4NWZA

Structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
395
structure length
395
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title Structure of the bacterial type II NADH dehydrogenase: a monotopic membrane protein with an essential role in energy generation.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum
molecule tags Oxidoreductase
total genus 126
structure length 395
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4nwzA00
3SZCA 3T2KA 3SZWA 4GAPA 4NWZA 5KMPA 4G73A 3T2ZA 3SY4A 4G6GA 4GAVA 5KMQA 3HYXA 3SZ0A 4G6HA 3KPKA 4G9KA 3SZFA 3T2YA 3SXIA 5KMRA 5KMSA 3T14A 4G74A 3HYWA 3T31A 3HYVA 3SX6A 3T0KA 3SYIA
chains in the Genus database with same CATH superfamily
2CVJA 3CMMA 3UKQA 2BCPA 2JB1A 2DKIA 1DOBA 3AE4A 3HZLA 1VG0A 1CBOA 2VQ7A 4UP3A 3P1WA 4HA6A 4H50A 4K5RA 5C2TA 3Q9TA 4J33A 2PYXA 4ADWA 2VVLG 3ATQA 4H2RA 1PBCA 1PS9A 5KOWA 1GXFA 1IUSA 1EBDA 3SZ0A 1REOA 4H4YA 4Z24A 4C3XA 3IHMA 2QAEA 1PXBA 2FJBA 1LV0A 1NDAA 2WP5A 3LXDA 3AE3A 4H4ZA 3FIMB 5JCMA 3NGCX 2WOVA 4TM1A 4A6NB 2AR8A 2GMHA 4CNKA 3DK9A 4IA5A 2W0HA 4CCRA 2XCGA 1NHRA 1KSSA 1E6EA 4EQWA 1PJ6A 1FL2A 3EF6A 1NHPA 3T2KA 2RGHA 5IPYA 2WU5A 5JCKA 2X8GA 3RP7A 3FBSA 4GAPA 2AQJA 4G73A 1F6MA 1Q9IA 2B76A 3Q6JA 4IVMB 5IQ1A 4A5LA 2ZZCA 2BA9A 3GYJA 4EQSA 3ICTA 5HYMA 4G6GA 4X9MA 3UOVA 3QSEA 1PJ5A 4RSLA 3UOYA 1GALA 4BK3A 2V61A 1JU2A 3AWIA 3ITJA 4H4RA 3HYXA 5GSNA 4H4PA 2XLTA 4FDCB 4C77A 2FJEA 3OC4A 2XDOA 4TM0A 2WOWA 3GD3A 4YTNA 2GR0A 5BUKA 4JNAA 3DJDA 5L46A 3HYWA 2Q6UA 2WEUA 1JRZA 2VVMA 2C7GA 2V5ZA 3UKHA 3NNEA 2ARDA 3SFEA 1DJNA 2Z5YA 4OPGA 3UTHA 4OCGA 3LJPA 2WS3A 2RABA 3H8IA 3II4A 1B4VA 5KMPA 1GESA 4YSXA 1Q1WA 2C3CA 1JRYA 3AEEA 4GR1A 2BXRA 3F8RA 1H83A 5FS8A 5KMQA 4CY6A 4TLXA 4GRTA 3EAOA 3QJ4A 5LV9A 1S2YA 3UP5A 2Q0LA 1KNPA 1GTHA 1B5QA 3REDA 3V3NA 1QLBA 4RG4A 5FS9A 3UTFA 1GREA 1O94A 3T14A 4J57A 1CJ4A 4AP3A 1GRHA 3CNPA 3AYJA 1NHQA 2BS4A 2YVGA 3BHFA 4EIPA 1F8RA 1ONFA 4H2NA 2WDVA 2BK5A 2YM2A 4U8JA 1PN0A 3VRDB 1PXCA 3CNDA 4U8LA 2X8HA 2AAQA 3UOZA 1YQ4A 3NG7X 2UZZA 3SQPA 1NEKA 1YKJA 3B6DA 4LIIA 4BV6A 2C66A 2BCGG 4B63A 1K0JA 2CFYA 5DBJA 3UP4A 1BKWA 5BRTA 2E4GA 2Q7VA 3ATRA 5EB4A 4YXDA 4II2A 3UKLA 1GOSA 2CULA 4EIQA 4OPCA 3CGCA 3NTAA 2X50A 4AT0A 2B9XA 3G5RA 1K0LA 2FJAA 1VRQB 1ZOYA 2FBWA 2YR6A 2BK4A 4OPUA 5FS7A 4Z2TA 3SX6A 1LPFA 1AOGA 4X9NA 4DGKA 1IUWA 4EQRA 3K30A 3PS9A 3NH3X 1GRBA 1ZOVA 4H2QA 1GETA 3M12A 1EL8A 1DOCA 3AE9A 1PBDA 1BZLA 2EQ7A 2YG6A 1EL7A 4Y4MA 2WBAA 2XLUA 1CC6A 2YR5A 3ALMA 3GWDA 4YSHA 2WPCA 4NEVA 1IJHA 2GRTA 1IUXA 2WQYA 3NK2X 4DSHA 1B37A 5J7XA 2BS3A 3NYFA 4AOSA 3AEDA 3FG2P 5KMRA 3SGLA 2WU2A 3GSIA 4GF7A 1ZX9A 1H7XA 2VVLA 2Z5XA 3BI4A 1VG9A 1ZY8A 1H86A 4G74A 3CGDA 3UTGA 3P4QA 4XXGA 4YSYA 5U1OA 2XVEA 3BHKA 2WHDA 5GRTA 4UDQA 1E1KA 3NKSA 1O95A 2C64A 2GH5A 1H84A 3QFBA 3AEFA 3LZXA 3NYEA 3UCLA 4Z2RA 1VQWA 1MO9A 2VOUA 3NYCA 5KVIA 4EMIA 2JAEA 2WOIA 3AXBA 3AE6A 3GMBA 5HHFA 4HB9A 2C72A 3AYIA 2BRAA 2IVEA 1O5WA 4J34A 4Y4NA 4BJYA 4YTMA 5U63A 1UKVG 1S3BA 4DNAA 1ZMDA 1RYIA 4OPIA 1PBBA 3GRSA 4OPLA 3WE0A 3DJEA 3GMCA 1CF3A 2E5VA 3E1TA 4G9KA 1LTXR 3GYIA 4U8KA 4BURA 1Y56A 3CNJA 3K7TA 1GNDA 4U8OA 3CIRA 2C3DA 3DJJA 4JNQA 3RP6A 1N4VA 3DK8A 2WPEA 4DSGA 1OJAA 3T31A 4H4WA 4NTCA 1LJ1A 3VQRA 3AE1A 1TYPA 1DXLA 3D8XA 4EM3A 2GAGB 1H82A 1ZDLA 3VRBA 1CHUA 5KRQA 3DGZA 2JK6A 2GR1A 3NN6X 1PDHA 1FEAA 3AE2A 4UDPA 4Z25A 3C4NA 2IIDA 1CJ3A 2XLRA 5CKUA 3SY4A 2XFQA 4PAAA 2BC1A 3T37A 3D1CA 3LZWA 3L8KA 3KLJA 3UKAA 2JBVA 1JNZA 1ELIA 1ZK7A 4Z44A 1QO8A 1TRBA 2C75A 2R0CA 2X99A 3SXIA 4B66A 4JN9A 1CC2A 3K7QX 1GPEA 3LOVA 4TM3A 1LQUA 2A8XA 2NPXA 3KVEA 4K5SA 1E1LA 1N4UA 2PHHA 3EPTA 3KKJA 4O5UA 2YAUA 3NT6A 3V3OA 3CPHG 2R0GA 4H4UA 4TLZA 1XDIA 2A89A 2GR2A 1OJDA 3URHA 3AEGA 5ER0A 2C70A 2YG7A 4YSZA 3ALLA 2GR3A 4ECHA 2XLPA 3COXA 4JY2A 3IC9A 4FK1C 2C65A 4AOXA 2A87A 4AT2A 4D04A 2B7SA 1GEUA 5TR3A 4U2SA 4EM4A 1KNRA 1TDOA 4CRTA 4EMJA 1NENA 2DKHA 3UKKA 4J31A 4KX6A 4A6NA 1DODA 1D7YA 1EL5A 4NTDA 3AE5A 4XWRA 2XVJA 5HY5A 2R4EA 4C74A 3K7MX 5M0ZA 2VQBA 3QVPA 5HXIA 3DH9A 4IA6A 4A99A 2Y6QA 3CPJG 2XVIA 2EQ8A 4GUVA 1N4WA 2EQ9A 3KA7A 3NN0X 3V76A 3CTYA 2APGA 2GF3A 4YKFA 1ZP0A 1BWCA 4U2TA 3G5SA 2C73A 1OJCA 2V3AA 4GDEA 3SFDA 1CJCA 1TDNA 1XPQA 4REKA 1JRXA 3P4PA 1L9CA 2BABA 3BNMA 1Q1RA 1LQTA 1XHCA 4U8PA 1D4DA 5KMSA 3NHOX 5EB5A 3VR8A 2O9ZA 2YQUA 2C4CA 2H89A 3OZ2A 3NTDA 4O5QA 3CGBA 5CQFA 4U8MA 4Z2UA 2B9WA 3PVCA 4KPRA 5JCIA 4D03A 1S2QA 2WESA 3AEBA 4FX9A 4A9WA 2GMJA 3T2ZA 4I59A 1RSGA 3EANA 2VZ2A 3RHAA 1NAAA 1Y0PA 3UKFA 2V60A 2JKCA 3AE7A 2OLNA 4H4TA 4JQ9A 4NTEA 2YLZA 2VRLA 3F8DA 1PBFA 2BC0A 1XANA 2ZZBA 3KPKA 4K22A 4EMWA 3GDPA 1ZKQA 3G5QA 2X8CA 1OJTA 3DJGX 3CNTA 3QSSA 4U2LA 2VRMA 3ABVA 4H4QA 1PXAA 5EBKA 1P2EA 2OALA 1F3PA 2EQ6A 2QCUA 4P9SA 3P9UA 3T0KA 2XFNA 3ADAB 1BGJA 3UTEA 4WX1A 1KF6A 2GQWA 1TDEA 1E7PA 3GWFA 3I3LA 1JOAA 5JCLA 1B8SA 3BNUA 1FEBA 3I6DA 2J3NA 1JEHA 1CC4A 3L1RA 2ZBWA 4RG3A 2YWLA 2C76A 1IUUA 3BI5A 2BACA 4IV9A 2YM1A 1H7WA 2GVCA 3FMWA 4JY3A 3SM8A 4XWZA 2XFPA 3H8LA 2WDRA 3KPFA 5U25A 2R45A 3PO7A 1L9EA 2R0PA 2YR4A 4H2PA 3NK1X 4II3A 5FMHA 4CBQA 3GD4A 4B1BA 4ZCDA 4CCQA 1KFYA 1PHHA 4U8NA 2E1MA 4H4VA 3SZFA 3O0HA 4GDPA 2GQFA 1OJ9A 3AB1A 4WCTA 1CL0A 1FCDA 4OPDA 3UOXA 5BVAA 1V59A 1FOHA 3AD9B 3FPZA 4Y4LA 2WP9A 2JB2A 1DJQA 1E39A 4ICYA 1PJ7A 4CNJA 1EL9A 3BI2A 3IF9A 2Q0KA 3C4AA 1H6VA 3F8PA 4U8IA 5KVHA 3CNSA 2X3NA 3UKPA 1N1PA 2HQMA 4A65A 3P4SA 2QA1A 4G6HA 1GRTA 4B67A 1GRGA 5J60A 3GYXA 1D5TA 1NHSA 1P2HA 1RP0A 4I58A 3ICSA 4H4SA 4B65A 4Z43A 3JSKA 1CJ2A 1D4EA 2R4JA 2V3BA 2YLWA 4ZCCA 1E1MA 2BK3A 2WPFA 2R46A 4J56A 4YKGA 2B9YA 1Z6LA 1W4XA 2YLRA 5KOXA 2CDUA 3C96A 2TMDA 2WETA 2F5ZA 2XLSA 4MJWA 4BJZA 1GT8A 2YG4A 4NZHA 2I0ZA 2BRYA 1IUTA 1D7LA 1PBEA 2Y6RA 2RGJA 3ICRA 4X4JA 1DOEA 2WDQA 3M0OA 3CN8A 4OVIA 1H81A 4C3YA 3T2YA 1BF3A 1X31B 2BXSA 4J2WA 4ZN0A 3NRNA 2JB3A 1GRAA 5FS6A 3AD7B 4FK1A 4PABA 3HYVA 2YLXA 4USRA 1D4CA 3R9UA 1E1NA 1S3EA 3AD8B 3LB8A 2IVDA 4B68A 2OLOA 4A79A 3IHGA 3IWAA 3ALJA 3VR9A 4M52A 1SEZA 4N9XA 4YT0A 1MXTA 3RNMA 2H88A 2GEWA 4GAVA 4IVOB 2XYOA 1GERA 2YVFA 4USQA 1NPXA 1TDFA 4J36A 1HYUA 5EOWA 1L0VA 4B64A 3GDNA 3RP8A 3NIXA 4K8DA 3CPIG 3NLCA 4BK1A 2OA1A 2YVJA 1FECA 3B3RA 4TM4A 3DMEA 1BGNA 3AECA 4UDRA 1GV4A 1QJDA 1MOKA 2NVKX 3QSMA 3SZCA 4JDRA 4BK2A 3AE8A 4EQXA 3CGEA 2V6OA 5C3JA 3GRTA 1YQZA 3SZWA 4NWZA 2GV8A 1F8WA 3QFAA 1KSUA 1NG4A 4A7AA 2OAMA 3AYLA 4C5OA 2BS2A 4NNJA 2TPRA 2XFOA 2XVHA 4LA1A 5IQ4A 1F8SA 2YLTA 4K7ZA 4H7UA 5KWFA 3H4KA 5M10A 1GRFA 1JNRA 2GAHB 1COYA 2XVFA 3DA1A 3DGHA 4YTPA 4K2XA 2RGOA 4Z26A 1VDCA 4LU6A 5JCNA 2ACZA 3KU9A 1KDGA 1Y56B 1NG3A 2YG5A 1K0IA 5KXJA 1GTEA 3SYIA 4YWOA 5BULA 3S5WA 2YLSA 1L9DA 1LVLA 1YQ3A 2B7RA 1M6IA 3LADA 4APNA 1TDKA 1K4QA 1TYTA 2BYBA 2QA2A 2ZZ0A 2XFUA 4NEWA 1DNCA 2R9ZA 3ISHA 2WP6A 5KNLA 3QVRA 3DK4A 3ZYXA 1M64A 4H4XA 3S61A 3AEAA 3M13A 1YY5A 3P4RA 3VRAA 3KD9A 4E0VA 2FJDA 3ZDNA 4AP1A 4OPTA 2GB0A 2YG3A 4CY8A 1GSNA 1ZMCA 2C67A 3NK0X 4GCMA 1IUVA 4B69A
chains in the Genus database with same CATH topology
2CVJA 3CMMA 3UKQA 2BCPA 2JB1A 2DKIA 1DOBA 3AE4A 3HZLA 1VG0A 1CBOA 2VQ7A 4UP3A 3P1WA 4HA6A 4H50A 4K5RA 5C2TA 3Q9TA 4J33A 2PYXA 4ADWA 2VVLG 3ATQA 4H2RA 1PBCA 1PS9A 5KOWA 1GXFA 1IUSA 1EBDA 3SZ0A 1REOA 4H4YA 4Z24A 4C3XA 3IHMA 2QAEA 1PXBA 2FJBA 1LV0A 1NDAA 2WP5A 3LXDA 3AE3A 4H4ZA 3FIMB 5JCMA 3NGCX 2WOVA 4TM1A 4A6NB 2AR8A 2GMHA 4CNKA 3DK9A 4IA5A 2W0HA 4CCRA 2XCGA 1NHRA 1KSSA 1E6EA 4EQWA 1PJ6A 1FL2A 3EF6A 1NHPA 3T2KA 2RGHA 5IPYA 2WU5A 5JCKA 2X8GA 3RP7A 3FBSA 4GAPA 2AQJA 4G73A 1F6MA 1Q9IA 2B76A 3Q6JA 4IVMB 5IQ1A 4A5LA 2ZZCA 2BA9A 3GYJA 4EQSA 3ICTA 5HYMA 4G6GA 4X9MA 3UOVA 3QSEA 1PJ5A 4RSLA 3UOYA 1GALA 4BK3A 2V61A 1JU2A 3AWIA 3ITJA 4H4RA 3HYXA 5GSNA 4H4PA 2XLTA 4FDCB 4C77A 2FJEA 3OC4A 2XDOA 4TM0A 2WOWA 3GD3A 4YTNA 2GR0A 5BUKA 4JNAA 3DJDA 5L46A 3HYWA 2Q6UA 2WEUA 1JRZA 2VVMA 2C7GA 2V5ZA 3UKHA 3NNEA 2ARDA 3SFEA 1DJNA 2Z5YA 4OPGA 3UTHA 4OCGA 3LJPA 2WS3A 2RABA 3H8IA 3II4A 1B4VA 5KMPA 1GESA 4YSXA 1Q1WA 2C3CA 1JRYA 3AEEA 4GR1A 2BXRA 3F8RA 1H83A 5FS8A 5KMQA 4CY6A 4TLXA 4GRTA 3EAOA 3QJ4A 5LV9A 1S2YA 3UP5A 2Q0LA 1KNPA 1GTHA 1B5QA 3REDA 3V3NA 1QLBA 4RG4A 5FS9A 3UTFA 1GREA 1O94A 3T14A 4J57A 1CJ4A 4AP3A 1GRHA 3CNPA 3AYJA 1NHQA 2BS4A 2YVGA 3BHFA 4EIPA 1F8RA 1ONFA 4H2NA 2WDVA 2BK5A 2YM2A 4U8JA 1PN0A 3VRDB 1PXCA 3CNDA 4U8LA 2X8HA 2AAQA 3UOZA 1YQ4A 3NG7X 2UZZA 3SQPA 1NEKA 1YKJA 3B6DA 4LIIA 4BV6A 2C66A 2BCGG 4B63A 1K0JA 2CFYA 5DBJA 3UP4A 1BKWA 5BRTA 2E4GA 2Q7VA 3ATRA 5EB4A 4YXDA 4II2A 3UKLA 1GOSA 2CULA 4EIQA 4OPCA 3CGCA 3NTAA 2X50A 4AT0A 2B9XA 3G5RA 1K0LA 2FJAA 1VRQB 1ZOYA 2FBWA 2YR6A 2BK4A 4OPUA 5FS7A 4Z2TA 3SX6A 1LPFA 1AOGA 4X9NA 4DGKA 1IUWA 4EQRA 3K30A 3PS9A 3NH3X 1GRBA 1ZOVA 4H2QA 1GETA 3M12A 1EL8A 1DOCA 3AE9A 1PBDA 1BZLA 2EQ7A 2YG6A 1EL7A 4Y4MA 2WBAA 2XLUA 1CC6A 2YR5A 3ALMA 3GWDA 4YSHA 2WPCA 4NEVA 1IJHA 2GRTA 1IUXA 2WQYA 3NK2X 4DSHA 1B37A 5J7XA 2BS3A 3NYFA 4AOSA 3AEDA 3FG2P 5KMRA 3SGLA 2WU2A 3GSIA 4GF7A 1ZX9A 1H7XA 2VVLA 2Z5XA 3BI4A 1VG9A 1ZY8A 1H86A 4G74A 3CGDA 3UTGA 3P4QA 4XXGA 4YSYA 5U1OA 2XVEA 3BHKA 2WHDA 5GRTA 4UDQA 1E1KA 3NKSA 1O95A 2C64A 2GH5A 1H84A 3QFBA 3AEFA 3LZXA 3NYEA 3UCLA 4Z2RA 1VQWA 1MO9A 2VOUA 3NYCA 5KVIA 4EMIA 2JAEA 2WOIA 3AXBA 3AE6A 3GMBA 5HHFA 4HB9A 2C72A 3AYIA 2BRAA 2IVEA 1O5WA 4J34A 4Y4NA 4BJYA 4YTMA 5U63A 1UKVG 1S3BA 4DNAA 1ZMDA 1RYIA 4OPIA 1PBBA 3GRSA 4OPLA 3WE0A 3DJEA 3GMCA 1CF3A 2E5VA 3E1TA 4G9KA 1LTXR 3GYIA 4U8KA 4BURA 1Y56A 3CNJA 3K7TA 1GNDA 4U8OA 3CIRA 2C3DA 3DJJA 4JNQA 3RP6A 1N4VA 3DK8A 2WPEA 4DSGA 1OJAA 3T31A 4H4WA 4NTCA 1LJ1A 3VQRA 3AE1A 1TYPA 1DXLA 3D8XA 4EM3A 2GAGB 1H82A 1ZDLA 3VRBA 1CHUA 5KRQA 3DGZA 2JK6A 2GR1A 3NN6X 1PDHA 1FEAA 3AE2A 4UDPA 4Z25A 3C4NA 2IIDA 1CJ3A 2XLRA 5CKUA 3SY4A 2XFQA 4PAAA 2BC1A 3T37A 3D1CA 3LZWA 3L8KA 3KLJA 3UKAA 2JBVA 1JNZA 1ELIA 1ZK7A 4Z44A 1QO8A 1TRBA 2C75A 2R0CA 2X99A 3SXIA 4B66A 4JN9A 1CC2A 3K7QX 1GPEA 3LOVA 4TM3A 1LQUA 2A8XA 2NPXA 3KVEA 4K5SA 1E1LA 1N4UA 2PHHA 3EPTA 3KKJA 4O5UA 2YAUA 3NT6A 3V3OA 3CPHG 2R0GA 4H4UA 4TLZA 1XDIA 2A89A 2GR2A 1OJDA 3URHA 3AEGA 5ER0A 2C70A 2YG7A 4YSZA 3ALLA 2GR3A 4ECHA 2XLPA 3COXA 4JY2A 3IC9A 4FK1C 2C65A 4AOXA 2A87A 4AT2A 4D04A 2B7SA 1GEUA 5TR3A 4U2SA 4EM4A 1KNRA 1TDOA 4CRTA 4EMJA 1NENA 2DKHA 3UKKA 4J31A 4KX6A 4A6NA 1DODA 1D7YA 1EL5A 4NTDA 3AE5A 4XWRA 2XVJA 5HY5A 2R4EA 4C74A 3K7MX 5M0ZA 2VQBA 3QVPA 5HXIA 3DH9A 4IA6A 4A99A 2Y6QA 3CPJG 2XVIA 2EQ8A 4GUVA 1N4WA 2EQ9A 3KA7A 3NN0X 3V76A 3CTYA 2APGA 2GF3A 4YKFA 1ZP0A 1BWCA 4U2TA 3G5SA 2C73A 1OJCA 2V3AA 4GDEA 3SFDA 1CJCA 1TDNA 1XPQA 4REKA 1JRXA 3P4PA 1L9CA 2BABA 3BNMA 1Q1RA 1LQTA 1XHCA 4U8PA 1D4DA 5KMSA 3NHOX 5EB5A 3VR8A 2O9ZA 2YQUA 2C4CA 2H89A 3OZ2A 3NTDA 4O5QA 3CGBA 5CQFA 4U8MA 4Z2UA 2B9WA 3PVCA 4KPRA 5JCIA 4D03A 1S2QA 2WESA 3AEBA 4FX9A 4A9WA 2GMJA 3T2ZA 4I59A 1RSGA 3EANA 2VZ2A 3RHAA 1NAAA 1Y0PA 3UKFA 2V60A 2JKCA 3AE7A 2OLNA 4H4TA 4JQ9A 4NTEA 2YLZA 2VRLA 3F8DA 1PBFA 2BC0A 1XANA 2ZZBA 3KPKA 4K22A 4EMWA 3GDPA 1ZKQA 3G5QA 2X8CA 1OJTA 3DJGX 3CNTA 3QSSA 4U2LA 2VRMA 3ABVA 4H4QA 1PXAA 5EBKA 1P2EA 2OALA 1F3PA 2EQ6A 2QCUA 4P9SA 3P9UA 3T0KA 2XFNA 3ADAB 1BGJA 3UTEA 4WX1A 1KF6A 2GQWA 1TDEA 1E7PA 3GWFA 3I3LA 1JOAA 5JCLA 1B8SA 3BNUA 1FEBA 3I6DA 2J3NA 1JEHA 1CC4A 3L1RA 2ZBWA 4RG3A 2YWLA 2C76A 1IUUA 3BI5A 2BACA 4IV9A 2YM1A 1H7WA 2GVCA 3FMWA 4JY3A 3SM8A 4XWZA 2XFPA 3H8LA 2WDRA 3KPFA 5U25A 2R45A 3PO7A 1L9EA 2R0PA 2YR4A 4H2PA 3NK1X 4II3A 5FMHA 4CBQA 3GD4A 4B1BA 4ZCDA 4CCQA 1KFYA 1PHHA 4U8NA 2E1MA 4H4VA 3SZFA 3O0HA 4GDPA 2GQFA 1OJ9A 3AB1A 4WCTA 1CL0A 1FCDA 4OPDA 3UOXA 5BVAA 1V59A 1FOHA 3AD9B 3FPZA 4Y4LA 2WP9A 2JB2A 1DJQA 1E39A 4ICYA 1PJ7A 4CNJA 1EL9A 3BI2A 3IF9A 2Q0KA 3C4AA 1H6VA 3F8PA 4U8IA 5KVHA 3CNSA 2X3NA 3UKPA 1N1PA 2HQMA 4A65A 3P4SA 2QA1A 4G6HA 1GRTA 4B67A 1GRGA 5J60A 3GYXA 1D5TA 1NHSA 1P2HA 1RP0A 4I58A 3ICSA 4H4SA 4B65A 4Z43A 3JSKA 1CJ2A 1D4EA 2R4JA 2V3BA 2YLWA 4ZCCA 1E1MA 2BK3A 2WPFA 2R46A 4J56A 4YKGA 2B9YA 1Z6LA 1W4XA 2YLRA 5KOXA 2CDUA 3C96A 2TMDA 2WETA 2F5ZA 2XLSA 4MJWA 4BJZA 1GT8A 2YG4A 4NZHA 2I0ZA 2BRYA 1IUTA 1D7LA 1PBEA 2Y6RA 2RGJA 3ICRA 4X4JA 1DOEA 2WDQA 3M0OA 3CN8A 4OVIA 1H81A 4C3YA 3T2YA 1BF3A 1X31B 2BXSA 4J2WA 4ZN0A 3NRNA 2JB3A 1GRAA 5FS6A 3AD7B 4FK1A 4PABA 3HYVA 2YLXA 4USRA 1D4CA 3R9UA 1E1NA 1S3EA 3AD8B 3LB8A 2IVDA 4B68A 2OLOA 4A79A 3IHGA 3IWAA 3ALJA 3VR9A 4M52A 1SEZA 4N9XA 4YT0A 1MXTA 3RNMA 2H88A 2GEWA 4GAVA 4IVOB 2XYOA 1GERA 2YVFA 4USQA 1NPXA 1TDFA 4J36A 1HYUA 5EOWA 1L0VA 4B64A 3GDNA 3RP8A 3NIXA 4K8DA 3CPIG 3NLCA 4BK1A 2OA1A 2YVJA 1FECA 3B3RA 4TM4A 3DMEA 1BGNA 3AECA 4UDRA 1GV4A 1QJDA 1MOKA 2NVKX 3QSMA 3SZCA 4JDRA 4BK2A 3AE8A 4EQXA 3CGEA 2V6OA 5C3JA 3GRTA 1YQZA 3SZWA 4NWZA 2GV8A 1F8WA 3QFAA 1KSUA 1NG4A 4A7AA 2OAMA 3AYLA 4C5OA 2BS2A 4NNJA 2TPRA 2XFOA 2XVHA 4LA1A 5IQ4A 1F8SA 2YLTA 4K7ZA 4H7UA 5KWFA 3H4KA 5M10A 1GRFA 1JNRA 2GAHB 1COYA 2XVFA 3DA1A 3DGHA 4YTPA 4K2XA 2RGOA 4Z26A 1VDCA 4LU6A 5JCNA 2ACZA 3KU9A 1KDGA 1Y56B 1NG3A 2YG5A 1K0IA 5KXJA 1GTEA 3SYIA 4YWOA 5BULA 3S5WA 2YLSA 1L9DA 1LVLA 1YQ3A 2B7RA 1M6IA 3LADA 4APNA 1TDKA 1K4QA 1TYTA 2BYBA 2QA2A 2ZZ0A 2XFUA 4NEWA 1DNCA 2R9ZA 3ISHA 2WP6A 5KNLA 3QVRA 3DK4A 3ZYXA 1M64A 4H4XA 3S61A 3AEAA 3M13A 1YY5A 3P4RA 3VRAA 3KD9A 4E0VA 2FJDA 3ZDNA 4AP1A 4OPTA 2GB0A 2YG3A 4CY8A 1GSNA 1ZMCA 2C67A 3NK0X 4GCMA 1IUVA 4B69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZC A;  3T2K A;  3SZW A;  4GAP A;  4NWZ A;  5KMP A;  4G73 A;  3T2Z A;  3SY4 A;  4G6G A;  4GAV A;  5KMQ A;  3HYX A;  3SZ0 A;  4G6H A;  3KPK A;  4G9K A;  3SZF A;  3T2Y A;  3SXI A;  5KMR A;  5KMS A;  3T14 A;  4G74 A;  3HYW A;  3T31 A;  3HYV A;  3SX6 A;  3T0K A;  3SYI A; 
#chains in the Genus database with same CATH topology
 2CVJ A;  3CMM A;  3UKQ A;  2BCP A;  2JB1 A;  2DKI A;  1DOB A;  3AE4 A;  3HZL A;  1VG0 A;  1CBO A;  2VQ7 A;  4UP3 A;  3P1W A;  4HA6 A;  4H50 A;  4K5R A;  5C2T A;  3Q9T A;  4J33 A;  2PYX A;  4ADW A;  2VVL G;  3ATQ A;  4H2R A;  1PBC A;  1PS9 A;  5KOW A;  1GXF A;  1IUS A;  1EBD A;  3SZ0 A;  1REO A;  4H4Y A;  4Z24 A;  4C3X A;  3IHM A;  2QAE A;  1PXB A;  2FJB A;  1LV0 A;  1NDA A;  2WP5 A;  3LXD A;  3AE3 A;  4H4Z A;  3FIM B;  5JCM A;  3NGC X;  2WOV A;  4TM1 A;  4A6N B;  2AR8 A;  2GMH A;  4CNK A;  3DK9 A;  4IA5 A;  2W0H A;  4CCR A;  2XCG A;  1NHR A;  1KSS A;  1E6E A;  4EQW A;  1PJ6 A;  1FL2 A;  3EF6 A;  1NHP A;  3T2K A;  2RGH A;  5IPY A;  2WU5 A;  5JCK A;  2X8G A;  3RP7 A;  3FBS A;  4GAP A;  2AQJ A;  4G73 A;  1F6M A;  1Q9I A;  2B76 A;  3Q6J A;  4IVM B;  5IQ1 A;  4A5L A;  2ZZC A;  2BA9 A;  3GYJ A;  4EQS A;  3ICT A;  5HYM A;  4G6G A;  4X9M A;  3UOV A;  3QSE A;  1PJ5 A;  4RSL A;  3UOY A;  1GAL A;  4BK3 A;  2V61 A;  1JU2 A;  3AWI A;  3ITJ A;  4H4R A;  3HYX A;  5GSN A;  4H4P A;  2XLT A;  4FDC B;  4C77 A;  2FJE A;  3OC4 A;  2XDO A;  4TM0 A;  2WOW A;  3GD3 A;  4YTN A;  2GR0 A;  5BUK A;  4JNA A;  3DJD A;  5L46 A;  3HYW A;  2Q6U A;  2WEU A;  1JRZ A;  2VVM A;  2C7G A;  2V5Z A;  3UKH A;  3NNE A;  2ARD A;  3SFE A;  1DJN A;  2Z5Y A;  4OPG A;  3UTH A;  4OCG A;  3LJP A;  2WS3 A;  2RAB A;  3H8I A;  3II4 A;  1B4V A;  5KMP A;  1GES A;  4YSX A;  1Q1W A;  2C3C A;  1JRY A;  3AEE A;  4GR1 A;  2BXR A;  3F8R A;  1H83 A;  5FS8 A;  5KMQ A;  4CY6 A;  4TLX A;  4GRT A;  3EAO A;  3QJ4 A;  5LV9 A;  1S2Y A;  3UP5 A;  2Q0L A;  1KNP A;  1GTH A;  1B5Q A;  3RED A;  3V3N A;  1QLB A;  4RG4 A;  5FS9 A;  3UTF A;  1GRE A;  1O94 A;  3T14 A;  4J57 A;  1CJ4 A;  4AP3 A;  1GRH A;  3CNP A;  3AYJ A;  1NHQ A;  2BS4 A;  2YVG A;  3BHF A;  4EIP A;  1F8R A;  1ONF A;  4H2N A;  2WDV A;  2BK5 A;  2YM2 A;  4U8J A;  1PN0 A;  3VRD B;  1PXC A;  3CND A;  4U8L A;  2X8H A;  2AAQ A;  3UOZ A;  1YQ4 A;  3NG7 X;  2UZZ A;  3SQP A;  1NEK A;  1YKJ A;  3B6D A;  4LII A;  4BV6 A;  2C66 A;  2BCG G;  4B63 A;  1K0J A;  2CFY A;  5DBJ A;  3UP4 A;  1BKW A;  5BRT A;  2E4G A;  2Q7V A;  3ATR A;  5EB4 A;  4YXD A;  4II2 A;  3UKL A;  1GOS A;  2CUL A;  4EIQ A;  4OPC A;  3CGC A;  3NTA A;  2X50 A;  4AT0 A;  2B9X A;  3G5R A;  1K0L A;  2FJA A;  1VRQ B;  1ZOY A;  2FBW A;  2YR6 A;  2BK4 A;  4OPU A;  5FS7 A;  4Z2T A;  3SX6 A;  1LPF A;  1AOG A;  4X9N A;  4DGK A;  1IUW A;  4EQR A;  3K30 A;  3PS9 A;  3NH3 X;  1GRB A;  1ZOV A;  4H2Q A;  1GET A;  3M12 A;  1EL8 A;  1DOC A;  3AE9 A;  1PBD A;  1BZL A;  2EQ7 A;  2YG6 A;  1EL7 A;  4Y4M A;  2WBA A;  2XLU A;  1CC6 A;  2YR5 A;  3ALM A;  3GWD A;  4YSH A;  2WPC A;  4NEV A;  1IJH A;  2GRT A;  1IUX A;  2WQY A;  3NK2 X;  4DSH A;  1B37 A;  5J7X A;  2BS3 A;  3NYF A;  4AOS A;  3AED A;  3FG2 P;  5KMR A;  3SGL A;  2WU2 A;  3GSI A;  4GF7 A;  1ZX9 A;  1H7X A;  2VVL A;  2Z5X A;  3BI4 A;  1VG9 A;  1ZY8 A;  1H86 A;  4G74 A;  3CGD A;  3UTG A;  3P4Q A;  4XXG A;  4YSY A;  5U1O A;  2XVE A;  3BHK A;  2WHD A;  5GRT A;  4UDQ A;  1E1K A;  3NKS A;  1O95 A;  2C64 A;  2GH5 A;  1H84 A;  3QFB A;  3AEF A;  3LZX A;  3NYE A;  3UCL A;  4Z2R A;  1VQW A;  1MO9 A;  2VOU A;  3NYC A;  5KVI A;  4EMI A;  2JAE A;  2WOI A;  3AXB A;  3AE6 A;  3GMB A;  5HHF A;  4HB9 A;  2C72 A;  3AYI A;  2BRA A;  2IVE A;  1O5W A;  4J34 A;  4Y4N A;  4BJY A;  4YTM A;  5U63 A;  1UKV G;  1S3B A;  4DNA A;  1ZMD A;  1RYI A;  4OPI A;  1PBB A;  3GRS A;  4OPL A;  3WE0 A;  3DJE A;  3GMC A;  1CF3 A;  2E5V A;  3E1T A;  4G9K A;  1LTX R;  3GYI A;  4U8K A;  4BUR A;  1Y56 A;  3CNJ A;  3K7T A;  1GND A;  4U8O A;  3CIR A;  2C3D A;  3DJJ A;  4JNQ A;  3RP6 A;  1N4V A;  3DK8 A;  2WPE A;  4DSG A;  1OJA A;  3T31 A;  4H4W A;  4NTC A;  1LJ1 A;  3VQR A;  3AE1 A;  1TYP A;  1DXL A;  3D8X A;  4EM3 A;  2GAG B;  1H82 A;  1ZDL A;  3VRB A;  1CHU A;  5KRQ A;  3DGZ A;  2JK6 A;  2GR1 A;  3NN6 X;  1PDH A;  1FEA A;  3AE2 A;  4UDP A;  4Z25 A;  3C4N A;  2IID A;  1CJ3 A;  2XLR A;  5CKU A;  3SY4 A;  2XFQ A;  4PAA A;  2BC1 A;  3T37 A;  3D1C A;  3LZW A;  3L8K A;  3KLJ A;  3UKA A;  2JBV A;  1JNZ A;  1ELI A;  1ZK7 A;  4Z44 A;  1QO8 A;  1TRB A;  2C75 A;  2R0C A;  2X99 A;  3SXI A;  4B66 A;  4JN9 A;  1CC2 A;  3K7Q X;  1GPE A;  3LOV A;  4TM3 A;  1LQU A;  2A8X A;  2NPX A;  3KVE A;  4K5S A;  1E1L A;  1N4U A;  2PHH A;  3EPT A;  3KKJ A;  4O5U A;  2YAU A;  3NT6 A;  3V3O A;  3CPH G;  2R0G A;  4H4U A;  4TLZ A;  1XDI A;  2A89 A;  2GR2 A;  1OJD A;  3URH A;  3AEG A;  5ER0 A;  2C70 A;  2YG7 A;  4YSZ A;  3ALL A;  2GR3 A;  4ECH A;  2XLP A;  3COX A;  4JY2 A;  3IC9 A;  4FK1 C;  2C65 A;  4AOX A;  2A87 A;  4AT2 A;  4D04 A;  2B7S A;  1GEU A;  5TR3 A;  4U2S A;  4EM4 A;  1KNR A;  1TDO A;  4CRT A;  4EMJ A;  1NEN A;  2DKH A;  3UKK A;  4J31 A;  4KX6 A;  4A6N A;  1DOD A;  1D7Y A;  1EL5 A;  4NTD A;  3AE5 A;  4XWR A;  2XVJ A;  5HY5 A;  2R4E A;  4C74 A;  3K7M X;  5M0Z A;  2VQB A;  3QVP A;  5HXI A;  3DH9 A;  4IA6 A;  4A99 A;  2Y6Q A;  3CPJ G;  2XVI A;  2EQ8 A;  4GUV A;  1N4W A;  2EQ9 A;  3KA7 A;  3NN0 X;  3V76 A;  3CTY A;  2APG A;  2GF3 A;  4YKF A;  1ZP0 A;  1BWC A;  4U2T A;  3G5S A;  2C73 A;  1OJC A;  2V3A A;  4GDE A;  3SFD A;  1CJC A;  1TDN A;  1XPQ A;  4REK A;  1JRX A;  3P4P A;  1L9C A;  2BAB A;  3BNM A;  1Q1R A;  1LQT A;  1XHC A;  4U8P A;  1D4D A;  5KMS A;  3NHO X;  5EB5 A;  3VR8 A;  2O9Z A;  2YQU A;  2C4C A;  2H89 A;  3OZ2 A;  3NTD A;  4O5Q A;  3CGB A;  5CQF A;  4U8M A;  4Z2U A;  2B9W A;  3PVC A;  4KPR A;  5JCI A;  4D03 A;  1S2Q A;  2WES A;  3AEB A;  4FX9 A;  4A9W A;  2GMJ A;  3T2Z A;  4I59 A;  1RSG A;  3EAN A;  2VZ2 A;  3RHA A;  1NAA A;  1Y0P A;  3UKF A;  2V60 A;  2JKC A;  3AE7 A;  2OLN A;  4H4T A;  4JQ9 A;  4NTE A;  2YLZ A;  2VRL A;  3F8D A;  1PBF A;  2BC0 A;  1XAN A;  2ZZB A;  3KPK A;  4K22 A;  4EMW A;  3GDP A;  1ZKQ A;  3G5Q A;  2X8C A;  1OJT A;  3DJG X;  3CNT A;  3QSS A;  4U2L A;  2VRM A;  3ABV A;  4H4Q A;  1PXA A;  5EBK A;  1P2E A;  2OAL A;  1F3P A;  2EQ6 A;  2QCU A;  4P9S A;  3P9U A;  3T0K A;  2XFN A;  3ADA B;  1BGJ A;  3UTE A;  4WX1 A;  1KF6 A;  2GQW A;  1TDE A;  1E7P A;  3GWF A;  3I3L A;  1JOA A;  5JCL A;  1B8S A;  3BNU A;  1FEB A;  3I6D A;  2J3N A;  1JEH A;  1CC4 A;  3L1R A;  2ZBW A;  4RG3 A;  2YWL A;  2C76 A;  1IUU A;  3BI5 A;  2BAC A;  4IV9 A;  2YM1 A;  1H7W A;  2GVC A;  3FMW A;  4JY3 A;  3SM8 A;  4XWZ A;  2XFP A;  3H8L A;  2WDR A;  3KPF A;  5U25 A;  2R45 A;  3PO7 A;  1L9E A;  2R0P A;  2YR4 A;  4H2P A;  3NK1 X;  4II3 A;  5FMH A;  4CBQ A;  3GD4 A;  4B1B A;  4ZCD A;  4CCQ A;  1KFY A;  1PHH A;  4U8N A;  2E1M A;  4H4V A;  3SZF A;  3O0H A;  4GDP A;  2GQF A;  1OJ9 A;  3AB1 A;  4WCT A;  1CL0 A;  1FCD A;  4OPD A;  3UOX A;  5BVA A;  1V59 A;  1FOH A;  3AD9 B;  3FPZ A;  4Y4L A;  2WP9 A;  2JB2 A;  1DJQ A;  1E39 A;  4ICY A;  1PJ7 A;  4CNJ A;  1EL9 A;  3BI2 A;  3IF9 A;  2Q0K A;  3C4A A;  1H6V A;  3F8P A;  4U8I A;  5KVH A;  3CNS A;  2X3N A;  3UKP A;  1N1P A;  2HQM A;  4A65 A;  3P4S A;  2QA1 A;  4G6H A;  1GRT A;  4B67 A;  1GRG A;  5J60 A;  3GYX A;  1D5T A;  1NHS A;  1P2H A;  1RP0 A;  4I58 A;  3ICS A;  4H4S A;  4B65 A;  4Z43 A;  3JSK A;  1CJ2 A;  1D4E A;  2R4J A;  2V3B A;  2YLW A;  4ZCC A;  1E1M A;  2BK3 A;  2WPF A;  2R46 A;  4J56 A;  4YKG A;  2B9Y A;  1Z6L A;  1W4X A;  2YLR A;  5KOX A;  2CDU A;  3C96 A;  2TMD A;  2WET A;  2F5Z A;  2XLS A;  4MJW A;  4BJZ A;  1GT8 A;  2YG4 A;  4NZH A;  2I0Z A;  2BRY A;  1IUT A;  1D7L A;  1PBE A;  2Y6R A;  2RGJ A;  3ICR A;  4X4J A;  1DOE A;  2WDQ A;  3M0O A;  3CN8 A;  4OVI A;  1H81 A;  4C3Y A;  3T2Y A;  1BF3 A;  1X31 B;  2BXS A;  4J2W A;  4ZN0 A;  3NRN A;  2JB3 A;  1GRA A;  5FS6 A;  3AD7 B;  4FK1 A;  4PAB A;  3HYV A;  2YLX A;  4USR A;  1D4C A;  3R9U A;  1E1N A;  1S3E A;  3AD8 B;  3LB8 A;  2IVD A;  4B68 A;  2OLO A;  4A79 A;  3IHG A;  3IWA A;  3ALJ A;  3VR9 A;  4M52 A;  1SEZ A;  4N9X A;  4YT0 A;  1MXT A;  3RNM A;  2H88 A;  2GEW A;  4GAV A;  4IVO B;  2XYO A;  1GER A;  2YVF A;  4USQ A;  1NPX A;  1TDF A;  4J36 A;  1HYU A;  5EOW A;  1L0V A;  4B64 A;  3GDN A;  3RP8 A;  3NIX A;  4K8D A;  3CPI G;  3NLC A;  4BK1 A;  2OA1 A;  2YVJ A;  1FEC A;  3B3R A;  4TM4 A;  3DME A;  1BGN A;  3AEC A;  4UDR A;  1GV4 A;  1QJD A;  1MOK A;  2NVK X;  3QSM A;  3SZC A;  4JDR A;  4BK2 A;  3AE8 A;  4EQX A;  3CGE A;  2V6O A;  5C3J A;  3GRT A;  1YQZ A;  3SZW A;  4NWZ A;  2GV8 A;  1F8W A;  3QFA A;  1KSU A;  1NG4 A;  4A7A A;  2OAM A;  3AYL A;  4C5O A;  2BS2 A;  4NNJ A;  2TPR A;  2XFO A;  2XVH A;  4LA1 A;  5IQ4 A;  1F8S A;  2YLT A;  4K7Z A;  4H7U A;  5KWF A;  3H4K A;  5M10 A;  1GRF A;  1JNR A;  2GAH B;  1COY A;  2XVF A;  3DA1 A;  3DGH A;  4YTP A;  4K2X A;  2RGO A;  4Z26 A;  1VDC A;  4LU6 A;  5JCN A;  2ACZ A;  3KU9 A;  1KDG A;  1Y56 B;  1NG3 A;  2YG5 A;  1K0I A;  5KXJ A;  1GTE A;  3SYI A;  4YWO A;  5BUL A;  3S5W A;  2YLS A;  1L9D A;  1LVL A;  1YQ3 A;  2B7R A;  1M6I A;  3LAD A;  4APN A;  1TDK A;  1K4Q A;  1TYT A;  2BYB A;  2QA2 A;  2ZZ0 A;  2XFU A;  4NEW A;  1DNC A;  2R9Z A;  3ISH A;  2WP6 A;  5KNL A;  3QVR A;  3DK4 A;  3ZYX A;  1M64 A;  4H4X A;  3S61 A;  3AEA A;  3M13 A;  1YY5 A;  3P4R A;  3VRA A;  3KD9 A;  4E0V A;  2FJD A;  3ZDN A;  4AP1 A;  4OPT A;  2GB0 A;  2YG3 A;  4CY8 A;  1GSN A;  1ZMC A;  2C67 A;  3NK0 X;  4GCM A;  1IUV A;  4B69 A; 
#chains in the Genus database with same CATH homology
 2CVJ A;  3CMM A;  3UKQ A;  2BCP A;  2JB1 A;  2DKI A;  1DOB A;  3AE4 A;  3HZL A;  1VG0 A;  1CBO A;  2VQ7 A;  4UP3 A;  3P1W A;  4HA6 A;  4H50 A;  4K5R A;  5C2T A;  3Q9T A;  4J33 A;  2PYX A;  4ADW A;  2VVL G;  3ATQ A;  4H2R A;  1PBC A;  1PS9 A;  5KOW A;  1GXF A;  1IUS A;  1EBD A;  3SZ0 A;  1REO A;  4H4Y A;  4Z24 A;  4C3X A;  3IHM A;  2QAE A;  1PXB A;  2FJB A;  1LV0 A;  1NDA A;  2WP5 A;  3LXD A;  3AE3 A;  4H4Z A;  3FIM B;  5JCM A;  3NGC X;  2WOV A;  4TM1 A;  4A6N B;  2AR8 A;  2GMH A;  4CNK A;  3DK9 A;  4IA5 A;  2W0H A;  4CCR A;  2XCG A;  1NHR A;  1KSS A;  1E6E A;  4EQW A;  1PJ6 A;  1FL2 A;  3EF6 A;  1NHP A;  3T2K A;  2RGH A;  5IPY A;  2WU5 A;  5JCK A;  2X8G A;  3RP7 A;  3FBS A;  4GAP A;  2AQJ A;  4G73 A;  1F6M A;  1Q9I A;  2B76 A;  3Q6J A;  4IVM B;  5IQ1 A;  4A5L A;  2ZZC A;  2BA9 A;  3GYJ A;  4EQS A;  3ICT A;  5HYM A;  4G6G A;  4X9M A;  3UOV A;  3QSE A;  1PJ5 A;  4RSL A;  3UOY A;  1GAL A;  4BK3 A;  2V61 A;  1JU2 A;  3AWI A;  3ITJ A;  4H4R A;  3HYX A;  5GSN A;  4H4P A;  2XLT A;  4FDC B;  4C77 A;  2FJE A;  3OC4 A;  2XDO A;  4TM0 A;  2WOW A;  3GD3 A;  4YTN A;  2GR0 A;  5BUK A;  4JNA A;  3DJD A;  5L46 A;  3HYW A;  2Q6U A;  2WEU A;  1JRZ A;  2VVM A;  2C7G A;  2V5Z A;  3UKH A;  3NNE A;  2ARD A;  3SFE A;  1DJN A;  2Z5Y A;  4OPG A;  3UTH A;  4OCG A;  3LJP A;  2WS3 A;  2RAB A;  3H8I A;  3II4 A;  1B4V A;  5KMP A;  1GES A;  4YSX A;  1Q1W A;  2C3C A;  1JRY A;  3AEE A;  4GR1 A;  2BXR A;  3F8R A;  1H83 A;  5FS8 A;  5KMQ A;  4CY6 A;  4TLX A;  4GRT A;  3EAO A;  3QJ4 A;  5LV9 A;  1S2Y A;  3UP5 A;  2Q0L A;  1KNP A;  1GTH A;  1B5Q A;  3RED A;  3V3N A;  1QLB A;  4RG4 A;  5FS9 A;  3UTF A;  1GRE A;  1O94 A;  3T14 A;  4J57 A;  1CJ4 A;  4AP3 A;  1GRH A;  3CNP A;  3AYJ A;  1NHQ A;  2BS4 A;  2YVG A;  3BHF A;  4EIP A;  1F8R A;  1ONF A;  4H2N A;  2WDV A;  2BK5 A;  2YM2 A;  4U8J A;  1PN0 A;  3VRD B;  1PXC A;  3CND A;  4U8L A;  2X8H A;  2AAQ A;  3UOZ A;  1YQ4 A;  3NG7 X;  2UZZ A;  3SQP A;  1NEK A;  1YKJ A;  3B6D A;  4LII A;  4BV6 A;  2C66 A;  2BCG G;  4B63 A;  1K0J A;  2CFY A;  5DBJ A;  3UP4 A;  1BKW A;  5BRT A;  2E4G A;  2Q7V A;  3ATR A;  5EB4 A;  4YXD A;  4II2 A;  3UKL A;  1GOS A;  2CUL A;  4EIQ A;  4OPC A;  3CGC A;  3NTA A;  2X50 A;  4AT0 A;  2B9X A;  3G5R A;  1K0L A;  2FJA A;  1VRQ B;  1ZOY A;  2FBW A;  2YR6 A;  2BK4 A;  4OPU A;  5FS7 A;  4Z2T A;  3SX6 A;  1LPF A;  1AOG A;  4X9N A;  4DGK A;  1IUW A;  4EQR A;  3K30 A;  3PS9 A;  3NH3 X;  1GRB A;  1ZOV A;  4H2Q A;  1GET A;  3M12 A;  1EL8 A;  1DOC A;  3AE9 A;  1PBD A;  1BZL A;  2EQ7 A;  2YG6 A;  1EL7 A;  4Y4M A;  2WBA A;  2XLU A;  1CC6 A;  2YR5 A;  3ALM A;  3GWD A;  4YSH A;  2WPC A;  4NEV A;  1IJH A;  2GRT A;  1IUX A;  2WQY A;  3NK2 X;  4DSH A;  1B37 A;  5J7X A;  2BS3 A;  3NYF A;  4AOS A;  3AED A;  3FG2 P;  5KMR A;  3SGL A;  2WU2 A;  3GSI A;  4GF7 A;  1ZX9 A;  1H7X A;  2VVL A;  2Z5X A;  3BI4 A;  1VG9 A;  1ZY8 A;  1H86 A;  4G74 A;  3CGD A;  3UTG A;  3P4Q A;  4XXG A;  4YSY A;  5U1O A;  2XVE A;  3BHK A;  2WHD A;  5GRT A;  4UDQ A;  1E1K A;  3NKS A;  1O95 A;  2C64 A;  2GH5 A;  1H84 A;  3QFB A;  3AEF A;  3LZX A;  3NYE A;  3UCL A;  4Z2R A;  1VQW A;  1MO9 A;  2VOU A;  3NYC A;  5KVI A;  4EMI A;  2JAE A;  2WOI A;  3AXB A;  3AE6 A;  3GMB A;  5HHF A;  4HB9 A;  2C72 A;  3AYI A;  2BRA A;  2IVE A;  1O5W A;  4J34 A;  4Y4N A;  4BJY A;  4YTM A;  5U63 A;  1UKV G;  1S3B A;  4DNA A;  1ZMD A;  1RYI A;  4OPI A;  1PBB A;  3GRS A;  4OPL A;  3WE0 A;  3DJE A;  3GMC A;  1CF3 A;  2E5V A;  3E1T A;  4G9K A;  1LTX R;  3GYI A;  4U8K A;  4BUR A;  1Y56 A;  3CNJ A;  3K7T A;  1GND A;  4U8O A;  3CIR A;  2C3D A;  3DJJ A;  4JNQ A;  3RP6 A;  1N4V A;  3DK8 A;  2WPE A;  4DSG A;  1OJA A;  3T31 A;  4H4W A;  4NTC A;  1LJ1 A;  3VQR A;  3AE1 A;  1TYP A;  1DXL A;  3D8X A;  4EM3 A;  2GAG B;  1H82 A;  1ZDL A;  3VRB A;  1CHU A;  5KRQ A;  3DGZ A;  2JK6 A;  2GR1 A;  3NN6 X;  1PDH A;  1FEA A;  3AE2 A;  4UDP A;  4Z25 A;  3C4N A;  2IID A;  1CJ3 A;  2XLR A;  5CKU A;  3SY4 A;  2XFQ A;  4PAA A;  2BC1 A;  3T37 A;  3D1C A;  3LZW A;  3L8K A;  3KLJ A;  3UKA A;  2JBV A;  1JNZ A;  1ELI A;  1ZK7 A;  4Z44 A;  1QO8 A;  1TRB A;  2C75 A;  2R0C A;  2X99 A;  3SXI A;  4B66 A;  4JN9 A;  1CC2 A;  3K7Q X;  1GPE A;  3LOV A;  4TM3 A;  1LQU A;  2A8X A;  2NPX A;  3KVE A;  4K5S A;  1E1L A;  1N4U A;  2PHH A;  3EPT A;  3KKJ A;  4O5U A;  2YAU A;  3NT6 A;  3V3O A;  3CPH G;  2R0G A;  4H4U A;  4TLZ A;  1XDI A;  2A89 A;  2GR2 A;  1OJD A;  3URH A;  3AEG A;  5ER0 A;  2C70 A;  2YG7 A;  4YSZ A;  3ALL A;  2GR3 A;  4ECH A;  2XLP A;  3COX A;  4JY2 A;  3IC9 A;  4FK1 C;  2C65 A;  4AOX A;  2A87 A;  4AT2 A;  4D04 A;  2B7S A;  1GEU A;  5TR3 A;  4U2S A;  4EM4 A;  1KNR A;  1TDO A;  4CRT A;  4EMJ A;  1NEN A;  2DKH A;  3UKK A;  4J31 A;  4KX6 A;  4A6N A;  1DOD A;  1D7Y A;  1EL5 A;  4NTD A;  3AE5 A;  4XWR A;  2XVJ A;  5HY5 A;  2R4E A;  4C74 A;  3K7M X;  5M0Z A;  2VQB A;  3QVP A;  5HXI A;  3DH9 A;  4IA6 A;  4A99 A;  2Y6Q A;  3CPJ G;  2XVI A;  2EQ8 A;  4GUV A;  1N4W A;  2EQ9 A;  3KA7 A;  3NN0 X;  3V76 A;  3CTY A;  2APG A;  2GF3 A;  4YKF A;  1ZP0 A;  1BWC A;  4U2T A;  3G5S A;  2C73 A;  1OJC A;  2V3A A;  4GDE A;  3SFD A;  1CJC A;  1TDN A;  1XPQ A;  4REK A;  1JRX A;  3P4P A;  1L9C A;  2BAB A;  3BNM A;  1Q1R A;  1LQT A;  1XHC A;  4U8P A;  1D4D A;  5KMS A;  3NHO X;  5EB5 A;  3VR8 A;  2O9Z A;  2YQU A;  2C4C A;  2H89 A;  3OZ2 A;  3NTD A;  4O5Q A;  3CGB A;  5CQF A;  4U8M A;  4Z2U A;  2B9W A;  3PVC A;  4KPR A;  5JCI A;  4D03 A;  1S2Q A;  2WES A;  3AEB A;  4FX9 A;  4A9W A;  2GMJ A;  3T2Z A;  4I59 A;  1RSG A;  3EAN A;  2VZ2 A;  3RHA A;  1NAA A;  1Y0P A;  3UKF A;  2V60 A;  2JKC A;  3AE7 A;  2OLN A;  4H4T A;  4JQ9 A;  4NTE A;  2YLZ A;  2VRL A;  3F8D A;  1PBF A;  2BC0 A;  1XAN A;  2ZZB A;  3KPK A;  4K22 A;  4EMW A;  3GDP A;  1ZKQ A;  3G5Q A;  2X8C A;  1OJT A;  3DJG X;  3CNT A;  3QSS A;  4U2L A;  2VRM A;  3ABV A;  4H4Q A;  1PXA A;  5EBK A;  1P2E A;  2OAL A;  1F3P A;  2EQ6 A;  2QCU A;  4P9S A;  3P9U A;  3T0K A;  2XFN A;  3ADA B;  1BGJ A;  3UTE A;  4WX1 A;  1KF6 A;  2GQW A;  1TDE A;  1E7P A;  3GWF A;  3I3L A;  1JOA A;  5JCL A;  1B8S A;  3BNU A;  1FEB A;  3I6D A;  2J3N A;  1JEH A;  1CC4 A;  3L1R A;  2ZBW A;  4RG3 A;  2YWL A;  2C76 A;  1IUU A;  3BI5 A;  2BAC A;  4IV9 A;  2YM1 A;  1H7W A;  2GVC A;  3FMW A;  4JY3 A;  3SM8 A;  4XWZ A;  2XFP A;  3H8L A;  2WDR A;  3KPF A;  5U25 A;  2R45 A;  3PO7 A;  1L9E A;  2R0P A;  2YR4 A;  4H2P A;  3NK1 X;  4II3 A;  5FMH A;  4CBQ A;  3GD4 A;  4B1B A;  4ZCD A;  4CCQ A;  1KFY A;  1PHH A;  4U8N A;  2E1M A;  4H4V A;  3SZF A;  3O0H A;  4GDP A;  2GQF A;  1OJ9 A;  3AB1 A;  4WCT A;  1CL0 A;  1FCD A;  4OPD A;  3UOX A;  5BVA A;  1V59 A;  1FOH A;  3AD9 B;  3FPZ A;  4Y4L A;  2WP9 A;  2JB2 A;  1DJQ A;  1E39 A;  4ICY A;  1PJ7 A;  4CNJ A;  1EL9 A;  3BI2 A;  3IF9 A;  2Q0K A;  3C4A A;  1H6V A;  3F8P A;  4U8I A;  5KVH A;  3CNS A;  2X3N A;  3UKP A;  1N1P A;  2HQM A;  4A65 A;  3P4S A;  2QA1 A;  4G6H A;  1GRT A;  4B67 A;  1GRG A;  5J60 A;  3GYX A;  1D5T A;  1NHS A;  1P2H A;  1RP0 A;  4I58 A;  3ICS A;  4H4S A;  4B65 A;  4Z43 A;  3JSK A;  1CJ2 A;  1D4E A;  2R4J A;  2V3B A;  2YLW A;  4ZCC A;  1E1M A;  2BK3 A;  2WPF A;  2R46 A;  4J56 A;  4YKG A;  2B9Y A;  1Z6L A;  1W4X A;  2YLR A;  5KOX A;  2CDU A;  3C96 A;  2TMD A;  2WET A;  2F5Z A;  2XLS A;  4MJW A;  4BJZ A;  1GT8 A;  2YG4 A;  4NZH A;  2I0Z A;  2BRY A;  1IUT A;  1D7L A;  1PBE A;  2Y6R A;  2RGJ A;  3ICR A;  4X4J A;  1DOE A;  2WDQ A;  3M0O A;  3CN8 A;  4OVI A;  1H81 A;  4C3Y A;  3T2Y A;  1BF3 A;  1X31 B;  2BXS A;  4J2W A;  4ZN0 A;  3NRN A;  2JB3 A;  1GRA A;  5FS6 A;  3AD7 B;  4FK1 A;  4PAB A;  3HYV A;  2YLX A;  4USR A;  1D4C A;  3R9U A;  1E1N A;  1S3E A;  3AD8 B;  3LB8 A;  2IVD A;  4B68 A;  2OLO A;  4A79 A;  3IHG A;  3IWA A;  3ALJ A;  3VR9 A;  4M52 A;  1SEZ A;  4N9X A;  4YT0 A;  1MXT A;  3RNM A;  2H88 A;  2GEW A;  4GAV A;  4IVO B;  2XYO A;  1GER A;  2YVF A;  4USQ A;  1NPX A;  1TDF A;  4J36 A;  1HYU A;  5EOW A;  1L0V A;  4B64 A;  3GDN A;  3RP8 A;  3NIX A;  4K8D A;  3CPI G;  3NLC A;  4BK1 A;  2OA1 A;  2YVJ A;  1FEC A;  3B3R A;  4TM4 A;  3DME A;  1BGN A;  3AEC A;  4UDR A;  1GV4 A;  1QJD A;  1MOK A;  2NVK X;  3QSM A;  3SZC A;  4JDR A;  4BK2 A;  3AE8 A;  4EQX A;  3CGE A;  2V6O A;  5C3J A;  3GRT A;  1YQZ A;  3SZW A;  4NWZ A;  2GV8 A;  1F8W A;  3QFA A;  1KSU A;  1NG4 A;  4A7A A;  2OAM A;  3AYL A;  4C5O A;  2BS2 A;  4NNJ A;  2TPR A;  2XFO A;  2XVH A;  4LA1 A;  5IQ4 A;  1F8S A;  2YLT A;  4K7Z A;  4H7U A;  5KWF A;  3H4K A;  5M10 A;  1GRF A;  1JNR A;  2GAH B;  1COY A;  2XVF A;  3DA1 A;  3DGH A;  4YTP A;  4K2X A;  2RGO A;  4Z26 A;  1VDC A;  4LU6 A;  5JCN A;  2ACZ A;  3KU9 A;  1KDG A;  1Y56 B;  1NG3 A;  2YG5 A;  1K0I A;  5KXJ A;  1GTE A;  3SYI A;  4YWO A;  5BUL A;  3S5W A;  2YLS A;  1L9D A;  1LVL A;  1YQ3 A;  2B7R A;  1M6I A;  3LAD A;  4APN A;  1TDK A;  1K4Q A;  1TYT A;  2BYB A;  2QA2 A;  2ZZ0 A;  2XFU A;  4NEW A;  1DNC A;  2R9Z A;  3ISH A;  2WP6 A;  5KNL A;  3QVR A;  3DK4 A;  3ZYX A;  1M64 A;  4H4X A;  3S61 A;  3AEA A;  3M13 A;  1YY5 A;  3P4R A;  3VRA A;  3KD9 A;  4E0V A;  2FJD A;  3ZDN A;  4AP1 A;  4OPT A;  2GB0 A;  2YG3 A;  4CY8 A;  1GSN A;  1ZMC A;  2C67 A;  3NK0 X;  4GCM A;  1IUV A;  4B69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...