4NWZA

Structure of bacterial type ii nadh dehydrogenase from caldalkalibacillus thermarum at 2.5a resolution
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
395
structure length
395
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title Structure of the bacterial type II NADH dehydrogenase: a monotopic membrane protein with an essential role in energy generation.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum
molecule tags Oxidoreductase
total genus 126
structure length 395
sequence length 395
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4nwzA00
3SZCA 3KPKA 5KMQA 3T0KA 4G9KA 3SZ0A 3SXIA 3SY4A 3SYIA 4G74A 3SZFA 3T2ZA 4G73A 5KMSA 5KMRA 4G6GA 3T2KA 3HYWA 3HYXA 5KMPA 3T14A 3SZWA 3SX6A 4GAPA 3HYVA 3T2YA 4GAVA 3T31A 4NWZA 4G6HA
chains in the Genus database with same CATH superfamily
1QJDA 1ONFA 2YLRA 1E1KA 3C4AA 2Q7VA 3K7TA 3NT6A 4K7ZA 4OCGA 1NG3A 2OLOA 3IF9A 5CQFA 1O5WA 1CC4A 1CHUA 2VVMA 3NHOX 1M6IA 3LJPA 4U2SA 1O94A 2V60A 2NPXA 3PO7A 4B65A 2YG6A 2C65A 3SYIA 3FPZA 3DK9A 3NYEA 4A6NA 1GNDA 3CGBA 3FMWA 4CCQA 1CL0A 4U8KA 3NRNA 1D4DA 3UKHA 2X8HA 3CGEA 1JRZA 2X8CA 1P2EA 1YQ4A 1S2QA 4FK1A 4B66A 3O0HA 4I59A 1K0IA 3AEEA 3FG2P 4LA1A 1ZMDA 2A8XA 4C77A 1Y56B 1D4CA 4CCRA 3T37A 2Q0KA 3BI4A 1LV0A 5FS9A 1KNRA 3GWDA 3VRBA 3RP6A 2WOVA 3KKJA 1H86A 1PBEA 2GR0A 1NDAA 2GQWA 2WP9A 5BVAA 3C4NA 4APNA 1Y0PA 2WDRA 4YTPA 2XFNA 3AXBA 3NIXA 3KVEA 1F8SA 1L9CA 2XVEA 4CNKA 1CC6A 3DA1A 1H7WA 1GRHA 2I0ZA 2V6OA 4J33A 2VOUA 3SQPA 4G6GA 3T2KA 3QSMA 3UKKA 2WQYA 1ZKQA 1Z6LA 1TDKA 2YG5A 3P1WA 1GXFA 4M52A 1DOEA 3T2YA 5EB5A 1SEZA 2GR3A 3DGHA 2BA9A 2XVJA 1DJNA 3EPTA 1EL9A 3VR8A 4DNAA 4H4RA 3QSSA 1KF6A 2WBAA 3KU9A 3LZWA 3RHAA 1PJ6A 1TDEA 4RSLA 1E39A 2GEWA 4PAAA 3I6DA 3LB8A 1YQZA 2BC0A 1CJ4A 3ZDNA 2BS2A 2DKHA 2WOWA 4K2XA 2JAEA 5KXJA 3VQRA 1F8WA 1CJ3A 1F3PA 2RGOA 2VQ7A 2XLSA 1YKJA 1TDNA 4REKA 3DK4A 3GDPA 3NH3X 1JNRA 3UCLA 5L46A 1E1MA 2BCPA 4C3XA 3RP8A 3B3RA 3AYLA 4H2PA 4YXDA 4O5UA 4Z44A 5J60A 3P4SA 4H4VA 4H4TA 5BULA 1NPXA 3QSEA 4WCTA 1D7LA 4CY6A 2PHHA 3AE7A 1FCDA 2Q6UA 3D8XA 1LQTA 1L0VA 4AOXA 4G6HA 1TYTA 1NHRA 1RP0A 1GTEA 1L9DA 1XHCA 2C72A 3NNEA 1MXTA 1VG0A 4J34A 4NTCA 2R46A 4YSHA 1B4VA 1L9EA 1OJCA 2JBVA 3CPIG 3R9UA 5JCLA 3CNSA 1IUXA 1PJ7A 2B9XA 2YLWA 5TR3A 4YKFA 4UDQA 4B63A 2AAQA 2BS3A 3BI5A 2V5ZA 1PDHA 2ZZCA 1JEHA 2APGA 4Z25A 2YLZA 4X4JA 4KX6A 1NG4A 4OPIA 3URHA 1D4EA 2XDOA 1GPEA 4Z26A 2C75A 3BHKA 4K5RA 2EQ9A 3LOVA 4YTMA 2EQ7A 1GTHA 2Q0LA 5FS6A 1Q9IA 3VRDB 3BNUA 1MOKA 1N4WA 2EQ6A 2YR4A 1IUVA 1JRXA 3Q6JA 3AEDA 1EL5A 1W4XA 3F8RA 5M10A 4YT0A 1D7YA 1OJAA 2C76A 4JDRA 3CPJG 1KNPA 4BJYA 4A6NB 1JOAA 2WDVA 1LQUA 3T2ZA 5J7XA 4X9MA 3M13A 4NTEA 4ECHA 2X99A 3QVPA 4E0VA 1JU2A 1XPQA 1DXLA 2QA1A 4EIQA 2BABA 4I58A 2FJEA 4K5SA 2IVDA 4XWRA 4EQRA 2RABA 3AD9B 2F5ZA 4ZCDA 2OA1A 3BHFA 1PS9A 2VQBA 3B6DA 3FIMB 2B7RA 2WESA 3ABVA 4FX9A 2WP6A 4NTDA 2ARDA 3D1CA 4NWZA 2XVIA 2BS4A 2XLPA 1NENA 3GYXA 3SXIA 3NKSA 1IUWA 4U8OA 5U25A 1BWCA 3NTAA 2JK6A 3IHGA 1P2HA 2IVEA 4AOSA 5BRTA 3AE6A 5KRQA 1FEAA 4JQ9A 2JKCA 3QVRA 3H8IA 1F6MA 2CULA 2XVFA 3UOVA 1VRQB 3NGCX 3QJ4A 1CJCA 5GSNA 3HYXA 1H6VA 3BI2A 3GD3A 5KWFA 4U8JA 1GSNA 5HXIA 2XFUA 2YLTA 5IQ4A 4IV9A 3AD7B 3CNJA 4RG4A 1MO9A 4H50A 4UDPA 4ICYA 4NNJA 1IJHA 1DOBA 2GR2A 1GRGA 2QAEA 3G5SA 2AQJA 3KPFA 2GAHB 1F8RA 4H4PA 2CVJA 4YTNA 2QA2A 4H2RA 4WX1A 2FJBA 1BGNA 1ZK7A 4A5LA 1S3BA 2E4GA 2O9ZA 3UP5A 2A87A 2YVFA 3IWAA 3S5WA 2B9YA 1GV4A 2BYBA 2WOIA 4JY2A 4EQWA 4IA5A 2YR6A 3UOYA 3F8DA 3P4PA 4AP1A 3UTGA 3REDA 2WP5A 2EQ8A 3HYWA 4KPRA 2GV8A 1DOCA 4U8IA 4Y4MA 1Q1WA 4A7AA 3ICTA 2XFPA 2CFYA 1B8SA 1PJ5A 2C7GA 2R4JA 3GSIA 5EOWA 2A89A 2QCUA 2WHDA 3RP7A 2RGJA 3AEBA 3KLJA 3AYIA 2WPEA 2GRTA 2E1MA 3CNDA 2FBWA 2BXRA 2WPCA 2YG7A 3ITJA 3V3OA 2OAMA 1REOA 3NLCA 3SY4A 5JCIA 1KFYA 1LVLA 1IUTA 2BC1A 2YAUA 3AE5A 5KMRA 1BF3A 1GREA 4BK1A 2Y6QA 4FK1C 5HY5A 1GEUA 4X9NA 5KOWA 5KMPA 3M0OA 4H4ZA 2B7SA 4J57A 4OPGA 2YQUA 4EQXA 1GT8A 2GQFA 4TM0A 1Y56A 3T31A 1GERA 2C3DA 3DJGX 4EM3A 2YVGA 3E1TA 5KMQA 1FECA 3DJEA 2H89A 2B9WA 1NEKA 2CDUA 1N1PA 2GMJA 4IVOB 2R4EA 1M64A 3II4A 1VDCA 1H81A 3AECA 4TM3A 5EBKA 4CBQA 2XFOA 2TPRA 2ZZ0A 3ADAB 3AE2A 1ZOVA 3P4QA 5FMHA 1GESA 3UTFA 1GALA 2XLUA 4OPDA 3DJJA 1OJDA 4H2QA 4EMIA 3CMMA 2Z5YA 4GR1A 2XLTA 1N4UA 1ELIA 2YM1A 3IHMA 3OC4A 1OJ9A 4GDEA 2GB0A 4OPUA 4U8LA 3NK1X 3SZWA 1N4VA 1CF3A 4GRTA 4XWZA 2JB1A 3QFBA 2XCGA 5HYMA 2OLNA 3KPKA 2ACZA 1H82A 2GVCA 4YWOA 3SM8A 4H7UA 3M12A 3NTDA 4NEWA 1JRYA 1EBDA 3WE0A 3UKQA 1D5TA 3UOZA 3KA7A 3VRAA 2V3AA 5KOXA 5M0ZA 2YLSA 4Z24A 4Y4NA 4GF7A 1LPFA 1GETA 4H4WA 4GUVA 2V3BA 4OPTA 3T14A 4HB9A 3KD9A 1EL7A 4JNQA 4YSXA 5HHFA 5FS7A 3QFAA 3K7MX 1KSSA 4PABA 1S2YA 1X31B 2VVLG 2VZ2A 4H4QA 1EL8A 4TLXA 3NK0X 4II3A 3NG7X 4N9XA 4DSGA 3NYFA 1LTXR 4ZN0A 2IIDA 3G5QA 2V61A 3GRSA 3JSKA 2FJDA 2TMDA 3F8PA 5U63A 4DGKA 2R9ZA 1BKWA 1TRBA 1GRAA 2C4CA 4J36A 2ZBWA 2XLRA 3ICRA 4A99A 5KMSA 1LJ1A 1UKVG 1ZMCA 2H88A 4K22A 1RYIA 2JB2A 4UDRA 3H8LA 3LADA 4J31A 3AYJA 1S3EA 1VG9A 3GMBA 3K30A 4BV6A 3GDNA 4H2NA 4EMWA 2YWLA 3AEGA 4P9SA 4EMJA 2WS3A 1PHHA 2C66A 2J3NA 2X8GA 4EM4A 5C3JA 3CNPA 3L1RA 2R45A 3P9UA 4JNAA 3SZCA 3AE4A 4DSHA 4BK3A 4B69A 4TM4A 1ZDLA 3DJDA 3SFDA 4B64A 4AT2A 2GF3A 1HYUA 3OZ2A 4IA6A 2WETA 4A65A 4EIPA 1H84A 3H4KA 1E1NA 3NN0X 1FEBA 3AB1A 2RGHA 3EF6A 2R0PA 4YSZA 3SZFA 4G73A 1RSGA 3L8KA 4BJZA 3UP4A 3UTHA 1QO8A 2YLXA 4MJWA 2WDQA 1GRBA 4BK2A 3C96A 1NHPA 3SX6A 5KNLA 2XYOA 2YR5A 4II2A 4H4SA 4C74A 4O5QA 5IPYA 1E7PA 4TLZA 3P4RA 5IQ1A 1ZP0A 1OJTA 3AEAA 2BK4A 2R0GA 3COXA 2GH5A 2AR8A 2BK5A 2C70A 1PXBA 3SZ0A 3UKPA 1FOHA 3V76A 4EQSA 3NYCA 4CY8A 2C64A 3ICSA 4CRTA 1GOSA 2BXSA 1CBOA 2JB3A 2XVHA 4U2LA 3UOXA 3RNMA 4USQA 1PBBA 1V59A 1TDFA 3G5RA 4LU6A 4U8NA 3VR9A 1ZY8A 4U8MA 3DMEA 2X50A 4GCMA 1VQWA 1K0LA 3ATRA 4H4UA 2VVLA 2E5VA 3UTEA 4C3YA 3SFEA 4Z43A 3SGLA 2B76A 1IUSA 3AE1A 3S61A 3PS9A 5JCMA 1DNCA 1YY5A 4JN9A 3DGZA 1CJ2A 1GRTA 3GWFA 4B68A 3GD4A 4UP3A 5KVHA 1K4QA 4C5OA 1BGJA 2VRMA 4FDCB 4H4XA 3I3LA 1DJQA 2BRAA 4G9KA 4D03A 4D04A 3EAOA 3ATQA 3CN8A 4Z2TA 2C73A 4A79A 1BZLA 4AT0A 2YVJA 1B37A 4U2TA 3HZLA 5ER0A 4U8PA 3DH9A 1KSUA 3V3NA 1PXAA 2Y6RA 1K0JA 2ZZBA 1PBDA 1PBCA 1PXCA 3Q9TA 5KVIA 4H4YA 4OVIA 2R0CA 4ZCCA 3UKLA 1AOGA 2DKIA 1H83A 1NHSA 4GAPA 5JCKA 1H7XA 2YG4A 4J2WA 3LXDA 3NK2X 5EB4A 1E6EA 4Z2UA 2WU2A 4GAVA 3GYIA 3CIRA 4NEVA 3AE9A 4B67A 4Z2RA 3GRTA 3UKAA 4TM1A 3T0KA 2UZZA 2C67A 2WPFA 3AE8A 5LV9A 4HA6A 1XANA 2GMHA 1O95A 3AE3A 3BNMA 5U1OA 3PVCA 4AP3A 1B5QA 2Z5XA 1NHQA 3AEFA 3K7QX 4NZHA 2BCGG 3ALJA 4GDPA 3AD8B 4USRA 4OPLA 4G74A 3GYJA 1Q1RA 4IVMB 3DK8A 3UKFA 5FS8A 4YKGA 3NN6X 2WEUA 1KDGA 2NVKX 2W0HA 3LZXA 4ADWA 4JY3A 1ZOYA 3HYVA 2GAGB 5C2TA 2XFQA 1FL2A 1PN0A 3CTYA 4CNJA 1ZX9A 2YG3A 3GMCA 1TDOA 3CNTA 2PYXA 3ZYXA 3EANA 1PBFA 2X3NA 3FBSA 3CPHG 3CGCA 5DBJA 4Y4LA 4A9WA 4J56A 1YQ3A 1XDIA 3ALLA 1JNZA 1CC2A 4OPCA 1GRFA 1QLBA 3CGDA 5GRTA 1E1LA 3AWIA 5JCNA 4K8DA 2WU5A 4BURA 4B1BA 5CKUA 2VRLA 4YSYA 1NAAA 2BK3A 2OALA 1TYPA 1COYA 2BRYA 3IC9A 5BUKA 4LIIA 4RG3A 2C3CA 1DODA 3ALMA 3ISHA 1IUUA 2BACA 2FJAA 4XXGA 2HQMA 2GR1A 2YM2A
chains in the Genus database with same CATH topology
1QJDA 1ONFA 2YLRA 1E1KA 3C4AA 2Q7VA 3K7TA 3NT6A 4K7ZA 4OCGA 1NG3A 2OLOA 3IF9A 5CQFA 1O5WA 1CC4A 1CHUA 2VVMA 3NHOX 1M6IA 3LJPA 4U2SA 1O94A 2V60A 2NPXA 3PO7A 4B65A 2YG6A 2C65A 3SYIA 3FPZA 3DK9A 3NYEA 4A6NA 1GNDA 3CGBA 3FMWA 4CCQA 1CL0A 4U8KA 3NRNA 1D4DA 3UKHA 2X8HA 3CGEA 1JRZA 2X8CA 1P2EA 1YQ4A 1S2QA 4FK1A 4B66A 3O0HA 4I59A 1K0IA 3AEEA 3FG2P 4LA1A 1ZMDA 2A8XA 4C77A 1Y56B 1D4CA 4CCRA 3T37A 2Q0KA 3BI4A 1LV0A 5FS9A 1KNRA 3GWDA 3VRBA 3RP6A 2WOVA 3KKJA 1H86A 1PBEA 2GR0A 1NDAA 2GQWA 2WP9A 5BVAA 3C4NA 4APNA 1Y0PA 2WDRA 4YTPA 2XFNA 3AXBA 3NIXA 3KVEA 1F8SA 1L9CA 2XVEA 4CNKA 1CC6A 3DA1A 1H7WA 1GRHA 2I0ZA 2V6OA 4J33A 2VOUA 3SQPA 4G6GA 3T2KA 3QSMA 3UKKA 2WQYA 1ZKQA 1Z6LA 1TDKA 2YG5A 3P1WA 1GXFA 4M52A 1DOEA 3T2YA 5EB5A 1SEZA 2GR3A 3DGHA 2BA9A 2XVJA 1DJNA 3EPTA 1EL9A 3VR8A 4DNAA 4H4RA 3QSSA 1KF6A 2WBAA 3KU9A 3LZWA 3RHAA 1PJ6A 1TDEA 4RSLA 1E39A 2GEWA 4PAAA 3I6DA 3LB8A 1YQZA 2BC0A 1CJ4A 3ZDNA 2BS2A 2DKHA 2WOWA 4K2XA 2JAEA 5KXJA 3VQRA 1F8WA 1CJ3A 1F3PA 2RGOA 2VQ7A 2XLSA 1YKJA 1TDNA 4REKA 3DK4A 3GDPA 3NH3X 1JNRA 3UCLA 5L46A 1E1MA 2BCPA 4C3XA 3RP8A 3B3RA 3AYLA 4H2PA 4YXDA 4O5UA 4Z44A 5J60A 3P4SA 4H4VA 4H4TA 5BULA 1NPXA 3QSEA 4WCTA 1D7LA 4CY6A 2PHHA 3AE7A 1FCDA 2Q6UA 3D8XA 1LQTA 1L0VA 4AOXA 4G6HA 1TYTA 1NHRA 1RP0A 1GTEA 1L9DA 1XHCA 2C72A 3NNEA 1MXTA 1VG0A 4J34A 4NTCA 2R46A 4YSHA 1B4VA 1L9EA 1OJCA 2JBVA 3CPIG 3R9UA 5JCLA 3CNSA 1IUXA 1PJ7A 2B9XA 2YLWA 5TR3A 4YKFA 4UDQA 4B63A 2AAQA 2BS3A 3BI5A 2V5ZA 1PDHA 2ZZCA 1JEHA 2APGA 4Z25A 2YLZA 4X4JA 4KX6A 1NG4A 4OPIA 3URHA 1D4EA 2XDOA 1GPEA 4Z26A 2C75A 3BHKA 4K5RA 2EQ9A 3LOVA 4YTMA 2EQ7A 1GTHA 2Q0LA 5FS6A 1Q9IA 3VRDB 3BNUA 1MOKA 1N4WA 2EQ6A 2YR4A 1IUVA 1JRXA 3Q6JA 3AEDA 1EL5A 1W4XA 3F8RA 5M10A 4YT0A 1D7YA 1OJAA 2C76A 4JDRA 3CPJG 1KNPA 4BJYA 4A6NB 1JOAA 2WDVA 1LQUA 3T2ZA 5J7XA 4X9MA 3M13A 4NTEA 4ECHA 2X99A 3QVPA 4E0VA 1JU2A 1XPQA 1DXLA 2QA1A 4EIQA 2BABA 4I58A 2FJEA 4K5SA 2IVDA 4XWRA 4EQRA 2RABA 3AD9B 2F5ZA 4ZCDA 2OA1A 3BHFA 1PS9A 2VQBA 3B6DA 3FIMB 2B7RA 2WESA 3ABVA 4FX9A 2WP6A 4NTDA 2ARDA 3D1CA 4NWZA 2XVIA 2BS4A 2XLPA 1NENA 3GYXA 3SXIA 3NKSA 1IUWA 4U8OA 5U25A 1BWCA 3NTAA 2JK6A 3IHGA 1P2HA 2IVEA 4AOSA 5BRTA 3AE6A 5KRQA 1FEAA 4JQ9A 2JKCA 3QVRA 3H8IA 1F6MA 2CULA 2XVFA 3UOVA 1VRQB 3NGCX 3QJ4A 1CJCA 5GSNA 3HYXA 1H6VA 3BI2A 3GD3A 5KWFA 4U8JA 1GSNA 5HXIA 2XFUA 2YLTA 5IQ4A 4IV9A 3AD7B 3CNJA 4RG4A 1MO9A 4H50A 4UDPA 4ICYA 4NNJA 1IJHA 1DOBA 2GR2A 1GRGA 2QAEA 3G5SA 2AQJA 3KPFA 2GAHB 1F8RA 4H4PA 2CVJA 4YTNA 2QA2A 4H2RA 4WX1A 2FJBA 1BGNA 1ZK7A 4A5LA 1S3BA 2E4GA 2O9ZA 3UP5A 2A87A 2YVFA 3IWAA 3S5WA 2B9YA 1GV4A 2BYBA 2WOIA 4JY2A 4EQWA 4IA5A 2YR6A 3UOYA 3F8DA 3P4PA 4AP1A 3UTGA 3REDA 2WP5A 2EQ8A 3HYWA 4KPRA 2GV8A 1DOCA 4U8IA 4Y4MA 1Q1WA 4A7AA 3ICTA 2XFPA 2CFYA 1B8SA 1PJ5A 2C7GA 2R4JA 3GSIA 5EOWA 2A89A 2QCUA 2WHDA 3RP7A 2RGJA 3AEBA 3KLJA 3AYIA 2WPEA 2GRTA 2E1MA 3CNDA 2FBWA 2BXRA 2WPCA 2YG7A 3ITJA 3V3OA 2OAMA 1REOA 3NLCA 3SY4A 5JCIA 1KFYA 1LVLA 1IUTA 2BC1A 2YAUA 3AE5A 5KMRA 1BF3A 1GREA 4BK1A 2Y6QA 4FK1C 5HY5A 1GEUA 4X9NA 5KOWA 5KMPA 3M0OA 4H4ZA 2B7SA 4J57A 4OPGA 2YQUA 4EQXA 1GT8A 2GQFA 4TM0A 1Y56A 3T31A 1GERA 2C3DA 3DJGX 4EM3A 2YVGA 3E1TA 5KMQA 1FECA 3DJEA 2H89A 2B9WA 1NEKA 2CDUA 1N1PA 2GMJA 4IVOB 2R4EA 1M64A 3II4A 1VDCA 1H81A 3AECA 4TM3A 5EBKA 4CBQA 2XFOA 2TPRA 2ZZ0A 3ADAB 3AE2A 1ZOVA 3P4QA 5FMHA 1GESA 3UTFA 1GALA 2XLUA 4OPDA 3DJJA 1OJDA 4H2QA 4EMIA 3CMMA 2Z5YA 4GR1A 2XLTA 1N4UA 1ELIA 2YM1A 3IHMA 3OC4A 1OJ9A 4GDEA 2GB0A 4OPUA 4U8LA 3NK1X 3SZWA 1N4VA 1CF3A 4GRTA 4XWZA 2JB1A 3QFBA 2XCGA 5HYMA 2OLNA 3KPKA 2ACZA 1H82A 2GVCA 4YWOA 3SM8A 4H7UA 3M12A 3NTDA 4NEWA 1JRYA 1EBDA 3WE0A 3UKQA 1D5TA 3UOZA 3KA7A 3VRAA 2V3AA 5KOXA 5M0ZA 2YLSA 4Z24A 4Y4NA 4GF7A 1LPFA 1GETA 4H4WA 4GUVA 2V3BA 4OPTA 3T14A 4HB9A 3KD9A 1EL7A 4JNQA 4YSXA 5HHFA 5FS7A 3QFAA 3K7MX 1KSSA 4PABA 1S2YA 1X31B 2VVLG 2VZ2A 4H4QA 1EL8A 4TLXA 3NK0X 4II3A 3NG7X 4N9XA 4DSGA 3NYFA 1LTXR 4ZN0A 2IIDA 3G5QA 2V61A 3GRSA 3JSKA 2FJDA 2TMDA 3F8PA 5U63A 4DGKA 2R9ZA 1BKWA 1TRBA 1GRAA 2C4CA 4J36A 2ZBWA 2XLRA 3ICRA 4A99A 5KMSA 1LJ1A 1UKVG 1ZMCA 2H88A 4K22A 1RYIA 2JB2A 4UDRA 3H8LA 3LADA 4J31A 3AYJA 1S3EA 1VG9A 3GMBA 3K30A 4BV6A 3GDNA 4H2NA 4EMWA 2YWLA 3AEGA 4P9SA 4EMJA 2WS3A 1PHHA 2C66A 2J3NA 2X8GA 4EM4A 5C3JA 3CNPA 3L1RA 2R45A 3P9UA 4JNAA 3SZCA 3AE4A 4DSHA 4BK3A 4B69A 4TM4A 1ZDLA 3DJDA 3SFDA 4B64A 4AT2A 2GF3A 1HYUA 3OZ2A 4IA6A 2WETA 4A65A 4EIPA 1H84A 3H4KA 1E1NA 3NN0X 1FEBA 3AB1A 2RGHA 3EF6A 2R0PA 4YSZA 3SZFA 4G73A 1RSGA 3L8KA 4BJZA 3UP4A 3UTHA 1QO8A 2YLXA 4MJWA 2WDQA 1GRBA 4BK2A 3C96A 1NHPA 3SX6A 5KNLA 2XYOA 2YR5A 4II2A 4H4SA 4C74A 4O5QA 5IPYA 1E7PA 4TLZA 3P4RA 5IQ1A 1ZP0A 1OJTA 3AEAA 2BK4A 2R0GA 3COXA 2GH5A 2AR8A 2BK5A 2C70A 1PXBA 3SZ0A 3UKPA 1FOHA 3V76A 4EQSA 3NYCA 4CY8A 2C64A 3ICSA 4CRTA 1GOSA 2BXSA 1CBOA 2JB3A 2XVHA 4U2LA 3UOXA 3RNMA 4USQA 1PBBA 1V59A 1TDFA 3G5RA 4LU6A 4U8NA 3VR9A 1ZY8A 4U8MA 3DMEA 2X50A 4GCMA 1VQWA 1K0LA 3ATRA 4H4UA 2VVLA 2E5VA 3UTEA 4C3YA 3SFEA 4Z43A 3SGLA 2B76A 1IUSA 3AE1A 3S61A 3PS9A 5JCMA 1DNCA 1YY5A 4JN9A 3DGZA 1CJ2A 1GRTA 3GWFA 4B68A 3GD4A 4UP3A 5KVHA 1K4QA 4C5OA 1BGJA 2VRMA 4FDCB 4H4XA 3I3LA 1DJQA 2BRAA 4G9KA 4D03A 4D04A 3EAOA 3ATQA 3CN8A 4Z2TA 2C73A 4A79A 1BZLA 4AT0A 2YVJA 1B37A 4U2TA 3HZLA 5ER0A 4U8PA 3DH9A 1KSUA 3V3NA 1PXAA 2Y6RA 1K0JA 2ZZBA 1PBDA 1PBCA 1PXCA 3Q9TA 5KVIA 4H4YA 4OVIA 2R0CA 4ZCCA 3UKLA 1AOGA 2DKIA 1H83A 1NHSA 4GAPA 5JCKA 1H7XA 2YG4A 4J2WA 3LXDA 3NK2X 5EB4A 1E6EA 4Z2UA 2WU2A 4GAVA 3GYIA 3CIRA 4NEVA 3AE9A 4B67A 4Z2RA 3GRTA 3UKAA 4TM1A 3T0KA 2UZZA 2C67A 2WPFA 3AE8A 5LV9A 4HA6A 1XANA 2GMHA 1O95A 3AE3A 3BNMA 5U1OA 3PVCA 4AP3A 1B5QA 2Z5XA 1NHQA 3AEFA 3K7QX 4NZHA 2BCGG 3ALJA 4GDPA 3AD8B 4USRA 4OPLA 4G74A 3GYJA 1Q1RA 4IVMB 3DK8A 3UKFA 5FS8A 4YKGA 3NN6X 2WEUA 1KDGA 2NVKX 2W0HA 3LZXA 4ADWA 4JY3A 1ZOYA 3HYVA 2GAGB 5C2TA 2XFQA 1FL2A 1PN0A 3CTYA 4CNJA 1ZX9A 2YG3A 3GMCA 1TDOA 3CNTA 2PYXA 3ZYXA 3EANA 1PBFA 2X3NA 3FBSA 3CPHG 3CGCA 5DBJA 4Y4LA 4A9WA 4J56A 1YQ3A 1XDIA 3ALLA 1JNZA 1CC2A 4OPCA 1GRFA 1QLBA 3CGDA 5GRTA 1E1LA 3AWIA 5JCNA 4K8DA 2WU5A 4BURA 4B1BA 5CKUA 2VRLA 4YSYA 1NAAA 2BK3A 2OALA 1TYPA 1COYA 2BRYA 3IC9A 5BUKA 4LIIA 4RG3A 2C3CA 1DODA 3ALMA 3ISHA 1IUUA 2BACA 2FJAA 4XXGA 2HQMA 2GR1A 2YM2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SZC A;  3KPK A;  5KMQ A;  3T0K A;  4G9K A;  3SZ0 A;  3SXI A;  3SY4 A;  3SYI A;  4G74 A;  3SZF A;  3T2Z A;  4G73 A;  5KMS A;  5KMR A;  4G6G A;  3T2K A;  3HYW A;  3HYX A;  5KMP A;  3T14 A;  3SZW A;  3SX6 A;  4GAP A;  3HYV A;  3T2Y A;  4GAV A;  3T31 A;  4NWZ A;  4G6H A; 
#chains in the Genus database with same CATH topology
 1QJD A;  1ONF A;  2YLR A;  1E1K A;  3C4A A;  2Q7V A;  3K7T A;  3NT6 A;  4K7Z A;  4OCG A;  1NG3 A;  2OLO A;  3IF9 A;  5CQF A;  1O5W A;  1CC4 A;  1CHU A;  2VVM A;  3NHO X;  1M6I A;  3LJP A;  4U2S A;  1O94 A;  2V60 A;  2NPX A;  3PO7 A;  4B65 A;  2YG6 A;  2C65 A;  3SYI A;  3FPZ A;  3DK9 A;  3NYE A;  4A6N A;  1GND A;  3CGB A;  3FMW A;  4CCQ A;  1CL0 A;  4U8K A;  3NRN A;  1D4D A;  3UKH A;  2X8H A;  3CGE A;  1JRZ A;  2X8C A;  1P2E A;  1YQ4 A;  1S2Q A;  4FK1 A;  4B66 A;  3O0H A;  4I59 A;  1K0I A;  3AEE A;  3FG2 P;  4LA1 A;  1ZMD A;  2A8X A;  4C77 A;  1Y56 B;  1D4C A;  4CCR A;  3T37 A;  2Q0K A;  3BI4 A;  1LV0 A;  5FS9 A;  1KNR A;  3GWD A;  3VRB A;  3RP6 A;  2WOV A;  3KKJ A;  1H86 A;  1PBE A;  2GR0 A;  1NDA A;  2GQW A;  2WP9 A;  5BVA A;  3C4N A;  4APN A;  1Y0P A;  2WDR A;  4YTP A;  2XFN A;  3AXB A;  3NIX A;  3KVE A;  1F8S A;  1L9C A;  2XVE A;  4CNK A;  1CC6 A;  3DA1 A;  1H7W A;  1GRH A;  2I0Z A;  2V6O A;  4J33 A;  2VOU A;  3SQP A;  4G6G A;  3T2K A;  3QSM A;  3UKK A;  2WQY A;  1ZKQ A;  1Z6L A;  1TDK A;  2YG5 A;  3P1W A;  1GXF A;  4M52 A;  1DOE A;  3T2Y A;  5EB5 A;  1SEZ A;  2GR3 A;  3DGH A;  2BA9 A;  2XVJ A;  1DJN A;  3EPT A;  1EL9 A;  3VR8 A;  4DNA A;  4H4R A;  3QSS A;  1KF6 A;  2WBA A;  3KU9 A;  3LZW A;  3RHA A;  1PJ6 A;  1TDE A;  4RSL A;  1E39 A;  2GEW A;  4PAA A;  3I6D A;  3LB8 A;  1YQZ A;  2BC0 A;  1CJ4 A;  3ZDN A;  2BS2 A;  2DKH A;  2WOW A;  4K2X A;  2JAE A;  5KXJ A;  3VQR A;  1F8W A;  1CJ3 A;  1F3P A;  2RGO A;  2VQ7 A;  2XLS A;  1YKJ A;  1TDN A;  4REK A;  3DK4 A;  3GDP A;  3NH3 X;  1JNR A;  3UCL A;  5L46 A;  1E1M A;  2BCP A;  4C3X A;  3RP8 A;  3B3R A;  3AYL A;  4H2P A;  4YXD A;  4O5U A;  4Z44 A;  5J60 A;  3P4S A;  4H4V A;  4H4T A;  5BUL A;  1NPX A;  3QSE A;  4WCT A;  1D7L A;  4CY6 A;  2PHH A;  3AE7 A;  1FCD A;  2Q6U A;  3D8X A;  1LQT A;  1L0V A;  4AOX A;  4G6H A;  1TYT A;  1NHR A;  1RP0 A;  1GTE A;  1L9D A;  1XHC A;  2C72 A;  3NNE A;  1MXT A;  1VG0 A;  4J34 A;  4NTC A;  2R46 A;  4YSH A;  1B4V A;  1L9E A;  1OJC A;  2JBV A;  3CPI G;  3R9U A;  5JCL A;  3CNS A;  1IUX A;  1PJ7 A;  2B9X A;  2YLW A;  5TR3 A;  4YKF A;  4UDQ A;  4B63 A;  2AAQ A;  2BS3 A;  3BI5 A;  2V5Z A;  1PDH A;  2ZZC A;  1JEH A;  2APG A;  4Z25 A;  2YLZ A;  4X4J A;  4KX6 A;  1NG4 A;  4OPI A;  3URH A;  1D4E A;  2XDO A;  1GPE A;  4Z26 A;  2C75 A;  3BHK A;  4K5R A;  2EQ9 A;  3LOV A;  4YTM A;  2EQ7 A;  1GTH A;  2Q0L A;  5FS6 A;  1Q9I A;  3VRD B;  3BNU A;  1MOK A;  1N4W A;  2EQ6 A;  2YR4 A;  1IUV A;  1JRX A;  3Q6J A;  3AED A;  1EL5 A;  1W4X A;  3F8R A;  5M10 A;  4YT0 A;  1D7Y A;  1OJA A;  2C76 A;  4JDR A;  3CPJ G;  1KNP A;  4BJY A;  4A6N B;  1JOA A;  2WDV A;  1LQU A;  3T2Z A;  5J7X A;  4X9M A;  3M13 A;  4NTE A;  4ECH A;  2X99 A;  3QVP A;  4E0V A;  1JU2 A;  1XPQ A;  1DXL A;  2QA1 A;  4EIQ A;  2BAB A;  4I58 A;  2FJE A;  4K5S A;  2IVD A;  4XWR A;  4EQR A;  2RAB A;  3AD9 B;  2F5Z A;  4ZCD A;  2OA1 A;  3BHF A;  1PS9 A;  2VQB A;  3B6D A;  3FIM B;  2B7R A;  2WES A;  3ABV A;  4FX9 A;  2WP6 A;  4NTD A;  2ARD A;  3D1C A;  4NWZ A;  2XVI A;  2BS4 A;  2XLP A;  1NEN A;  3GYX A;  3SXI A;  3NKS A;  1IUW A;  4U8O A;  5U25 A;  1BWC A;  3NTA A;  2JK6 A;  3IHG A;  1P2H A;  2IVE A;  4AOS A;  5BRT A;  3AE6 A;  5KRQ A;  1FEA A;  4JQ9 A;  2JKC A;  3QVR A;  3H8I A;  1F6M A;  2CUL A;  2XVF A;  3UOV A;  1VRQ B;  3NGC X;  3QJ4 A;  1CJC A;  5GSN A;  3HYX A;  1H6V A;  3BI2 A;  3GD3 A;  5KWF A;  4U8J A;  1GSN A;  5HXI A;  2XFU A;  2YLT A;  5IQ4 A;  4IV9 A;  3AD7 B;  3CNJ A;  4RG4 A;  1MO9 A;  4H50 A;  4UDP A;  4ICY A;  4NNJ A;  1IJH A;  1DOB A;  2GR2 A;  1GRG A;  2QAE A;  3G5S A;  2AQJ A;  3KPF A;  2GAH B;  1F8R A;  4H4P A;  2CVJ A;  4YTN A;  2QA2 A;  4H2R A;  4WX1 A;  2FJB A;  1BGN A;  1ZK7 A;  4A5L A;  1S3B A;  2E4G A;  2O9Z A;  3UP5 A;  2A87 A;  2YVF A;  3IWA A;  3S5W A;  2B9Y A;  1GV4 A;  2BYB A;  2WOI A;  4JY2 A;  4EQW A;  4IA5 A;  2YR6 A;  3UOY A;  3F8D A;  3P4P A;  4AP1 A;  3UTG A;  3RED A;  2WP5 A;  2EQ8 A;  3HYW A;  4KPR A;  2GV8 A;  1DOC A;  4U8I A;  4Y4M A;  1Q1W A;  4A7A A;  3ICT A;  2XFP A;  2CFY A;  1B8S A;  1PJ5 A;  2C7G A;  2R4J A;  3GSI A;  5EOW A;  2A89 A;  2QCU A;  2WHD A;  3RP7 A;  2RGJ A;  3AEB A;  3KLJ A;  3AYI A;  2WPE A;  2GRT A;  2E1M A;  3CND A;  2FBW A;  2BXR A;  2WPC A;  2YG7 A;  3ITJ A;  3V3O A;  2OAM A;  1REO A;  3NLC A;  3SY4 A;  5JCI A;  1KFY A;  1LVL A;  1IUT A;  2BC1 A;  2YAU A;  3AE5 A;  5KMR A;  1BF3 A;  1GRE A;  4BK1 A;  2Y6Q A;  4FK1 C;  5HY5 A;  1GEU A;  4X9N A;  5KOW A;  5KMP A;  3M0O A;  4H4Z A;  2B7S A;  4J57 A;  4OPG A;  2YQU A;  4EQX A;  1GT8 A;  2GQF A;  4TM0 A;  1Y56 A;  3T31 A;  1GER A;  2C3D A;  3DJG X;  4EM3 A;  2YVG A;  3E1T A;  5KMQ A;  1FEC A;  3DJE A;  2H89 A;  2B9W A;  1NEK A;  2CDU A;  1N1P A;  2GMJ A;  4IVO B;  2R4E A;  1M64 A;  3II4 A;  1VDC A;  1H81 A;  3AEC A;  4TM3 A;  5EBK A;  4CBQ A;  2XFO A;  2TPR A;  2ZZ0 A;  3ADA B;  3AE2 A;  1ZOV A;  3P4Q A;  5FMH A;  1GES A;  3UTF A;  1GAL A;  2XLU A;  4OPD A;  3DJJ A;  1OJD A;  4H2Q A;  4EMI A;  3CMM A;  2Z5Y A;  4GR1 A;  2XLT A;  1N4U A;  1ELI A;  2YM1 A;  3IHM A;  3OC4 A;  1OJ9 A;  4GDE A;  2GB0 A;  4OPU A;  4U8L A;  3NK1 X;  3SZW A;  1N4V A;  1CF3 A;  4GRT A;  4XWZ A;  2JB1 A;  3QFB A;  2XCG A;  5HYM A;  2OLN A;  3KPK A;  2ACZ A;  1H82 A;  2GVC A;  4YWO A;  3SM8 A;  4H7U A;  3M12 A;  3NTD A;  4NEW A;  1JRY A;  1EBD A;  3WE0 A;  3UKQ A;  1D5T A;  3UOZ A;  3KA7 A;  3VRA A;  2V3A A;  5KOX A;  5M0Z A;  2YLS A;  4Z24 A;  4Y4N A;  4GF7 A;  1LPF A;  1GET A;  4H4W A;  4GUV A;  2V3B A;  4OPT A;  3T14 A;  4HB9 A;  3KD9 A;  1EL7 A;  4JNQ A;  4YSX A;  5HHF A;  5FS7 A;  3QFA A;  3K7M X;  1KSS A;  4PAB A;  1S2Y A;  1X31 B;  2VVL G;  2VZ2 A;  4H4Q A;  1EL8 A;  4TLX A;  3NK0 X;  4II3 A;  3NG7 X;  4N9X A;  4DSG A;  3NYF A;  1LTX R;  4ZN0 A;  2IID A;  3G5Q A;  2V61 A;  3GRS A;  3JSK A;  2FJD A;  2TMD A;  3F8P A;  5U63 A;  4DGK A;  2R9Z A;  1BKW A;  1TRB A;  1GRA A;  2C4C A;  4J36 A;  2ZBW A;  2XLR A;  3ICR A;  4A99 A;  5KMS A;  1LJ1 A;  1UKV G;  1ZMC A;  2H88 A;  4K22 A;  1RYI A;  2JB2 A;  4UDR A;  3H8L A;  3LAD A;  4J31 A;  3AYJ A;  1S3E A;  1VG9 A;  3GMB A;  3K30 A;  4BV6 A;  3GDN A;  4H2N A;  4EMW A;  2YWL A;  3AEG A;  4P9S A;  4EMJ A;  2WS3 A;  1PHH A;  2C66 A;  2J3N A;  2X8G A;  4EM4 A;  5C3J A;  3CNP A;  3L1R A;  2R45 A;  3P9U A;  4JNA A;  3SZC A;  3AE4 A;  4DSH A;  4BK3 A;  4B69 A;  4TM4 A;  1ZDL A;  3DJD A;  3SFD A;  4B64 A;  4AT2 A;  2GF3 A;  1HYU A;  3OZ2 A;  4IA6 A;  2WET A;  4A65 A;  4EIP A;  1H84 A;  3H4K A;  1E1N A;  3NN0 X;  1FEB A;  3AB1 A;  2RGH A;  3EF6 A;  2R0P A;  4YSZ A;  3SZF A;  4G73 A;  1RSG A;  3L8K A;  4BJZ A;  3UP4 A;  3UTH A;  1QO8 A;  2YLX A;  4MJW A;  2WDQ A;  1GRB A;  4BK2 A;  3C96 A;  1NHP A;  3SX6 A;  5KNL A;  2XYO A;  2YR5 A;  4II2 A;  4H4S A;  4C74 A;  4O5Q A;  5IPY A;  1E7P A;  4TLZ A;  3P4R A;  5IQ1 A;  1ZP0 A;  1OJT A;  3AEA A;  2BK4 A;  2R0G A;  3COX A;  2GH5 A;  2AR8 A;  2BK5 A;  2C70 A;  1PXB A;  3SZ0 A;  3UKP A;  1FOH A;  3V76 A;  4EQS A;  3NYC A;  4CY8 A;  2C64 A;  3ICS A;  4CRT A;  1GOS A;  2BXS A;  1CBO A;  2JB3 A;  2XVH A;  4U2L A;  3UOX A;  3RNM A;  4USQ A;  1PBB A;  1V59 A;  1TDF A;  3G5R A;  4LU6 A;  4U8N A;  3VR9 A;  1ZY8 A;  4U8M A;  3DME A;  2X50 A;  4GCM A;  1VQW A;  1K0L A;  3ATR A;  4H4U A;  2VVL A;  2E5V A;  3UTE A;  4C3Y A;  3SFE A;  4Z43 A;  3SGL A;  2B76 A;  1IUS A;  3AE1 A;  3S61 A;  3PS9 A;  5JCM A;  1DNC A;  1YY5 A;  4JN9 A;  3DGZ A;  1CJ2 A;  1GRT A;  3GWF A;  4B68 A;  3GD4 A;  4UP3 A;  5KVH A;  1K4Q A;  4C5O A;  1BGJ A;  2VRM A;  4FDC B;  4H4X A;  3I3L A;  1DJQ A;  2BRA A;  4G9K A;  4D03 A;  4D04 A;  3EAO A;  3ATQ A;  3CN8 A;  4Z2T A;  2C73 A;  4A79 A;  1BZL A;  4AT0 A;  2YVJ A;  1B37 A;  4U2T A;  3HZL A;  5ER0 A;  4U8P A;  3DH9 A;  1KSU A;  3V3N A;  1PXA A;  2Y6R A;  1K0J A;  2ZZB A;  1PBD A;  1PBC A;  1PXC A;  3Q9T A;  5KVI A;  4H4Y A;  4OVI A;  2R0C A;  4ZCC A;  3UKL A;  1AOG A;  2DKI A;  1H83 A;  1NHS A;  4GAP A;  5JCK A;  1H7X A;  2YG4 A;  4J2W A;  3LXD A;  3NK2 X;  5EB4 A;  1E6E A;  4Z2U A;  2WU2 A;  4GAV A;  3GYI A;  3CIR A;  4NEV A;  3AE9 A;  4B67 A;  4Z2R A;  3GRT A;  3UKA A;  4TM1 A;  3T0K A;  2UZZ A;  2C67 A;  2WPF A;  3AE8 A;  5LV9 A;  4HA6 A;  1XAN A;  2GMH A;  1O95 A;  3AE3 A;  3BNM A;  5U1O A;  3PVC A;  4AP3 A;  1B5Q A;  2Z5X A;  1NHQ A;  3AEF A;  3K7Q X;  4NZH A;  2BCG G;  3ALJ A;  4GDP A;  3AD8 B;  4USR A;  4OPL A;  4G74 A;  3GYJ A;  1Q1R A;  4IVM B;  3DK8 A;  3UKF A;  5FS8 A;  4YKG A;  3NN6 X;  2WEU A;  1KDG A;  2NVK X;  2W0H A;  3LZX A;  4ADW A;  4JY3 A;  1ZOY A;  3HYV A;  2GAG B;  5C2T A;  2XFQ A;  1FL2 A;  1PN0 A;  3CTY A;  4CNJ A;  1ZX9 A;  2YG3 A;  3GMC A;  1TDO A;  3CNT A;  2PYX A;  3ZYX A;  3EAN A;  1PBF A;  2X3N A;  3FBS A;  3CPH G;  3CGC A;  5DBJ A;  4Y4L A;  4A9W A;  4J56 A;  1YQ3 A;  1XDI A;  3ALL A;  1JNZ A;  1CC2 A;  4OPC A;  1GRF A;  1QLB A;  3CGD A;  5GRT A;  1E1L A;  3AWI A;  5JCN A;  4K8D A;  2WU5 A;  4BUR A;  4B1B A;  5CKU A;  2VRL A;  4YSY A;  1NAA A;  2BK3 A;  2OAL A;  1TYP A;  1COY A;  2BRY A;  3IC9 A;  5BUK A;  4LII A;  4RG3 A;  2C3C A;  1DOD A;  3ALM A;  3ISH A;  1IUU A;  2BAC A;  2FJA A;  4XXG A;  2HQM A;  2GR1 A;  2YM2 A; 
#chains in the Genus database with same CATH homology
 1QJD A;  1ONF A;  2YLR A;  1E1K A;  3C4A A;  2Q7V A;  3K7T A;  3NT6 A;  4K7Z A;  4OCG A;  1NG3 A;  2OLO A;  3IF9 A;  5CQF A;  1O5W A;  1CC4 A;  1CHU A;  2VVM A;  3NHO X;  1M6I A;  3LJP A;  4U2S A;  1O94 A;  2V60 A;  2NPX A;  3PO7 A;  4B65 A;  2YG6 A;  2C65 A;  3SYI A;  3FPZ A;  3DK9 A;  3NYE A;  4A6N A;  1GND A;  3CGB A;  3FMW A;  4CCQ A;  1CL0 A;  4U8K A;  3NRN A;  1D4D A;  3UKH A;  2X8H A;  3CGE A;  1JRZ A;  2X8C A;  1P2E A;  1YQ4 A;  1S2Q A;  4FK1 A;  4B66 A;  3O0H A;  4I59 A;  1K0I A;  3AEE A;  3FG2 P;  4LA1 A;  1ZMD A;  2A8X A;  4C77 A;  1Y56 B;  1D4C A;  4CCR A;  3T37 A;  2Q0K A;  3BI4 A;  1LV0 A;  5FS9 A;  1KNR A;  3GWD A;  3VRB A;  3RP6 A;  2WOV A;  3KKJ A;  1H86 A;  1PBE A;  2GR0 A;  1NDA A;  2GQW A;  2WP9 A;  5BVA A;  3C4N A;  4APN A;  1Y0P A;  2WDR A;  4YTP A;  2XFN A;  3AXB A;  3NIX A;  3KVE A;  1F8S A;  1L9C A;  2XVE A;  4CNK A;  1CC6 A;  3DA1 A;  1H7W A;  1GRH A;  2I0Z A;  2V6O A;  4J33 A;  2VOU A;  3SQP A;  4G6G A;  3T2K A;  3QSM A;  3UKK A;  2WQY A;  1ZKQ A;  1Z6L A;  1TDK A;  2YG5 A;  3P1W A;  1GXF A;  4M52 A;  1DOE A;  3T2Y A;  5EB5 A;  1SEZ A;  2GR3 A;  3DGH A;  2BA9 A;  2XVJ A;  1DJN A;  3EPT A;  1EL9 A;  3VR8 A;  4DNA A;  4H4R A;  3QSS A;  1KF6 A;  2WBA A;  3KU9 A;  3LZW A;  3RHA A;  1PJ6 A;  1TDE A;  4RSL A;  1E39 A;  2GEW A;  4PAA A;  3I6D A;  3LB8 A;  1YQZ A;  2BC0 A;  1CJ4 A;  3ZDN A;  2BS2 A;  2DKH A;  2WOW A;  4K2X A;  2JAE A;  5KXJ A;  3VQR A;  1F8W A;  1CJ3 A;  1F3P A;  2RGO A;  2VQ7 A;  2XLS A;  1YKJ A;  1TDN A;  4REK A;  3DK4 A;  3GDP A;  3NH3 X;  1JNR A;  3UCL A;  5L46 A;  1E1M A;  2BCP A;  4C3X A;  3RP8 A;  3B3R A;  3AYL A;  4H2P A;  4YXD A;  4O5U A;  4Z44 A;  5J60 A;  3P4S A;  4H4V A;  4H4T A;  5BUL A;  1NPX A;  3QSE A;  4WCT A;  1D7L A;  4CY6 A;  2PHH A;  3AE7 A;  1FCD A;  2Q6U A;  3D8X A;  1LQT A;  1L0V A;  4AOX A;  4G6H A;  1TYT A;  1NHR A;  1RP0 A;  1GTE A;  1L9D A;  1XHC A;  2C72 A;  3NNE A;  1MXT A;  1VG0 A;  4J34 A;  4NTC A;  2R46 A;  4YSH A;  1B4V A;  1L9E A;  1OJC A;  2JBV A;  3CPI G;  3R9U A;  5JCL A;  3CNS A;  1IUX A;  1PJ7 A;  2B9X A;  2YLW A;  5TR3 A;  4YKF A;  4UDQ A;  4B63 A;  2AAQ A;  2BS3 A;  3BI5 A;  2V5Z A;  1PDH A;  2ZZC A;  1JEH A;  2APG A;  4Z25 A;  2YLZ A;  4X4J A;  4KX6 A;  1NG4 A;  4OPI A;  3URH A;  1D4E A;  2XDO A;  1GPE A;  4Z26 A;  2C75 A;  3BHK A;  4K5R A;  2EQ9 A;  3LOV A;  4YTM A;  2EQ7 A;  1GTH A;  2Q0L A;  5FS6 A;  1Q9I A;  3VRD B;  3BNU A;  1MOK A;  1N4W A;  2EQ6 A;  2YR4 A;  1IUV A;  1JRX A;  3Q6J A;  3AED A;  1EL5 A;  1W4X A;  3F8R A;  5M10 A;  4YT0 A;  1D7Y A;  1OJA A;  2C76 A;  4JDR A;  3CPJ G;  1KNP A;  4BJY A;  4A6N B;  1JOA A;  2WDV A;  1LQU A;  3T2Z A;  5J7X A;  4X9M A;  3M13 A;  4NTE A;  4ECH A;  2X99 A;  3QVP A;  4E0V A;  1JU2 A;  1XPQ A;  1DXL A;  2QA1 A;  4EIQ A;  2BAB A;  4I58 A;  2FJE A;  4K5S A;  2IVD A;  4XWR A;  4EQR A;  2RAB A;  3AD9 B;  2F5Z A;  4ZCD A;  2OA1 A;  3BHF A;  1PS9 A;  2VQB A;  3B6D A;  3FIM B;  2B7R A;  2WES A;  3ABV A;  4FX9 A;  2WP6 A;  4NTD A;  2ARD A;  3D1C A;  4NWZ A;  2XVI A;  2BS4 A;  2XLP A;  1NEN A;  3GYX A;  3SXI A;  3NKS A;  1IUW A;  4U8O A;  5U25 A;  1BWC A;  3NTA A;  2JK6 A;  3IHG A;  1P2H A;  2IVE A;  4AOS A;  5BRT A;  3AE6 A;  5KRQ A;  1FEA A;  4JQ9 A;  2JKC A;  3QVR A;  3H8I A;  1F6M A;  2CUL A;  2XVF A;  3UOV A;  1VRQ B;  3NGC X;  3QJ4 A;  1CJC A;  5GSN A;  3HYX A;  1H6V A;  3BI2 A;  3GD3 A;  5KWF A;  4U8J A;  1GSN A;  5HXI A;  2XFU A;  2YLT A;  5IQ4 A;  4IV9 A;  3AD7 B;  3CNJ A;  4RG4 A;  1MO9 A;  4H50 A;  4UDP A;  4ICY A;  4NNJ A;  1IJH A;  1DOB A;  2GR2 A;  1GRG A;  2QAE A;  3G5S A;  2AQJ A;  3KPF A;  2GAH B;  1F8R A;  4H4P A;  2CVJ A;  4YTN A;  2QA2 A;  4H2R A;  4WX1 A;  2FJB A;  1BGN A;  1ZK7 A;  4A5L A;  1S3B A;  2E4G A;  2O9Z A;  3UP5 A;  2A87 A;  2YVF A;  3IWA A;  3S5W A;  2B9Y A;  1GV4 A;  2BYB A;  2WOI A;  4JY2 A;  4EQW A;  4IA5 A;  2YR6 A;  3UOY A;  3F8D A;  3P4P A;  4AP1 A;  3UTG A;  3RED A;  2WP5 A;  2EQ8 A;  3HYW A;  4KPR A;  2GV8 A;  1DOC A;  4U8I A;  4Y4M A;  1Q1W A;  4A7A A;  3ICT A;  2XFP A;  2CFY A;  1B8S A;  1PJ5 A;  2C7G A;  2R4J A;  3GSI A;  5EOW A;  2A89 A;  2QCU A;  2WHD A;  3RP7 A;  2RGJ A;  3AEB A;  3KLJ A;  3AYI A;  2WPE A;  2GRT A;  2E1M A;  3CND A;  2FBW A;  2BXR A;  2WPC A;  2YG7 A;  3ITJ A;  3V3O A;  2OAM A;  1REO A;  3NLC A;  3SY4 A;  5JCI A;  1KFY A;  1LVL A;  1IUT A;  2BC1 A;  2YAU A;  3AE5 A;  5KMR A;  1BF3 A;  1GRE A;  4BK1 A;  2Y6Q A;  4FK1 C;  5HY5 A;  1GEU A;  4X9N A;  5KOW A;  5KMP A;  3M0O A;  4H4Z A;  2B7S A;  4J57 A;  4OPG A;  2YQU A;  4EQX A;  1GT8 A;  2GQF A;  4TM0 A;  1Y56 A;  3T31 A;  1GER A;  2C3D A;  3DJG X;  4EM3 A;  2YVG A;  3E1T A;  5KMQ A;  1FEC A;  3DJE A;  2H89 A;  2B9W A;  1NEK A;  2CDU A;  1N1P A;  2GMJ A;  4IVO B;  2R4E A;  1M64 A;  3II4 A;  1VDC A;  1H81 A;  3AEC A;  4TM3 A;  5EBK A;  4CBQ A;  2XFO A;  2TPR A;  2ZZ0 A;  3ADA B;  3AE2 A;  1ZOV A;  3P4Q A;  5FMH A;  1GES A;  3UTF A;  1GAL A;  2XLU A;  4OPD A;  3DJJ A;  1OJD A;  4H2Q A;  4EMI A;  3CMM A;  2Z5Y A;  4GR1 A;  2XLT A;  1N4U A;  1ELI A;  2YM1 A;  3IHM A;  3OC4 A;  1OJ9 A;  4GDE A;  2GB0 A;  4OPU A;  4U8L A;  3NK1 X;  3SZW A;  1N4V A;  1CF3 A;  4GRT A;  4XWZ A;  2JB1 A;  3QFB A;  2XCG A;  5HYM A;  2OLN A;  3KPK A;  2ACZ A;  1H82 A;  2GVC A;  4YWO A;  3SM8 A;  4H7U A;  3M12 A;  3NTD A;  4NEW A;  1JRY A;  1EBD A;  3WE0 A;  3UKQ A;  1D5T A;  3UOZ A;  3KA7 A;  3VRA A;  2V3A A;  5KOX A;  5M0Z A;  2YLS A;  4Z24 A;  4Y4N A;  4GF7 A;  1LPF A;  1GET A;  4H4W A;  4GUV A;  2V3B A;  4OPT A;  3T14 A;  4HB9 A;  3KD9 A;  1EL7 A;  4JNQ A;  4YSX A;  5HHF A;  5FS7 A;  3QFA A;  3K7M X;  1KSS A;  4PAB A;  1S2Y A;  1X31 B;  2VVL G;  2VZ2 A;  4H4Q A;  1EL8 A;  4TLX A;  3NK0 X;  4II3 A;  3NG7 X;  4N9X A;  4DSG A;  3NYF A;  1LTX R;  4ZN0 A;  2IID A;  3G5Q A;  2V61 A;  3GRS A;  3JSK A;  2FJD A;  2TMD A;  3F8P A;  5U63 A;  4DGK A;  2R9Z A;  1BKW A;  1TRB A;  1GRA A;  2C4C A;  4J36 A;  2ZBW A;  2XLR A;  3ICR A;  4A99 A;  5KMS A;  1LJ1 A;  1UKV G;  1ZMC A;  2H88 A;  4K22 A;  1RYI A;  2JB2 A;  4UDR A;  3H8L A;  3LAD A;  4J31 A;  3AYJ A;  1S3E A;  1VG9 A;  3GMB A;  3K30 A;  4BV6 A;  3GDN A;  4H2N A;  4EMW A;  2YWL A;  3AEG A;  4P9S A;  4EMJ A;  2WS3 A;  1PHH A;  2C66 A;  2J3N A;  2X8G A;  4EM4 A;  5C3J A;  3CNP A;  3L1R A;  2R45 A;  3P9U A;  4JNA A;  3SZC A;  3AE4 A;  4DSH A;  4BK3 A;  4B69 A;  4TM4 A;  1ZDL A;  3DJD A;  3SFD A;  4B64 A;  4AT2 A;  2GF3 A;  1HYU A;  3OZ2 A;  4IA6 A;  2WET A;  4A65 A;  4EIP A;  1H84 A;  3H4K A;  1E1N A;  3NN0 X;  1FEB A;  3AB1 A;  2RGH A;  3EF6 A;  2R0P A;  4YSZ A;  3SZF A;  4G73 A;  1RSG A;  3L8K A;  4BJZ A;  3UP4 A;  3UTH A;  1QO8 A;  2YLX A;  4MJW A;  2WDQ A;  1GRB A;  4BK2 A;  3C96 A;  1NHP A;  3SX6 A;  5KNL A;  2XYO A;  2YR5 A;  4II2 A;  4H4S A;  4C74 A;  4O5Q A;  5IPY A;  1E7P A;  4TLZ A;  3P4R A;  5IQ1 A;  1ZP0 A;  1OJT A;  3AEA A;  2BK4 A;  2R0G A;  3COX A;  2GH5 A;  2AR8 A;  2BK5 A;  2C70 A;  1PXB A;  3SZ0 A;  3UKP A;  1FOH A;  3V76 A;  4EQS A;  3NYC A;  4CY8 A;  2C64 A;  3ICS A;  4CRT A;  1GOS A;  2BXS A;  1CBO A;  2JB3 A;  2XVH A;  4U2L A;  3UOX A;  3RNM A;  4USQ A;  1PBB A;  1V59 A;  1TDF A;  3G5R A;  4LU6 A;  4U8N A;  3VR9 A;  1ZY8 A;  4U8M A;  3DME A;  2X50 A;  4GCM A;  1VQW A;  1K0L A;  3ATR A;  4H4U A;  2VVL A;  2E5V A;  3UTE A;  4C3Y A;  3SFE A;  4Z43 A;  3SGL A;  2B76 A;  1IUS A;  3AE1 A;  3S61 A;  3PS9 A;  5JCM A;  1DNC A;  1YY5 A;  4JN9 A;  3DGZ A;  1CJ2 A;  1GRT A;  3GWF A;  4B68 A;  3GD4 A;  4UP3 A;  5KVH A;  1K4Q A;  4C5O A;  1BGJ A;  2VRM A;  4FDC B;  4H4X A;  3I3L A;  1DJQ A;  2BRA A;  4G9K A;  4D03 A;  4D04 A;  3EAO A;  3ATQ A;  3CN8 A;  4Z2T A;  2C73 A;  4A79 A;  1BZL A;  4AT0 A;  2YVJ A;  1B37 A;  4U2T A;  3HZL A;  5ER0 A;  4U8P A;  3DH9 A;  1KSU A;  3V3N A;  1PXA A;  2Y6R A;  1K0J A;  2ZZB A;  1PBD A;  1PBC A;  1PXC A;  3Q9T A;  5KVI A;  4H4Y A;  4OVI A;  2R0C A;  4ZCC A;  3UKL A;  1AOG A;  2DKI A;  1H83 A;  1NHS A;  4GAP A;  5JCK A;  1H7X A;  2YG4 A;  4J2W A;  3LXD A;  3NK2 X;  5EB4 A;  1E6E A;  4Z2U A;  2WU2 A;  4GAV A;  3GYI A;  3CIR A;  4NEV A;  3AE9 A;  4B67 A;  4Z2R A;  3GRT A;  3UKA A;  4TM1 A;  3T0K A;  2UZZ A;  2C67 A;  2WPF A;  3AE8 A;  5LV9 A;  4HA6 A;  1XAN A;  2GMH A;  1O95 A;  3AE3 A;  3BNM A;  5U1O A;  3PVC A;  4AP3 A;  1B5Q A;  2Z5X A;  1NHQ A;  3AEF A;  3K7Q X;  4NZH A;  2BCG G;  3ALJ A;  4GDP A;  3AD8 B;  4USR A;  4OPL A;  4G74 A;  3GYJ A;  1Q1R A;  4IVM B;  3DK8 A;  3UKF A;  5FS8 A;  4YKG A;  3NN6 X;  2WEU A;  1KDG A;  2NVK X;  2W0H A;  3LZX A;  4ADW A;  4JY3 A;  1ZOY A;  3HYV A;  2GAG B;  5C2T A;  2XFQ A;  1FL2 A;  1PN0 A;  3CTY A;  4CNJ A;  1ZX9 A;  2YG3 A;  3GMC A;  1TDO A;  3CNT A;  2PYX A;  3ZYX A;  3EAN A;  1PBF A;  2X3N A;  3FBS A;  3CPH G;  3CGC A;  5DBJ A;  4Y4L A;  4A9W A;  4J56 A;  1YQ3 A;  1XDI A;  3ALL A;  1JNZ A;  1CC2 A;  4OPC A;  1GRF A;  1QLB A;  3CGD A;  5GRT A;  1E1L A;  3AWI A;  5JCN A;  4K8D A;  2WU5 A;  4BUR A;  4B1B A;  5CKU A;  2VRL A;  4YSY A;  1NAA A;  2BK3 A;  2OAL A;  1TYP A;  1COY A;  2BRY A;  3IC9 A;  5BUK A;  4LII A;  4RG3 A;  2C3C A;  1DOD A;  3ALM A;  3ISH A;  1IUU A;  2BAC A;  2FJA A;  4XXG A;  2HQM A;  2GR1 A;  2YM2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...