3NHOX

Complex of 6-hydroxy-l-nicotine oxidase with product bound at active site
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 139
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nhoX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nhoX02
1P2HA 1N1PA 4CNJA 1CBOA 4YKFA 1H7WA 3NG7X 3RP7A 2A89A 4U8JA 1YY5A 5GRTA 5IPYA 2TPRA 2VVLG 1RSGA 3CN8A 2VVLA 4XWZA 3EANA 2GV8A 4OPIA 3C4NA 4JQ9A 1IUVA 4XWRA 1PBDA 4UDPA 4CCRA 1ZX9A 2ACZA 1GEUA 2Q6UA 4J57A 1OJTA 2HQMA 3I3LA 5ER0A 2ZBWA 1DJQA 5JCKA 4GUVA 4H2NA 3NN6X 1NHQA 3I6DA 1CHUA 4USQA 1F3PA 3ISHA 1EL5A 2YAUA 3LXDA 4JDRA 4OCGA 3V3NA 1JU2A 4U8MA 3SGLA 4X9NA 4C5OA 4H4YA 2QA1A 2ZZBA 4YXDA 1K0LA 3CNPA 3GD4A 4CBQA 3F8PA 4K2XA 3M0OA 4USRA 3NYCA 2O9ZA 2X50A 1F6MA 1PXBA 4YTNA 3NYEA 2JAEA 3AYJA 4BV6A 2IVDA 1DOEA 2V3AA 2WU2A 4A9WA 1QJDA 3DJEA 4B65A 4ICYA 3PS9A 5KOXA 4OPUA 4U8OA 1RP0A 3DK4A 2FJEA 2XLTA 3H4KA 3UKAA 5JCNA 3D1CA 4EMWA 1KSUA 1JOAA 1Y56A 2GR1A 3P4SA 1GPEA 1JEHA 1E39A 3CGEA 2YLWA 1IUWA 4BURA 2ZZCA 1VG0A 2C67A 4J34A 4K5SA 3UOYA 3ICRA 4N9XA 1DJNA 4BK3A 2YVFA 3UTHA 1XANA 3KA7A 3NN0X 1NPXA 4H4RA 5M10A 3NNEA 3UP4A 3AE1A 4B66A 1GESA 5KOWA 1LJ1A 1XPQA 3AEDA 1D4EA 2QAEA 5KVIA 2GMHA 3DGHA 4U2SA 4H4ZA 3VR9A 1V59A 2V60A 3AYLA 3KU9A 3NGCX 1N4WA 2BCPA 2WP9A 4KX6A 2APGA 4AOXA 1OJDA 4CRTA 1ONFA 3LADA 4GDEA 1CJCA 3D8XA 4OPTA 2V6OA 1PS9A 2GR0A 1PBBA 1IUUA 1Y56B 2BS4A 1B8SA 2R46A 2V61A 2YG7A 4UP3A 3P9UA 4I59A 1RYIA 1TDOA 3AEFA 1GRGA 1D7YA 3UKLA 2BACA 4IVMB 2Z5YA 3K7QX 2JKCA 2R9ZA 2WDRA 5L46A 3DJGX 4EMJA 4ZCCA 2EQ6A 2RABA 3DA1A 3AE8A 3QVPA 1NG3A 2C73A 3AE6A 5U25A 1EL7A 4Z2TA 2XVEA 4WX1A 2XFOA 5FMHA 4D03A 1MO9A 3FPZA 2B7RA 2JB1A 1PHHA 1N4VA 3C96A 3Q6JA 4BK2A 1KNRA 1NHSA 1DOCA 1LPFA 3V3OA 3RP8A 3S5WA 5KXJA 2XFNA 2CFYA 1O94A 2BC0A 5M0ZA 2GVCA 3M13A 4GCMA 5BRTA 1KDGA 1BGJA 1NAAA 2JB2A 2YVJA 3CNDA 1PBEA 4H4XA 4YSHA 1PXCA 2C3CA 3WE0A 1GTEA 4GRTA 2VQ7A 3UP5A 1UKVG 5BULA 3QSMA 3KLJA 2B9WA 1YQ4A 4A6NA 2R0PA 4TM3A 4ZN0A 2R45A 4JNAA 4K22A 3AD9B 1NHPA 4H4SA 1EL9A 2UZZA 5FS9A 4H4WA 5GSNA 1ZMDA 1CC2A 1CC6A 2AQJA 3DK9A 5DBJA 3VQRA 2VVMA 2R4EA 4TM4A 1TDEA 1OJAA 2W0HA 4JN9A 5HXIA 4FK1A 3H8LA 4IV9A 3B6DA 3LZWA 4UDQA 4AP1A 4FX9A 1DODA 3NTAA 4TM0A 1BGNA 2E1MA 4PABA 1TRBA 2AAQA 4A79A 1JNZA 2WPCA 1NEKA 2IIDA 3NHOX 1DXLA 1EBDA 2YVGA 3PO7A 1KNPA 4H4TA 2BCGG 2YG4A 3UKKA 3K7TA 3SQPA 3O0HA 1AOGA 2XVIA 4LIIA 2GAGB 4EIQA 1KF6A 3QVRA 4EQSA 3NTDA 1L9EA 3ICSA 1PJ7A 4MJWA 1EL8A 3NKSA 4A6NB 1JRZA 5HY5A 1Z6LA 3NK0X 3UOZA 2FBWA 2B76A 1JRYA 3NIXA 3FBSA 1GRHA 5FS7A 5J7XA 1GREA 4B64A 1YQZA 3GDNA 4Z44A 1LV0A 1L9CA 1OJCA 1PJ5A 3BI2A 2V5ZA 2PHHA 2JB3A 4B67A 3AE9A 3LJPA 3R9UA 4B63A 1E1LA 3AD7B 3ITJA 1H82A 2YM2A 2YR4A 2XLUA 1LQUA 2Q0KA 4JNQA 1GV4A 3G5QA 3NH3X 4UDRA 2WP5A 3AEGA 4K8DA 4NZHA 5EB5A 3ALLA 3B3RA 1D7LA 2TMDA 4H4PA 3SFEA 3KPFA 5CKUA 1F8RA 2WPEA 3BI5A 1K0JA 1IUSA 2C64A 2YWLA 2B9YA 2ZZ0A 3CNTA 4JY2A 3OZ2A 3VRAA 4K7ZA 1W4XA 2XVJA 2E4GA 2YLZA 4IA6A 4RG4A 3URHA 2BK4A 3L1RA 4U8IA 1FOHA 1SEZA 2C65A 5IQ1A 1Q1RA 1P2EA 2FJBA 3HZLA 4YSXA 2WEUA 4FDCB 1ZOVA 4IA5A 2BXSA 4JY3A 2V3BA 3CGBA 3GDPA 1Q9IA 1FECA 4Z24A 3QJ4A 1TYTA 4Z26A 2GAHB 5JCLA 4H4QA 1GSNA 2R4JA 3NLCA 2RGJA 3V76A 2BK5A 5CQFA 3DJDA 3AE7A 4OPLA 4A5LA 4C77A 4U2TA 4IVOB 1GRAA 2XDOA 4YKGA 1CJ3A 1S3EA 1CJ2A 1GRFA 4GF7A 2XLPA 3GYJA 5U1OA 2OLOA 3P1WA 3FIMB 1NG4A 4OPGA 4DGKA 3S61A 3QSSA 4YTPA 3AEBA 3UKQA 2XVFA 1GRBA 2CDUA 1Q1WA 2R0GA 4B1BA 3IWAA 4EQXA 3RHAA 4H7UA 2WPFA 2B7SA 4H4VA 1QO8A 4ZCDA 1TDKA 1H6VA 2GQFA 3CNJA 2XFUA 3AEEA 2YQUA 3IC9A 2GQWA 1FEAA 3ICTA 1GTHA 3OC4A 4HA6A 1MXTA 1GALA 3UKHA 4EQRA 3UOXA 1F8WA 3IHGA 2BA9A 3GWFA 5BVAA 3SFDA 1E6EA 4Z2UA 1JRXA 3KVEA 1TYPA 2IVEA 4Z43A 3AD8B 3CPJG 2X99A 1PXAA 3QSEA 3LOVA 1TDNA 2AR8A 2GF3A 3GMCA 4KPRA 2H89A 1KFYA 1D5TA 1H7XA 1CC4A 4K5RA 4X4JA 4AT0A 1GRTA 1CL0A 3GYIA 3UKPA 4HB9A 2EQ8A 2EQ7A 3VRDB 3VRBA 4CCQA 1PN0A 3ADAB 2BK3A 1COYA 2BXRA 1L0VA 1S2QA 3EAOA 2EQ9A 4BK1A 2RGOA 3BHFA 3GMBA 4O5QA 5EOWA 4YTMA 2YLSA 1FL2A 2WESA 5HHFA 3UCLA 2GMJA 4EM4A 1ZOYA 2F5ZA 3K7MX 1GETA 2FJAA 5JCMA 2YLTA 2BC1A 3NT6A 1CF3A 5EB4A 2ARDA 2X8GA 3KKJA 4Z2RA 2XCGA 2DKIA 3REDA 3DH9A 1N4UA 3GD3A 4TM1A 2Q0LA 2WOIA 2FJDA 4AOSA 1NHRA 3ZDNA 3AE3A 3NYFA 2GB0A 1GERA 2BABA 1LTXR 1NDAA 1O5WA 2X8CA 4REKA 4C74A 2X3NA 2WDQA 3F8RA 4PAAA 3GWDA 2QA2A 1VRQB 4NTDA 1M64A 3AWIA 1ZDLA 1XDIA 3COXA 4NTEA 2WS3A 1YKJA 2VOUA 1S2YA 2GEWA 3LB8A 3P4QA 3Q9TA 4A65A 4CY8A 4RSLA 3BNUA 3II4A 2XLSA 3AE2A 3EPTA 1D4CA 2QCUA 4O5UA 2YR6A 4YT0A 1DNCA 4EMIA 3CNSA 4DSHA 3DGZA 4X9MA 2WBAA 4U8LA 1H84A 2WOWA 3M12A 4GDPA 4H2RA 2J3NA 4BJYA 5JCIA 1KSSA 1S3BA 1O95A 4YWOA 2YLXA 1BKWA 4OPDA 1L9DA 3C4AA 3L8KA 1H81A 4ECHA 3ATRA 1E7PA 5C3JA 2BYBA 2GR3A 5KVHA 5BUKA 3RNMA 5HYMA 1BF3A 4YSZA 3ABVA 2C70A 3CPIG 1E1KA 2C3DA 4OPCA 4Y4MA 5C2TA 5KRQA 1FEBA 2NVKX 4J2WA 3T37A 1TDFA 2YR5A 2B9XA 2CVJA 3G5SA 1REOA 2BS3A 3NK2X 3AEAA 1VG9A 2VZ2A 2JBVA 2XVHA 4A7AA 4APNA 1XHCA 5IQ4A 2RGHA 4DSGA 3RP6A 3G5RA 3LZXA 1YQ3A 4LU6A 5EBKA 2YLRA 4C3YA 4WCTA 4CY6A 4TLZA 3ALMA 1HYUA 1ZKQA 4I58A 5LV9A 2OAMA 1NENA 3JSKA 3KD9A 1MOKA 1H83A 1B4VA 4U8PA 3GSIA 3P4PA 4J31A 4LA1A 2BS2A 3IHMA 1H86A 3CIRA 3ATQA 3QFBA 5FS6A 3K30A 2GH5A 2NPXA 4ADWA 1B37A 1LVLA 1ZP0A 4J36A 4AT2A 1PJ6A 1Y0PA 2Y6RA 3VR8A 3NRNA 4A99A 2X8HA 4YSYA 4J56A 4U2LA 2GR2A 3IF9A 3FMWA 1D4DA 2H88A 4EM3A 1F8SA 3P4RA 5FS8A 1VDCA 3E1TA 4U8KA 3UKFA 1IUTA 1IUXA 3PVCA 2WP6A 2YM1A 4EQWA 4XXGA 2XLRA 4P9SA 2VRLA 2C72A 2XFQA 3DJJA 2XYOA 1ZMCA 2YG6A 2GRTA 3EF6A 2C66A 1QLBA 3AE4A 3ALJA 2JK6A 2OALA 3UOVA 1LQTA 3NK1X 4M52A 3CGDA 1X31B 4OVIA 1PBFA 2Y6QA 4NEWA 3DK8A 1GNDA 2WU5A 1K4QA 3GRTA 2A87A 2WDVA 4RG3A 1B5QA 2YG5A 4B69A 3BHKA 1BZLA 1CJ4A 2C76A 3FG2P 2Z5XA 2XFPA 3BI4A 1GOSA 2VQBA 2C75A 4AP3A 3AYIA 3H8IA 2A8XA 3CTYA 4H2PA 2Q7VA 1GXFA 1ZY8A 3QFAA 1E1MA 4DNAA 1BWCA 4H2QA 4FK1C 1M6IA 2I0ZA 1IJHA 1PDHA 3AB1A 3DMEA 2YG3A 3BNMA 4H4UA 2R0CA 3UTFA 4BJZA 3SM8A 4Y4NA 2OA1A 4U8NA 2C7GA 4H50A 3UTEA 3CGCA 4EIPA 4TLXA 3CPHG 1JNRA 3AXBA 1FCDA 1GT8A 1DOBA 1VQWA 3GRSA 2VRMA 2E5VA 2WETA 2WQYA 3AE5A 3ZYXA 5TR3A 5U63A 3UTGA 2CULA 2PYXA 3F8DA 2WHDA 4J33A 4NTCA 4E0VA 1ZK7A 5KWFA 1K0IA 4CNKA 1ELIA 2WOVA 4Y4LA 4NEVA 4B68A 1PBCA 4D04A 4Z25A 1E1NA 2OLNA 3AECA 4GR1A 2DKHA 5J60A 4C3XA 1OJ9A
chains in the Genus database with same CATH superfamily
1P2HA 1N1PA 4CNJA 1CBOA 4YKFA 1H7WA 3NG7X 3RP7A 4GAPA 2A89A 4U8JA 1YY5A 5GRTA 5IPYA 2TPRA 2VVLG 1RSGA 3CN8A 2VVLA 4XWZA 3EANA 2GV8A 4OPIA 3C4NA 3CMMA 1IUVA 4JQ9A 4XWRA 1PBDA 4UDPA 4CCRA 1ZX9A 2ACZA 1GEUA 2Q6UA 4J57A 1OJTA 2HQMA 3I3LA 5ER0A 2ZBWA 1DJQA 5JCKA 4GUVA 4H2NA 3NN6X 1NHQA 3I6DA 1CHUA 4USQA 3SXIA 1F3PA 3ISHA 1EL5A 2YAUA 3LXDA 4JDRA 4OCGA 3V3NA 1JU2A 4U8MA 3SGLA 4X9NA 4C5OA 4H4YA 2QA1A 2ZZBA 4YXDA 1K0LA 3CNPA 3GD4A 4CBQA 3F8PA 4K2XA 3M0OA 4USRA 3NYCA 2O9ZA 2X50A 1F6MA 1PXBA 4YTNA 3NYEA 2JAEA 3AYJA 4BV6A 2IVDA 1DOEA 2V3AA 2WU2A 4A9WA 1QJDA 3DJEA 4B65A 4ICYA 3PS9A 5KOXA 4OPUA 4U8OA 1RP0A 3DK4A 2FJEA 2XLTA 3H4KA 3UKAA 5JCNA 3D1CA 4EMWA 1KSUA 1JOAA 1Y56A 2GR1A 3P4SA 1GPEA 1JEHA 1E39A 3CGEA 2YLWA 1IUWA 4BURA 2ZZCA 1VG0A 2C67A 4J34A 4K5SA 3UOYA 3ICRA 4N9XA 1DJNA 4BK3A 2YVFA 3UTHA 1XANA 3KA7A 3NN0X 1NPXA 4H4RA 5M10A 3NNEA 3UP4A 3AE1A 4B66A 1GESA 5KOWA 1LJ1A 1XPQA 3AEDA 1D4EA 2QAEA 5KVIA 2GMHA 3DGHA 3SY4A 5KNLA 4U2SA 4H4ZA 3VR9A 1V59A 2V60A 3AYLA 3KU9A 3NGCX 1N4WA 2BCPA 2WP9A 4KX6A 2APGA 4AOXA 1OJDA 4CRTA 1ONFA 3LADA 4GDEA 1CJCA 3D8XA 4OPTA 2V6OA 1PS9A 2GR0A 1PBBA 1IUUA 1Y56B 2BS4A 1B8SA 2R46A 2V61A 2YG7A 4UP3A 3P9UA 4I59A 1RYIA 1TDOA 3AEFA 1GRGA 1D7YA 3T2KA 3UKLA 4G6GA 2BACA 4IVMB 2Z5YA 3K7QX 2JKCA 2R9ZA 2WDRA 2BRAA 5L46A 3DJGX 4EMJA 4ZCCA 2EQ6A 2RABA 3DA1A 3AE8A 3QVPA 1NG3A 2C73A 3AE6A 5U25A 1EL7A 4Z2TA 2XVEA 4WX1A 2XFOA 5FMHA 4D03A 1MO9A 3FPZA 2B7RA 2JB1A 1PHHA 1N4VA 3C96A 3Q6JA 4BK2A 1KNRA 1NHSA 1DOCA 1LPFA 3V3OA 3RP8A 3S5WA 5KXJA 2XFNA 2CFYA 1O94A 2BC0A 5KMQA 5M0ZA 2GVCA 5KMPA 3M13A 4GCMA 5BRTA 1KDGA 1BGJA 1NAAA 2JB2A 2YVJA 3CNDA 1PBEA 3GYXA 4H4XA 4YSHA 1PXCA 2C3CA 3WE0A 1GTEA 4GRTA 2VQ7A 3UP5A 1UKVG 4G73A 5BULA 3QSMA 3KLJA 2B9WA 1YQ4A 4A6NA 2R0PA 4TM3A 4ZN0A 2R45A 4JNAA 3T2ZA 4K22A 3AD9B 1NHPA 4H4SA 1EL9A 2UZZA 5FS9A 4H4WA 5GSNA 1ZMDA 1CC2A 1CC6A 2AQJA 3DK9A 5DBJA 3VQRA 2VVMA 2R4EA 5KMSA 4TM4A 1TDEA 1OJAA 2W0HA 4JN9A 4NNJA 5HXIA 4FK1A 3H8LA 4IV9A 3B6DA 3LZWA 4UDQA 4AP1A 4FX9A 1DODA 3NTAA 4TM0A 1BGNA 2E1MA 4PABA 1TRBA 2AAQA 4A79A 3HYVA 1JNZA 2WPCA 1NEKA 2IIDA 3NHOX 1DXLA 1EBDA 2YVGA 3PO7A 1KNPA 4H4TA 2BCGG 2YG4A 3UKKA 3K7TA 3SQPA 3O0HA 1AOGA 2XVIA 4LIIA 3T0KA 2GAGB 4EIQA 1KF6A 3QVRA 4G9KA 4EQSA 3NTDA 1L9EA 3ICSA 1PJ7A 4MJWA 1EL8A 3NKSA 4A6NB 1JRZA 5HY5A 1Z6LA 3NK0X 3UOZA 2FBWA 2B76A 1JRYA 3NIXA 3FBSA 1GRHA 5FS7A 5J7XA 1GREA 4B64A 1YQZA 3GDNA 4Z44A 1LV0A 1L9CA 1OJCA 1PJ5A 3BI2A 2V5ZA 2PHHA 2JB3A 4B67A 4II3A 3AE9A 3LJPA 3R9UA 4B63A 1E1LA 3AD7B 3ITJA 1H82A 2YM2A 2YR4A 2XLUA 1LQUA 2Q0KA 4JNQA 1GV4A 3G5QA 3NH3X 4UDRA 2WP5A 3AEGA 4K8DA 4NZHA 5EB5A 3ALLA 3B3RA 1D7LA 2TMDA 4H4PA 3SFEA 3KPFA 5CKUA 1F8RA 2WPEA 3BI5A 1K0JA 1IUSA 2C64A 2YWLA 2B9YA 2ZZ0A 3CNTA 4JY2A 3OZ2A 3VRAA 4K7ZA 1W4XA 2XVJA 2E4GA 4G74A 2YLZA 4IA6A 4RG4A 3URHA 2BK4A 3L1RA 4U8IA 1FOHA 1SEZA 2C65A 5IQ1A 1Q1RA 1P2EA 2FJBA 3HZLA 4YSXA 2WEUA 4FDCB 1ZOVA 4IA5A 2BXSA 4JY3A 2V3BA 3CGBA 3GDPA 1Q9IA 1FECA 4Z24A 3QJ4A 1TYTA 3HYXA 4Z26A 2GAHB 5JCLA 4H4QA 1GSNA 2R4JA 3NLCA 2RGJA 3V76A 2BK5A 5CQFA 3DJDA 3AE7A 4OPLA 4A5LA 4C77A 4U2TA 4IVOB 1GRAA 3SZFA 2XDOA 4YKGA 4GAVA 1CJ3A 1S3EA 1CJ2A 1GRFA 4GF7A 2XLPA 3GYJA 5U1OA 2OLOA 3P1WA 3FIMB 1NG4A 4OPGA 4DGKA 3S61A 3QSSA 4G6HA 3AEBA 3UKQA 2XVFA 4YTPA 1GRBA 2CDUA 1Q1WA 2R0GA 4B1BA 3IWAA 4EQXA 3RHAA 4H7UA 2WPFA 2B7SA 4H4VA 1QO8A 4ZCDA 1TDKA 1H6VA 3HYWA 2GQFA 3CNJA 3T14A 2XFUA 3AEEA 2YQUA 3IC9A 2GQWA 1FEAA 3ICTA 1GTHA 3OC4A 4HA6A 1MXTA 1GALA 3UKHA 4EQRA 3UOXA 1F8WA 3IHGA 2BA9A 3GWFA 5BVAA 3SFDA 1E6EA 4Z2UA 1JRXA 3KVEA 3KPKA 1TYPA 2IVEA 4Z43A 3AD8B 3CPJG 2X99A 1PXAA 3QSEA 3LOVA 1TDNA 2AR8A 2GF3A 3GMCA 4KPRA 2H89A 1KFYA 1D5TA 1H7XA 1CC4A 4K5RA 4X4JA 4AT0A 1GRTA 1CL0A 3GYIA 3UKPA 4HB9A 2EQ8A 2EQ7A 3VRDB 3VRBA 4CCQA 1PN0A 3ADAB 2BK3A 1COYA 2BXRA 1L0VA 1S2QA 3EAOA 2EQ9A 4BK1A 2RGOA 3BHFA 3GMBA 4O5QA 5EOWA 4YTMA 2YLSA 1FL2A 2WESA 5HHFA 3UCLA 2GMJA 4EM4A 1ZOYA 2F5ZA 3K7MX 1GETA 2FJAA 5JCMA 2YLTA 2BC1A 3NT6A 1CF3A 5EB4A 2ARDA 2X8GA 3KKJA 4Z2RA 2XCGA 2DKIA 3REDA 3DH9A 1N4UA 3GD3A 4TM1A 2Q0LA 2WOIA 2FJDA 4AOSA 1NHRA 3ZDNA 3AE3A 3NYFA 2GB0A 1GERA 2BABA 1LTXR 1NDAA 1O5WA 2X8CA 4REKA 4C74A 2X3NA 2WDQA 3F8RA 4PAAA 3GWDA 2QA2A 1VRQB 4NTDA 1M64A 3AWIA 1ZDLA 1XDIA 3COXA 4NTEA 2C4CA 2WS3A 1YKJA 3T31A 2VOUA 1S2YA 2GEWA 3LB8A 3P4QA 3Q9TA 4A65A 4CY8A 4RSLA 3BNUA 3II4A 2XLSA 3AE2A 3EPTA 1D4CA 2QCUA 4O5UA 2YR6A 4II2A 1DNCA 4EMIA 4YT0A 3CNSA 4DSHA 3DGZA 4X9MA 2WBAA 4U8LA 1H84A 2WOWA 3M12A 4GDPA 4H2RA 2J3NA 4BJYA 5JCIA 1KSSA 1S3BA 1O95A 4YWOA 2YLXA 1BKWA 4OPDA 1L9DA 3C4AA 3L8KA 1H81A 4ECHA 3ATRA 1E7PA 5C3JA 2BYBA 2GR3A 5KVHA 5BUKA 3RNMA 5HYMA 1BF3A 4YSZA 3ABVA 2C70A 3CPIG 1E1KA 2C3DA 4OPCA 4Y4MA 5C2TA 5KRQA 1FEBA 2NVKX 4J2WA 3T37A 1TDFA 2YR5A 2B9XA 2CVJA 3G5SA 1REOA 2BS3A 3NK2X 3AEAA 1VG9A 2VZ2A 2JBVA 2XVHA 4A7AA 4APNA 1XHCA 5IQ4A 2RGHA 4DSGA 3RP6A 3G5RA 3LZXA 1YQ3A 4LU6A 5EBKA 3SZCA 2YLRA 4C3YA 4WCTA 4CY6A 4TLZA 3ALMA 1HYUA 1ZKQA 4I58A 5LV9A 2OAMA 1NENA 3JSKA 3KD9A 1MOKA 1H83A 1B4VA 4U8PA 3GSIA 3P4PA 4J31A 4LA1A 2BS2A 3IHMA 3SZWA 1H86A 3CIRA 3ATQA 3QFBA 5FS6A 3K30A 2GH5A 2NPXA 4ADWA 1B37A 1LVLA 1ZP0A 3SX6A 4J36A 4AT2A 1PJ6A 1Y0PA 2Y6RA 3VR8A 3NRNA 4A99A 2X8HA 4YSYA 4J56A 4U2LA 2GR2A 3IF9A 3FMWA 1D4DA 2H88A 3SZ0A 4EM3A 1F8SA 3P4RA 5FS8A 1VDCA 3E1TA 4U8KA 3UKFA 1IUTA 1IUXA 3PVCA 2WP6A 2BRYA 2YM1A 4EQWA 4XXGA 2XLRA 4P9SA 2VRLA 2C72A 2XFQA 3DJJA 2XYOA 1ZMCA 2YG6A 2GRTA 3EF6A 2C66A 5KMRA 1QLBA 3AE4A 3ALJA 2JK6A 2OALA 3T2YA 1LQTA 3NK1X 4M52A 3UOVA 3CGDA 1X31B 4OVIA 1PBFA 2Y6QA 4NEWA 3DK8A 1GNDA 2WU5A 1K4QA 3GRTA 2A87A 2WDVA 4RG3A 3SYIA 1B5QA 2YG5A 4B69A 3BHKA 1BZLA 1CJ4A 2C76A 3FG2P 2Z5XA 2XFPA 3BI4A 1GOSA 2VQBA 2C75A 4AP3A 3AYIA 3H8IA 2A8XA 3CTYA 4H2PA 2Q7VA 1GXFA 1ZY8A 3QFAA 1E1MA 4DNAA 1BWCA 4H2QA 4FK1C 1M6IA 2I0ZA 1IJHA 1PDHA 3AB1A 3DMEA 2YG3A 3BNMA 4H4UA 2R0CA 3UTFA 4BJZA 3SM8A 4Y4NA 2OA1A 4U8NA 2C7GA 4H50A 3UTEA 3CGCA 4EIPA 4TLXA 3CPHG 1JNRA 3AXBA 1FCDA 1GT8A 1DOBA 1VQWA 3GRSA 2VRMA 2E5VA 2WETA 2WQYA 3AE5A 3ZYXA 5TR3A 5U63A 3UTGA 2CULA 2PYXA 3F8DA 2WHDA 4J33A 4NTCA 4E0VA 1ZK7A 5KWFA 1K0IA 4CNKA 1ELIA 2WOVA 4Y4LA 4NEVA 4B68A 1PBCA 4D04A 4Z25A 1E1NA 2OLNA 3AECA 4GR1A 2DKHA 4NWZA 4C3XA 5J60A 1OJ9A
chains in the Genus database with same CATH topology
1P2HA 1N1PA 4CNJA 1CBOA 4YKFA 1H7WA 3NG7X 3RP7A 4GAPA 2A89A 4U8JA 1YY5A 5GRTA 5IPYA 2TPRA 2VVLG 1RSGA 3CN8A 2VVLA 4XWZA 3EANA 2GV8A 4OPIA 3C4NA 3CMMA 1IUVA 4JQ9A 4XWRA 1PBDA 4UDPA 4CCRA 1ZX9A 2ACZA 1GEUA 2Q6UA 4J57A 1OJTA 2HQMA 3I3LA 5ER0A 2ZBWA 1DJQA 5JCKA 4GUVA 4H2NA 3NN6X 1NHQA 3I6DA 1CHUA 4USQA 3SXIA 1F3PA 3ISHA 1EL5A 2YAUA 3LXDA 4JDRA 4OCGA 3V3NA 1JU2A 4U8MA 3SGLA 4X9NA 4C5OA 4H4YA 2QA1A 2ZZBA 4YXDA 1K0LA 3CNPA 3GD4A 4CBQA 3F8PA 4K2XA 3M0OA 4USRA 3NYCA 2O9ZA 2X50A 1F6MA 1PXBA 4YTNA 3NYEA 2JAEA 3AYJA 4BV6A 2IVDA 1DOEA 2V3AA 2WU2A 4A9WA 1QJDA 3DJEA 4B65A 4ICYA 3PS9A 5KOXA 4OPUA 4U8OA 1RP0A 3DK4A 2FJEA 2XLTA 3H4KA 3UKAA 5JCNA 3D1CA 4EMWA 1KSUA 1JOAA 1Y56A 2GR1A 3P4SA 1GPEA 1JEHA 1E39A 3CGEA 2YLWA 1IUWA 4BURA 2ZZCA 1VG0A 2C67A 4J34A 4K5SA 3UOYA 3ICRA 4N9XA 1DJNA 4BK3A 2YVFA 3UTHA 1XANA 3KA7A 3NN0X 1NPXA 4H4RA 5M10A 3NNEA 3UP4A 3AE1A 4B66A 1GESA 5KOWA 1LJ1A 1XPQA 3AEDA 1D4EA 2QAEA 5KVIA 2GMHA 3DGHA 3SY4A 5KNLA 4U2SA 4H4ZA 3VR9A 1V59A 2V60A 3AYLA 3KU9A 3NGCX 1N4WA 2BCPA 2WP9A 4KX6A 2APGA 4AOXA 1OJDA 4CRTA 1ONFA 3LADA 4GDEA 1CJCA 3D8XA 4OPTA 2V6OA 1PS9A 2GR0A 1PBBA 1IUUA 1Y56B 2BS4A 1B8SA 2R46A 2V61A 2YG7A 4UP3A 3P9UA 4I59A 1RYIA 1TDOA 3AEFA 1GRGA 1D7YA 3T2KA 3UKLA 4G6GA 2BACA 4IVMB 2Z5YA 3K7QX 2JKCA 2R9ZA 2WDRA 2BRAA 5L46A 3DJGX 4EMJA 4ZCCA 2EQ6A 2RABA 3DA1A 3AE8A 3QVPA 1NG3A 2C73A 3AE6A 5U25A 1EL7A 4Z2TA 2XVEA 4WX1A 2XFOA 5FMHA 4D03A 1MO9A 3FPZA 2B7RA 2JB1A 1PHHA 1N4VA 3C96A 3Q6JA 4BK2A 1KNRA 1NHSA 1DOCA 1LPFA 3V3OA 3RP8A 3S5WA 5KXJA 2XFNA 2CFYA 1O94A 2BC0A 5KMQA 5M0ZA 2GVCA 5KMPA 3M13A 4GCMA 5BRTA 1KDGA 1BGJA 1NAAA 2JB2A 2YVJA 3CNDA 1PBEA 3GYXA 4H4XA 4YSHA 1PXCA 2C3CA 3WE0A 1GTEA 4GRTA 2VQ7A 3UP5A 1UKVG 4G73A 5BULA 3QSMA 3KLJA 2B9WA 1YQ4A 4A6NA 2R0PA 4TM3A 4ZN0A 2R45A 4JNAA 3T2ZA 4K22A 3AD9B 1NHPA 4H4SA 1EL9A 2UZZA 5FS9A 4H4WA 5GSNA 1ZMDA 1CC2A 1CC6A 2AQJA 3DK9A 5DBJA 3VQRA 2VVMA 2R4EA 5KMSA 4TM4A 1TDEA 1OJAA 2W0HA 4JN9A 4NNJA 5HXIA 4FK1A 3H8LA 4IV9A 3B6DA 3LZWA 4UDQA 4AP1A 4FX9A 1DODA 3NTAA 4TM0A 1BGNA 2E1MA 4PABA 1TRBA 2AAQA 4A79A 3HYVA 1JNZA 2WPCA 1NEKA 2IIDA 3NHOX 1DXLA 1EBDA 2YVGA 3PO7A 1KNPA 4H4TA 2BCGG 2YG4A 3UKKA 3K7TA 3SQPA 3O0HA 1AOGA 2XVIA 4LIIA 3T0KA 2GAGB 4EIQA 1KF6A 3QVRA 4G9KA 4EQSA 3NTDA 1L9EA 3ICSA 1PJ7A 4MJWA 1EL8A 3NKSA 4A6NB 1JRZA 5HY5A 1Z6LA 3NK0X 3UOZA 2FBWA 2B76A 1JRYA 3NIXA 3FBSA 1GRHA 5FS7A 5J7XA 1GREA 4B64A 1YQZA 3GDNA 4Z44A 1LV0A 1L9CA 1OJCA 1PJ5A 3BI2A 2V5ZA 2PHHA 2JB3A 4B67A 4II3A 3AE9A 3LJPA 3R9UA 4B63A 1E1LA 3AD7B 3ITJA 1H82A 2YM2A 2YR4A 2XLUA 1LQUA 2Q0KA 4JNQA 1GV4A 3G5QA 3NH3X 4UDRA 2WP5A 3AEGA 4K8DA 4NZHA 5EB5A 3ALLA 3B3RA 1D7LA 2TMDA 4H4PA 3SFEA 3KPFA 5CKUA 1F8RA 2WPEA 3BI5A 1K0JA 1IUSA 2C64A 2YWLA 2B9YA 2ZZ0A 3CNTA 4JY2A 3OZ2A 3VRAA 4K7ZA 1W4XA 2XVJA 2E4GA 4G74A 2YLZA 4IA6A 4RG4A 3URHA 2BK4A 3L1RA 4U8IA 1FOHA 1SEZA 2C65A 5IQ1A 1Q1RA 1P2EA 2FJBA 3HZLA 4YSXA 2WEUA 4FDCB 1ZOVA 4IA5A 2BXSA 4JY3A 2V3BA 3CGBA 3GDPA 1Q9IA 1FECA 4Z24A 3QJ4A 1TYTA 3HYXA 4Z26A 2GAHB 5JCLA 4H4QA 1GSNA 2R4JA 3NLCA 2RGJA 3V76A 2BK5A 5CQFA 3DJDA 3AE7A 4OPLA 4A5LA 4C77A 4U2TA 4IVOB 1GRAA 3SZFA 2XDOA 4YKGA 4GAVA 1CJ3A 1S3EA 1CJ2A 1GRFA 4GF7A 2XLPA 3GYJA 5U1OA 2OLOA 3P1WA 3FIMB 1NG4A 4OPGA 4DGKA 3S61A 3QSSA 4G6HA 3AEBA 3UKQA 2XVFA 4YTPA 1GRBA 2CDUA 1Q1WA 2R0GA 4B1BA 3IWAA 4EQXA 3RHAA 4H7UA 2WPFA 2B7SA 4H4VA 1QO8A 4ZCDA 1TDKA 1H6VA 3HYWA 2GQFA 3CNJA 3T14A 2XFUA 3AEEA 2YQUA 3IC9A 2GQWA 1FEAA 3ICTA 1GTHA 3OC4A 4HA6A 1MXTA 1GALA 3UKHA 4EQRA 3UOXA 1F8WA 3IHGA 2BA9A 3GWFA 5BVAA 3SFDA 1E6EA 4Z2UA 1JRXA 3KVEA 3KPKA 1TYPA 2IVEA 4Z43A 3AD8B 3CPJG 2X99A 1PXAA 3QSEA 3LOVA 1TDNA 2AR8A 2GF3A 3GMCA 4KPRA 2H89A 1KFYA 1D5TA 1H7XA 1CC4A 4K5RA 4X4JA 4AT0A 1GRTA 1CL0A 3GYIA 3UKPA 4HB9A 2EQ8A 2EQ7A 3VRDB 3VRBA 4CCQA 1PN0A 3ADAB 2BK3A 1COYA 2BXRA 1L0VA 1S2QA 3EAOA 2EQ9A 4BK1A 2RGOA 3BHFA 3GMBA 4O5QA 5EOWA 4YTMA 2YLSA 1FL2A 2WESA 5HHFA 3UCLA 2GMJA 4EM4A 1ZOYA 2F5ZA 3K7MX 1GETA 2FJAA 5JCMA 2YLTA 2BC1A 3NT6A 1CF3A 5EB4A 2ARDA 2X8GA 3KKJA 4Z2RA 2XCGA 2DKIA 3REDA 3DH9A 1N4UA 3GD3A 4TM1A 2Q0LA 2WOIA 2FJDA 4AOSA 1NHRA 3ZDNA 3AE3A 3NYFA 2GB0A 1GERA 2BABA 1LTXR 1NDAA 1O5WA 2X8CA 4REKA 4C74A 2X3NA 2WDQA 3F8RA 4PAAA 3GWDA 2QA2A 1VRQB 4NTDA 1M64A 3AWIA 1ZDLA 1XDIA 3COXA 4NTEA 2C4CA 2WS3A 1YKJA 3T31A 2VOUA 1S2YA 2GEWA 3LB8A 3P4QA 3Q9TA 4A65A 4CY8A 4RSLA 3BNUA 3II4A 2XLSA 3AE2A 3EPTA 1D4CA 2QCUA 4O5UA 2YR6A 4II2A 1DNCA 4EMIA 4YT0A 3CNSA 4DSHA 3DGZA 4X9MA 2WBAA 4U8LA 1H84A 2WOWA 3M12A 4GDPA 4H2RA 2J3NA 4BJYA 5JCIA 1KSSA 1S3BA 1O95A 4YWOA 2YLXA 1BKWA 4OPDA 1L9DA 3C4AA 3L8KA 1H81A 4ECHA 3ATRA 1E7PA 5C3JA 2BYBA 2GR3A 5KVHA 5BUKA 3RNMA 5HYMA 1BF3A 4YSZA 3ABVA 2C70A 3CPIG 1E1KA 2C3DA 4OPCA 4Y4MA 5C2TA 5KRQA 1FEBA 2NVKX 4J2WA 3T37A 1TDFA 2YR5A 2B9XA 2CVJA 3G5SA 1REOA 2BS3A 3NK2X 3AEAA 1VG9A 2VZ2A 2JBVA 2XVHA 4A7AA 4APNA 1XHCA 5IQ4A 2RGHA 4DSGA 3RP6A 3G5RA 3LZXA 1YQ3A 4LU6A 5EBKA 3SZCA 2YLRA 4C3YA 4WCTA 4CY6A 4TLZA 3ALMA 1HYUA 1ZKQA 4I58A 5LV9A 2OAMA 1NENA 3JSKA 3KD9A 1MOKA 1H83A 1B4VA 4U8PA 3GSIA 3P4PA 4J31A 4LA1A 2BS2A 3IHMA 3SZWA 1H86A 3CIRA 3ATQA 3QFBA 5FS6A 3K30A 2GH5A 2NPXA 4ADWA 1B37A 1LVLA 1ZP0A 3SX6A 4J36A 4AT2A 1PJ6A 1Y0PA 2Y6RA 3VR8A 3NRNA 4A99A 2X8HA 4YSYA 4J56A 4U2LA 2GR2A 3IF9A 3FMWA 1D4DA 2H88A 3SZ0A 4EM3A 1F8SA 3P4RA 5FS8A 1VDCA 3E1TA 4U8KA 3UKFA 1IUTA 1IUXA 3PVCA 2WP6A 2BRYA 2YM1A 4EQWA 4XXGA 2XLRA 4P9SA 2VRLA 2C72A 2XFQA 3DJJA 2XYOA 1ZMCA 2YG6A 2GRTA 3EF6A 2C66A 5KMRA 1QLBA 3AE4A 3ALJA 2JK6A 2OALA 3T2YA 1LQTA 3NK1X 4M52A 3UOVA 3CGDA 1X31B 4OVIA 1PBFA 2Y6QA 4NEWA 3DK8A 1GNDA 2WU5A 1K4QA 3GRTA 2A87A 2WDVA 4RG3A 3SYIA 1B5QA 2YG5A 4B69A 3BHKA 1BZLA 1CJ4A 2C76A 3FG2P 2Z5XA 2XFPA 3BI4A 1GOSA 2VQBA 2C75A 4AP3A 3AYIA 3H8IA 2A8XA 3CTYA 4H2PA 2Q7VA 1GXFA 1ZY8A 3QFAA 1E1MA 4DNAA 1BWCA 4H2QA 4FK1C 1M6IA 2I0ZA 1IJHA 1PDHA 3AB1A 3DMEA 2YG3A 3BNMA 4H4UA 2R0CA 3UTFA 4BJZA 3SM8A 4Y4NA 2OA1A 4U8NA 2C7GA 4H50A 3UTEA 3CGCA 4EIPA 4TLXA 3CPHG 1JNRA 3AXBA 1FCDA 1GT8A 1DOBA 1VQWA 3GRSA 2VRMA 2E5VA 2WETA 2WQYA 3AE5A 3ZYXA 5TR3A 5U63A 3UTGA 2CULA 2PYXA 3F8DA 2WHDA 4J33A 4NTCA 4E0VA 1ZK7A 5KWFA 1K0IA 4CNKA 1ELIA 2WOVA 4Y4LA 4NEVA 4B68A 1PBCA 4D04A 4Z25A 1E1NA 2OLNA 3AECA 4GR1A 2DKHA 4NWZA 4C3XA 5J60A 1OJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P2H A;  1N1P A;  4CNJ A;  1CBO A;  4YKF A;  1H7W A;  3NG7 X;  3RP7 A;  2A89 A;  4U8J A;  1YY5 A;  5GRT A;  5IPY A;  2TPR A;  2VVL G;  1RSG A;  3CN8 A;  2VVL A;  4XWZ A;  3EAN A;  2GV8 A;  4OPI A;  3C4N A;  4JQ9 A;  1IUV A;  4XWR A;  1PBD A;  4UDP A;  4CCR A;  1ZX9 A;  2ACZ A;  1GEU A;  2Q6U A;  4J57 A;  1OJT A;  2HQM A;  3I3L A;  5ER0 A;  2ZBW A;  1DJQ A;  5JCK A;  4GUV A;  4H2N A;  3NN6 X;  1NHQ A;  3I6D A;  1CHU A;  4USQ A;  1F3P A;  3ISH A;  1EL5 A;  2YAU A;  3LXD A;  4JDR A;  4OCG A;  3V3N A;  1JU2 A;  4U8M A;  3SGL A;  4X9N A;  4C5O A;  4H4Y A;  2QA1 A;  2ZZB A;  4YXD A;  1K0L A;  3CNP A;  3GD4 A;  4CBQ A;  3F8P A;  4K2X A;  3M0O A;  4USR A;  3NYC A;  2O9Z A;  2X50 A;  1F6M A;  1PXB A;  4YTN A;  3NYE A;  2JAE A;  3AYJ A;  4BV6 A;  2IVD A;  1DOE A;  2V3A A;  2WU2 A;  4A9W A;  1QJD A;  3DJE A;  4B65 A;  4ICY A;  3PS9 A;  5KOX A;  4OPU A;  4U8O A;  1RP0 A;  3DK4 A;  2FJE A;  2XLT A;  3H4K A;  3UKA A;  5JCN A;  3D1C A;  4EMW A;  1KSU A;  1JOA A;  1Y56 A;  2GR1 A;  3P4S A;  1GPE A;  1JEH A;  1E39 A;  3CGE A;  2YLW A;  1IUW A;  4BUR A;  2ZZC A;  1VG0 A;  2C67 A;  4J34 A;  4K5S A;  3UOY A;  3ICR A;  4N9X A;  1DJN A;  4BK3 A;  2YVF A;  3UTH A;  1XAN A;  3KA7 A;  3NN0 X;  1NPX A;  4H4R A;  5M10 A;  3NNE A;  3UP4 A;  3AE1 A;  4B66 A;  1GES A;  5KOW A;  1LJ1 A;  1XPQ A;  3AED A;  1D4E A;  2QAE A;  5KVI A;  2GMH A;  3DGH A;  4U2S A;  4H4Z A;  3VR9 A;  1V59 A;  2V60 A;  3AYL A;  3KU9 A;  3NGC X;  1N4W A;  2BCP A;  2WP9 A;  4KX6 A;  2APG A;  4AOX A;  1OJD A;  4CRT A;  1ONF A;  3LAD A;  4GDE A;  1CJC A;  3D8X A;  4OPT A;  2V6O A;  1PS9 A;  2GR0 A;  1PBB A;  1IUU A;  1Y56 B;  2BS4 A;  1B8S A;  2R46 A;  2V61 A;  2YG7 A;  4UP3 A;  3P9U A;  4I59 A;  1RYI A;  1TDO A;  3AEF A;  1GRG A;  1D7Y A;  3UKL A;  2BAC A;  4IVM B;  2Z5Y A;  3K7Q X;  2JKC A;  2R9Z A;  2WDR A;  5L46 A;  3DJG X;  4EMJ A;  4ZCC A;  2EQ6 A;  2RAB A;  3DA1 A;  3AE8 A;  3QVP A;  1NG3 A;  2C73 A;  3AE6 A;  5U25 A;  1EL7 A;  4Z2T A;  2XVE A;  4WX1 A;  2XFO A;  5FMH A;  4D03 A;  1MO9 A;  3FPZ A;  2B7R A;  2JB1 A;  1PHH A;  1N4V A;  3C96 A;  3Q6J A;  4BK2 A;  1KNR A;  1NHS A;  1DOC A;  1LPF A;  3V3O A;  3RP8 A;  3S5W A;  5KXJ A;  2XFN A;  2CFY A;  1O94 A;  2BC0 A;  5M0Z A;  2GVC A;  3M13 A;  4GCM A;  5BRT A;  1KDG A;  1BGJ A;  1NAA A;  2JB2 A;  2YVJ A;  3CND A;  1PBE A;  4H4X A;  4YSH A;  1PXC A;  2C3C A;  3WE0 A;  1GTE A;  4GRT A;  2VQ7 A;  3UP5 A;  1UKV G;  5BUL A;  3QSM A;  3KLJ A;  2B9W A;  1YQ4 A;  4A6N A;  2R0P A;  4TM3 A;  4ZN0 A;  2R45 A;  4JNA A;  4K22 A;  3AD9 B;  1NHP A;  4H4S A;  1EL9 A;  2UZZ A;  5FS9 A;  4H4W A;  5GSN A;  1ZMD A;  1CC2 A;  1CC6 A;  2AQJ A;  3DK9 A;  5DBJ A;  3VQR A;  2VVM A;  2R4E A;  4TM4 A;  1TDE A;  1OJA A;  2W0H A;  4JN9 A;  5HXI A;  4FK1 A;  3H8L A;  4IV9 A;  3B6D A;  3LZW A;  4UDQ A;  4AP1 A;  4FX9 A;  1DOD A;  3NTA A;  4TM0 A;  1BGN A;  2E1M A;  4PAB A;  1TRB A;  2AAQ A;  4A79 A;  1JNZ A;  2WPC A;  1NEK A;  2IID A;  3NHO X;  1DXL A;  1EBD A;  2YVG A;  3PO7 A;  1KNP A;  4H4T A;  2BCG G;  2YG4 A;  3UKK A;  3K7T A;  3SQP A;  3O0H A;  1AOG A;  2XVI A;  4LII A;  2GAG B;  4EIQ A;  1KF6 A;  3QVR A;  4EQS A;  3NTD A;  1L9E A;  3ICS A;  1PJ7 A;  4MJW A;  1EL8 A;  3NKS A;  4A6N B;  1JRZ A;  5HY5 A;  1Z6L A;  3NK0 X;  3UOZ A;  2FBW A;  2B76 A;  1JRY A;  3NIX A;  3FBS A;  1GRH A;  5FS7 A;  5J7X A;  1GRE A;  4B64 A;  1YQZ A;  3GDN A;  4Z44 A;  1LV0 A;  1L9C A;  1OJC A;  1PJ5 A;  3BI2 A;  2V5Z A;  2PHH A;  2JB3 A;  4B67 A;  3AE9 A;  3LJP A;  3R9U A;  4B63 A;  1E1L A;  3AD7 B;  3ITJ A;  1H82 A;  2YM2 A;  2YR4 A;  2XLU A;  1LQU A;  2Q0K A;  4JNQ A;  1GV4 A;  3G5Q A;  3NH3 X;  4UDR A;  2WP5 A;  3AEG A;  4K8D A;  4NZH A;  5EB5 A;  3ALL A;  3B3R A;  1D7L A;  2TMD A;  4H4P A;  3SFE A;  3KPF A;  5CKU A;  1F8R A;  2WPE A;  3BI5 A;  1K0J A;  1IUS A;  2C64 A;  2YWL A;  2B9Y A;  2ZZ0 A;  3CNT A;  4JY2 A;  3OZ2 A;  3VRA A;  4K7Z A;  1W4X A;  2XVJ A;  2E4G A;  2YLZ A;  4IA6 A;  4RG4 A;  3URH A;  2BK4 A;  3L1R A;  4U8I A;  1FOH A;  1SEZ A;  2C65 A;  5IQ1 A;  1Q1R A;  1P2E A;  2FJB A;  3HZL A;  4YSX A;  2WEU A;  4FDC B;  1ZOV A;  4IA5 A;  2BXS A;  4JY3 A;  2V3B A;  3CGB A;  3GDP A;  1Q9I A;  1FEC A;  4Z24 A;  3QJ4 A;  1TYT A;  4Z26 A;  2GAH B;  5JCL A;  4H4Q A;  1GSN A;  2R4J A;  3NLC A;  2RGJ A;  3V76 A;  2BK5 A;  5CQF A;  3DJD A;  3AE7 A;  4OPL A;  4A5L A;  4C77 A;  4U2T A;  4IVO B;  1GRA A;  2XDO A;  4YKG A;  1CJ3 A;  1S3E A;  1CJ2 A;  1GRF A;  4GF7 A;  2XLP A;  3GYJ A;  5U1O A;  2OLO A;  3P1W A;  3FIM B;  1NG4 A;  4OPG A;  4DGK A;  3S61 A;  3QSS A;  4YTP A;  3AEB A;  3UKQ A;  2XVF A;  1GRB A;  2CDU A;  1Q1W A;  2R0G A;  4B1B A;  3IWA A;  4EQX A;  3RHA A;  4H7U A;  2WPF A;  2B7S A;  4H4V A;  1QO8 A;  4ZCD A;  1TDK A;  1H6V A;  2GQF A;  3CNJ A;  2XFU A;  3AEE A;  2YQU A;  3IC9 A;  2GQW A;  1FEA A;  3ICT A;  1GTH A;  3OC4 A;  4HA6 A;  1MXT A;  1GAL A;  3UKH A;  4EQR A;  3UOX A;  1F8W A;  3IHG A;  2BA9 A;  3GWF A;  5BVA A;  3SFD A;  1E6E A;  4Z2U A;  1JRX A;  3KVE A;  1TYP A;  2IVE A;  4Z43 A;  3AD8 B;  3CPJ G;  2X99 A;  1PXA A;  3QSE A;  3LOV A;  1TDN A;  2AR8 A;  2GF3 A;  3GMC A;  4KPR A;  2H89 A;  1KFY A;  1D5T A;  1H7X A;  1CC4 A;  4K5R A;  4X4J A;  4AT0 A;  1GRT A;  1CL0 A;  3GYI A;  3UKP A;  4HB9 A;  2EQ8 A;  2EQ7 A;  3VRD B;  3VRB A;  4CCQ A;  1PN0 A;  3ADA B;  2BK3 A;  1COY A;  2BXR A;  1L0V A;  1S2Q A;  3EAO A;  2EQ9 A;  4BK1 A;  2RGO A;  3BHF A;  3GMB A;  4O5Q A;  5EOW A;  4YTM A;  2YLS A;  1FL2 A;  2WES A;  5HHF A;  3UCL A;  2GMJ A;  4EM4 A;  1ZOY A;  2F5Z A;  3K7M X;  1GET A;  2FJA A;  5JCM A;  2YLT A;  2BC1 A;  3NT6 A;  1CF3 A;  5EB4 A;  2ARD A;  2X8G A;  3KKJ A;  4Z2R A;  2XCG A;  2DKI A;  3RED A;  3DH9 A;  1N4U A;  3GD3 A;  4TM1 A;  2Q0L A;  2WOI A;  2FJD A;  4AOS A;  1NHR A;  3ZDN A;  3AE3 A;  3NYF A;  2GB0 A;  1GER A;  2BAB A;  1LTX R;  1NDA A;  1O5W A;  2X8C A;  4REK A;  4C74 A;  2X3N A;  2WDQ A;  3F8R A;  4PAA A;  3GWD A;  2QA2 A;  1VRQ B;  4NTD A;  1M64 A;  3AWI A;  1ZDL A;  1XDI A;  3COX A;  4NTE A;  2WS3 A;  1YKJ A;  2VOU A;  1S2Y A;  2GEW A;  3LB8 A;  3P4Q A;  3Q9T A;  4A65 A;  4CY8 A;  4RSL A;  3BNU A;  3II4 A;  2XLS A;  3AE2 A;  3EPT A;  1D4C A;  2QCU A;  4O5U A;  2YR6 A;  4YT0 A;  1DNC A;  4EMI A;  3CNS A;  4DSH A;  3DGZ A;  4X9M A;  2WBA A;  4U8L A;  1H84 A;  2WOW A;  3M12 A;  4GDP A;  4H2R A;  2J3N A;  4BJY A;  5JCI A;  1KSS A;  1S3B A;  1O95 A;  4YWO A;  2YLX A;  1BKW A;  4OPD A;  1L9D A;  3C4A A;  3L8K A;  1H81 A;  4ECH A;  3ATR A;  1E7P A;  5C3J A;  2BYB A;  2GR3 A;  5KVH A;  5BUK A;  3RNM A;  5HYM A;  1BF3 A;  4YSZ A;  3ABV A;  2C70 A;  3CPI G;  1E1K A;  2C3D A;  4OPC A;  4Y4M A;  5C2T A;  5KRQ A;  1FEB A;  2NVK X;  4J2W A;  3T37 A;  1TDF A;  2YR5 A;  2B9X A;  2CVJ A;  3G5S A;  1REO A;  2BS3 A;  3NK2 X;  3AEA A;  1VG9 A;  2VZ2 A;  2JBV A;  2XVH A;  4A7A A;  4APN A;  1XHC A;  5IQ4 A;  2RGH A;  4DSG A;  3RP6 A;  3G5R A;  3LZX A;  1YQ3 A;  4LU6 A;  5EBK A;  2YLR A;  4C3Y A;  4WCT A;  4CY6 A;  4TLZ A;  3ALM A;  1HYU A;  1ZKQ A;  4I58 A;  5LV9 A;  2OAM A;  1NEN A;  3JSK A;  3KD9 A;  1MOK A;  1H83 A;  1B4V A;  4U8P A;  3GSI A;  3P4P A;  4J31 A;  4LA1 A;  2BS2 A;  3IHM A;  1H86 A;  3CIR A;  3ATQ A;  3QFB A;  5FS6 A;  3K30 A;  2GH5 A;  2NPX A;  4ADW A;  1B37 A;  1LVL A;  1ZP0 A;  4J36 A;  4AT2 A;  1PJ6 A;  1Y0P A;  2Y6R A;  3VR8 A;  3NRN A;  4A99 A;  2X8H A;  4YSY A;  4J56 A;  4U2L A;  2GR2 A;  3IF9 A;  3FMW A;  1D4D A;  2H88 A;  4EM3 A;  1F8S A;  3P4R A;  5FS8 A;  1VDC A;  3E1T A;  4U8K A;  3UKF A;  1IUT A;  1IUX A;  3PVC A;  2WP6 A;  2YM1 A;  4EQW A;  4XXG A;  2XLR A;  4P9S A;  2VRL A;  2C72 A;  2XFQ A;  3DJJ A;  2XYO A;  1ZMC A;  2YG6 A;  2GRT A;  3EF6 A;  2C66 A;  1QLB A;  3AE4 A;  3ALJ A;  2JK6 A;  2OAL A;  3UOV A;  1LQT A;  3NK1 X;  4M52 A;  3CGD A;  1X31 B;  4OVI A;  1PBF A;  2Y6Q A;  4NEW A;  3DK8 A;  1GND A;  2WU5 A;  1K4Q A;  3GRT A;  2A87 A;  2WDV A;  4RG3 A;  1B5Q A;  2YG5 A;  4B69 A;  3BHK A;  1BZL A;  1CJ4 A;  2C76 A;  3FG2 P;  2Z5X A;  2XFP A;  3BI4 A;  1GOS A;  2VQB A;  2C75 A;  4AP3 A;  3AYI A;  3H8I A;  2A8X A;  3CTY A;  4H2P A;  2Q7V A;  1GXF A;  1ZY8 A;  3QFA A;  1E1M A;  4DNA A;  1BWC A;  4H2Q A;  4FK1 C;  1M6I A;  2I0Z A;  1IJH A;  1PDH A;  3AB1 A;  3DME A;  2YG3 A;  3BNM A;  4H4U A;  2R0C A;  3UTF A;  4BJZ A;  3SM8 A;  4Y4N A;  2OA1 A;  4U8N A;  2C7G A;  4H50 A;  3UTE A;  3CGC A;  4EIP A;  4TLX A;  3CPH G;  1JNR A;  3AXB A;  1FCD A;  1GT8 A;  1DOB A;  1VQW A;  3GRS A;  2VRM A;  2E5V A;  2WET A;  2WQY A;  3AE5 A;  3ZYX A;  5TR3 A;  5U63 A;  3UTG A;  2CUL A;  2PYX A;  3F8D A;  2WHD A;  4J33 A;  4NTC A;  4E0V A;  1ZK7 A;  5KWF A;  1K0I A;  4CNK A;  1ELI A;  2WOV A;  4Y4L A;  4NEV A;  4B68 A;  1PBC A;  4D04 A;  4Z25 A;  1E1N A;  2OLN A;  3AEC A;  4GR1 A;  2DKH A;  5J60 A;  4C3X A;  1OJ9 A; 
#chains in the Genus database with same CATH topology
 1P2H A;  1N1P A;  4CNJ A;  1CBO A;  4YKF A;  1H7W A;  3NG7 X;  3RP7 A;  4GAP A;  2A89 A;  4U8J A;  1YY5 A;  5GRT A;  5IPY A;  2TPR A;  2VVL G;  1RSG A;  3CN8 A;  2VVL A;  4XWZ A;  3EAN A;  2GV8 A;  4OPI A;  3C4N A;  3CMM A;  1IUV A;  4JQ9 A;  4XWR A;  1PBD A;  4UDP A;  4CCR A;  1ZX9 A;  2ACZ A;  1GEU A;  2Q6U A;  4J57 A;  1OJT A;  2HQM A;  3I3L A;  5ER0 A;  2ZBW A;  1DJQ A;  5JCK A;  4GUV A;  4H2N A;  3NN6 X;  1NHQ A;  3I6D A;  1CHU A;  4USQ A;  3SXI A;  1F3P A;  3ISH A;  1EL5 A;  2YAU A;  3LXD A;  4JDR A;  4OCG A;  3V3N A;  1JU2 A;  4U8M A;  3SGL A;  4X9N A;  4C5O A;  4H4Y A;  2QA1 A;  2ZZB A;  4YXD A;  1K0L A;  3CNP A;  3GD4 A;  4CBQ A;  3F8P A;  4K2X A;  3M0O A;  4USR A;  3NYC A;  2O9Z A;  2X50 A;  1F6M A;  1PXB A;  4YTN A;  3NYE A;  2JAE A;  3AYJ A;  4BV6 A;  2IVD A;  1DOE A;  2V3A A;  2WU2 A;  4A9W A;  1QJD A;  3DJE A;  4B65 A;  4ICY A;  3PS9 A;  5KOX A;  4OPU A;  4U8O A;  1RP0 A;  3DK4 A;  2FJE A;  2XLT A;  3H4K A;  3UKA A;  5JCN A;  3D1C A;  4EMW A;  1KSU A;  1JOA A;  1Y56 A;  2GR1 A;  3P4S A;  1GPE A;  1JEH A;  1E39 A;  3CGE A;  2YLW A;  1IUW A;  4BUR A;  2ZZC A;  1VG0 A;  2C67 A;  4J34 A;  4K5S A;  3UOY A;  3ICR A;  4N9X A;  1DJN A;  4BK3 A;  2YVF A;  3UTH A;  1XAN A;  3KA7 A;  3NN0 X;  1NPX A;  4H4R A;  5M10 A;  3NNE A;  3UP4 A;  3AE1 A;  4B66 A;  1GES A;  5KOW A;  1LJ1 A;  1XPQ A;  3AED A;  1D4E A;  2QAE A;  5KVI A;  2GMH A;  3DGH A;  3SY4 A;  5KNL A;  4U2S A;  4H4Z A;  3VR9 A;  1V59 A;  2V60 A;  3AYL A;  3KU9 A;  3NGC X;  1N4W A;  2BCP A;  2WP9 A;  4KX6 A;  2APG A;  4AOX A;  1OJD A;  4CRT A;  1ONF A;  3LAD A;  4GDE A;  1CJC A;  3D8X A;  4OPT A;  2V6O A;  1PS9 A;  2GR0 A;  1PBB A;  1IUU A;  1Y56 B;  2BS4 A;  1B8S A;  2R46 A;  2V61 A;  2YG7 A;  4UP3 A;  3P9U A;  4I59 A;  1RYI A;  1TDO A;  3AEF A;  1GRG A;  1D7Y A;  3T2K A;  3UKL A;  4G6G A;  2BAC A;  4IVM B;  2Z5Y A;  3K7Q X;  2JKC A;  2R9Z A;  2WDR A;  2BRA A;  5L46 A;  3DJG X;  4EMJ A;  4ZCC A;  2EQ6 A;  2RAB A;  3DA1 A;  3AE8 A;  3QVP A;  1NG3 A;  2C73 A;  3AE6 A;  5U25 A;  1EL7 A;  4Z2T A;  2XVE A;  4WX1 A;  2XFO A;  5FMH A;  4D03 A;  1MO9 A;  3FPZ A;  2B7R A;  2JB1 A;  1PHH A;  1N4V A;  3C96 A;  3Q6J A;  4BK2 A;  1KNR A;  1NHS A;  1DOC A;  1LPF A;  3V3O A;  3RP8 A;  3S5W A;  5KXJ A;  2XFN A;  2CFY A;  1O94 A;  2BC0 A;  5KMQ A;  5M0Z A;  2GVC A;  5KMP A;  3M13 A;  4GCM A;  5BRT A;  1KDG A;  1BGJ A;  1NAA A;  2JB2 A;  2YVJ A;  3CND A;  1PBE A;  3GYX A;  4H4X A;  4YSH A;  1PXC A;  2C3C A;  3WE0 A;  1GTE A;  4GRT A;  2VQ7 A;  3UP5 A;  1UKV G;  4G73 A;  5BUL A;  3QSM A;  3KLJ A;  2B9W A;  1YQ4 A;  4A6N A;  2R0P A;  4TM3 A;  4ZN0 A;  2R45 A;  4JNA A;  3T2Z A;  4K22 A;  3AD9 B;  1NHP A;  4H4S A;  1EL9 A;  2UZZ A;  5FS9 A;  4H4W A;  5GSN A;  1ZMD A;  1CC2 A;  1CC6 A;  2AQJ A;  3DK9 A;  5DBJ A;  3VQR A;  2VVM A;  2R4E A;  5KMS A;  4TM4 A;  1TDE A;  1OJA A;  2W0H A;  4JN9 A;  4NNJ A;  5HXI A;  4FK1 A;  3H8L A;  4IV9 A;  3B6D A;  3LZW A;  4UDQ A;  4AP1 A;  4FX9 A;  1DOD A;  3NTA A;  4TM0 A;  1BGN A;  2E1M A;  4PAB A;  1TRB A;  2AAQ A;  4A79 A;  3HYV A;  1JNZ A;  2WPC A;  1NEK A;  2IID A;  3NHO X;  1DXL A;  1EBD A;  2YVG A;  3PO7 A;  1KNP A;  4H4T A;  2BCG G;  2YG4 A;  3UKK A;  3K7T A;  3SQP A;  3O0H A;  1AOG A;  2XVI A;  4LII A;  3T0K A;  2GAG B;  4EIQ A;  1KF6 A;  3QVR A;  4G9K A;  4EQS A;  3NTD A;  1L9E A;  3ICS A;  1PJ7 A;  4MJW A;  1EL8 A;  3NKS A;  4A6N B;  1JRZ A;  5HY5 A;  1Z6L A;  3NK0 X;  3UOZ A;  2FBW A;  2B76 A;  1JRY A;  3NIX A;  3FBS A;  1GRH A;  5FS7 A;  5J7X A;  1GRE A;  4B64 A;  1YQZ A;  3GDN A;  4Z44 A;  1LV0 A;  1L9C A;  1OJC A;  1PJ5 A;  3BI2 A;  2V5Z A;  2PHH A;  2JB3 A;  4B67 A;  4II3 A;  3AE9 A;  3LJP A;  3R9U A;  4B63 A;  1E1L A;  3AD7 B;  3ITJ A;  1H82 A;  2YM2 A;  2YR4 A;  2XLU A;  1LQU A;  2Q0K A;  4JNQ A;  1GV4 A;  3G5Q A;  3NH3 X;  4UDR A;  2WP5 A;  3AEG A;  4K8D A;  4NZH A;  5EB5 A;  3ALL A;  3B3R A;  1D7L A;  2TMD A;  4H4P A;  3SFE A;  3KPF A;  5CKU A;  1F8R A;  2WPE A;  3BI5 A;  1K0J A;  1IUS A;  2C64 A;  2YWL A;  2B9Y A;  2ZZ0 A;  3CNT A;  4JY2 A;  3OZ2 A;  3VRA A;  4K7Z A;  1W4X A;  2XVJ A;  2E4G A;  4G74 A;  2YLZ A;  4IA6 A;  4RG4 A;  3URH A;  2BK4 A;  3L1R A;  4U8I A;  1FOH A;  1SEZ A;  2C65 A;  5IQ1 A;  1Q1R A;  1P2E A;  2FJB A;  3HZL A;  4YSX A;  2WEU A;  4FDC B;  1ZOV A;  4IA5 A;  2BXS A;  4JY3 A;  2V3B A;  3CGB A;  3GDP A;  1Q9I A;  1FEC A;  4Z24 A;  3QJ4 A;  1TYT A;  3HYX A;  4Z26 A;  2GAH B;  5JCL A;  4H4Q A;  1GSN A;  2R4J A;  3NLC A;  2RGJ A;  3V76 A;  2BK5 A;  5CQF A;  3DJD A;  3AE7 A;  4OPL A;  4A5L A;  4C77 A;  4U2T A;  4IVO B;  1GRA A;  3SZF A;  2XDO A;  4YKG A;  4GAV A;  1CJ3 A;  1S3E A;  1CJ2 A;  1GRF A;  4GF7 A;  2XLP A;  3GYJ A;  5U1O A;  2OLO A;  3P1W A;  3FIM B;  1NG4 A;  4OPG A;  4DGK A;  3S61 A;  3QSS A;  4G6H A;  3AEB A;  3UKQ A;  2XVF A;  4YTP A;  1GRB A;  2CDU A;  1Q1W A;  2R0G A;  4B1B A;  3IWA A;  4EQX A;  3RHA A;  4H7U A;  2WPF A;  2B7S A;  4H4V A;  1QO8 A;  4ZCD A;  1TDK A;  1H6V A;  3HYW A;  2GQF A;  3CNJ A;  3T14 A;  2XFU A;  3AEE A;  2YQU A;  3IC9 A;  2GQW A;  1FEA A;  3ICT A;  1GTH A;  3OC4 A;  4HA6 A;  1MXT A;  1GAL A;  3UKH A;  4EQR A;  3UOX A;  1F8W A;  3IHG A;  2BA9 A;  3GWF A;  5BVA A;  3SFD A;  1E6E A;  4Z2U A;  1JRX A;  3KVE A;  3KPK A;  1TYP A;  2IVE A;  4Z43 A;  3AD8 B;  3CPJ G;  2X99 A;  1PXA A;  3QSE A;  3LOV A;  1TDN A;  2AR8 A;  2GF3 A;  3GMC A;  4KPR A;  2H89 A;  1KFY A;  1D5T A;  1H7X A;  1CC4 A;  4K5R A;  4X4J A;  4AT0 A;  1GRT A;  1CL0 A;  3GYI A;  3UKP A;  4HB9 A;  2EQ8 A;  2EQ7 A;  3VRD B;  3VRB A;  4CCQ A;  1PN0 A;  3ADA B;  2BK3 A;  1COY A;  2BXR A;  1L0V A;  1S2Q A;  3EAO A;  2EQ9 A;  4BK1 A;  2RGO A;  3BHF A;  3GMB A;  4O5Q A;  5EOW A;  4YTM A;  2YLS A;  1FL2 A;  2WES A;  5HHF A;  3UCL A;  2GMJ A;  4EM4 A;  1ZOY A;  2F5Z A;  3K7M X;  1GET A;  2FJA A;  5JCM A;  2YLT A;  2BC1 A;  3NT6 A;  1CF3 A;  5EB4 A;  2ARD A;  2X8G A;  3KKJ A;  4Z2R A;  2XCG A;  2DKI A;  3RED A;  3DH9 A;  1N4U A;  3GD3 A;  4TM1 A;  2Q0L A;  2WOI A;  2FJD A;  4AOS A;  1NHR A;  3ZDN A;  3AE3 A;  3NYF A;  2GB0 A;  1GER A;  2BAB A;  1LTX R;  1NDA A;  1O5W A;  2X8C A;  4REK A;  4C74 A;  2X3N A;  2WDQ A;  3F8R A;  4PAA A;  3GWD A;  2QA2 A;  1VRQ B;  4NTD A;  1M64 A;  3AWI A;  1ZDL A;  1XDI A;  3COX A;  4NTE A;  2C4C A;  2WS3 A;  1YKJ A;  3T31 A;  2VOU A;  1S2Y A;  2GEW A;  3LB8 A;  3P4Q A;  3Q9T A;  4A65 A;  4CY8 A;  4RSL A;  3BNU A;  3II4 A;  2XLS A;  3AE2 A;  3EPT A;  1D4C A;  2QCU A;  4O5U A;  2YR6 A;  4II2 A;  1DNC A;  4EMI A;  4YT0 A;  3CNS A;  4DSH A;  3DGZ A;  4X9M A;  2WBA A;  4U8L A;  1H84 A;  2WOW A;  3M12 A;  4GDP A;  4H2R A;  2J3N A;  4BJY A;  5JCI A;  1KSS A;  1S3B A;  1O95 A;  4YWO A;  2YLX A;  1BKW A;  4OPD A;  1L9D A;  3C4A A;  3L8K A;  1H81 A;  4ECH A;  3ATR A;  1E7P A;  5C3J A;  2BYB A;  2GR3 A;  5KVH A;  5BUK A;  3RNM A;  5HYM A;  1BF3 A;  4YSZ A;  3ABV A;  2C70 A;  3CPI G;  1E1K A;  2C3D A;  4OPC A;  4Y4M A;  5C2T A;  5KRQ A;  1FEB A;  2NVK X;  4J2W A;  3T37 A;  1TDF A;  2YR5 A;  2B9X A;  2CVJ A;  3G5S A;  1REO A;  2BS3 A;  3NK2 X;  3AEA A;  1VG9 A;  2VZ2 A;  2JBV A;  2XVH A;  4A7A A;  4APN A;  1XHC A;  5IQ4 A;  2RGH A;  4DSG A;  3RP6 A;  3G5R A;  3LZX A;  1YQ3 A;  4LU6 A;  5EBK A;  3SZC A;  2YLR A;  4C3Y A;  4WCT A;  4CY6 A;  4TLZ A;  3ALM A;  1HYU A;  1ZKQ A;  4I58 A;  5LV9 A;  2OAM A;  1NEN A;  3JSK A;  3KD9 A;  1MOK A;  1H83 A;  1B4V A;  4U8P A;  3GSI A;  3P4P A;  4J31 A;  4LA1 A;  2BS2 A;  3IHM A;  3SZW A;  1H86 A;  3CIR A;  3ATQ A;  3QFB A;  5FS6 A;  3K30 A;  2GH5 A;  2NPX A;  4ADW A;  1B37 A;  1LVL A;  1ZP0 A;  3SX6 A;  4J36 A;  4AT2 A;  1PJ6 A;  1Y0P A;  2Y6R A;  3VR8 A;  3NRN A;  4A99 A;  2X8H A;  4YSY A;  4J56 A;  4U2L A;  2GR2 A;  3IF9 A;  3FMW A;  1D4D A;  2H88 A;  3SZ0 A;  4EM3 A;  1F8S A;  3P4R A;  5FS8 A;  1VDC A;  3E1T A;  4U8K A;  3UKF A;  1IUT A;  1IUX A;  3PVC A;  2WP6 A;  2BRY A;  2YM1 A;  4EQW A;  4XXG A;  2XLR A;  4P9S A;  2VRL A;  2C72 A;  2XFQ A;  3DJJ A;  2XYO A;  1ZMC A;  2YG6 A;  2GRT A;  3EF6 A;  2C66 A;  5KMR A;  1QLB A;  3AE4 A;  3ALJ A;  2JK6 A;  2OAL A;  3T2Y A;  1LQT A;  3NK1 X;  4M52 A;  3UOV A;  3CGD A;  1X31 B;  4OVI A;  1PBF A;  2Y6Q A;  4NEW A;  3DK8 A;  1GND A;  2WU5 A;  1K4Q A;  3GRT A;  2A87 A;  2WDV A;  4RG3 A;  3SYI A;  1B5Q A;  2YG5 A;  4B69 A;  3BHK A;  1BZL A;  1CJ4 A;  2C76 A;  3FG2 P;  2Z5X A;  2XFP A;  3BI4 A;  1GOS A;  2VQB A;  2C75 A;  4AP3 A;  3AYI A;  3H8I A;  2A8X A;  3CTY A;  4H2P A;  2Q7V A;  1GXF A;  1ZY8 A;  3QFA A;  1E1M A;  4DNA A;  1BWC A;  4H2Q A;  4FK1 C;  1M6I A;  2I0Z A;  1IJH A;  1PDH A;  3AB1 A;  3DME A;  2YG3 A;  3BNM A;  4H4U A;  2R0C A;  3UTF A;  4BJZ A;  3SM8 A;  4Y4N A;  2OA1 A;  4U8N A;  2C7G A;  4H50 A;  3UTE A;  3CGC A;  4EIP A;  4TLX A;  3CPH G;  1JNR A;  3AXB A;  1FCD A;  1GT8 A;  1DOB A;  1VQW A;  3GRS A;  2VRM A;  2E5V A;  2WET A;  2WQY A;  3AE5 A;  3ZYX A;  5TR3 A;  5U63 A;  3UTG A;  2CUL A;  2PYX A;  3F8D A;  2WHD A;  4J33 A;  4NTC A;  4E0V A;  1ZK7 A;  5KWF A;  1K0I A;  4CNK A;  1ELI A;  2WOV A;  4Y4L A;  4NEV A;  4B68 A;  1PBC A;  4D04 A;  4Z25 A;  1E1N A;  2OLN A;  3AEC A;  4GR1 A;  2DKH A;  4NWZ A;  4C3X A;  5J60 A;  1OJ9 A; 
#chains in the Genus database with same CATH homology
 1P2H A;  1N1P A;  4CNJ A;  1CBO A;  4YKF A;  1H7W A;  3NG7 X;  3RP7 A;  4GAP A;  2A89 A;  4U8J A;  1YY5 A;  5GRT A;  5IPY A;  2TPR A;  2VVL G;  1RSG A;  3CN8 A;  2VVL A;  4XWZ A;  3EAN A;  2GV8 A;  4OPI A;  3C4N A;  3CMM A;  1IUV A;  4JQ9 A;  4XWR A;  1PBD A;  4UDP A;  4CCR A;  1ZX9 A;  2ACZ A;  1GEU A;  2Q6U A;  4J57 A;  1OJT A;  2HQM A;  3I3L A;  5ER0 A;  2ZBW A;  1DJQ A;  5JCK A;  4GUV A;  4H2N A;  3NN6 X;  1NHQ A;  3I6D A;  1CHU A;  4USQ A;  3SXI A;  1F3P A;  3ISH A;  1EL5 A;  2YAU A;  3LXD A;  4JDR A;  4OCG A;  3V3N A;  1JU2 A;  4U8M A;  3SGL A;  4X9N A;  4C5O A;  4H4Y A;  2QA1 A;  2ZZB A;  4YXD A;  1K0L A;  3CNP A;  3GD4 A;  4CBQ A;  3F8P A;  4K2X A;  3M0O A;  4USR A;  3NYC A;  2O9Z A;  2X50 A;  1F6M A;  1PXB A;  4YTN A;  3NYE A;  2JAE A;  3AYJ A;  4BV6 A;  2IVD A;  1DOE A;  2V3A A;  2WU2 A;  4A9W A;  1QJD A;  3DJE A;  4B65 A;  4ICY A;  3PS9 A;  5KOX A;  4OPU A;  4U8O A;  1RP0 A;  3DK4 A;  2FJE A;  2XLT A;  3H4K A;  3UKA A;  5JCN A;  3D1C A;  4EMW A;  1KSU A;  1JOA A;  1Y56 A;  2GR1 A;  3P4S A;  1GPE A;  1JEH A;  1E39 A;  3CGE A;  2YLW A;  1IUW A;  4BUR A;  2ZZC A;  1VG0 A;  2C67 A;  4J34 A;  4K5S A;  3UOY A;  3ICR A;  4N9X A;  1DJN A;  4BK3 A;  2YVF A;  3UTH A;  1XAN A;  3KA7 A;  3NN0 X;  1NPX A;  4H4R A;  5M10 A;  3NNE A;  3UP4 A;  3AE1 A;  4B66 A;  1GES A;  5KOW A;  1LJ1 A;  1XPQ A;  3AED A;  1D4E A;  2QAE A;  5KVI A;  2GMH A;  3DGH A;  3SY4 A;  5KNL A;  4U2S A;  4H4Z A;  3VR9 A;  1V59 A;  2V60 A;  3AYL A;  3KU9 A;  3NGC X;  1N4W A;  2BCP A;  2WP9 A;  4KX6 A;  2APG A;  4AOX A;  1OJD A;  4CRT A;  1ONF A;  3LAD A;  4GDE A;  1CJC A;  3D8X A;  4OPT A;  2V6O A;  1PS9 A;  2GR0 A;  1PBB A;  1IUU A;  1Y56 B;  2BS4 A;  1B8S A;  2R46 A;  2V61 A;  2YG7 A;  4UP3 A;  3P9U A;  4I59 A;  1RYI A;  1TDO A;  3AEF A;  1GRG A;  1D7Y A;  3T2K A;  3UKL A;  4G6G A;  2BAC A;  4IVM B;  2Z5Y A;  3K7Q X;  2JKC A;  2R9Z A;  2WDR A;  2BRA A;  5L46 A;  3DJG X;  4EMJ A;  4ZCC A;  2EQ6 A;  2RAB A;  3DA1 A;  3AE8 A;  3QVP A;  1NG3 A;  2C73 A;  3AE6 A;  5U25 A;  1EL7 A;  4Z2T A;  2XVE A;  4WX1 A;  2XFO A;  5FMH A;  4D03 A;  1MO9 A;  3FPZ A;  2B7R A;  2JB1 A;  1PHH A;  1N4V A;  3C96 A;  3Q6J A;  4BK2 A;  1KNR A;  1NHS A;  1DOC A;  1LPF A;  3V3O A;  3RP8 A;  3S5W A;  5KXJ A;  2XFN A;  2CFY A;  1O94 A;  2BC0 A;  5KMQ A;  5M0Z A;  2GVC A;  5KMP A;  3M13 A;  4GCM A;  5BRT A;  1KDG A;  1BGJ A;  1NAA A;  2JB2 A;  2YVJ A;  3CND A;  1PBE A;  3GYX A;  4H4X A;  4YSH A;  1PXC A;  2C3C A;  3WE0 A;  1GTE A;  4GRT A;  2VQ7 A;  3UP5 A;  1UKV G;  4G73 A;  5BUL A;  3QSM A;  3KLJ A;  2B9W A;  1YQ4 A;  4A6N A;  2R0P A;  4TM3 A;  4ZN0 A;  2R45 A;  4JNA A;  3T2Z A;  4K22 A;  3AD9 B;  1NHP A;  4H4S A;  1EL9 A;  2UZZ A;  5FS9 A;  4H4W A;  5GSN A;  1ZMD A;  1CC2 A;  1CC6 A;  2AQJ A;  3DK9 A;  5DBJ A;  3VQR A;  2VVM A;  2R4E A;  5KMS A;  4TM4 A;  1TDE A;  1OJA A;  2W0H A;  4JN9 A;  4NNJ A;  5HXI A;  4FK1 A;  3H8L A;  4IV9 A;  3B6D A;  3LZW A;  4UDQ A;  4AP1 A;  4FX9 A;  1DOD A;  3NTA A;  4TM0 A;  1BGN A;  2E1M A;  4PAB A;  1TRB A;  2AAQ A;  4A79 A;  3HYV A;  1JNZ A;  2WPC A;  1NEK A;  2IID A;  3NHO X;  1DXL A;  1EBD A;  2YVG A;  3PO7 A;  1KNP A;  4H4T A;  2BCG G;  2YG4 A;  3UKK A;  3K7T A;  3SQP A;  3O0H A;  1AOG A;  2XVI A;  4LII A;  3T0K A;  2GAG B;  4EIQ A;  1KF6 A;  3QVR A;  4G9K A;  4EQS A;  3NTD A;  1L9E A;  3ICS A;  1PJ7 A;  4MJW A;  1EL8 A;  3NKS A;  4A6N B;  1JRZ A;  5HY5 A;  1Z6L A;  3NK0 X;  3UOZ A;  2FBW A;  2B76 A;  1JRY A;  3NIX A;  3FBS A;  1GRH A;  5FS7 A;  5J7X A;  1GRE A;  4B64 A;  1YQZ A;  3GDN A;  4Z44 A;  1LV0 A;  1L9C A;  1OJC A;  1PJ5 A;  3BI2 A;  2V5Z A;  2PHH A;  2JB3 A;  4B67 A;  4II3 A;  3AE9 A;  3LJP A;  3R9U A;  4B63 A;  1E1L A;  3AD7 B;  3ITJ A;  1H82 A;  2YM2 A;  2YR4 A;  2XLU A;  1LQU A;  2Q0K A;  4JNQ A;  1GV4 A;  3G5Q A;  3NH3 X;  4UDR A;  2WP5 A;  3AEG A;  4K8D A;  4NZH A;  5EB5 A;  3ALL A;  3B3R A;  1D7L A;  2TMD A;  4H4P A;  3SFE A;  3KPF A;  5CKU A;  1F8R A;  2WPE A;  3BI5 A;  1K0J A;  1IUS A;  2C64 A;  2YWL A;  2B9Y A;  2ZZ0 A;  3CNT A;  4JY2 A;  3OZ2 A;  3VRA A;  4K7Z A;  1W4X A;  2XVJ A;  2E4G A;  4G74 A;  2YLZ A;  4IA6 A;  4RG4 A;  3URH A;  2BK4 A;  3L1R A;  4U8I A;  1FOH A;  1SEZ A;  2C65 A;  5IQ1 A;  1Q1R A;  1P2E A;  2FJB A;  3HZL A;  4YSX A;  2WEU A;  4FDC B;  1ZOV A;  4IA5 A;  2BXS A;  4JY3 A;  2V3B A;  3CGB A;  3GDP A;  1Q9I A;  1FEC A;  4Z24 A;  3QJ4 A;  1TYT A;  3HYX A;  4Z26 A;  2GAH B;  5JCL A;  4H4Q A;  1GSN A;  2R4J A;  3NLC A;  2RGJ A;  3V76 A;  2BK5 A;  5CQF A;  3DJD A;  3AE7 A;  4OPL A;  4A5L A;  4C77 A;  4U2T A;  4IVO B;  1GRA A;  3SZF A;  2XDO A;  4YKG A;  4GAV A;  1CJ3 A;  1S3E A;  1CJ2 A;  1GRF A;  4GF7 A;  2XLP A;  3GYJ A;  5U1O A;  2OLO A;  3P1W A;  3FIM B;  1NG4 A;  4OPG A;  4DGK A;  3S61 A;  3QSS A;  4G6H A;  3AEB A;  3UKQ A;  2XVF A;  4YTP A;  1GRB A;  2CDU A;  1Q1W A;  2R0G A;  4B1B A;  3IWA A;  4EQX A;  3RHA A;  4H7U A;  2WPF A;  2B7S A;  4H4V A;  1QO8 A;  4ZCD A;  1TDK A;  1H6V A;  3HYW A;  2GQF A;  3CNJ A;  3T14 A;  2XFU A;  3AEE A;  2YQU A;  3IC9 A;  2GQW A;  1FEA A;  3ICT A;  1GTH A;  3OC4 A;  4HA6 A;  1MXT A;  1GAL A;  3UKH A;  4EQR A;  3UOX A;  1F8W A;  3IHG A;  2BA9 A;  3GWF A;  5BVA A;  3SFD A;  1E6E A;  4Z2U A;  1JRX A;  3KVE A;  3KPK A;  1TYP A;  2IVE A;  4Z43 A;  3AD8 B;  3CPJ G;  2X99 A;  1PXA A;  3QSE A;  3LOV A;  1TDN A;  2AR8 A;  2GF3 A;  3GMC A;  4KPR A;  2H89 A;  1KFY A;  1D5T A;  1H7X A;  1CC4 A;  4K5R A;  4X4J A;  4AT0 A;  1GRT A;  1CL0 A;  3GYI A;  3UKP A;  4HB9 A;  2EQ8 A;  2EQ7 A;  3VRD B;  3VRB A;  4CCQ A;  1PN0 A;  3ADA B;  2BK3 A;  1COY A;  2BXR A;  1L0V A;  1S2Q A;  3EAO A;  2EQ9 A;  4BK1 A;  2RGO A;  3BHF A;  3GMB A;  4O5Q A;  5EOW A;  4YTM A;  2YLS A;  1FL2 A;  2WES A;  5HHF A;  3UCL A;  2GMJ A;  4EM4 A;  1ZOY A;  2F5Z A;  3K7M X;  1GET A;  2FJA A;  5JCM A;  2YLT A;  2BC1 A;  3NT6 A;  1CF3 A;  5EB4 A;  2ARD A;  2X8G A;  3KKJ A;  4Z2R A;  2XCG A;  2DKI A;  3RED A;  3DH9 A;  1N4U A;  3GD3 A;  4TM1 A;  2Q0L A;  2WOI A;  2FJD A;  4AOS A;  1NHR A;  3ZDN A;  3AE3 A;  3NYF A;  2GB0 A;  1GER A;  2BAB A;  1LTX R;  1NDA A;  1O5W A;  2X8C A;  4REK A;  4C74 A;  2X3N A;  2WDQ A;  3F8R A;  4PAA A;  3GWD A;  2QA2 A;  1VRQ B;  4NTD A;  1M64 A;  3AWI A;  1ZDL A;  1XDI A;  3COX A;  4NTE A;  2C4C A;  2WS3 A;  1YKJ A;  3T31 A;  2VOU A;  1S2Y A;  2GEW A;  3LB8 A;  3P4Q A;  3Q9T A;  4A65 A;  4CY8 A;  4RSL A;  3BNU A;  3II4 A;  2XLS A;  3AE2 A;  3EPT A;  1D4C A;  2QCU A;  4O5U A;  2YR6 A;  4II2 A;  1DNC A;  4EMI A;  4YT0 A;  3CNS A;  4DSH A;  3DGZ A;  4X9M A;  2WBA A;  4U8L A;  1H84 A;  2WOW A;  3M12 A;  4GDP A;  4H2R A;  2J3N A;  4BJY A;  5JCI A;  1KSS A;  1S3B A;  1O95 A;  4YWO A;  2YLX A;  1BKW A;  4OPD A;  1L9D A;  3C4A A;  3L8K A;  1H81 A;  4ECH A;  3ATR A;  1E7P A;  5C3J A;  2BYB A;  2GR3 A;  5KVH A;  5BUK A;  3RNM A;  5HYM A;  1BF3 A;  4YSZ A;  3ABV A;  2C70 A;  3CPI G;  1E1K A;  2C3D A;  4OPC A;  4Y4M A;  5C2T A;  5KRQ A;  1FEB A;  2NVK X;  4J2W A;  3T37 A;  1TDF A;  2YR5 A;  2B9X A;  2CVJ A;  3G5S A;  1REO A;  2BS3 A;  3NK2 X;  3AEA A;  1VG9 A;  2VZ2 A;  2JBV A;  2XVH A;  4A7A A;  4APN A;  1XHC A;  5IQ4 A;  2RGH A;  4DSG A;  3RP6 A;  3G5R A;  3LZX A;  1YQ3 A;  4LU6 A;  5EBK A;  3SZC A;  2YLR A;  4C3Y A;  4WCT A;  4CY6 A;  4TLZ A;  3ALM A;  1HYU A;  1ZKQ A;  4I58 A;  5LV9 A;  2OAM A;  1NEN A;  3JSK A;  3KD9 A;  1MOK A;  1H83 A;  1B4V A;  4U8P A;  3GSI A;  3P4P A;  4J31 A;  4LA1 A;  2BS2 A;  3IHM A;  3SZW A;  1H86 A;  3CIR A;  3ATQ A;  3QFB A;  5FS6 A;  3K30 A;  2GH5 A;  2NPX A;  4ADW A;  1B37 A;  1LVL A;  1ZP0 A;  3SX6 A;  4J36 A;  4AT2 A;  1PJ6 A;  1Y0P A;  2Y6R A;  3VR8 A;  3NRN A;  4A99 A;  2X8H A;  4YSY A;  4J56 A;  4U2L A;  2GR2 A;  3IF9 A;  3FMW A;  1D4D A;  2H88 A;  3SZ0 A;  4EM3 A;  1F8S A;  3P4R A;  5FS8 A;  1VDC A;  3E1T A;  4U8K A;  3UKF A;  1IUT A;  1IUX A;  3PVC A;  2WP6 A;  2BRY A;  2YM1 A;  4EQW A;  4XXG A;  2XLR A;  4P9S A;  2VRL A;  2C72 A;  2XFQ A;  3DJJ A;  2XYO A;  1ZMC A;  2YG6 A;  2GRT A;  3EF6 A;  2C66 A;  5KMR A;  1QLB A;  3AE4 A;  3ALJ A;  2JK6 A;  2OAL A;  3T2Y A;  1LQT A;  3NK1 X;  4M52 A;  3UOV A;  3CGD A;  1X31 B;  4OVI A;  1PBF A;  2Y6Q A;  4NEW A;  3DK8 A;  1GND A;  2WU5 A;  1K4Q A;  3GRT A;  2A87 A;  2WDV A;  4RG3 A;  3SYI A;  1B5Q A;  2YG5 A;  4B69 A;  3BHK A;  1BZL A;  1CJ4 A;  2C76 A;  3FG2 P;  2Z5X A;  2XFP A;  3BI4 A;  1GOS A;  2VQB A;  2C75 A;  4AP3 A;  3AYI A;  3H8I A;  2A8X A;  3CTY A;  4H2P A;  2Q7V A;  1GXF A;  1ZY8 A;  3QFA A;  1E1M A;  4DNA A;  1BWC A;  4H2Q A;  4FK1 C;  1M6I A;  2I0Z A;  1IJH A;  1PDH A;  3AB1 A;  3DME A;  2YG3 A;  3BNM A;  4H4U A;  2R0C A;  3UTF A;  4BJZ A;  3SM8 A;  4Y4N A;  2OA1 A;  4U8N A;  2C7G A;  4H50 A;  3UTE A;  3CGC A;  4EIP A;  4TLX A;  3CPH G;  1JNR A;  3AXB A;  1FCD A;  1GT8 A;  1DOB A;  1VQW A;  3GRS A;  2VRM A;  2E5V A;  2WET A;  2WQY A;  3AE5 A;  3ZYX A;  5TR3 A;  5U63 A;  3UTG A;  2CUL A;  2PYX A;  3F8D A;  2WHD A;  4J33 A;  4NTC A;  4E0V A;  1ZK7 A;  5KWF A;  1K0I A;  4CNK A;  1ELI A;  2WOV A;  4Y4L A;  4NEV A;  4B68 A;  1PBC A;  4D04 A;  4Z25 A;  1E1N A;  2OLN A;  3AEC A;  4GR1 A;  2DKH A;  4NWZ A;  4C3X A;  5J60 A;  1OJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...