1REOA

L-amino acid oxidase from agkistrodon halys pallas
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords AHPLAAO
publication title Purification, partial characterization, crystallization and structural determination of AHP-LAAO, a novel L-amino-acid oxidase with cell apoptosis-inducing activity from Agkistrodon halys pallas venom.
pubmed doi rcsb
total genus 181
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1reoA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1reoA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1reoA01
3PO7A 1H86A 2A87A 1GOSA 3AD9B 1F6MA 3AYIA 4DSGA 4K7ZA 4AP1A 1IUWA 1DJQA 3NN6X 3P4PA 3UKHA 2EQ9A 2CVJA 1TRBA 1YQ3A 2OAMA 1V59A 3GDPA 4K5RA 4U8LA 2EQ6A 5HHFA 1PJ5A 3SFEA 2WDQA 1D5TA 3K7MX 4ICYA 5EOWA 4AP3A 3NTAA 3CN8A 3B6DA 4IA6A 4UDQA 2V6OA 2YAUA 3L8KA 3UKQA 1EL7A 1NG4A 4YSZA 3ALJA 5IQ4A 3FMWA 1JRYA 4A65A 1KNRA 1ZY8A 4TLXA 3RP8A 1S2QA 3QSEA 4GRTA 5BUKA 2CULA 3RNMA 2Y6QA 3GD3A 3ITJA 2AQJA 2JKCA 2ZBWA 3NYFA 2XFOA 2C3CA 2ACZA 2A89A 2WOVA 3GMBA 4IV9A 4NEVA 1O95A 3AEDA 3C4NA 1TDNA 1PXBA 3NTDA 2YR4A 3S61A 3B3RA 3NKSA 4B69A 2YQUA 4H4SA 4YSYA 5HY5A 2GR3A 4OPDA 3D1CA 4N9XA 1GTEA 1MOKA 1KSUA 1KF6A 2GVCA 3RP6A 2YLSA 2XDOA 3PS9A 5JCLA 4P9SA 2XLPA 1SEZA 1OJCA 2WOWA 5TR3A 5U25A 2B7RA 5CKUA 2BABA 2TPRA 1N4VA 2RGJA 1CJ3A 4Y4NA 3IHGA 2VOUA 2WETA 2C66A 1PBCA 3LZXA 2O9ZA 3CGCA 4OPLA 1PBDA 1BKWA 1S2YA 3P9UA 3QFAA 4BURA 1D4EA 2FJBA 2X99A 2GAGB 4NTDA 3ISHA 4GR1A 4AT0A 1OJAA 4PAAA 1GRAA 2YM1A 4OPCA 2WP9A 1PS9A 2VVMA 1TDFA 4C74A 3ZYXA 3EAOA 4D03A 2XVIA 5M0ZA 1ZX9A 4USRA 4BJZA 5L46A 4Z24A 4H4UA 1ZKQA 1PXAA 4H2RA 4J33A 1DJNA 2FBWA 2RGHA 1COYA 1TDEA 1F8RA 3DGHA 2BK5A 1M64A 2C7GA 2R45A 3IHMA 1VG0A 4EMIA 1NAAA 3NG7X 4GUVA 1LJ1A 3NYCA 3UTGA 1LPFA 5HXIA 3BHKA 2WPFA 4NEWA 2YM2A 4GF7A 3AE8A 1VG9A 1ZP0A 4TM1A 1BWCA 4U2SA 1B5QA 1ONFA 1X31B 2R4JA 1O94A 1QLBA 1CJ2A 2B7SA 2WHDA 4USQA 1KSSA 3AWIA 3ICSA 2H89A 1H6VA 1PXCA 2XLTA 5IQ1A 4BV6A 4A5LA 4JNQA 3EF6A 1VRQB 1MO9A 4XWZA 4E0VA 1QJDA 4CCRA 1DOCA 2OLNA 2X8HA 1FOHA 4YKGA 1L9DA 2BXSA 2XVEA 1MXTA 1JU2A 4Y4LA 5FMHA 3UTEA 1ZOYA 1Y56A 1EL5A 2R0PA 3AE9A 3GWFA 2GR0A 1ZOVA 3DA1A 5BVAA 4YTPA 2EQ8A 2Z5YA 2JBVA 4AT2A 2A8XA 3DJDA 3AD7B 4U8PA 2BC0A 2ZZCA 3AECA 4EQRA 1YKJA 4B68A 4U8OA 1YQ4A 2C70A 3LZWA 2DKIA 4B1BA 3CNSA 4UDRA 3UKLA 3NK2X 4A6NB 4A6NA 4YWOA 2YG5A 1D7LA 2CFYA 2C75A 2X8CA 4PABA 3ALLA 5CQFA 5KVHA 5KVIA 2WP6A 1LV0A 3F8PA 2BXRA 4BK3A 4H50A 1HYUA 2JB3A 3UOYA 4EQSA 2BK4A 4BJYA 5FS9A 2OLOA 2GMJA 3AEEA 1NHSA 3L1RA 4CBQA 5EB4A 4EMJA 4J31A 3AE7A 2C73A 1P2EA 3AD8B 1L9EA 1PBBA 1Q9IA 4KPRA 3M0OA 5C2TA 3AYLA 1K0LA 1NEKA 4EQXA 3P4RA 1DODA 2YLTA 4D04A 3FPZA 3M13A 1XDIA 2VVLA 4X4JA 5KOWA 2NVKX 3EPTA 4JY2A 2XFQA 3NYEA 1ZK7A 3G5QA 3DK4A 2DKHA 2ZZBA 3ICRA 3WE0A 4A9WA 3VR9A 2BS3A 3E1TA 3AEGA 3H8LA 3S5WA 4H7UA 4HB9A 2WDRA 1NPXA 3I6DA 4B67A 3VRDB 4JN9A 4OPTA 1Q1RA 3CGDA 3ICTA 3QVPA 2JB1A 1BF3A 1RYIA 1EL8A 2BCGG 1CJCA 1K0JA 3C96A 4H4VA 2QA2A 3URHA 1D4DA 4H2QA 4FK1A 2C76A 1PDHA 2JK6A 4FX9A 4WX1A 4C5OA 2UZZA 3BHFA 3NT6A 3PVCA 3DK9A 2BS4A 3NNEA 1JRZA 4CNJA 3VRAA 4M52A 1ZMCA 4O5QA 1K0IA 4NZHA 2YG7A 5U1OA 1K4QA 1GXFA 1O5WA 4X9NA 3Q6JA 2EQ7A 2Q7VA 2WS3A 3FG2P 2C65A 4YTMA 3LOVA 1E7PA 1GETA 3QJ4A 3DJEA 5J7XA 4Z43A 4FDCB 1N4UA 1DOBA 4B65A 1FEAA 1GRFA 3T37A 4EMWA 4NTEA 1F3PA 4OVIA 3AE6A 2XFPA 4TM3A 3BI5A 2B76A 2XFUA 2WOIA 4EIPA 2BYBA 3GRTA 1XANA 3RHAA 3KD9A 1KFYA 1RSGA 2YVGA 3BI4A 1N1PA 4ZN0A 4U8NA 2PHHA 1ZMDA 2BK3A 3BNUA 3AE4A 3G5SA 2B9XA 1EL9A 3IF9A 1OJ9A 1PHHA 2Q6UA 1GPEA 2X50A 2R4EA 2YLRA 4TM0A 3V3OA 2GH5A 4CY6A 4FK1C 1XHCA 1NHRA 2GQFA 1YQZA 4A7AA 5EBKA 1CF3A 4GDPA 1H81A 4H2PA 4K8DA 1JRXA 1OJDA 1E6EA 1B37A 1E1KA 4H2NA 3HZLA 3CNPA 1H7WA 2APGA 3ADAB 5ER0A 1NG3A 2OALA 3QVRA 3V3NA 2GQWA 3SM8A 2XLRA 3GYJA 1M6IA 1NENA 3KLJA 4DGKA 1LQTA 2YG3A 1H83A 4H4ZA 3DH9A 3CTYA 2ARDA 2GR1A 1GRBA 2XVFA 1TYTA 1GNDA 3ATRA 1JEHA 1GTHA 1W4XA 1Y56B 3F8DA 4HA6A 2GR2A 4ADWA 1GEUA 3NK0X 1DNCA 3G5RA 2V60A 2WP5A 1JNZA 2WDVA 4H4QA 2XCGA 1IUVA 4ECHA 3LXDA 2E1MA 2IVDA 1DOEA 4K5SA 1NHQA 2QCUA 5FS7A 3IWAA 2WU2A 1E1NA 2I0ZA 2VQ7A 2JAEA 3AEBA 3P4QA 1Q1WA 1Y0PA 5U63A 2BCPA 3AE3A 2AR8A 3QFBA 5EB5A 2CDUA 1TDKA 4CNKA 5KXJA 4LIIA 2AAQA 4BK1A 5HYMA 3CGEA 2ZZ0A 4Y4MA 2J3NA 4Z2RA 2IVEA 1AOGA 2YG6A 3GRSA 4IVMB 4UDPA 1D4CA 4CRTA 1LQUA 4Z26A 1GESA 4J36A 3RP7A 2V3AA 2R46A 3VRBA 2C3DA 4U2LA 4OPGA 1GRTA 5IPYA 2WESA 3UOZA 1S3EA 4I59A 4BK2A 2NPXA 4RG4A 3K7TA 4UP3A 3DMEA 4H4RA 2R0GA 3CGBA 4JY3A 3GD4A 4GDEA 4X9MA 4EM4A 1RP0A 5JCKA 3AE5A 2YG4A 1JNRA 4K22A 4H4PA 5JCNA 4IVOB 4C77A 5FS6A 1PN0A 1F8WA 1CC2A 4H4XA 1PBFA 4DSHA 4JDRA 3CPJG 4XWRA 4REKA 4B63A 1TYPA 4U8JA 4U8IA 2R9ZA 3EANA 1FCDA 5BULA 4A99A 3NIXA 1L0VA 3BNMA 4U8MA 1E39A 1GSNA 3K7QX 4H4WA 1EBDA 2VRMA 3O0HA 4H4TA 3NHOX 2JB2A 1VQWA 5LV9A 3AEAA 3GWDA 2HQMA 4XXGA 1NDAA 2BS2A 2V3BA 1IUSA 3NH3X 1CC4A 4TLZA 2V61A 2BC1A 3UTFA 2X3NA 4AOXA 1CC6A 3AEFA 1S3BA 1LVLA 5FS8A 3CIRA 2VRLA 1D7YA 2XLUA 2VQBA 1H84A 1L9CA 5GSNA 5C3JA 4U8KA 3F8RA 3P4SA 2XFNA 2VVLG 1CHUA 4A79A 2QAEA 3GYIA 2WEUA 3COXA 1IUUA 1FL2A 3NLCA 3II4A 1YY5A 3ALMA 5JCIA 4ZCDA 2XVHA 2YLZA 1PJ6A 2X8GA 4NTCA 4EM3A 1PBEA 2E4GA 4YXDA 3OZ2A 5KRQA 3LJPA 2XVJA 3LADA 5DBJA 3AXBA 3NK1X 3NRNA 3GSIA 3V76A 1QO8A 4YSHA 3DK8A 3AE2A 2QA1A 4JQ9A 1IJHA 1XPQA 3QSSA 2GRTA 4LU6A 4OPIA 1NHPA 2E5VA 1KDGA 1H7XA 1N4WA 1GREA 3H4KA 3LB8A 3UP4A 4Z2TA 2PYXA 1LTXR 3VR8A 1ELIA 4MJWA 4CY8A 3JSKA 5KOXA 2FJDA 3AB1A 3UOVA 3UKAA 4Z25A 1B4VA 3SFDA 3DJJA 3ATQA 2IIDA 2YLXA 5BRTA 2TMDA 2YVFA 4LA1A 2FJAA 1IUTA 1CL0A 1IUXA 1JOAA 2WU5A 4EIQA 1GV4A 1CBOA 3CNJA 2W0HA 1FEBA 4RG3A 1BGNA 2WPCA 5M10A 4KX6A 3P1WA 3I3LA 1B8SA 4TM4A 4DNAA 4I58A 2C67A 2GF3A 3IC9A 4B64A 1PJ7A 2GAHB 2Q0LA 2FJEA 3BI2A 4CCQA 1Z6LA 3AYJA 1ZDLA 2B9YA 2BA9A 2WBAA 3UOXA 3UTHA 2XLSA 2GV8A 4YKFA 3SQPA 4OCGA 3OC4A 3K30A 2V5ZA 1GT8A 2B9WA 2Q0KA 3GMCA 2RABA 1P2HA 1CJ4A 2WQYA 4J2WA 3FIMB 1OJTA 3D8XA 3DGZA 4B66A 2OA1A 3M12A 5GRTA 4AOSA 3KU9A 3CNDA 4WCTA 1BGJA 2F5ZA 3KPFA 5KWFA 2GB0A 1REOA 2GEWA 4Z2UA 4Z44A 3R9UA 1GRGA 3C4AA 1DXLA 2YR6A 3Q9TA 4JNAA 3REDA 5JCMA 4K2XA 1BZLA 2XYOA 2H88A 1E1LA 3UCLA 4H4YA 1UKVG 3QSMA 1E1MA 3VQRA 3CNTA 2VZ2A 2RGOA 3ABVA 4J34A 1F8SA 4APNA 2R0CA 4J57A 3KKJA 3NN0X 4IA5A 2C72A 4OPUA 3GDNA 4RSLA 4C3XA 3KA7A 4YSXA 3ZDNA 3CPHG 3AE1A 4U2TA 4J56A 4GCMA 3FBSA 4O5UA 2YVJA 3H8IA 3DJGX 3KVEA 2C64A 1GALA 1GRHA 2Z5XA 2WPEA 3NGCX 3CPIG 3SGLA 2YWLA 2YLWA 1H82A 3UKFA 2Y6RA 1GERA 4ZCCA 1KNPA 4EQWA 4YTNA 5J60A 3UKPA 3UP5A 1VDCA 4YT0A 3UKKA 2GMHA 4C3YA 1FECA 2YR5A 2BACA 1TDOA
chains in the Genus database with same CATH superfamily
3PO7A 1H86A 2A87A 1GOSA 3AD9B 1F6MA 3AYIA 4DSGA 4K7ZA 4AP1A 1IUWA 1DJQA 3NN6X 3P4PA 3UKHA 2EQ9A 4GAVA 2CVJA 1TRBA 1YQ3A 2OAMA 1V59A 3GDPA 4K5RA 4U8LA 2EQ6A 5HHFA 1PJ5A 3SFEA 2WDQA 1D5TA 3K7MX 4ICYA 4NWZA 5EOWA 4AP3A 3NTAA 3CN8A 3B6DA 4IA6A 4UDQA 2V6OA 2YAUA 3L8KA 3UKQA 1EL7A 1NG4A 4YSZA 3ALJA 5IQ4A 3FMWA 1JRYA 4A65A 1KNRA 1ZY8A 4TLXA 3RP8A 1S2QA 3QSEA 4GRTA 2BRAA 5BUKA 2CULA 3RNMA 2Y6QA 3GD3A 3ITJA 2AQJA 2JKCA 2ZBWA 3NYFA 2XFOA 2C3CA 2ACZA 2A89A 2WOVA 3SXIA 4IV9A 3GMBA 4NEVA 4GAPA 1O95A 3AEDA 3C4NA 1TDNA 1PXBA 3NTDA 2YR4A 4G6GA 3B3RA 3NKSA 3S61A 2YQUA 4H4SA 4B69A 4YSYA 2GR3A 4OPDA 3D1CA 4N9XA 1GTEA 1MOKA 1KSUA 1KF6A 2GVCA 3RP6A 2YLSA 2XDOA 3PS9A 4G9KA 4P9SA 5JCLA 2XLPA 1SEZA 1OJCA 2WOWA 3SX6A 5TR3A 5U25A 2B7RA 5CKUA 2BABA 2TPRA 1N4VA 2RGJA 1CJ3A 4Y4NA 3IHGA 2VOUA 2WETA 2C66A 1PBCA 3LZXA 2O9ZA 3CGCA 4OPLA 1PBDA 1BKWA 1S2YA 3P9UA 3QFAA 4BURA 1D4EA 2FJBA 2X99A 2GAGB 4NTDA 3ISHA 4GR1A 4AT0A 1OJAA 4PAAA 1GRAA 2YM1A 4OPCA 2WP9A 5KMRA 1PS9A 2VVMA 1TDFA 4C74A 3ZYXA 3EAOA 4D03A 2XVIA 5M0ZA 1ZX9A 4USRA 4BJZA 5L46A 4Z24A 4H4UA 1ZKQA 1PXAA 4H2RA 4J33A 1DJNA 2FBWA 2RGHA 1COYA 1TDEA 5HY5A 1F8RA 4G74A 5KMSA 3DGHA 2BK5A 1M64A 3SZCA 2C7GA 2R45A 3IHMA 1VG0A 4EMIA 1NAAA 3NG7X 4GUVA 1LJ1A 3NYCA 3UTGA 3HYXA 1LPFA 3T2YA 5HXIA 3BHKA 2WPFA 4NEWA 2YM2A 4GF7A 3T0KA 3AE8A 1VG9A 1ZP0A 4TM1A 1BWCA 4U2SA 1B5QA 1ONFA 1X31B 2R4JA 1O94A 1QLBA 1CJ2A 2B7SA 2WHDA 4USQA 1KSSA 3AWIA 3ICSA 2H89A 1H6VA 1PXCA 2XLTA 5IQ1A 4BV6A 4A5LA 4JNQA 3EF6A 1VRQB 1MO9A 4XWZA 4E0VA 1QJDA 4CCRA 1DOCA 2OLNA 2X8HA 1FOHA 4NNJA 1L9DA 4YKGA 2BXSA 2XVEA 1MXTA 1JU2A 4Y4LA 5FMHA 3UTEA 1ZOYA 1Y56A 1EL5A 2R0PA 3AE9A 3GWFA 2GR0A 1ZOVA 3DA1A 5BVAA 4YTPA 2EQ8A 2Z5YA 2JBVA 4AT2A 2A8XA 3DJDA 3AD7B 4U8PA 2BC0A 2ZZCA 3AECA 4EQRA 1YKJA 4B68A 4U8OA 1YQ4A 2C70A 3LZWA 2DKIA 4B1BA 3CNSA 4UDRA 3UKLA 3NK2X 4A6NB 4A6NA 4YWOA 2YG5A 1D7LA 2CFYA 2C75A 2X8CA 4PABA 3ALLA 5CQFA 5KVHA 5KVIA 2WP6A 1LV0A 3F8PA 2BXRA 4BK3A 4H50A 1HYUA 2JB3A 3UOYA 4II2A 4EQSA 2BK4A 4BJYA 5FS9A 2OLOA 2GMJA 3AEEA 1NHSA 3L1RA 4CBQA 5EB4A 3T14A 4EMJA 4J31A 3AE7A 2C73A 1P2EA 3AD8B 1L9EA 1PBBA 1Q9IA 4KPRA 3M0OA 5C2TA 3AYLA 1K0LA 3GYXA 1NEKA 4EQXA 3P4RA 1DODA 2YLTA 4D04A 3FPZA 3M13A 1XDIA 2VVLA 4X4JA 5KOWA 2NVKX 3EPTA 4JY2A 2XFQA 3NYEA 1ZK7A 3G5QA 3DK4A 2DKHA 2ZZBA 3ICRA 4A9WA 3VR9A 2BS3A 3E1TA 3AEGA 3H8LA 3T2KA 4G73A 3S5WA 4H7UA 4HB9A 2WDRA 1NPXA 3I6DA 3T2ZA 3VRDB 4B67A 4JN9A 4OPTA 1Q1RA 3CGDA 3ICTA 3QVPA 2JB1A 1BF3A 1RYIA 1EL8A 2BCGG 1CJCA 1K0JA 3C96A 4H4VA 2QA2A 3URHA 1D4DA 4H2QA 4FK1A 2C76A 1PDHA 2JK6A 4FX9A 4WX1A 4C5OA 2UZZA 3BHFA 3NT6A 3PVCA 3DK9A 2BRYA 2BS4A 3NNEA 1JRZA 4CNJA 3VRAA 4M52A 1ZMCA 4O5QA 1K0IA 4NZHA 2YG7A 5U1OA 1K4QA 1GXFA 1O5WA 4X9NA 3Q6JA 2EQ7A 2Q7VA 2WS3A 3FG2P 2C65A 4YTMA 3LOVA 1E7PA 1GETA 3QJ4A 3DJEA 5J7XA 4Z43A 4FDCB 1N4UA 1DOBA 4B65A 1FEAA 1GRFA 3T37A 4EMWA 4NTEA 1F3PA 4OVIA 3AE6A 2XFPA 4TM3A 3BI5A 2B76A 2XFUA 2WOIA 4EIPA 2BYBA 3GRTA 1XANA 3RHAA 3KD9A 4II3A 1KFYA 1RSGA 2YVGA 3BI4A 1N1PA 4ZN0A 4U8NA 2PHHA 1ZMDA 3KPKA 2BK3A 3BNUA 5KNLA 3AE4A 3G5SA 2B9XA 1EL9A 3IF9A 1OJ9A 1PHHA 2Q6UA 1GPEA 2X50A 2R4EA 2YLRA 4TM0A 3V3OA 2GH5A 4CY6A 4FK1C 1XHCA 1NHRA 2GQFA 1YQZA 4A7AA 5EBKA 1CF3A 4GDPA 1H81A 4H2PA 4K8DA 1JRXA 1OJDA 1E6EA 1B37A 1E1KA 4H2NA 3HZLA 3CNPA 1H7WA 2APGA 3ADAB 5ER0A 1NG3A 2OALA 3QVRA 3V3NA 2GQWA 3SM8A 2XLRA 3GYJA 1M6IA 1NENA 3KLJA 4DGKA 1LQTA 2YG3A 1H83A 4H4ZA 3DH9A 3CTYA 2ARDA 2GR1A 1GRBA 2XVFA 1TYTA 1GNDA 3ATRA 1JEHA 1GTHA 1W4XA 1Y56B 3F8DA 4HA6A 2GR2A 4ADWA 1GEUA 3NK0X 1DNCA 3G5RA 3SYIA 3SZ0A 2V60A 2WP5A 1JNZA 2WDVA 4H4QA 2XCGA 1IUVA 4ECHA 3LXDA 2E1MA 2IVDA 1DOEA 4K5SA 1NHQA 2QCUA 5FS7A 3IWAA 2WU2A 1E1NA 2I0ZA 2VQ7A 2JAEA 3AEBA 3P4QA 1Q1WA 1Y0PA 5U63A 2BCPA 3AE3A 2AR8A 3QFBA 5EB5A 2CDUA 1TDKA 4CNKA 5KXJA 4LIIA 2AAQA 4BK1A 5HYMA 3CGEA 2ZZ0A 4Y4MA 2J3NA 4Z2RA 2IVEA 1AOGA 2YG6A 3GRSA 4IVMB 4UDPA 1D4CA 3HYWA 4CRTA 1LQUA 4Z26A 1GESA 4J36A 3RP7A 2V3AA 2R46A 3VRBA 2C3DA 4U2LA 4OPGA 1GRTA 5IPYA 2WESA 3UOZA 1S3EA 4I59A 4BK2A 2NPXA 4RG4A 3K7TA 4UP3A 3DMEA 4H4RA 2R0GA 3CGBA 4JY3A 3GD4A 4GDEA 4X9MA 4EM4A 1RP0A 5JCKA 3AE5A 2YG4A 1JNRA 4K22A 4H4PA 5JCNA 4IVOB 4C77A 5FS6A 1PN0A 1F8WA 1CC2A 4H4XA 1PBFA 4DSHA 4JDRA 3CPJG 4XWRA 4REKA 4B63A 1TYPA 4U8JA 4U8IA 2R9ZA 3EANA 1FCDA 5BULA 4A99A 3NIXA 1L0VA 3BNMA 4U8MA 1E39A 1GSNA 3K7QX 4H4WA 1EBDA 3HYVA 2VRMA 3O0HA 4H4TA 3NHOX 2JB2A 1VQWA 5LV9A 3AEAA 3GWDA 2HQMA 4XXGA 1NDAA 2BS2A 2V3BA 1IUSA 3NH3X 1CC4A 4TLZA 2V61A 2BC1A 3UTFA 2X3NA 4AOXA 1CC6A 3AEFA 1S3BA 1LVLA 5FS8A 3CIRA 2VRLA 1D7YA 2XLUA 2VQBA 1H84A 1L9CA 5GSNA 5C3JA 4U8KA 3F8RA 3P4SA 2XFNA 2VVLG 1CHUA 4A79A 2QAEA 3GYIA 2WEUA 3COXA 1IUUA 1FL2A 3NLCA 3II4A 1YY5A 3ALMA 5JCIA 4ZCDA 2XVHA 2YLZA 1PJ6A 2X8GA 4NTCA 4EM3A 1PBEA 2E4GA 4YXDA 3OZ2A 5KRQA 3LJPA 2XVJA 3LADA 5DBJA 3AXBA 3NK1X 3NRNA 3GSIA 4G6HA 3V76A 1QO8A 4YSHA 3DK8A 3AE2A 2QA1A 4JQ9A 1IJHA 1XPQA 3QSSA 2GRTA 4LU6A 4OPIA 1NHPA 2E5VA 1KDGA 1H7XA 1N4WA 1GREA 3H4KA 3LB8A 3UP4A 4Z2TA 2PYXA 1LTXR 3VR8A 1ELIA 4MJWA 4CY8A 3JSKA 5KOXA 2FJDA 3AB1A 3SY4A 3UOVA 3UKAA 4Z25A 1B4VA 3SFDA 3DJJA 3ATQA 2IIDA 2YLXA 5BRTA 2TMDA 2YVFA 4LA1A 2FJAA 1IUTA 1CL0A 1IUXA 1JOAA 2WU5A 5KMQA 4EIQA 1GV4A 1CBOA 3CNJA 2W0HA 1FEBA 4RG3A 1BGNA 2WPCA 5M10A 4KX6A 3P1WA 3I3LA 1B8SA 4TM4A 3T31A 4DNAA 4I58A 2C67A 2GF3A 3IC9A 4B64A 1PJ7A 2GAHB 2Q0LA 3SZWA 2FJEA 3BI2A 4CCQA 1Z6LA 5KMPA 3AYJA 1ZDLA 2B9YA 2BA9A 2WBAA 3UOXA 3UTHA 2XLSA 2GV8A 4YKFA 3SQPA 4OCGA 3SZFA 3OC4A 3K30A 2B9WA 2V5ZA 1GT8A 2Q0KA 3GMCA 2RABA 1P2HA 1CJ4A 2WQYA 4J2WA 3FIMB 1OJTA 3D8XA 3DGZA 4B66A 2OA1A 3M12A 5GRTA 4AOSA 3KU9A 3CNDA 4WCTA 1BGJA 2F5ZA 3KPFA 5KWFA 2GB0A 1REOA 2GEWA 4Z2UA 4Z44A 3R9UA 1GRGA 3C4AA 1DXLA 2YR6A 3Q9TA 4JNAA 3REDA 5JCMA 4K2XA 1BZLA 2XYOA 2H88A 1E1LA 3UCLA 2C4CA 4H4YA 1UKVG 3QSMA 1E1MA 3VQRA 3CNTA 2VZ2A 2RGOA 3ABVA 4J34A 1F8SA 4APNA 2R0CA 4J57A 3KKJA 3NN0X 3CMMA 4IA5A 2C72A 4OPUA 3GDNA 4RSLA 4C3XA 3KA7A 4YSXA 3ZDNA 3CPHG 3AE1A 4U2TA 4J56A 4GCMA 3FBSA 4O5UA 2YVJA 3H8IA 3DJGX 3KVEA 2C64A 1GALA 1GRHA 2Z5XA 2WPEA 3NGCX 3CPIG 3SGLA 2YWLA 2BACA 2YLWA 1H82A 3UKFA 2Y6RA 1GERA 4ZCCA 1KNPA 4EQWA 4YTNA 5J60A 3UKPA 3UP5A 1VDCA 4YT0A 3UKKA 2GMHA 4C3YA 1FECA 2YR5A 3WE0A 1TDOA
chains in the Genus database with same CATH topology
3PO7A 1H86A 2A87A 1GOSA 3AD9B 1F6MA 3AYIA 4DSGA 4K7ZA 4AP1A 1IUWA 1DJQA 3NN6X 3P4PA 3UKHA 2EQ9A 4GAVA 2CVJA 1TRBA 1YQ3A 2OAMA 1V59A 3GDPA 4K5RA 4U8LA 2EQ6A 5HHFA 1PJ5A 3SFEA 2WDQA 1D5TA 3K7MX 4ICYA 4NWZA 5EOWA 4AP3A 3NTAA 3CN8A 3B6DA 4IA6A 4UDQA 2V6OA 2YAUA 3L8KA 3UKQA 1EL7A 1NG4A 4YSZA 3ALJA 5IQ4A 3FMWA 1JRYA 4A65A 1KNRA 1ZY8A 4TLXA 3RP8A 1S2QA 3QSEA 4GRTA 2BRAA 5BUKA 2CULA 3RNMA 2Y6QA 3GD3A 3ITJA 2AQJA 2JKCA 2ZBWA 3NYFA 2XFOA 2C3CA 2ACZA 2A89A 2WOVA 3SXIA 3GMBA 4IV9A 4NEVA 4GAPA 1O95A 3AEDA 3C4NA 1TDNA 1PXBA 3NTDA 2YR4A 4G6GA 3B3RA 3NKSA 3S61A 2YQUA 4H4SA 4B69A 4YSYA 2GR3A 4OPDA 3D1CA 4N9XA 1GTEA 1MOKA 1KSUA 1KF6A 2GVCA 3RP6A 2YLSA 2XDOA 3PS9A 4G9KA 4P9SA 5JCLA 2XLPA 1SEZA 1OJCA 2WOWA 3SX6A 5TR3A 5U25A 2B7RA 5CKUA 2BABA 2TPRA 1N4VA 2RGJA 1CJ3A 4Y4NA 3IHGA 2VOUA 2WETA 2C66A 1PBCA 3LZXA 2O9ZA 3CGCA 4OPLA 1PBDA 1BKWA 1S2YA 3P9UA 3QFAA 4BURA 1D4EA 2FJBA 2X99A 2GAGB 4NTDA 3ISHA 4GR1A 4AT0A 1OJAA 4PAAA 1GRAA 2YM1A 4OPCA 2WP9A 5KMRA 1PS9A 2VVMA 1TDFA 4C74A 3ZYXA 3EAOA 4D03A 2XVIA 5M0ZA 1ZX9A 4USRA 4BJZA 5L46A 4Z24A 4H4UA 1ZKQA 1PXAA 4H2RA 4J33A 1DJNA 2FBWA 2RGHA 1COYA 1TDEA 5HY5A 1F8RA 4G74A 5KMSA 3DGHA 2BK5A 1M64A 3SZCA 2C7GA 2R45A 3IHMA 1VG0A 4EMIA 1NAAA 3NG7X 4GUVA 1LJ1A 3NYCA 3UTGA 3HYXA 1LPFA 3T2YA 5HXIA 3BHKA 2WPFA 4NEWA 2YM2A 4GF7A 3T0KA 3AE8A 1VG9A 1ZP0A 4TM1A 1BWCA 4U2SA 1B5QA 1ONFA 1X31B 2R4JA 1O94A 1QLBA 1CJ2A 2B7SA 2WHDA 4USQA 1KSSA 3AWIA 3ICSA 2H89A 1H6VA 1PXCA 2XLTA 5IQ1A 4BV6A 4A5LA 4JNQA 3EF6A 1VRQB 1MO9A 4XWZA 4E0VA 1QJDA 4CCRA 1DOCA 2OLNA 2X8HA 1FOHA 4NNJA 1L9DA 4YKGA 2BXSA 2XVEA 1MXTA 1JU2A 4Y4LA 5FMHA 3UTEA 1ZOYA 1Y56A 1EL5A 2R0PA 3AE9A 3GWFA 2GR0A 1ZOVA 3DA1A 5BVAA 4YTPA 2EQ8A 2Z5YA 2JBVA 4AT2A 2A8XA 3DJDA 3AD7B 4U8PA 2BC0A 2ZZCA 3AECA 4EQRA 1YKJA 4B68A 4U8OA 1YQ4A 2C70A 3LZWA 2DKIA 4B1BA 3CNSA 4UDRA 3UKLA 3NK2X 4A6NB 4A6NA 4YWOA 2YG5A 1D7LA 2CFYA 2C75A 2X8CA 4PABA 3ALLA 5CQFA 5KVHA 5KVIA 2WP6A 1LV0A 3F8PA 2BXRA 4BK3A 4H50A 1HYUA 2JB3A 3UOYA 4II2A 4EQSA 2BK4A 4BJYA 5FS9A 2OLOA 2GMJA 3AEEA 1NHSA 3L1RA 4CBQA 5EB4A 3T14A 4EMJA 4J31A 3AE7A 2C73A 1P2EA 3AD8B 1L9EA 1PBBA 1Q9IA 4KPRA 3M0OA 5C2TA 3AYLA 1K0LA 3GYXA 1NEKA 4EQXA 3P4RA 1DODA 2YLTA 4D04A 3FPZA 3M13A 1XDIA 2VVLA 4X4JA 5KOWA 2NVKX 3EPTA 4JY2A 2XFQA 3NYEA 1ZK7A 3G5QA 3DK4A 2DKHA 2ZZBA 3ICRA 3WE0A 4A9WA 3VR9A 2BS3A 3E1TA 3AEGA 3H8LA 3T2KA 4G73A 3S5WA 4H7UA 4HB9A 2WDRA 1NPXA 3I6DA 3T2ZA 3VRDB 4B67A 4JN9A 4OPTA 1Q1RA 3CGDA 3ICTA 3QVPA 2JB1A 1BF3A 1RYIA 1EL8A 2BCGG 1CJCA 1K0JA 3C96A 4H4VA 2QA2A 3URHA 1D4DA 4H2QA 4FK1A 2C76A 1PDHA 2JK6A 4FX9A 4WX1A 4C5OA 2UZZA 3BHFA 3NT6A 3PVCA 3DK9A 2BRYA 2BS4A 3NNEA 1JRZA 4CNJA 3VRAA 4M52A 1ZMCA 4O5QA 1K0IA 4NZHA 2YG7A 5U1OA 1K4QA 1GXFA 1O5WA 4X9NA 3Q6JA 2EQ7A 2Q7VA 2WS3A 3FG2P 2C65A 4YTMA 3LOVA 1E7PA 1GETA 3QJ4A 3DJEA 5J7XA 4Z43A 4FDCB 1N4UA 1DOBA 4B65A 1FEAA 1GRFA 3T37A 4EMWA 4NTEA 1F3PA 4OVIA 3AE6A 2XFPA 4TM3A 3BI5A 2B76A 2XFUA 2WOIA 4EIPA 2BYBA 3GRTA 1XANA 3RHAA 3KD9A 4II3A 1KFYA 1RSGA 2YVGA 3BI4A 1N1PA 4ZN0A 4U8NA 2PHHA 1ZMDA 3KPKA 2BK3A 3BNUA 5KNLA 3AE4A 3G5SA 2B9XA 1EL9A 3IF9A 1OJ9A 1PHHA 2Q6UA 1GPEA 2X50A 2R4EA 2YLRA 4TM0A 3V3OA 2GH5A 4CY6A 4FK1C 1XHCA 1NHRA 2GQFA 1YQZA 4A7AA 5EBKA 1CF3A 4GDPA 1H81A 4H2PA 4K8DA 1JRXA 1OJDA 1E6EA 1B37A 1E1KA 4H2NA 3HZLA 3CNPA 1H7WA 2APGA 3ADAB 5ER0A 1NG3A 2OALA 3QVRA 3V3NA 2GQWA 3SM8A 2XLRA 3GYJA 1M6IA 1NENA 3KLJA 4DGKA 1LQTA 2YG3A 1H83A 4H4ZA 3DH9A 3CTYA 2ARDA 2GR1A 1GRBA 2XVFA 1TYTA 1GNDA 3ATRA 1JEHA 1GTHA 1W4XA 1Y56B 3F8DA 4HA6A 2GR2A 4ADWA 1GEUA 3NK0X 1DNCA 3G5RA 3SYIA 3SZ0A 2V60A 2WP5A 1JNZA 2WDVA 4H4QA 2XCGA 1IUVA 4ECHA 3LXDA 2E1MA 2IVDA 1DOEA 4K5SA 1NHQA 2QCUA 5FS7A 3IWAA 2WU2A 1E1NA 2I0ZA 2VQ7A 2JAEA 3AEBA 3P4QA 1Q1WA 1Y0PA 5U63A 2BCPA 3AE3A 2AR8A 3QFBA 5EB5A 2CDUA 1TDKA 4CNKA 5KXJA 4LIIA 2AAQA 4BK1A 5HYMA 3CGEA 2ZZ0A 4Y4MA 2J3NA 4Z2RA 2IVEA 1AOGA 2YG6A 3GRSA 4IVMB 4UDPA 1D4CA 3HYWA 4CRTA 1LQUA 4Z26A 1GESA 4J36A 3RP7A 2V3AA 2R46A 3VRBA 2C3DA 4U2LA 4OPGA 1GRTA 5IPYA 2WESA 3UOZA 1S3EA 4I59A 4BK2A 2NPXA 4RG4A 3K7TA 4UP3A 3DMEA 4H4RA 2R0GA 3CGBA 4JY3A 3GD4A 4GDEA 4X9MA 4EM4A 1RP0A 5JCKA 3AE5A 2YG4A 1JNRA 4K22A 4H4PA 5JCNA 4IVOB 4C77A 5FS6A 1PN0A 1F8WA 1CC2A 4H4XA 1PBFA 4DSHA 4JDRA 3CPJG 4XWRA 4REKA 4B63A 1TYPA 4U8JA 4U8IA 2R9ZA 3EANA 1FCDA 5BULA 4A99A 3NIXA 1L0VA 3BNMA 4U8MA 1E39A 1GSNA 3K7QX 4H4WA 1EBDA 3HYVA 2VRMA 3O0HA 4H4TA 3NHOX 2JB2A 1VQWA 5LV9A 3AEAA 3GWDA 2HQMA 4XXGA 1NDAA 2BS2A 2V3BA 1IUSA 3NH3X 1CC4A 4TLZA 2V61A 2BC1A 3UTFA 2X3NA 4AOXA 1CC6A 3AEFA 1S3BA 1LVLA 5FS8A 3CIRA 2VRLA 1D7YA 2XLUA 2VQBA 1H84A 1L9CA 5GSNA 5C3JA 4U8KA 3F8RA 3P4SA 2XFNA 2VVLG 1CHUA 4A79A 2QAEA 3GYIA 2WEUA 3COXA 1IUUA 1FL2A 3NLCA 3II4A 1YY5A 3ALMA 5JCIA 4ZCDA 2XVHA 2YLZA 1PJ6A 2X8GA 4NTCA 4EM3A 1PBEA 2E4GA 4YXDA 3OZ2A 5KRQA 3LJPA 2XVJA 3LADA 5DBJA 3AXBA 3NK1X 3NRNA 3GSIA 4G6HA 3V76A 1QO8A 4YSHA 3DK8A 3AE2A 2QA1A 4JQ9A 1IJHA 1XPQA 3QSSA 2GRTA 4LU6A 4OPIA 1NHPA 2E5VA 1KDGA 1H7XA 1N4WA 1GREA 3H4KA 3LB8A 3UP4A 4Z2TA 2PYXA 1LTXR 3VR8A 1ELIA 4MJWA 4CY8A 3JSKA 5KOXA 2FJDA 3AB1A 3SY4A 3UOVA 3UKAA 4Z25A 1B4VA 3SFDA 3DJJA 3ATQA 2IIDA 2YLXA 5BRTA 2TMDA 2YVFA 4LA1A 2FJAA 1IUTA 1CL0A 1IUXA 1JOAA 2WU5A 5KMQA 4EIQA 1GV4A 1CBOA 3CNJA 2W0HA 1FEBA 4RG3A 1BGNA 2WPCA 5M10A 4KX6A 3P1WA 3I3LA 1B8SA 4TM4A 3T31A 4DNAA 4I58A 2C67A 2GF3A 3IC9A 4B64A 1PJ7A 2GAHB 2Q0LA 3SZWA 2FJEA 3BI2A 4CCQA 1Z6LA 5KMPA 3AYJA 1ZDLA 2B9YA 2BA9A 2WBAA 3UOXA 3UTHA 2XLSA 2GV8A 4YKFA 3SQPA 4OCGA 3SZFA 3OC4A 3K30A 2V5ZA 1GT8A 2B9WA 2Q0KA 3GMCA 2RABA 1P2HA 1CJ4A 2WQYA 4J2WA 3FIMB 1OJTA 3D8XA 3DGZA 4B66A 2OA1A 3M12A 5GRTA 4AOSA 3KU9A 3CNDA 4WCTA 1BGJA 2F5ZA 3KPFA 5KWFA 2GB0A 1REOA 2GEWA 4Z2UA 4Z44A 3R9UA 1GRGA 3C4AA 1DXLA 2YR6A 3Q9TA 4JNAA 3REDA 5JCMA 4K2XA 1BZLA 2XYOA 2H88A 1E1LA 3UCLA 2C4CA 4H4YA 1UKVG 3QSMA 1E1MA 3VQRA 3CNTA 2VZ2A 2RGOA 3ABVA 4J34A 1F8SA 4APNA 2R0CA 4J57A 3KKJA 3NN0X 3CMMA 4IA5A 2C72A 4OPUA 3GDNA 4RSLA 4C3XA 3KA7A 4YSXA 3ZDNA 3CPHG 3AE1A 4U2TA 4J56A 4GCMA 3FBSA 4O5UA 2YVJA 3H8IA 3DJGX 3KVEA 2C64A 1GALA 1GRHA 2Z5XA 2WPEA 3NGCX 3CPIG 3SGLA 2YWLA 2YLWA 1H82A 3UKFA 2Y6RA 1GERA 4ZCCA 1KNPA 4EQWA 4YTNA 5J60A 3UKPA 3UP5A 1VDCA 4YT0A 3UKKA 2GMHA 4C3YA 1FECA 2YR5A 2BACA 1TDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO7 A;  1H86 A;  2A87 A;  1GOS A;  3AD9 B;  1F6M A;  3AYI A;  4DSG A;  4K7Z A;  4AP1 A;  1IUW A;  1DJQ A;  3NN6 X;  3P4P A;  3UKH A;  2EQ9 A;  2CVJ A;  1TRB A;  1YQ3 A;  2OAM A;  1V59 A;  3GDP A;  4K5R A;  4U8L A;  2EQ6 A;  5HHF A;  1PJ5 A;  3SFE A;  2WDQ A;  1D5T A;  3K7M X;  4ICY A;  5EOW A;  4AP3 A;  3NTA A;  3CN8 A;  3B6D A;  4IA6 A;  4UDQ A;  2V6O A;  2YAU A;  3L8K A;  3UKQ A;  1EL7 A;  1NG4 A;  4YSZ A;  3ALJ A;  5IQ4 A;  3FMW A;  1JRY A;  4A65 A;  1KNR A;  1ZY8 A;  4TLX A;  3RP8 A;  1S2Q A;  3QSE A;  4GRT A;  5BUK A;  2CUL A;  3RNM A;  2Y6Q A;  3GD3 A;  3ITJ A;  2AQJ A;  2JKC A;  2ZBW A;  3NYF A;  2XFO A;  2C3C A;  2ACZ A;  2A89 A;  2WOV A;  3GMB A;  4IV9 A;  4NEV A;  1O95 A;  3AED A;  3C4N A;  1TDN A;  1PXB A;  3NTD A;  2YR4 A;  3S61 A;  3B3R A;  3NKS A;  4B69 A;  2YQU A;  4H4S A;  4YSY A;  5HY5 A;  2GR3 A;  4OPD A;  3D1C A;  4N9X A;  1GTE A;  1MOK A;  1KSU A;  1KF6 A;  2GVC A;  3RP6 A;  2YLS A;  2XDO A;  3PS9 A;  5JCL A;  4P9S A;  2XLP A;  1SEZ A;  1OJC A;  2WOW A;  5TR3 A;  5U25 A;  2B7R A;  5CKU A;  2BAB A;  2TPR A;  1N4V A;  2RGJ A;  1CJ3 A;  4Y4N A;  3IHG A;  2VOU A;  2WET A;  2C66 A;  1PBC A;  3LZX A;  2O9Z A;  3CGC A;  4OPL A;  1PBD A;  1BKW A;  1S2Y A;  3P9U A;  3QFA A;  4BUR A;  1D4E A;  2FJB A;  2X99 A;  2GAG B;  4NTD A;  3ISH A;  4GR1 A;  4AT0 A;  1OJA A;  4PAA A;  1GRA A;  2YM1 A;  4OPC A;  2WP9 A;  1PS9 A;  2VVM A;  1TDF A;  4C74 A;  3ZYX A;  3EAO A;  4D03 A;  2XVI A;  5M0Z A;  1ZX9 A;  4USR A;  4BJZ A;  5L46 A;  4Z24 A;  4H4U A;  1ZKQ A;  1PXA A;  4H2R A;  4J33 A;  1DJN A;  2FBW A;  2RGH A;  1COY A;  1TDE A;  1F8R A;  3DGH A;  2BK5 A;  1M64 A;  2C7G A;  2R45 A;  3IHM A;  1VG0 A;  4EMI A;  1NAA A;  3NG7 X;  4GUV A;  1LJ1 A;  3NYC A;  3UTG A;  1LPF A;  5HXI A;  3BHK A;  2WPF A;  4NEW A;  2YM2 A;  4GF7 A;  3AE8 A;  1VG9 A;  1ZP0 A;  4TM1 A;  1BWC A;  4U2S A;  1B5Q A;  1ONF A;  1X31 B;  2R4J A;  1O94 A;  1QLB A;  1CJ2 A;  2B7S A;  2WHD A;  4USQ A;  1KSS A;  3AWI A;  3ICS A;  2H89 A;  1H6V A;  1PXC A;  2XLT A;  5IQ1 A;  4BV6 A;  4A5L A;  4JNQ A;  3EF6 A;  1VRQ B;  1MO9 A;  4XWZ A;  4E0V A;  1QJD A;  4CCR A;  1DOC A;  2OLN A;  2X8H A;  1FOH A;  4YKG A;  1L9D A;  2BXS A;  2XVE A;  1MXT A;  1JU2 A;  4Y4L A;  5FMH A;  3UTE A;  1ZOY A;  1Y56 A;  1EL5 A;  2R0P A;  3AE9 A;  3GWF A;  2GR0 A;  1ZOV A;  3DA1 A;  5BVA A;  4YTP A;  2EQ8 A;  2Z5Y A;  2JBV A;  4AT2 A;  2A8X A;  3DJD A;  3AD7 B;  4U8P A;  2BC0 A;  2ZZC A;  3AEC A;  4EQR A;  1YKJ A;  4B68 A;  4U8O A;  1YQ4 A;  2C70 A;  3LZW A;  2DKI A;  4B1B A;  3CNS A;  4UDR A;  3UKL A;  3NK2 X;  4A6N B;  4A6N A;  4YWO A;  2YG5 A;  1D7L A;  2CFY A;  2C75 A;  2X8C A;  4PAB A;  3ALL A;  5CQF A;  5KVH A;  5KVI A;  2WP6 A;  1LV0 A;  3F8P A;  2BXR A;  4BK3 A;  4H50 A;  1HYU A;  2JB3 A;  3UOY A;  4EQS A;  2BK4 A;  4BJY A;  5FS9 A;  2OLO A;  2GMJ A;  3AEE A;  1NHS A;  3L1R A;  4CBQ A;  5EB4 A;  4EMJ A;  4J31 A;  3AE7 A;  2C73 A;  1P2E A;  3AD8 B;  1L9E A;  1PBB A;  1Q9I A;  4KPR A;  3M0O A;  5C2T A;  3AYL A;  1K0L A;  1NEK A;  4EQX A;  3P4R A;  1DOD A;  2YLT A;  4D04 A;  3FPZ A;  3M13 A;  1XDI A;  2VVL A;  4X4J A;  5KOW A;  2NVK X;  3EPT A;  4JY2 A;  2XFQ A;  3NYE A;  1ZK7 A;  3G5Q A;  3DK4 A;  2DKH A;  2ZZB A;  3ICR A;  3WE0 A;  4A9W A;  3VR9 A;  2BS3 A;  3E1T A;  3AEG A;  3H8L A;  3S5W A;  4H7U A;  4HB9 A;  2WDR A;  1NPX A;  3I6D A;  4B67 A;  3VRD B;  4JN9 A;  4OPT A;  1Q1R A;  3CGD A;  3ICT A;  3QVP A;  2JB1 A;  1BF3 A;  1RYI A;  1EL8 A;  2BCG G;  1CJC A;  1K0J A;  3C96 A;  4H4V A;  2QA2 A;  3URH A;  1D4D A;  4H2Q A;  4FK1 A;  2C76 A;  1PDH A;  2JK6 A;  4FX9 A;  4WX1 A;  4C5O A;  2UZZ A;  3BHF A;  3NT6 A;  3PVC A;  3DK9 A;  2BS4 A;  3NNE A;  1JRZ A;  4CNJ A;  3VRA A;  4M52 A;  1ZMC A;  4O5Q A;  1K0I A;  4NZH A;  2YG7 A;  5U1O A;  1K4Q A;  1GXF A;  1O5W A;  4X9N A;  3Q6J A;  2EQ7 A;  2Q7V A;  2WS3 A;  3FG2 P;  2C65 A;  4YTM A;  3LOV A;  1E7P A;  1GET A;  3QJ4 A;  3DJE A;  5J7X A;  4Z43 A;  4FDC B;  1N4U A;  1DOB A;  4B65 A;  1FEA A;  1GRF A;  3T37 A;  4EMW A;  4NTE A;  1F3P A;  4OVI A;  3AE6 A;  2XFP A;  4TM3 A;  3BI5 A;  2B76 A;  2XFU A;  2WOI A;  4EIP A;  2BYB A;  3GRT A;  1XAN A;  3RHA A;  3KD9 A;  1KFY A;  1RSG A;  2YVG A;  3BI4 A;  1N1P A;  4ZN0 A;  4U8N A;  2PHH A;  1ZMD A;  2BK3 A;  3BNU A;  3AE4 A;  3G5S A;  2B9X A;  1EL9 A;  3IF9 A;  1OJ9 A;  1PHH A;  2Q6U A;  1GPE A;  2X50 A;  2R4E A;  2YLR A;  4TM0 A;  3V3O A;  2GH5 A;  4CY6 A;  4FK1 C;  1XHC A;  1NHR A;  2GQF A;  1YQZ A;  4A7A A;  5EBK A;  1CF3 A;  4GDP A;  1H81 A;  4H2P A;  4K8D A;  1JRX A;  1OJD A;  1E6E A;  1B37 A;  1E1K A;  4H2N A;  3HZL A;  3CNP A;  1H7W A;  2APG A;  3ADA B;  5ER0 A;  1NG3 A;  2OAL A;  3QVR A;  3V3N A;  2GQW A;  3SM8 A;  2XLR A;  3GYJ A;  1M6I A;  1NEN A;  3KLJ A;  4DGK A;  1LQT A;  2YG3 A;  1H83 A;  4H4Z A;  3DH9 A;  3CTY A;  2ARD A;  2GR1 A;  1GRB A;  2XVF A;  1TYT A;  1GND A;  3ATR A;  1JEH A;  1GTH A;  1W4X A;  1Y56 B;  3F8D A;  4HA6 A;  2GR2 A;  4ADW A;  1GEU A;  3NK0 X;  1DNC A;  3G5R A;  2V60 A;  2WP5 A;  1JNZ A;  2WDV A;  4H4Q A;  2XCG A;  1IUV A;  4ECH A;  3LXD A;  2E1M A;  2IVD A;  1DOE A;  4K5S A;  1NHQ A;  2QCU A;  5FS7 A;  3IWA A;  2WU2 A;  1E1N A;  2I0Z A;  2VQ7 A;  2JAE A;  3AEB A;  3P4Q A;  1Q1W A;  1Y0P A;  5U63 A;  2BCP A;  3AE3 A;  2AR8 A;  3QFB A;  5EB5 A;  2CDU A;  1TDK A;  4CNK A;  5KXJ A;  4LII A;  2AAQ A;  4BK1 A;  5HYM A;  3CGE A;  2ZZ0 A;  4Y4M A;  2J3N A;  4Z2R A;  2IVE A;  1AOG A;  2YG6 A;  3GRS A;  4IVM B;  4UDP A;  1D4C A;  4CRT A;  1LQU A;  4Z26 A;  1GES A;  4J36 A;  3RP7 A;  2V3A A;  2R46 A;  3VRB A;  2C3D A;  4U2L A;  4OPG A;  1GRT A;  5IPY A;  2WES A;  3UOZ A;  1S3E A;  4I59 A;  4BK2 A;  2NPX A;  4RG4 A;  3K7T A;  4UP3 A;  3DME A;  4H4R A;  2R0G A;  3CGB A;  4JY3 A;  3GD4 A;  4GDE A;  4X9M A;  4EM4 A;  1RP0 A;  5JCK A;  3AE5 A;  2YG4 A;  1JNR A;  4K22 A;  4H4P A;  5JCN A;  4IVO B;  4C77 A;  5FS6 A;  1PN0 A;  1F8W A;  1CC2 A;  4H4X A;  1PBF A;  4DSH A;  4JDR A;  3CPJ G;  4XWR A;  4REK A;  4B63 A;  1TYP A;  4U8J A;  4U8I A;  2R9Z A;  3EAN A;  1FCD A;  5BUL A;  4A99 A;  3NIX A;  1L0V A;  3BNM A;  4U8M A;  1E39 A;  1GSN A;  3K7Q X;  4H4W A;  1EBD A;  2VRM A;  3O0H A;  4H4T A;  3NHO X;  2JB2 A;  1VQW A;  5LV9 A;  3AEA A;  3GWD A;  2HQM A;  4XXG A;  1NDA A;  2BS2 A;  2V3B A;  1IUS A;  3NH3 X;  1CC4 A;  4TLZ A;  2V61 A;  2BC1 A;  3UTF A;  2X3N A;  4AOX A;  1CC6 A;  3AEF A;  1S3B A;  1LVL A;  5FS8 A;  3CIR A;  2VRL A;  1D7Y A;  2XLU A;  2VQB A;  1H84 A;  1L9C A;  5GSN A;  5C3J A;  4U8K A;  3F8R A;  3P4S A;  2XFN A;  2VVL G;  1CHU A;  4A79 A;  2QAE A;  3GYI A;  2WEU A;  3COX A;  1IUU A;  1FL2 A;  3NLC A;  3II4 A;  1YY5 A;  3ALM A;  5JCI A;  4ZCD A;  2XVH A;  2YLZ A;  1PJ6 A;  2X8G A;  4NTC A;  4EM3 A;  1PBE A;  2E4G A;  4YXD A;  3OZ2 A;  5KRQ A;  3LJP A;  2XVJ A;  3LAD A;  5DBJ A;  3AXB A;  3NK1 X;  3NRN A;  3GSI A;  3V76 A;  1QO8 A;  4YSH A;  3DK8 A;  3AE2 A;  2QA1 A;  4JQ9 A;  1IJH A;  1XPQ A;  3QSS A;  2GRT A;  4LU6 A;  4OPI A;  1NHP A;  2E5V A;  1KDG A;  1H7X A;  1N4W A;  1GRE A;  3H4K A;  3LB8 A;  3UP4 A;  4Z2T A;  2PYX A;  1LTX R;  3VR8 A;  1ELI A;  4MJW A;  4CY8 A;  3JSK A;  5KOX A;  2FJD A;  3AB1 A;  3UOV A;  3UKA A;  4Z25 A;  1B4V A;  3SFD A;  3DJJ A;  3ATQ A;  2IID A;  2YLX A;  5BRT A;  2TMD A;  2YVF A;  4LA1 A;  2FJA A;  1IUT A;  1CL0 A;  1IUX A;  1JOA A;  2WU5 A;  4EIQ A;  1GV4 A;  1CBO A;  3CNJ A;  2W0H A;  1FEB A;  4RG3 A;  1BGN A;  2WPC A;  5M10 A;  4KX6 A;  3P1W A;  3I3L A;  1B8S A;  4TM4 A;  4DNA A;  4I58 A;  2C67 A;  2GF3 A;  3IC9 A;  4B64 A;  1PJ7 A;  2GAH B;  2Q0L A;  2FJE A;  3BI2 A;  4CCQ A;  1Z6L A;  3AYJ A;  1ZDL A;  2B9Y A;  2BA9 A;  2WBA A;  3UOX A;  3UTH A;  2XLS A;  2GV8 A;  4YKF A;  3SQP A;  4OCG A;  3OC4 A;  3K30 A;  2V5Z A;  1GT8 A;  2B9W A;  2Q0K A;  3GMC A;  2RAB A;  1P2H A;  1CJ4 A;  2WQY A;  4J2W A;  3FIM B;  1OJT A;  3D8X A;  3DGZ A;  4B66 A;  2OA1 A;  3M12 A;  5GRT A;  4AOS A;  3KU9 A;  3CND A;  4WCT A;  1BGJ A;  2F5Z A;  3KPF A;  5KWF A;  2GB0 A;  1REO A;  2GEW A;  4Z2U A;  4Z44 A;  3R9U A;  1GRG A;  3C4A A;  1DXL A;  2YR6 A;  3Q9T A;  4JNA A;  3RED A;  5JCM A;  4K2X A;  1BZL A;  2XYO A;  2H88 A;  1E1L A;  3UCL A;  4H4Y A;  1UKV G;  3QSM A;  1E1M A;  3VQR A;  3CNT A;  2VZ2 A;  2RGO A;  3ABV A;  4J34 A;  1F8S A;  4APN A;  2R0C A;  4J57 A;  3KKJ A;  3NN0 X;  4IA5 A;  2C72 A;  4OPU A;  3GDN A;  4RSL A;  4C3X A;  3KA7 A;  4YSX A;  3ZDN A;  3CPH G;  3AE1 A;  4U2T A;  4J56 A;  4GCM A;  3FBS A;  4O5U A;  2YVJ A;  3H8I A;  3DJG X;  3KVE A;  2C64 A;  1GAL A;  1GRH A;  2Z5X A;  2WPE A;  3NGC X;  3CPI G;  3SGL A;  2YWL A;  2YLW A;  1H82 A;  3UKF A;  2Y6R A;  1GER A;  4ZCC A;  1KNP A;  4EQW A;  4YTN A;  5J60 A;  3UKP A;  3UP5 A;  1VDC A;  4YT0 A;  3UKK A;  2GMH A;  4C3Y A;  1FEC A;  2YR5 A;  2BAC A;  1TDO A; 
#chains in the Genus database with same CATH topology
 3PO7 A;  1H86 A;  2A87 A;  1GOS A;  3AD9 B;  1F6M A;  3AYI A;  4DSG A;  4K7Z A;  4AP1 A;  1IUW A;  1DJQ A;  3NN6 X;  3P4P A;  3UKH A;  2EQ9 A;  4GAV A;  2CVJ A;  1TRB A;  1YQ3 A;  2OAM A;  1V59 A;  3GDP A;  4K5R A;  4U8L A;  2EQ6 A;  5HHF A;  1PJ5 A;  3SFE A;  2WDQ A;  1D5T A;  3K7M X;  4ICY A;  4NWZ A;  5EOW A;  4AP3 A;  3NTA A;  3CN8 A;  3B6D A;  4IA6 A;  4UDQ A;  2V6O A;  2YAU A;  3L8K A;  3UKQ A;  1EL7 A;  1NG4 A;  4YSZ A;  3ALJ A;  5IQ4 A;  3FMW A;  1JRY A;  4A65 A;  1KNR A;  1ZY8 A;  4TLX A;  3RP8 A;  1S2Q A;  3QSE A;  4GRT A;  2BRA A;  5BUK A;  2CUL A;  3RNM A;  2Y6Q A;  3GD3 A;  3ITJ A;  2AQJ A;  2JKC A;  2ZBW A;  3NYF A;  2XFO A;  2C3C A;  2ACZ A;  2A89 A;  2WOV A;  3SXI A;  4IV9 A;  3GMB A;  4NEV A;  4GAP A;  1O95 A;  3AED A;  3C4N A;  1TDN A;  1PXB A;  3NTD A;  2YR4 A;  4G6G A;  3B3R A;  3NKS A;  3S61 A;  2YQU A;  4H4S A;  4B69 A;  4YSY A;  2GR3 A;  4OPD A;  3D1C A;  4N9X A;  1GTE A;  1MOK A;  1KSU A;  1KF6 A;  2GVC A;  3RP6 A;  2YLS A;  2XDO A;  3PS9 A;  4G9K A;  4P9S A;  5JCL A;  2XLP A;  1SEZ A;  1OJC A;  2WOW A;  3SX6 A;  5TR3 A;  5U25 A;  2B7R A;  5CKU A;  2BAB A;  2TPR A;  1N4V A;  2RGJ A;  1CJ3 A;  4Y4N A;  3IHG A;  2VOU A;  2WET A;  2C66 A;  1PBC A;  3LZX A;  2O9Z A;  3CGC A;  4OPL A;  1PBD A;  1BKW A;  1S2Y A;  3P9U A;  3QFA A;  4BUR A;  1D4E A;  2FJB A;  2X99 A;  2GAG B;  4NTD A;  3ISH A;  4GR1 A;  4AT0 A;  1OJA A;  4PAA A;  1GRA A;  2YM1 A;  4OPC A;  2WP9 A;  5KMR A;  1PS9 A;  2VVM A;  1TDF A;  4C74 A;  3ZYX A;  3EAO A;  4D03 A;  2XVI A;  5M0Z A;  1ZX9 A;  4USR A;  4BJZ A;  5L46 A;  4Z24 A;  4H4U A;  1ZKQ A;  1PXA A;  4H2R A;  4J33 A;  1DJN A;  2FBW A;  2RGH A;  1COY A;  1TDE A;  5HY5 A;  1F8R A;  4G74 A;  5KMS A;  3DGH A;  2BK5 A;  1M64 A;  3SZC A;  2C7G A;  2R45 A;  3IHM A;  1VG0 A;  4EMI A;  1NAA A;  3NG7 X;  4GUV A;  1LJ1 A;  3NYC A;  3UTG A;  3HYX A;  1LPF A;  3T2Y A;  5HXI A;  3BHK A;  2WPF A;  4NEW A;  2YM2 A;  4GF7 A;  3T0K A;  3AE8 A;  1VG9 A;  1ZP0 A;  4TM1 A;  1BWC A;  4U2S A;  1B5Q A;  1ONF A;  1X31 B;  2R4J A;  1O94 A;  1QLB A;  1CJ2 A;  2B7S A;  2WHD A;  4USQ A;  1KSS A;  3AWI A;  3ICS A;  2H89 A;  1H6V A;  1PXC A;  2XLT A;  5IQ1 A;  4BV6 A;  4A5L A;  4JNQ A;  3EF6 A;  1VRQ B;  1MO9 A;  4XWZ A;  4E0V A;  1QJD A;  4CCR A;  1DOC A;  2OLN A;  2X8H A;  1FOH A;  4NNJ A;  1L9D A;  4YKG A;  2BXS A;  2XVE A;  1MXT A;  1JU2 A;  4Y4L A;  5FMH A;  3UTE A;  1ZOY A;  1Y56 A;  1EL5 A;  2R0P A;  3AE9 A;  3GWF A;  2GR0 A;  1ZOV A;  3DA1 A;  5BVA A;  4YTP A;  2EQ8 A;  2Z5Y A;  2JBV A;  4AT2 A;  2A8X A;  3DJD A;  3AD7 B;  4U8P A;  2BC0 A;  2ZZC A;  3AEC A;  4EQR A;  1YKJ A;  4B68 A;  4U8O A;  1YQ4 A;  2C70 A;  3LZW A;  2DKI A;  4B1B A;  3CNS A;  4UDR A;  3UKL A;  3NK2 X;  4A6N B;  4A6N A;  4YWO A;  2YG5 A;  1D7L A;  2CFY A;  2C75 A;  2X8C A;  4PAB A;  3ALL A;  5CQF A;  5KVH A;  5KVI A;  2WP6 A;  1LV0 A;  3F8P A;  2BXR A;  4BK3 A;  4H50 A;  1HYU A;  2JB3 A;  3UOY A;  4II2 A;  4EQS A;  2BK4 A;  4BJY A;  5FS9 A;  2OLO A;  2GMJ A;  3AEE A;  1NHS A;  3L1R A;  4CBQ A;  5EB4 A;  3T14 A;  4EMJ A;  4J31 A;  3AE7 A;  2C73 A;  1P2E A;  3AD8 B;  1L9E A;  1PBB A;  1Q9I A;  4KPR A;  3M0O A;  5C2T A;  3AYL A;  1K0L A;  3GYX A;  1NEK A;  4EQX A;  3P4R A;  1DOD A;  2YLT A;  4D04 A;  3FPZ A;  3M13 A;  1XDI A;  2VVL A;  4X4J A;  5KOW A;  2NVK X;  3EPT A;  4JY2 A;  2XFQ A;  3NYE A;  1ZK7 A;  3G5Q A;  3DK4 A;  2DKH A;  2ZZB A;  3ICR A;  4A9W A;  3VR9 A;  2BS3 A;  3E1T A;  3AEG A;  3H8L A;  3T2K A;  4G73 A;  3S5W A;  4H7U A;  4HB9 A;  2WDR A;  1NPX A;  3I6D A;  3T2Z A;  3VRD B;  4B67 A;  4JN9 A;  4OPT A;  1Q1R A;  3CGD A;  3ICT A;  3QVP A;  2JB1 A;  1BF3 A;  1RYI A;  1EL8 A;  2BCG G;  1CJC A;  1K0J A;  3C96 A;  4H4V A;  2QA2 A;  3URH A;  1D4D A;  4H2Q A;  4FK1 A;  2C76 A;  1PDH A;  2JK6 A;  4FX9 A;  4WX1 A;  4C5O A;  2UZZ A;  3BHF A;  3NT6 A;  3PVC A;  3DK9 A;  2BRY A;  2BS4 A;  3NNE A;  1JRZ A;  4CNJ A;  3VRA A;  4M52 A;  1ZMC A;  4O5Q A;  1K0I A;  4NZH A;  2YG7 A;  5U1O A;  1K4Q A;  1GXF A;  1O5W A;  4X9N A;  3Q6J A;  2EQ7 A;  2Q7V A;  2WS3 A;  3FG2 P;  2C65 A;  4YTM A;  3LOV A;  1E7P A;  1GET A;  3QJ4 A;  3DJE A;  5J7X A;  4Z43 A;  4FDC B;  1N4U A;  1DOB A;  4B65 A;  1FEA A;  1GRF A;  3T37 A;  4EMW A;  4NTE A;  1F3P A;  4OVI A;  3AE6 A;  2XFP A;  4TM3 A;  3BI5 A;  2B76 A;  2XFU A;  2WOI A;  4EIP A;  2BYB A;  3GRT A;  1XAN A;  3RHA A;  3KD9 A;  4II3 A;  1KFY A;  1RSG A;  2YVG A;  3BI4 A;  1N1P A;  4ZN0 A;  4U8N A;  2PHH A;  1ZMD A;  3KPK A;  2BK3 A;  3BNU A;  5KNL A;  3AE4 A;  3G5S A;  2B9X A;  1EL9 A;  3IF9 A;  1OJ9 A;  1PHH A;  2Q6U A;  1GPE A;  2X50 A;  2R4E A;  2YLR A;  4TM0 A;  3V3O A;  2GH5 A;  4CY6 A;  4FK1 C;  1XHC A;  1NHR A;  2GQF A;  1YQZ A;  4A7A A;  5EBK A;  1CF3 A;  4GDP A;  1H81 A;  4H2P A;  4K8D A;  1JRX A;  1OJD A;  1E6E A;  1B37 A;  1E1K A;  4H2N A;  3HZL A;  3CNP A;  1H7W A;  2APG A;  3ADA B;  5ER0 A;  1NG3 A;  2OAL A;  3QVR A;  3V3N A;  2GQW A;  3SM8 A;  2XLR A;  3GYJ A;  1M6I A;  1NEN A;  3KLJ A;  4DGK A;  1LQT A;  2YG3 A;  1H83 A;  4H4Z A;  3DH9 A;  3CTY A;  2ARD A;  2GR1 A;  1GRB A;  2XVF A;  1TYT A;  1GND A;  3ATR A;  1JEH A;  1GTH A;  1W4X A;  1Y56 B;  3F8D A;  4HA6 A;  2GR2 A;  4ADW A;  1GEU A;  3NK0 X;  1DNC A;  3G5R A;  3SYI A;  3SZ0 A;  2V60 A;  2WP5 A;  1JNZ A;  2WDV A;  4H4Q A;  2XCG A;  1IUV A;  4ECH A;  3LXD A;  2E1M A;  2IVD A;  1DOE A;  4K5S A;  1NHQ A;  2QCU A;  5FS7 A;  3IWA A;  2WU2 A;  1E1N A;  2I0Z A;  2VQ7 A;  2JAE A;  3AEB A;  3P4Q A;  1Q1W A;  1Y0P A;  5U63 A;  2BCP A;  3AE3 A;  2AR8 A;  3QFB A;  5EB5 A;  2CDU A;  1TDK A;  4CNK A;  5KXJ A;  4LII A;  2AAQ A;  4BK1 A;  5HYM A;  3CGE A;  2ZZ0 A;  4Y4M A;  2J3N A;  4Z2R A;  2IVE A;  1AOG A;  2YG6 A;  3GRS A;  4IVM B;  4UDP A;  1D4C A;  3HYW A;  4CRT A;  1LQU A;  4Z26 A;  1GES A;  4J36 A;  3RP7 A;  2V3A A;  2R46 A;  3VRB A;  2C3D A;  4U2L A;  4OPG A;  1GRT A;  5IPY A;  2WES A;  3UOZ A;  1S3E A;  4I59 A;  4BK2 A;  2NPX A;  4RG4 A;  3K7T A;  4UP3 A;  3DME A;  4H4R A;  2R0G A;  3CGB A;  4JY3 A;  3GD4 A;  4GDE A;  4X9M A;  4EM4 A;  1RP0 A;  5JCK A;  3AE5 A;  2YG4 A;  1JNR A;  4K22 A;  4H4P A;  5JCN A;  4IVO B;  4C77 A;  5FS6 A;  1PN0 A;  1F8W A;  1CC2 A;  4H4X A;  1PBF A;  4DSH A;  4JDR A;  3CPJ G;  4XWR A;  4REK A;  4B63 A;  1TYP A;  4U8J A;  4U8I A;  2R9Z A;  3EAN A;  1FCD A;  5BUL A;  4A99 A;  3NIX A;  1L0V A;  3BNM A;  4U8M A;  1E39 A;  1GSN A;  3K7Q X;  4H4W A;  1EBD A;  3HYV A;  2VRM A;  3O0H A;  4H4T A;  3NHO X;  2JB2 A;  1VQW A;  5LV9 A;  3AEA A;  3GWD A;  2HQM A;  4XXG A;  1NDA A;  2BS2 A;  2V3B A;  1IUS A;  3NH3 X;  1CC4 A;  4TLZ A;  2V61 A;  2BC1 A;  3UTF A;  2X3N A;  4AOX A;  1CC6 A;  3AEF A;  1S3B A;  1LVL A;  5FS8 A;  3CIR A;  2VRL A;  1D7Y A;  2XLU A;  2VQB A;  1H84 A;  1L9C A;  5GSN A;  5C3J A;  4U8K A;  3F8R A;  3P4S A;  2XFN A;  2VVL G;  1CHU A;  4A79 A;  2QAE A;  3GYI A;  2WEU A;  3COX A;  1IUU A;  1FL2 A;  3NLC A;  3II4 A;  1YY5 A;  3ALM A;  5JCI A;  4ZCD A;  2XVH A;  2YLZ A;  1PJ6 A;  2X8G A;  4NTC A;  4EM3 A;  1PBE A;  2E4G A;  4YXD A;  3OZ2 A;  5KRQ A;  3LJP A;  2XVJ A;  3LAD A;  5DBJ A;  3AXB A;  3NK1 X;  3NRN A;  3GSI A;  4G6H A;  3V76 A;  1QO8 A;  4YSH A;  3DK8 A;  3AE2 A;  2QA1 A;  4JQ9 A;  1IJH A;  1XPQ A;  3QSS A;  2GRT A;  4LU6 A;  4OPI A;  1NHP A;  2E5V A;  1KDG A;  1H7X A;  1N4W A;  1GRE A;  3H4K A;  3LB8 A;  3UP4 A;  4Z2T A;  2PYX A;  1LTX R;  3VR8 A;  1ELI A;  4MJW A;  4CY8 A;  3JSK A;  5KOX A;  2FJD A;  3AB1 A;  3SY4 A;  3UOV A;  3UKA A;  4Z25 A;  1B4V A;  3SFD A;  3DJJ A;  3ATQ A;  2IID A;  2YLX A;  5BRT A;  2TMD A;  2YVF A;  4LA1 A;  2FJA A;  1IUT A;  1CL0 A;  1IUX A;  1JOA A;  2WU5 A;  5KMQ A;  4EIQ A;  1GV4 A;  1CBO A;  3CNJ A;  2W0H A;  1FEB A;  4RG3 A;  1BGN A;  2WPC A;  5M10 A;  4KX6 A;  3P1W A;  3I3L A;  1B8S A;  4TM4 A;  3T31 A;  4DNA A;  4I58 A;  2C67 A;  2GF3 A;  3IC9 A;  4B64 A;  1PJ7 A;  2GAH B;  2Q0L A;  3SZW A;  2FJE A;  3BI2 A;  4CCQ A;  1Z6L A;  5KMP A;  3AYJ A;  1ZDL A;  2B9Y A;  2BA9 A;  2WBA A;  3UOX A;  3UTH A;  2XLS A;  2GV8 A;  4YKF A;  3SQP A;  4OCG A;  3SZF A;  3OC4 A;  3K30 A;  2B9W A;  2V5Z A;  1GT8 A;  2Q0K A;  3GMC A;  2RAB A;  1P2H A;  1CJ4 A;  2WQY A;  4J2W A;  3FIM B;  1OJT A;  3D8X A;  3DGZ A;  4B66 A;  2OA1 A;  3M12 A;  5GRT A;  4AOS A;  3KU9 A;  3CND A;  4WCT A;  1BGJ A;  2F5Z A;  3KPF A;  5KWF A;  2GB0 A;  1REO A;  2GEW A;  4Z2U A;  4Z44 A;  3R9U A;  1GRG A;  3C4A A;  1DXL A;  2YR6 A;  3Q9T A;  4JNA A;  3RED A;  5JCM A;  4K2X A;  1BZL A;  2XYO A;  2H88 A;  1E1L A;  3UCL A;  2C4C A;  4H4Y A;  1UKV G;  3QSM A;  1E1M A;  3VQR A;  3CNT A;  2VZ2 A;  2RGO A;  3ABV A;  4J34 A;  1F8S A;  4APN A;  2R0C A;  4J57 A;  3KKJ A;  3NN0 X;  3CMM A;  4IA5 A;  2C72 A;  4OPU A;  3GDN A;  4RSL A;  4C3X A;  3KA7 A;  4YSX A;  3ZDN A;  3CPH G;  3AE1 A;  4U2T A;  4J56 A;  4GCM A;  3FBS A;  4O5U A;  2YVJ A;  3H8I A;  3DJG X;  3KVE A;  2C64 A;  1GAL A;  1GRH A;  2Z5X A;  2WPE A;  3NGC X;  3CPI G;  3SGL A;  2YWL A;  2BAC A;  2YLW A;  1H82 A;  3UKF A;  2Y6R A;  1GER A;  4ZCC A;  1KNP A;  4EQW A;  4YTN A;  5J60 A;  3UKP A;  3UP5 A;  1VDC A;  4YT0 A;  3UKK A;  2GMH A;  4C3Y A;  1FEC A;  2YR5 A;  3WE0 A;  1TDO A; 
#chains in the Genus database with same CATH homology
 3PO7 A;  1H86 A;  2A87 A;  1GOS A;  3AD9 B;  1F6M A;  3AYI A;  4DSG A;  4K7Z A;  4AP1 A;  1IUW A;  1DJQ A;  3NN6 X;  3P4P A;  3UKH A;  2EQ9 A;  4GAV A;  2CVJ A;  1TRB A;  1YQ3 A;  2OAM A;  1V59 A;  3GDP A;  4K5R A;  4U8L A;  2EQ6 A;  5HHF A;  1PJ5 A;  3SFE A;  2WDQ A;  1D5T A;  3K7M X;  4ICY A;  4NWZ A;  5EOW A;  4AP3 A;  3NTA A;  3CN8 A;  3B6D A;  4IA6 A;  4UDQ A;  2V6O A;  2YAU A;  3L8K A;  3UKQ A;  1EL7 A;  1NG4 A;  4YSZ A;  3ALJ A;  5IQ4 A;  3FMW A;  1JRY A;  4A65 A;  1KNR A;  1ZY8 A;  4TLX A;  3RP8 A;  1S2Q A;  3QSE A;  4GRT A;  2BRA A;  5BUK A;  2CUL A;  3RNM A;  2Y6Q A;  3GD3 A;  3ITJ A;  2AQJ A;  2JKC A;  2ZBW A;  3NYF A;  2XFO A;  2C3C A;  2ACZ A;  2A89 A;  2WOV A;  3SXI A;  3GMB A;  4IV9 A;  4NEV A;  4GAP A;  1O95 A;  3AED A;  3C4N A;  1TDN A;  1PXB A;  3NTD A;  2YR4 A;  4G6G A;  3B3R A;  3NKS A;  3S61 A;  2YQU A;  4H4S A;  4B69 A;  4YSY A;  2GR3 A;  4OPD A;  3D1C A;  4N9X A;  1GTE A;  1MOK A;  1KSU A;  1KF6 A;  2GVC A;  3RP6 A;  2YLS A;  2XDO A;  3PS9 A;  4G9K A;  4P9S A;  5JCL A;  2XLP A;  1SEZ A;  1OJC A;  2WOW A;  3SX6 A;  5TR3 A;  5U25 A;  2B7R A;  5CKU A;  2BAB A;  2TPR A;  1N4V A;  2RGJ A;  1CJ3 A;  4Y4N A;  3IHG A;  2VOU A;  2WET A;  2C66 A;  1PBC A;  3LZX A;  2O9Z A;  3CGC A;  4OPL A;  1PBD A;  1BKW A;  1S2Y A;  3P9U A;  3QFA A;  4BUR A;  1D4E A;  2FJB A;  2X99 A;  2GAG B;  4NTD A;  3ISH A;  4GR1 A;  4AT0 A;  1OJA A;  4PAA A;  1GRA A;  2YM1 A;  4OPC A;  2WP9 A;  5KMR A;  1PS9 A;  2VVM A;  1TDF A;  4C74 A;  3ZYX A;  3EAO A;  4D03 A;  2XVI A;  5M0Z A;  1ZX9 A;  4USR A;  4BJZ A;  5L46 A;  4Z24 A;  4H4U A;  1ZKQ A;  1PXA A;  4H2R A;  4J33 A;  1DJN A;  2FBW A;  2RGH A;  1COY A;  1TDE A;  5HY5 A;  1F8R A;  4G74 A;  5KMS A;  3DGH A;  2BK5 A;  1M64 A;  3SZC A;  2C7G A;  2R45 A;  3IHM A;  1VG0 A;  4EMI A;  1NAA A;  3NG7 X;  4GUV A;  1LJ1 A;  3NYC A;  3UTG A;  3HYX A;  1LPF A;  3T2Y A;  5HXI A;  3BHK A;  2WPF A;  4NEW A;  2YM2 A;  4GF7 A;  3T0K A;  3AE8 A;  1VG9 A;  1ZP0 A;  4TM1 A;  1BWC A;  4U2S A;  1B5Q A;  1ONF A;  1X31 B;  2R4J A;  1O94 A;  1QLB A;  1CJ2 A;  2B7S A;  2WHD A;  4USQ A;  1KSS A;  3AWI A;  3ICS A;  2H89 A;  1H6V A;  1PXC A;  2XLT A;  5IQ1 A;  4BV6 A;  4A5L A;  4JNQ A;  3EF6 A;  1VRQ B;  1MO9 A;  4XWZ A;  4E0V A;  1QJD A;  4CCR A;  1DOC A;  2OLN A;  2X8H A;  1FOH A;  4NNJ A;  1L9D A;  4YKG A;  2BXS A;  2XVE A;  1MXT A;  1JU2 A;  4Y4L A;  5FMH A;  3UTE A;  1ZOY A;  1Y56 A;  1EL5 A;  2R0P A;  3AE9 A;  3GWF A;  2GR0 A;  1ZOV A;  3DA1 A;  5BVA A;  4YTP A;  2EQ8 A;  2Z5Y A;  2JBV A;  4AT2 A;  2A8X A;  3DJD A;  3AD7 B;  4U8P A;  2BC0 A;  2ZZC A;  3AEC A;  4EQR A;  1YKJ A;  4B68 A;  4U8O A;  1YQ4 A;  2C70 A;  3LZW A;  2DKI A;  4B1B A;  3CNS A;  4UDR A;  3UKL A;  3NK2 X;  4A6N B;  4A6N A;  4YWO A;  2YG5 A;  1D7L A;  2CFY A;  2C75 A;  2X8C A;  4PAB A;  3ALL A;  5CQF A;  5KVH A;  5KVI A;  2WP6 A;  1LV0 A;  3F8P A;  2BXR A;  4BK3 A;  4H50 A;  1HYU A;  2JB3 A;  3UOY A;  4II2 A;  4EQS A;  2BK4 A;  4BJY A;  5FS9 A;  2OLO A;  2GMJ A;  3AEE A;  1NHS A;  3L1R A;  4CBQ A;  5EB4 A;  3T14 A;  4EMJ A;  4J31 A;  3AE7 A;  2C73 A;  1P2E A;  3AD8 B;  1L9E A;  1PBB A;  1Q9I A;  4KPR A;  3M0O A;  5C2T A;  3AYL A;  1K0L A;  3GYX A;  1NEK A;  4EQX A;  3P4R A;  1DOD A;  2YLT A;  4D04 A;  3FPZ A;  3M13 A;  1XDI A;  2VVL A;  4X4J A;  5KOW A;  2NVK X;  3EPT A;  4JY2 A;  2XFQ A;  3NYE A;  1ZK7 A;  3G5Q A;  3DK4 A;  2DKH A;  2ZZB A;  3ICR A;  3WE0 A;  4A9W A;  3VR9 A;  2BS3 A;  3E1T A;  3AEG A;  3H8L A;  3T2K A;  4G73 A;  3S5W A;  4H7U A;  4HB9 A;  2WDR A;  1NPX A;  3I6D A;  3T2Z A;  3VRD B;  4B67 A;  4JN9 A;  4OPT A;  1Q1R A;  3CGD A;  3ICT A;  3QVP A;  2JB1 A;  1BF3 A;  1RYI A;  1EL8 A;  2BCG G;  1CJC A;  1K0J A;  3C96 A;  4H4V A;  2QA2 A;  3URH A;  1D4D A;  4H2Q A;  4FK1 A;  2C76 A;  1PDH A;  2JK6 A;  4FX9 A;  4WX1 A;  4C5O A;  2UZZ A;  3BHF A;  3NT6 A;  3PVC A;  3DK9 A;  2BRY A;  2BS4 A;  3NNE A;  1JRZ A;  4CNJ A;  3VRA A;  4M52 A;  1ZMC A;  4O5Q A;  1K0I A;  4NZH A;  2YG7 A;  5U1O A;  1K4Q A;  1GXF A;  1O5W A;  4X9N A;  3Q6J A;  2EQ7 A;  2Q7V A;  2WS3 A;  3FG2 P;  2C65 A;  4YTM A;  3LOV A;  1E7P A;  1GET A;  3QJ4 A;  3DJE A;  5J7X A;  4Z43 A;  4FDC B;  1N4U A;  1DOB A;  4B65 A;  1FEA A;  1GRF A;  3T37 A;  4EMW A;  4NTE A;  1F3P A;  4OVI A;  3AE6 A;  2XFP A;  4TM3 A;  3BI5 A;  2B76 A;  2XFU A;  2WOI A;  4EIP A;  2BYB A;  3GRT A;  1XAN A;  3RHA A;  3KD9 A;  4II3 A;  1KFY A;  1RSG A;  2YVG A;  3BI4 A;  1N1P A;  4ZN0 A;  4U8N A;  2PHH A;  1ZMD A;  3KPK A;  2BK3 A;  3BNU A;  5KNL A;  3AE4 A;  3G5S A;  2B9X A;  1EL9 A;  3IF9 A;  1OJ9 A;  1PHH A;  2Q6U A;  1GPE A;  2X50 A;  2R4E A;  2YLR A;  4TM0 A;  3V3O A;  2GH5 A;  4CY6 A;  4FK1 C;  1XHC A;  1NHR A;  2GQF A;  1YQZ A;  4A7A A;  5EBK A;  1CF3 A;  4GDP A;  1H81 A;  4H2P A;  4K8D A;  1JRX A;  1OJD A;  1E6E A;  1B37 A;  1E1K A;  4H2N A;  3HZL A;  3CNP A;  1H7W A;  2APG A;  3ADA B;  5ER0 A;  1NG3 A;  2OAL A;  3QVR A;  3V3N A;  2GQW A;  3SM8 A;  2XLR A;  3GYJ A;  1M6I A;  1NEN A;  3KLJ A;  4DGK A;  1LQT A;  2YG3 A;  1H83 A;  4H4Z A;  3DH9 A;  3CTY A;  2ARD A;  2GR1 A;  1GRB A;  2XVF A;  1TYT A;  1GND A;  3ATR A;  1JEH A;  1GTH A;  1W4X A;  1Y56 B;  3F8D A;  4HA6 A;  2GR2 A;  4ADW A;  1GEU A;  3NK0 X;  1DNC A;  3G5R A;  3SYI A;  3SZ0 A;  2V60 A;  2WP5 A;  1JNZ A;  2WDV A;  4H4Q A;  2XCG A;  1IUV A;  4ECH A;  3LXD A;  2E1M A;  2IVD A;  1DOE A;  4K5S A;  1NHQ A;  2QCU A;  5FS7 A;  3IWA A;  2WU2 A;  1E1N A;  2I0Z A;  2VQ7 A;  2JAE A;  3AEB A;  3P4Q A;  1Q1W A;  1Y0P A;  5U63 A;  2BCP A;  3AE3 A;  2AR8 A;  3QFB A;  5EB5 A;  2CDU A;  1TDK A;  4CNK A;  5KXJ A;  4LII A;  2AAQ A;  4BK1 A;  5HYM A;  3CGE A;  2ZZ0 A;  4Y4M A;  2J3N A;  4Z2R A;  2IVE A;  1AOG A;  2YG6 A;  3GRS A;  4IVM B;  4UDP A;  1D4C A;  3HYW A;  4CRT A;  1LQU A;  4Z26 A;  1GES A;  4J36 A;  3RP7 A;  2V3A A;  2R46 A;  3VRB A;  2C3D A;  4U2L A;  4OPG A;  1GRT A;  5IPY A;  2WES A;  3UOZ A;  1S3E A;  4I59 A;  4BK2 A;  2NPX A;  4RG4 A;  3K7T A;  4UP3 A;  3DME A;  4H4R A;  2R0G A;  3CGB A;  4JY3 A;  3GD4 A;  4GDE A;  4X9M A;  4EM4 A;  1RP0 A;  5JCK A;  3AE5 A;  2YG4 A;  1JNR A;  4K22 A;  4H4P A;  5JCN A;  4IVO B;  4C77 A;  5FS6 A;  1PN0 A;  1F8W A;  1CC2 A;  4H4X A;  1PBF A;  4DSH A;  4JDR A;  3CPJ G;  4XWR A;  4REK A;  4B63 A;  1TYP A;  4U8J A;  4U8I A;  2R9Z A;  3EAN A;  1FCD A;  5BUL A;  4A99 A;  3NIX A;  1L0V A;  3BNM A;  4U8M A;  1E39 A;  1GSN A;  3K7Q X;  4H4W A;  1EBD A;  3HYV A;  2VRM A;  3O0H A;  4H4T A;  3NHO X;  2JB2 A;  1VQW A;  5LV9 A;  3AEA A;  3GWD A;  2HQM A;  4XXG A;  1NDA A;  2BS2 A;  2V3B A;  1IUS A;  3NH3 X;  1CC4 A;  4TLZ A;  2V61 A;  2BC1 A;  3UTF A;  2X3N A;  4AOX A;  1CC6 A;  3AEF A;  1S3B A;  1LVL A;  5FS8 A;  3CIR A;  2VRL A;  1D7Y A;  2XLU A;  2VQB A;  1H84 A;  1L9C A;  5GSN A;  5C3J A;  4U8K A;  3F8R A;  3P4S A;  2XFN A;  2VVL G;  1CHU A;  4A79 A;  2QAE A;  3GYI A;  2WEU A;  3COX A;  1IUU A;  1FL2 A;  3NLC A;  3II4 A;  1YY5 A;  3ALM A;  5JCI A;  4ZCD A;  2XVH A;  2YLZ A;  1PJ6 A;  2X8G A;  4NTC A;  4EM3 A;  1PBE A;  2E4G A;  4YXD A;  3OZ2 A;  5KRQ A;  3LJP A;  2XVJ A;  3LAD A;  5DBJ A;  3AXB A;  3NK1 X;  3NRN A;  3GSI A;  4G6H A;  3V76 A;  1QO8 A;  4YSH A;  3DK8 A;  3AE2 A;  2QA1 A;  4JQ9 A;  1IJH A;  1XPQ A;  3QSS A;  2GRT A;  4LU6 A;  4OPI A;  1NHP A;  2E5V A;  1KDG A;  1H7X A;  1N4W A;  1GRE A;  3H4K A;  3LB8 A;  3UP4 A;  4Z2T A;  2PYX A;  1LTX R;  3VR8 A;  1ELI A;  4MJW A;  4CY8 A;  3JSK A;  5KOX A;  2FJD A;  3AB1 A;  3SY4 A;  3UOV A;  3UKA A;  4Z25 A;  1B4V A;  3SFD A;  3DJJ A;  3ATQ A;  2IID A;  2YLX A;  5BRT A;  2TMD A;  2YVF A;  4LA1 A;  2FJA A;  1IUT A;  1CL0 A;  1IUX A;  1JOA A;  2WU5 A;  5KMQ A;  4EIQ A;  1GV4 A;  1CBO A;  3CNJ A;  2W0H A;  1FEB A;  4RG3 A;  1BGN A;  2WPC A;  5M10 A;  4KX6 A;  3P1W A;  3I3L A;  1B8S A;  4TM4 A;  3T31 A;  4DNA A;  4I58 A;  2C67 A;  2GF3 A;  3IC9 A;  4B64 A;  1PJ7 A;  2GAH B;  2Q0L A;  3SZW A;  2FJE A;  3BI2 A;  4CCQ A;  1Z6L A;  5KMP A;  3AYJ A;  1ZDL A;  2B9Y A;  2BA9 A;  2WBA A;  3UOX A;  3UTH A;  2XLS A;  2GV8 A;  4YKF A;  3SQP A;  4OCG A;  3SZF A;  3OC4 A;  3K30 A;  2V5Z A;  1GT8 A;  2B9W A;  2Q0K A;  3GMC A;  2RAB A;  1P2H A;  1CJ4 A;  2WQY A;  4J2W A;  3FIM B;  1OJT A;  3D8X A;  3DGZ A;  4B66 A;  2OA1 A;  3M12 A;  5GRT A;  4AOS A;  3KU9 A;  3CND A;  4WCT A;  1BGJ A;  2F5Z A;  3KPF A;  5KWF A;  2GB0 A;  1REO A;  2GEW A;  4Z2U A;  4Z44 A;  3R9U A;  1GRG A;  3C4A A;  1DXL A;  2YR6 A;  3Q9T A;  4JNA A;  3RED A;  5JCM A;  4K2X A;  1BZL A;  2XYO A;  2H88 A;  1E1L A;  3UCL A;  2C4C A;  4H4Y A;  1UKV G;  3QSM A;  1E1M A;  3VQR A;  3CNT A;  2VZ2 A;  2RGO A;  3ABV A;  4J34 A;  1F8S A;  4APN A;  2R0C A;  4J57 A;  3KKJ A;  3NN0 X;  3CMM A;  4IA5 A;  2C72 A;  4OPU A;  3GDN A;  4RSL A;  4C3X A;  3KA7 A;  4YSX A;  3ZDN A;  3CPH G;  3AE1 A;  4U2T A;  4J56 A;  4GCM A;  3FBS A;  4O5U A;  2YVJ A;  3H8I A;  3DJG X;  3KVE A;  2C64 A;  1GAL A;  1GRH A;  2Z5X A;  2WPE A;  3NGC X;  3CPI G;  3SGL A;  2YWL A;  2YLW A;  1H82 A;  3UKF A;  2Y6R A;  1GER A;  4ZCC A;  1KNP A;  4EQW A;  4YTN A;  5J60 A;  3UKP A;  3UP5 A;  1VDC A;  4YT0 A;  3UKK A;  2GMH A;  4C3Y A;  1FEC A;  2YR5 A;  2BAC A;  1TDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...