3NHOX

Complex of 6-hydroxy-l-nicotine oxidase with product bound at active site
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal structure analysis of free and substrate-bound 6-hydroxy-L-nicotine oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 139
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nhoX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3nhoX02
2XCGA 1GRFA 1OJDA 4A6NA 1OJ9A 2UZZA 3REDA 1GRGA 2YLZA 1JNZA 2BACA 4J34A 3UTGA 4U8OA 2WP6A 1GNDA 4Z43A 4OPUA 3DJEA 1EL9A 2VVLA 4Z2UA 1H86A 4I59A 1PS9A 3EAOA 2BXRA 3UTHA 4H2NA 2C67A 1PHHA 2E4GA 3DJDA 4Z2RA 5JCNA 2QCUA 2WDVA 4NEWA 1DODA 3IC9A 1P2HA 3UP4A 3VR9A 1GREA 1D7LA 2R0CA 2H89A 1SEZA 3CGEA 5IQ1A 2OA1A 1PXAA 3AE9A 2TPRA 3ITJA 4WCTA 5EOWA 1ONFA 2V3AA 1Y56B 4IA5A 1GERA 2A87A 1ZY8A 3GWFA 1NAAA 2R4JA 1FECA 3CNDA 4ECHA 2AAQA 2X8CA 2JKCA 4CBQA 3UCLA 1B4VA 2GR1A 4DSGA 3EF6A 4HB9A 1GEUA 2X8GA 4USRA 4YT0A 3P4QA 3SQPA 2WPEA 2X8HA 4YSHA 1IJHA 1DOEA 4TLZA 3M12A 4J57A 2XVHA 4OPTA 2YLTA 1JRYA 5DBJA 4H4WA 3RP6A 3AD8B 1DJNA 1LQUA 1BGNA 1ZX9A 2YG6A 3VRAA 2WDQA 1K0IA 1CC2A 2CVJA 3Q9TA 2XYOA 3UOYA 2XFPA 1BGJA 4GDEA 2Q7VA 2QA2A 3K7MX 1KNRA 4APNA 1D4CA 3CNSA 4H4RA 3GSIA 3C4NA 4H4UA 1M64A 2XVJA 3NNEA 3UKPA 1CC4A 2JB2A 3QSMA 3CNTA 1NG4A 3L1RA 2RGOA 4D03A 1O94A 1XDIA 5KVHA 3PS9A 1XPQA 3GD3A 4EQXA 3AE8A 2R0PA 1Z6LA 1JOAA 3NG7X 1CJ3A 3K30A 2A89A 4O5UA 3BI2A 2B7SA 4AOSA 4EM4A 5U25A 1GXFA 3M13A 4XWRA 4GUVA 3S61A 1IUXA 3F8RA 5J7XA 3ZYXA 1DXLA 4TM3A 2V6OA 3L8KA 1B37A 2JB1A 1Y56A 1COYA 4EM3A 3O0HA 2Z5YA 3NHOX 2H88A 3ALLA 1PJ5A 4FK1A 3ATQA 4GDPA 1S3EA 1TDFA 1LTXR 2WPFA 2YG3A 4UP3A 3G5QA 4U8MA 1CHUA 1GSNA 3NK0X 3OZ2A 1S2YA 4EMIA 2QAEA 3BNUA 2VZ2A 3GYJA 4EQRA 2APGA 4BJYA 4OPIA 1IUVA 4IVOB 4USQA 3RP7A 5JCMA 2RGHA 2BC1A 4B1BA 4DGKA 4YTMA 1MXTA 1BF3A 2IVDA 2EQ8A 2ACZA 3AWIA 2AR8A 5BUKA 1BKWA 1D4EA 1GRTA 3GYIA 4X9NA 1PJ7A 3AD7B 1CC6A 3AE3A 1D7YA 3CPJG 4EQSA 3AYIA 3GD4A 4UDPA 4LIIA 4A79A 2GVCA 5ER0A 3UKHA 3I6DA 5KXJA 1ELIA 3DH9A 1TYTA 4C77A 3DGZA 2ZZBA 5J60A 2JK6A 5IPYA 3AYJA 2GF3A 4J31A 2GB0A 4LA1A 1PJ6A 1AOGA 2V3BA 1Q9IA 2WEUA 1TDEA 4EQWA 2YR4A 1FEAA 2YAUA 1GRHA 3G5RA 4A9WA 3AXBA 3K7QX 4BK3A 3QFAA 3RP8A 3CN8A 2GR3A 3DK9A 3C96A 2XFQA 1E7PA 1EL8A 1DOCA 3FIMB 4B64A 5KRQA 3QVRA 2WOWA 2VQ7A 3V3OA 3VRDB 3AD9B 2Z5XA 3ICSA 3KKJA 4Z25A 1E39A 1VRQB 2B9WA 2IIDA 2BK5A 3EPTA 3SFEA 2GMHA 3VR8A 4CNJA 4ICYA 3QFBA 4YTNA 2C70A 2GAHB 2V60A 2HQMA 3ATRA 5BULA 4HA6A 4H4VA 4FK1C 1H7XA 2YR5A 3KVEA 2YG5A 2YLXA 1YKJA 3IHMA 1PXCA 3IWAA 2B76A 2VQBA 4U2SA 5CKUA 4A7AA 5HYMA 3UKAA 2B7RA 2XLSA 5KOWA 2WP5A 3NTDA 2WPCA 2WHDA 1GRBA 1Y0PA 4U8PA 3UTFA 2PHHA 3FBSA 4JY3A 4Y4LA 4BJZA 4REKA 2R45A 2IVEA 3P4PA 4IV9A 1H81A 1N4VA 1CBOA 5KVIA 2WBAA 1FEBA 5JCKA 1ZOVA 3GMCA 3JSKA 3NN0X 2GR0A 2JBVA 3ALMA 1CJ2A 4XWZA 2X50A 1D4DA 2YVFA 4N9XA 2R9ZA 1ZK7A 2JAEA 1EBDA 3KA7A 1EL5A 1LQTA 1F8SA 3PO7A 4H4PA 5U1OA 4YSZA 2B9YA 4CY8A 3AEAA 3BI4A 1FL2A 1GESA 5LV9A 4M52A 1DOBA 2GEWA 3CPHG 3HZLA 2VVMA 2C72A 2Q0KA 1NHRA 4K7ZA 5BVAA 1E6EA 1E1LA 3M0OA 1YQZA 5KWFA 1TDKA 4AP3A 4U2LA 3COXA 3CGCA 2GR2A 3I3LA 1OJAA 1KSSA 1RYIA 1IUWA 3H8LA 4JQ9A 4IVMB 4H50A 5L46A 3RHAA 4YKFA 3FG2P 1BWCA 2B9XA 4CY6A 2WETA 2WESA 4B67A 1KDGA 3GRSA 4B69A 4GRTA 1O95A 3OC4A 2BS3A 2X3NA 2GQWA 3CTYA 4TM0A 1VG9A 5GRTA 2TMDA 4UDQA 2ZZCA 2YR6A 3BHKA 3GDPA 3NIXA 3NLCA 3NYCA 2C73A 4H7UA 4K5RA 4OPDA 3UP5A 4YKGA 1HYUA 1RSGA 2C76A 1REOA 4U8IA 3ADAB 2XVIA 1D5TA 4AT2A 4B65A 1K0JA 3AECA 4YXDA 4A65A 2F5ZA 3NT6A 2X99A 3B3RA 2WOIA 2YVGA 3NYFA 3WE0A 5JCIA 4H4TA 3P4SA 1XANA 2Q6UA 2I0ZA 1JNRA 3GDNA 2FBWA 4GF7A 3NGCX 1E1KA 4YSXA 1F6MA 4A6NB 3LB8A 1KNPA 3UOXA 4NTCA 1PXBA 4DSHA 4ADWA 1F8RA 2V61A 4OVIA 5C2TA 4TM4A 4Z2TA 4U8LA 1OJCA 2YWLA 2OLOA 3IF9A 1OJTA 1O5WA 2WS3A 1KSUA 2OAMA 5TR3A 1IUUA 1GT8A 1MO9A 1L9EA 4K22A 3NH3X 3DJGX 1GPEA 2EQ9A 2FJDA 3LOVA 1N1PA 2C64A 1MOKA 2FJEA 2BS2A 3BI5A 4OPGA 1GRAA 3AEGA 4IA6A 2R46A 3NTAA 1NPXA 3DA1A 4KX6A 1JRXA 4YTPA 4Z26A 2XLUA 1KF6A 1F3PA 2WU5A 4DNAA 2YVJA 3QSEA 3T37A 2VRLA 3DJJA 1PBDA 4Y4MA 5CQFA 2C3CA 3P9UA 5EB4A 1H84A 1L0VA 3DK8A 2GQFA 3AEFA 4K5SA 2EQ6A 4JDRA 1E1NA 4GCMA 2QA1A 1B5QA 3LJPA 4ZCDA 1B8SA 1H7WA 4B66A 4BURA 1H83A 2NPXA 1N4UA 1NEKA 2YLSA 4X9MA 1GTHA 4JY2A 3F8PA 4K2XA 3P4RA 4A99A 1TDOA 3AE5A 4OCGA 1FCDA 4MJWA 1PBBA 1XHCA 1JEHA 1NDAA 4OPCA 3QSSA 5HHFA 1CL0A 3FPZA 2PYXA 1S3BA 2YM2A 3P1WA 2BS4A 3CNJA 3AEBA 4O5QA 3R9UA 3SM8A 1BZLA 2OLNA 1YY5A 2XFOA 1UKVG 1YQ4A 3CGBA 3D8XA 3PVCA 4Z24A 2BA9A 2BXSA 4EIPA 1F8WA 1LV0A 2XVEA 4UDRA 4D04A 2NVKX 4ZN0A 2BABA 1RP0A 1IUSA 3CNPA 1KFYA 1S2QA 2RABA 2XLTA 3AE1A 3CPIG 3IHGA 4C3XA 4U8JA 1QO8A 4H4ZA 4GR1A 1FOHA 1Q1WA 2J3NA 2YG7A 2ARDA 3VRBA 4RG3A 2E1MA 2YM1A 5BRTA 3NN6X 3NRNA 3AEDA 4I58A 1H6VA 3FMWA 1PBCA 4YWOA 4B68A 4TM1A 3NYEA 5FMHA 2W0HA 4JN9A 4H2QA 5HY5A 2ZBWA 1IUTA 1H82A 1JU2A 4NTDA 3ICTA 1ZKQA 4RSLA 5EBKA 1TRBA 4BK1A 5JCLA 1NHPA 4C3YA 4Y4NA 2C65A 3RNMA 4K8DA 1TDNA 2XFUA 1CJ4A 3SFDA 1NHSA 1L9DA 1NG3A 1QJDA 4CRTA 3BHFA 2O9ZA 1NHQA 1ZMDA 2WDRA 2GH5A 3CIRA 1X31B 3LXDA 4CCQA 1K4QA 4A5LA 3C4AA 1K0LA 3F8DA 4BV6A 1VG0A 2Q0LA 1VQWA 2FJBA 2WQYA 4U2TA 2VRMA 1DNCA 4KPRA 1E1MA 2BCGG 4NZHA 1CJCA 2V5ZA 3V3NA 1GETA 2Y6RA 3VQRA 3G5SA 2BK3A 4ZCCA 3KLJA 1LJ1A 1GALA 2VOUA 4U8NA 1NENA 2A8XA 3UKFA 4CCRA 2XLRA 3GMBA 1N4WA 2EQ7A 3UOVA 3AB1A 3K7TA 4EMJA 3D1CA 4EMWA 1QLBA 1W4XA 2GAGB 3GWDA 3NK1X 3QJ4A 2C75A 4H4QA 2JB3A 2R4EA 4J36A 3LADA 1GV4A 2FJAA 4H2PA 2VVLG 4H4SA 4LU6A 5FS8A 3Q6JA 3BNMA 4OPLA 3V76A 2E5VA 2GRTA 2WOVA 4YSYA 3E1TA 4NTEA 4WX1A 3ZDNA 2C66A 3QVPA 4E0VA 2YLWA 4X4JA 5C3JA 2RGJA 4B63A 3UKKA 2OALA 4P9SA 2GMJA 3AE2A 4C74A 5M10A 3S5WA 1CF3A 3AE7A 2CULA 5FS9A 4C5OA 1ZDLA 5HXIA 1TYPA 3DGHA 1DJQA 1YQ3A 2XLPA 5KOXA 3ABVA 5IQ4A 5EB5A 2BK4A 3UKQA 2CFYA 3KPFA 5GSNA 1JRZA 2YG4A 3DK4A 4J56A 2BCPA 3UOZA 2Y6QA 3NKSA 5FS7A 1Q1RA 3KU9A 4PAAA 1PBEA 4AT0A 4JNAA 4H4YA 1PBFA 2YLRA 1ZOYA 3LZXA 4AOXA 4JNQA 3UKLA 1L9CA 2BYBA 1GTEA 1V59A 4RG4A 2ZZ0A 5M0ZA 2C7GA 3H8IA 2XDOA 4AP1A 4U8KA 2AQJA 3H4KA 4FDCB 3ISHA 2BC0A 3AYLA 3KD9A 4TLXA 5U63A 3ICRA 1PDHA 1VDCA 2DKHA 3EANA 1ZMCA 3CGDA 4BK2A 1ZP0A 3DMEA 3UTEA 4FX9A 1LPFA 3NK2X 1P2EA 2GV8A 2CDUA 2C3DA 3LZWA 1M6IA 3URHA 4PABA 2DKIA 3AEEA 2R0GA 3B6DA 5FS6A 4H2RA 4CNKA 1GOSA 2WP9A 3SGLA 3AE6A 3AE4A 2XVFA 1EL7A 3ALJA 4EIQA 2XFNA 4J2WA 2WU2A 4J33A 2YQUA 4NEVA 3II4A 4H4XA 4Z44A 1LVLA 4XXGA 3GRTA 1PN0A
chains in the Genus database with same CATH superfamily
2XCGA 1GRFA 1OJDA 4A6NA 1OJ9A 2UZZA 3REDA 1GRGA 2YLZA 1JNZA 2BACA 4J34A 3UTGA 4U8OA 2WP6A 3SX6A 1GNDA 4Z43A 4OPUA 3DJEA 1EL9A 2VVLA 4Z2UA 1H86A 4I59A 1PS9A 3EAOA 2BXRA 3UTHA 4H2NA 2C67A 1PHHA 2E4GA 3DJDA 4Z2RA 5JCNA 2QCUA 2WDVA 4NEWA 1DODA 3IC9A 1P2HA 3UP4A 3VR9A 1GREA 4NNJA 1D7LA 2R0CA 2H89A 1SEZA 3CGEA 5IQ1A 2OA1A 1PXAA 3AE9A 2TPRA 3ITJA 4WCTA 5EOWA 1ONFA 2V3AA 1Y56B 4IA5A 1GERA 2A87A 1ZY8A 3GWFA 1NAAA 2R4JA 1FECA 3CNDA 4ECHA 2AAQA 2X8CA 2JKCA 4CBQA 3UCLA 1B4VA 2GR1A 4DSGA 3EF6A 4HB9A 1GEUA 2X8GA 4USRA 4YT0A 3P4QA 3SQPA 2WPEA 2X8HA 3T14A 4YSHA 1IJHA 1DOEA 4TLZA 3M12A 4J57A 2XVHA 4OPTA 2YLTA 1JRYA 3SZWA 5DBJA 4H4WA 3RP6A 3AD8B 1DJNA 1LQUA 1BGNA 1ZX9A 2YG6A 3VRAA 2WDQA 3T0KA 1K0IA 1CC2A 2CVJA 3Q9TA 2XYOA 3UOYA 2BRAA 2XFPA 1BGJA 4GDEA 2Q7VA 2QA2A 3K7MX 1KNRA 4APNA 1D4CA 3CNSA 4H4RA 3GSIA 3C4NA 5KNLA 4H4UA 1M64A 2XVJA 3NNEA 3UKPA 1CC4A 2JB2A 3QSMA 3CNTA 1NG4A 3L1RA 2RGOA 4D03A 1O94A 1XDIA 5KVHA 3PS9A 1XPQA 3GD3A 4G9KA 4EQXA 3AE8A 2R0PA 1Z6LA 1JOAA 3NG7X 1CJ3A 3K30A 2A89A 4O5UA 3BI2A 3SY4A 2B7SA 4AOSA 4EM4A 5U25A 1GXFA 3M13A 4XWRA 4GUVA 3S61A 1IUXA 3F8RA 5J7XA 3ZYXA 1DXLA 4TM3A 2V6OA 3L8KA 1B37A 2JB1A 1Y56A 1COYA 4GAPA 4EM3A 3O0HA 2Z5YA 3NHOX 2H88A 3ALLA 1PJ5A 4FK1A 3ATQA 4GDPA 3SXIA 1S3EA 1TDFA 1LTXR 4GAVA 2WPFA 2YG3A 4UP3A 3G5QA 4U8MA 1CHUA 1GSNA 3NK0X 3OZ2A 1S2YA 4EMIA 2QAEA 3BNUA 2VZ2A 3GYJA 3KPKA 4EQRA 2APGA 4BJYA 4OPIA 1IUVA 4IVOB 4USQA 3RP7A 5JCMA 2RGHA 2BC1A 4B1BA 4DGKA 4YTMA 1MXTA 1BF3A 2IVDA 2EQ8A 2ACZA 3AWIA 2AR8A 5BUKA 1BKWA 1D4EA 1GRTA 3GYIA 4X9NA 1PJ7A 5KMSA 3AD7B 1CC6A 3AE3A 1D7YA 3CPJG 4EQSA 3AYIA 3GD4A 4UDPA 4LIIA 4A79A 2GVCA 5ER0A 3UKHA 3I6DA 5KXJA 1ELIA 3DH9A 1TYTA 4C77A 3DGZA 2ZZBA 5J60A 2JK6A 5IPYA 3AYJA 2GF3A 4J31A 2GB0A 4LA1A 3HYVA 1PJ6A 1AOGA 2V3BA 1Q9IA 2WEUA 1TDEA 4EQWA 2YR4A 1FEAA 2YAUA 1GRHA 3G5RA 4A9WA 3AXBA 3K7QX 4BK3A 3QFAA 4II3A 3RP8A 3CN8A 2GR3A 3DK9A 3C96A 2XFQA 1E7PA 1EL8A 1DOCA 3FIMB 4B64A 5KRQA 3QVRA 2WOWA 2VQ7A 3V3OA 3VRDB 3AD9B 2Z5XA 3ICSA 3KKJA 4Z25A 1E39A 1VRQB 2B9WA 2IIDA 2BK5A 3EPTA 3SFEA 2GMHA 3VR8A 4CNJA 4ICYA 3QFBA 4YTNA 2C70A 2GAHB 2V60A 2HQMA 3ATRA 5BULA 4HA6A 4H4VA 4FK1C 1H7XA 2YR5A 3KVEA 2YG5A 2YLXA 1YKJA 3HYXA 1PXCA 3IHMA 2B76A 2VQBA 3IWAA 4U2SA 5CKUA 4A7AA 5HYMA 3UKAA 2B7RA 2XLSA 5KOWA 2WP5A 3NTDA 2WPCA 2WHDA 1GRBA 1Y0PA 4U8PA 3UTFA 2PHHA 3FBSA 4JY3A 4Y4LA 4BJZA 4REKA 2R45A 2IVEA 3P4PA 4IV9A 1H81A 1N4VA 1CBOA 5KVIA 2WBAA 1FEBA 5JCKA 1ZOVA 3GMCA 3JSKA 3NN0X 2GR0A 2JBVA 3ALMA 1CJ2A 4XWZA 2X50A 1D4DA 2YVFA 4N9XA 4NWZA 2R9ZA 1ZK7A 2JAEA 1EBDA 2BRYA 3KA7A 1EL5A 1LQTA 1F8SA 3PO7A 4II2A 4H4PA 5U1OA 4YSZA 2B9YA 4CY8A 3AEAA 3BI4A 1FL2A 1GESA 5LV9A 4M52A 1DOBA 2GEWA 3CPHG 3HZLA 2VVMA 2C72A 2Q0KA 1NHRA 4K7ZA 5BVAA 1E6EA 1E1LA 3M0OA 1YQZA 5KWFA 1TDKA 4AP3A 4U2LA 3COXA 3CGCA 2GR2A 3I3LA 1OJAA 1KSSA 1RYIA 1IUWA 3H8LA 4JQ9A 4IVMB 4H50A 5L46A 3RHAA 4YKFA 3FG2P 1BWCA 2B9XA 4CY6A 2WETA 2WESA 4B67A 1KDGA 3GRSA 4B69A 4GRTA 1O95A 3OC4A 2BS3A 2X3NA 2GQWA 3CTYA 4TM0A 1VG9A 5GRTA 2TMDA 4UDQA 2ZZCA 2YR6A 3BHKA 3GDPA 3NIXA 3NLCA 3NYCA 2C73A 4G6GA 4H7UA 4K5RA 4OPDA 3UP5A 1HYUA 1RSGA 2C76A 1REOA 4U8IA 3ADAB 2XVIA 1D5TA 4AT2A 3SYIA 4B65A 1K0JA 3AECA 4YXDA 4A65A 2F5ZA 3NT6A 2X99A 3B3RA 2WOIA 2YVGA 3NYFA 3WE0A 5JCIA 4H4TA 3P4SA 1XANA 2Q6UA 2I0ZA 1JNRA 3GDNA 2FBWA 4GF7A 3NGCX 1E1KA 4YSXA 1F6MA 5KMPA 4A6NB 3LB8A 1KNPA 3UOXA 4NTCA 1PXBA 4DSHA 4ADWA 1F8RA 2V61A 4OVIA 5C2TA 4TM4A 4Z2TA 4U8LA 1OJCA 2YWLA 2OLOA 3IF9A 1OJTA 1O5WA 2WS3A 1KSUA 2OAMA 5TR3A 1IUUA 1GT8A 1MO9A 1L9EA 4K22A 3NH3X 3DJGX 1GPEA 2EQ9A 2FJDA 3LOVA 1N1PA 2C64A 1MOKA 2FJEA 2BS2A 3BI5A 4OPGA 1GRAA 3AEGA 4IA6A 2R46A 3NTAA 1NPXA 3DA1A 4KX6A 1JRXA 4YTPA 4Z26A 2XLUA 1KF6A 1F3PA 2WU5A 4DNAA 2YVJA 3QSEA 3T37A 2C4CA 2VRLA 3DJJA 1PBDA 4Y4MA 5CQFA 2C3CA 3P9UA 5EB4A 1H84A 1L0VA 3DK8A 2GQFA 3AEFA 4K5SA 2EQ6A 4JDRA 1E1NA 4GCMA 2QA1A 4G74A 1B5QA 3LJPA 4ZCDA 1B8SA 1H7WA 4B66A 4BURA 1H83A 2NPXA 1N4UA 1NEKA 2YLSA 4X9MA 1GTHA 4JY2A 3F8PA 4K2XA 3P4RA 4A99A 1TDOA 3AE5A 4OCGA 3CMMA 1FCDA 4MJWA 1PBBA 5KMQA 1XHCA 1JEHA 1NDAA 4OPCA 3QSSA 5HHFA 1CL0A 3FPZA 2PYXA 1S3BA 2YM2A 3P1WA 2BS4A 3CNJA 3AEBA 4O5QA 3R9UA 3SM8A 1BZLA 2OLNA 1YY5A 2XFOA 1UKVG 1YQ4A 3CGBA 3D8XA 3PVCA 4Z24A 2BA9A 2BXSA 4EIPA 1F8WA 1LV0A 2XVEA 4UDRA 4D04A 2NVKX 4ZN0A 2BABA 1RP0A 1IUSA 3CNPA 1KFYA 1S2QA 2RABA 2XLTA 3AE1A 3T31A 3CPIG 3IHGA 4C3XA 4U8JA 1QO8A 4H4ZA 3GYXA 4GR1A 1FOHA 1Q1WA 2J3NA 2YG7A 2ARDA 3VRBA 4RG3A 2E1MA 2YM1A 5BRTA 3NN6X 3NRNA 3AEDA 4I58A 1H6VA 3FMWA 1PBCA 3HYWA 4YWOA 4B68A 4TM1A 3NYEA 5FMHA 2W0HA 3T2KA 4JN9A 4H2QA 5HY5A 2ZBWA 1IUTA 1H82A 1JU2A 4NTDA 3ICTA 1ZKQA 4RSLA 5EBKA 1TRBA 4BK1A 5JCLA 1NHPA 4C3YA 4Y4NA 2C65A 3RNMA 4K8DA 1TDNA 2XFUA 1CJ4A 3SFDA 3T2ZA 1NHSA 1L9DA 1NG3A 1QJDA 4CRTA 3SZFA 3BHFA 2O9ZA 1NHQA 1ZMDA 2WDRA 4G73A 2GH5A 3CIRA 1X31B 3LXDA 4CCQA 1K4QA 4A5LA 3C4AA 1K0LA 3F8DA 4BV6A 1VG0A 2Q0LA 1VQWA 2FJBA 2WQYA 4U2TA 2VRMA 1DNCA 4KPRA 1E1MA 2BCGG 4NZHA 1CJCA 2V5ZA 3V3NA 1GETA 2Y6RA 3VQRA 3G5SA 2BK3A 4ZCCA 3KLJA 1LJ1A 1GALA 2VOUA 4U8NA 1NENA 2A8XA 3UKFA 4CCRA 2XLRA 3GMBA 1N4WA 2EQ7A 3UOVA 3AB1A 3K7TA 4EMJA 3D1CA 4EMWA 1QLBA 1W4XA 2GAGB 3GWDA 3NK1X 3QJ4A 2C75A 4H4QA 2JB3A 2R4EA 4J36A 3SZCA 3LADA 1GV4A 2FJAA 4H2PA 2VVLG 4H4SA 4LU6A 5FS8A 3Q6JA 3BNMA 4OPLA 3V76A 2E5VA 2GRTA 2WOVA 4YSYA 3E1TA 4NTEA 4WX1A 3ZDNA 2C66A 3QVPA 4E0VA 2YLWA 4X4JA 5C3JA 2RGJA 4B63A 3UKKA 4YKGA 2OALA 4P9SA 2GMJA 3AE2A 4C74A 5M10A 3S5WA 1CF3A 3AE7A 2CULA 5FS9A 4C5OA 1ZDLA 5HXIA 1TYPA 3DGHA 1DJQA 1YQ3A 2XLPA 5KOXA 3ABVA 3SZ0A 5IQ4A 5EB5A 2BK4A 3UKQA 2CFYA 3KPFA 5GSNA 1JRZA 2YG4A 3DK4A 4J56A 2BCPA 3UOZA 2Y6QA 3NKSA 5FS7A 1Q1RA 3KU9A 4PAAA 1PBEA 4AT0A 4JNAA 4H4YA 1PBFA 2YLRA 1ZOYA 3LZXA 4AOXA 4JNQA 3UKLA 1L9CA 2BYBA 1GTEA 1V59A 4RG4A 2ZZ0A 5M0ZA 2C7GA 3H8IA 2XDOA 4AP1A 4U8KA 2AQJA 3H4KA 4FDCB 3ISHA 2BC0A 3AYLA 3KD9A 4TLXA 5U63A 3ICRA 1PDHA 1VDCA 2DKHA 3EANA 1ZMCA 3CGDA 4BK2A 1ZP0A 3DMEA 3UTEA 4FX9A 1LPFA 3NK2X 1P2EA 2GV8A 2CDUA 2C3DA 3LZWA 1M6IA 3URHA 4PABA 2DKIA 3AEEA 2R0GA 3B6DA 5KMRA 5FS6A 4H2RA 4CNKA 1GOSA 2WP9A 3SGLA 3AE6A 3AE4A 2XVFA 1EL7A 3ALJA 4EIQA 3T2YA 2XFNA 4J2WA 2WU2A 4J33A 2YQUA 4NEVA 3II4A 4H4XA 4Z44A 1LVLA 4G6HA 4XXGA 3GRTA 1PN0A
chains in the Genus database with same CATH topology
2XCGA 1GRFA 1OJDA 4A6NA 1OJ9A 2UZZA 3REDA 1GRGA 2YLZA 1JNZA 2BACA 4J34A 3UTGA 4U8OA 2WP6A 3SX6A 1GNDA 4Z43A 4OPUA 3DJEA 1EL9A 2VVLA 4Z2UA 1H86A 4I59A 1PS9A 3EAOA 2BXRA 3UTHA 4H2NA 2C67A 1PHHA 2E4GA 3DJDA 4Z2RA 5JCNA 2QCUA 2WDVA 4NEWA 1DODA 3IC9A 1P2HA 3UP4A 3VR9A 1GREA 4NNJA 1D7LA 2R0CA 2H89A 1SEZA 3CGEA 5IQ1A 2OA1A 1PXAA 3AE9A 2TPRA 3ITJA 4WCTA 5EOWA 1ONFA 2V3AA 1Y56B 4IA5A 1GERA 2A87A 1ZY8A 3GWFA 1NAAA 2R4JA 1FECA 3CNDA 4ECHA 2AAQA 2X8CA 2JKCA 4CBQA 3UCLA 1B4VA 2GR1A 4DSGA 3EF6A 4HB9A 1GEUA 2X8GA 4USRA 4YT0A 3P4QA 3SQPA 2WPEA 2X8HA 3T14A 4YSHA 1IJHA 1DOEA 4TLZA 3M12A 4J57A 2XVHA 4OPTA 2YLTA 1JRYA 3SZWA 5DBJA 4H4WA 3RP6A 3AD8B 1DJNA 1LQUA 1BGNA 1ZX9A 2YG6A 3VRAA 2WDQA 3T0KA 1K0IA 1CC2A 2CVJA 3Q9TA 2XYOA 3UOYA 2BRAA 2XFPA 1BGJA 4GDEA 2Q7VA 2QA2A 3K7MX 1KNRA 4APNA 1D4CA 3CNSA 4H4RA 3GSIA 3C4NA 5KNLA 4H4UA 1M64A 2XVJA 3NNEA 3UKPA 1CC4A 2JB2A 3QSMA 3CNTA 1NG4A 3L1RA 2RGOA 4D03A 1O94A 1XDIA 5KVHA 3PS9A 1XPQA 3GD3A 4G9KA 4EQXA 3AE8A 2R0PA 1Z6LA 1JOAA 3NG7X 1CJ3A 3K30A 2A89A 4O5UA 3BI2A 3SY4A 2B7SA 4AOSA 4EM4A 5U25A 1GXFA 3M13A 4XWRA 4GUVA 3S61A 1IUXA 3F8RA 5J7XA 3ZYXA 1DXLA 4TM3A 2V6OA 3L8KA 1B37A 2JB1A 1Y56A 1COYA 4GAPA 4EM3A 3O0HA 2Z5YA 3NHOX 2H88A 3ALLA 1PJ5A 4FK1A 3ATQA 4GDPA 3SXIA 1S3EA 1TDFA 1LTXR 4GAVA 2WPFA 2YG3A 4UP3A 3G5QA 4U8MA 1CHUA 1GSNA 3NK0X 3OZ2A 1S2YA 4EMIA 2QAEA 3BNUA 2VZ2A 3GYJA 3KPKA 4EQRA 2APGA 4BJYA 4OPIA 1IUVA 4IVOB 4USQA 3RP7A 5JCMA 2RGHA 2BC1A 4B1BA 4DGKA 4YTMA 1MXTA 1BF3A 2IVDA 2EQ8A 2ACZA 3AWIA 2AR8A 5BUKA 1BKWA 1D4EA 1GRTA 3GYIA 4X9NA 1PJ7A 5KMSA 3AD7B 1CC6A 3AE3A 1D7YA 3CPJG 4EQSA 3AYIA 3GD4A 4UDPA 4LIIA 4A79A 2GVCA 5ER0A 3UKHA 3I6DA 5KXJA 1ELIA 3DH9A 1TYTA 4C77A 3DGZA 2ZZBA 5J60A 2JK6A 5IPYA 3AYJA 2GF3A 4J31A 2GB0A 4LA1A 3HYVA 1PJ6A 1AOGA 2V3BA 1Q9IA 2WEUA 1TDEA 4EQWA 2YR4A 1FEAA 2YAUA 1GRHA 3G5RA 4A9WA 3AXBA 3K7QX 4BK3A 3QFAA 4II3A 3RP8A 3CN8A 2GR3A 3DK9A 3C96A 2XFQA 1E7PA 1EL8A 1DOCA 3FIMB 4B64A 5KRQA 3QVRA 2WOWA 2VQ7A 3V3OA 3VRDB 3AD9B 2Z5XA 3ICSA 3KKJA 4Z25A 1E39A 1VRQB 2B9WA 2IIDA 2BK5A 3EPTA 3SFEA 2GMHA 3VR8A 4CNJA 4ICYA 3QFBA 4YTNA 2C70A 2GAHB 2V60A 2HQMA 3ATRA 5BULA 4HA6A 4H4VA 4FK1C 1H7XA 2YR5A 3KVEA 2YG5A 2YLXA 1YKJA 3HYXA 1PXCA 3IHMA 2B76A 2VQBA 3IWAA 4U2SA 5CKUA 4A7AA 5HYMA 3UKAA 2B7RA 2XLSA 5KOWA 2WP5A 3NTDA 2WPCA 2WHDA 1GRBA 1Y0PA 4U8PA 3UTFA 2PHHA 3FBSA 4JY3A 4Y4LA 4BJZA 4REKA 2R45A 2IVEA 3P4PA 4IV9A 1H81A 1N4VA 1CBOA 5KVIA 2WBAA 1FEBA 5JCKA 1ZOVA 3GMCA 3JSKA 3NN0X 2GR0A 2JBVA 3ALMA 1CJ2A 4XWZA 2X50A 1D4DA 2YVFA 4N9XA 4NWZA 2R9ZA 1ZK7A 2JAEA 1EBDA 2BRYA 3KA7A 1EL5A 1LQTA 1F8SA 3PO7A 4II2A 4H4PA 5U1OA 4YSZA 2B9YA 4CY8A 3AEAA 3BI4A 1FL2A 1GESA 5LV9A 4M52A 1DOBA 2GEWA 3CPHG 3HZLA 2VVMA 2C72A 2Q0KA 1NHRA 4K7ZA 5BVAA 1E6EA 1E1LA 3M0OA 1YQZA 5KWFA 1TDKA 4AP3A 4U2LA 3COXA 3CGCA 2GR2A 3I3LA 1OJAA 1KSSA 1RYIA 1IUWA 3H8LA 4JQ9A 4IVMB 4H50A 5L46A 3RHAA 4YKFA 3FG2P 1BWCA 2B9XA 4CY6A 2WETA 2WESA 4B67A 1KDGA 3GRSA 4B69A 4GRTA 1O95A 3OC4A 2BS3A 2X3NA 2GQWA 3CTYA 4TM0A 1VG9A 5GRTA 2TMDA 4UDQA 2ZZCA 2YR6A 3BHKA 3GDPA 3NIXA 3NLCA 3NYCA 2C73A 4G6GA 4H7UA 4K5RA 4OPDA 3UP5A 1HYUA 1RSGA 2C76A 1REOA 4U8IA 3ADAB 2XVIA 1D5TA 4AT2A 3SYIA 4B65A 1K0JA 3AECA 4YXDA 4A65A 2F5ZA 3NT6A 2X99A 3B3RA 2WOIA 2YVGA 3NYFA 3WE0A 5JCIA 4H4TA 3P4SA 1XANA 2Q6UA 2I0ZA 1JNRA 3GDNA 2FBWA 4GF7A 3NGCX 1E1KA 4YSXA 1F6MA 5KMPA 4A6NB 3LB8A 1KNPA 3UOXA 4NTCA 1PXBA 4DSHA 4ADWA 1F8RA 2V61A 4OVIA 5C2TA 4TM4A 4Z2TA 4U8LA 1OJCA 2YWLA 2OLOA 3IF9A 1OJTA 1O5WA 2WS3A 1KSUA 2OAMA 5TR3A 1IUUA 1GT8A 1MO9A 1L9EA 4K22A 3NH3X 3DJGX 1GPEA 2EQ9A 2FJDA 3LOVA 1N1PA 2C64A 1MOKA 2FJEA 2BS2A 3BI5A 4OPGA 1GRAA 3AEGA 4IA6A 2R46A 3NTAA 1NPXA 3DA1A 4KX6A 1JRXA 4YTPA 4Z26A 2XLUA 1KF6A 1F3PA 2WU5A 4DNAA 2YVJA 3QSEA 3T37A 2C4CA 2VRLA 3DJJA 1PBDA 4Y4MA 5CQFA 2C3CA 3P9UA 5EB4A 1H84A 1L0VA 3DK8A 2GQFA 3AEFA 4K5SA 2EQ6A 4JDRA 1E1NA 4GCMA 2QA1A 4G74A 1B5QA 3LJPA 4ZCDA 1B8SA 1H7WA 4B66A 4BURA 1H83A 2NPXA 1N4UA 1NEKA 2YLSA 4X9MA 1GTHA 4JY2A 3F8PA 4K2XA 3P4RA 4A99A 1TDOA 3AE5A 4OCGA 3CMMA 1FCDA 4MJWA 1PBBA 5KMQA 1XHCA 1JEHA 1NDAA 4OPCA 3QSSA 5HHFA 1CL0A 3FPZA 2PYXA 1S3BA 2YM2A 3P1WA 2BS4A 3CNJA 3AEBA 4O5QA 3R9UA 3SM8A 1BZLA 2OLNA 1YY5A 2XFOA 1UKVG 1YQ4A 3CGBA 3D8XA 3PVCA 4Z24A 2BA9A 2BXSA 4EIPA 1F8WA 1LV0A 2XVEA 4UDRA 4D04A 2NVKX 4ZN0A 2BABA 1RP0A 1IUSA 3CNPA 1KFYA 1S2QA 2RABA 2XLTA 3AE1A 3T31A 3CPIG 3IHGA 4C3XA 4U8JA 1QO8A 4H4ZA 3GYXA 4GR1A 1FOHA 1Q1WA 2J3NA 2YG7A 2ARDA 3VRBA 4RG3A 2E1MA 2YM1A 5BRTA 3NN6X 3NRNA 3AEDA 4I58A 1H6VA 3FMWA 1PBCA 3HYWA 4YWOA 4B68A 4TM1A 3NYEA 5FMHA 2W0HA 3T2KA 4JN9A 4H2QA 5HY5A 2ZBWA 1IUTA 1H82A 1JU2A 4NTDA 3ICTA 1ZKQA 4RSLA 5EBKA 1TRBA 4BK1A 5JCLA 1NHPA 4C3YA 4Y4NA 2C65A 3RNMA 4K8DA 1TDNA 2XFUA 1CJ4A 3SFDA 3T2ZA 1NHSA 1L9DA 1NG3A 1QJDA 4CRTA 3SZFA 3BHFA 2O9ZA 1NHQA 1ZMDA 2WDRA 4G73A 2GH5A 3CIRA 1X31B 3LXDA 4CCQA 1K4QA 4A5LA 3C4AA 1K0LA 3F8DA 4BV6A 1VG0A 2Q0LA 1VQWA 2FJBA 2WQYA 4U2TA 2VRMA 1DNCA 4KPRA 1E1MA 2BCGG 4NZHA 1CJCA 2V5ZA 3V3NA 1GETA 2Y6RA 3VQRA 3G5SA 2BK3A 4ZCCA 3KLJA 1LJ1A 1GALA 2VOUA 4U8NA 1NENA 2A8XA 3UKFA 4CCRA 2XLRA 3GMBA 1N4WA 2EQ7A 3UOVA 3AB1A 3K7TA 4EMJA 3D1CA 4EMWA 1QLBA 1W4XA 2GAGB 3GWDA 3NK1X 3QJ4A 2C75A 4H4QA 2JB3A 2R4EA 4J36A 3SZCA 3LADA 1GV4A 2FJAA 4H2PA 2VVLG 4H4SA 4LU6A 5FS8A 3Q6JA 3BNMA 4OPLA 3V76A 2E5VA 2GRTA 2WOVA 4YSYA 3E1TA 4NTEA 4WX1A 3ZDNA 2C66A 3QVPA 4E0VA 2YLWA 4X4JA 5C3JA 2RGJA 4B63A 3UKKA 4YKGA 2OALA 4P9SA 2GMJA 3AE2A 4C74A 5M10A 3S5WA 1CF3A 3AE7A 2CULA 5FS9A 4C5OA 1ZDLA 5HXIA 1TYPA 3DGHA 1DJQA 1YQ3A 2XLPA 5KOXA 3ABVA 3SZ0A 5IQ4A 5EB5A 2BK4A 3UKQA 2CFYA 3KPFA 5GSNA 1JRZA 2YG4A 3DK4A 4J56A 2BCPA 3UOZA 2Y6QA 3NKSA 5FS7A 1Q1RA 3KU9A 4PAAA 1PBEA 4AT0A 4JNAA 4H4YA 1PBFA 2YLRA 1ZOYA 3LZXA 4AOXA 4JNQA 3UKLA 1L9CA 2BYBA 1GTEA 1V59A 4RG4A 2ZZ0A 5M0ZA 2C7GA 3H8IA 2XDOA 4AP1A 4U8KA 2AQJA 3H4KA 4FDCB 3ISHA 2BC0A 3AYLA 3KD9A 4TLXA 5U63A 3ICRA 1PDHA 1VDCA 2DKHA 3EANA 1ZMCA 3CGDA 4BK2A 1ZP0A 3DMEA 3UTEA 4FX9A 1LPFA 3NK2X 1P2EA 2GV8A 2CDUA 2C3DA 3LZWA 1M6IA 3URHA 4PABA 2DKIA 3AEEA 2R0GA 3B6DA 5KMRA 5FS6A 4H2RA 4CNKA 1GOSA 2WP9A 3SGLA 3AE6A 3AE4A 2XVFA 1EL7A 3ALJA 4EIQA 3T2YA 2XFNA 4J2WA 2WU2A 4J33A 2YQUA 4NEVA 3II4A 4H4XA 4Z44A 1LVLA 4G6HA 4XXGA 3GRTA 1PN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XCG A;  1GRF A;  1OJD A;  4A6N A;  1OJ9 A;  2UZZ A;  3RED A;  1GRG A;  2YLZ A;  1JNZ A;  2BAC A;  4J34 A;  3UTG A;  4U8O A;  2WP6 A;  1GND A;  4Z43 A;  4OPU A;  3DJE A;  1EL9 A;  2VVL A;  4Z2U A;  1H86 A;  4I59 A;  1PS9 A;  3EAO A;  2BXR A;  3UTH A;  4H2N A;  2C67 A;  1PHH A;  2E4G A;  3DJD A;  4Z2R A;  5JCN A;  2QCU A;  2WDV A;  4NEW A;  1DOD A;  3IC9 A;  1P2H A;  3UP4 A;  3VR9 A;  1GRE A;  1D7L A;  2R0C A;  2H89 A;  1SEZ A;  3CGE A;  5IQ1 A;  2OA1 A;  1PXA A;  3AE9 A;  2TPR A;  3ITJ A;  4WCT A;  5EOW A;  1ONF A;  2V3A A;  1Y56 B;  4IA5 A;  1GER A;  2A87 A;  1ZY8 A;  3GWF A;  1NAA A;  2R4J A;  1FEC A;  3CND A;  4ECH A;  2AAQ A;  2X8C A;  2JKC A;  4CBQ A;  3UCL A;  1B4V A;  2GR1 A;  4DSG A;  3EF6 A;  4HB9 A;  1GEU A;  2X8G A;  4USR A;  4YT0 A;  3P4Q A;  3SQP A;  2WPE A;  2X8H A;  4YSH A;  1IJH A;  1DOE A;  4TLZ A;  3M12 A;  4J57 A;  2XVH A;  4OPT A;  2YLT A;  1JRY A;  5DBJ A;  4H4W A;  3RP6 A;  3AD8 B;  1DJN A;  1LQU A;  1BGN A;  1ZX9 A;  2YG6 A;  3VRA A;  2WDQ A;  1K0I A;  1CC2 A;  2CVJ A;  3Q9T A;  2XYO A;  3UOY A;  2XFP A;  1BGJ A;  4GDE A;  2Q7V A;  2QA2 A;  3K7M X;  1KNR A;  4APN A;  1D4C A;  3CNS A;  4H4R A;  3GSI A;  3C4N A;  4H4U A;  1M64 A;  2XVJ A;  3NNE A;  3UKP A;  1CC4 A;  2JB2 A;  3QSM A;  3CNT A;  1NG4 A;  3L1R A;  2RGO A;  4D03 A;  1O94 A;  1XDI A;  5KVH A;  3PS9 A;  1XPQ A;  3GD3 A;  4EQX A;  3AE8 A;  2R0P A;  1Z6L A;  1JOA A;  3NG7 X;  1CJ3 A;  3K30 A;  2A89 A;  4O5U A;  3BI2 A;  2B7S A;  4AOS A;  4EM4 A;  5U25 A;  1GXF A;  3M13 A;  4XWR A;  4GUV A;  3S61 A;  1IUX A;  3F8R A;  5J7X A;  3ZYX A;  1DXL A;  4TM3 A;  2V6O A;  3L8K A;  1B37 A;  2JB1 A;  1Y56 A;  1COY A;  4EM3 A;  3O0H A;  2Z5Y A;  3NHO X;  2H88 A;  3ALL A;  1PJ5 A;  4FK1 A;  3ATQ A;  4GDP A;  1S3E A;  1TDF A;  1LTX R;  2WPF A;  2YG3 A;  4UP3 A;  3G5Q A;  4U8M A;  1CHU A;  1GSN A;  3NK0 X;  3OZ2 A;  1S2Y A;  4EMI A;  2QAE A;  3BNU A;  2VZ2 A;  3GYJ A;  4EQR A;  2APG A;  4BJY A;  4OPI A;  1IUV A;  4IVO B;  4USQ A;  3RP7 A;  5JCM A;  2RGH A;  2BC1 A;  4B1B A;  4DGK A;  4YTM A;  1MXT A;  1BF3 A;  2IVD A;  2EQ8 A;  2ACZ A;  3AWI A;  2AR8 A;  5BUK A;  1BKW A;  1D4E A;  1GRT A;  3GYI A;  4X9N A;  1PJ7 A;  3AD7 B;  1CC6 A;  3AE3 A;  1D7Y A;  3CPJ G;  4EQS A;  3AYI A;  3GD4 A;  4UDP A;  4LII A;  4A79 A;  2GVC A;  5ER0 A;  3UKH A;  3I6D A;  5KXJ A;  1ELI A;  3DH9 A;  1TYT A;  4C77 A;  3DGZ A;  2ZZB A;  5J60 A;  2JK6 A;  5IPY A;  3AYJ A;  2GF3 A;  4J31 A;  2GB0 A;  4LA1 A;  1PJ6 A;  1AOG A;  2V3B A;  1Q9I A;  2WEU A;  1TDE A;  4EQW A;  2YR4 A;  1FEA A;  2YAU A;  1GRH A;  3G5R A;  4A9W A;  3AXB A;  3K7Q X;  4BK3 A;  3QFA A;  3RP8 A;  3CN8 A;  2GR3 A;  3DK9 A;  3C96 A;  2XFQ A;  1E7P A;  1EL8 A;  1DOC A;  3FIM B;  4B64 A;  5KRQ A;  3QVR A;  2WOW A;  2VQ7 A;  3V3O A;  3VRD B;  3AD9 B;  2Z5X A;  3ICS A;  3KKJ A;  4Z25 A;  1E39 A;  1VRQ B;  2B9W A;  2IID A;  2BK5 A;  3EPT A;  3SFE A;  2GMH A;  3VR8 A;  4CNJ A;  4ICY A;  3QFB A;  4YTN A;  2C70 A;  2GAH B;  2V60 A;  2HQM A;  3ATR A;  5BUL A;  4HA6 A;  4H4V A;  4FK1 C;  1H7X A;  2YR5 A;  3KVE A;  2YG5 A;  2YLX A;  1YKJ A;  3IHM A;  1PXC A;  3IWA A;  2B76 A;  2VQB A;  4U2S A;  5CKU A;  4A7A A;  5HYM A;  3UKA A;  2B7R A;  2XLS A;  5KOW A;  2WP5 A;  3NTD A;  2WPC A;  2WHD A;  1GRB A;  1Y0P A;  4U8P A;  3UTF A;  2PHH A;  3FBS A;  4JY3 A;  4Y4L A;  4BJZ A;  4REK A;  2R45 A;  2IVE A;  3P4P A;  4IV9 A;  1H81 A;  1N4V A;  1CBO A;  5KVI A;  2WBA A;  1FEB A;  5JCK A;  1ZOV A;  3GMC A;  3JSK A;  3NN0 X;  2GR0 A;  2JBV A;  3ALM A;  1CJ2 A;  4XWZ A;  2X50 A;  1D4D A;  2YVF A;  4N9X A;  2R9Z A;  1ZK7 A;  2JAE A;  1EBD A;  3KA7 A;  1EL5 A;  1LQT A;  1F8S A;  3PO7 A;  4H4P A;  5U1O A;  4YSZ A;  2B9Y A;  4CY8 A;  3AEA A;  3BI4 A;  1FL2 A;  1GES A;  5LV9 A;  4M52 A;  1DOB A;  2GEW A;  3CPH G;  3HZL A;  2VVM A;  2C72 A;  2Q0K A;  1NHR A;  4K7Z A;  5BVA A;  1E6E A;  1E1L A;  3M0O A;  1YQZ A;  5KWF A;  1TDK A;  4AP3 A;  4U2L A;  3COX A;  3CGC A;  2GR2 A;  3I3L A;  1OJA A;  1KSS A;  1RYI A;  1IUW A;  3H8L A;  4JQ9 A;  4IVM B;  4H50 A;  5L46 A;  3RHA A;  4YKF A;  3FG2 P;  1BWC A;  2B9X A;  4CY6 A;  2WET A;  2WES A;  4B67 A;  1KDG A;  3GRS A;  4B69 A;  4GRT A;  1O95 A;  3OC4 A;  2BS3 A;  2X3N A;  2GQW A;  3CTY A;  4TM0 A;  1VG9 A;  5GRT A;  2TMD A;  4UDQ A;  2ZZC A;  2YR6 A;  3BHK A;  3GDP A;  3NIX A;  3NLC A;  3NYC A;  2C73 A;  4H7U A;  4K5R A;  4OPD A;  3UP5 A;  4YKG A;  1HYU A;  1RSG A;  2C76 A;  1REO A;  4U8I A;  3ADA B;  2XVI A;  1D5T A;  4AT2 A;  4B65 A;  1K0J A;  3AEC A;  4YXD A;  4A65 A;  2F5Z A;  3NT6 A;  2X99 A;  3B3R A;  2WOI A;  2YVG A;  3NYF A;  3WE0 A;  5JCI A;  4H4T A;  3P4S A;  1XAN A;  2Q6U A;  2I0Z A;  1JNR A;  3GDN A;  2FBW A;  4GF7 A;  3NGC X;  1E1K A;  4YSX A;  1F6M A;  4A6N B;  3LB8 A;  1KNP A;  3UOX A;  4NTC A;  1PXB A;  4DSH A;  4ADW A;  1F8R A;  2V61 A;  4OVI A;  5C2T A;  4TM4 A;  4Z2T A;  4U8L A;  1OJC A;  2YWL A;  2OLO A;  3IF9 A;  1OJT A;  1O5W A;  2WS3 A;  1KSU A;  2OAM A;  5TR3 A;  1IUU A;  1GT8 A;  1MO9 A;  1L9E A;  4K22 A;  3NH3 X;  3DJG X;  1GPE A;  2EQ9 A;  2FJD A;  3LOV A;  1N1P A;  2C64 A;  1MOK A;  2FJE A;  2BS2 A;  3BI5 A;  4OPG A;  1GRA A;  3AEG A;  4IA6 A;  2R46 A;  3NTA A;  1NPX A;  3DA1 A;  4KX6 A;  1JRX A;  4YTP A;  4Z26 A;  2XLU A;  1KF6 A;  1F3P A;  2WU5 A;  4DNA A;  2YVJ A;  3QSE A;  3T37 A;  2VRL A;  3DJJ A;  1PBD A;  4Y4M A;  5CQF A;  2C3C A;  3P9U A;  5EB4 A;  1H84 A;  1L0V A;  3DK8 A;  2GQF A;  3AEF A;  4K5S A;  2EQ6 A;  4JDR A;  1E1N A;  4GCM A;  2QA1 A;  1B5Q A;  3LJP A;  4ZCD A;  1B8S A;  1H7W A;  4B66 A;  4BUR A;  1H83 A;  2NPX A;  1N4U A;  1NEK A;  2YLS A;  4X9M A;  1GTH A;  4JY2 A;  3F8P A;  4K2X A;  3P4R A;  4A99 A;  1TDO A;  3AE5 A;  4OCG A;  1FCD A;  4MJW A;  1PBB A;  1XHC A;  1JEH A;  1NDA A;  4OPC A;  3QSS A;  5HHF A;  1CL0 A;  3FPZ A;  2PYX A;  1S3B A;  2YM2 A;  3P1W A;  2BS4 A;  3CNJ A;  3AEB A;  4O5Q A;  3R9U A;  3SM8 A;  1BZL A;  2OLN A;  1YY5 A;  2XFO A;  1UKV G;  1YQ4 A;  3CGB A;  3D8X A;  3PVC A;  4Z24 A;  2BA9 A;  2BXS A;  4EIP A;  1F8W A;  1LV0 A;  2XVE A;  4UDR A;  4D04 A;  2NVK X;  4ZN0 A;  2BAB A;  1RP0 A;  1IUS A;  3CNP A;  1KFY A;  1S2Q A;  2RAB A;  2XLT A;  3AE1 A;  3CPI G;  3IHG A;  4C3X A;  4U8J A;  1QO8 A;  4H4Z A;  4GR1 A;  1FOH A;  1Q1W A;  2J3N A;  2YG7 A;  2ARD A;  3VRB A;  4RG3 A;  2E1M A;  2YM1 A;  5BRT A;  3NN6 X;  3NRN A;  3AED A;  4I58 A;  1H6V A;  3FMW A;  1PBC A;  4YWO A;  4B68 A;  4TM1 A;  3NYE A;  5FMH A;  2W0H A;  4JN9 A;  4H2Q A;  5HY5 A;  2ZBW A;  1IUT A;  1H82 A;  1JU2 A;  4NTD A;  3ICT A;  1ZKQ A;  4RSL A;  5EBK A;  1TRB A;  4BK1 A;  5JCL A;  1NHP A;  4C3Y A;  4Y4N A;  2C65 A;  3RNM A;  4K8D A;  1TDN A;  2XFU A;  1CJ4 A;  3SFD A;  1NHS A;  1L9D A;  1NG3 A;  1QJD A;  4CRT A;  3BHF A;  2O9Z A;  1NHQ A;  1ZMD A;  2WDR A;  2GH5 A;  3CIR A;  1X31 B;  3LXD A;  4CCQ A;  1K4Q A;  4A5L A;  3C4A A;  1K0L A;  3F8D A;  4BV6 A;  1VG0 A;  2Q0L A;  1VQW A;  2FJB A;  2WQY A;  4U2T A;  2VRM A;  1DNC A;  4KPR A;  1E1M A;  2BCG G;  4NZH A;  1CJC A;  2V5Z A;  3V3N A;  1GET A;  2Y6R A;  3VQR A;  3G5S A;  2BK3 A;  4ZCC A;  3KLJ A;  1LJ1 A;  1GAL A;  2VOU A;  4U8N A;  1NEN A;  2A8X A;  3UKF A;  4CCR A;  2XLR A;  3GMB A;  1N4W A;  2EQ7 A;  3UOV A;  3AB1 A;  3K7T A;  4EMJ A;  3D1C A;  4EMW A;  1QLB A;  1W4X A;  2GAG B;  3GWD A;  3NK1 X;  3QJ4 A;  2C75 A;  4H4Q A;  2JB3 A;  2R4E A;  4J36 A;  3LAD A;  1GV4 A;  2FJA A;  4H2P A;  2VVL G;  4H4S A;  4LU6 A;  5FS8 A;  3Q6J A;  3BNM A;  4OPL A;  3V76 A;  2E5V A;  2GRT A;  2WOV A;  4YSY A;  3E1T A;  4NTE A;  4WX1 A;  3ZDN A;  2C66 A;  3QVP A;  4E0V A;  2YLW A;  4X4J A;  5C3J A;  2RGJ A;  4B63 A;  3UKK A;  2OAL A;  4P9S A;  2GMJ A;  3AE2 A;  4C74 A;  5M10 A;  3S5W A;  1CF3 A;  3AE7 A;  2CUL A;  5FS9 A;  4C5O A;  1ZDL A;  5HXI A;  1TYP A;  3DGH A;  1DJQ A;  1YQ3 A;  2XLP A;  5KOX A;  3ABV A;  5IQ4 A;  5EB5 A;  2BK4 A;  3UKQ A;  2CFY A;  3KPF A;  5GSN A;  1JRZ A;  2YG4 A;  3DK4 A;  4J56 A;  2BCP A;  3UOZ A;  2Y6Q A;  3NKS A;  5FS7 A;  1Q1R A;  3KU9 A;  4PAA A;  1PBE A;  4AT0 A;  4JNA A;  4H4Y A;  1PBF A;  2YLR A;  1ZOY A;  3LZX A;  4AOX A;  4JNQ A;  3UKL A;  1L9C A;  2BYB A;  1GTE A;  1V59 A;  4RG4 A;  2ZZ0 A;  5M0Z A;  2C7G A;  3H8I A;  2XDO A;  4AP1 A;  4U8K A;  2AQJ A;  3H4K A;  4FDC B;  3ISH A;  2BC0 A;  3AYL A;  3KD9 A;  4TLX A;  5U63 A;  3ICR A;  1PDH A;  1VDC A;  2DKH A;  3EAN A;  1ZMC A;  3CGD A;  4BK2 A;  1ZP0 A;  3DME A;  3UTE A;  4FX9 A;  1LPF A;  3NK2 X;  1P2E A;  2GV8 A;  2CDU A;  2C3D A;  3LZW A;  1M6I A;  3URH A;  4PAB A;  2DKI A;  3AEE A;  2R0G A;  3B6D A;  5FS6 A;  4H2R A;  4CNK A;  1GOS A;  2WP9 A;  3SGL A;  3AE6 A;  3AE4 A;  2XVF A;  1EL7 A;  3ALJ A;  4EIQ A;  2XFN A;  4J2W A;  2WU2 A;  4J33 A;  2YQU A;  4NEV A;  3II4 A;  4H4X A;  4Z44 A;  1LVL A;  4XXG A;  3GRT A;  1PN0 A; 
#chains in the Genus database with same CATH topology
 2XCG A;  1GRF A;  1OJD A;  4A6N A;  1OJ9 A;  2UZZ A;  3RED A;  1GRG A;  2YLZ A;  1JNZ A;  2BAC A;  4J34 A;  3UTG A;  4U8O A;  2WP6 A;  3SX6 A;  1GND A;  4Z43 A;  4OPU A;  3DJE A;  1EL9 A;  2VVL A;  4Z2U A;  1H86 A;  4I59 A;  1PS9 A;  3EAO A;  2BXR A;  3UTH A;  4H2N A;  2C67 A;  1PHH A;  2E4G A;  3DJD A;  4Z2R A;  5JCN A;  2QCU A;  2WDV A;  4NEW A;  1DOD A;  3IC9 A;  1P2H A;  3UP4 A;  3VR9 A;  1GRE A;  4NNJ A;  1D7L A;  2R0C A;  2H89 A;  1SEZ A;  3CGE A;  5IQ1 A;  2OA1 A;  1PXA A;  3AE9 A;  2TPR A;  3ITJ A;  4WCT A;  5EOW A;  1ONF A;  2V3A A;  1Y56 B;  4IA5 A;  1GER A;  2A87 A;  1ZY8 A;  3GWF A;  1NAA A;  2R4J A;  1FEC A;  3CND A;  4ECH A;  2AAQ A;  2X8C A;  2JKC A;  4CBQ A;  3UCL A;  1B4V A;  2GR1 A;  4DSG A;  3EF6 A;  4HB9 A;  1GEU A;  2X8G A;  4USR A;  4YT0 A;  3P4Q A;  3SQP A;  2WPE A;  2X8H A;  3T14 A;  4YSH A;  1IJH A;  1DOE A;  4TLZ A;  3M12 A;  4J57 A;  2XVH A;  4OPT A;  2YLT A;  1JRY A;  3SZW A;  5DBJ A;  4H4W A;  3RP6 A;  3AD8 B;  1DJN A;  1LQU A;  1BGN A;  1ZX9 A;  2YG6 A;  3VRA A;  2WDQ A;  3T0K A;  1K0I A;  1CC2 A;  2CVJ A;  3Q9T A;  2XYO A;  3UOY A;  2BRA A;  2XFP A;  1BGJ A;  4GDE A;  2Q7V A;  2QA2 A;  3K7M X;  1KNR A;  4APN A;  1D4C A;  3CNS A;  4H4R A;  3GSI A;  3C4N A;  5KNL A;  4H4U A;  1M64 A;  2XVJ A;  3NNE A;  3UKP A;  1CC4 A;  2JB2 A;  3QSM A;  3CNT A;  1NG4 A;  3L1R A;  2RGO A;  4D03 A;  1O94 A;  1XDI A;  5KVH A;  3PS9 A;  1XPQ A;  3GD3 A;  4G9K A;  4EQX A;  3AE8 A;  2R0P A;  1Z6L A;  1JOA A;  3NG7 X;  1CJ3 A;  3K30 A;  2A89 A;  4O5U A;  3BI2 A;  3SY4 A;  2B7S A;  4AOS A;  4EM4 A;  5U25 A;  1GXF A;  3M13 A;  4XWR A;  4GUV A;  3S61 A;  1IUX A;  3F8R A;  5J7X A;  3ZYX A;  1DXL A;  4TM3 A;  2V6O A;  3L8K A;  1B37 A;  2JB1 A;  1Y56 A;  1COY A;  4GAP A;  4EM3 A;  3O0H A;  2Z5Y A;  3NHO X;  2H88 A;  3ALL A;  1PJ5 A;  4FK1 A;  3ATQ A;  4GDP A;  3SXI A;  1S3E A;  1TDF A;  1LTX R;  4GAV A;  2WPF A;  2YG3 A;  4UP3 A;  3G5Q A;  4U8M A;  1CHU A;  1GSN A;  3NK0 X;  3OZ2 A;  1S2Y A;  4EMI A;  2QAE A;  3BNU A;  2VZ2 A;  3GYJ A;  3KPK A;  4EQR A;  2APG A;  4BJY A;  4OPI A;  1IUV A;  4IVO B;  4USQ A;  3RP7 A;  5JCM A;  2RGH A;  2BC1 A;  4B1B A;  4DGK A;  4YTM A;  1MXT A;  1BF3 A;  2IVD A;  2EQ8 A;  2ACZ A;  3AWI A;  2AR8 A;  5BUK A;  1BKW A;  1D4E A;  1GRT A;  3GYI A;  4X9N A;  1PJ7 A;  5KMS A;  3AD7 B;  1CC6 A;  3AE3 A;  1D7Y A;  3CPJ G;  4EQS A;  3AYI A;  3GD4 A;  4UDP A;  4LII A;  4A79 A;  2GVC A;  5ER0 A;  3UKH A;  3I6D A;  5KXJ A;  1ELI A;  3DH9 A;  1TYT A;  4C77 A;  3DGZ A;  2ZZB A;  5J60 A;  2JK6 A;  5IPY A;  3AYJ A;  2GF3 A;  4J31 A;  2GB0 A;  4LA1 A;  3HYV A;  1PJ6 A;  1AOG A;  2V3B A;  1Q9I A;  2WEU A;  1TDE A;  4EQW A;  2YR4 A;  1FEA A;  2YAU A;  1GRH A;  3G5R A;  4A9W A;  3AXB A;  3K7Q X;  4BK3 A;  3QFA A;  4II3 A;  3RP8 A;  3CN8 A;  2GR3 A;  3DK9 A;  3C96 A;  2XFQ A;  1E7P A;  1EL8 A;  1DOC A;  3FIM B;  4B64 A;  5KRQ A;  3QVR A;  2WOW A;  2VQ7 A;  3V3O A;  3VRD B;  3AD9 B;  2Z5X A;  3ICS A;  3KKJ A;  4Z25 A;  1E39 A;  1VRQ B;  2B9W A;  2IID A;  2BK5 A;  3EPT A;  3SFE A;  2GMH A;  3VR8 A;  4CNJ A;  4ICY A;  3QFB A;  4YTN A;  2C70 A;  2GAH B;  2V60 A;  2HQM A;  3ATR A;  5BUL A;  4HA6 A;  4H4V A;  4FK1 C;  1H7X A;  2YR5 A;  3KVE A;  2YG5 A;  2YLX A;  1YKJ A;  3HYX A;  1PXC A;  3IHM A;  2B76 A;  2VQB A;  3IWA A;  4U2S A;  5CKU A;  4A7A A;  5HYM A;  3UKA A;  2B7R A;  2XLS A;  5KOW A;  2WP5 A;  3NTD A;  2WPC A;  2WHD A;  1GRB A;  1Y0P A;  4U8P A;  3UTF A;  2PHH A;  3FBS A;  4JY3 A;  4Y4L A;  4BJZ A;  4REK A;  2R45 A;  2IVE A;  3P4P A;  4IV9 A;  1H81 A;  1N4V A;  1CBO A;  5KVI A;  2WBA A;  1FEB A;  5JCK A;  1ZOV A;  3GMC A;  3JSK A;  3NN0 X;  2GR0 A;  2JBV A;  3ALM A;  1CJ2 A;  4XWZ A;  2X50 A;  1D4D A;  2YVF A;  4N9X A;  4NWZ A;  2R9Z A;  1ZK7 A;  2JAE A;  1EBD A;  2BRY A;  3KA7 A;  1EL5 A;  1LQT A;  1F8S A;  3PO7 A;  4II2 A;  4H4P A;  5U1O A;  4YSZ A;  2B9Y A;  4CY8 A;  3AEA A;  3BI4 A;  1FL2 A;  1GES A;  5LV9 A;  4M52 A;  1DOB A;  2GEW A;  3CPH G;  3HZL A;  2VVM A;  2C72 A;  2Q0K A;  1NHR A;  4K7Z A;  5BVA A;  1E6E A;  1E1L A;  3M0O A;  1YQZ A;  5KWF A;  1TDK A;  4AP3 A;  4U2L A;  3COX A;  3CGC A;  2GR2 A;  3I3L A;  1OJA A;  1KSS A;  1RYI A;  1IUW A;  3H8L A;  4JQ9 A;  4IVM B;  4H50 A;  5L46 A;  3RHA A;  4YKF A;  3FG2 P;  1BWC A;  2B9X A;  4CY6 A;  2WET A;  2WES A;  4B67 A;  1KDG A;  3GRS A;  4B69 A;  4GRT A;  1O95 A;  3OC4 A;  2BS3 A;  2X3N A;  2GQW A;  3CTY A;  4TM0 A;  1VG9 A;  5GRT A;  2TMD A;  4UDQ A;  2ZZC A;  2YR6 A;  3BHK A;  3GDP A;  3NIX A;  3NLC A;  3NYC A;  2C73 A;  4G6G A;  4H7U A;  4K5R A;  4OPD A;  3UP5 A;  1HYU A;  1RSG A;  2C76 A;  1REO A;  4U8I A;  3ADA B;  2XVI A;  1D5T A;  4AT2 A;  3SYI A;  4B65 A;  1K0J A;  3AEC A;  4YXD A;  4A65 A;  2F5Z A;  3NT6 A;  2X99 A;  3B3R A;  2WOI A;  2YVG A;  3NYF A;  3WE0 A;  5JCI A;  4H4T A;  3P4S A;  1XAN A;  2Q6U A;  2I0Z A;  1JNR A;  3GDN A;  2FBW A;  4GF7 A;  3NGC X;  1E1K A;  4YSX A;  1F6M A;  5KMP A;  4A6N B;  3LB8 A;  1KNP A;  3UOX A;  4NTC A;  1PXB A;  4DSH A;  4ADW A;  1F8R A;  2V61 A;  4OVI A;  5C2T A;  4TM4 A;  4Z2T A;  4U8L A;  1OJC A;  2YWL A;  2OLO A;  3IF9 A;  1OJT A;  1O5W A;  2WS3 A;  1KSU A;  2OAM A;  5TR3 A;  1IUU A;  1GT8 A;  1MO9 A;  1L9E A;  4K22 A;  3NH3 X;  3DJG X;  1GPE A;  2EQ9 A;  2FJD A;  3LOV A;  1N1P A;  2C64 A;  1MOK A;  2FJE A;  2BS2 A;  3BI5 A;  4OPG A;  1GRA A;  3AEG A;  4IA6 A;  2R46 A;  3NTA A;  1NPX A;  3DA1 A;  4KX6 A;  1JRX A;  4YTP A;  4Z26 A;  2XLU A;  1KF6 A;  1F3P A;  2WU5 A;  4DNA A;  2YVJ A;  3QSE A;  3T37 A;  2C4C A;  2VRL A;  3DJJ A;  1PBD A;  4Y4M A;  5CQF A;  2C3C A;  3P9U A;  5EB4 A;  1H84 A;  1L0V A;  3DK8 A;  2GQF A;  3AEF A;  4K5S A;  2EQ6 A;  4JDR A;  1E1N A;  4GCM A;  2QA1 A;  4G74 A;  1B5Q A;  3LJP A;  4ZCD A;  1B8S A;  1H7W A;  4B66 A;  4BUR A;  1H83 A;  2NPX A;  1N4U A;  1NEK A;  2YLS A;  4X9M A;  1GTH A;  4JY2 A;  3F8P A;  4K2X A;  3P4R A;  4A99 A;  1TDO A;  3AE5 A;  4OCG A;  3CMM A;  1FCD A;  4MJW A;  1PBB A;  5KMQ A;  1XHC A;  1JEH A;  1NDA A;  4OPC A;  3QSS A;  5HHF A;  1CL0 A;  3FPZ A;  2PYX A;  1S3B A;  2YM2 A;  3P1W A;  2BS4 A;  3CNJ A;  3AEB A;  4O5Q A;  3R9U A;  3SM8 A;  1BZL A;  2OLN A;  1YY5 A;  2XFO A;  1UKV G;  1YQ4 A;  3CGB A;  3D8X A;  3PVC A;  4Z24 A;  2BA9 A;  2BXS A;  4EIP A;  1F8W A;  1LV0 A;  2XVE A;  4UDR A;  4D04 A;  2NVK X;  4ZN0 A;  2BAB A;  1RP0 A;  1IUS A;  3CNP A;  1KFY A;  1S2Q A;  2RAB A;  2XLT A;  3AE1 A;  3T31 A;  3CPI G;  3IHG A;  4C3X A;  4U8J A;  1QO8 A;  4H4Z A;  3GYX A;  4GR1 A;  1FOH A;  1Q1W A;  2J3N A;  2YG7 A;  2ARD A;  3VRB A;  4RG3 A;  2E1M A;  2YM1 A;  5BRT A;  3NN6 X;  3NRN A;  3AED A;  4I58 A;  1H6V A;  3FMW A;  1PBC A;  3HYW A;  4YWO A;  4B68 A;  4TM1 A;  3NYE A;  5FMH A;  2W0H A;  3T2K A;  4JN9 A;  4H2Q A;  5HY5 A;  2ZBW A;  1IUT A;  1H82 A;  1JU2 A;  4NTD A;  3ICT A;  1ZKQ A;  4RSL A;  5EBK A;  1TRB A;  4BK1 A;  5JCL A;  1NHP A;  4C3Y A;  4Y4N A;  2C65 A;  3RNM A;  4K8D A;  1TDN A;  2XFU A;  1CJ4 A;  3SFD A;  3T2Z A;  1NHS A;  1L9D A;  1NG3 A;  1QJD A;  4CRT A;  3SZF A;  3BHF A;  2O9Z A;  1NHQ A;  1ZMD A;  2WDR A;  4G73 A;  2GH5 A;  3CIR A;  1X31 B;  3LXD A;  4CCQ A;  1K4Q A;  4A5L A;  3C4A A;  1K0L A;  3F8D A;  4BV6 A;  1VG0 A;  2Q0L A;  1VQW A;  2FJB A;  2WQY A;  4U2T A;  2VRM A;  1DNC A;  4KPR A;  1E1M A;  2BCG G;  4NZH A;  1CJC A;  2V5Z A;  3V3N A;  1GET A;  2Y6R A;  3VQR A;  3G5S A;  2BK3 A;  4ZCC A;  3KLJ A;  1LJ1 A;  1GAL A;  2VOU A;  4U8N A;  1NEN A;  2A8X A;  3UKF A;  4CCR A;  2XLR A;  3GMB A;  1N4W A;  2EQ7 A;  3UOV A;  3AB1 A;  3K7T A;  4EMJ A;  3D1C A;  4EMW A;  1QLB A;  1W4X A;  2GAG B;  3GWD A;  3NK1 X;  3QJ4 A;  2C75 A;  4H4Q A;  2JB3 A;  2R4E A;  4J36 A;  3SZC A;  3LAD A;  1GV4 A;  2FJA A;  4H2P A;  2VVL G;  4H4S A;  4LU6 A;  5FS8 A;  3Q6J A;  3BNM A;  4OPL A;  3V76 A;  2E5V A;  2GRT A;  2WOV A;  4YSY A;  3E1T A;  4NTE A;  4WX1 A;  3ZDN A;  2C66 A;  3QVP A;  4E0V A;  2YLW A;  4X4J A;  5C3J A;  2RGJ A;  4B63 A;  3UKK A;  4YKG A;  2OAL A;  4P9S A;  2GMJ A;  3AE2 A;  4C74 A;  5M10 A;  3S5W A;  1CF3 A;  3AE7 A;  2CUL A;  5FS9 A;  4C5O A;  1ZDL A;  5HXI A;  1TYP A;  3DGH A;  1DJQ A;  1YQ3 A;  2XLP A;  5KOX A;  3ABV A;  3SZ0 A;  5IQ4 A;  5EB5 A;  2BK4 A;  3UKQ A;  2CFY A;  3KPF A;  5GSN A;  1JRZ A;  2YG4 A;  3DK4 A;  4J56 A;  2BCP A;  3UOZ A;  2Y6Q A;  3NKS A;  5FS7 A;  1Q1R A;  3KU9 A;  4PAA A;  1PBE A;  4AT0 A;  4JNA A;  4H4Y A;  1PBF A;  2YLR A;  1ZOY A;  3LZX A;  4AOX A;  4JNQ A;  3UKL A;  1L9C A;  2BYB A;  1GTE A;  1V59 A;  4RG4 A;  2ZZ0 A;  5M0Z A;  2C7G A;  3H8I A;  2XDO A;  4AP1 A;  4U8K A;  2AQJ A;  3H4K A;  4FDC B;  3ISH A;  2BC0 A;  3AYL A;  3KD9 A;  4TLX A;  5U63 A;  3ICR A;  1PDH A;  1VDC A;  2DKH A;  3EAN A;  1ZMC A;  3CGD A;  4BK2 A;  1ZP0 A;  3DME A;  3UTE A;  4FX9 A;  1LPF A;  3NK2 X;  1P2E A;  2GV8 A;  2CDU A;  2C3D A;  3LZW A;  1M6I A;  3URH A;  4PAB A;  2DKI A;  3AEE A;  2R0G A;  3B6D A;  5KMR A;  5FS6 A;  4H2R A;  4CNK A;  1GOS A;  2WP9 A;  3SGL A;  3AE6 A;  3AE4 A;  2XVF A;  1EL7 A;  3ALJ A;  4EIQ A;  3T2Y A;  2XFN A;  4J2W A;  2WU2 A;  4J33 A;  2YQU A;  4NEV A;  3II4 A;  4H4X A;  4Z44 A;  1LVL A;  4G6H A;  4XXG A;  3GRT A;  1PN0 A; 
#chains in the Genus database with same CATH homology
 2XCG A;  1GRF A;  1OJD A;  4A6N A;  1OJ9 A;  2UZZ A;  3RED A;  1GRG A;  2YLZ A;  1JNZ A;  2BAC A;  4J34 A;  3UTG A;  4U8O A;  2WP6 A;  3SX6 A;  1GND A;  4Z43 A;  4OPU A;  3DJE A;  1EL9 A;  2VVL A;  4Z2U A;  1H86 A;  4I59 A;  1PS9 A;  3EAO A;  2BXR A;  3UTH A;  4H2N A;  2C67 A;  1PHH A;  2E4G A;  3DJD A;  4Z2R A;  5JCN A;  2QCU A;  2WDV A;  4NEW A;  1DOD A;  3IC9 A;  1P2H A;  3UP4 A;  3VR9 A;  1GRE A;  4NNJ A;  1D7L A;  2R0C A;  2H89 A;  1SEZ A;  3CGE A;  5IQ1 A;  2OA1 A;  1PXA A;  3AE9 A;  2TPR A;  3ITJ A;  4WCT A;  5EOW A;  1ONF A;  2V3A A;  1Y56 B;  4IA5 A;  1GER A;  2A87 A;  1ZY8 A;  3GWF A;  1NAA A;  2R4J A;  1FEC A;  3CND A;  4ECH A;  2AAQ A;  2X8C A;  2JKC A;  4CBQ A;  3UCL A;  1B4V A;  2GR1 A;  4DSG A;  3EF6 A;  4HB9 A;  1GEU A;  2X8G A;  4USR A;  4YT0 A;  3P4Q A;  3SQP A;  2WPE A;  2X8H A;  3T14 A;  4YSH A;  1IJH A;  1DOE A;  4TLZ A;  3M12 A;  4J57 A;  2XVH A;  4OPT A;  2YLT A;  1JRY A;  3SZW A;  5DBJ A;  4H4W A;  3RP6 A;  3AD8 B;  1DJN A;  1LQU A;  1BGN A;  1ZX9 A;  2YG6 A;  3VRA A;  2WDQ A;  3T0K A;  1K0I A;  1CC2 A;  2CVJ A;  3Q9T A;  2XYO A;  3UOY A;  2BRA A;  2XFP A;  1BGJ A;  4GDE A;  2Q7V A;  2QA2 A;  3K7M X;  1KNR A;  4APN A;  1D4C A;  3CNS A;  4H4R A;  3GSI A;  3C4N A;  5KNL A;  4H4U A;  1M64 A;  2XVJ A;  3NNE A;  3UKP A;  1CC4 A;  2JB2 A;  3QSM A;  3CNT A;  1NG4 A;  3L1R A;  2RGO A;  4D03 A;  1O94 A;  1XDI A;  5KVH A;  3PS9 A;  1XPQ A;  3GD3 A;  4G9K A;  4EQX A;  3AE8 A;  2R0P A;  1Z6L A;  1JOA A;  3NG7 X;  1CJ3 A;  3K30 A;  2A89 A;  4O5U A;  3BI2 A;  3SY4 A;  2B7S A;  4AOS A;  4EM4 A;  5U25 A;  1GXF A;  3M13 A;  4XWR A;  4GUV A;  3S61 A;  1IUX A;  3F8R A;  5J7X A;  3ZYX A;  1DXL A;  4TM3 A;  2V6O A;  3L8K A;  1B37 A;  2JB1 A;  1Y56 A;  1COY A;  4GAP A;  4EM3 A;  3O0H A;  2Z5Y A;  3NHO X;  2H88 A;  3ALL A;  1PJ5 A;  4FK1 A;  3ATQ A;  4GDP A;  3SXI A;  1S3E A;  1TDF A;  1LTX R;  4GAV A;  2WPF A;  2YG3 A;  4UP3 A;  3G5Q A;  4U8M A;  1CHU A;  1GSN A;  3NK0 X;  3OZ2 A;  1S2Y A;  4EMI A;  2QAE A;  3BNU A;  2VZ2 A;  3GYJ A;  3KPK A;  4EQR A;  2APG A;  4BJY A;  4OPI A;  1IUV A;  4IVO B;  4USQ A;  3RP7 A;  5JCM A;  2RGH A;  2BC1 A;  4B1B A;  4DGK A;  4YTM A;  1MXT A;  1BF3 A;  2IVD A;  2EQ8 A;  2ACZ A;  3AWI A;  2AR8 A;  5BUK A;  1BKW A;  1D4E A;  1GRT A;  3GYI A;  4X9N A;  1PJ7 A;  5KMS A;  3AD7 B;  1CC6 A;  3AE3 A;  1D7Y A;  3CPJ G;  4EQS A;  3AYI A;  3GD4 A;  4UDP A;  4LII A;  4A79 A;  2GVC A;  5ER0 A;  3UKH A;  3I6D A;  5KXJ A;  1ELI A;  3DH9 A;  1TYT A;  4C77 A;  3DGZ A;  2ZZB A;  5J60 A;  2JK6 A;  5IPY A;  3AYJ A;  2GF3 A;  4J31 A;  2GB0 A;  4LA1 A;  3HYV A;  1PJ6 A;  1AOG A;  2V3B A;  1Q9I A;  2WEU A;  1TDE A;  4EQW A;  2YR4 A;  1FEA A;  2YAU A;  1GRH A;  3G5R A;  4A9W A;  3AXB A;  3K7Q X;  4BK3 A;  3QFA A;  4II3 A;  3RP8 A;  3CN8 A;  2GR3 A;  3DK9 A;  3C96 A;  2XFQ A;  1E7P A;  1EL8 A;  1DOC A;  3FIM B;  4B64 A;  5KRQ A;  3QVR A;  2WOW A;  2VQ7 A;  3V3O A;  3VRD B;  3AD9 B;  2Z5X A;  3ICS A;  3KKJ A;  4Z25 A;  1E39 A;  1VRQ B;  2B9W A;  2IID A;  2BK5 A;  3EPT A;  3SFE A;  2GMH A;  3VR8 A;  4CNJ A;  4ICY A;  3QFB A;  4YTN A;  2C70 A;  2GAH B;  2V60 A;  2HQM A;  3ATR A;  5BUL A;  4HA6 A;  4H4V A;  4FK1 C;  1H7X A;  2YR5 A;  3KVE A;  2YG5 A;  2YLX A;  1YKJ A;  3HYX A;  1PXC A;  3IHM A;  2B76 A;  2VQB A;  3IWA A;  4U2S A;  5CKU A;  4A7A A;  5HYM A;  3UKA A;  2B7R A;  2XLS A;  5KOW A;  2WP5 A;  3NTD A;  2WPC A;  2WHD A;  1GRB A;  1Y0P A;  4U8P A;  3UTF A;  2PHH A;  3FBS A;  4JY3 A;  4Y4L A;  4BJZ A;  4REK A;  2R45 A;  2IVE A;  3P4P A;  4IV9 A;  1H81 A;  1N4V A;  1CBO A;  5KVI A;  2WBA A;  1FEB A;  5JCK A;  1ZOV A;  3GMC A;  3JSK A;  3NN0 X;  2GR0 A;  2JBV A;  3ALM A;  1CJ2 A;  4XWZ A;  2X50 A;  1D4D A;  2YVF A;  4N9X A;  4NWZ A;  2R9Z A;  1ZK7 A;  2JAE A;  1EBD A;  2BRY A;  3KA7 A;  1EL5 A;  1LQT A;  1F8S A;  3PO7 A;  4II2 A;  4H4P A;  5U1O A;  4YSZ A;  2B9Y A;  4CY8 A;  3AEA A;  3BI4 A;  1FL2 A;  1GES A;  5LV9 A;  4M52 A;  1DOB A;  2GEW A;  3CPH G;  3HZL A;  2VVM A;  2C72 A;  2Q0K A;  1NHR A;  4K7Z A;  5BVA A;  1E6E A;  1E1L A;  3M0O A;  1YQZ A;  5KWF A;  1TDK A;  4AP3 A;  4U2L A;  3COX A;  3CGC A;  2GR2 A;  3I3L A;  1OJA A;  1KSS A;  1RYI A;  1IUW A;  3H8L A;  4JQ9 A;  4IVM B;  4H50 A;  5L46 A;  3RHA A;  4YKF A;  3FG2 P;  1BWC A;  2B9X A;  4CY6 A;  2WET A;  2WES A;  4B67 A;  1KDG A;  3GRS A;  4B69 A;  4GRT A;  1O95 A;  3OC4 A;  2BS3 A;  2X3N A;  2GQW A;  3CTY A;  4TM0 A;  1VG9 A;  5GRT A;  2TMD A;  4UDQ A;  2ZZC A;  2YR6 A;  3BHK A;  3GDP A;  3NIX A;  3NLC A;  3NYC A;  2C73 A;  4G6G A;  4H7U A;  4K5R A;  4OPD A;  3UP5 A;  1HYU A;  1RSG A;  2C76 A;  1REO A;  4U8I A;  3ADA B;  2XVI A;  1D5T A;  4AT2 A;  3SYI A;  4B65 A;  1K0J A;  3AEC A;  4YXD A;  4A65 A;  2F5Z A;  3NT6 A;  2X99 A;  3B3R A;  2WOI A;  2YVG A;  3NYF A;  3WE0 A;  5JCI A;  4H4T A;  3P4S A;  1XAN A;  2Q6U A;  2I0Z A;  1JNR A;  3GDN A;  2FBW A;  4GF7 A;  3NGC X;  1E1K A;  4YSX A;  1F6M A;  5KMP A;  4A6N B;  3LB8 A;  1KNP A;  3UOX A;  4NTC A;  1PXB A;  4DSH A;  4ADW A;  1F8R A;  2V61 A;  4OVI A;  5C2T A;  4TM4 A;  4Z2T A;  4U8L A;  1OJC A;  2YWL A;  2OLO A;  3IF9 A;  1OJT A;  1O5W A;  2WS3 A;  1KSU A;  2OAM A;  5TR3 A;  1IUU A;  1GT8 A;  1MO9 A;  1L9E A;  4K22 A;  3NH3 X;  3DJG X;  1GPE A;  2EQ9 A;  2FJD A;  3LOV A;  1N1P A;  2C64 A;  1MOK A;  2FJE A;  2BS2 A;  3BI5 A;  4OPG A;  1GRA A;  3AEG A;  4IA6 A;  2R46 A;  3NTA A;  1NPX A;  3DA1 A;  4KX6 A;  1JRX A;  4YTP A;  4Z26 A;  2XLU A;  1KF6 A;  1F3P A;  2WU5 A;  4DNA A;  2YVJ A;  3QSE A;  3T37 A;  2C4C A;  2VRL A;  3DJJ A;  1PBD A;  4Y4M A;  5CQF A;  2C3C A;  3P9U A;  5EB4 A;  1H84 A;  1L0V A;  3DK8 A;  2GQF A;  3AEF A;  4K5S A;  2EQ6 A;  4JDR A;  1E1N A;  4GCM A;  2QA1 A;  4G74 A;  1B5Q A;  3LJP A;  4ZCD A;  1B8S A;  1H7W A;  4B66 A;  4BUR A;  1H83 A;  2NPX A;  1N4U A;  1NEK A;  2YLS A;  4X9M A;  1GTH A;  4JY2 A;  3F8P A;  4K2X A;  3P4R A;  4A99 A;  1TDO A;  3AE5 A;  4OCG A;  3CMM A;  1FCD A;  4MJW A;  1PBB A;  5KMQ A;  1XHC A;  1JEH A;  1NDA A;  4OPC A;  3QSS A;  5HHF A;  1CL0 A;  3FPZ A;  2PYX A;  1S3B A;  2YM2 A;  3P1W A;  2BS4 A;  3CNJ A;  3AEB A;  4O5Q A;  3R9U A;  3SM8 A;  1BZL A;  2OLN A;  1YY5 A;  2XFO A;  1UKV G;  1YQ4 A;  3CGB A;  3D8X A;  3PVC A;  4Z24 A;  2BA9 A;  2BXS A;  4EIP A;  1F8W A;  1LV0 A;  2XVE A;  4UDR A;  4D04 A;  2NVK X;  4ZN0 A;  2BAB A;  1RP0 A;  1IUS A;  3CNP A;  1KFY A;  1S2Q A;  2RAB A;  2XLT A;  3AE1 A;  3T31 A;  3CPI G;  3IHG A;  4C3X A;  4U8J A;  1QO8 A;  4H4Z A;  3GYX A;  4GR1 A;  1FOH A;  1Q1W A;  2J3N A;  2YG7 A;  2ARD A;  3VRB A;  4RG3 A;  2E1M A;  2YM1 A;  5BRT A;  3NN6 X;  3NRN A;  3AED A;  4I58 A;  1H6V A;  3FMW A;  1PBC A;  3HYW A;  4YWO A;  4B68 A;  4TM1 A;  3NYE A;  5FMH A;  2W0H A;  3T2K A;  4JN9 A;  4H2Q A;  5HY5 A;  2ZBW A;  1IUT A;  1H82 A;  1JU2 A;  4NTD A;  3ICT A;  1ZKQ A;  4RSL A;  5EBK A;  1TRB A;  4BK1 A;  5JCL A;  1NHP A;  4C3Y A;  4Y4N A;  2C65 A;  3RNM A;  4K8D A;  1TDN A;  2XFU A;  1CJ4 A;  3SFD A;  3T2Z A;  1NHS A;  1L9D A;  1NG3 A;  1QJD A;  4CRT A;  3SZF A;  3BHF A;  2O9Z A;  1NHQ A;  1ZMD A;  2WDR A;  4G73 A;  2GH5 A;  3CIR A;  1X31 B;  3LXD A;  4CCQ A;  1K4Q A;  4A5L A;  3C4A A;  1K0L A;  3F8D A;  4BV6 A;  1VG0 A;  2Q0L A;  1VQW A;  2FJB A;  2WQY A;  4U2T A;  2VRM A;  1DNC A;  4KPR A;  1E1M A;  2BCG G;  4NZH A;  1CJC A;  2V5Z A;  3V3N A;  1GET A;  2Y6R A;  3VQR A;  3G5S A;  2BK3 A;  4ZCC A;  3KLJ A;  1LJ1 A;  1GAL A;  2VOU A;  4U8N A;  1NEN A;  2A8X A;  3UKF A;  4CCR A;  2XLR A;  3GMB A;  1N4W A;  2EQ7 A;  3UOV A;  3AB1 A;  3K7T A;  4EMJ A;  3D1C A;  4EMW A;  1QLB A;  1W4X A;  2GAG B;  3GWD A;  3NK1 X;  3QJ4 A;  2C75 A;  4H4Q A;  2JB3 A;  2R4E A;  4J36 A;  3SZC A;  3LAD A;  1GV4 A;  2FJA A;  4H2P A;  2VVL G;  4H4S A;  4LU6 A;  5FS8 A;  3Q6J A;  3BNM A;  4OPL A;  3V76 A;  2E5V A;  2GRT A;  2WOV A;  4YSY A;  3E1T A;  4NTE A;  4WX1 A;  3ZDN A;  2C66 A;  3QVP A;  4E0V A;  2YLW A;  4X4J A;  5C3J A;  2RGJ A;  4B63 A;  3UKK A;  4YKG A;  2OAL A;  4P9S A;  2GMJ A;  3AE2 A;  4C74 A;  5M10 A;  3S5W A;  1CF3 A;  3AE7 A;  2CUL A;  5FS9 A;  4C5O A;  1ZDL A;  5HXI A;  1TYP A;  3DGH A;  1DJQ A;  1YQ3 A;  2XLP A;  5KOX A;  3ABV A;  3SZ0 A;  5IQ4 A;  5EB5 A;  2BK4 A;  3UKQ A;  2CFY A;  3KPF A;  5GSN A;  1JRZ A;  2YG4 A;  3DK4 A;  4J56 A;  2BCP A;  3UOZ A;  2Y6Q A;  3NKS A;  5FS7 A;  1Q1R A;  3KU9 A;  4PAA A;  1PBE A;  4AT0 A;  4JNA A;  4H4Y A;  1PBF A;  2YLR A;  1ZOY A;  3LZX A;  4AOX A;  4JNQ A;  3UKL A;  1L9C A;  2BYB A;  1GTE A;  1V59 A;  4RG4 A;  2ZZ0 A;  5M0Z A;  2C7G A;  3H8I A;  2XDO A;  4AP1 A;  4U8K A;  2AQJ A;  3H4K A;  4FDC B;  3ISH A;  2BC0 A;  3AYL A;  3KD9 A;  4TLX A;  5U63 A;  3ICR A;  1PDH A;  1VDC A;  2DKH A;  3EAN A;  1ZMC A;  3CGD A;  4BK2 A;  1ZP0 A;  3DME A;  3UTE A;  4FX9 A;  1LPF A;  3NK2 X;  1P2E A;  2GV8 A;  2CDU A;  2C3D A;  3LZW A;  1M6I A;  3URH A;  4PAB A;  2DKI A;  3AEE A;  2R0G A;  3B6D A;  5KMR A;  5FS6 A;  4H2R A;  4CNK A;  1GOS A;  2WP9 A;  3SGL A;  3AE6 A;  3AE4 A;  2XVF A;  1EL7 A;  3ALJ A;  4EIQ A;  3T2Y A;  2XFN A;  4J2W A;  2WU2 A;  4J33 A;  2YQU A;  4NEV A;  3II4 A;  4H4X A;  4Z44 A;  1LVL A;  4G6H A;  4XXG A;  3GRT A;  1PN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...