4OPU A;  4OVI A;  3UOX A;  2WDR A;  3DME A;  2ACZ A;  4EM4 A;  3S61 A;  2YLS A;  5FS8 A;  3CNJ A;  3V3N A;  3NN6 X;  3NT6 A;  2X3N A;  3D8X A;  3ICR A;  4NWZ A;  2YLT A;  1YQ4 A;  2C3D A;  3RP7 A;  3AE7 A;  3SZ0 A;  2GAG B;  2X8G A;  1L9C A;  2YWL A;  1ZX9 A;  4ICY A;  3AYI A;  4J31 A;  1FEB A;  4GRT A;  4U8O A;  3CTY A;  1MOK A;  1JU2 A;  4I59 A;  3ZYX A;  2R9Z A;  3ALL A;  2A87 A;  1F3P A;  3QSE A;  4PAB A;  5C3J A;  3VRB A;  2B7S A;  4TLZ A;  4H4S A;  1NHQ A;  3UTE A;  4BUR A;  2YVJ A;  4PAA A;  4YTM A;  3NK1 X;  4B63 A;  5JCN A;  2Y6R A;  3AD7 B;  3UKF A;  2QCU A;  3AE6 A;  1O95 A;  3QVP A;  4NTE A;  5FMH A;  4BJZ A;  2CDU A;  2V60 A;  3UOY A;  2JAE A;  4B64 A;  4A9W A;  1BWC A;  4P9S A;  2BS2 A;  5IPY A;  4AP1 A;  4Z26 A;  2YM2 A;  3T2K A;  3KPF A;  4MJW A;  4JNA A;  3GD3 A;  2Z5Y A;  2H88 A;  2VOU A;  5KMS A;  1NDA A;  1LQT A;  4EIP A;  4Z43 A;  4K5S A;  2XFP A;  5KMR A;  1ZY8 A;  1GAL A;  1EBD A;  4H4U A;  2CVJ A;  4LA1 A;  4YKG A;  5HY5 A;  4A65 A;  2XLP A;  4YSZ A;  3AEB A;  3KU9 A;  1EL8 A;  3KLJ A;  1FCD A;  2WHD A;  2RGJ A;  1RSG A;  5LV9 A;  3UTG A;  1CL0 A;  1K0L A;  2DKI A;  3FMW A;  1S3B A;  1MO9 A;  3NGC X;  4BV6 A;  1COY A;  1P2E A;  2XYO A;  2YLX A;  2YR4 A;  3H4K A;  1H7X A;  2AQJ A;  3OZ2 A;  4JNQ A;  1JNZ A;  3NHO X;  1ZOY A;  2GVC A;  5BVA A;  1DXL A;  2GB0 A;  3DJJ A;  4X9N A;  5IQ1 A;  4Z24 A;  3GSI A;  3SZC A;  1E39 A;  1GRA A;  1K0J A;  2EQ6 A;  1UKV G;  1PXB A;  1PJ6 A;  1XAN A;  2JB1 A;  2Q0K A;  2XLU A;  3CMM A;  3P9U A;  3P4S A;  4OPL A;  5J7X A;  4C5O A;  4YTN A;  2VVL A;  3CPI G;  3SFD A;  4A6N A;  4C3Y A;  3G5R A;  3DJD A;  3BNU A;  2OLO A;  1NHS A;  1DNC A;  4U8J A;  1ZP0 A;  1H81 A;  1E1M A;  3D1C A;  2WOI A;  1QJD A;  2WET A;  2NVK X;  5FS7 A;  4CRT A;  3BI4 A;  3RP8 A;  2WPE A;  5EOW A;  1N1P A;  1O94 A;  3KKJ A;  1CJ3 A;  5KMQ A;  4EIQ A;  3EF6 A;  3UKH A;  1PBE A;  2X8C A;  4EQR A;  4AP3 A;  1D5T A;  1PS9 A;  4B68 A;  2YG4 A;  4UDR A;  2BRA A;  1IJH A;  1PN0 A;  1ZMD A;  4U8K A;  5HXI A;  3LXD A;  1OJA A;  2APG A;  3B3R A;  4G6H A;  2XFO A;  1XPQ A;  2VZ2 A;  2C73 A;  1JNR A;  2B76 A;  1TDE A;  2C76 A;  3DH9 A;  5BUK A;  1F8S A;  1H7W A;  3E1T A;  4DNA A;  1ZK7 A;  2ZZ0 A;  3GYI A;  2B9W A;  4U2T A;  3AD9 B;  3P4Q A;  1E1L A;  3QJ4 A;  4U8I A;  3T37 A;  3NYC A;  4GCM A;  4GR1 A;  4JDR A;  4RG3 A;  3WE0 A;  1GER A;  1E1N A;  1W4X A;  3GRS A;  2JB3 A;  3KPK A;  1JRX A;  3NYF A;  4X4J A;  3UP5 A;  5EBK A;  1LVL A;  2GR3 A;  4AT2 A;  2C72 A;  2BS4 A;  1NPX A;  2GH5 A;  2J3N A;  2XVF A;  1E6E A;  1F6M A;  3GDN A;  5IQ4 A;  3V3O A;  2B9Y A;  2QA2 A;  1Y56 A;  4G73 A;  4IA5 A;  2EQ8 A;  3C4A A;  1PDH A;  4CY8 A;  3NN0 X;  3K30 A;  1H83 A;  1TDO A;  2NPX A;  3AB1 A;  4YKF A;  1E7P A;  1GV4 A;  5JCM A;  4N9X A;  5KOW A;  1GOS A;  3BI2 A;  3UP4 A;  4U2L A;  2ARD A;  4CBQ A;  2ZZB A;  3PO7 A;  3GWD A;  4NNJ A;  3VQR A;  1NHP A;  3AE2 A;  2DKH A;  3ICT A;  2B7R A;  2XCG A;  2XFQ A;  3C4N A;  1DOB A;  2YVG A;  1GTH A;  4NEV A;  5FS6 A;  3FPZ A;  1JOA A;  2YR5 A;  2JKC A;  3AED A;  2JB2 A;  4JN9 A;  4XWZ A;  3UKK A;  3NKS A;  4D03 A;  3CGB A;  2IVD A;  2RAB A;  3NH3 X;  1OJD A;  3BHK A;  2R4J A;  3EAO A;  5EB4 A;  2C3C A;  3NTD A;  2FJD A;  3JSK A;  4OPI A;  5HHF A;  3AD8 B;  4YSX A;  1CJ4 A;  4D04 A;  2GR1 A;  3SX6 A;  3ZDN A;  5U63 A;  2V61 A;  1HYU A;  1DOD A;  4J36 A;  1D7L A;  3K7M X;  3VR9 A;  4C74 A;  1Q1W A;  3QFB A;  1B8S A;  3ABV A;  1ZOV A;  3ICS A;  1PJ5 A;  1CBO A;  1VQW A;  1OJT A;  5KXJ A;  1GRG A;  2BCP A;  4LU6 A;  3DK4 A;  1GT8 A;  3EAN A;  1K4Q A;  3NK0 X;  3RHA A;  4NEW A;  3UKL A;  2BXS A;  3BI5 A;  1JRZ A;  2R0G A;  1TDF A;  3CNP A;  5ER0 A;  4A7A A;  4K7Z A;  4A5L A;  3T2Z A;  2E5V A;  3AE5 A;  3T31 A;  1XDI A;  3QFA A;  4YWO A;  3PS9 A;  3LOV A;  1MXT A;  4EMW A;  2GMJ A;  4EQX A;  5DBJ A;  2YAU A;  1NHR A;  3Q6J A;  4JQ9 A;  4K5R A;  4DSH A;  4H4W A;  1OJ9 A;  1PBC A;  1GES A;  4U8M A;  4EM3 A;  4H4Z A;  2C4C A;  3BHF A;  4EQS A;  2WPF A;  3AE1 A;  3UTH A;  1BZL A;  4YSH A;  4YXD A;  4Y4L A;  2BYB A;  1QLB A;  4Z2T A;  4NTD A;  3QVR A;  1IUT A;  2GR2 A;  2X8H A;  1CF3 A;  1H86 A;  1YQZ A;  5CKU A;  2YLZ A;  3GMC A;  4Z2R A;  3LB8 A;  1H6V A;  4J56 A;  4C3X A;  3AYJ A;  1NEK A;  4G9K A;  3UKA A;  3CGE A;  1F8W A;  4G74 A;  1TYP A;  2VRL A;  1ZKQ A;  2GV8 A;  3GD4 A;  3IF9 A;  2FBW A;  3H8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...