4NWZA

Structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
395
structure length
395
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title Structure of the bacterial type II NADH dehydrogenase: a monotopic membrane protein with an essential role in energy generation.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum
total genus 126
structure length 395
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4nwzA00
3KPKA 4G73A 4G74A 5KMQA 4GAPA 3SZ0A 4G6HA 3T14A 3T2YA 5KMPA 4G6GA 3SZWA 3SZCA 3SX6A 4NWZA 3SXIA 4GAVA 3HYVA 3HYWA 4G9KA 3SYIA 3T0KA 3T31A 5KMRA 3T2KA 3SY4A 3HYXA 5KMSA 3T2ZA 3SZFA
chains in the Genus database with same CATH superfamily
1PBEA 3CPJG 4OPDA 1M6IA 2BC0A 3WE0A 2WP5A 3F8PA 3BHKA 5BULA 5FMHA 4U2LA 3AYLA 2YR6A 3DGZA 2RGJA 2F5ZA 2CDUA 3AEEA 4ICYA 1LVLA 1L9DA 3QSMA 2X8GA 1E39A 3F8DA 2V61A 4NTDA 2XVEA 5KMPA 3UTEA 2WP6A 2NVKX 5EB4A 3CPIG 5GSNA 1CJ2A 1XDIA 4B64A 4CY6A 2GAGB 2WPEA 4FDCB 5KVHA 1XHCA 3EPTA 1CC4A 3G5SA 2PYXA 4H4XA 3T0KA 3II4A 3DH9A 5KMRA 2BRYA 1MO9A 1UKVG 2UZZA 3CGBA 5BRTA 3SFEA 4YTPA 1D5TA 1S3EA 3SZFA 3AEGA 1VQWA 2C66A 3UCLA 4O5QA 2DKIA 4J36A 3KLJA 4BV6A 2QA2A 4OPGA 3ZYXA 3FIMB 1E1LA 4CCRA 4IV9A 1O5WA 3NN6X 2Z5XA 2XFPA 2FJAA 3QJ4A 4IA6A 4C5OA 4Z2TA 4O5UA 1H84A 4H2NA 4H4ZA 3ZDNA 3G5RA 2X8CA 1D7LA 1GALA 3LADA 4U8MA 3UOXA 1TDKA 1ONFA 3NGCX 2W0HA 1MOKA 3GSIA 2WDQA 3KD9A 1N4UA 2XDOA 2B9YA 2X3NA 3DJEA 1DXLA 1GRBA 1PBDA 2CULA 2BCPA 3H4KA 3ICSA 4H4UA 4N9XA 2A8XA 2ACZA 1L0VA 4DGKA 2XFOA 3AE2A 3CGDA 3HZLA 2FJBA 1CJ4A 1CF3A 1OJAA 3GRTA 1RP0A 3P4PA 4HA6A 3RHAA 5FS7A 2WBAA 2J3NA 4BJZA 4NTEA 1GERA 1F3PA 1E7PA 2BXRA 3NYCA 2QA1A 4G74A 1CBOA 4Z25A 5CQFA 2XCGA 3UOYA 3UKQA 3AWIA 1DOBA 2FBWA 2WU2A 2APGA 5EBKA 1E1NA 1PJ7A 1NENA 4A9WA 4KPRA 1PJ6A 3CNDA 4A65A 5FS8A 1GEUA 4H4RA 1VG0A 3AB1A 3NK0X 4WX1A 3H8IA 3NLCA 3L8KA 1REOA 1S2YA 2OLNA 4CCQA 1PHHA 4BK3A 3T31A 5U63A 3AD8B 2R46A 4YWOA 1YKJA 2WP9A 5HYMA 3GD3A 1ZMDA 4X9NA 2IVDA 1TDOA 1Y0PA 2BCGG 4JDRA 1N1PA 5EOWA 4IA5A 3CGCA 3UKLA 2GEWA 1Q9IA 2VOUA 5KMQA 3GDNA 2RGOA 4A79A 4Z44A 2O9ZA 4H2QA 2BS4A 3CNPA 1Y56A 1K0IA 2XLPA 3PS9A 3B3RA 4A6NB 4U8LA 3GDPA 1JNRA 4K5RA 3RNMA 1GRFA 2Z5YA 1M64A 3SGLA 1IUWA 4TM0A 1X31B 3ICTA 1NG4A 1GRAA 2C3DA 2Q7VA 2GMHA 2XLSA 3C4NA 2YLXA 2BS3A 1N4WA 2Q6UA 2V3BA 4H4TA 2WDRA 3H8LA 3NHOX 4A99A 2X99A 2AQJA 3GWDA 4AT0A 2C64A 4PAAA 1GV4A 5U25A 5C2TA 5KVIA 5CKUA 1NG3A 3SZ0A 2VRMA 4X4JA 4U2TA 3T2YA 1GXFA 3KKJA 4U8PA 4B65A 1IJHA 1IUTA 3G5QA 1V59A 1FCDA 1E6EA 1LV0A 2B9WA 2XVHA 2GQWA 3C96A 1O94A 3M12A 1EL8A 2WU5A 1JNZA 3HYVA 3FBSA 4UDQA 4YSXA 1CL0A 1LQUA 1NPXA 2OLOA 3NH3X 4A5LA 3T2KA 3GYJA 4IVMB 4C3XA 1COYA 1GT8A 3AE5A 1Z6LA 2OALA 3NRNA 4G73A 3NNEA 1GTHA 1ZOYA 3FMWA 3K7TA 4H4YA 3DK9A 1FOHA 4DNAA 1DODA 1JU2A 2WOWA 4BURA 5C3JA 4Y4NA 4EQRA 4K2XA 4NZHA 3NIXA 4FK1C 4EM4A 4OVIA 2YG7A 4G6GA 3QFAA 5KXJA 3DA1A 2YG6A 4JY2A 3CN8A 1E1MA 3IF9A 2GVCA 3AXBA 4IVOB 1ZY8A 4AT2A 4U8OA 5DBJA 1TDEA 1OJ9A 4WCTA 5GRTA 1CC6A 2IIDA 2JB1A 5JCLA 2AR8A 3M13A 2YVFA 4U8NA 1OJDA 2X50A 3AE7A 3KPFA 4K22A 3FPZA 2GH5A 4TM4A 1JRXA 4LIIA 4U2SA 4USRA 3UKKA 3QFBA 4J33A 4I58A 3C4AA 1PN0A 2YLZA 2YLRA 3IHMA 4ADWA 1VG9A 4JQ9A 1RSGA 2I0ZA 4PABA 3REDA 2C75A 3LJPA 1B8SA 1CJCA 1FECA 3I6DA 3DJDA 3NN0X 4RG4A 1NDAA 2Y6QA 3V76A 1GPEA 1FEAA 3ALMA 3GRSA 1XANA 5U1OA 2C3CA 2GV8A 3HYWA 2RGHA 4BK2A 3UOZA 2RABA 3NYFA 5KOXA 2IVEA 4Z2UA 4OPIA 4OPTA 1AOGA 3NTDA 1IUXA 4K5SA 3P4RA 1NHRA 1D4DA 2PHHA 2CVJA 2GF3A 5ER0A 3R9UA 3DJJA 3AEBA 1PS9A 2C67A 2E4GA 4B67A 3K30A 3UKFA 1PDHA 2JKCA 4AP3A 1EBDA 1DOCA 5KNLA 2EQ9A 1LJ1A 3GWFA 4OPUA 3AEDA 4A7AA 2YG4A 2YM2A 5LV9A 2GR2A 4B66A 2XVFA 3SZWA 3UKAA 4EIPA 1KSSA 1VRQB 3JSKA 3V3NA 3S5WA 3UKPA 1P2HA 5IQ1A 1NHPA 3UP4A 1GNDA 1DJNA 4H7UA 4NEVA 3AE9A 3SFDA 5JCMA 3BI2A 3IHGA 4LU6A 5HY5A 1D4CA 5KMSA 1KF6A 4H4WA 1F8RA 2YVJA 4H2RA 4JNQA 3KU9A 3VRBA 2C73A 2C72A 1YQ4A 4EMJA 1EL7A 2GR3A 3M0OA 3EANA 3D1CA 4H4QA 2ZZ0A 3ISHA 3O0HA 2XLTA 2GB0A 2WETA 1P2EA 1PBBA 4FX9A 4KX6A 1H86A 2C70A 4GAPA 4TLZA 4XWRA 1L9EA 4JY3A 3LOVA 1ZOVA 1GRHA 4ECHA 5HXIA 2TPRA 2BK4A 2ZZCA 3K7MX 3AE8A 3CIRA 1ZDLA 1GRGA 3KA7A 1TDFA 1KDGA 3AYIA 4AOXA 3DJGX 3P4QA 4OCGA 2A89A 4B63A 3SY4A 3HYXA 2OA1A 2ARDA 3T2ZA 3K7QX 1H7XA 1IUVA 4J34A 4RG3A 2B7RA 1OJTA 2Y6RA 3CNTA 3DMEA 4YTNA 2BA9A 4EQSA 3CMMA 3CTYA 1XPQA 3COXA 4TLXA 1LTXR 4X9MA 1H82A 4H4SA 4YTMA 1N4VA 2R45A 4BJYA 4DSHA 4C74A 3PO7A 4U8KA 1JEHA 5KOWA 3E1TA 3RP6A 2EQ8A 3OC4A 2YG5A 1F6MA 3UTFA 3QVRA 3ALLA 4OPLA 2BACA 1TYPA 2YQUA 4EQXA 1S2QA 2VVLG 1RYIA 3BNUA 4XWZA 4Y4MA 3SXIA 3QVPA 4GF7A 2R0GA 3OZ2A 2V3AA 1PXBA 3UP5A 5JCIA 1F8WA 1CHUA 1Q1RA 1QO8A 1PJ5A 2GRTA 4I59A 5TR3A 1NAAA 4II3A 3UTGA 2GAHB 1ZP0A 5BUKA 4UDPA 3F8RA 4J31A 2H89A 1EL9A 3UOVA 1B5QA 1H6VA 3CPHG 3VR8A 3DK4A 1NHQA 1HYUA 2JB2A 2YM1A 3IC9A 2WS3A 2BYBA 1ZX9A 1YY5A 2WESA 3RP7A 4NNJA 2WPCA 1GOSA 1BF3A 4D04A 4H2PA 3GD4A 2VZ2A 2ZZBA 2YG3A 4Z43A 4HB9A 2WQYA 1NHSA 1CC2A 4J57A 4EQWA 4XXGA 3NYEA 2V6OA 3QSSA 4H4VA 5KRQA 2Q0LA 1Y56B 3AYJA 2TMDA 5JCNA 3Q6JA 1PXCA 2YWLA 4AP1A 3ATRA 2BC1A 3ITJA 4C3YA 1FEBA 3BHFA 3NG7X 5J7XA 1W4XA 3AD9B 4CBQA 5M0ZA 4JNAA 4CNKA 2A87A 2GQFA 4BK1A 4DSGA 3ICRA 2ZBWA 1KNRA 2VVMA 2VRLA 2JK6A 2YLSA 2YAUA 1EL5A 3KVEA 3NK2X 1MXTA 2R9ZA 4RSLA 3I3LA 2GMJA 4CRTA 2R4EA 5FS6A 4TM1A 3AE1A 1GSNA 1FL2A 1GTEA 2OAMA 3EAOA 4K7ZA 2FJEA 2WDVA 3QSEA 3SYIA 3VQRA 4EMIA 3ABVA 3BI5A 3VRDB 4USQA 3LB8A 3BI4A 1KSUA 2H88A 3DGHA 3RP8A 4C77A 1IUSA 3LZXA 2C65A 2XFUA 2BABA 5KWFA 3D8XA 3VRAA 4REKA 2XLRA 1PBFA 1Q1WA 4J56A 4TM3A 3SM8A 1NEKA 4A6NA 1BWCA 1YQ3A 1ZK7A 2GR0A 4K8DA 2CFYA 3AE4A 4GUVA 2B76A 2C76A 3LXDA 1GRTA 2C7GA 1GETA 1JRYA 3SX6A 1S3BA 1E1KA 1QLBA 2R4JA 1BGJA 2XFQA 3IWAA 1JOAA 4NTCA 2EQ7A 4ZCDA 1YQZA 4LA1A 4Y4LA 3AECA 1B37A 3AD7B 1D4EA 4J2WA 1DOEA 1TRBA 1BZLA 4AOSA 2NPXA 3CNSA 1GREA 4II2A 1BGNA 1H81A 2C4CA 5L46A 1CJ3A 1PBCA 2V5ZA 3NK1X 3T37A 1QJDA 4GDPA 5M10A 3P9UA 2JB3A 2WOIA 3UTHA 4YSYA 2V60A 3ADAB 2YR4A 3EF6A 1L9CA 4YXDA 1DJQA 3LZWA 3GMBA 4FK1A 3B6DA 1JRZA 4YKFA 1B4VA 1O95A 3ATQA 4U8IA 3ALJA 3S61A 4B1BA 3GYXA 1IUUA 4GAVA 4YSZA 5IPYA 4G9KA 5JCKA 1BKWA 1PXAA 2AAQA 2YVGA 5FS9A 3URHA 4GDEA 3VR9A 4UP3A 1GESA 3GMCA 4EIQA 2BK3A 2B9XA 1H7WA 4D03A 2WHDA 5BVAA 2E1MA 2B7SA 2BS2A 1KNPA 3CGEA 2XYOA 2R0CA 4JN9A 2R0PA 1TDNA 4B68A 1F8SA 3Q9TA 5EB5A 4CNJA 2FJDA 4Z26A 3AE3A 4U8JA 3T14A 1SEZA 2XVIA 3SQPA 2XLUA 2YLWA 4EM3A 3SZCA 1ELIA 2BK5A 4OPCA 4ZN0A 1OJCA 4YKGA 4MJWA 2WEUA 2EQ6A 4UDRA 3NT6A 4H50A 3DK8A 2VVLA 4GCMA 4P9SA 2WOVA 2JBVA 2HQMA 5IQ4A 1ZKQA 2YLTA 4EMWA 4YT0A 4GR1A 3KPKA 2QAEA 3P1WA 4NEWA 4APNA 2GR1A 2QCUA 4Z24A 2XVJA 4Z2RA 4H4PA 1K0LA 3UKHA 3PVCA 5J60A 4E0VA 4YSHA 3NTAA 3P4SA 1LPFA 3V3OA 3AEFA 3L1RA 1ZMCA 5HHFA 4CY8A 4M52A 3FG2P 1K4QA 2JAEA 4ZCCA 4G6HA 2X8HA 2XFNA 2BXSA 2VQBA 3AEAA 2DKHA 1KFYA 3AE6A 3NKSA 4GRTA 2Q0KA 2BRAA 1DNCA 4NWZA 2E5VA 1TYTA 2WPFA 3GYIA 1D7YA 1K0JA 1H83A 1VDCA 2VQ7A 3CNJA 4B69A 3BNMA 2YR5A 1LQTA
chains in the Genus database with same CATH topology
1PBEA 3CPJG 4OPDA 1M6IA 2BC0A 3WE0A 2WP5A 3F8PA 3BHKA 5BULA 5FMHA 4U2LA 3AYLA 2YR6A 3DGZA 2RGJA 2F5ZA 2CDUA 3AEEA 4ICYA 1LVLA 1L9DA 3QSMA 2X8GA 1E39A 3F8DA 2V61A 4NTDA 2XVEA 5KMPA 3UTEA 2WP6A 2NVKX 5EB4A 3CPIG 5GSNA 1CJ2A 1XDIA 4B64A 4CY6A 2GAGB 2WPEA 4FDCB 5KVHA 1XHCA 3EPTA 1CC4A 3G5SA 2PYXA 4H4XA 3T0KA 3II4A 3DH9A 5KMRA 2BRYA 1MO9A 1UKVG 2UZZA 3CGBA 5BRTA 3SFEA 4YTPA 1D5TA 1S3EA 3SZFA 3AEGA 1VQWA 2C66A 3UCLA 4O5QA 2DKIA 4J36A 3KLJA 4BV6A 2QA2A 4OPGA 3ZYXA 3FIMB 1E1LA 4CCRA 4IV9A 1O5WA 3NN6X 2Z5XA 2XFPA 2FJAA 3QJ4A 4IA6A 4C5OA 4Z2TA 4O5UA 1H84A 4H2NA 4H4ZA 3ZDNA 3G5RA 2X8CA 1D7LA 1GALA 3LADA 4U8MA 3UOXA 1TDKA 1ONFA 3NGCX 2W0HA 1MOKA 3GSIA 2WDQA 3KD9A 1N4UA 2XDOA 2B9YA 2X3NA 3DJEA 1DXLA 1GRBA 1PBDA 2CULA 2BCPA 3H4KA 3ICSA 4H4UA 4N9XA 2A8XA 2ACZA 1L0VA 4DGKA 2XFOA 3AE2A 3CGDA 3HZLA 2FJBA 1CJ4A 1CF3A 1OJAA 3GRTA 1RP0A 3P4PA 4HA6A 3RHAA 5FS7A 2WBAA 2J3NA 4BJZA 4NTEA 1GERA 1F3PA 1E7PA 2BXRA 3NYCA 2QA1A 4G74A 1CBOA 4Z25A 5CQFA 2XCGA 3UOYA 3UKQA 3AWIA 1DOBA 2FBWA 2WU2A 2APGA 5EBKA 1E1NA 1PJ7A 1NENA 4A9WA 4KPRA 1PJ6A 3CNDA 4A65A 5FS8A 1GEUA 4H4RA 1VG0A 3AB1A 3NK0X 4WX1A 3H8IA 3NLCA 3L8KA 1REOA 1S2YA 2OLNA 4CCQA 1PHHA 4BK3A 3T31A 5U63A 3AD8B 2R46A 4YWOA 1YKJA 2WP9A 5HYMA 3GD3A 1ZMDA 4X9NA 2IVDA 1TDOA 1Y0PA 2BCGG 4JDRA 1N1PA 5EOWA 4IA5A 3CGCA 3UKLA 2GEWA 1Q9IA 2VOUA 5KMQA 3GDNA 2RGOA 4A79A 4Z44A 2O9ZA 4H2QA 2BS4A 3CNPA 1Y56A 1K0IA 2XLPA 3PS9A 3B3RA 4A6NB 4U8LA 3GDPA 1JNRA 4K5RA 3RNMA 1GRFA 2Z5YA 1M64A 3SGLA 1IUWA 4TM0A 1X31B 3ICTA 1NG4A 1GRAA 2C3DA 2Q7VA 2GMHA 2XLSA 3C4NA 2YLXA 2BS3A 1N4WA 2Q6UA 2V3BA 4H4TA 2WDRA 3H8LA 3NHOX 4A99A 2X99A 2AQJA 3GWDA 4AT0A 2C64A 4PAAA 1GV4A 5U25A 5C2TA 5KVIA 5CKUA 1NG3A 3SZ0A 2VRMA 4X4JA 4U2TA 3T2YA 1GXFA 3KKJA 4U8PA 4B65A 1IJHA 1IUTA 3G5QA 1V59A 1FCDA 1E6EA 1LV0A 2B9WA 2XVHA 2GQWA 3C96A 1O94A 3M12A 1EL8A 2WU5A 1JNZA 3HYVA 3FBSA 4UDQA 4YSXA 1CL0A 1LQUA 1NPXA 2OLOA 3NH3X 4A5LA 3T2KA 3GYJA 4IVMB 4C3XA 1COYA 1GT8A 3AE5A 1Z6LA 2OALA 3NRNA 4G73A 3NNEA 1GTHA 1ZOYA 3FMWA 3K7TA 4H4YA 3DK9A 1FOHA 4DNAA 1DODA 1JU2A 2WOWA 4BURA 5C3JA 4Y4NA 4EQRA 4K2XA 4NZHA 3NIXA 4FK1C 4EM4A 4OVIA 2YG7A 4G6GA 3QFAA 5KXJA 3DA1A 2YG6A 4JY2A 3CN8A 1E1MA 3IF9A 2GVCA 3AXBA 4IVOB 1ZY8A 4AT2A 4U8OA 5DBJA 1TDEA 1OJ9A 4WCTA 5GRTA 1CC6A 2IIDA 2JB1A 5JCLA 2AR8A 3M13A 2YVFA 4U8NA 1OJDA 2X50A 3AE7A 3KPFA 4K22A 3FPZA 2GH5A 4TM4A 1JRXA 4LIIA 4U2SA 4USRA 3UKKA 3QFBA 4J33A 4I58A 3C4AA 1PN0A 2YLZA 2YLRA 3IHMA 4ADWA 1VG9A 4JQ9A 1RSGA 2I0ZA 4PABA 3REDA 2C75A 3LJPA 1B8SA 1CJCA 1FECA 3I6DA 3DJDA 3NN0X 4RG4A 1NDAA 2Y6QA 3V76A 1GPEA 1FEAA 3ALMA 3GRSA 1XANA 5U1OA 2C3CA 2GV8A 3HYWA 2RGHA 4BK2A 3UOZA 2RABA 3NYFA 5KOXA 2IVEA 4Z2UA 4OPIA 4OPTA 1AOGA 3NTDA 1IUXA 4K5SA 3P4RA 1NHRA 1D4DA 2PHHA 2CVJA 2GF3A 5ER0A 3R9UA 3DJJA 3AEBA 1PS9A 2C67A 2E4GA 4B67A 3K30A 3UKFA 1PDHA 2JKCA 4AP3A 1EBDA 1DOCA 5KNLA 2EQ9A 1LJ1A 3GWFA 4OPUA 3AEDA 4A7AA 2YG4A 2YM2A 5LV9A 2GR2A 4B66A 2XVFA 3SZWA 3UKAA 4EIPA 1KSSA 1VRQB 3JSKA 3V3NA 3S5WA 3UKPA 1P2HA 5IQ1A 1NHPA 3UP4A 1GNDA 1DJNA 4H7UA 4NEVA 3AE9A 3SFDA 5JCMA 3BI2A 3IHGA 4LU6A 5HY5A 1D4CA 5KMSA 1KF6A 4H4WA 1F8RA 2YVJA 4H2RA 4JNQA 3KU9A 3VRBA 2C73A 2C72A 1YQ4A 4EMJA 1EL7A 2GR3A 3M0OA 3EANA 3D1CA 4H4QA 2ZZ0A 3ISHA 3O0HA 2XLTA 2GB0A 2WETA 1P2EA 1PBBA 4FX9A 4KX6A 1H86A 2C70A 4GAPA 4TLZA 4XWRA 1L9EA 4JY3A 3LOVA 1ZOVA 1GRHA 4ECHA 5HXIA 2TPRA 2BK4A 2ZZCA 3K7MX 3AE8A 3CIRA 1ZDLA 1GRGA 3KA7A 1TDFA 1KDGA 3AYIA 4AOXA 3DJGX 3P4QA 4OCGA 2A89A 4B63A 3SY4A 3HYXA 2OA1A 2ARDA 3T2ZA 3K7QX 1H7XA 1IUVA 4J34A 4RG3A 2B7RA 1OJTA 2Y6RA 3CNTA 3DMEA 4YTNA 2BA9A 4EQSA 3CMMA 3CTYA 1XPQA 3COXA 4TLXA 1LTXR 4X9MA 1H82A 4H4SA 4YTMA 1N4VA 2R45A 4BJYA 4DSHA 4C74A 3PO7A 4U8KA 1JEHA 5KOWA 3E1TA 3RP6A 2EQ8A 3OC4A 2YG5A 1F6MA 3UTFA 3QVRA 3ALLA 4OPLA 2BACA 1TYPA 2YQUA 4EQXA 1S2QA 2VVLG 1RYIA 3BNUA 4XWZA 4Y4MA 3SXIA 3QVPA 4GF7A 2R0GA 3OZ2A 2V3AA 1PXBA 3UP5A 5JCIA 1F8WA 1CHUA 1Q1RA 1QO8A 1PJ5A 2GRTA 4I59A 5TR3A 1NAAA 4II3A 3UTGA 2GAHB 1ZP0A 5BUKA 4UDPA 3F8RA 4J31A 2H89A 1EL9A 3UOVA 1B5QA 1H6VA 3CPHG 3VR8A 3DK4A 1NHQA 1HYUA 2JB2A 2YM1A 3IC9A 2WS3A 2BYBA 1ZX9A 1YY5A 2WESA 3RP7A 4NNJA 2WPCA 1GOSA 1BF3A 4D04A 4H2PA 3GD4A 2VZ2A 2ZZBA 2YG3A 4Z43A 4HB9A 2WQYA 1NHSA 1CC2A 4J57A 4EQWA 4XXGA 3NYEA 2V6OA 3QSSA 4H4VA 5KRQA 2Q0LA 1Y56B 3AYJA 2TMDA 5JCNA 3Q6JA 1PXCA 2YWLA 4AP1A 3ATRA 2BC1A 3ITJA 4C3YA 1FEBA 3BHFA 3NG7X 5J7XA 1W4XA 3AD9B 4CBQA 5M0ZA 4JNAA 4CNKA 2A87A 2GQFA 4BK1A 4DSGA 3ICRA 2ZBWA 1KNRA 2VVMA 2VRLA 2JK6A 2YLSA 2YAUA 1EL5A 3KVEA 3NK2X 1MXTA 2R9ZA 4RSLA 3I3LA 2GMJA 4CRTA 2R4EA 5FS6A 4TM1A 3AE1A 1GSNA 1FL2A 1GTEA 2OAMA 3EAOA 4K7ZA 2FJEA 2WDVA 3QSEA 3SYIA 3VQRA 4EMIA 3ABVA 3BI5A 3VRDB 4USQA 3LB8A 3BI4A 1KSUA 2H88A 3DGHA 3RP8A 4C77A 1IUSA 3LZXA 2C65A 2XFUA 2BABA 5KWFA 3D8XA 3VRAA 4REKA 2XLRA 1PBFA 1Q1WA 4J56A 4TM3A 3SM8A 1NEKA 4A6NA 1BWCA 1YQ3A 1ZK7A 2GR0A 4K8DA 2CFYA 3AE4A 4GUVA 2B76A 2C76A 3LXDA 1GRTA 2C7GA 1GETA 1JRYA 3SX6A 1S3BA 1E1KA 1QLBA 2R4JA 1BGJA 2XFQA 3IWAA 1JOAA 4NTCA 2EQ7A 4ZCDA 1YQZA 4LA1A 4Y4LA 3AECA 1B37A 3AD7B 1D4EA 4J2WA 1DOEA 1TRBA 1BZLA 4AOSA 2NPXA 3CNSA 1GREA 4II2A 1BGNA 1H81A 2C4CA 5L46A 1CJ3A 1PBCA 2V5ZA 3NK1X 3T37A 1QJDA 4GDPA 5M10A 3P9UA 2JB3A 2WOIA 3UTHA 4YSYA 2V60A 3ADAB 2YR4A 3EF6A 1L9CA 4YXDA 1DJQA 3LZWA 3GMBA 4FK1A 3B6DA 1JRZA 4YKFA 1B4VA 1O95A 3ATQA 4U8IA 3ALJA 3S61A 4B1BA 3GYXA 1IUUA 4GAVA 4YSZA 5IPYA 4G9KA 5JCKA 1BKWA 1PXAA 2AAQA 2YVGA 5FS9A 3URHA 4GDEA 3VR9A 4UP3A 1GESA 3GMCA 4EIQA 2BK3A 2B9XA 1H7WA 4D03A 2WHDA 5BVAA 2E1MA 2B7SA 2BS2A 1KNPA 3CGEA 2XYOA 2R0CA 4JN9A 2R0PA 1TDNA 4B68A 1F8SA 3Q9TA 5EB5A 4CNJA 2FJDA 4Z26A 3AE3A 4U8JA 3T14A 1SEZA 2XVIA 3SQPA 2XLUA 2YLWA 4EM3A 3SZCA 1ELIA 2BK5A 4OPCA 4ZN0A 1OJCA 4YKGA 4MJWA 2WEUA 2EQ6A 4UDRA 3NT6A 4H50A 3DK8A 2VVLA 4GCMA 4P9SA 2WOVA 2JBVA 2HQMA 5IQ4A 1ZKQA 2YLTA 4EMWA 4YT0A 4GR1A 3KPKA 2QAEA 3P1WA 4NEWA 4APNA 2GR1A 2QCUA 4Z24A 2XVJA 4Z2RA 4H4PA 1K0LA 3UKHA 3PVCA 5J60A 4E0VA 4YSHA 3NTAA 3P4SA 1LPFA 3V3OA 3AEFA 3L1RA 1ZMCA 5HHFA 4CY8A 4M52A 3FG2P 1K4QA 2JAEA 4ZCCA 4G6HA 2X8HA 2XFNA 2BXSA 2VQBA 3AEAA 2DKHA 1KFYA 3AE6A 3NKSA 4GRTA 2Q0KA 2BRAA 1DNCA 4NWZA 2E5VA 1TYTA 2WPFA 3GYIA 1D7YA 1K0JA 1H83A 1VDCA 2VQ7A 3CNJA 4B69A 3BNMA 2YR5A 1LQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KPK A;  4G73 A;  4G74 A;  5KMQ A;  4GAP A;  3SZ0 A;  4G6H A;  3T14 A;  3T2Y A;  5KMP A;  4G6G A;  3SZW A;  3SZC A;  3SX6 A;  4NWZ A;  3SXI A;  4GAV A;  3HYV A;  3HYW A;  4G9K A;  3SYI A;  3T0K A;  3T31 A;  5KMR A;  3T2K A;  3SY4 A;  3HYX A;  5KMS A;  3T2Z A;  3SZF A; 
#chains in the Genus database with same CATH topology
 1PBE A;  3CPJ G;  4OPD A;  1M6I A;  2BC0 A;  3WE0 A;  2WP5 A;  3F8P A;  3BHK A;  5BUL A;  5FMH A;  4U2L A;  3AYL A;  2YR6 A;  3DGZ A;  2RGJ A;  2F5Z A;  2CDU A;  3AEE A;  4ICY A;  1LVL A;  1L9D A;  3QSM A;  2X8G A;  1E39 A;  3F8D A;  2V61 A;  4NTD A;  2XVE A;  5KMP A;  3UTE A;  2WP6 A;  2NVK X;  5EB4 A;  3CPI G;  5GSN A;  1CJ2 A;  1XDI A;  4B64 A;  4CY6 A;  2GAG B;  2WPE A;  4FDC B;  5KVH A;  1XHC A;  3EPT A;  1CC4 A;  3G5S A;  2PYX A;  4H4X A;  3T0K A;  3II4 A;  3DH9 A;  5KMR A;  2BRY A;  1MO9 A;  1UKV G;  2UZZ A;  3CGB A;  5BRT A;  3SFE A;  4YTP A;  1D5T A;  1S3E A;  3SZF A;  3AEG A;  1VQW A;  2C66 A;  3UCL A;  4O5Q A;  2DKI A;  4J36 A;  3KLJ A;  4BV6 A;  2QA2 A;  4OPG A;  3ZYX A;  3FIM B;  1E1L A;  4CCR A;  4IV9 A;  1O5W A;  3NN6 X;  2Z5X A;  2XFP A;  2FJA A;  3QJ4 A;  4IA6 A;  4C5O A;  4Z2T A;  4O5U A;  1H84 A;  4H2N A;  4H4Z A;  3ZDN A;  3G5R A;  2X8C A;  1D7L A;  1GAL A;  3LAD A;  4U8M A;  3UOX A;  1TDK A;  1ONF A;  3NGC X;  2W0H A;  1MOK A;  3GSI A;  2WDQ A;  3KD9 A;  1N4U A;  2XDO A;  2B9Y A;  2X3N A;  3DJE A;  1DXL A;  1GRB A;  1PBD A;  2CUL A;  2BCP A;  3H4K A;  3ICS A;  4H4U A;  4N9X A;  2A8X A;  2ACZ A;  1L0V A;  4DGK A;  2XFO A;  3AE2 A;  3CGD A;  3HZL A;  2FJB A;  1CJ4 A;  1CF3 A;  1OJA A;  3GRT A;  1RP0 A;  3P4P A;  4HA6 A;  3RHA A;  5FS7 A;  2WBA A;  2J3N A;  4BJZ A;  4NTE A;  1GER A;  1F3P A;  1E7P A;  2BXR A;  3NYC A;  2QA1 A;  4G74 A;  1CBO A;  4Z25 A;  5CQF A;  2XCG A;  3UOY A;  3UKQ A;  3AWI A;  1DOB A;  2FBW A;  2WU2 A;  2APG A;  5EBK A;  1E1N A;  1PJ7 A;  1NEN A;  4A9W A;  4KPR A;  1PJ6 A;  3CND A;  4A65 A;  5FS8 A;  1GEU A;  4H4R A;  1VG0 A;  3AB1 A;  3NK0 X;  4WX1 A;  3H8I A;  3NLC A;  3L8K A;  1REO A;  1S2Y A;  2OLN A;  4CCQ A;  1PHH A;  4BK3 A;  3T31 A;  5U63 A;  3AD8 B;  2R46 A;  4YWO A;  1YKJ A;  2WP9 A;  5HYM A;  3GD3 A;  1ZMD A;  4X9N A;  2IVD A;  1TDO A;  1Y0P A;  2BCG G;  4JDR A;  1N1P A;  5EOW A;  4IA5 A;  3CGC A;  3UKL A;  2GEW A;  1Q9I A;  2VOU A;  5KMQ A;  3GDN A;  2RGO A;  4A79 A;  4Z44 A;  2O9Z A;  4H2Q A;  2BS4 A;  3CNP A;  1Y56 A;  1K0I A;  2XLP A;  3PS9 A;  3B3R A;  4A6N B;  4U8L A;  3GDP A;  1JNR A;  4K5R A;  3RNM A;  1GRF A;  2Z5Y A;  1M64 A;  3SGL A;  1IUW A;  4TM0 A;  1X31 B;  3ICT A;  1NG4 A;  1GRA A;  2C3D A;  2Q7V A;  2GMH A;  2XLS A;  3C4N A;  2YLX A;  2BS3 A;  1N4W A;  2Q6U A;  2V3B A;  4H4T A;  2WDR A;  3H8L A;  3NHO X;  4A99 A;  2X99 A;  2AQJ A;  3GWD A;  4AT0 A;  2C64 A;  4PAA A;  1GV4 A;  5U25 A;  5C2T A;  5KVI A;  5CKU A;  1NG3 A;  3SZ0 A;  2VRM A;  4X4J A;  4U2T A;  3T2Y A;  1GXF A;  3KKJ A;  4U8P A;  4B65 A;  1IJH A;  1IUT A;  3G5Q A;  1V59 A;  1FCD A;  1E6E A;  1LV0 A;  2B9W A;  2XVH A;  2GQW A;  3C96 A;  1O94 A;  3M12 A;  1EL8 A;  2WU5 A;  1JNZ A;  3HYV A;  3FBS A;  4UDQ A;  4YSX A;  1CL0 A;  1LQU A;  1NPX A;  2OLO A;  3NH3 X;  4A5L A;  3T2K A;  3GYJ A;  4IVM B;  4C3X A;  1COY A;  1GT8 A;  3AE5 A;  1Z6L A;  2OAL A;  3NRN A;  4G73 A;  3NNE A;  1GTH A;  1ZOY A;  3FMW A;  3K7T A;  4H4Y A;  3DK9 A;  1FOH A;  4DNA A;  1DOD A;  1JU2 A;  2WOW A;  4BUR A;  5C3J A;  4Y4N A;  4EQR A;  4K2X A;  4NZH A;  3NIX A;  4FK1 C;  4EM4 A;  4OVI A;  2YG7 A;  4G6G A;  3QFA A;  5KXJ A;  3DA1 A;  2YG6 A;  4JY2 A;  3CN8 A;  1E1M A;  3IF9 A;  2GVC A;  3AXB A;  4IVO B;  1ZY8 A;  4AT2 A;  4U8O A;  5DBJ A;  1TDE A;  1OJ9 A;  4WCT A;  5GRT A;  1CC6 A;  2IID A;  2JB1 A;  5JCL A;  2AR8 A;  3M13 A;  2YVF A;  4U8N A;  1OJD A;  2X50 A;  3AE7 A;  3KPF A;  4K22 A;  3FPZ A;  2GH5 A;  4TM4 A;  1JRX A;  4LII A;  4U2S A;  4USR A;  3UKK A;  3QFB A;  4J33 A;  4I58 A;  3C4A A;  1PN0 A;  2YLZ A;  2YLR A;  3IHM A;  4ADW A;  1VG9 A;  4JQ9 A;  1RSG A;  2I0Z A;  4PAB A;  3RED A;  2C75 A;  3LJP A;  1B8S A;  1CJC A;  1FEC A;  3I6D A;  3DJD A;  3NN0 X;  4RG4 A;  1NDA A;  2Y6Q A;  3V76 A;  1GPE A;  1FEA A;  3ALM A;  3GRS A;  1XAN A;  5U1O A;  2C3C A;  2GV8 A;  3HYW A;  2RGH A;  4BK2 A;  3UOZ A;  2RAB A;  3NYF A;  5KOX A;  2IVE A;  4Z2U A;  4OPI A;  4OPT A;  1AOG A;  3NTD A;  1IUX A;  4K5S A;  3P4R A;  1NHR A;  1D4D A;  2PHH A;  2CVJ A;  2GF3 A;  5ER0 A;  3R9U A;  3DJJ A;  3AEB A;  1PS9 A;  2C67 A;  2E4G A;  4B67 A;  3K30 A;  3UKF A;  1PDH A;  2JKC A;  4AP3 A;  1EBD A;  1DOC A;  5KNL A;  2EQ9 A;  1LJ1 A;  3GWF A;  4OPU A;  3AED A;  4A7A A;  2YG4 A;  2YM2 A;  5LV9 A;  2GR2 A;  4B66 A;  2XVF A;  3SZW A;  3UKA A;  4EIP A;  1KSS A;  1VRQ B;  3JSK A;  3V3N A;  3S5W A;  3UKP A;  1P2H A;  5IQ1 A;  1NHP A;  3UP4 A;  1GND A;  1DJN A;  4H7U A;  4NEV A;  3AE9 A;  3SFD A;  5JCM A;  3BI2 A;  3IHG A;  4LU6 A;  5HY5 A;  1D4C A;  5KMS A;  1KF6 A;  4H4W A;  1F8R A;  2YVJ A;  4H2R A;  4JNQ A;  3KU9 A;  3VRB A;  2C73 A;  2C72 A;  1YQ4 A;  4EMJ A;  1EL7 A;  2GR3 A;  3M0O A;  3EAN A;  3D1C A;  4H4Q A;  2ZZ0 A;  3ISH A;  3O0H A;  2XLT A;  2GB0 A;  2WET A;  1P2E A;  1PBB A;  4FX9 A;  4KX6 A;  1H86 A;  2C70 A;  4GAP A;  4TLZ A;  4XWR A;  1L9E A;  4JY3 A;  3LOV A;  1ZOV A;  1GRH A;  4ECH A;  5HXI A;  2TPR A;  2BK4 A;  2ZZC A;  3K7M X;  3AE8 A;  3CIR A;  1ZDL A;  1GRG A;  3KA7 A;  1TDF A;  1KDG A;  3AYI A;  4AOX A;  3DJG X;  3P4Q A;  4OCG A;  2A89 A;  4B63 A;  3SY4 A;  3HYX A;  2OA1 A;  2ARD A;  3T2Z A;  3K7Q X;  1H7X A;  1IUV A;  4J34 A;  4RG3 A;  2B7R A;  1OJT A;  2Y6R A;  3CNT A;  3DME A;  4YTN A;  2BA9 A;  4EQS A;  3CMM A;  3CTY A;  1XPQ A;  3COX A;  4TLX A;  1LTX R;  4X9M A;  1H82 A;  4H4S A;  4YTM A;  1N4V A;  2R45 A;  4BJY A;  4DSH A;  4C74 A;  3PO7 A;  4U8K A;  1JEH A;  5KOW A;  3E1T A;  3RP6 A;  2EQ8 A;  3OC4 A;  2YG5 A;  1F6M A;  3UTF A;  3QVR A;  3ALL A;  4OPL A;  2BAC A;  1TYP A;  2YQU A;  4EQX A;  1S2Q A;  2VVL G;  1RYI A;  3BNU A;  4XWZ A;  4Y4M A;  3SXI A;  3QVP A;  4GF7 A;  2R0G A;  3OZ2 A;  2V3A A;  1PXB A;  3UP5 A;  5JCI A;  1F8W A;  1CHU A;  1Q1R A;  1QO8 A;  1PJ5 A;  2GRT A;  4I59 A;  5TR3 A;  1NAA A;  4II3 A;  3UTG A;  2GAH B;  1ZP0 A;  5BUK A;  4UDP A;  3F8R A;  4J31 A;  2H89 A;  1EL9 A;  3UOV A;  1B5Q A;  1H6V A;  3CPH G;  3VR8 A;  3DK4 A;  1NHQ A;  1HYU A;  2JB2 A;  2YM1 A;  3IC9 A;  2WS3 A;  2BYB A;  1ZX9 A;  1YY5 A;  2WES A;  3RP7 A;  4NNJ A;  2WPC A;  1GOS A;  1BF3 A;  4D04 A;  4H2P A;  3GD4 A;  2VZ2 A;  2ZZB A;  2YG3 A;  4Z43 A;  4HB9 A;  2WQY A;  1NHS A;  1CC2 A;  4J57 A;  4EQW A;  4XXG A;  3NYE A;  2V6O A;  3QSS A;  4H4V A;  5KRQ A;  2Q0L A;  1Y56 B;  3AYJ A;  2TMD A;  5JCN A;  3Q6J A;  1PXC A;  2YWL A;  4AP1 A;  3ATR A;  2BC1 A;  3ITJ A;  4C3Y A;  1FEB A;  3BHF A;  3NG7 X;  5J7X A;  1W4X A;  3AD9 B;  4CBQ A;  5M0Z A;  4JNA A;  4CNK A;  2A87 A;  2GQF A;  4BK1 A;  4DSG A;  3ICR A;  2ZBW A;  1KNR A;  2VVM A;  2VRL A;  2JK6 A;  2YLS A;  2YAU A;  1EL5 A;  3KVE A;  3NK2 X;  1MXT A;  2R9Z A;  4RSL A;  3I3L A;  2GMJ A;  4CRT A;  2R4E A;  5FS6 A;  4TM1 A;  3AE1 A;  1GSN A;  1FL2 A;  1GTE A;  2OAM A;  3EAO A;  4K7Z A;  2FJE A;  2WDV A;  3QSE A;  3SYI A;  3VQR A;  4EMI A;  3ABV A;  3BI5 A;  3VRD B;  4USQ A;  3LB8 A;  3BI4 A;  1KSU A;  2H88 A;  3DGH A;  3RP8 A;  4C77 A;  1IUS A;  3LZX A;  2C65 A;  2XFU A;  2BAB A;  5KWF A;  3D8X A;  3VRA A;  4REK A;  2XLR A;  1PBF A;  1Q1W A;  4J56 A;  4TM3 A;  3SM8 A;  1NEK A;  4A6N A;  1BWC A;  1YQ3 A;  1ZK7 A;  2GR0 A;  4K8D A;  2CFY A;  3AE4 A;  4GUV A;  2B76 A;  2C76 A;  3LXD A;  1GRT A;  2C7G A;  1GET A;  1JRY A;  3SX6 A;  1S3B A;  1E1K A;  1QLB A;  2R4J A;  1BGJ A;  2XFQ A;  3IWA A;  1JOA A;  4NTC A;  2EQ7 A;  4ZCD A;  1YQZ A;  4LA1 A;  4Y4L A;  3AEC A;  1B37 A;  3AD7 B;  1D4E A;  4J2W A;  1DOE A;  1TRB A;  1BZL A;  4AOS A;  2NPX A;  3CNS A;  1GRE A;  4II2 A;  1BGN A;  1H81 A;  2C4C A;  5L46 A;  1CJ3 A;  1PBC A;  2V5Z A;  3NK1 X;  3T37 A;  1QJD A;  4GDP A;  5M10 A;  3P9U A;  2JB3 A;  2WOI A;  3UTH A;  4YSY A;  2V60 A;  3ADA B;  2YR4 A;  3EF6 A;  1L9C A;  4YXD A;  1DJQ A;  3LZW A;  3GMB A;  4FK1 A;  3B6D A;  1JRZ A;  4YKF A;  1B4V A;  1O95 A;  3ATQ A;  4U8I A;  3ALJ A;  3S61 A;  4B1B A;  3GYX A;  1IUU A;  4GAV A;  4YSZ A;  5IPY A;  4G9K A;  5JCK A;  1BKW A;  1PXA A;  2AAQ A;  2YVG A;  5FS9 A;  3URH A;  4GDE A;  3VR9 A;  4UP3 A;  1GES A;  3GMC A;  4EIQ A;  2BK3 A;  2B9X A;  1H7W A;  4D03 A;  2WHD A;  5BVA A;  2E1M A;  2B7S A;  2BS2 A;  1KNP A;  3CGE A;  2XYO A;  2R0C A;  4JN9 A;  2R0P A;  1TDN A;  4B68 A;  1F8S A;  3Q9T A;  5EB5 A;  4CNJ A;  2FJD A;  4Z26 A;  3AE3 A;  4U8J A;  3T14 A;  1SEZ A;  2XVI A;  3SQP A;  2XLU A;  2YLW A;  4EM3 A;  3SZC A;  1ELI A;  2BK5 A;  4OPC A;  4ZN0 A;  1OJC A;  4YKG A;  4MJW A;  2WEU A;  2EQ6 A;  4UDR A;  3NT6 A;  4H50 A;  3DK8 A;  2VVL A;  4GCM A;  4P9S A;  2WOV A;  2JBV A;  2HQM A;  5IQ4 A;  1ZKQ A;  2YLT A;  4EMW A;  4YT0 A;  4GR1 A;  3KPK A;  2QAE A;  3P1W A;  4NEW A;  4APN A;  2GR1 A;  2QCU A;  4Z24 A;  2XVJ A;  4Z2R A;  4H4P A;  1K0L A;  3UKH A;  3PVC A;  5J60 A;  4E0V A;  4YSH A;  3NTA A;  3P4S A;  1LPF A;  3V3O A;  3AEF A;  3L1R A;  1ZMC A;  5HHF A;  4CY8 A;  4M52 A;  3FG2 P;  1K4Q A;  2JAE A;  4ZCC A;  4G6H A;  2X8H A;  2XFN A;  2BXS A;  2VQB A;  3AEA A;  2DKH A;  1KFY A;  3AE6 A;  3NKS A;  4GRT A;  2Q0K A;  2BRA A;  1DNC A;  4NWZ A;  2E5V A;  1TYT A;  2WPF A;  3GYI A;  1D7Y A;  1K0J A;  1H83 A;  1VDC A;  2VQ7 A;  3CNJ A;  4B69 A;  3BNM A;  2YR5 A;  1LQT A; 
#chains in the Genus database with same CATH homology
 1PBE A;  3CPJ G;  4OPD A;  1M6I A;  2BC0 A;  3WE0 A;  2WP5 A;  3F8P A;  3BHK A;  5BUL A;  5FMH A;  4U2L A;  3AYL A;  2YR6 A;  3DGZ A;  2RGJ A;  2F5Z A;  2CDU A;  3AEE A;  4ICY A;  1LVL A;  1L9D A;  3QSM A;  2X8G A;  1E39 A;  3F8D A;  2V61 A;  4NTD A;  2XVE A;  5KMP A;  3UTE A;  2WP6 A;  2NVK X;  5EB4 A;  3CPI G;  5GSN A;  1CJ2 A;  1XDI A;  4B64 A;  4CY6 A;  2GAG B;  2WPE A;  4FDC B;  5KVH A;  1XHC A;  3EPT A;  1CC4 A;  3G5S A;  2PYX A;  4H4X A;  3T0K A;  3II4 A;  3DH9 A;  5KMR A;  2BRY A;  1MO9 A;  1UKV G;  2UZZ A;  3CGB A;  5BRT A;  3SFE A;  4YTP A;  1D5T A;  1S3E A;  3SZF A;  3AEG A;  1VQW A;  2C66 A;  3UCL A;  4O5Q A;  2DKI A;  4J36 A;  3KLJ A;  4BV6 A;  2QA2 A;  4OPG A;  3ZYX A;  3FIM B;  1E1L A;  4CCR A;  4IV9 A;  1O5W A;  3NN6 X;  2Z5X A;  2XFP A;  2FJA A;  3QJ4 A;  4IA6 A;  4C5O A;  4Z2T A;  4O5U A;  1H84 A;  4H2N A;  4H4Z A;  3ZDN A;  3G5R A;  2X8C A;  1D7L A;  1GAL A;  3LAD A;  4U8M A;  3UOX A;  1TDK A;  1ONF A;  3NGC X;  2W0H A;  1MOK A;  3GSI A;  2WDQ A;  3KD9 A;  1N4U A;  2XDO A;  2B9Y A;  2X3N A;  3DJE A;  1DXL A;  1GRB A;  1PBD A;  2CUL A;  2BCP A;  3H4K A;  3ICS A;  4H4U A;  4N9X A;  2A8X A;  2ACZ A;  1L0V A;  4DGK A;  2XFO A;  3AE2 A;  3CGD A;  3HZL A;  2FJB A;  1CJ4 A;  1CF3 A;  1OJA A;  3GRT A;  1RP0 A;  3P4P A;  4HA6 A;  3RHA A;  5FS7 A;  2WBA A;  2J3N A;  4BJZ A;  4NTE A;  1GER A;  1F3P A;  1E7P A;  2BXR A;  3NYC A;  2QA1 A;  4G74 A;  1CBO A;  4Z25 A;  5CQF A;  2XCG A;  3UOY A;  3UKQ A;  3AWI A;  1DOB A;  2FBW A;  2WU2 A;  2APG A;  5EBK A;  1E1N A;  1PJ7 A;  1NEN A;  4A9W A;  4KPR A;  1PJ6 A;  3CND A;  4A65 A;  5FS8 A;  1GEU A;  4H4R A;  1VG0 A;  3AB1 A;  3NK0 X;  4WX1 A;  3H8I A;  3NLC A;  3L8K A;  1REO A;  1S2Y A;  2OLN A;  4CCQ A;  1PHH A;  4BK3 A;  3T31 A;  5U63 A;  3AD8 B;  2R46 A;  4YWO A;  1YKJ A;  2WP9 A;  5HYM A;  3GD3 A;  1ZMD A;  4X9N A;  2IVD A;  1TDO A;  1Y0P A;  2BCG G;  4JDR A;  1N1P A;  5EOW A;  4IA5 A;  3CGC A;  3UKL A;  2GEW A;  1Q9I A;  2VOU A;  5KMQ A;  3GDN A;  2RGO A;  4A79 A;  4Z44 A;  2O9Z A;  4H2Q A;  2BS4 A;  3CNP A;  1Y56 A;  1K0I A;  2XLP A;  3PS9 A;  3B3R A;  4A6N B;  4U8L A;  3GDP A;  1JNR A;  4K5R A;  3RNM A;  1GRF A;  2Z5Y A;  1M64 A;  3SGL A;  1IUW A;  4TM0 A;  1X31 B;  3ICT A;  1NG4 A;  1GRA A;  2C3D A;  2Q7V A;  2GMH A;  2XLS A;  3C4N A;  2YLX A;  2BS3 A;  1N4W A;  2Q6U A;  2V3B A;  4H4T A;  2WDR A;  3H8L A;  3NHO X;  4A99 A;  2X99 A;  2AQJ A;  3GWD A;  4AT0 A;  2C64 A;  4PAA A;  1GV4 A;  5U25 A;  5C2T A;  5KVI A;  5CKU A;  1NG3 A;  3SZ0 A;  2VRM A;  4X4J A;  4U2T A;  3T2Y A;  1GXF A;  3KKJ A;  4U8P A;  4B65 A;  1IJH A;  1IUT A;  3G5Q A;  1V59 A;  1FCD A;  1E6E A;  1LV0 A;  2B9W A;  2XVH A;  2GQW A;  3C96 A;  1O94 A;  3M12 A;  1EL8 A;  2WU5 A;  1JNZ A;  3HYV A;  3FBS A;  4UDQ A;  4YSX A;  1CL0 A;  1LQU A;  1NPX A;  2OLO A;  3NH3 X;  4A5L A;  3T2K A;  3GYJ A;  4IVM B;  4C3X A;  1COY A;  1GT8 A;  3AE5 A;  1Z6L A;  2OAL A;  3NRN A;  4G73 A;  3NNE A;  1GTH A;  1ZOY A;  3FMW A;  3K7T A;  4H4Y A;  3DK9 A;  1FOH A;  4DNA A;  1DOD A;  1JU2 A;  2WOW A;  4BUR A;  5C3J A;  4Y4N A;  4EQR A;  4K2X A;  4NZH A;  3NIX A;  4FK1 C;  4EM4 A;  4OVI A;  2YG7 A;  4G6G A;  3QFA A;  5KXJ A;  3DA1 A;  2YG6 A;  4JY2 A;  3CN8 A;  1E1M A;  3IF9 A;  2GVC A;  3AXB A;  4IVO B;  1ZY8 A;  4AT2 A;  4U8O A;  5DBJ A;  1TDE A;  1OJ9 A;  4WCT A;  5GRT A;  1CC6 A;  2IID A;  2JB1 A;  5JCL A;  2AR8 A;  3M13 A;  2YVF A;  4U8N A;  1OJD A;  2X50 A;  3AE7 A;  3KPF A;  4K22 A;  3FPZ A;  2GH5 A;  4TM4 A;  1JRX A;  4LII A;  4U2S A;  4USR A;  3UKK A;  3QFB A;  4J33 A;  4I58 A;  3C4A A;  1PN0 A;  2YLZ A;  2YLR A;  3IHM A;  4ADW A;  1VG9 A;  4JQ9 A;  1RSG A;  2I0Z A;  4PAB A;  3RED A;  2C75 A;  3LJP A;  1B8S A;  1CJC A;  1FEC A;  3I6D A;  3DJD A;  3NN0 X;  4RG4 A;  1NDA A;  2Y6Q A;  3V76 A;  1GPE A;  1FEA A;  3ALM A;  3GRS A;  1XAN A;  5U1O A;  2C3C A;  2GV8 A;  3HYW A;  2RGH A;  4BK2 A;  3UOZ A;  2RAB A;  3NYF A;  5KOX A;  2IVE A;  4Z2U A;  4OPI A;  4OPT A;  1AOG A;  3NTD A;  1IUX A;  4K5S A;  3P4R A;  1NHR A;  1D4D A;  2PHH A;  2CVJ A;  2GF3 A;  5ER0 A;  3R9U A;  3DJJ A;  3AEB A;  1PS9 A;  2C67 A;  2E4G A;  4B67 A;  3K30 A;  3UKF A;  1PDH A;  2JKC A;  4AP3 A;  1EBD A;  1DOC A;  5KNL A;  2EQ9 A;  1LJ1 A;  3GWF A;  4OPU A;  3AED A;  4A7A A;  2YG4 A;  2YM2 A;  5LV9 A;  2GR2 A;  4B66 A;  2XVF A;  3SZW A;  3UKA A;  4EIP A;  1KSS A;  1VRQ B;  3JSK A;  3V3N A;  3S5W A;  3UKP A;  1P2H A;  5IQ1 A;  1NHP A;  3UP4 A;  1GND A;  1DJN A;  4H7U A;  4NEV A;  3AE9 A;  3SFD A;  5JCM A;  3BI2 A;  3IHG A;  4LU6 A;  5HY5 A;  1D4C A;  5KMS A;  1KF6 A;  4H4W A;  1F8R A;  2YVJ A;  4H2R A;  4JNQ A;  3KU9 A;  3VRB A;  2C73 A;  2C72 A;  1YQ4 A;  4EMJ A;  1EL7 A;  2GR3 A;  3M0O A;  3EAN A;  3D1C A;  4H4Q A;  2ZZ0 A;  3ISH A;  3O0H A;  2XLT A;  2GB0 A;  2WET A;  1P2E A;  1PBB A;  4FX9 A;  4KX6 A;  1H86 A;  2C70 A;  4GAP A;  4TLZ A;  4XWR A;  1L9E A;  4JY3 A;  3LOV A;  1ZOV A;  1GRH A;  4ECH A;  5HXI A;  2TPR A;  2BK4 A;  2ZZC A;  3K7M X;  3AE8 A;  3CIR A;  1ZDL A;  1GRG A;  3KA7 A;  1TDF A;  1KDG A;  3AYI A;  4AOX A;  3DJG X;  3P4Q A;  4OCG A;  2A89 A;  4B63 A;  3SY4 A;  3HYX A;  2OA1 A;  2ARD A;  3T2Z A;  3K7Q X;  1H7X A;  1IUV A;  4J34 A;  4RG3 A;  2B7R A;  1OJT A;  2Y6R A;  3CNT A;  3DME A;  4YTN A;  2BA9 A;  4EQS A;  3CMM A;  3CTY A;  1XPQ A;  3COX A;  4TLX A;  1LTX R;  4X9M A;  1H82 A;  4H4S A;  4YTM A;  1N4V A;  2R45 A;  4BJY A;  4DSH A;  4C74 A;  3PO7 A;  4U8K A;  1JEH A;  5KOW A;  3E1T A;  3RP6 A;  2EQ8 A;  3OC4 A;  2YG5 A;  1F6M A;  3UTF A;  3QVR A;  3ALL A;  4OPL A;  2BAC A;  1TYP A;  2YQU A;  4EQX A;  1S2Q A;  2VVL G;  1RYI A;  3BNU A;  4XWZ A;  4Y4M A;  3SXI A;  3QVP A;  4GF7 A;  2R0G A;  3OZ2 A;  2V3A A;  1PXB A;  3UP5 A;  5JCI A;  1F8W A;  1CHU A;  1Q1R A;  1QO8 A;  1PJ5 A;  2GRT A;  4I59 A;  5TR3 A;  1NAA A;  4II3 A;  3UTG A;  2GAH B;  1ZP0 A;  5BUK A;  4UDP A;  3F8R A;  4J31 A;  2H89 A;  1EL9 A;  3UOV A;  1B5Q A;  1H6V A;  3CPH G;  3VR8 A;  3DK4 A;  1NHQ A;  1HYU A;  2JB2 A;  2YM1 A;  3IC9 A;  2WS3 A;  2BYB A;  1ZX9 A;  1YY5 A;  2WES A;  3RP7 A;  4NNJ A;  2WPC A;  1GOS A;  1BF3 A;  4D04 A;  4H2P A;  3GD4 A;  2VZ2 A;  2ZZB A;  2YG3 A;  4Z43 A;  4HB9 A;  2WQY A;  1NHS A;  1CC2 A;  4J57 A;  4EQW A;  4XXG A;  3NYE A;  2V6O A;  3QSS A;  4H4V A;  5KRQ A;  2Q0L A;  1Y56 B;  3AYJ A;  2TMD A;  5JCN A;  3Q6J A;  1PXC A;  2YWL A;  4AP1 A;  3ATR A;  2BC1 A;  3ITJ A;  4C3Y A;  1FEB A;  3BHF A;  3NG7 X;  5J7X A;  1W4X A;  3AD9 B;  4CBQ A;  5M0Z A;  4JNA A;  4CNK A;  2A87 A;  2GQF A;  4BK1 A;  4DSG A;  3ICR A;  2ZBW A;  1KNR A;  2VVM A;  2VRL A;  2JK6 A;  2YLS A;  2YAU A;  1EL5 A;  3KVE A;  3NK2 X;  1MXT A;  2R9Z A;  4RSL A;  3I3L A;  2GMJ A;  4CRT A;  2R4E A;  5FS6 A;  4TM1 A;  3AE1 A;  1GSN A;  1FL2 A;  1GTE A;  2OAM A;  3EAO A;  4K7Z A;  2FJE A;  2WDV A;  3QSE A;  3SYI A;  3VQR A;  4EMI A;  3ABV A;  3BI5 A;  3VRD B;  4USQ A;  3LB8 A;  3BI4 A;  1KSU A;  2H88 A;  3DGH A;  3RP8 A;  4C77 A;  1IUS A;  3LZX A;  2C65 A;  2XFU A;  2BAB A;  5KWF A;  3D8X A;  3VRA A;  4REK A;  2XLR A;  1PBF A;  1Q1W A;  4J56 A;  4TM3 A;  3SM8 A;  1NEK A;  4A6N A;  1BWC A;  1YQ3 A;  1ZK7 A;  2GR0 A;  4K8D A;  2CFY A;  3AE4 A;  4GUV A;  2B76 A;  2C76 A;  3LXD A;  1GRT A;  2C7G A;  1GET A;  1JRY A;  3SX6 A;  1S3B A;  1E1K A;  1QLB A;  2R4J A;  1BGJ A;  2XFQ A;  3IWA A;  1JOA A;  4NTC A;  2EQ7 A;  4ZCD A;  1YQZ A;  4LA1 A;  4Y4L A;  3AEC A;  1B37 A;  3AD7 B;  1D4E A;  4J2W A;  1DOE A;  1TRB A;  1BZL A;  4AOS A;  2NPX A;  3CNS A;  1GRE A;  4II2 A;  1BGN A;  1H81 A;  2C4C A;  5L46 A;  1CJ3 A;  1PBC A;  2V5Z A;  3NK1 X;  3T37 A;  1QJD A;  4GDP A;  5M10 A;  3P9U A;  2JB3 A;  2WOI A;  3UTH A;  4YSY A;  2V60 A;  3ADA B;  2YR4 A;  3EF6 A;  1L9C A;  4YXD A;  1DJQ A;  3LZW A;  3GMB A;  4FK1 A;  3B6D A;  1JRZ A;  4YKF A;  1B4V A;  1O95 A;  3ATQ A;  4U8I A;  3ALJ A;  3S61 A;  4B1B A;  3GYX A;  1IUU A;  4GAV A;  4YSZ A;  5IPY A;  4G9K A;  5JCK A;  1BKW A;  1PXA A;  2AAQ A;  2YVG A;  5FS9 A;  3URH A;  4GDE A;  3VR9 A;  4UP3 A;  1GES A;  3GMC A;  4EIQ A;  2BK3 A;  2B9X A;  1H7W A;  4D03 A;  2WHD A;  5BVA A;  2E1M A;  2B7S A;  2BS2 A;  1KNP A;  3CGE A;  2XYO A;  2R0C A;  4JN9 A;  2R0P A;  1TDN A;  4B68 A;  1F8S A;  3Q9T A;  5EB5 A;  4CNJ A;  2FJD A;  4Z26 A;  3AE3 A;  4U8J A;  3T14 A;  1SEZ A;  2XVI A;  3SQP A;  2XLU A;  2YLW A;  4EM3 A;  3SZC A;  1ELI A;  2BK5 A;  4OPC A;  4ZN0 A;  1OJC A;  4YKG A;  4MJW A;  2WEU A;  2EQ6 A;  4UDR A;  3NT6 A;  4H50 A;  3DK8 A;  2VVL A;  4GCM A;  4P9S A;  2WOV A;  2JBV A;  2HQM A;  5IQ4 A;  1ZKQ A;  2YLT A;  4EMW A;  4YT0 A;  4GR1 A;  3KPK A;  2QAE A;  3P1W A;  4NEW A;  4APN A;  2GR1 A;  2QCU A;  4Z24 A;  2XVJ A;  4Z2R A;  4H4P A;  1K0L A;  3UKH A;  3PVC A;  5J60 A;  4E0V A;  4YSH A;  3NTA A;  3P4S A;  1LPF A;  3V3O A;  3AEF A;  3L1R A;  1ZMC A;  5HHF A;  4CY8 A;  4M52 A;  3FG2 P;  1K4Q A;  2JAE A;  4ZCC A;  4G6H A;  2X8H A;  2XFN A;  2BXS A;  2VQB A;  3AEA A;  2DKH A;  1KFY A;  3AE6 A;  3NKS A;  4GRT A;  2Q0K A;  2BRA A;  1DNC A;  4NWZ A;  2E5V A;  1TYT A;  2WPF A;  3GYI A;  1D7Y A;  1K0J A;  1H83 A;  1VDC A;  2VQ7 A;  3CNJ A;  4B69 A;  3BNM A;  2YR5 A;  1LQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...