4NWZA

Structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
395
structure length
395
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the bacterial type II NADH dehydrogenase: a monotopic membrane protein with an essential role in energy generation.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
total genus 126
structure length 395
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4nwzA00
5KMRA 3SZCA 3SZFA 3T2KA 3SY4A 4G73A 4G9KA 3T14A 3SXIA 3SYIA 3HYWA 3KPKA 3T2YA 4G6HA 3SZWA 3SX6A 3T2ZA 5KMQA 3T31A 3HYVA 5KMPA 3SZ0A 3HYXA 4GAVA 4G6GA 4G74A 5KMSA 4GAPA 4NWZA 3T0KA
chains in the Genus database with same CATH superfamily
4J56A 3II4A 3CN8A 4GCMA 4A65A 5BVAA 3DJEA 5KMRA 3DJDA 3ICSA 4Y4NA 1TDEA 3BNMA 4G73A 3P9UA 1HYUA 1B37A 3SYIA 3M12A 4OPLA 3DK8A 4TM1A 1KF6A 2WOIA 4GR1A 3ADAB 3UKFA 4Z2TA 2VVMA 2JAEA 3UTFA 2V3AA 2JBVA 1VG9A 2OA1A 4OPTA 1YQ4A 4GAVA 2GR0A 4Z43A 3EANA 4NEVA 4Z24A 1OJAA 2GV8A 2WESA 4H4SA 1L9EA 3UOYA 1H7WA 4X9MA 4DSHA 2Z5XA 1E39A 1IUSA 2WDQA 1BZLA 1MO9A 4U8NA 1Y56A 4I59A 3SY4A 4FDCB 2BA9A 2WQYA 3NN0X 4G9KA 4PAAA 2ZZ0A 5U63A 1PBFA 3UCLA 1D4CA 3HYWA 3UP5A 2YLSA 3NK0X 2YLZA 1GRTA 2XFUA 4DNAA 4A99A 2GAHB 2FBWA 3KPFA 2B9XA 2E4GA 4UDRA 3K7MX 2CDUA 3NN6X 4G6GA 1PS9A 3GWDA 4HA6A 1GXFA 4YTMA 4U2LA 1DOEA 3IWAA 1JNZA 1OJDA 2WPCA 5M0ZA 5JCKA 4JQ9A 1O94A 2FJEA 3DK4A 5FMHA 1NENA 1PDHA 4Y4MA 3BNUA 3SM8A 1LQUA 5CKUA 3SQPA 1JRZA 1RP0A 1NHRA 2GB0A 3KA7A 1NG3A 2XFNA 2YVJA 1EBDA 2XFPA 3AE9A 3DK9A 3UKPA 5KOXA 3NLCA 5CQFA 1XHCA 4AOXA 3EPTA 4IA5A 2WPEA 1JU2A 1Y0PA 1BF3A 2WEUA 1QLBA 2GQFA 3T2ZA 3URHA 4IVMB 4K5SA 4H2RA 3SZ0A 1Q1RA 3C96A 2VRMA 2TPRA 2YVGA 4H2NA 3WE0A 2XVHA 4EQWA 1F8WA 1S3BA 2WP9A 3RHAA 1D7YA 4U8MA 1EL8A 4LIIA 2XVEA 1D7LA 2BABA 4RG3A 3KKJA 4B69A 1S2QA 1GRBA 2WOWA 2WU2A 4O5UA 1FOHA 3AB1A 1GALA 4U8KA 4EMIA 4APNA 1CL0A 2A87A 2X50A 3AYIA 1XDIA 1JRXA 3GMBA 1D4DA 2X8GA 4GF7A 1E6EA 4TLXA 2EQ7A 4X4JA 1ELIA 3CNTA 5FS8A 2XLPA 5GSNA 4YSZA 4WCTA 3VRBA 4A9WA 3QJ4A 1QO8A 1TYPA 2X3NA 3LADA 1LV0A 1ZK7A 3ALJA 3BHFA 1Z6LA 1CC2A 5HXIA 3DJJA 1IUWA 4XWZA 3NYEA 1GRGA 1TDKA 3Q6JA 4GAPA 2XLSA 4H4VA 4AP1A 5BUKA 5BULA 5J60A 3CPIG 3NG7X 4H7UA 3EAOA 1NPXA 2C3CA 4EQXA 3KVEA 1F6MA 1H84A 2BXRA 3H8LA 4ZCCA 4FX9A 4U2SA 2YAUA 3CPJG 2APGA 5U25A 3EF6A 3ZDNA 5KOWA 3AE8A 2OAMA 4K5RA 2X8CA 4BK3A 1TYTA 3DA1A 4C3YA 5JCNA 3FIMB 4O5QA 3T31A 3T37A 2YVFA 1E1MA 1GEUA 4J31A 1NAAA 4NEWA 4HB9A 4RSLA 3S61A 4CRTA 4GRTA 4REKA 2C66A 1VG0A 4C3XA 4G74A 4J36A 2XLRA 4K22A 3I3LA 1EL5A 3M0OA 2XLUA 3PS9A 2YG4A 3P4QA 1CJ3A 2TMDA 1RSGA 4B66A 2F5ZA 2O9ZA 2BC0A 2YWLA 3VRAA 1GSNA 2C67A 5FS6A 3NYCA 2AR8A 1W4XA 4H4ZA 1K0LA 3FG2P 4YSXA 1AOGA 1CJ4A 4UDPA 5L46A 3GDPA 1DXLA 1LVLA 3ICTA 2GMJA 2JB2A 2EQ8A 1KFYA 2R0CA 4G6HA 4H4UA 1V59A 4I58A 2DKHA 5JCMA 3F8RA 2JKCA 2R4EA 3CMMA 1GOSA 1M6IA 2IVDA 4H2PA 1REOA 3AE3A 3AYJA 4OPCA 1D5TA 3I6DA 4IVOB 1PBBA 3VRDB 5KRQA 2YQUA 2C76A 2BK5A 5HYMA 4UDQA 3K7TA 5KVIA 2RGHA 2ARDA 3GWFA 2OALA 1DOCA 3NTAA 4EIQA 1H83A 4NTCA 1PN0A 1KNRA 4JNQA 2GAGB 1PHHA 4H4XA 2XLTA 3DH9A 1E1LA 3GSIA 2VOUA 3QVRA 3GYIA 3T14A 2RGOA 3RP7A 3ZYXA 2GR2A 2E1MA 3CNPA 3KPKA 4Z2UA 3AE5A 1GT8A 3NYFA 4YKFA 3F8DA 2QA1A 2C72A 1BKWA 1N4VA 2I0ZA 2V6OA 5BRTA 3GRTA 3KLJA 4P9SA 4A6NA 3AYLA 4DGKA 2R0PA 1F3PA 3NH3X 5KNLA 4IA6A 4RG4A 4BJYA 1H81A 1H86A 2VRLA 2C75A 2Y6QA 3ABVA 5EOWA 2QCUA 1BWCA 4OPDA 1LTXR 1Q1WA 1B4VA 4XXGA 4FK1A 3GRSA 4J34A 2B9WA 3L1RA 3FMWA 4YSYA 1DNCA 4N9XA 4BJZA 3CGDA 4USRA 3PVCA 1GTHA 2RABA 4K8DA 3CGBA 2C70A 2WPFA 2Q0KA 5FS9A 2BCPA 4ICYA 5TR3A 1ZOYA 3UTGA 4EM4A 2GQWA 2R46A 1Q9IA 2GH5A 3QVPA 1S2YA 4B68A 4ECHA 1S3EA 3AE4A 1JNRA 4A79A 1PBDA 1CBOA 3GMCA 1CC4A 1MXTA 4NWZA 1X31B 3IC9A 2BRAA 3D8XA 4K7ZA 2YLRA 2YG6A 1DODA 2R4JA 3B3RA 2OLNA 3UOVA 1D4EA 3AD8B 4II3A 4U8LA 4CBQA 2EQ6A 2Q0LA 5J7XA 2ZZBA 5GRTA 4Z25A 3CIRA 3Q9TA 1PXBA 4YKGA 2BCGG 3AE7A 3ALLA 4J33A 3VR8A 4GUVA 3UTEA 2XFQA 4EQRA 3UKKA 4PABA 1CF3A 2NPXA 2GMHA 3S5WA 4J2WA 2BK4A 4U8IA 4B1BA 4UP3A 4KX6A 3ATQA 2YG5A 3JSKA 3QSSA 4CY6A 1N1PA 4TLZA 1OJTA 1OJCA 1CJ2A 5ER0A 1KNPA 2B9YA 3GYXA 4EMWA 2QAEA 4EM3A 3G5QA 3NKSA 4IV9A 3C4NA 4U8PA 2ACZA 2R45A 2VQBA 3NIXA 2ZZCA 3F8PA 4MJWA 4OCGA 1FL2A 4DSGA 1GRAA 4II2A 1TRBA 3AEAA 4OPIA 4H4YA 3LZXA 2XVJA 1E1NA 3NGCX 3UP4A 2C73A 5HY5A 3AWIA 3SZWA 4CY8A 1FEBA 2JB1A 5JCLA 4JNAA 3V76A 3DMEA 5IPYA 4A6NB 2XFOA 3AEGA 3CNSA 1GETA 1NEKA 2XVFA 1BGNA 2HQMA 2VVLG 1O95A 3ATRA 4U8JA 2J3NA 2GRTA 4TM3A 3HZLA 2QA2A 5IQ1A 2H88A 2IVEA 1IUXA 3CGCA 3AD7B 1CHUA 4J57A 3PO7A 4GDEA 4X9NA 3RP8A 2XCGA 3SFDA 2WOVA 4YSHA 2GEWA 3C4AA 3SXIA 2BS2A 1GRFA 3KD9A 1NHSA 2X8HA 3CNJA 4ZN0A 4M52A 2WU5A 1XANA 2YLXA 3K30A 3P4SA 1NDAA 5FS7A 4CNJA 2BXSA 5KXJA 1MOKA 4C74A 2GVCA 2V5ZA 2Z5YA 3QFBA 2R9ZA 4OPGA 1K0JA 4H2QA 4USQA 1M64A 1N4UA 3QFAA 2WP6A 2WHDA 3AECA 2WS3A 4AP3A 1O5WA 4YTNA 1PBCA 3ICRA 1GPEA 1VRQB 1YQ3A 4A5LA 1IJHA 2DKIA 1PXCA 1CC6A 2GR3A 3AE1A 1ZY8A 4U2TA 2H89A 1TDNA 4NTEA 1FECA 2Q7VA 3LJPA 3SZFA 2YR6A 4H4RA 1NG4A 2R0GA 1EL7A 3RP6A 3SFEA 4GDPA 2CVJA 1LJ1A 1GRHA 3CNDA 3DGZA 1GNDA 4CCRA 4NZHA 2W0HA 5U1OA 1EL9A 3IHGA 3VQRA 3UKHA 1DJNA 2AQJA 3NTDA 4H4PA 4ADWA 4YWOA 1YY5A 4CCQA 1F8SA 2YLTA 2WETA 4BV6A 2WBAA 5IQ4A 4B67A 1PJ7A 2XVIA 4JN9A 1YQZA 3ITJA 1TDOA 3AE2A 5EBKA 4Z26A 5KMPA 4H50A 4EQSA 5KVHA 4JDRA 1N4WA 1GREA 3H8IA 5M10A 2YG3A 2B7SA 3FPZA 3REDA 3KU9A 3SZCA 3T2KA 1E7PA 2GF3A 4D03A 3CGEA 3FBSA 1L0VA 1KSUA 2VQ7A 4BK2A 4XWRA 1JRYA 2X99A 5JCIA 1B8SA 2V60A 2A8XA 3UKAA 4OPUA 4B64A 1FCDA 5KMQA 1ZP0A 2BK3A 4U8OA 3NRNA 3UKQA 2UZZA 2BRYA 1PBEA 2BACA 3G5SA 2XDOA 3HYXA 2YM1A 2ZBWA 2B7RA 4WX1A 1GV4A 3CPHG 1ZMCA 2YG7A 1JOAA 1ZDLA 3BI5A 3R9UA 2V3BA 5KWFA 4ZCDA 4Y4LA 4JY2A 4AT2A 2WDVA 1PJ6A 4BURA 2NVKX 2YR5A 3NT6A 4H4QA 4H4WA 3G5RA 2C4CA 1RYIA 3RNMA 1NHPA 5C3JA 4NNJA 2RGJA 1KDGA 2VVLA 4KPRA 2JB3A 1JEHA 2C3DA 4YXDA 1IUVA 4H4TA 5EB4A 1PJ5A 1DOBA 3GDNA 3IF9A 3OZ2A 3T2YA 4Z44A 3DGHA 3NK1X 3SX6A 2IIDA 4LU6A 2FJBA 3HYVA 1H7XA 2XYOA 3IHMA 3E1TA 5EB5A 1K0IA 3M13A 2C65A 5C2TA 4EIPA 1OJ9A 3BHKA 3B6DA 1BGJA 4EMJA 1P2HA 3LOVA 1DJQA 1TDFA 2FJAA 4TM0A 3UOXA 2Q6UA 1XPQA 1VDCA 3AEDA 4B65A 5HHFA 3P4RA 1B5QA 4D04A 2A89A 3SGLA 4A7AA 3V3OA 3ALMA 3DJGX 4AOSA 1Y56B 1K4QA 1NHQA 2PHHA 1ZKQA 1VQWA 4YT0A 1GERA 1GESA 3UOZA 4NTDA 2WDRA 1FEAA 3UTHA 2PYXA 3LXDA 2V61A 1LPFA 5DBJA 4YTPA 2AAQA 3BI4A 3COXA 3AEBA 3GYJA 3LZWA 2B76A 3V3NA 2C7GA 4AT0A 1ONFA 2OLOA 3AE6A 1ZMDA 2E5VA 3BI2A 3K7QX 2CFYA 3GD4A 4C5OA 3AD9B 2JK6A 2YR4A 2FJDA 2BS4A 4BK1A 4C77A 5LV9A 3AEEA 2YLWA 4K2XA 1H6VA 1L9DA 4B63A 3GD3A 4E0VA 2Y6RA 3O0HA 3T0KA 2VZ2A 3AXBA 3UKLA 3H4KA 3ISHA 4Z2RA 2C64A 3LB8A 1P2EA 1H82A 4LA1A 1L9CA 4TM4A 3QSMA 3NK2X 3AEFA 3NNEA 2CULA 4OVIA 3CTYA 1F8RA 4CNKA 1UKVG 4FK1C 1ZOVA 3P1WA 2EQ9A 2GR1A 3OC4A 1CJCA 3VR9A 3L8KA 4JY3A 1SEZA 1E1KA 2BYBA 2WP5A 1IUTA 3D1CA 1LQTA 1GTEA 3P4PA 1KSSA 1COYA 2BC1A 1IUUA 1ZX9A 3QSEA 1PXAA 2YM2A 1QJDA 5KMSA 1YKJA 2BS3A 3NHOX
chains in the Genus database with same CATH topology
4J56A 3II4A 3CN8A 4GCMA 4A65A 5BVAA 3DJEA 5KMRA 3DJDA 3ICSA 4Y4NA 1TDEA 3BNMA 4G73A 3P9UA 1HYUA 1B37A 3SYIA 3M12A 4OPLA 3DK8A 4TM1A 1KF6A 2WOIA 4GR1A 3ADAB 3UKFA 4Z2TA 2VVMA 2JAEA 3UTFA 2V3AA 2JBVA 1VG9A 2OA1A 4OPTA 1YQ4A 4GAVA 2GR0A 4Z43A 3EANA 4NEVA 4Z24A 1OJAA 2GV8A 2WESA 4H4SA 1L9EA 3UOYA 1H7WA 4X9MA 4DSHA 2Z5XA 1E39A 1IUSA 2WDQA 1BZLA 1MO9A 4U8NA 1Y56A 4I59A 3SY4A 4FDCB 2BA9A 2WQYA 3NN0X 4G9KA 4PAAA 2ZZ0A 5U63A 1PBFA 3UCLA 1D4CA 3HYWA 3UP5A 2YLSA 3NK0X 2YLZA 1GRTA 2XFUA 4DNAA 4A99A 2GAHB 2FBWA 3KPFA 2B9XA 2E4GA 4UDRA 3K7MX 2CDUA 3NN6X 4G6GA 1PS9A 3GWDA 4HA6A 1GXFA 4YTMA 4U2LA 1DOEA 3IWAA 1JNZA 1OJDA 2WPCA 5M0ZA 5JCKA 4JQ9A 1O94A 2FJEA 3DK4A 5FMHA 1NENA 1PDHA 4Y4MA 3BNUA 3SM8A 1LQUA 5CKUA 3SQPA 1JRZA 1RP0A 1NHRA 2GB0A 3KA7A 1NG3A 2XFNA 2YVJA 1EBDA 2XFPA 3AE9A 3DK9A 3UKPA 5KOXA 3NLCA 5CQFA 1XHCA 4AOXA 3EPTA 4IA5A 2WPEA 1JU2A 1Y0PA 1BF3A 2WEUA 1QLBA 2GQFA 3T2ZA 3URHA 4IVMB 4K5SA 4H2RA 3SZ0A 1Q1RA 3C96A 2VRMA 2TPRA 2YVGA 4H2NA 3WE0A 2XVHA 4EQWA 1F8WA 1S3BA 2WP9A 3RHAA 1D7YA 4U8MA 1EL8A 4LIIA 2XVEA 1D7LA 2BABA 4RG3A 3KKJA 4B69A 1S2QA 1GRBA 2WOWA 2WU2A 4O5UA 1FOHA 3AB1A 1GALA 4U8KA 4EMIA 4APNA 1CL0A 2A87A 2X50A 3AYIA 1XDIA 1JRXA 3GMBA 1D4DA 2X8GA 4GF7A 1E6EA 4TLXA 2EQ7A 4X4JA 1ELIA 3CNTA 5FS8A 2XLPA 5GSNA 4YSZA 4WCTA 3VRBA 4A9WA 3QJ4A 1QO8A 1TYPA 2X3NA 3LADA 1LV0A 1ZK7A 3ALJA 3BHFA 1Z6LA 1CC2A 5HXIA 3DJJA 1IUWA 4XWZA 3NYEA 1GRGA 1TDKA 3Q6JA 4GAPA 2XLSA 4H4VA 4AP1A 5BUKA 5BULA 5J60A 3CPIG 3NG7X 4H7UA 3EAOA 1NPXA 2C3CA 4EQXA 3KVEA 1F6MA 1H84A 2BXRA 3H8LA 4ZCCA 4FX9A 4U2SA 2YAUA 3CPJG 2APGA 5U25A 3EF6A 3ZDNA 5KOWA 3AE8A 2OAMA 4K5RA 2X8CA 4BK3A 1TYTA 3DA1A 4C3YA 5JCNA 3FIMB 4O5QA 3T31A 3T37A 2YVFA 1E1MA 1GEUA 4J31A 1NAAA 4NEWA 4HB9A 4RSLA 3S61A 4CRTA 4GRTA 4REKA 2C66A 1VG0A 4C3XA 4G74A 4J36A 2XLRA 4K22A 3I3LA 1EL5A 3M0OA 2XLUA 3PS9A 2YG4A 3P4QA 1CJ3A 2TMDA 1RSGA 4B66A 2F5ZA 2O9ZA 2BC0A 2YWLA 3VRAA 1GSNA 2C67A 5FS6A 3NYCA 2AR8A 1W4XA 4H4ZA 1K0LA 3FG2P 4YSXA 1AOGA 1CJ4A 4UDPA 5L46A 3GDPA 1DXLA 1LVLA 3ICTA 2GMJA 2JB2A 2EQ8A 1KFYA 2R0CA 4G6HA 4H4UA 1V59A 4I58A 2DKHA 5JCMA 3F8RA 2JKCA 2R4EA 3CMMA 1GOSA 1M6IA 2IVDA 4H2PA 1REOA 3AE3A 3AYJA 4OPCA 1D5TA 3I6DA 4IVOB 1PBBA 3VRDB 5KRQA 2YQUA 2C76A 2BK5A 5HYMA 4UDQA 3K7TA 5KVIA 2RGHA 2ARDA 3GWFA 2OALA 1DOCA 3NTAA 4EIQA 1H83A 4NTCA 1PN0A 1KNRA 4JNQA 2GAGB 1PHHA 4H4XA 2XLTA 3DH9A 1E1LA 3GSIA 2VOUA 3QVRA 3GYIA 3T14A 2RGOA 3RP7A 3ZYXA 2GR2A 2E1MA 3CNPA 3KPKA 4Z2UA 3AE5A 1GT8A 3NYFA 4YKFA 3F8DA 2QA1A 2C72A 1BKWA 1N4VA 2I0ZA 2V6OA 5BRTA 3GRTA 3KLJA 4P9SA 4A6NA 3AYLA 4DGKA 2R0PA 1F3PA 3NH3X 5KNLA 4IA6A 4RG4A 4BJYA 1H81A 1H86A 2VRLA 2C75A 2Y6QA 3ABVA 5EOWA 2QCUA 1BWCA 4OPDA 1LTXR 1Q1WA 1B4VA 4XXGA 4FK1A 3GRSA 4J34A 2B9WA 3L1RA 3FMWA 4YSYA 1DNCA 4N9XA 4BJZA 3CGDA 4USRA 3PVCA 1GTHA 2RABA 4K8DA 3CGBA 2C70A 2WPFA 2Q0KA 5FS9A 2BCPA 4ICYA 5TR3A 1ZOYA 3UTGA 4EM4A 2GQWA 2R46A 1Q9IA 2GH5A 3QVPA 1S2YA 4B68A 4ECHA 1S3EA 3AE4A 1JNRA 4A79A 1PBDA 1CBOA 3GMCA 1CC4A 1MXTA 4NWZA 1X31B 3IC9A 2BRAA 3D8XA 4K7ZA 2YLRA 2YG6A 1DODA 2R4JA 3B3RA 2OLNA 3UOVA 1D4EA 3AD8B 4II3A 4U8LA 4CBQA 2EQ6A 2Q0LA 5J7XA 2ZZBA 5GRTA 4Z25A 3CIRA 3Q9TA 1PXBA 4YKGA 2BCGG 3AE7A 3ALLA 4J33A 3VR8A 4GUVA 3UTEA 2XFQA 4EQRA 3UKKA 4PABA 1CF3A 2NPXA 2GMHA 3S5WA 4J2WA 2BK4A 4U8IA 4B1BA 4UP3A 4KX6A 3ATQA 2YG5A 3JSKA 3QSSA 4CY6A 1N1PA 4TLZA 1OJTA 1OJCA 1CJ2A 5ER0A 1KNPA 2B9YA 3GYXA 4EMWA 2QAEA 4EM3A 3G5QA 3NKSA 4IV9A 3C4NA 4U8PA 2ACZA 2R45A 2VQBA 3NIXA 2ZZCA 3F8PA 4MJWA 4OCGA 1FL2A 4DSGA 1GRAA 4II2A 1TRBA 3AEAA 4OPIA 4H4YA 3LZXA 2XVJA 1E1NA 3NGCX 3UP4A 2C73A 5HY5A 3AWIA 3SZWA 4CY8A 1FEBA 2JB1A 5JCLA 4JNAA 3V76A 3DMEA 5IPYA 4A6NB 2XFOA 3AEGA 3CNSA 1GETA 1NEKA 2XVFA 1BGNA 2HQMA 2VVLG 1O95A 3ATRA 4U8JA 2J3NA 2GRTA 4TM3A 3HZLA 2QA2A 5IQ1A 2H88A 2IVEA 1IUXA 3CGCA 3AD7B 1CHUA 4J57A 3PO7A 4GDEA 4X9NA 3RP8A 2XCGA 3SFDA 2WOVA 4YSHA 2GEWA 3C4AA 3SXIA 2BS2A 1GRFA 3KD9A 1NHSA 2X8HA 3CNJA 4ZN0A 4M52A 2WU5A 1XANA 2YLXA 3K30A 3P4SA 1NDAA 5FS7A 4CNJA 2BXSA 5KXJA 1MOKA 4C74A 2GVCA 2V5ZA 2Z5YA 3QFBA 2R9ZA 4OPGA 1K0JA 4H2QA 4USQA 1M64A 1N4UA 3QFAA 2WP6A 2WHDA 3AECA 2WS3A 4AP3A 1O5WA 4YTNA 1PBCA 3ICRA 1GPEA 1VRQB 1YQ3A 4A5LA 1IJHA 2DKIA 1PXCA 1CC6A 2GR3A 3AE1A 1ZY8A 4U2TA 2H89A 1TDNA 4NTEA 1FECA 2Q7VA 3LJPA 3SZFA 2YR6A 4H4RA 1NG4A 2R0GA 1EL7A 3RP6A 3SFEA 4GDPA 2CVJA 1LJ1A 1GRHA 3CNDA 3DGZA 1GNDA 4CCRA 4NZHA 2W0HA 5U1OA 1EL9A 3IHGA 3VQRA 3UKHA 1DJNA 2AQJA 3NTDA 4H4PA 4ADWA 4YWOA 1YY5A 4CCQA 1F8SA 2YLTA 2WETA 4BV6A 2WBAA 5IQ4A 4B67A 1PJ7A 2XVIA 4JN9A 1YQZA 3ITJA 1TDOA 3AE2A 5EBKA 4Z26A 5KMPA 4H50A 4EQSA 5KVHA 4JDRA 1N4WA 1GREA 3H8IA 5M10A 2YG3A 2B7SA 3FPZA 3REDA 3KU9A 3SZCA 3T2KA 1E7PA 2GF3A 4D03A 3CGEA 3FBSA 1L0VA 1KSUA 2VQ7A 4BK2A 4XWRA 1JRYA 2X99A 5JCIA 1B8SA 2V60A 2A8XA 3UKAA 4OPUA 4B64A 1FCDA 5KMQA 1ZP0A 2BK3A 4U8OA 3NRNA 3UKQA 2UZZA 2BRYA 1PBEA 2BACA 3G5SA 2XDOA 3HYXA 2YM1A 2ZBWA 2B7RA 4WX1A 1GV4A 3CPHG 1ZMCA 2YG7A 1JOAA 1ZDLA 3BI5A 3R9UA 2V3BA 5KWFA 4ZCDA 4Y4LA 4JY2A 4AT2A 2WDVA 1PJ6A 4BURA 2NVKX 2YR5A 3NT6A 4H4QA 4H4WA 3G5RA 2C4CA 1RYIA 3RNMA 1NHPA 5C3JA 4NNJA 2RGJA 1KDGA 2VVLA 4KPRA 2JB3A 1JEHA 2C3DA 4YXDA 1IUVA 4H4TA 5EB4A 1PJ5A 1DOBA 3GDNA 3IF9A 3OZ2A 3T2YA 4Z44A 3DGHA 3NK1X 3SX6A 2IIDA 4LU6A 2FJBA 3HYVA 1H7XA 2XYOA 3IHMA 3E1TA 5EB5A 1K0IA 3M13A 2C65A 5C2TA 4EIPA 1OJ9A 3BHKA 3B6DA 1BGJA 4EMJA 1P2HA 3LOVA 1DJQA 1TDFA 2FJAA 4TM0A 3UOXA 2Q6UA 1XPQA 1VDCA 3AEDA 4B65A 5HHFA 3P4RA 1B5QA 4D04A 2A89A 3SGLA 4A7AA 3V3OA 3ALMA 3DJGX 4AOSA 1Y56B 1K4QA 1NHQA 2PHHA 1ZKQA 1VQWA 4YT0A 1GERA 1GESA 3UOZA 4NTDA 2WDRA 1FEAA 3UTHA 2PYXA 3LXDA 2V61A 1LPFA 5DBJA 4YTPA 2AAQA 3BI4A 3COXA 3AEBA 3GYJA 3LZWA 2B76A 3V3NA 2C7GA 4AT0A 1ONFA 2OLOA 3AE6A 1ZMDA 2E5VA 3BI2A 3K7QX 2CFYA 3GD4A 4C5OA 3AD9B 2JK6A 2YR4A 2FJDA 2BS4A 4BK1A 4C77A 5LV9A 3AEEA 2YLWA 4K2XA 1H6VA 1L9DA 4B63A 3GD3A 4E0VA 2Y6RA 3O0HA 3T0KA 2VZ2A 3AXBA 3UKLA 3H4KA 3ISHA 4Z2RA 2C64A 3LB8A 1P2EA 1H82A 4LA1A 1L9CA 4TM4A 3QSMA 3NK2X 3AEFA 3NNEA 2CULA 4OVIA 3CTYA 1F8RA 4CNKA 1UKVG 4FK1C 1ZOVA 3P1WA 2EQ9A 2GR1A 3OC4A 1CJCA 3VR9A 3L8KA 4JY3A 1SEZA 1E1KA 2BYBA 2WP5A 1IUTA 3D1CA 1LQTA 1GTEA 3P4PA 1KSSA 1COYA 2BC1A 1IUUA 1ZX9A 3QSEA 1PXAA 2YM2A 1QJDA 5KMSA 1YKJA 2BS3A 3NHOX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMR A;  3SZC A;  3SZF A;  3T2K A;  3SY4 A;  4G73 A;  4G9K A;  3T14 A;  3SXI A;  3SYI A;  3HYW A;  3KPK A;  3T2Y A;  4G6H A;  3SZW A;  3SX6 A;  3T2Z A;  5KMQ A;  3T31 A;  3HYV A;  5KMP A;  3SZ0 A;  3HYX A;  4GAV A;  4G6G A;  4G74 A;  5KMS A;  4GAP A;  4NWZ A;  3T0K A; 
#chains in the Genus database with same CATH topology
 4J56 A;  3II4 A;  3CN8 A;  4GCM A;  4A65 A;  5BVA A;  3DJE A;  5KMR A;  3DJD A;  3ICS A;  4Y4N A;  1TDE A;  3BNM A;  4G73 A;  3P9U A;  1HYU A;  1B37 A;  3SYI A;  3M12 A;  4OPL A;  3DK8 A;  4TM1 A;  1KF6 A;  2WOI A;  4GR1 A;  3ADA B;  3UKF A;  4Z2T A;  2VVM A;  2JAE A;  3UTF A;  2V3A A;  2JBV A;  1VG9 A;  2OA1 A;  4OPT A;  1YQ4 A;  4GAV A;  2GR0 A;  4Z43 A;  3EAN A;  4NEV A;  4Z24 A;  1OJA A;  2GV8 A;  2WES A;  4H4S A;  1L9E A;  3UOY A;  1H7W A;  4X9M A;  4DSH A;  2Z5X A;  1E39 A;  1IUS A;  2WDQ A;  1BZL A;  1MO9 A;  4U8N A;  1Y56 A;  4I59 A;  3SY4 A;  4FDC B;  2BA9 A;  2WQY A;  3NN0 X;  4G9K A;  4PAA A;  2ZZ0 A;  5U63 A;  1PBF A;  3UCL A;  1D4C A;  3HYW A;  3UP5 A;  2YLS A;  3NK0 X;  2YLZ A;  1GRT A;  2XFU A;  4DNA A;  4A99 A;  2GAH B;  2FBW A;  3KPF A;  2B9X A;  2E4G A;  4UDR A;  3K7M X;  2CDU A;  3NN6 X;  4G6G A;  1PS9 A;  3GWD A;  4HA6 A;  1GXF A;  4YTM A;  4U2L A;  1DOE A;  3IWA A;  1JNZ A;  1OJD A;  2WPC A;  5M0Z A;  5JCK A;  4JQ9 A;  1O94 A;  2FJE A;  3DK4 A;  5FMH A;  1NEN A;  1PDH A;  4Y4M A;  3BNU A;  3SM8 A;  1LQU A;  5CKU A;  3SQP A;  1JRZ A;  1RP0 A;  1NHR A;  2GB0 A;  3KA7 A;  1NG3 A;  2XFN A;  2YVJ A;  1EBD A;  2XFP A;  3AE9 A;  3DK9 A;  3UKP A;  5KOX A;  3NLC A;  5CQF A;  1XHC A;  4AOX A;  3EPT A;  4IA5 A;  2WPE A;  1JU2 A;  1Y0P A;  1BF3 A;  2WEU A;  1QLB A;  2GQF A;  3T2Z A;  3URH A;  4IVM B;  4K5S A;  4H2R A;  3SZ0 A;  1Q1R A;  3C96 A;  2VRM A;  2TPR A;  2YVG A;  4H2N A;  3WE0 A;  2XVH A;  4EQW A;  1F8W A;  1S3B A;  2WP9 A;  3RHA A;  1D7Y A;  4U8M A;  1EL8 A;  4LII A;  2XVE A;  1D7L A;  2BAB A;  4RG3 A;  3KKJ A;  4B69 A;  1S2Q A;  1GRB A;  2WOW A;  2WU2 A;  4O5U A;  1FOH A;  3AB1 A;  1GAL A;  4U8K A;  4EMI A;  4APN A;  1CL0 A;  2A87 A;  2X50 A;  3AYI A;  1XDI A;  1JRX A;  3GMB A;  1D4D A;  2X8G A;  4GF7 A;  1E6E A;  4TLX A;  2EQ7 A;  4X4J A;  1ELI A;  3CNT A;  5FS8 A;  2XLP A;  5GSN A;  4YSZ A;  4WCT A;  3VRB A;  4A9W A;  3QJ4 A;  1QO8 A;  1TYP A;  2X3N A;  3LAD A;  1LV0 A;  1ZK7 A;  3ALJ A;  3BHF A;  1Z6L A;  1CC2 A;  5HXI A;  3DJJ A;  1IUW A;  4XWZ A;  3NYE A;  1GRG A;  1TDK A;  3Q6J A;  4GAP A;  2XLS A;  4H4V A;  4AP1 A;  5BUK A;  5BUL A;  5J60 A;  3CPI G;  3NG7 X;  4H7U A;  3EAO A;  1NPX A;  2C3C A;  4EQX A;  3KVE A;  1F6M A;  1H84 A;  2BXR A;  3H8L A;  4ZCC A;  4FX9 A;  4U2S A;  2YAU A;  3CPJ G;  2APG A;  5U25 A;  3EF6 A;  3ZDN A;  5KOW A;  3AE8 A;  2OAM A;  4K5R A;  2X8C A;  4BK3 A;  1TYT A;  3DA1 A;  4C3Y A;  5JCN A;  3FIM B;  4O5Q A;  3T31 A;  3T37 A;  2YVF A;  1E1M A;  1GEU A;  4J31 A;  1NAA A;  4NEW A;  4HB9 A;  4RSL A;  3S61 A;  4CRT A;  4GRT A;  4REK A;  2C66 A;  1VG0 A;  4C3X A;  4G74 A;  4J36 A;  2XLR A;  4K22 A;  3I3L A;  1EL5 A;  3M0O A;  2XLU A;  3PS9 A;  2YG4 A;  3P4Q A;  1CJ3 A;  2TMD A;  1RSG A;  4B66 A;  2F5Z A;  2O9Z A;  2BC0 A;  2YWL A;  3VRA A;  1GSN A;  2C67 A;  5FS6 A;  3NYC A;  2AR8 A;  1W4X A;  4H4Z A;  1K0L A;  3FG2 P;  4YSX A;  1AOG A;  1CJ4 A;  4UDP A;  5L46 A;  3GDP A;  1DXL A;  1LVL A;  3ICT A;  2GMJ A;  2JB2 A;  2EQ8 A;  1KFY A;  2R0C A;  4G6H A;  4H4U A;  1V59 A;  4I58 A;  2DKH A;  5JCM A;  3F8R A;  2JKC A;  2R4E A;  3CMM A;  1GOS A;  1M6I A;  2IVD A;  4H2P A;  1REO A;  3AE3 A;  3AYJ A;  4OPC A;  1D5T A;  3I6D A;  4IVO B;  1PBB A;  3VRD B;  5KRQ A;  2YQU A;  2C76 A;  2BK5 A;  5HYM A;  4UDQ A;  3K7T A;  5KVI A;  2RGH A;  2ARD A;  3GWF A;  2OAL A;  1DOC A;  3NTA A;  4EIQ A;  1H83 A;  4NTC A;  1PN0 A;  1KNR A;  4JNQ A;  2GAG B;  1PHH A;  4H4X A;  2XLT A;  3DH9 A;  1E1L A;  3GSI A;  2VOU A;  3QVR A;  3GYI A;  3T14 A;  2RGO A;  3RP7 A;  3ZYX A;  2GR2 A;  2E1M A;  3CNP A;  3KPK A;  4Z2U A;  3AE5 A;  1GT8 A;  3NYF A;  4YKF A;  3F8D A;  2QA1 A;  2C72 A;  1BKW A;  1N4V A;  2I0Z A;  2V6O A;  5BRT A;  3GRT A;  3KLJ A;  4P9S A;  4A6N A;  3AYL A;  4DGK A;  2R0P A;  1F3P A;  3NH3 X;  5KNL A;  4IA6 A;  4RG4 A;  4BJY A;  1H81 A;  1H86 A;  2VRL A;  2C75 A;  2Y6Q A;  3ABV A;  5EOW A;  2QCU A;  1BWC A;  4OPD A;  1LTX R;  1Q1W A;  1B4V A;  4XXG A;  4FK1 A;  3GRS A;  4J34 A;  2B9W A;  3L1R A;  3FMW A;  4YSY A;  1DNC A;  4N9X A;  4BJZ A;  3CGD A;  4USR A;  3PVC A;  1GTH A;  2RAB A;  4K8D A;  3CGB A;  2C70 A;  2WPF A;  2Q0K A;  5FS9 A;  2BCP A;  4ICY A;  5TR3 A;  1ZOY A;  3UTG A;  4EM4 A;  2GQW A;  2R46 A;  1Q9I A;  2GH5 A;  3QVP A;  1S2Y A;  4B68 A;  4ECH A;  1S3E A;  3AE4 A;  1JNR A;  4A79 A;  1PBD A;  1CBO A;  3GMC A;  1CC4 A;  1MXT A;  4NWZ A;  1X31 B;  3IC9 A;  2BRA A;  3D8X A;  4K7Z A;  2YLR A;  2YG6 A;  1DOD A;  2R4J A;  3B3R A;  2OLN A;  3UOV A;  1D4E A;  3AD8 B;  4II3 A;  4U8L A;  4CBQ A;  2EQ6 A;  2Q0L A;  5J7X A;  2ZZB A;  5GRT A;  4Z25 A;  3CIR A;  3Q9T A;  1PXB A;  4YKG A;  2BCG G;  3AE7 A;  3ALL A;  4J33 A;  3VR8 A;  4GUV A;  3UTE A;  2XFQ A;  4EQR A;  3UKK A;  4PAB A;  1CF3 A;  2NPX A;  2GMH A;  3S5W A;  4J2W A;  2BK4 A;  4U8I A;  4B1B A;  4UP3 A;  4KX6 A;  3ATQ A;  2YG5 A;  3JSK A;  3QSS A;  4CY6 A;  1N1P A;  4TLZ A;  1OJT A;  1OJC A;  1CJ2 A;  5ER0 A;  1KNP A;  2B9Y A;  3GYX A;  4EMW A;  2QAE A;  4EM3 A;  3G5Q A;  3NKS A;  4IV9 A;  3C4N A;  4U8P A;  2ACZ A;  2R45 A;  2VQB A;  3NIX A;  2ZZC A;  3F8P A;  4MJW A;  4OCG A;  1FL2 A;  4DSG A;  1GRA A;  4II2 A;  1TRB A;  3AEA A;  4OPI A;  4H4Y A;  3LZX A;  2XVJ A;  1E1N A;  3NGC X;  3UP4 A;  2C73 A;  5HY5 A;  3AWI A;  3SZW A;  4CY8 A;  1FEB A;  2JB1 A;  5JCL A;  4JNA A;  3V76 A;  3DME A;  5IPY A;  4A6N B;  2XFO A;  3AEG A;  3CNS A;  1GET A;  1NEK A;  2XVF A;  1BGN A;  2HQM A;  2VVL G;  1O95 A;  3ATR A;  4U8J A;  2J3N A;  2GRT A;  4TM3 A;  3HZL A;  2QA2 A;  5IQ1 A;  2H88 A;  2IVE A;  1IUX A;  3CGC A;  3AD7 B;  1CHU A;  4J57 A;  3PO7 A;  4GDE A;  4X9N A;  3RP8 A;  2XCG A;  3SFD A;  2WOV A;  4YSH A;  2GEW A;  3C4A A;  3SXI A;  2BS2 A;  1GRF A;  3KD9 A;  1NHS A;  2X8H A;  3CNJ A;  4ZN0 A;  4M52 A;  2WU5 A;  1XAN A;  2YLX A;  3K30 A;  3P4S A;  1NDA A;  5FS7 A;  4CNJ A;  2BXS A;  5KXJ A;  1MOK A;  4C74 A;  2GVC A;  2V5Z A;  2Z5Y A;  3QFB A;  2R9Z A;  4OPG A;  1K0J A;  4H2Q A;  4USQ A;  1M64 A;  1N4U A;  3QFA A;  2WP6 A;  2WHD A;  3AEC A;  2WS3 A;  4AP3 A;  1O5W A;  4YTN A;  1PBC A;  3ICR A;  1GPE A;  1VRQ B;  1YQ3 A;  4A5L A;  1IJH A;  2DKI A;  1PXC A;  1CC6 A;  2GR3 A;  3AE1 A;  1ZY8 A;  4U2T A;  2H89 A;  1TDN A;  4NTE A;  1FEC A;  2Q7V A;  3LJP A;  3SZF A;  2YR6 A;  4H4R A;  1NG4 A;  2R0G A;  1EL7 A;  3RP6 A;  3SFE A;  4GDP A;  2CVJ A;  1LJ1 A;  1GRH A;  3CND A;  3DGZ A;  1GND A;  4CCR A;  4NZH A;  2W0H A;  5U1O A;  1EL9 A;  3IHG A;  3VQR A;  3UKH A;  1DJN A;  2AQJ A;  3NTD A;  4H4P A;  4ADW A;  4YWO A;  1YY5 A;  4CCQ A;  1F8S A;  2YLT A;  2WET A;  4BV6 A;  2WBA A;  5IQ4 A;  4B67 A;  1PJ7 A;  2XVI A;  4JN9 A;  1YQZ A;  3ITJ A;  1TDO A;  3AE2 A;  5EBK A;  4Z26 A;  5KMP A;  4H50 A;  4EQS A;  5KVH A;  4JDR A;  1N4W A;  1GRE A;  3H8I A;  5M10 A;  2YG3 A;  2B7S A;  3FPZ A;  3RED A;  3KU9 A;  3SZC A;  3T2K A;  1E7P A;  2GF3 A;  4D03 A;  3CGE A;  3FBS A;  1L0V A;  1KSU A;  2VQ7 A;  4BK2 A;  4XWR A;  1JRY A;  2X99 A;  5JCI A;  1B8S A;  2V60 A;  2A8X A;  3UKA A;  4OPU A;  4B64 A;  1FCD A;  5KMQ A;  1ZP0 A;  2BK3 A;  4U8O A;  3NRN A;  3UKQ A;  2UZZ A;  2BRY A;  1PBE A;  2BAC A;  3G5S A;  2XDO A;  3HYX A;  2YM1 A;  2ZBW A;  2B7R A;  4WX1 A;  1GV4 A;  3CPH G;  1ZMC A;  2YG7 A;  1JOA A;  1ZDL A;  3BI5 A;  3R9U A;  2V3B A;  5KWF A;  4ZCD A;  4Y4L A;  4JY2 A;  4AT2 A;  2WDV A;  1PJ6 A;  4BUR A;  2NVK X;  2YR5 A;  3NT6 A;  4H4Q A;  4H4W A;  3G5R A;  2C4C A;  1RYI A;  3RNM A;  1NHP A;  5C3J A;  4NNJ A;  2RGJ A;  1KDG A;  2VVL A;  4KPR A;  2JB3 A;  1JEH A;  2C3D A;  4YXD A;  1IUV A;  4H4T A;  5EB4 A;  1PJ5 A;  1DOB A;  3GDN A;  3IF9 A;  3OZ2 A;  3T2Y A;  4Z44 A;  3DGH A;  3NK1 X;  3SX6 A;  2IID A;  4LU6 A;  2FJB A;  3HYV A;  1H7X A;  2XYO A;  3IHM A;  3E1T A;  5EB5 A;  1K0I A;  3M13 A;  2C65 A;  5C2T A;  4EIP A;  1OJ9 A;  3BHK A;  3B6D A;  1BGJ A;  4EMJ A;  1P2H A;  3LOV A;  1DJQ A;  1TDF A;  2FJA A;  4TM0 A;  3UOX A;  2Q6U A;  1XPQ A;  1VDC A;  3AED A;  4B65 A;  5HHF A;  3P4R A;  1B5Q A;  4D04 A;  2A89 A;  3SGL A;  4A7A A;  3V3O A;  3ALM A;  3DJG X;  4AOS A;  1Y56 B;  1K4Q A;  1NHQ A;  2PHH A;  1ZKQ A;  1VQW A;  4YT0 A;  1GER A;  1GES A;  3UOZ A;  4NTD A;  2WDR A;  1FEA A;  3UTH A;  2PYX A;  3LXD A;  2V61 A;  1LPF A;  5DBJ A;  4YTP A;  2AAQ A;  3BI4 A;  3COX A;  3AEB A;  3GYJ A;  3LZW A;  2B76 A;  3V3N A;  2C7G A;  4AT0 A;  1ONF A;  2OLO A;  3AE6 A;  1ZMD A;  2E5V A;  3BI2 A;  3K7Q X;  2CFY A;  3GD4 A;  4C5O A;  3AD9 B;  2JK6 A;  2YR4 A;  2FJD A;  2BS4 A;  4BK1 A;  4C77 A;  5LV9 A;  3AEE A;  2YLW A;  4K2X A;  1H6V A;  1L9D A;  4B63 A;  3GD3 A;  4E0V A;  2Y6R A;  3O0H A;  3T0K A;  2VZ2 A;  3AXB A;  3UKL A;  3H4K A;  3ISH A;  4Z2R A;  2C64 A;  3LB8 A;  1P2E A;  1H82 A;  4LA1 A;  1L9C A;  4TM4 A;  3QSM A;  3NK2 X;  3AEF A;  3NNE A;  2CUL A;  4OVI A;  3CTY A;  1F8R A;  4CNK A;  1UKV G;  4FK1 C;  1ZOV A;  3P1W A;  2EQ9 A;  2GR1 A;  3OC4 A;  1CJC A;  3VR9 A;  3L8K A;  4JY3 A;  1SEZ A;  1E1K A;  2BYB A;  2WP5 A;  1IUT A;  3D1C A;  1LQT A;  1GTE A;  3P4P A;  1KSS A;  1COY A;  2BC1 A;  1IUU A;  1ZX9 A;  3QSE A;  1PXA A;  2YM2 A;  1QJD A;  5KMS A;  1YKJ A;  2BS3 A;  3NHO X; 
#chains in the Genus database with same CATH homology
 4J56 A;  3II4 A;  3CN8 A;  4GCM A;  4A65 A;  5BVA A;  3DJE A;  5KMR A;  3DJD A;  3ICS A;  4Y4N A;  1TDE A;  3BNM A;  4G73 A;  3P9U A;  1HYU A;  1B37 A;  3SYI A;  3M12 A;  4OPL A;  3DK8 A;  4TM1 A;  1KF6 A;  2WOI A;  4GR1 A;  3ADA B;  3UKF A;  4Z2T A;  2VVM A;  2JAE A;  3UTF A;  2V3A A;  2JBV A;  1VG9 A;  2OA1 A;  4OPT A;  1YQ4 A;  4GAV A;  2GR0 A;  4Z43 A;  3EAN A;  4NEV A;  4Z24 A;  1OJA A;  2GV8 A;  2WES A;  4H4S A;  1L9E A;  3UOY A;  1H7W A;  4X9M A;  4DSH A;  2Z5X A;  1E39 A;  1IUS A;  2WDQ A;  1BZL A;  1MO9 A;  4U8N A;  1Y56 A;  4I59 A;  3SY4 A;  4FDC B;  2BA9 A;  2WQY A;  3NN0 X;  4G9K A;  4PAA A;  2ZZ0 A;  5U63 A;  1PBF A;  3UCL A;  1D4C A;  3HYW A;  3UP5 A;  2YLS A;  3NK0 X;  2YLZ A;  1GRT A;  2XFU A;  4DNA A;  4A99 A;  2GAH B;  2FBW A;  3KPF A;  2B9X A;  2E4G A;  4UDR A;  3K7M X;  2CDU A;  3NN6 X;  4G6G A;  1PS9 A;  3GWD A;  4HA6 A;  1GXF A;  4YTM A;  4U2L A;  1DOE A;  3IWA A;  1JNZ A;  1OJD A;  2WPC A;  5M0Z A;  5JCK A;  4JQ9 A;  1O94 A;  2FJE A;  3DK4 A;  5FMH A;  1NEN A;  1PDH A;  4Y4M A;  3BNU A;  3SM8 A;  1LQU A;  5CKU A;  3SQP A;  1JRZ A;  1RP0 A;  1NHR A;  2GB0 A;  3KA7 A;  1NG3 A;  2XFN A;  2YVJ A;  1EBD A;  2XFP A;  3AE9 A;  3DK9 A;  3UKP A;  5KOX A;  3NLC A;  5CQF A;  1XHC A;  4AOX A;  3EPT A;  4IA5 A;  2WPE A;  1JU2 A;  1Y0P A;  1BF3 A;  2WEU A;  1QLB A;  2GQF A;  3T2Z A;  3URH A;  4IVM B;  4K5S A;  4H2R A;  3SZ0 A;  1Q1R A;  3C96 A;  2VRM A;  2TPR A;  2YVG A;  4H2N A;  3WE0 A;  2XVH A;  4EQW A;  1F8W A;  1S3B A;  2WP9 A;  3RHA A;  1D7Y A;  4U8M A;  1EL8 A;  4LII A;  2XVE A;  1D7L A;  2BAB A;  4RG3 A;  3KKJ A;  4B69 A;  1S2Q A;  1GRB A;  2WOW A;  2WU2 A;  4O5U A;  1FOH A;  3AB1 A;  1GAL A;  4U8K A;  4EMI A;  4APN A;  1CL0 A;  2A87 A;  2X50 A;  3AYI A;  1XDI A;  1JRX A;  3GMB A;  1D4D A;  2X8G A;  4GF7 A;  1E6E A;  4TLX A;  2EQ7 A;  4X4J A;  1ELI A;  3CNT A;  5FS8 A;  2XLP A;  5GSN A;  4YSZ A;  4WCT A;  3VRB A;  4A9W A;  3QJ4 A;  1QO8 A;  1TYP A;  2X3N A;  3LAD A;  1LV0 A;  1ZK7 A;  3ALJ A;  3BHF A;  1Z6L A;  1CC2 A;  5HXI A;  3DJJ A;  1IUW A;  4XWZ A;  3NYE A;  1GRG A;  1TDK A;  3Q6J A;  4GAP A;  2XLS A;  4H4V A;  4AP1 A;  5BUK A;  5BUL A;  5J60 A;  3CPI G;  3NG7 X;  4H7U A;  3EAO A;  1NPX A;  2C3C A;  4EQX A;  3KVE A;  1F6M A;  1H84 A;  2BXR A;  3H8L A;  4ZCC A;  4FX9 A;  4U2S A;  2YAU A;  3CPJ G;  2APG A;  5U25 A;  3EF6 A;  3ZDN A;  5KOW A;  3AE8 A;  2OAM A;  4K5R A;  2X8C A;  4BK3 A;  1TYT A;  3DA1 A;  4C3Y A;  5JCN A;  3FIM B;  4O5Q A;  3T31 A;  3T37 A;  2YVF A;  1E1M A;  1GEU A;  4J31 A;  1NAA A;  4NEW A;  4HB9 A;  4RSL A;  3S61 A;  4CRT A;  4GRT A;  4REK A;  2C66 A;  1VG0 A;  4C3X A;  4G74 A;  4J36 A;  2XLR A;  4K22 A;  3I3L A;  1EL5 A;  3M0O A;  2XLU A;  3PS9 A;  2YG4 A;  3P4Q A;  1CJ3 A;  2TMD A;  1RSG A;  4B66 A;  2F5Z A;  2O9Z A;  2BC0 A;  2YWL A;  3VRA A;  1GSN A;  2C67 A;  5FS6 A;  3NYC A;  2AR8 A;  1W4X A;  4H4Z A;  1K0L A;  3FG2 P;  4YSX A;  1AOG A;  1CJ4 A;  4UDP A;  5L46 A;  3GDP A;  1DXL A;  1LVL A;  3ICT A;  2GMJ A;  2JB2 A;  2EQ8 A;  1KFY A;  2R0C A;  4G6H A;  4H4U A;  1V59 A;  4I58 A;  2DKH A;  5JCM A;  3F8R A;  2JKC A;  2R4E A;  3CMM A;  1GOS A;  1M6I A;  2IVD A;  4H2P A;  1REO A;  3AE3 A;  3AYJ A;  4OPC A;  1D5T A;  3I6D A;  4IVO B;  1PBB A;  3VRD B;  5KRQ A;  2YQU A;  2C76 A;  2BK5 A;  5HYM A;  4UDQ A;  3K7T A;  5KVI A;  2RGH A;  2ARD A;  3GWF A;  2OAL A;  1DOC A;  3NTA A;  4EIQ A;  1H83 A;  4NTC A;  1PN0 A;  1KNR A;  4JNQ A;  2GAG B;  1PHH A;  4H4X A;  2XLT A;  3DH9 A;  1E1L A;  3GSI A;  2VOU A;  3QVR A;  3GYI A;  3T14 A;  2RGO A;  3RP7 A;  3ZYX A;  2GR2 A;  2E1M A;  3CNP A;  3KPK A;  4Z2U A;  3AE5 A;  1GT8 A;  3NYF A;  4YKF A;  3F8D A;  2QA1 A;  2C72 A;  1BKW A;  1N4V A;  2I0Z A;  2V6O A;  5BRT A;  3GRT A;  3KLJ A;  4P9S A;  4A6N A;  3AYL A;  4DGK A;  2R0P A;  1F3P A;  3NH3 X;  5KNL A;  4IA6 A;  4RG4 A;  4BJY A;  1H81 A;  1H86 A;  2VRL A;  2C75 A;  2Y6Q A;  3ABV A;  5EOW A;  2QCU A;  1BWC A;  4OPD A;  1LTX R;  1Q1W A;  1B4V A;  4XXG A;  4FK1 A;  3GRS A;  4J34 A;  2B9W A;  3L1R A;  3FMW A;  4YSY A;  1DNC A;  4N9X A;  4BJZ A;  3CGD A;  4USR A;  3PVC A;  1GTH A;  2RAB A;  4K8D A;  3CGB A;  2C70 A;  2WPF A;  2Q0K A;  5FS9 A;  2BCP A;  4ICY A;  5TR3 A;  1ZOY A;  3UTG A;  4EM4 A;  2GQW A;  2R46 A;  1Q9I A;  2GH5 A;  3QVP A;  1S2Y A;  4B68 A;  4ECH A;  1S3E A;  3AE4 A;  1JNR A;  4A79 A;  1PBD A;  1CBO A;  3GMC A;  1CC4 A;  1MXT A;  4NWZ A;  1X31 B;  3IC9 A;  2BRA A;  3D8X A;  4K7Z A;  2YLR A;  2YG6 A;  1DOD A;  2R4J A;  3B3R A;  2OLN A;  3UOV A;  1D4E A;  3AD8 B;  4II3 A;  4U8L A;  4CBQ A;  2EQ6 A;  2Q0L A;  5J7X A;  2ZZB A;  5GRT A;  4Z25 A;  3CIR A;  3Q9T A;  1PXB A;  4YKG A;  2BCG G;  3AE7 A;  3ALL A;  4J33 A;  3VR8 A;  4GUV A;  3UTE A;  2XFQ A;  4EQR A;  3UKK A;  4PAB A;  1CF3 A;  2NPX A;  2GMH A;  3S5W A;  4J2W A;  2BK4 A;  4U8I A;  4B1B A;  4UP3 A;  4KX6 A;  3ATQ A;  2YG5 A;  3JSK A;  3QSS A;  4CY6 A;  1N1P A;  4TLZ A;  1OJT A;  1OJC A;  1CJ2 A;  5ER0 A;  1KNP A;  2B9Y A;  3GYX A;  4EMW A;  2QAE A;  4EM3 A;  3G5Q A;  3NKS A;  4IV9 A;  3C4N A;  4U8P A;  2ACZ A;  2R45 A;  2VQB A;  3NIX A;  2ZZC A;  3F8P A;  4MJW A;  4OCG A;  1FL2 A;  4DSG A;  1GRA A;  4II2 A;  1TRB A;  3AEA A;  4OPI A;  4H4Y A;  3LZX A;  2XVJ A;  1E1N A;  3NGC X;  3UP4 A;  2C73 A;  5HY5 A;  3AWI A;  3SZW A;  4CY8 A;  1FEB A;  2JB1 A;  5JCL A;  4JNA A;  3V76 A;  3DME A;  5IPY A;  4A6N B;  2XFO A;  3AEG A;  3CNS A;  1GET A;  1NEK A;  2XVF A;  1BGN A;  2HQM A;  2VVL G;  1O95 A;  3ATR A;  4U8J A;  2J3N A;  2GRT A;  4TM3 A;  3HZL A;  2QA2 A;  5IQ1 A;  2H88 A;  2IVE A;  1IUX A;  3CGC A;  3AD7 B;  1CHU A;  4J57 A;  3PO7 A;  4GDE A;  4X9N A;  3RP8 A;  2XCG A;  3SFD A;  2WOV A;  4YSH A;  2GEW A;  3C4A A;  3SXI A;  2BS2 A;  1GRF A;  3KD9 A;  1NHS A;  2X8H A;  3CNJ A;  4ZN0 A;  4M52 A;  2WU5 A;  1XAN A;  2YLX A;  3K30 A;  3P4S A;  1NDA A;  5FS7 A;  4CNJ A;  2BXS A;  5KXJ A;  1MOK A;  4C74 A;  2GVC A;  2V5Z A;  2Z5Y A;  3QFB A;  2R9Z A;  4OPG A;  1K0J A;  4H2Q A;  4USQ A;  1M64 A;  1N4U A;  3QFA A;  2WP6 A;  2WHD A;  3AEC A;  2WS3 A;  4AP3 A;  1O5W A;  4YTN A;  1PBC A;  3ICR A;  1GPE A;  1VRQ B;  1YQ3 A;  4A5L A;  1IJH A;  2DKI A;  1PXC A;  1CC6 A;  2GR3 A;  3AE1 A;  1ZY8 A;  4U2T A;  2H89 A;  1TDN A;  4NTE A;  1FEC A;  2Q7V A;  3LJP A;  3SZF A;  2YR6 A;  4H4R A;  1NG4 A;  2R0G A;  1EL7 A;  3RP6 A;  3SFE A;  4GDP A;  2CVJ A;  1LJ1 A;  1GRH A;  3CND A;  3DGZ A;  1GND A;  4CCR A;  4NZH A;  2W0H A;  5U1O A;  1EL9 A;  3IHG A;  3VQR A;  3UKH A;  1DJN A;  2AQJ A;  3NTD A;  4H4P A;  4ADW A;  4YWO A;  1YY5 A;  4CCQ A;  1F8S A;  2YLT A;  2WET A;  4BV6 A;  2WBA A;  5IQ4 A;  4B67 A;  1PJ7 A;  2XVI A;  4JN9 A;  1YQZ A;  3ITJ A;  1TDO A;  3AE2 A;  5EBK A;  4Z26 A;  5KMP A;  4H50 A;  4EQS A;  5KVH A;  4JDR A;  1N4W A;  1GRE A;  3H8I A;  5M10 A;  2YG3 A;  2B7S A;  3FPZ A;  3RED A;  3KU9 A;  3SZC A;  3T2K A;  1E7P A;  2GF3 A;  4D03 A;  3CGE A;  3FBS A;  1L0V A;  1KSU A;  2VQ7 A;  4BK2 A;  4XWR A;  1JRY A;  2X99 A;  5JCI A;  1B8S A;  2V60 A;  2A8X A;  3UKA A;  4OPU A;  4B64 A;  1FCD A;  5KMQ A;  1ZP0 A;  2BK3 A;  4U8O A;  3NRN A;  3UKQ A;  2UZZ A;  2BRY A;  1PBE A;  2BAC A;  3G5S A;  2XDO A;  3HYX A;  2YM1 A;  2ZBW A;  2B7R A;  4WX1 A;  1GV4 A;  3CPH G;  1ZMC A;  2YG7 A;  1JOA A;  1ZDL A;  3BI5 A;  3R9U A;  2V3B A;  5KWF A;  4ZCD A;  4Y4L A;  4JY2 A;  4AT2 A;  2WDV A;  1PJ6 A;  4BUR A;  2NVK X;  2YR5 A;  3NT6 A;  4H4Q A;  4H4W A;  3G5R A;  2C4C A;  1RYI A;  3RNM A;  1NHP A;  5C3J A;  4NNJ A;  2RGJ A;  1KDG A;  2VVL A;  4KPR A;  2JB3 A;  1JEH A;  2C3D A;  4YXD A;  1IUV A;  4H4T A;  5EB4 A;  1PJ5 A;  1DOB A;  3GDN A;  3IF9 A;  3OZ2 A;  3T2Y A;  4Z44 A;  3DGH A;  3NK1 X;  3SX6 A;  2IID A;  4LU6 A;  2FJB A;  3HYV A;  1H7X A;  2XYO A;  3IHM A;  3E1T A;  5EB5 A;  1K0I A;  3M13 A;  2C65 A;  5C2T A;  4EIP A;  1OJ9 A;  3BHK A;  3B6D A;  1BGJ A;  4EMJ A;  1P2H A;  3LOV A;  1DJQ A;  1TDF A;  2FJA A;  4TM0 A;  3UOX A;  2Q6U A;  1XPQ A;  1VDC A;  3AED A;  4B65 A;  5HHF A;  3P4R A;  1B5Q A;  4D04 A;  2A89 A;  3SGL A;  4A7A A;  3V3O A;  3ALM A;  3DJG X;  4AOS A;  1Y56 B;  1K4Q A;  1NHQ A;  2PHH A;  1ZKQ A;  1VQW A;  4YT0 A;  1GER A;  1GES A;  3UOZ A;  4NTD A;  2WDR A;  1FEA A;  3UTH A;  2PYX A;  3LXD A;  2V61 A;  1LPF A;  5DBJ A;  4YTP A;  2AAQ A;  3BI4 A;  3COX A;  3AEB A;  3GYJ A;  3LZW A;  2B76 A;  3V3N A;  2C7G A;  4AT0 A;  1ONF A;  2OLO A;  3AE6 A;  1ZMD A;  2E5V A;  3BI2 A;  3K7Q X;  2CFY A;  3GD4 A;  4C5O A;  3AD9 B;  2JK6 A;  2YR4 A;  2FJD A;  2BS4 A;  4BK1 A;  4C77 A;  5LV9 A;  3AEE A;  2YLW A;  4K2X A;  1H6V A;  1L9D A;  4B63 A;  3GD3 A;  4E0V A;  2Y6R A;  3O0H A;  3T0K A;  2VZ2 A;  3AXB A;  3UKL A;  3H4K A;  3ISH A;  4Z2R A;  2C64 A;  3LB8 A;  1P2E A;  1H82 A;  4LA1 A;  1L9C A;  4TM4 A;  3QSM A;  3NK2 X;  3AEF A;  3NNE A;  2CUL A;  4OVI A;  3CTY A;  1F8R A;  4CNK A;  1UKV G;  4FK1 C;  1ZOV A;  3P1W A;  2EQ9 A;  2GR1 A;  3OC4 A;  1CJC A;  3VR9 A;  3L8K A;  4JY3 A;  1SEZ A;  1E1K A;  2BYB A;  2WP5 A;  1IUT A;  3D1C A;  1LQT A;  1GTE A;  3P4P A;  1KSS A;  1COY A;  2BC1 A;  1IUU A;  1ZX9 A;  3QSE A;  1PXA A;  2YM2 A;  1QJD A;  5KMS A;  1YKJ A;  2BS3 A;  3NHO X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...