1REOA

L-amino acid oxidase from agkistrodon halys pallas
Total Genus 181
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
181
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Purification, partial characterization, crystallization and structural determination of AHP-LAAO, a novel L-amino-acid oxidase with cell apoptosis-inducing activity from Agkistrodon halys pallas venom.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AHPLAAO
total genus 181
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1reoA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1reoA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1reoA01
2CULA 1TDOA 3M0OA 2YG3A 1GERA 3G5SA 3AE6A 2JK6A 4Z43A 3PVCA 4USRA 3BNUA 1AOGA 2UZZA 2C66A 3CPIG 4KPRA 3UOVA 1F3PA 3AYJA 2R4JA 4B63A 3AEFA 4EQRA 3KPFA 4U8LA 3QVPA 2FBWA 3DJDA 4Z26A 3Q9TA 4USQA 2BCPA 1BZLA 1E1LA 3K7TA 3Q6JA 2YR6A 3H4KA 1F8SA 4X9NA 2V6OA 3QJ4A 1E39A 1FEAA 2C7GA 3AEAA 1PDHA 3LOVA 1Q1RA 3ICSA 1VDCA 1Y0PA 4Z24A 1NHSA 3BI4A 3UP4A 4AP1A 5IQ1A 4K22A 1OJAA 1XPQA 2GR3A 3NYCA 4CBQA 1DOBA 2E1MA 5BULA 4JNAA 5BUKA 2YLZA 2JB1A 4Y4LA 1E6EA 1IUWA 2VQ7A 3ISHA 3GMBA 1TDFA 1D7YA 4B65A 5EB5A 3QSMA 3VRAA 1BGNA 2FJDA 3F8DA 2GR0A 1LQUA 4GRTA 4H2PA 2APGA 2Z5YA 1GTEA 1ZMDA 3H8IA 1CBOA 5U1OA 3SFEA 1OJTA 4H4QA 2VRMA 3OC4A 1XHCA 3K7MX 4C3YA 2QCUA 3CNDA 1PBCA 5EBKA 4C5OA 4OPLA 5BVAA 2GB0A 1NHQA 2GR1A 2C3DA 4RG3A 2O9ZA 1IUVA 2BK3A 1JRXA 3IHGA 4B69A 1IUTA 3NTDA 2BYBA 3DJJA 3EAOA 3LZXA 1ONFA 3B3RA 2WBAA 2VZ2A 4EQXA 5FS8A 2OAMA 2WS3A 4Z2UA 2FJAA 2YVJA 4JY3A 4NZHA 5M0ZA 4H2QA 4X4JA 1D7LA 1KNPA 3NNEA 1GRHA 1Q9IA 3QVRA 1ZOYA 3GMCA 3ATRA 2A87A 3AE9A 1L9DA 3ICRA 3FMWA 1E1MA 1L9CA 2W0HA 3CGDA 1H6VA 1ELIA 3KD9A 1CC6A 1HYUA 2A8XA 4Z25A 3DGHA 1E1NA 5GRTA 1GESA 3ALMA 2WOWA 1RSGA 4CCRA 5KOXA 1B4VA 3VR8A 1NHPA 1D5TA 3AYIA 2H88A 2XFNA 3GWDA 1N4UA 3KVEA 4GUVA 2RABA 3V76A 4B64A 2E4GA 4BV6A 1V59A 2WPFA 1PHHA 1K4QA 1GT8A 2RGHA 2ACZA 4B1BA 2WEUA 1LV0A 3AWIA 4GDPA 1CHUA 2JB3A 2JKCA 4H4RA 1F6MA 3K30A 4GF7A 2YG4A 3H8LA 3QFAA 3AD7B 2YLWA 3LJPA 4OPCA 1ZOVA 1TYPA 3NTAA 3LXDA 4J36A 1BGJA 3T37A 2XLTA 3KU9A 1Y56A 4BK2A 5HXIA 2NPXA 5IPYA 1GEUA 3VRBA 3AECA 4CY6A 1VRQB 4LA1A 2QA2A 2VQBA 1KSUA 4H4VA 4HB9A 4YTNA 2Y6RA 3NK1X 1OJCA 1TYTA 4M52A 4XWRA 3ADAB 1S3EA 4J56A 4UDRA 3CNTA 2E5VA 2GMJA 2OALA 5EOWA 2V3BA 2VVLG 3D8XA 4OPGA 4A99A 3NG7X 5J7XA 4YTPA 3KKJA 1H82A 2YLXA 1DOCA 1JRYA 2BACA 4ECHA 5DBJA 2R4EA 1ZX9A 1DXLA 2WP9A 3C4NA 4OPUA 3V3OA 3VR9A 4E0VA 3JSKA 4OPTA 2Y6QA 4H2NA 4TLZA 5CKUA 4BK1A 1VG9A 4D03A 2BCGG 2GVCA 5JCIA 3RP6A 2EQ7A 4K7ZA 3UTEA 2YLSA 4H4YA 4CY8A 3UTFA 5M10A 4YSZA 1IUUA 4FK1A 4U8MA 3NK0X 4NTDA 3P9UA 1OJDA 3G5RA 3UKHA 3LADA 2DKHA 4TM3A 1H86A 1QO8A 1L0VA 4JQ9A 5HY5A 4EIPA 4UDQA 1P2EA 4A7AA 4FX9A 3S5WA 2C67A 2VVLA 3RHAA 4D04A 3AE4A 2FJBA 2Q0LA 4U2TA 4DSGA 1S3BA 1GNDA 1CC2A 1PJ5A 2YWLA 1TDEA 3NHOX 2VRLA 2GR2A 4C3XA 4OCGA 1Z6LA 2BABA 2R45A 3AXBA 3UTHA 3GSIA 2EQ6A 4I58A 2YR4A 4Z44A 3UOZA 4ADWA 2V61A 4ZCCA 5JCKA 1B5QA 1H84A 1NAAA 3ICTA 2WDQA 2RGJA 1PS9A 2A89A 2WETA 3NGCX 2TMDA 4H4SA 1JRZA 2B7RA 1GSNA 1BKWA 4U8PA 1CF3A 1NG3A 4H4PA 4YKFA 4EM4A 3LB8A 2XLPA 4LU6A 2Q0KA 4GCMA 2OA1A 3VRDB 2GMHA 2AR8A 3NH3X 2XVFA 1K0JA 2DKIA 4C74A 4H4TA 1CL0A 4H2RA 2QAEA 2XYOA 4WCTA 2R9ZA 3BI2A 1EL9A 3AEEA 3OZ2A 5KVHA 3ZYXA 2C72A 1H83A 2Q7VA 2WP6A 5TR3A 5U25A 4A5LA 4CNJA 4YSYA 2WPEA 5KXJA 3SGLA 3UCLA 4REKA 1L9EA 1PJ7A 2X3NA 3D1CA 3NK2X 3L1RA 2YLTA 4Z2TA 2ZZCA 2BXRA 3GDPA 1DJQA 2GRTA 4A65A 3KA7A 3R9UA 4FDCB 3CNJA 4EM3A 3IWAA 4LIIA 4NEWA 4MJWA 3F8PA 2R0GA 4BJYA 3DK8A 2WOIA 1KF6A 1Y56B 4YTMA 1FEBA 3CGBA 3ABVA 3BHFA 2RGOA 5FS9A 5BRTA 1D4DA 3GWFA 4EMJA 4H4ZA 3UOYA 1JOAA 4K5RA 3URHA 1B8SA 1TDNA 1FECA 2XVIA 2XDOA 4J34A 3B6DA 1TRBA 3BHKA 3ITJA 3KLJA 3VQRA 1JNZA 2B9XA 2Z5XA 1KNRA 4O5UA 1H7XA 3NLCA 2XVJA 2WPCA 1LQTA 1YQ3A 3AE2A 1ZK7A 1EL7A 5L46A 4RG4A 3DGZA 3UKAA 4AOSA 4U8OA 1GRTA 4U8IA 4IV9A 3GRTA 3AEBA 2I0ZA 1KFYA 1GTHA 2GEWA 4TM0A 1PBBA 1ZMCA 3AD8B 4IA6A 5KOWA 2V3AA 5KWFA 4YXDA 2ARDA 4ZCDA 1GPEA 2JAEA 2C75A 1IUXA 1K0IA 3F8RA 5FMHA 1NENA 4RSLA 2Q6UA 3II4A 3CIRA 3EPTA 4K2XA 1KDGA 1XANA 1PJ6A 3EANA 4IA5A 5U63A 2B7SA 1N1PA 5FS7A 2C65A 2ZZBA 1PBEA 1IJHA 3EF6A 1GRGA 1JEHA 2GF3A 2GV8A 3QSSA 4H4WA 2YQUA 2YAUA 1E1KA 4BK3A 2JB2A 2EQ9A 2AAQA 3P4SA 2EQ8A 2R0CA 3GD4A 4H4XA 3FG2P 4PABA 4YWOA 5FS6A 4A6NA 1ZKQA 4J2WA 1H7WA 1VQWA 3DK4A 5JCMA 3AE5A 2YVFA 2VVMA 1RYIA 2YM2A 3P4PA 1GRFA 3NRNA 2GAHB 3NT6A 1O5WA 2WU2A 1MO9A 2X99A 4I59A 1O95A 3ALLA 3NYEA 2F5ZA 3NN6X 2IIDA 1GOSA 3C96A 4K5SA 2C3CA 2OLOA 1S2YA 2GAGB 3QFBA 3ZDNA 1YQZA 3CTYA 2BS2A 3BNMA 2BK4A 4BURA 2WP5A 3IC9A 1EL8A 3GRSA 1XDIA 4U8JA 2JBVA 1B37A 5ER0A 1MOKA 3AE3A 3WE0A 1YKJA 3IHMA 4FK1C 3GD3A 2GQFA 3M13A 3G5QA 4OPIA 4U2SA 4ZN0A 2FJEA 3UKPA 1DJNA 3DJEA 1DOEA 2J3NA 3BI5A 1D4CA 3NN0X 3ALJA 1FOHA 3C4AA 1FCDA 1LTXR 2BC0A 4XWZA 2C64A 4Z2RA 3CNSA 2BS4A 2BXSA 3RNMA 2BS3A 2YVGA 1GV4A 4TM1A 5GSNA 3UKQA 3FBSA 3GDNA 4DNAA 2BK5A 3I3LA 4AP3A 2C76A 3DA1A 2VOUA 3P1WA 1DODA 2R46A 2YG5A 3AD9B 4U2LA 1CJ3A 4WX1A 2XLRA 4YKGA 1CJ4A 4B66A 5HHFA 1BF3A 1PBDA 4X9MA 3UKLA 3NKSA 3P4RA 4Y4MA 3HZLA 2PHHA 3E1TA 2CFYA 1IUSA 1O94A 2YR5A 2X50A 4IVOB 2C73A 4H50A 5C2TA 4YT0A 3NIXA 2XLSA 3RP8A 4NEVA 3LZWA 4A9WA 1NPXA 3IF9A 3UKFA 1GRBA 1K0LA 1P2HA 4HA6A 3FPZA 4B68A 1ZP0A 4H4UA 5JCNA 1MXTA 2R0PA 3COXA 3FIMB 4EMIA 1JU2A 5CQFA 2XVHA 1D4EA 3L8KA 3RP7A 2YM1A 4B67A 4PAAA 4JY2A 1H81A 4K8DA 1GREA 1N4WA 4UP3A 2B76A 2ZBWA 4OPDA 4TM4A 1PBFA 3CN8A 1EL5A 4JN9A 4GDEA 1REOA 2WESA 1JNRA 1NEKA 3AEDA 4NTEA 2ZZ0A 2X8HA 2WU5A 4CRTA 3CPHG 4BJZA 1LPFA 1ZDLA 1QLBA 4J31A 1NDAA 1TDKA 2B9WA 4DGKA 1OJ9A 2XFQA 2X8GA 3UTGA 4CNKA 3ATQA 5C3JA 1X31B 4EQSA 5IQ4A 4YSXA 1PN0A 3PS9A 1YY5A 3AE1A 1CC4A 2WDVA 3S61A 5HYMA 3GYIA 2WDRA 2XCGA 4H7UA 1NHRA 5KRQA 3CGEA 2CDUA 1S2QA 4U8KA 3AE8A 3AYLA 1M6IA 2XFUA 2V5ZA 3M12A 1FL2A 4P9SA 4U8NA 3SM8A 1SEZA 1W4XA 4JDRA 3AEGA 1N4VA 1F8RA 3CPJG 2X8CA 2NVKX 4XXGA 3UP5A 1EBDA 1COYA 1Q1WA 4NTCA 3SQPA 2IVDA 2BC1A 2WQYA 3NYFA 2WHDA 4J57A 5EB4A 3V3NA 2IVEA 1CJCA 1F8WA 1NG4A 2QA1A 2YLRA 4EIQA 2AQJA 2XFOA 1YQ4A 3PO7A 1ZY8A 4AT2A 2C70A 2H89A 1GALA 2V60A 3AB1A 3CGCA 1PXCA 4N9XA 1RP0A 4OVIA 1M64A 5J60A 1LJ1A 2B9YA 4ICYA 1GRAA 3DK9A 3UKKA 1KSSA 3CNPA 1E7PA 4YSHA 2HQMA 3QSEA 1UKVG 4AT0A 2YG7A 4EQWA 3K7QX 4IVMB 4CCQA 3UOXA 4TLXA 2XFPA 3AE7A 3SFDA 2YG6A 1BWCA 3I6DA 4O5QA 4GR1A 4DSHA 4UDPA 2PYXA 1CJ2A 2GQWA 5LV9A 1DNCA 3DJGX 2OLNA 3O0HA 4C77A 2BA9A 2TPRA 1QJDA 3P4QA 3GYJA 1GETA 3DH9A 4J33A 4AOXA 4EMWA 2XVEA 4A6NB 4A79A 4Y4NA 5JCLA 1GXFA 3DMEA 2GH5A 2WOVA 2XLUA 1VG0A 1PXAA 1PXBA 5KVIA 4APNA 2CVJA 4JNQA 1LVLA 3REDA 4KX6A
chains in the Genus database with same CATH superfamily
2CULA 1TDOA 3M0OA 3HYVA 2YG3A 1GERA 3G5SA 3AE6A 2JK6A 4Z43A 3PVCA 3T14A 4USRA 3BNUA 1AOGA 2UZZA 2C66A 3CPIG 4KPRA 3UOVA 1F3PA 3AYJA 2R4JA 4B63A 3AEFA 4EQRA 3KPFA 4U8LA 3QVPA 2FBWA 3DJDA 4NNJA 4Z26A 3Q9TA 4USQA 2BCPA 1BZLA 1E1LA 3K7TA 3Q6JA 2YR6A 3H4KA 1F8SA 4X9NA 2V6OA 3QJ4A 1E39A 1FEAA 2C7GA 3AEAA 1PDHA 3LOVA 1Q1RA 3ICSA 1VDCA 1Y0PA 4Z24A 1NHSA 3BI4A 3UP4A 4AP1A 5IQ1A 4K22A 1OJAA 1XPQA 2GR3A 3NYCA 4NWZA 4CBQA 1DOBA 2E1MA 5BULA 4JNAA 5BUKA 2YLZA 2JB1A 4Y4LA 1E6EA 1IUWA 2VQ7A 3ISHA 3GMBA 1TDFA 1D7YA 4B65A 5EB5A 3QSMA 3VRAA 1BGNA 2FJDA 3F8DA 2GR0A 1LQUA 4GRTA 4H2PA 2APGA 2Z5YA 1GTEA 1ZMDA 3H8IA 1CBOA 5U1OA 3SFEA 1OJTA 4H4QA 3SX6A 2VRMA 3OC4A 1XHCA 3K7MX 4C3YA 2QCUA 3CNDA 1PBCA 5EBKA 4C5OA 4OPLA 5BVAA 2GB0A 1NHQA 2GR1A 2C3DA 4RG3A 2O9ZA 1IUVA 2BK3A 1JRXA 3IHGA 4B69A 1IUTA 3NTDA 2BYBA 3DJJA 3EAOA 3LZXA 1ONFA 3B3RA 3T2YA 2WBAA 2VZ2A 4EQXA 5FS8A 2OAMA 2WS3A 4Z2UA 2FJAA 2YVJA 4JY3A 4NZHA 5M0ZA 4H2QA 4X4JA 1D7LA 1KNPA 3NNEA 1GRHA 3T31A 1Q9IA 5KNLA 3QVRA 3T2KA 1ZOYA 3GMCA 3ATRA 2A87A 3AE9A 1L9DA 3ICRA 3FMWA 1E1MA 1L9CA 2W0HA 3CGDA 1H6VA 1ELIA 3KD9A 1CC6A 1HYUA 2A8XA 5KMRA 4Z25A 3DGHA 1E1NA 5GRTA 1GESA 3ALMA 2WOWA 1RSGA 4CCRA 5KOXA 1B4VA 3VR8A 1NHPA 1D5TA 3AYIA 2H88A 2XFNA 3GWDA 1N4UA 3KVEA 4GUVA 2RABA 3V76A 4B64A 2E4GA 4BV6A 1V59A 2WPFA 1PHHA 1K4QA 1GT8A 2RGHA 2ACZA 4B1BA 2WEUA 1LV0A 3AWIA 4GDPA 1CHUA 2JB3A 2JKCA 4H4RA 1F6MA 3K30A 4GF7A 2YG4A 3H8LA 3QFAA 3AD7B 2YLWA 3LJPA 4OPCA 1ZOVA 1TYPA 3NTAA 3SY4A 3LXDA 4J36A 1BGJA 3T37A 2XLTA 3KU9A 1Y56A 4BK2A 5HXIA 2NPXA 5IPYA 1GEUA 3VRBA 3AECA 4CY6A 1VRQB 4LA1A 2QA2A 2VQBA 1KSUA 2BRAA 4H4VA 4G6GA 2Y6RA 4HB9A 4YTNA 3NK1X 1OJCA 1TYTA 4M52A 4XWRA 3SZFA 3ADAB 1S3EA 4J56A 4UDRA 3CNTA 2E5VA 2GMJA 2OALA 5EOWA 2V3BA 2VVLG 3D8XA 4OPGA 4A99A 3NG7X 5J7XA 4YTPA 3KKJA 1H82A 2YLXA 1DOCA 1JRYA 2BACA 4ECHA 5DBJA 2R4EA 1ZX9A 1DXLA 2WP9A 3C4NA 4OPUA 3V3OA 3VR9A 4E0VA 3JSKA 4OPTA 2Y6QA 4H2NA 4TLZA 5CKUA 4BK1A 1VG9A 4D03A 2BCGG 2GVCA 5JCIA 3RP6A 2EQ7A 4K7ZA 3UTEA 2YLSA 4H4YA 4CY8A 3UTFA 5KMQA 5M10A 4YSZA 1IUUA 4FK1A 3CMMA 4U8MA 3NK0X 4NTDA 3P9UA 1OJDA 3G5RA 3UKHA 3LADA 2DKHA 4TM3A 1H86A 1QO8A 1L0VA 4JQ9A 3T0KA 5HY5A 4EIPA 4UDQA 1P2EA 4A7AA 3HYXA 4FX9A 2C67A 3S5WA 3SXIA 2VVLA 3RHAA 4D04A 3AE4A 2FJBA 2Q0LA 4U2TA 4DSGA 1S3BA 1GNDA 1CC2A 1PJ5A 2YWLA 1TDEA 3NHOX 2VRLA 2GR2A 4C3XA 4OCGA 1Z6LA 2BABA 2R45A 3AXBA 3UTHA 3GSIA 2EQ6A 4I58A 2YR4A 4Z44A 3SZWA 3UOZA 4ADWA 2V61A 4ZCCA 5JCKA 1B5QA 1H84A 1NAAA 3ICTA 2WDQA 2RGJA 1PS9A 2A89A 2WETA 3NGCX 2TMDA 4H4SA 1JRZA 2B7RA 1GSNA 1BKWA 4U8PA 3KPKA 1CF3A 1NG3A 4H4PA 4YKFA 4EM4A 3LB8A 2XLPA 4LU6A 2Q0KA 4GCMA 2OA1A 3VRDB 2GMHA 2AR8A 3NH3X 2XVFA 1K0JA 2DKIA 4C74A 4H4TA 1CL0A 4H2RA 2QAEA 2XYOA 4WCTA 2R9ZA 3BI2A 1EL9A 3AEEA 3OZ2A 5KVHA 3ZYXA 2C72A 1H83A 2Q7VA 2WP6A 4GAPA 5TR3A 5U25A 4A5LA 4CNJA 4YSYA 2WPEA 5KXJA 3SGLA 3UCLA 4REKA 1L9EA 1PJ7A 2X3NA 3D1CA 3NK2X 3L1RA 2YLTA 4Z2TA 2ZZCA 2BXRA 3GDPA 1DJQA 2GRTA 4A65A 3KA7A 3R9UA 4FDCB 3CNJA 4EM3A 3IWAA 4LIIA 4NEWA 4MJWA 3F8PA 2R0GA 4BJYA 3DK8A 2WOIA 1KF6A 1Y56B 4YTMA 1FEBA 3CGBA 3ABVA 3BHFA 2RGOA 5FS9A 5BRTA 1D4DA 3GWFA 4EMJA 4G74A 4H4ZA 3UOYA 1JOAA 4K5RA 3URHA 1B8SA 1TDNA 1FECA 2XVIA 2XDOA 4J34A 3B6DA 1TRBA 3BHKA 3ITJA 3KLJA 3VQRA 2B9XA 1JNZA 2Z5XA 1KNRA 4O5UA 1H7XA 3NLCA 2XVJA 2WPCA 1LQTA 1YQ3A 3AE2A 1ZK7A 1EL7A 5L46A 4RG4A 3DGZA 3UKAA 4AOSA 4U8OA 1GRTA 4U8IA 4IV9A 3GRTA 3AEBA 2I0ZA 1KFYA 1GTHA 2GEWA 4TM0A 1PBBA 1ZMCA 3AD8B 4IA6A 5KOWA 2V3AA 5KWFA 4YXDA 2ARDA 4ZCDA 1GPEA 2JAEA 2C75A 1IUXA 1K0IA 3F8RA 5FMHA 1NENA 4RSLA 2Q6UA 3II4A 3CIRA 3EPTA 4K2XA 1KDGA 1XANA 1PJ6A 3EANA 4IA5A 5U63A 2B7SA 1N1PA 5FS7A 2C65A 2ZZBA 3SYIA 1PBEA 1IJHA 3EF6A 1GRGA 1JEHA 2GF3A 2GV8A 3QSSA 4H4WA 2YQUA 2YAUA 1E1KA 4BK3A 2JB2A 2EQ9A 2AAQA 3P4SA 2EQ8A 2R0CA 3GD4A 4H4XA 3FG2P 4PABA 4YWOA 5FS6A 4A6NA 4II2A 1ZKQA 4J2WA 1H7WA 1VQWA 3DK4A 5JCMA 3AE5A 2YVFA 2VVMA 1RYIA 2YM2A 3P4PA 1GRFA 3NRNA 2GAHB 3NT6A 1O5WA 2WU2A 1MO9A 2X99A 4I59A 1O95A 3ALLA 3NYEA 2F5ZA 3NN6X 2IIDA 1GOSA 3C96A 4K5SA 2C3CA 2OLOA 1S2YA 2GAGB 3QFBA 3ZDNA 1YQZA 3CTYA 2BS2A 3BNMA 2BK4A 4BURA 2WP5A 3T2ZA 3IC9A 1EL8A 3GRSA 1XDIA 4U8JA 2JBVA 1B37A 5ER0A 1MOKA 3AE3A 3WE0A 1YKJA 3IHMA 4FK1C 3GD3A 2GQFA 3M13A 3G5QA 4OPIA 4U2SA 4ZN0A 2FJEA 3UKPA 1DJNA 3DJEA 1DOEA 2J3NA 3BI5A 1D4CA 3NN0X 3ALJA 1FOHA 3C4AA 1FCDA 1LTXR 2BC0A 4XWZA 2C64A 4Z2RA 3CNSA 2BS4A 2BXSA 3RNMA 2BS3A 2YVGA 1GV4A 4TM1A 5GSNA 3UKQA 3FBSA 3GDNA 4DNAA 2BK5A 3I3LA 4AP3A 2C76A 3DA1A 2VOUA 3P1WA 1DODA 2R46A 2YG5A 3AD9B 4U2LA 1CJ3A 4WX1A 2XLRA 4YKGA 1CJ4A 4B66A 5HHFA 1BF3A 1PBDA 4X9MA 3UKLA 3NKSA 3P4RA 4Y4MA 3HZLA 2PHHA 3E1TA 2CFYA 1IUSA 1O94A 2YR5A 2X50A 4IVOB 5KMPA 2C73A 4H50A 5C2TA 4YT0A 3NIXA 2XLSA 3RP8A 4NEVA 3LZWA 4A9WA 1NPXA 3IF9A 3UKFA 1GRBA 1K0LA 1P2HA 4HA6A 3FPZA 4B68A 1ZP0A 4H4UA 5JCNA 1MXTA 2R0PA 3COXA 3FIMB 4EMIA 1JU2A 5CQFA 2XVHA 1D4EA 3L8KA 3RP7A 2YM1A 4B67A 4PAAA 4JY2A 1H81A 4K8DA 1GREA 1N4WA 4UP3A 2B76A 2ZBWA 4OPDA 4TM4A 1PBFA 3CN8A 1EL5A 4JN9A 4G6HA 4GDEA 1REOA 2WESA 1JNRA 1NEKA 3AEDA 4G73A 4NTEA 2ZZ0A 2X8HA 2WU5A 4CRTA 3CPHG 4G9KA 4BJZA 1LPFA 1ZDLA 1QLBA 4J31A 2B9WA 1TDKA 1NDAA 4DGKA 1OJ9A 2XFQA 2X8GA 3UTGA 4CNKA 3ATQA 5C3JA 1X31B 4EQSA 5IQ4A 4YSXA 1PN0A 3PS9A 1YY5A 3AE1A 1CC4A 2WDVA 3S61A 3HYWA 3GYIA 5HYMA 2WDRA 2XCGA 4H7UA 1NHRA 5KRQA 3CGEA 2CDUA 1S2QA 4U8KA 3AE8A 3AYLA 1M6IA 2XFUA 2V5ZA 3M12A 1FL2A 4P9SA 4U8NA 3SM8A 1SEZA 1W4XA 4JDRA 3AEGA 1N4VA 1F8RA 3CPJG 2X8CA 2NVKX 4XXGA 3UP5A 1EBDA 1COYA 1Q1WA 4NTCA 3SQPA 2IVDA 2BC1A 2WQYA 3NYFA 2WHDA 4J57A 5EB4A 3V3NA 3GYXA 2IVEA 1CJCA 1F8WA 1NG4A 2QA1A 2YLRA 4EIQA 2AQJA 2XFOA 1YQ4A 3PO7A 2BRYA 1ZY8A 4AT2A 3SZCA 2C70A 2H89A 1GALA 2V60A 3AB1A 3CGCA 1PXCA 4II3A 1RP0A 4N9XA 1M64A 4OVIA 5J60A 1LJ1A 2B9YA 4ICYA 1GRAA 3DK9A 3UKKA 1KSSA 3CNPA 1E7PA 4YSHA 2HQMA 3QSEA 4GAVA 1UKVG 4AT0A 2YG7A 4EQWA 3K7QX 4IVMB 4CCQA 3UOXA 4TLXA 2XFPA 2C4CA 3AE7A 3SFDA 2YG6A 1BWCA 3I6DA 4O5QA 4GR1A 4DSHA 5KMSA 4UDPA 2PYXA 1CJ2A 2GQWA 5LV9A 1DNCA 3DJGX 2OLNA 3O0HA 4C77A 2BA9A 2TPRA 1QJDA 3P4QA 3GYJA 1GETA 3DH9A 4J33A 4AOXA 4EMWA 2XVEA 4A6NB 4A79A 4Y4NA 5JCLA 1GXFA 3DMEA 2GH5A 2WOVA 2XLUA 1VG0A 1PXAA 1PXBA 5KVIA 4APNA 2CVJA 3SZ0A 4JNQA 1LVLA 3REDA 4KX6A
chains in the Genus database with same CATH topology
2CULA 1TDOA 3M0OA 3HYVA 2YG3A 1GERA 3G5SA 3AE6A 2JK6A 4Z43A 3PVCA 3T14A 4USRA 3BNUA 1AOGA 2UZZA 2C66A 3CPIG 4KPRA 3UOVA 1F3PA 3AYJA 2R4JA 4B63A 3AEFA 4EQRA 3KPFA 4U8LA 3QVPA 2FBWA 3DJDA 4NNJA 4Z26A 3Q9TA 4USQA 2BCPA 1BZLA 1E1LA 3K7TA 3Q6JA 2YR6A 3H4KA 1F8SA 4X9NA 2V6OA 3QJ4A 1E39A 1FEAA 2C7GA 3AEAA 1PDHA 3LOVA 1Q1RA 3ICSA 1VDCA 1Y0PA 4Z24A 1NHSA 3BI4A 3UP4A 4AP1A 5IQ1A 4K22A 1OJAA 1XPQA 2GR3A 3NYCA 4NWZA 4CBQA 1DOBA 2E1MA 5BULA 4JNAA 5BUKA 2YLZA 2JB1A 4Y4LA 1E6EA 1IUWA 2VQ7A 3ISHA 3GMBA 1TDFA 1D7YA 4B65A 5EB5A 3QSMA 3VRAA 1BGNA 2FJDA 3F8DA 2GR0A 1LQUA 4GRTA 4H2PA 2APGA 2Z5YA 1GTEA 1ZMDA 3H8IA 1CBOA 5U1OA 3SFEA 1OJTA 4H4QA 3SX6A 2VRMA 3OC4A 1XHCA 3K7MX 4C3YA 2QCUA 3CNDA 1PBCA 5EBKA 4C5OA 4OPLA 5BVAA 2GB0A 1NHQA 2GR1A 2C3DA 4RG3A 2O9ZA 1IUVA 2BK3A 1JRXA 3IHGA 4B69A 1IUTA 3NTDA 2BYBA 3DJJA 3EAOA 3LZXA 1ONFA 3B3RA 3T2YA 2WBAA 2VZ2A 4EQXA 5FS8A 2OAMA 2WS3A 4Z2UA 2FJAA 2YVJA 4JY3A 4NZHA 5M0ZA 4H2QA 4X4JA 1D7LA 1KNPA 3NNEA 1GRHA 3T31A 1Q9IA 5KNLA 3QVRA 3T2KA 1ZOYA 3GMCA 3ATRA 2A87A 3AE9A 1L9DA 3ICRA 3FMWA 1E1MA 1L9CA 2W0HA 3CGDA 1H6VA 1ELIA 3KD9A 1CC6A 1HYUA 2A8XA 5KMRA 4Z25A 3DGHA 1E1NA 5GRTA 1GESA 3ALMA 2WOWA 1RSGA 4CCRA 5KOXA 1B4VA 3VR8A 1NHPA 1D5TA 3AYIA 2H88A 2XFNA 3GWDA 1N4UA 3KVEA 4GUVA 2RABA 3V76A 4B64A 2E4GA 4BV6A 1V59A 2WPFA 1PHHA 1K4QA 1GT8A 2RGHA 2ACZA 4B1BA 2WEUA 1LV0A 3AWIA 4GDPA 1CHUA 2JB3A 2JKCA 4H4RA 1F6MA 3K30A 4GF7A 2YG4A 3H8LA 3QFAA 3AD7B 2YLWA 3LJPA 4OPCA 1ZOVA 1TYPA 3NTAA 3SY4A 3LXDA 4J36A 1BGJA 3T37A 2XLTA 3KU9A 1Y56A 4BK2A 5HXIA 2NPXA 5IPYA 1GEUA 3VRBA 3AECA 4CY6A 1VRQB 4LA1A 2QA2A 2VQBA 1KSUA 2BRAA 4H4VA 4G6GA 2Y6RA 4HB9A 4YTNA 3NK1X 1OJCA 1TYTA 4M52A 4XWRA 3SZFA 3ADAB 1S3EA 4J56A 4UDRA 3CNTA 2E5VA 2GMJA 2OALA 5EOWA 2V3BA 2VVLG 3D8XA 4OPGA 4A99A 3NG7X 5J7XA 4YTPA 3KKJA 1H82A 2YLXA 1DOCA 1JRYA 2BACA 4ECHA 5DBJA 2R4EA 1ZX9A 1DXLA 2WP9A 3C4NA 4OPUA 3V3OA 3VR9A 4E0VA 3JSKA 4OPTA 2Y6QA 4H2NA 4TLZA 5CKUA 4BK1A 1VG9A 4D03A 2BCGG 2GVCA 5JCIA 3RP6A 2EQ7A 4K7ZA 3UTEA 2YLSA 4H4YA 4CY8A 3UTFA 5KMQA 5M10A 4YSZA 1IUUA 4FK1A 3CMMA 4U8MA 3NK0X 4NTDA 3P9UA 1OJDA 3G5RA 3UKHA 3LADA 2DKHA 4TM3A 1H86A 1QO8A 1L0VA 4JQ9A 3T0KA 5HY5A 4EIPA 4UDQA 1P2EA 4A7AA 3HYXA 4FX9A 2C67A 3S5WA 3SXIA 2VVLA 3RHAA 4D04A 3AE4A 2FJBA 2Q0LA 4U2TA 4DSGA 1S3BA 1GNDA 1CC2A 1PJ5A 2YWLA 1TDEA 3NHOX 2VRLA 2GR2A 4C3XA 4OCGA 1Z6LA 2BABA 2R45A 3AXBA 3UTHA 3GSIA 2EQ6A 4I58A 2YR4A 4Z44A 3SZWA 3UOZA 4ADWA 2V61A 4ZCCA 5JCKA 1B5QA 1H84A 1NAAA 3ICTA 2WDQA 2RGJA 1PS9A 2A89A 2WETA 3NGCX 2TMDA 4H4SA 1JRZA 2B7RA 1GSNA 1BKWA 4U8PA 3KPKA 1CF3A 1NG3A 4H4PA 4YKFA 4EM4A 3LB8A 2XLPA 4LU6A 2Q0KA 4GCMA 2OA1A 3VRDB 2GMHA 2AR8A 3NH3X 2XVFA 1K0JA 2DKIA 4C74A 4H4TA 1CL0A 4H2RA 2QAEA 2XYOA 4WCTA 2R9ZA 3BI2A 1EL9A 3AEEA 3OZ2A 5KVHA 3ZYXA 2C72A 1H83A 2Q7VA 2WP6A 4GAPA 5TR3A 5U25A 4A5LA 4CNJA 4YSYA 2WPEA 5KXJA 3SGLA 3UCLA 4REKA 1L9EA 1PJ7A 2X3NA 3D1CA 3NK2X 3L1RA 2YLTA 4Z2TA 2ZZCA 2BXRA 3GDPA 1DJQA 2GRTA 4A65A 3KA7A 3R9UA 4FDCB 3CNJA 4EM3A 3IWAA 4LIIA 4NEWA 4MJWA 3F8PA 2R0GA 4BJYA 3DK8A 2WOIA 1KF6A 1Y56B 4YTMA 1FEBA 3CGBA 3ABVA 3BHFA 2RGOA 5FS9A 5BRTA 1D4DA 3GWFA 4EMJA 4G74A 4H4ZA 3UOYA 1JOAA 4K5RA 3URHA 1B8SA 1TDNA 1FECA 2XVIA 2XDOA 4J34A 3B6DA 1TRBA 3BHKA 3ITJA 3KLJA 3VQRA 1JNZA 2B9XA 2Z5XA 1KNRA 4O5UA 1H7XA 3NLCA 2XVJA 2WPCA 1LQTA 1YQ3A 3AE2A 1ZK7A 1EL7A 5L46A 4RG4A 3DGZA 3UKAA 4AOSA 4U8OA 1GRTA 4U8IA 4IV9A 3GRTA 3AEBA 2I0ZA 1KFYA 1GTHA 2GEWA 4TM0A 1PBBA 1ZMCA 3AD8B 4IA6A 5KOWA 2V3AA 5KWFA 4YXDA 2ARDA 4ZCDA 1GPEA 2JAEA 2C75A 1IUXA 1K0IA 3F8RA 5FMHA 1NENA 4RSLA 2Q6UA 3II4A 3CIRA 3EPTA 4K2XA 1KDGA 1XANA 1PJ6A 3EANA 4IA5A 5U63A 2B7SA 1N1PA 5FS7A 2C65A 2ZZBA 3SYIA 1PBEA 1IJHA 3EF6A 1GRGA 1JEHA 2GF3A 2GV8A 3QSSA 4H4WA 2YQUA 2YAUA 1E1KA 4BK3A 2JB2A 2EQ9A 2AAQA 3P4SA 2EQ8A 2R0CA 3GD4A 4H4XA 3FG2P 4PABA 4YWOA 5FS6A 4A6NA 4II2A 1ZKQA 4J2WA 1H7WA 1VQWA 3DK4A 5JCMA 3AE5A 2YVFA 2VVMA 1RYIA 2YM2A 3P4PA 1GRFA 3NRNA 2GAHB 3NT6A 1O5WA 2WU2A 1MO9A 2X99A 4I59A 1O95A 3ALLA 3NYEA 2F5ZA 3NN6X 2IIDA 1GOSA 3C96A 4K5SA 2C3CA 2OLOA 1S2YA 2GAGB 3QFBA 3ZDNA 1YQZA 3CTYA 2BS2A 3BNMA 2BK4A 4BURA 2WP5A 3T2ZA 3IC9A 1EL8A 3GRSA 1XDIA 4U8JA 2JBVA 1B37A 5ER0A 1MOKA 3AE3A 3WE0A 1YKJA 3IHMA 4FK1C 3GD3A 2GQFA 3M13A 3G5QA 4OPIA 4U2SA 4ZN0A 2FJEA 3UKPA 1DJNA 3DJEA 1DOEA 2J3NA 3BI5A 1D4CA 3NN0X 3ALJA 1FOHA 3C4AA 1FCDA 1LTXR 2BC0A 4XWZA 2C64A 4Z2RA 3CNSA 2BS4A 2BXSA 3RNMA 2BS3A 2YVGA 1GV4A 4TM1A 5GSNA 3UKQA 3FBSA 3GDNA 4DNAA 2BK5A 3I3LA 4AP3A 2C76A 3DA1A 2VOUA 3P1WA 1DODA 2R46A 2YG5A 3AD9B 4U2LA 1CJ3A 4WX1A 2XLRA 4YKGA 1CJ4A 4B66A 5HHFA 1BF3A 1PBDA 4X9MA 3UKLA 3NKSA 3P4RA 4Y4MA 3HZLA 2PHHA 3E1TA 2CFYA 1IUSA 1O94A 2YR5A 2X50A 4IVOB 5KMPA 2C73A 4H50A 5C2TA 4YT0A 3NIXA 2XLSA 3RP8A 4NEVA 3LZWA 4A9WA 1NPXA 3IF9A 3UKFA 1GRBA 1K0LA 1P2HA 4HA6A 3FPZA 4B68A 1ZP0A 4H4UA 5JCNA 1MXTA 2R0PA 3COXA 3FIMB 4EMIA 1JU2A 5CQFA 2XVHA 1D4EA 3L8KA 3RP7A 2YM1A 4B67A 4PAAA 4JY2A 1H81A 4K8DA 1GREA 1N4WA 4UP3A 2B76A 2ZBWA 4OPDA 4TM4A 1PBFA 3CN8A 1EL5A 4JN9A 4G6HA 4GDEA 1REOA 2WESA 1JNRA 1NEKA 3AEDA 4G73A 4NTEA 2ZZ0A 2X8HA 2WU5A 4CRTA 3CPHG 4G9KA 4BJZA 1LPFA 1ZDLA 1QLBA 4J31A 1NDAA 1TDKA 2B9WA 4DGKA 1OJ9A 2XFQA 2X8GA 3UTGA 4CNKA 3ATQA 5C3JA 1X31B 4EQSA 5IQ4A 4YSXA 1PN0A 3PS9A 1YY5A 3AE1A 1CC4A 2WDVA 3S61A 3HYWA 3GYIA 5HYMA 2WDRA 2XCGA 4H7UA 1NHRA 5KRQA 3CGEA 2CDUA 1S2QA 4U8KA 3AE8A 3AYLA 1M6IA 2XFUA 2V5ZA 3M12A 1FL2A 4P9SA 4U8NA 3SM8A 1SEZA 1W4XA 4JDRA 3AEGA 1N4VA 1F8RA 3CPJG 2X8CA 2NVKX 4XXGA 3UP5A 1EBDA 1COYA 1Q1WA 4NTCA 3SQPA 2IVDA 2BC1A 2WQYA 3NYFA 2WHDA 4J57A 5EB4A 3V3NA 3GYXA 2IVEA 1CJCA 1F8WA 1NG4A 2QA1A 2YLRA 4EIQA 2AQJA 2XFOA 1YQ4A 3PO7A 2BRYA 1ZY8A 4AT2A 3SZCA 2C70A 2H89A 1GALA 2V60A 3AB1A 3CGCA 1PXCA 4II3A 1RP0A 4N9XA 1M64A 4OVIA 5J60A 1LJ1A 2B9YA 4ICYA 1GRAA 3DK9A 3UKKA 1KSSA 3CNPA 1E7PA 4YSHA 2HQMA 3QSEA 4GAVA 1UKVG 4AT0A 2YG7A 4EQWA 3K7QX 4IVMB 4CCQA 3UOXA 4TLXA 2XFPA 2C4CA 3AE7A 3SFDA 2YG6A 1BWCA 3I6DA 4O5QA 4GR1A 4DSHA 5KMSA 4UDPA 2PYXA 1CJ2A 2GQWA 5LV9A 1DNCA 3DJGX 2OLNA 3O0HA 4C77A 2BA9A 2TPRA 1QJDA 3P4QA 3GYJA 1GETA 3DH9A 4J33A 4AOXA 4EMWA 2XVEA 4A6NB 4A79A 4Y4NA 5JCLA 1GXFA 3DMEA 2GH5A 2WOVA 2XLUA 1VG0A 1PXAA 1PXBA 5KVIA 4APNA 2CVJA 3SZ0A 4JNQA 1LVLA 3REDA 4KX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUL A;  1TDO A;  3M0O A;  2YG3 A;  1GER A;  3G5S A;  3AE6 A;  2JK6 A;  4Z43 A;  3PVC A;  4USR A;  3BNU A;  1AOG A;  2UZZ A;  2C66 A;  3CPI G;  4KPR A;  3UOV A;  1F3P A;  3AYJ A;  2R4J A;  4B63 A;  3AEF A;  4EQR A;  3KPF A;  4U8L A;  3QVP A;  2FBW A;  3DJD A;  4Z26 A;  3Q9T A;  4USQ A;  2BCP A;  1BZL A;  1E1L A;  3K7T A;  3Q6J A;  2YR6 A;  3H4K A;  1F8S A;  4X9N A;  2V6O A;  3QJ4 A;  1E39 A;  1FEA A;  2C7G A;  3AEA A;  1PDH A;  3LOV A;  1Q1R A;  3ICS A;  1VDC A;  1Y0P A;  4Z24 A;  1NHS A;  3BI4 A;  3UP4 A;  4AP1 A;  5IQ1 A;  4K22 A;  1OJA A;  1XPQ A;  2GR3 A;  3NYC A;  4CBQ A;  1DOB A;  2E1M A;  5BUL A;  4JNA A;  5BUK A;  2YLZ A;  2JB1 A;  4Y4L A;  1E6E A;  1IUW A;  2VQ7 A;  3ISH A;  3GMB A;  1TDF A;  1D7Y A;  4B65 A;  5EB5 A;  3QSM A;  3VRA A;  1BGN A;  2FJD A;  3F8D A;  2GR0 A;  1LQU A;  4GRT A;  4H2P A;  2APG A;  2Z5Y A;  1GTE A;  1ZMD A;  3H8I A;  1CBO A;  5U1O A;  3SFE A;  1OJT A;  4H4Q A;  2VRM A;  3OC4 A;  1XHC A;  3K7M X;  4C3Y A;  2QCU A;  3CND A;  1PBC A;  5EBK A;  4C5O A;  4OPL A;  5BVA A;  2GB0 A;  1NHQ A;  2GR1 A;  2C3D A;  4RG3 A;  2O9Z A;  1IUV A;  2BK3 A;  1JRX A;  3IHG A;  4B69 A;  1IUT A;  3NTD A;  2BYB A;  3DJJ A;  3EAO A;  3LZX A;  1ONF A;  3B3R A;  2WBA A;  2VZ2 A;  4EQX A;  5FS8 A;  2OAM A;  2WS3 A;  4Z2U A;  2FJA A;  2YVJ A;  4JY3 A;  4NZH A;  5M0Z A;  4H2Q A;  4X4J A;  1D7L A;  1KNP A;  3NNE A;  1GRH A;  1Q9I A;  3QVR A;  1ZOY A;  3GMC A;  3ATR A;  2A87 A;  3AE9 A;  1L9D A;  3ICR A;  3FMW A;  1E1M A;  1L9C A;  2W0H A;  3CGD A;  1H6V A;  1ELI A;  3KD9 A;  1CC6 A;  1HYU A;  2A8X A;  4Z25 A;  3DGH A;  1E1N A;  5GRT A;  1GES A;  3ALM A;  2WOW A;  1RSG A;  4CCR A;  5KOX A;  1B4V A;  3VR8 A;  1NHP A;  1D5T A;  3AYI A;  2H88 A;  2XFN A;  3GWD A;  1N4U A;  3KVE A;  4GUV A;  2RAB A;  3V76 A;  4B64 A;  2E4G A;  4BV6 A;  1V59 A;  2WPF A;  1PHH A;  1K4Q A;  1GT8 A;  2RGH A;  2ACZ A;  4B1B A;  2WEU A;  1LV0 A;  3AWI A;  4GDP A;  1CHU A;  2JB3 A;  2JKC A;  4H4R A;  1F6M A;  3K30 A;  4GF7 A;  2YG4 A;  3H8L A;  3QFA A;  3AD7 B;  2YLW A;  3LJP A;  4OPC A;  1ZOV A;  1TYP A;  3NTA A;  3LXD A;  4J36 A;  1BGJ A;  3T37 A;  2XLT A;  3KU9 A;  1Y56 A;  4BK2 A;  5HXI A;  2NPX A;  5IPY A;  1GEU A;  3VRB A;  3AEC A;  4CY6 A;  1VRQ B;  4LA1 A;  2QA2 A;  2VQB A;  1KSU A;  4H4V A;  4HB9 A;  4YTN A;  2Y6R A;  3NK1 X;  1OJC A;  1TYT A;  4M52 A;  4XWR A;  3ADA B;  1S3E A;  4J56 A;  4UDR A;  3CNT A;  2E5V A;  2GMJ A;  2OAL A;  5EOW A;  2V3B A;  2VVL G;  3D8X A;  4OPG A;  4A99 A;  3NG7 X;  5J7X A;  4YTP A;  3KKJ A;  1H82 A;  2YLX A;  1DOC A;  1JRY A;  2BAC A;  4ECH A;  5DBJ A;  2R4E A;  1ZX9 A;  1DXL A;  2WP9 A;  3C4N A;  4OPU A;  3V3O A;  3VR9 A;  4E0V A;  3JSK A;  4OPT A;  2Y6Q A;  4H2N A;  4TLZ A;  5CKU A;  4BK1 A;  1VG9 A;  4D03 A;  2BCG G;  2GVC A;  5JCI A;  3RP6 A;  2EQ7 A;  4K7Z A;  3UTE A;  2YLS A;  4H4Y A;  4CY8 A;  3UTF A;  5M10 A;  4YSZ A;  1IUU A;  4FK1 A;  4U8M A;  3NK0 X;  4NTD A;  3P9U A;  1OJD A;  3G5R A;  3UKH A;  3LAD A;  2DKH A;  4TM3 A;  1H86 A;  1QO8 A;  1L0V A;  4JQ9 A;  5HY5 A;  4EIP A;  4UDQ A;  1P2E A;  4A7A A;  4FX9 A;  3S5W A;  2C67 A;  2VVL A;  3RHA A;  4D04 A;  3AE4 A;  2FJB A;  2Q0L A;  4U2T A;  4DSG A;  1S3B A;  1GND A;  1CC2 A;  1PJ5 A;  2YWL A;  1TDE A;  3NHO X;  2VRL A;  2GR2 A;  4C3X A;  4OCG A;  1Z6L A;  2BAB A;  2R45 A;  3AXB A;  3UTH A;  3GSI A;  2EQ6 A;  4I58 A;  2YR4 A;  4Z44 A;  3UOZ A;  4ADW A;  2V61 A;  4ZCC A;  5JCK A;  1B5Q A;  1H84 A;  1NAA A;  3ICT A;  2WDQ A;  2RGJ A;  1PS9 A;  2A89 A;  2WET A;  3NGC X;  2TMD A;  4H4S A;  1JRZ A;  2B7R A;  1GSN A;  1BKW A;  4U8P A;  1CF3 A;  1NG3 A;  4H4P A;  4YKF A;  4EM4 A;  3LB8 A;  2XLP A;  4LU6 A;  2Q0K A;  4GCM A;  2OA1 A;  3VRD B;  2GMH A;  2AR8 A;  3NH3 X;  2XVF A;  1K0J A;  2DKI A;  4C74 A;  4H4T A;  1CL0 A;  4H2R A;  2QAE A;  2XYO A;  4WCT A;  2R9Z A;  3BI2 A;  1EL9 A;  3AEE A;  3OZ2 A;  5KVH A;  3ZYX A;  2C72 A;  1H83 A;  2Q7V A;  2WP6 A;  5TR3 A;  5U25 A;  4A5L A;  4CNJ A;  4YSY A;  2WPE A;  5KXJ A;  3SGL A;  3UCL A;  4REK A;  1L9E A;  1PJ7 A;  2X3N A;  3D1C A;  3NK2 X;  3L1R A;  2YLT A;  4Z2T A;  2ZZC A;  2BXR A;  3GDP A;  1DJQ A;  2GRT A;  4A65 A;  3KA7 A;  3R9U A;  4FDC B;  3CNJ A;  4EM3 A;  3IWA A;  4LII A;  4NEW A;  4MJW A;  3F8P A;  2R0G A;  4BJY A;  3DK8 A;  2WOI A;  1KF6 A;  1Y56 B;  4YTM A;  1FEB A;  3CGB A;  3ABV A;  3BHF A;  2RGO A;  5FS9 A;  5BRT A;  1D4D A;  3GWF A;  4EMJ A;  4H4Z A;  3UOY A;  1JOA A;  4K5R A;  3URH A;  1B8S A;  1TDN A;  1FEC A;  2XVI A;  2XDO A;  4J34 A;  3B6D A;  1TRB A;  3BHK A;  3ITJ A;  3KLJ A;  3VQR A;  1JNZ A;  2B9X A;  2Z5X A;  1KNR A;  4O5U A;  1H7X A;  3NLC A;  2XVJ A;  2WPC A;  1LQT A;  1YQ3 A;  3AE2 A;  1ZK7 A;  1EL7 A;  5L46 A;  4RG4 A;  3DGZ A;  3UKA A;  4AOS A;  4U8O A;  1GRT A;  4U8I A;  4IV9 A;  3GRT A;  3AEB A;  2I0Z A;  1KFY A;  1GTH A;  2GEW A;  4TM0 A;  1PBB A;  1ZMC A;  3AD8 B;  4IA6 A;  5KOW A;  2V3A A;  5KWF A;  4YXD A;  2ARD A;  4ZCD A;  1GPE A;  2JAE A;  2C75 A;  1IUX A;  1K0I A;  3F8R A;  5FMH A;  1NEN A;  4RSL A;  2Q6U A;  3II4 A;  3CIR A;  3EPT A;  4K2X A;  1KDG A;  1XAN A;  1PJ6 A;  3EAN A;  4IA5 A;  5U63 A;  2B7S A;  1N1P A;  5FS7 A;  2C65 A;  2ZZB A;  1PBE A;  1IJH A;  3EF6 A;  1GRG A;  1JEH A;  2GF3 A;  2GV8 A;  3QSS A;  4H4W A;  2YQU A;  2YAU A;  1E1K A;  4BK3 A;  2JB2 A;  2EQ9 A;  2AAQ A;  3P4S A;  2EQ8 A;  2R0C A;  3GD4 A;  4H4X A;  3FG2 P;  4PAB A;  4YWO A;  5FS6 A;  4A6N A;  1ZKQ A;  4J2W A;  1H7W A;  1VQW A;  3DK4 A;  5JCM A;  3AE5 A;  2YVF A;  2VVM A;  1RYI A;  2YM2 A;  3P4P A;  1GRF A;  3NRN A;  2GAH B;  3NT6 A;  1O5W A;  2WU2 A;  1MO9 A;  2X99 A;  4I59 A;  1O95 A;  3ALL A;  3NYE A;  2F5Z A;  3NN6 X;  2IID A;  1GOS A;  3C96 A;  4K5S A;  2C3C A;  2OLO A;  1S2Y A;  2GAG B;  3QFB A;  3ZDN A;  1YQZ A;  3CTY A;  2BS2 A;  3BNM A;  2BK4 A;  4BUR A;  2WP5 A;  3IC9 A;  1EL8 A;  3GRS A;  1XDI A;  4U8J A;  2JBV A;  1B37 A;  5ER0 A;  1MOK A;  3AE3 A;  3WE0 A;  1YKJ A;  3IHM A;  4FK1 C;  3GD3 A;  2GQF A;  3M13 A;  3G5Q A;  4OPI A;  4U2S A;  4ZN0 A;  2FJE A;  3UKP A;  1DJN A;  3DJE A;  1DOE A;  2J3N A;  3BI5 A;  1D4C A;  3NN0 X;  3ALJ A;  1FOH A;  3C4A A;  1FCD A;  1LTX R;  2BC0 A;  4XWZ A;  2C64 A;  4Z2R A;  3CNS A;  2BS4 A;  2BXS A;  3RNM A;  2BS3 A;  2YVG A;  1GV4 A;  4TM1 A;  5GSN A;  3UKQ A;  3FBS A;  3GDN A;  4DNA A;  2BK5 A;  3I3L A;  4AP3 A;  2C76 A;  3DA1 A;  2VOU A;  3P1W A;  1DOD A;  2R46 A;  2YG5 A;  3AD9 B;  4U2L A;  1CJ3 A;  4WX1 A;  2XLR A;  4YKG A;  1CJ4 A;  4B66 A;  5HHF A;  1BF3 A;  1PBD A;  4X9M A;  3UKL A;  3NKS A;  3P4R A;  4Y4M A;  3HZL A;  2PHH A;  3E1T A;  2CFY A;  1IUS A;  1O94 A;  2YR5 A;  2X50 A;  4IVO B;  2C73 A;  4H50 A;  5C2T A;  4YT0 A;  3NIX A;  2XLS A;  3RP8 A;  4NEV A;  3LZW A;  4A9W A;  1NPX A;  3IF9 A;  3UKF A;  1GRB A;  1K0L A;  1P2H A;  4HA6 A;  3FPZ A;  4B68 A;  1ZP0 A;  4H4U A;  5JCN A;  1MXT A;  2R0P A;  3COX A;  3FIM B;  4EMI A;  1JU2 A;  5CQF A;  2XVH A;  1D4E A;  3L8K A;  3RP7 A;  2YM1 A;  4B67 A;  4PAA A;  4JY2 A;  1H81 A;  4K8D A;  1GRE A;  1N4W A;  4UP3 A;  2B76 A;  2ZBW A;  4OPD A;  4TM4 A;  1PBF A;  3CN8 A;  1EL5 A;  4JN9 A;  4GDE A;  1REO A;  2WES A;  1JNR A;  1NEK A;  3AED A;  4NTE A;  2ZZ0 A;  2X8H A;  2WU5 A;  4CRT A;  3CPH G;  4BJZ A;  1LPF A;  1ZDL A;  1QLB A;  4J31 A;  1NDA A;  1TDK A;  2B9W A;  4DGK A;  1OJ9 A;  2XFQ A;  2X8G A;  3UTG A;  4CNK A;  3ATQ A;  5C3J A;  1X31 B;  4EQS A;  5IQ4 A;  4YSX A;  1PN0 A;  3PS9 A;  1YY5 A;  3AE1 A;  1CC4 A;  2WDV A;  3S61 A;  5HYM A;  3GYI A;  2WDR A;  2XCG A;  4H7U A;  1NHR A;  5KRQ A;  3CGE A;  2CDU A;  1S2Q A;  4U8K A;  3AE8 A;  3AYL A;  1M6I A;  2XFU A;  2V5Z A;  3M12 A;  1FL2 A;  4P9S A;  4U8N A;  3SM8 A;  1SEZ A;  1W4X A;  4JDR A;  3AEG A;  1N4V A;  1F8R A;  3CPJ G;  2X8C A;  2NVK X;  4XXG A;  3UP5 A;  1EBD A;  1COY A;  1Q1W A;  4NTC A;  3SQP A;  2IVD A;  2BC1 A;  2WQY A;  3NYF A;  2WHD A;  4J57 A;  5EB4 A;  3V3N A;  2IVE A;  1CJC A;  1F8W A;  1NG4 A;  2QA1 A;  2YLR A;  4EIQ A;  2AQJ A;  2XFO A;  1YQ4 A;  3PO7 A;  1ZY8 A;  4AT2 A;  2C70 A;  2H89 A;  1GAL A;  2V60 A;  3AB1 A;  3CGC A;  1PXC A;  4N9X A;  1RP0 A;  4OVI A;  1M64 A;  5J60 A;  1LJ1 A;  2B9Y A;  4ICY A;  1GRA A;  3DK9 A;  3UKK A;  1KSS A;  3CNP A;  1E7P A;  4YSH A;  2HQM A;  3QSE A;  1UKV G;  4AT0 A;  2YG7 A;  4EQW A;  3K7Q X;  4IVM B;  4CCQ A;  3UOX A;  4TLX A;  2XFP A;  3AE7 A;  3SFD A;  2YG6 A;  1BWC A;  3I6D A;  4O5Q A;  4GR1 A;  4DSH A;  4UDP A;  2PYX A;  1CJ2 A;  2GQW A;  5LV9 A;  1DNC A;  3DJG X;  2OLN A;  3O0H A;  4C77 A;  2BA9 A;  2TPR A;  1QJD A;  3P4Q A;  3GYJ A;  1GET A;  3DH9 A;  4J33 A;  4AOX A;  4EMW A;  2XVE A;  4A6N B;  4A79 A;  4Y4N A;  5JCL A;  1GXF A;  3DME A;  2GH5 A;  2WOV A;  2XLU A;  1VG0 A;  1PXA A;  1PXB A;  5KVI A;  4APN A;  2CVJ A;  4JNQ A;  1LVL A;  3RED A;  4KX6 A; 
#chains in the Genus database with same CATH topology
 2CUL A;  1TDO A;  3M0O A;  3HYV A;  2YG3 A;  1GER A;  3G5S A;  3AE6 A;  2JK6 A;  4Z43 A;  3PVC A;  3T14 A;  4USR A;  3BNU A;  1AOG A;  2UZZ A;  2C66 A;  3CPI G;  4KPR A;  3UOV A;  1F3P A;  3AYJ A;  2R4J A;  4B63 A;  3AEF A;  4EQR A;  3KPF A;  4U8L A;  3QVP A;  2FBW A;  3DJD A;  4NNJ A;  4Z26 A;  3Q9T A;  4USQ A;  2BCP A;  1BZL A;  1E1L A;  3K7T A;  3Q6J A;  2YR6 A;  3H4K A;  1F8S A;  4X9N A;  2V6O A;  3QJ4 A;  1E39 A;  1FEA A;  2C7G A;  3AEA A;  1PDH A;  3LOV A;  1Q1R A;  3ICS A;  1VDC A;  1Y0P A;  4Z24 A;  1NHS A;  3BI4 A;  3UP4 A;  4AP1 A;  5IQ1 A;  4K22 A;  1OJA A;  1XPQ A;  2GR3 A;  3NYC A;  4NWZ A;  4CBQ A;  1DOB A;  2E1M A;  5BUL A;  4JNA A;  5BUK A;  2YLZ A;  2JB1 A;  4Y4L A;  1E6E A;  1IUW A;  2VQ7 A;  3ISH A;  3GMB A;  1TDF A;  1D7Y A;  4B65 A;  5EB5 A;  3QSM A;  3VRA A;  1BGN A;  2FJD A;  3F8D A;  2GR0 A;  1LQU A;  4GRT A;  4H2P A;  2APG A;  2Z5Y A;  1GTE A;  1ZMD A;  3H8I A;  1CBO A;  5U1O A;  3SFE A;  1OJT A;  4H4Q A;  3SX6 A;  2VRM A;  3OC4 A;  1XHC A;  3K7M X;  4C3Y A;  2QCU A;  3CND A;  1PBC A;  5EBK A;  4C5O A;  4OPL A;  5BVA A;  2GB0 A;  1NHQ A;  2GR1 A;  2C3D A;  4RG3 A;  2O9Z A;  1IUV A;  2BK3 A;  1JRX A;  3IHG A;  4B69 A;  1IUT A;  3NTD A;  2BYB A;  3DJJ A;  3EAO A;  3LZX A;  1ONF A;  3B3R A;  3T2Y A;  2WBA A;  2VZ2 A;  4EQX A;  5FS8 A;  2OAM A;  2WS3 A;  4Z2U A;  2FJA A;  2YVJ A;  4JY3 A;  4NZH A;  5M0Z A;  4H2Q A;  4X4J A;  1D7L A;  1KNP A;  3NNE A;  1GRH A;  3T31 A;  1Q9I A;  5KNL A;  3QVR A;  3T2K A;  1ZOY A;  3GMC A;  3ATR A;  2A87 A;  3AE9 A;  1L9D A;  3ICR A;  3FMW A;  1E1M A;  1L9C A;  2W0H A;  3CGD A;  1H6V A;  1ELI A;  3KD9 A;  1CC6 A;  1HYU A;  2A8X A;  5KMR A;  4Z25 A;  3DGH A;  1E1N A;  5GRT A;  1GES A;  3ALM A;  2WOW A;  1RSG A;  4CCR A;  5KOX A;  1B4V A;  3VR8 A;  1NHP A;  1D5T A;  3AYI A;  2H88 A;  2XFN A;  3GWD A;  1N4U A;  3KVE A;  4GUV A;  2RAB A;  3V76 A;  4B64 A;  2E4G A;  4BV6 A;  1V59 A;  2WPF A;  1PHH A;  1K4Q A;  1GT8 A;  2RGH A;  2ACZ A;  4B1B A;  2WEU A;  1LV0 A;  3AWI A;  4GDP A;  1CHU A;  2JB3 A;  2JKC A;  4H4R A;  1F6M A;  3K30 A;  4GF7 A;  2YG4 A;  3H8L A;  3QFA A;  3AD7 B;  2YLW A;  3LJP A;  4OPC A;  1ZOV A;  1TYP A;  3NTA A;  3SY4 A;  3LXD A;  4J36 A;  1BGJ A;  3T37 A;  2XLT A;  3KU9 A;  1Y56 A;  4BK2 A;  5HXI A;  2NPX A;  5IPY A;  1GEU A;  3VRB A;  3AEC A;  4CY6 A;  1VRQ B;  4LA1 A;  2QA2 A;  2VQB A;  1KSU A;  2BRA A;  4H4V A;  4G6G A;  2Y6R A;  4HB9 A;  4YTN A;  3NK1 X;  1OJC A;  1TYT A;  4M52 A;  4XWR A;  3SZF A;  3ADA B;  1S3E A;  4J56 A;  4UDR A;  3CNT A;  2E5V A;  2GMJ A;  2OAL A;  5EOW A;  2V3B A;  2VVL G;  3D8X A;  4OPG A;  4A99 A;  3NG7 X;  5J7X A;  4YTP A;  3KKJ A;  1H82 A;  2YLX A;  1DOC A;  1JRY A;  2BAC A;  4ECH A;  5DBJ A;  2R4E A;  1ZX9 A;  1DXL A;  2WP9 A;  3C4N A;  4OPU A;  3V3O A;  3VR9 A;  4E0V A;  3JSK A;  4OPT A;  2Y6Q A;  4H2N A;  4TLZ A;  5CKU A;  4BK1 A;  1VG9 A;  4D03 A;  2BCG G;  2GVC A;  5JCI A;  3RP6 A;  2EQ7 A;  4K7Z A;  3UTE A;  2YLS A;  4H4Y A;  4CY8 A;  3UTF A;  5KMQ A;  5M10 A;  4YSZ A;  1IUU A;  4FK1 A;  3CMM A;  4U8M A;  3NK0 X;  4NTD A;  3P9U A;  1OJD A;  3G5R A;  3UKH A;  3LAD A;  2DKH A;  4TM3 A;  1H86 A;  1QO8 A;  1L0V A;  4JQ9 A;  3T0K A;  5HY5 A;  4EIP A;  4UDQ A;  1P2E A;  4A7A A;  3HYX A;  4FX9 A;  2C67 A;  3S5W A;  3SXI A;  2VVL A;  3RHA A;  4D04 A;  3AE4 A;  2FJB A;  2Q0L A;  4U2T A;  4DSG A;  1S3B A;  1GND A;  1CC2 A;  1PJ5 A;  2YWL A;  1TDE A;  3NHO X;  2VRL A;  2GR2 A;  4C3X A;  4OCG A;  1Z6L A;  2BAB A;  2R45 A;  3AXB A;  3UTH A;  3GSI A;  2EQ6 A;  4I58 A;  2YR4 A;  4Z44 A;  3SZW A;  3UOZ A;  4ADW A;  2V61 A;  4ZCC A;  5JCK A;  1B5Q A;  1H84 A;  1NAA A;  3ICT A;  2WDQ A;  2RGJ A;  1PS9 A;  2A89 A;  2WET A;  3NGC X;  2TMD A;  4H4S A;  1JRZ A;  2B7R A;  1GSN A;  1BKW A;  4U8P A;  3KPK A;  1CF3 A;  1NG3 A;  4H4P A;  4YKF A;  4EM4 A;  3LB8 A;  2XLP A;  4LU6 A;  2Q0K A;  4GCM A;  2OA1 A;  3VRD B;  2GMH A;  2AR8 A;  3NH3 X;  2XVF A;  1K0J A;  2DKI A;  4C74 A;  4H4T A;  1CL0 A;  4H2R A;  2QAE A;  2XYO A;  4WCT A;  2R9Z A;  3BI2 A;  1EL9 A;  3AEE A;  3OZ2 A;  5KVH A;  3ZYX A;  2C72 A;  1H83 A;  2Q7V A;  2WP6 A;  4GAP A;  5TR3 A;  5U25 A;  4A5L A;  4CNJ A;  4YSY A;  2WPE A;  5KXJ A;  3SGL A;  3UCL A;  4REK A;  1L9E A;  1PJ7 A;  2X3N A;  3D1C A;  3NK2 X;  3L1R A;  2YLT A;  4Z2T A;  2ZZC A;  2BXR A;  3GDP A;  1DJQ A;  2GRT A;  4A65 A;  3KA7 A;  3R9U A;  4FDC B;  3CNJ A;  4EM3 A;  3IWA A;  4LII A;  4NEW A;  4MJW A;  3F8P A;  2R0G A;  4BJY A;  3DK8 A;  2WOI A;  1KF6 A;  1Y56 B;  4YTM A;  1FEB A;  3CGB A;  3ABV A;  3BHF A;  2RGO A;  5FS9 A;  5BRT A;  1D4D A;  3GWF A;  4EMJ A;  4G74 A;  4H4Z A;  3UOY A;  1JOA A;  4K5R A;  3URH A;  1B8S A;  1TDN A;  1FEC A;  2XVI A;  2XDO A;  4J34 A;  3B6D A;  1TRB A;  3BHK A;  3ITJ A;  3KLJ A;  3VQR A;  2B9X A;  1JNZ A;  2Z5X A;  1KNR A;  4O5U A;  1H7X A;  3NLC A;  2XVJ A;  2WPC A;  1LQT A;  1YQ3 A;  3AE2 A;  1ZK7 A;  1EL7 A;  5L46 A;  4RG4 A;  3DGZ A;  3UKA A;  4AOS A;  4U8O A;  1GRT A;  4U8I A;  4IV9 A;  3GRT A;  3AEB A;  2I0Z A;  1KFY A;  1GTH A;  2GEW A;  4TM0 A;  1PBB A;  1ZMC A;  3AD8 B;  4IA6 A;  5KOW A;  2V3A A;  5KWF A;  4YXD A;  2ARD A;  4ZCD A;  1GPE A;  2JAE A;  2C75 A;  1IUX A;  1K0I A;  3F8R A;  5FMH A;  1NEN A;  4RSL A;  2Q6U A;  3II4 A;  3CIR A;  3EPT A;  4K2X A;  1KDG A;  1XAN A;  1PJ6 A;  3EAN A;  4IA5 A;  5U63 A;  2B7S A;  1N1P A;  5FS7 A;  2C65 A;  2ZZB A;  3SYI A;  1PBE A;  1IJH A;  3EF6 A;  1GRG A;  1JEH A;  2GF3 A;  2GV8 A;  3QSS A;  4H4W A;  2YQU A;  2YAU A;  1E1K A;  4BK3 A;  2JB2 A;  2EQ9 A;  2AAQ A;  3P4S A;  2EQ8 A;  2R0C A;  3GD4 A;  4H4X A;  3FG2 P;  4PAB A;  4YWO A;  5FS6 A;  4A6N A;  4II2 A;  1ZKQ A;  4J2W A;  1H7W A;  1VQW A;  3DK4 A;  5JCM A;  3AE5 A;  2YVF A;  2VVM A;  1RYI A;  2YM2 A;  3P4P A;  1GRF A;  3NRN A;  2GAH B;  3NT6 A;  1O5W A;  2WU2 A;  1MO9 A;  2X99 A;  4I59 A;  1O95 A;  3ALL A;  3NYE A;  2F5Z A;  3NN6 X;  2IID A;  1GOS A;  3C96 A;  4K5S A;  2C3C A;  2OLO A;  1S2Y A;  2GAG B;  3QFB A;  3ZDN A;  1YQZ A;  3CTY A;  2BS2 A;  3BNM A;  2BK4 A;  4BUR A;  2WP5 A;  3T2Z A;  3IC9 A;  1EL8 A;  3GRS A;  1XDI A;  4U8J A;  2JBV A;  1B37 A;  5ER0 A;  1MOK A;  3AE3 A;  3WE0 A;  1YKJ A;  3IHM A;  4FK1 C;  3GD3 A;  2GQF A;  3M13 A;  3G5Q A;  4OPI A;  4U2S A;  4ZN0 A;  2FJE A;  3UKP A;  1DJN A;  3DJE A;  1DOE A;  2J3N A;  3BI5 A;  1D4C A;  3NN0 X;  3ALJ A;  1FOH A;  3C4A A;  1FCD A;  1LTX R;  2BC0 A;  4XWZ A;  2C64 A;  4Z2R A;  3CNS A;  2BS4 A;  2BXS A;  3RNM A;  2BS3 A;  2YVG A;  1GV4 A;  4TM1 A;  5GSN A;  3UKQ A;  3FBS A;  3GDN A;  4DNA A;  2BK5 A;  3I3L A;  4AP3 A;  2C76 A;  3DA1 A;  2VOU A;  3P1W A;  1DOD A;  2R46 A;  2YG5 A;  3AD9 B;  4U2L A;  1CJ3 A;  4WX1 A;  2XLR A;  4YKG A;  1CJ4 A;  4B66 A;  5HHF A;  1BF3 A;  1PBD A;  4X9M A;  3UKL A;  3NKS A;  3P4R A;  4Y4M A;  3HZL A;  2PHH A;  3E1T A;  2CFY A;  1IUS A;  1O94 A;  2YR5 A;  2X50 A;  4IVO B;  5KMP A;  2C73 A;  4H50 A;  5C2T A;  4YT0 A;  3NIX A;  2XLS A;  3RP8 A;  4NEV A;  3LZW A;  4A9W A;  1NPX A;  3IF9 A;  3UKF A;  1GRB A;  1K0L A;  1P2H A;  4HA6 A;  3FPZ A;  4B68 A;  1ZP0 A;  4H4U A;  5JCN A;  1MXT A;  2R0P A;  3COX A;  3FIM B;  4EMI A;  1JU2 A;  5CQF A;  2XVH A;  1D4E A;  3L8K A;  3RP7 A;  2YM1 A;  4B67 A;  4PAA A;  4JY2 A;  1H81 A;  4K8D A;  1GRE A;  1N4W A;  4UP3 A;  2B76 A;  2ZBW A;  4OPD A;  4TM4 A;  1PBF A;  3CN8 A;  1EL5 A;  4JN9 A;  4G6H A;  4GDE A;  1REO A;  2WES A;  1JNR A;  1NEK A;  3AED A;  4G73 A;  4NTE A;  2ZZ0 A;  2X8H A;  2WU5 A;  4CRT A;  3CPH G;  4G9K A;  4BJZ A;  1LPF A;  1ZDL A;  1QLB A;  4J31 A;  2B9W A;  1TDK A;  1NDA A;  4DGK A;  1OJ9 A;  2XFQ A;  2X8G A;  3UTG A;  4CNK A;  3ATQ A;  5C3J A;  1X31 B;  4EQS A;  5IQ4 A;  4YSX A;  1PN0 A;  3PS9 A;  1YY5 A;  3AE1 A;  1CC4 A;  2WDV A;  3S61 A;  3HYW A;  3GYI A;  5HYM A;  2WDR A;  2XCG A;  4H7U A;  1NHR A;  5KRQ A;  3CGE A;  2CDU A;  1S2Q A;  4U8K A;  3AE8 A;  3AYL A;  1M6I A;  2XFU A;  2V5Z A;  3M12 A;  1FL2 A;  4P9S A;  4U8N A;  3SM8 A;  1SEZ A;  1W4X A;  4JDR A;  3AEG A;  1N4V A;  1F8R A;  3CPJ G;  2X8C A;  2NVK X;  4XXG A;  3UP5 A;  1EBD A;  1COY A;  1Q1W A;  4NTC A;  3SQP A;  2IVD A;  2BC1 A;  2WQY A;  3NYF A;  2WHD A;  4J57 A;  5EB4 A;  3V3N A;  3GYX A;  2IVE A;  1CJC A;  1F8W A;  1NG4 A;  2QA1 A;  2YLR A;  4EIQ A;  2AQJ A;  2XFO A;  1YQ4 A;  3PO7 A;  2BRY A;  1ZY8 A;  4AT2 A;  3SZC A;  2C70 A;  2H89 A;  1GAL A;  2V60 A;  3AB1 A;  3CGC A;  1PXC A;  4II3 A;  1RP0 A;  4N9X A;  1M64 A;  4OVI A;  5J60 A;  1LJ1 A;  2B9Y A;  4ICY A;  1GRA A;  3DK9 A;  3UKK A;  1KSS A;  3CNP A;  1E7P A;  4YSH A;  2HQM A;  3QSE A;  4GAV A;  1UKV G;  4AT0 A;  2YG7 A;  4EQW A;  3K7Q X;  4IVM B;  4CCQ A;  3UOX A;  4TLX A;  2XFP A;  2C4C A;  3AE7 A;  3SFD A;  2YG6 A;  1BWC A;  3I6D A;  4O5Q A;  4GR1 A;  4DSH A;  5KMS A;  4UDP A;  2PYX A;  1CJ2 A;  2GQW A;  5LV9 A;  1DNC A;  3DJG X;  2OLN A;  3O0H A;  4C77 A;  2BA9 A;  2TPR A;  1QJD A;  3P4Q A;  3GYJ A;  1GET A;  3DH9 A;  4J33 A;  4AOX A;  4EMW A;  2XVE A;  4A6N B;  4A79 A;  4Y4N A;  5JCL A;  1GXF A;  3DME A;  2GH5 A;  2WOV A;  2XLU A;  1VG0 A;  1PXA A;  1PXB A;  5KVI A;  4APN A;  2CVJ A;  3SZ0 A;  4JNQ A;  1LVL A;  3RED A;  4KX6 A; 
#chains in the Genus database with same CATH homology
 2CUL A;  1TDO A;  3M0O A;  3HYV A;  2YG3 A;  1GER A;  3G5S A;  3AE6 A;  2JK6 A;  4Z43 A;  3PVC A;  3T14 A;  4USR A;  3BNU A;  1AOG A;  2UZZ A;  2C66 A;  3CPI G;  4KPR A;  3UOV A;  1F3P A;  3AYJ A;  2R4J A;  4B63 A;  3AEF A;  4EQR A;  3KPF A;  4U8L A;  3QVP A;  2FBW A;  3DJD A;  4NNJ A;  4Z26 A;  3Q9T A;  4USQ A;  2BCP A;  1BZL A;  1E1L A;  3K7T A;  3Q6J A;  2YR6 A;  3H4K A;  1F8S A;  4X9N A;  2V6O A;  3QJ4 A;  1E39 A;  1FEA A;  2C7G A;  3AEA A;  1PDH A;  3LOV A;  1Q1R A;  3ICS A;  1VDC A;  1Y0P A;  4Z24 A;  1NHS A;  3BI4 A;  3UP4 A;  4AP1 A;  5IQ1 A;  4K22 A;  1OJA A;  1XPQ A;  2GR3 A;  3NYC A;  4NWZ A;  4CBQ A;  1DOB A;  2E1M A;  5BUL A;  4JNA A;  5BUK A;  2YLZ A;  2JB1 A;  4Y4L A;  1E6E A;  1IUW A;  2VQ7 A;  3ISH A;  3GMB A;  1TDF A;  1D7Y A;  4B65 A;  5EB5 A;  3QSM A;  3VRA A;  1BGN A;  2FJD A;  3F8D A;  2GR0 A;  1LQU A;  4GRT A;  4H2P A;  2APG A;  2Z5Y A;  1GTE A;  1ZMD A;  3H8I A;  1CBO A;  5U1O A;  3SFE A;  1OJT A;  4H4Q A;  3SX6 A;  2VRM A;  3OC4 A;  1XHC A;  3K7M X;  4C3Y A;  2QCU A;  3CND A;  1PBC A;  5EBK A;  4C5O A;  4OPL A;  5BVA A;  2GB0 A;  1NHQ A;  2GR1 A;  2C3D A;  4RG3 A;  2O9Z A;  1IUV A;  2BK3 A;  1JRX A;  3IHG A;  4B69 A;  1IUT A;  3NTD A;  2BYB A;  3DJJ A;  3EAO A;  3LZX A;  1ONF A;  3B3R A;  3T2Y A;  2WBA A;  2VZ2 A;  4EQX A;  5FS8 A;  2OAM A;  2WS3 A;  4Z2U A;  2FJA A;  2YVJ A;  4JY3 A;  4NZH A;  5M0Z A;  4H2Q A;  4X4J A;  1D7L A;  1KNP A;  3NNE A;  1GRH A;  3T31 A;  1Q9I A;  5KNL A;  3QVR A;  3T2K A;  1ZOY A;  3GMC A;  3ATR A;  2A87 A;  3AE9 A;  1L9D A;  3ICR A;  3FMW A;  1E1M A;  1L9C A;  2W0H A;  3CGD A;  1H6V A;  1ELI A;  3KD9 A;  1CC6 A;  1HYU A;  2A8X A;  5KMR A;  4Z25 A;  3DGH A;  1E1N A;  5GRT A;  1GES A;  3ALM A;  2WOW A;  1RSG A;  4CCR A;  5KOX A;  1B4V A;  3VR8 A;  1NHP A;  1D5T A;  3AYI A;  2H88 A;  2XFN A;  3GWD A;  1N4U A;  3KVE A;  4GUV A;  2RAB A;  3V76 A;  4B64 A;  2E4G A;  4BV6 A;  1V59 A;  2WPF A;  1PHH A;  1K4Q A;  1GT8 A;  2RGH A;  2ACZ A;  4B1B A;  2WEU A;  1LV0 A;  3AWI A;  4GDP A;  1CHU A;  2JB3 A;  2JKC A;  4H4R A;  1F6M A;  3K30 A;  4GF7 A;  2YG4 A;  3H8L A;  3QFA A;  3AD7 B;  2YLW A;  3LJP A;  4OPC A;  1ZOV A;  1TYP A;  3NTA A;  3SY4 A;  3LXD A;  4J36 A;  1BGJ A;  3T37 A;  2XLT A;  3KU9 A;  1Y56 A;  4BK2 A;  5HXI A;  2NPX A;  5IPY A;  1GEU A;  3VRB A;  3AEC A;  4CY6 A;  1VRQ B;  4LA1 A;  2QA2 A;  2VQB A;  1KSU A;  2BRA A;  4H4V A;  4G6G A;  2Y6R A;  4HB9 A;  4YTN A;  3NK1 X;  1OJC A;  1TYT A;  4M52 A;  4XWR A;  3SZF A;  3ADA B;  1S3E A;  4J56 A;  4UDR A;  3CNT A;  2E5V A;  2GMJ A;  2OAL A;  5EOW A;  2V3B A;  2VVL G;  3D8X A;  4OPG A;  4A99 A;  3NG7 X;  5J7X A;  4YTP A;  3KKJ A;  1H82 A;  2YLX A;  1DOC A;  1JRY A;  2BAC A;  4ECH A;  5DBJ A;  2R4E A;  1ZX9 A;  1DXL A;  2WP9 A;  3C4N A;  4OPU A;  3V3O A;  3VR9 A;  4E0V A;  3JSK A;  4OPT A;  2Y6Q A;  4H2N A;  4TLZ A;  5CKU A;  4BK1 A;  1VG9 A;  4D03 A;  2BCG G;  2GVC A;  5JCI A;  3RP6 A;  2EQ7 A;  4K7Z A;  3UTE A;  2YLS A;  4H4Y A;  4CY8 A;  3UTF A;  5KMQ A;  5M10 A;  4YSZ A;  1IUU A;  4FK1 A;  3CMM A;  4U8M A;  3NK0 X;  4NTD A;  3P9U A;  1OJD A;  3G5R A;  3UKH A;  3LAD A;  2DKH A;  4TM3 A;  1H86 A;  1QO8 A;  1L0V A;  4JQ9 A;  3T0K A;  5HY5 A;  4EIP A;  4UDQ A;  1P2E A;  4A7A A;  3HYX A;  4FX9 A;  2C67 A;  3S5W A;  3SXI A;  2VVL A;  3RHA A;  4D04 A;  3AE4 A;  2FJB A;  2Q0L A;  4U2T A;  4DSG A;  1S3B A;  1GND A;  1CC2 A;  1PJ5 A;  2YWL A;  1TDE A;  3NHO X;  2VRL A;  2GR2 A;  4C3X A;  4OCG A;  1Z6L A;  2BAB A;  2R45 A;  3AXB A;  3UTH A;  3GSI A;  2EQ6 A;  4I58 A;  2YR4 A;  4Z44 A;  3SZW A;  3UOZ A;  4ADW A;  2V61 A;  4ZCC A;  5JCK A;  1B5Q A;  1H84 A;  1NAA A;  3ICT A;  2WDQ A;  2RGJ A;  1PS9 A;  2A89 A;  2WET A;  3NGC X;  2TMD A;  4H4S A;  1JRZ A;  2B7R A;  1GSN A;  1BKW A;  4U8P A;  3KPK A;  1CF3 A;  1NG3 A;  4H4P A;  4YKF A;  4EM4 A;  3LB8 A;  2XLP A;  4LU6 A;  2Q0K A;  4GCM A;  2OA1 A;  3VRD B;  2GMH A;  2AR8 A;  3NH3 X;  2XVF A;  1K0J A;  2DKI A;  4C74 A;  4H4T A;  1CL0 A;  4H2R A;  2QAE A;  2XYO A;  4WCT A;  2R9Z A;  3BI2 A;  1EL9 A;  3AEE A;  3OZ2 A;  5KVH A;  3ZYX A;  2C72 A;  1H83 A;  2Q7V A;  2WP6 A;  4GAP A;  5TR3 A;  5U25 A;  4A5L A;  4CNJ A;  4YSY A;  2WPE A;  5KXJ A;  3SGL A;  3UCL A;  4REK A;  1L9E A;  1PJ7 A;  2X3N A;  3D1C A;  3NK2 X;  3L1R A;  2YLT A;  4Z2T A;  2ZZC A;  2BXR A;  3GDP A;  1DJQ A;  2GRT A;  4A65 A;  3KA7 A;  3R9U A;  4FDC B;  3CNJ A;  4EM3 A;  3IWA A;  4LII A;  4NEW A;  4MJW A;  3F8P A;  2R0G A;  4BJY A;  3DK8 A;  2WOI A;  1KF6 A;  1Y56 B;  4YTM A;  1FEB A;  3CGB A;  3ABV A;  3BHF A;  2RGO A;  5FS9 A;  5BRT A;  1D4D A;  3GWF A;  4EMJ A;  4G74 A;  4H4Z A;  3UOY A;  1JOA A;  4K5R A;  3URH A;  1B8S A;  1TDN A;  1FEC A;  2XVI A;  2XDO A;  4J34 A;  3B6D A;  1TRB A;  3BHK A;  3ITJ A;  3KLJ A;  3VQR A;  1JNZ A;  2B9X A;  2Z5X A;  1KNR A;  4O5U A;  1H7X A;  3NLC A;  2XVJ A;  2WPC A;  1LQT A;  1YQ3 A;  3AE2 A;  1ZK7 A;  1EL7 A;  5L46 A;  4RG4 A;  3DGZ A;  3UKA A;  4AOS A;  4U8O A;  1GRT A;  4U8I A;  4IV9 A;  3GRT A;  3AEB A;  2I0Z A;  1KFY A;  1GTH A;  2GEW A;  4TM0 A;  1PBB A;  1ZMC A;  3AD8 B;  4IA6 A;  5KOW A;  2V3A A;  5KWF A;  4YXD A;  2ARD A;  4ZCD A;  1GPE A;  2JAE A;  2C75 A;  1IUX A;  1K0I A;  3F8R A;  5FMH A;  1NEN A;  4RSL A;  2Q6U A;  3II4 A;  3CIR A;  3EPT A;  4K2X A;  1KDG A;  1XAN A;  1PJ6 A;  3EAN A;  4IA5 A;  5U63 A;  2B7S A;  1N1P A;  5FS7 A;  2C65 A;  2ZZB A;  3SYI A;  1PBE A;  1IJH A;  3EF6 A;  1GRG A;  1JEH A;  2GF3 A;  2GV8 A;  3QSS A;  4H4W A;  2YQU A;  2YAU A;  1E1K A;  4BK3 A;  2JB2 A;  2EQ9 A;  2AAQ A;  3P4S A;  2EQ8 A;  2R0C A;  3GD4 A;  4H4X A;  3FG2 P;  4PAB A;  4YWO A;  5FS6 A;  4A6N A;  4II2 A;  1ZKQ A;  4J2W A;  1H7W A;  1VQW A;  3DK4 A;  5JCM A;  3AE5 A;  2YVF A;  2VVM A;  1RYI A;  2YM2 A;  3P4P A;  1GRF A;  3NRN A;  2GAH B;  3NT6 A;  1O5W A;  2WU2 A;  1MO9 A;  2X99 A;  4I59 A;  1O95 A;  3ALL A;  3NYE A;  2F5Z A;  3NN6 X;  2IID A;  1GOS A;  3C96 A;  4K5S A;  2C3C A;  2OLO A;  1S2Y A;  2GAG B;  3QFB A;  3ZDN A;  1YQZ A;  3CTY A;  2BS2 A;  3BNM A;  2BK4 A;  4BUR A;  2WP5 A;  3T2Z A;  3IC9 A;  1EL8 A;  3GRS A;  1XDI A;  4U8J A;  2JBV A;  1B37 A;  5ER0 A;  1MOK A;  3AE3 A;  3WE0 A;  1YKJ A;  3IHM A;  4FK1 C;  3GD3 A;  2GQF A;  3M13 A;  3G5Q A;  4OPI A;  4U2S A;  4ZN0 A;  2FJE A;  3UKP A;  1DJN A;  3DJE A;  1DOE A;  2J3N A;  3BI5 A;  1D4C A;  3NN0 X;  3ALJ A;  1FOH A;  3C4A A;  1FCD A;  1LTX R;  2BC0 A;  4XWZ A;  2C64 A;  4Z2R A;  3CNS A;  2BS4 A;  2BXS A;  3RNM A;  2BS3 A;  2YVG A;  1GV4 A;  4TM1 A;  5GSN A;  3UKQ A;  3FBS A;  3GDN A;  4DNA A;  2BK5 A;  3I3L A;  4AP3 A;  2C76 A;  3DA1 A;  2VOU A;  3P1W A;  1DOD A;  2R46 A;  2YG5 A;  3AD9 B;  4U2L A;  1CJ3 A;  4WX1 A;  2XLR A;  4YKG A;  1CJ4 A;  4B66 A;  5HHF A;  1BF3 A;  1PBD A;  4X9M A;  3UKL A;  3NKS A;  3P4R A;  4Y4M A;  3HZL A;  2PHH A;  3E1T A;  2CFY A;  1IUS A;  1O94 A;  2YR5 A;  2X50 A;  4IVO B;  5KMP A;  2C73 A;  4H50 A;  5C2T A;  4YT0 A;  3NIX A;  2XLS A;  3RP8 A;  4NEV A;  3LZW A;  4A9W A;  1NPX A;  3IF9 A;  3UKF A;  1GRB A;  1K0L A;  1P2H A;  4HA6 A;  3FPZ A;  4B68 A;  1ZP0 A;  4H4U A;  5JCN A;  1MXT A;  2R0P A;  3COX A;  3FIM B;  4EMI A;  1JU2 A;  5CQF A;  2XVH A;  1D4E A;  3L8K A;  3RP7 A;  2YM1 A;  4B67 A;  4PAA A;  4JY2 A;  1H81 A;  4K8D A;  1GRE A;  1N4W A;  4UP3 A;  2B76 A;  2ZBW A;  4OPD A;  4TM4 A;  1PBF A;  3CN8 A;  1EL5 A;  4JN9 A;  4G6H A;  4GDE A;  1REO A;  2WES A;  1JNR A;  1NEK A;  3AED A;  4G73 A;  4NTE A;  2ZZ0 A;  2X8H A;  2WU5 A;  4CRT A;  3CPH G;  4G9K A;  4BJZ A;  1LPF A;  1ZDL A;  1QLB A;  4J31 A;  1NDA A;  1TDK A;  2B9W A;  4DGK A;  1OJ9 A;  2XFQ A;  2X8G A;  3UTG A;  4CNK A;  3ATQ A;  5C3J A;  1X31 B;  4EQS A;  5IQ4 A;  4YSX A;  1PN0 A;  3PS9 A;  1YY5 A;  3AE1 A;  1CC4 A;  2WDV A;  3S61 A;  3HYW A;  3GYI A;  5HYM A;  2WDR A;  2XCG A;  4H7U A;  1NHR A;  5KRQ A;  3CGE A;  2CDU A;  1S2Q A;  4U8K A;  3AE8 A;  3AYL A;  1M6I A;  2XFU A;  2V5Z A;  3M12 A;  1FL2 A;  4P9S A;  4U8N A;  3SM8 A;  1SEZ A;  1W4X A;  4JDR A;  3AEG A;  1N4V A;  1F8R A;  3CPJ G;  2X8C A;  2NVK X;  4XXG A;  3UP5 A;  1EBD A;  1COY A;  1Q1W A;  4NTC A;  3SQP A;  2IVD A;  2BC1 A;  2WQY A;  3NYF A;  2WHD A;  4J57 A;  5EB4 A;  3V3N A;  3GYX A;  2IVE A;  1CJC A;  1F8W A;  1NG4 A;  2QA1 A;  2YLR A;  4EIQ A;  2AQJ A;  2XFO A;  1YQ4 A;  3PO7 A;  2BRY A;  1ZY8 A;  4AT2 A;  3SZC A;  2C70 A;  2H89 A;  1GAL A;  2V60 A;  3AB1 A;  3CGC A;  1PXC A;  4II3 A;  1RP0 A;  4N9X A;  1M64 A;  4OVI A;  5J60 A;  1LJ1 A;  2B9Y A;  4ICY A;  1GRA A;  3DK9 A;  3UKK A;  1KSS A;  3CNP A;  1E7P A;  4YSH A;  2HQM A;  3QSE A;  4GAV A;  1UKV G;  4AT0 A;  2YG7 A;  4EQW A;  3K7Q X;  4IVM B;  4CCQ A;  3UOX A;  4TLX A;  2XFP A;  2C4C A;  3AE7 A;  3SFD A;  2YG6 A;  1BWC A;  3I6D A;  4O5Q A;  4GR1 A;  4DSH A;  5KMS A;  4UDP A;  2PYX A;  1CJ2 A;  2GQW A;  5LV9 A;  1DNC A;  3DJG X;  2OLN A;  3O0H A;  4C77 A;  2BA9 A;  2TPR A;  1QJD A;  3P4Q A;  3GYJ A;  1GET A;  3DH9 A;  4J33 A;  4AOX A;  4EMW A;  2XVE A;  4A6N B;  4A79 A;  4Y4N A;  5JCL A;  1GXF A;  3DME A;  2GH5 A;  2WOV A;  2XLU A;  1VG0 A;  1PXA A;  1PXB A;  5KVI A;  4APN A;  2CVJ A;  3SZ0 A;  4JNQ A;  1LVL A;  3RED A;  4KX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...