3KKJA

X-ray structure of p. syringae q888a4 oxidoreductase at resolution 2.5a, northeast structural genomics consortium target psr10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
328
structure length
328
Chain Sequence
TVPIAIIGTGIAGLSAAQALTAAGHQVHLFDKSRGSGGRMSSKRSDAGALDMGAQYFTARDRRFATAVKQWQAQGHVAEWTPLLYNFHAGRLSPSPDEQVRWVGKPGMSAITRAMRGDMPVSFSCRITEVFRGEEHWNLLDAEGQNHGPFSHVIIATPAPQASTLLAAAPKLASVVAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPERDDTLDTWILHATSQWSRQNLDASREQVIEHLHGAFAELIDCTMPAPVFSLAHRWLYARPAGAHEWGALSDADLGIYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amine oxidase, flavin-containing
publication title X-ray structure of P. syringae q888a4 Oxidoreductase at resolution 2.5A, Northeast Structural Genomics Consortium target PsR10
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 88
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kkjA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kkjA02
1PBDA 4C77A 2GB0A 3SQPA 3M13A 1E1LA 4B69A 2ZZ0A 1NHSA 4X4JA 2C76A 2YLRA 3P4RA 4ICYA 3K7QX 4REKA 1KSSA 3ICRA 4YKGA 3AEDA 1CC6A 1RP0A 3GD4A 3CTYA 2WQYA 5KWFA 4JNAA 2BK5A 2WDVA 4BURA 4JNQA 3T37A 2YWLA 4EQRA 1NHPA 2GR0A 2B76A 2R0CA 2NVKX 3GSIA 1GERA 3C4NA 1TDOA 2OLNA 4N9XA 3AEEA 2BYBA 2C73A 4H2QA 3PS9A 1H7WA 3NH3X 1XDIA 3CGEA 1NEKA 1ZY8A 3ITJA 4H2RA 3AB1A 3CNJA 1GOSA 1S2QA 3EPTA 4C3XA 5HYMA 5IQ4A 4U2SA 1GSNA 4TLZA 4GDPA 2CULA 3V3NA 2WP6A 2VRMA 2YAUA 4U8KA 2UZZA 4A6NA 4O5QA 2OALA 4A65A 4B66A 1H81A 4EQXA 3AEAA 2Z5XA 4GUVA 5FS6A 1E7PA 4H4YA 4MJWA 4FX9A 1H86A 1QLBA 2B9YA 4YSYA 1NAAA 2BXSA 3L8KA 1NENA 1P2HA 4PABA 3GYJA 1DJNA 3D1CA 2R45A 2CVJA 3UKAA 1JRZA 3LB8A 1CC2A 2RABA 3IF9A 1KSUA 4IVMB 2V3AA 3EANA 5J60A 1GREA 2ARDA 2VVLA 3WE0A 3H8IA 2GAHB 4A6NB 3GD3A 3K7MX 2WU5A 2XCGA 3DJJA 3UTEA 5JCNA 2R4JA 4IA6A 1B5QA 1FEAA 2V3BA 2YG5A 1B4VA 1IUSA 2WPFA 1F8WA 2BS2A 3LXDA 2QA2A 2TMDA 1O95A 3IC9A 1H7XA 3CIRA 3RP8A 2PYXA 2VVMA 3S61A 1EL5A 5JCMA 2XYOA 4B65A 1CJ4A 3ZDNA 2RGOA 4ADWA 3R9UA 5BUKA 2XFNA 4WCTA 3NRNA 4CCRA 2Z5YA 2R46A 3AD7B 3KVEA 4EIQA 5FS7A 3K30A 3ALLA 3ZYXA 3B6DA 4EMJA 2JAEA 4NTCA 1B37A 1Y0PA 1JEHA 3CNPA 3AEBA 1NPXA 4KX6A 4UDQA 3CNTA 2VQBA 2DKHA 4C74A 4UP3A 2E5VA 2CDUA 4NEWA 3UOVA 4U8NA 2C67A 3P4PA 2ACZA 4B67A 4H4WA 1JRXA 2Q0KA 5GSNA 3GWDA 4OPTA 5J7XA 3C96A 2VOUA 2FJAA 3DJDA 2XVHA 2FJBA 2WP5A 3DMEA 3UKFA 3UOZA 3CNSA 5M0ZA 3QJ4A 3GDPA 1BF3A 2BS3A 5U25A 1P2EA 3NIXA 3NLCA 5BVAA 1OJDA 2GEWA 3CNDA 4OPLA 3BNUA 3GMCA 3P4SA 4H4QA 2Q0LA 4Z24A 4YXDA 3GRTA 3DJGX 3G5SA 2WPCA 3AYJA 4B68A 3ATQA 4B63A 4EIPA 1MOKA 1PBCA 5KOXA 2YM2A 2C66A 3ISHA 3F8PA 3Q9TA 5BRTA 1JU2A 1E1KA 1Q9IA 1GRTA 1PBFA 1YY5A 4Z43A 1GRBA 3RHAA 1H84A 4Z44A 4OPIA 1UKVG 3KKJA 3VRDB 4D04A 4K22A 1TYTA 1K0JA 4C5OA 3ALJA 1BWCA 1YKJA 3KU9A 3AWIA 4U2TA 4DSGA 2C3CA 1CJ3A 1NG3A 2JK6A 4JQ9A 3NG7X 5CKUA 4YKFA 1DOEA 3UKLA 5KOWA 3UOXA 3GDNA 1H82A 1OJ9A 1JNZA 2JB2A 1S3EA 4H4ZA 3VQRA 4U8LA 2XVEA 4EQSA 1CHUA 2WDRA 3GMBA 1GPEA 2H88A 2YLXA 3RP7A 4FK1A 1KFYA 3V3OA 3NTDA 1K0LA 1M6IA 1FL2A 1X31B 2EQ7A 3M12A 4JDRA 2WOWA 3ABVA 1DXLA 1D4DA 1DOCA 1TDKA 3AD8B 4CCQA 1S2YA 2A8XA 4FDCB 3AE6A 5KRQA 1BZLA 3AYLA 3G5RA 2X99A 2GR3A 4BK2A 3LZXA 4GF7A 2C70A 1E1MA 2C65A 4H4RA 1YQ3A 4TM1A 2JB3A 5C3JA 1F8SA 4Z2UA 4H2NA 4GR1A 3CPIG 5U63A 4Z2TA 3LOVA 1EL9A 3F8DA 3S5WA 5FS8A 1TDNA 2WOVA 3EAOA 2XVIA 1XPQA 4YTMA 2YG6A 1DOBA 5ER0A 3UCLA 2Y6QA 4RG3A 3RNMA 1XHCA 1GTHA 1GRGA 2O9ZA 3QSMA 1L0VA 3UKKA 1IUWA 3CGCA 1OJTA 3ATRA 2GR2A 3SM8A 3IHMA 3UKQA 1MO9A 3DGHA 4HB9A 4Z25A 3ADAB 2PHHA 1O5WA 3ALMA 4CBQA 1IUTA 3L1RA 4IA5A 2V6OA 1F6MA 4A7AA 1DODA 4E0VA 5KVIA 3P1WA 3I3LA 2BC1A 2YG7A 2B9WA 3LADA 1ZOVA 4U8MA 1ZMDA 5FMHA 4OPCA 3SGLA 2Q7VA 4OPGA 1VG0A 2ZZCA 4OPDA 4Y4MA 1ONFA 3F8RA 1GRFA 2A89A 2WOIA 5JCIA 3CN8A 4UDRA 1LJ1A 4RG4A 2IVEA 3UKPA 2B7SA 2YLZA 3NNEA 3DK9A 4U8PA 3URHA 4YSZA 3VR8A 1TDFA 1BGJA 2XVJA 1IUUA 1GT8A 2YVJA 1RYIA 4NEVA 1DNCA 1NHQA 2F5ZA 1PS9A 1N1PA 1E6EA 4JY3A 4Y4LA 1E1NA 2V61A 2X3NA 3AE3A 3COXA 3REDA 2YQUA 1HYUA 4I58A 1PHHA 4AP3A 3QVRA 1ZMCA 2C72A 4YSHA 2C64A 4K7ZA 4IVOB 2XLPA 4I59A 1PXAA 4OPUA 2EQ6A 2XFUA 2GMJA 4YTNA 4TM0A 1FEBA 2EQ9A 2CFYA 2R9ZA 4NZHA 5EB4A 4A5LA 1H83A 2GQWA 1LPFA 3IHGA 1CL0A 1YQZA 4YWOA 2H89A 1GALA 3BHKA 5IQ1A 4EMWA 3OZ2A 2GR1A 1E39A 4DNAA 5JCKA 1N4UA 3QSEA 2JB1A 2R4EA 3DJEA 2BXRA 5HHFA 4ZN0A 5EBKA 3AD9B 4XXGA 1BGNA 1K4QA 4CRTA 2YLWA 5U1OA 2GRTA 4KPRA 3OC4A 1Z6LA 3AXBA 4YT0A 2ZBWA 4UDPA 2BC0A 2APGA 1EL7A 2EQ8A 4J57A 4H4TA 4J33A 4K5RA 4EM4A 3II4A 5BULA 4APNA 4J34A 4CY8A 3GYIA 2B7RA 4LIIA 3H4KA 3E1TA 1ZDLA 3QSSA 4X9NA 2J3NA 1NDAA 2GH5A 2WPEA 1ZKQA 4Z2RA 4AT2A 1PN0A 1QO8A 4CNJA 3K7TA 3NT6A 2WBAA 3PO7A 1Y56A 4U8JA 2GVCA 3PVCA 3NHOX 1IUXA 1CJ2A 1JNRA 2E1MA 4TLXA 3AE9A 4BK3A 1AOGA 1D7LA 2QAEA 3C4AA 4JN9A 4B1BA 1JOAA 1JRYA 2BA9A 4P9SA 4YSXA 1CJCA 2X8HA 1PJ7A 4IV9A 4USRA 3QVPA 1GEUA 1PXBA 4ECHA 1VDCA 5C2TA 4A9WA 3KA7A 2FJEA 2XFPA 1GNDA 1L9EA 2QCUA 3BI5A 4M52A 4B64A 4DGKA 2XLTA 5JCLA 2ZZBA 3FBSA 2XFOA 5CQFA 3RP6A 1XANA 3NK2X 1Y56B 3CGBA 4ZCCA 4O5UA 2JBVA 1FOHA 1N4VA 1PJ6A 4U8OA 4AOSA 3SFDA 1EL8A 1ZX9A 3AECA 2A87A 1D5TA 2YVGA 1Q1RA 1S3BA 1W4XA 2BK3A 2FJDA 1NG4A 2IIDA 3KD9A 3NK0X 4GCMA 3V76A 2V60A 4WX1A 3BI4A 2XLUA 4YTPA 4OVIA 3GRSA 3VR9A 2XLRA 1K0IA 1KF6A 1TRBA 2YM1A 2WHDA 2NPXA 4H4VA 1YQ4A 2YR5A 2FBWA 2YG4A 1QJDA 3DK4A 1PBEA 3UTGA 4U2LA 4J31A 5IPYA 3KLJA 2BACA 3SFEA 2WESA 3NTAA 3DA1A 1F3PA 3NYEA 4X9MA 3GWFA 1GXFA 3H8LA 2BCPA 1VQWA 2BK4A 3AEFA 1L9DA 2YR4A 3CGDA 3LZWA 4LU6A 4U8IA 5GRTA 1VRQB 3NYCA 1F8RA 4EM3A 1Q1WA 4BV6A 5HY5A 1ZP0A 1CBOA 4GRTA 4A79A 2YLTA 1PJ5A 3NN6X 2C7GA 3AE7A 2WEUA 3AE5A 1D7YA 1TDEA 3BHFA 4AOXA 4H4UA 2QA1A 2VVLG 2R0PA 4EMIA 3FPZA 1L9CA 4H7UA 2JKCA 2IVDA 4K8DA 5EOWA 4RSLA 3DK8A 5LV9A 2AQJA 3FIMB 5KVHA 1GTEA 2BS4A 2X8CA 3P9UA 1CC4A 4TM3A 5M10A 3DGZA 4D03A 2OLOA 2WETA 5TR3A 4FK1C 1BKWA 4PAAA 3NYFA 2WU2A 2W0HA 2V5ZA 2VQ7A 4NTEA 3VRAA 1O94A 3IWAA 2I0ZA 2B9XA 5HXIA 3B3RA 1LQUA 3BNMA 2X50A 4H4XA 2GQFA 3Q6JA 1FECA 3BI2A 2HQMA 2WP9A 3UTFA 3CPHG 2VZ2A 3UP4A 4ZCDA 3NK1X 1GESA 3UKHA 2GF3A 1RSGA 1LV0A 4GDEA 2BCGG 3O0HA 2AR8A 4H4SA 4K5SA 3AYIA 1H6VA 4XWRA 4A99A 4Y4NA 4CY6A 3M0OA 3DH9A 1IUVA 4OCGA 1ELIA 3G5QA 3QFAA 3QFBA 1EBDA 1CF3A 2WS3A 4EQWA 1GETA 3ICTA 3UTHA 1PBBA 4Z26A 5FS9A 3UOYA 2OA1A 4H50A 3AEGA 3AE4A 4LA1A 3NGCX 1M64A 1LVLA 3CPJG 5KXJA 4H2PA 2TPRA 2VRLA 4DSHA 1KNRA 3EF6A 3P4QA 1PXCA 3KPFA 2BABA 1KNPA 1D4CA 2Q6UA 2XFQA 4BJYA 1N4WA 3JSKA 2X8GA 2GAGB 4J36A 1PDHA 3FG2P 2GV8A 2Y6RA 3I6DA 1B8SA 3HZLA 2RGJA 1ZK7A 4J2WA 1NHRA 3LJPA 3AE2A 1FCDA 2C75A 4K2XA 2GMHA 2C3DA 4XWZA 4BK1A 4AP1A 1DJQA 1VG9A 2YVFA 4JY2A 2YR6A 4HA6A 2XVFA 3FMWA 1KDGA 2XDOA 2RGHA 1GRHA 1COYA 1SEZA 5DBJA 3NN0X 1TYPA 2YLSA 2XLSA 5EB5A 1MXTA 3ICSA 1LTXR 4CNKA 3UP5A 1OJCA 1REOA 1ZOYA 4AT0A 1IJHA 1OJAA 2WDQA 3AE8A 3D8XA 4TM4A 2YG3A 3NKSA 2R0GA 1D4EA 5L46A 4J56A 1LQTA 1V59A 1GRAA 2AAQA 4C3YA 1GV4A 4NTDA 4BJZA 4USQA 2E4GA 2DKIA 3VRBA 2OAMA 4H4PA 3AE1A
chains in the Genus database with same CATH superfamily
1PBDA 4C77A 2GB0A 3SQPA 3M13A 1E1LA 4B69A 2ZZ0A 3SZWA 1NHSA 4X4JA 2C76A 2YLRA 3P4RA 3HYXA 4ICYA 3K7QX 4REKA 1KSSA 3ICRA 4YKGA 3AEDA 1CC6A 1RP0A 3GD4A 3CTYA 2WQYA 5KWFA 4JNAA 2BK5A 2WDVA 4BURA 4JNQA 3T37A 2YWLA 4EQRA 1NHPA 2GR0A 2B76A 2R0CA 2NVKX 3GSIA 1GERA 3C4NA 1TDOA 2OLNA 4N9XA 3AEEA 2BYBA 2C73A 4H2QA 3PS9A 1H7WA 3NH3X 1XDIA 3CGEA 1NEKA 1ZY8A 3ITJA 4H2RA 3AB1A 3CNJA 1GOSA 1S2QA 3EPTA 4C3XA 5HYMA 5IQ4A 4U2SA 1GSNA 4TLZA 4GDPA 2CULA 3V3NA 2WP6A 2VRMA 2YAUA 4U8KA 2UZZA 4A6NA 4O5QA 2OALA 4A65A 4B66A 1H81A 4EQXA 3AEAA 2Z5XA 4GUVA 5FS6A 1E7PA 4H4YA 4MJWA 4FX9A 1H86A 1QLBA 2B9YA 4YSYA 1NAAA 2BXSA 3L8KA 3T0KA 1NENA 1P2HA 4PABA 3GYJA 3SZ0A 1DJNA 3D1CA 2R45A 2CVJA 3UKAA 1JRZA 3LB8A 1CC2A 2RABA 3IF9A 1KSUA 4IVMB 2V3AA 3EANA 5J60A 1GREA 2ARDA 2VVLA 3WE0A 3H8IA 2GAHB 4A6NB 3GD3A 3K7MX 2WU5A 2XCGA 3DJJA 3UTEA 5JCNA 2R4JA 4IA6A 1B5QA 1FEAA 2V3BA 4II2A 2YG5A 1B4VA 1IUSA 2WPFA 1F8WA 2BS2A 3LXDA 2QA2A 2TMDA 1O95A 3IC9A 1H7XA 3CIRA 3RP8A 2PYXA 2VVMA 3S61A 1EL5A 5JCMA 2XYOA 4B65A 1CJ4A 3ZDNA 2RGOA 4ADWA 3R9UA 5BUKA 2XFNA 4WCTA 3NRNA 4CCRA 2Z5YA 2R46A 3AD7B 3KVEA 4EIQA 5FS7A 3K30A 3ALLA 3ZYXA 3B6DA 4EMJA 2JAEA 4NTCA 1B37A 1Y0PA 1JEHA 3CNPA 3AEBA 1NPXA 4KX6A 4UDQA 3CNTA 2VQBA 2DKHA 4C74A 4UP3A 2E5VA 2CDUA 4NEWA 3SXIA 4G73A 3UOVA 4U8NA 2C67A 3P4PA 2ACZA 4B67A 4H4WA 1JRXA 2Q0KA 5GSNA 3GWDA 4OPTA 5J7XA 3C96A 2VOUA 2FJAA 3DJDA 2XVHA 2FJBA 2WP5A 3DMEA 3UKFA 3UOZA 3CNSA 5M0ZA 3QJ4A 3GDPA 1BF3A 2BS3A 5U25A 1P2EA 3NIXA 3NLCA 5BVAA 1OJDA 2GEWA 3CNDA 4OPLA 3BNUA 3GMCA 3P4SA 2BRAA 4H4QA 2Q0LA 4Z24A 4YXDA 3GRTA 3DJGX 3G5SA 2WPCA 3AYJA 4B68A 3ATQA 4B63A 4EIPA 1MOKA 1PBCA 5KOXA 2YM2A 2C66A 3ISHA 3F8PA 3Q9TA 5BRTA 1JU2A 1E1KA 1Q9IA 1GRTA 1PBFA 1YY5A 4Z43A 1GRBA 3RHAA 1H84A 4Z44A 4OPIA 1UKVG 3KKJA 3VRDB 4D04A 3SYIA 4K22A 1TYTA 1K0JA 3T2YA 4C5OA 3ALJA 1BWCA 1YKJA 3KU9A 3AWIA 4U2TA 4DSGA 2C3CA 1CJ3A 1NG3A 2JK6A 4JQ9A 3NG7X 5CKUA 4YKFA 1DOEA 3UKLA 5KOWA 3UOXA 3GDNA 1H82A 1OJ9A 1JNZA 2JB2A 1S3EA 4H4ZA 3VQRA 4U8LA 2XVEA 4EQSA 1CHUA 2WDRA 3GMBA 1GPEA 2H88A 2YLXA 3RP7A 4FK1A 1KFYA 3V3OA 3NTDA 1K0LA 1M6IA 1FL2A 1X31B 2EQ7A 3M12A 4JDRA 2WOWA 3ABVA 1DXLA 1D4DA 1DOCA 1TDKA 3AD8B 3T14A 4CCQA 1S2YA 2A8XA 4FDCB 3AE6A 5KRQA 1BZLA 3AYLA 3T31A 3G5RA 2X99A 2GR3A 4BK2A 3LZXA 4GF7A 2C70A 1E1MA 2C65A 4H4RA 1YQ3A 4TM1A 2JB3A 5C3JA 1F8SA 4Z2UA 4H2NA 3SY4A 3HYVA 4GR1A 3CPIG 5U63A 4Z2TA 3LOVA 1EL9A 3F8DA 3S5WA 5FS8A 1TDNA 2WOVA 3EAOA 2XVIA 1XPQA 4YTMA 2YG6A 1DOBA 5ER0A 3UCLA 2Y6QA 4RG3A 3RNMA 1XHCA 1GTHA 1GRGA 2O9ZA 3QSMA 1L0VA 3UKKA 1IUWA 3CGCA 1OJTA 3ATRA 2GR2A 3SM8A 3IHMA 3T2ZA 3UKQA 1MO9A 3DGHA 4HB9A 4Z25A 3ADAB 4NNJA 2PHHA 1O5WA 3ALMA 4CBQA 1IUTA 3L1RA 4IA5A 2V6OA 1F6MA 4A7AA 1DODA 4E0VA 5KVIA 3P1WA 3I3LA 2BC1A 2YG7A 2B9WA 3LADA 1ZOVA 4U8MA 1ZMDA 5FMHA 4OPCA 3SGLA 2Q7VA 4OPGA 1VG0A 2ZZCA 4OPDA 4Y4MA 1ONFA 3F8RA 1GRFA 2A89A 2WOIA 5JCIA 3CN8A 4UDRA 1LJ1A 4RG4A 2IVEA 3UKPA 2B7SA 2YLZA 3NNEA 3DK9A 4U8PA 3URHA 4YSZA 3VR8A 1TDFA 1BGJA 2XVJA 1IUUA 1GT8A 2YVJA 1RYIA 4NEVA 1DNCA 1NHQA 2F5ZA 1PS9A 1N1PA 1E6EA 4JY3A 4Y4LA 1E1NA 2V61A 2X3NA 3AE3A 3COXA 3REDA 2YQUA 1HYUA 4I58A 1PHHA 4AP3A 3QVRA 1ZMCA 2C4CA 2C72A 4YSHA 2C64A 4K7ZA 2BRYA 2XLPA 4IVOB 4I59A 1PXAA 4OPUA 2EQ6A 3SZCA 2XFUA 2GMJA 4YTNA 4TM0A 1FEBA 2EQ9A 2CFYA 2R9ZA 4NZHA 5EB4A 4A5LA 1H83A 2GQWA 1LPFA 3IHGA 1CL0A 1YQZA 4YWOA 2H89A 1GALA 3BHKA 5IQ1A 4EMWA 3OZ2A 2GR1A 1E39A 4DNAA 5JCKA 1N4UA 3QSEA 2JB1A 2R4EA 3DJEA 2BXRA 5HHFA 4ZN0A 5EBKA 3AD9B 4XXGA 1BGNA 1K4QA 4CRTA 2YLWA 5U1OA 4G9KA 2GRTA 4KPRA 3OC4A 1Z6LA 3AXBA 3CMMA 4YT0A 2ZBWA 4UDPA 2BC0A 2APGA 1EL7A 2EQ8A 4J57A 4H4TA 4J33A 4K5RA 4EM4A 3II4A 5BULA 4APNA 4J34A 4CY8A 3GYIA 2B7RA 4LIIA 3H4KA 3E1TA 1ZDLA 3QSSA 4X9NA 2J3NA 1NDAA 2GH5A 2WPEA 1ZKQA 4Z2RA 4AT2A 1PN0A 1QO8A 4CNJA 3K7TA 3NT6A 2WBAA 3PO7A 1Y56A 4U8JA 2GVCA 3PVCA 3NHOX 5KMPA 1IUXA 1CJ2A 1JNRA 2E1MA 4TLXA 3AE9A 4BK3A 1AOGA 1D7LA 2QAEA 3C4AA 4JN9A 4B1BA 1JOAA 1JRYA 2BA9A 4GAVA 4P9SA 4YSXA 1CJCA 2X8HA 1PJ7A 4IV9A 4USRA 3T2KA 3QVPA 1GEUA 5KMRA 1PXBA 4ECHA 1VDCA 5C2TA 4A9WA 3KA7A 2FJEA 2XFPA 1GNDA 1L9EA 2QCUA 3BI5A 4M52A 4B64A 4DGKA 2XLTA 5JCLA 2ZZBA 3FBSA 2XFOA 5CQFA 3RP6A 1XANA 3NK2X 1Y56B 3CGBA 4ZCCA 4O5UA 2JBVA 1FOHA 3SZFA 1N4VA 1PJ6A 4U8OA 4AOSA 3SFDA 1EL8A 1ZX9A 3AECA 2A87A 1D5TA 2YVGA 1Q1RA 1S3BA 1W4XA 2BK3A 2FJDA 1NG4A 2IIDA 3KD9A 3NK0X 4GCMA 3V76A 2V60A 4WX1A 3BI4A 2XLUA 4YTPA 4OVIA 3GRSA 3VR9A 5KNLA 2XLRA 1K0IA 1KF6A 1TRBA 2YM1A 2WHDA 2NPXA 4H4VA 1YQ4A 2YR5A 2FBWA 2YG4A 5KMQA 5KMSA 1QJDA 3DK4A 1PBEA 3UTGA 4U2LA 4J31A 5IPYA 3KLJA 2BACA 3GYXA 2WESA 3NTAA 3DA1A 3SFEA 1F3PA 3NYEA 4X9MA 3GWFA 1GXFA 3H8LA 2BCPA 1VQWA 2BK4A 3AEFA 1L9DA 2YR4A 3CGDA 3LZWA 4LU6A 4U8IA 5GRTA 1VRQB 3NYCA 1F8RA 4EM3A 1Q1WA 4BV6A 5HY5A 1ZP0A 1CBOA 4GRTA 4A79A 2YLTA 1PJ5A 4NWZA 3NN6X 2C7GA 3AE7A 2WEUA 3AE5A 1D7YA 1TDEA 3BHFA 4AOXA 4H4UA 2QA1A 2VVLG 2R0PA 4II3A 3FPZA 1L9CA 4EMIA 4H7UA 2JKCA 2IVDA 4K8DA 5EOWA 4RSLA 3DK8A 5LV9A 2AQJA 3FIMB 5KVHA 1GTEA 2BS4A 2X8CA 3P9UA 1CC4A 4TM3A 5M10A 3DGZA 4D03A 2OLOA 2WETA 5TR3A 4FK1C 1BKWA 4PAAA 3NYFA 2WU2A 4GAPA 2W0HA 2V5ZA 2VQ7A 4NTEA 3VRAA 1O94A 3IWAA 2I0ZA 2B9XA 5HXIA 3B3RA 1LQUA 3BNMA 2X50A 4H4XA 2GQFA 3Q6JA 1FECA 3BI2A 3HYWA 2HQMA 2WP9A 3UTFA 3CPHG 2VZ2A 3UP4A 4ZCDA 4G74A 3NK1X 1GESA 3UKHA 2GF3A 1RSGA 1LV0A 4GDEA 2BCGG 3O0HA 2AR8A 4H4SA 4K5SA 3AYIA 1H6VA 4XWRA 4A99A 4Y4NA 4CY6A 3M0OA 3DH9A 1IUVA 4OCGA 1ELIA 3G5QA 3QFAA 3QFBA 1EBDA 1CF3A 2WS3A 4EQWA 1GETA 4G6HA 3ICTA 3UTHA 1PBBA 4Z26A 5FS9A 3UOYA 2OA1A 4H50A 3AEGA 3AE4A 4LA1A 3NGCX 1M64A 1LVLA 3CPJG 5KXJA 4H2PA 2TPRA 2VRLA 4DSHA 1KNRA 3EF6A 3P4QA 1PXCA 3KPFA 2BABA 1KNPA 1D4CA 2Q6UA 2XFQA 4BJYA 1N4WA 3JSKA 2X8GA 2GAGB 4J36A 1PDHA 3FG2P 2GV8A 2Y6RA 3I6DA 1B8SA 4G6GA 3HZLA 2RGJA 1ZK7A 4J2WA 1NHRA 3LJPA 3AE2A 1FCDA 2C75A 4K2XA 2GMHA 2C3DA 4XWZA 4BK1A 4AP1A 1DJQA 1VG9A 2YVFA 4JY2A 3KPKA 2YR6A 4HA6A 3SX6A 2XVFA 3FMWA 1KDGA 2XDOA 2RGHA 1GRHA 1COYA 1SEZA 5DBJA 3NN0X 1TYPA 2YLSA 2XLSA 5EB5A 1MXTA 3ICSA 1LTXR 4CNKA 3UP5A 1OJCA 1REOA 1ZOYA 4AT0A 1IJHA 1OJAA 2WDQA 3AE8A 3D8XA 4TM4A 2YG3A 3NKSA 2R0GA 1D4EA 5L46A 4J56A 1LQTA 1V59A 1GRAA 2AAQA 4C3YA 1GV4A 4NTDA 4BJZA 4USQA 2E4GA 2DKIA 3VRBA 2OAMA 4H4PA 3AE1A
chains in the Genus database with same CATH topology
1PBDA 4C77A 2GB0A 3SQPA 3M13A 1E1LA 4B69A 2ZZ0A 3SZWA 1NHSA 4X4JA 2C76A 2YLRA 3P4RA 3HYXA 4ICYA 3K7QX 4REKA 1KSSA 3ICRA 4YKGA 3AEDA 1CC6A 1RP0A 3GD4A 3CTYA 2WQYA 5KWFA 4JNAA 2BK5A 2WDVA 4BURA 4JNQA 3T37A 2YWLA 4EQRA 1NHPA 2GR0A 2B76A 2R0CA 2NVKX 3GSIA 1GERA 3C4NA 1TDOA 2OLNA 4N9XA 3AEEA 2BYBA 2C73A 4H2QA 3PS9A 1H7WA 3NH3X 1XDIA 3CGEA 1NEKA 1ZY8A 3ITJA 4H2RA 3AB1A 3CNJA 1GOSA 1S2QA 3EPTA 4C3XA 5HYMA 5IQ4A 4U2SA 1GSNA 4TLZA 4GDPA 2CULA 3V3NA 2WP6A 2VRMA 2YAUA 4U8KA 2UZZA 4A6NA 4O5QA 2OALA 4A65A 4B66A 1H81A 4EQXA 3AEAA 2Z5XA 4GUVA 5FS6A 1E7PA 4H4YA 4MJWA 4FX9A 1H86A 1QLBA 2B9YA 4YSYA 1NAAA 2BXSA 3L8KA 3T0KA 1NENA 1P2HA 4PABA 3GYJA 3SZ0A 1DJNA 3D1CA 2R45A 2CVJA 3UKAA 1JRZA 3LB8A 1CC2A 2RABA 3IF9A 1KSUA 4IVMB 2V3AA 3EANA 5J60A 1GREA 2ARDA 2VVLA 3WE0A 3H8IA 2GAHB 4A6NB 3GD3A 3K7MX 2WU5A 2XCGA 3DJJA 3UTEA 5JCNA 2R4JA 4IA6A 1B5QA 1FEAA 2V3BA 4II2A 2YG5A 1B4VA 1IUSA 2WPFA 1F8WA 2BS2A 3LXDA 2QA2A 2TMDA 1O95A 3IC9A 1H7XA 3CIRA 3RP8A 2PYXA 2VVMA 3S61A 1EL5A 5JCMA 2XYOA 4B65A 1CJ4A 3ZDNA 2RGOA 4ADWA 3R9UA 5BUKA 2XFNA 4WCTA 3NRNA 4CCRA 2Z5YA 2R46A 3AD7B 3KVEA 4EIQA 5FS7A 3K30A 3ALLA 3ZYXA 3B6DA 4EMJA 2JAEA 4NTCA 1B37A 1Y0PA 1JEHA 3CNPA 3AEBA 1NPXA 4KX6A 4UDQA 3CNTA 2VQBA 2DKHA 4C74A 4UP3A 2E5VA 2CDUA 4NEWA 3SXIA 4G73A 3UOVA 4U8NA 2C67A 3P4PA 2ACZA 4B67A 4H4WA 1JRXA 2Q0KA 5GSNA 3GWDA 4OPTA 5J7XA 3C96A 2VOUA 2FJAA 3DJDA 2XVHA 2FJBA 2WP5A 3DMEA 3UKFA 3UOZA 3CNSA 5M0ZA 3QJ4A 3GDPA 1BF3A 2BS3A 5U25A 1P2EA 3NIXA 3NLCA 5BVAA 1OJDA 2GEWA 3CNDA 4OPLA 3BNUA 3GMCA 3P4SA 2BRAA 4H4QA 2Q0LA 4Z24A 4YXDA 3GRTA 3DJGX 3G5SA 2WPCA 3AYJA 4B68A 3ATQA 4B63A 4EIPA 1MOKA 1PBCA 5KOXA 2YM2A 2C66A 3ISHA 3F8PA 3Q9TA 5BRTA 1JU2A 1E1KA 1Q9IA 1GRTA 1PBFA 1YY5A 4Z43A 1GRBA 3RHAA 1H84A 4Z44A 4OPIA 1UKVG 3KKJA 3VRDB 4D04A 3SYIA 4K22A 1TYTA 1K0JA 3T2YA 4C5OA 3ALJA 1BWCA 1YKJA 3KU9A 3AWIA 4U2TA 4DSGA 2C3CA 1CJ3A 1NG3A 2JK6A 4JQ9A 3NG7X 5CKUA 4YKFA 1DOEA 3UKLA 5KOWA 3UOXA 3GDNA 1H82A 1OJ9A 1JNZA 2JB2A 1S3EA 4H4ZA 3VQRA 4U8LA 2XVEA 4EQSA 1CHUA 2WDRA 3GMBA 1GPEA 2H88A 2YLXA 3RP7A 4FK1A 1KFYA 3V3OA 3NTDA 1K0LA 1M6IA 1FL2A 1X31B 2EQ7A 3M12A 4JDRA 2WOWA 3ABVA 1DXLA 1D4DA 1DOCA 1TDKA 3AD8B 3T14A 4CCQA 1S2YA 2A8XA 4FDCB 3AE6A 5KRQA 1BZLA 3AYLA 3T31A 3G5RA 2X99A 2GR3A 4BK2A 3LZXA 4GF7A 2C70A 1E1MA 2C65A 4H4RA 1YQ3A 4TM1A 2JB3A 5C3JA 1F8SA 4Z2UA 4H2NA 3SY4A 3HYVA 4GR1A 3CPIG 5U63A 4Z2TA 3LOVA 1EL9A 3F8DA 3S5WA 5FS8A 1TDNA 2WOVA 3EAOA 2XVIA 1XPQA 4YTMA 2YG6A 1DOBA 5ER0A 3UCLA 2Y6QA 4RG3A 3RNMA 1XHCA 1GTHA 1GRGA 2O9ZA 3QSMA 1L0VA 3UKKA 1IUWA 3CGCA 1OJTA 3ATRA 2GR2A 3SM8A 3IHMA 3T2ZA 3UKQA 1MO9A 3DGHA 4HB9A 4Z25A 3ADAB 4NNJA 2PHHA 1O5WA 3ALMA 4CBQA 1IUTA 3L1RA 4IA5A 2V6OA 1F6MA 4A7AA 1DODA 4E0VA 5KVIA 3P1WA 3I3LA 2BC1A 2YG7A 2B9WA 3LADA 1ZOVA 4U8MA 1ZMDA 5FMHA 4OPCA 3SGLA 2Q7VA 4OPGA 1VG0A 2ZZCA 4OPDA 4Y4MA 1ONFA 3F8RA 1GRFA 2A89A 2WOIA 5JCIA 3CN8A 4UDRA 1LJ1A 4RG4A 2IVEA 3UKPA 2B7SA 2YLZA 3NNEA 3DK9A 4U8PA 3URHA 4YSZA 3VR8A 1TDFA 1BGJA 2XVJA 1IUUA 1GT8A 2YVJA 1RYIA 4NEVA 1DNCA 1NHQA 2F5ZA 1PS9A 1N1PA 1E6EA 4JY3A 4Y4LA 1E1NA 2V61A 2X3NA 3AE3A 3COXA 3REDA 2YQUA 1HYUA 4I58A 1PHHA 4AP3A 3QVRA 1ZMCA 2C4CA 2C72A 4YSHA 2C64A 4K7ZA 2BRYA 2XLPA 4IVOB 4I59A 1PXAA 4OPUA 2EQ6A 3SZCA 2XFUA 2GMJA 4YTNA 4TM0A 1FEBA 2EQ9A 2CFYA 2R9ZA 4NZHA 5EB4A 4A5LA 1H83A 2GQWA 1LPFA 3IHGA 1CL0A 1YQZA 4YWOA 2H89A 1GALA 3BHKA 5IQ1A 4EMWA 3OZ2A 2GR1A 1E39A 4DNAA 5JCKA 1N4UA 3QSEA 2JB1A 2R4EA 3DJEA 2BXRA 5HHFA 4ZN0A 5EBKA 3AD9B 4XXGA 1BGNA 1K4QA 4CRTA 2YLWA 5U1OA 4G9KA 2GRTA 4KPRA 3OC4A 1Z6LA 3AXBA 3CMMA 4YT0A 2ZBWA 4UDPA 2BC0A 2APGA 1EL7A 2EQ8A 4J57A 4H4TA 4J33A 4K5RA 4EM4A 3II4A 5BULA 4APNA 4J34A 4CY8A 3GYIA 2B7RA 4LIIA 3H4KA 3E1TA 1ZDLA 3QSSA 4X9NA 2J3NA 1NDAA 2GH5A 2WPEA 1ZKQA 4Z2RA 4AT2A 1PN0A 1QO8A 4CNJA 3K7TA 3NT6A 2WBAA 3PO7A 1Y56A 4U8JA 2GVCA 3PVCA 3NHOX 5KMPA 1IUXA 1CJ2A 1JNRA 2E1MA 4TLXA 3AE9A 4BK3A 1AOGA 1D7LA 2QAEA 3C4AA 4JN9A 4B1BA 1JOAA 1JRYA 2BA9A 4GAVA 4P9SA 4YSXA 1CJCA 2X8HA 1PJ7A 4IV9A 4USRA 3T2KA 3QVPA 1GEUA 5KMRA 1PXBA 4ECHA 1VDCA 5C2TA 4A9WA 3KA7A 2FJEA 2XFPA 1GNDA 1L9EA 2QCUA 3BI5A 4M52A 4B64A 4DGKA 2XLTA 5JCLA 2ZZBA 3FBSA 2XFOA 5CQFA 3RP6A 1XANA 3NK2X 1Y56B 3CGBA 4ZCCA 4O5UA 2JBVA 1FOHA 3SZFA 1N4VA 1PJ6A 4U8OA 4AOSA 3SFDA 1EL8A 1ZX9A 3AECA 2A87A 1D5TA 2YVGA 1Q1RA 1S3BA 1W4XA 2BK3A 2FJDA 1NG4A 2IIDA 3KD9A 3NK0X 4GCMA 3V76A 2V60A 4WX1A 3BI4A 2XLUA 4YTPA 4OVIA 3GRSA 3VR9A 5KNLA 2XLRA 1K0IA 1KF6A 1TRBA 2YM1A 2WHDA 2NPXA 4H4VA 1YQ4A 2YR5A 2FBWA 2YG4A 5KMQA 5KMSA 1QJDA 3DK4A 1PBEA 3UTGA 4U2LA 4J31A 5IPYA 3KLJA 2BACA 3GYXA 2WESA 3NTAA 3DA1A 3SFEA 1F3PA 3NYEA 4X9MA 3GWFA 1GXFA 3H8LA 2BCPA 1VQWA 2BK4A 3AEFA 1L9DA 2YR4A 3CGDA 3LZWA 4LU6A 4U8IA 5GRTA 1VRQB 3NYCA 1F8RA 4EM3A 1Q1WA 4BV6A 5HY5A 1ZP0A 1CBOA 4GRTA 4A79A 2YLTA 1PJ5A 4NWZA 3NN6X 2C7GA 3AE7A 2WEUA 3AE5A 1D7YA 1TDEA 3BHFA 4AOXA 4H4UA 2QA1A 2VVLG 2R0PA 4II3A 3FPZA 1L9CA 4EMIA 4H7UA 2JKCA 2IVDA 4K8DA 5EOWA 4RSLA 3DK8A 5LV9A 2AQJA 3FIMB 5KVHA 1GTEA 2BS4A 2X8CA 3P9UA 1CC4A 4TM3A 5M10A 3DGZA 4D03A 2OLOA 2WETA 5TR3A 4FK1C 1BKWA 4PAAA 3NYFA 2WU2A 4GAPA 2W0HA 2V5ZA 2VQ7A 4NTEA 3VRAA 1O94A 3IWAA 2I0ZA 2B9XA 5HXIA 3B3RA 1LQUA 3BNMA 2X50A 4H4XA 2GQFA 3Q6JA 1FECA 3BI2A 3HYWA 2HQMA 2WP9A 3UTFA 3CPHG 2VZ2A 3UP4A 4ZCDA 4G74A 3NK1X 1GESA 3UKHA 2GF3A 1RSGA 1LV0A 4GDEA 2BCGG 3O0HA 2AR8A 4H4SA 4K5SA 3AYIA 1H6VA 4XWRA 4A99A 4Y4NA 4CY6A 3M0OA 3DH9A 1IUVA 4OCGA 1ELIA 3G5QA 3QFAA 3QFBA 1EBDA 1CF3A 2WS3A 4EQWA 1GETA 4G6HA 3ICTA 3UTHA 1PBBA 4Z26A 5FS9A 3UOYA 2OA1A 4H50A 3AEGA 3AE4A 4LA1A 3NGCX 1M64A 1LVLA 3CPJG 5KXJA 4H2PA 2TPRA 2VRLA 4DSHA 1KNRA 3EF6A 3P4QA 1PXCA 3KPFA 2BABA 1KNPA 1D4CA 2Q6UA 2XFQA 4BJYA 1N4WA 3JSKA 2X8GA 2GAGB 4J36A 1PDHA 3FG2P 2GV8A 2Y6RA 3I6DA 1B8SA 4G6GA 3HZLA 2RGJA 1ZK7A 4J2WA 1NHRA 3LJPA 3AE2A 1FCDA 2C75A 4K2XA 2GMHA 2C3DA 4XWZA 4BK1A 4AP1A 1DJQA 1VG9A 2YVFA 4JY2A 3KPKA 2YR6A 4HA6A 3SX6A 2XVFA 3FMWA 1KDGA 2XDOA 2RGHA 1GRHA 1COYA 1SEZA 5DBJA 3NN0X 1TYPA 2YLSA 2XLSA 5EB5A 1MXTA 3ICSA 1LTXR 4CNKA 3UP5A 1OJCA 1REOA 1ZOYA 4AT0A 1IJHA 1OJAA 2WDQA 3AE8A 3D8XA 4TM4A 2YG3A 3NKSA 2R0GA 1D4EA 5L46A 4J56A 1LQTA 1V59A 1GRAA 2AAQA 4C3YA 1GV4A 4NTDA 4BJZA 4USQA 2E4GA 2DKIA 3VRBA 2OAMA 4H4PA 3AE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBD A;  4C77 A;  2GB0 A;  3SQP A;  3M13 A;  1E1L A;  4B69 A;  2ZZ0 A;  1NHS A;  4X4J A;  2C76 A;  2YLR A;  3P4R A;  4ICY A;  3K7Q X;  4REK A;  1KSS A;  3ICR A;  4YKG A;  3AED A;  1CC6 A;  1RP0 A;  3GD4 A;  3CTY A;  2WQY A;  5KWF A;  4JNA A;  2BK5 A;  2WDV A;  4BUR A;  4JNQ A;  3T37 A;  2YWL A;  4EQR A;  1NHP A;  2GR0 A;  2B76 A;  2R0C A;  2NVK X;  3GSI A;  1GER A;  3C4N A;  1TDO A;  2OLN A;  4N9X A;  3AEE A;  2BYB A;  2C73 A;  4H2Q A;  3PS9 A;  1H7W A;  3NH3 X;  1XDI A;  3CGE A;  1NEK A;  1ZY8 A;  3ITJ A;  4H2R A;  3AB1 A;  3CNJ A;  1GOS A;  1S2Q A;  3EPT A;  4C3X A;  5HYM A;  5IQ4 A;  4U2S A;  1GSN A;  4TLZ A;  4GDP A;  2CUL A;  3V3N A;  2WP6 A;  2VRM A;  2YAU A;  4U8K A;  2UZZ A;  4A6N A;  4O5Q A;  2OAL A;  4A65 A;  4B66 A;  1H81 A;  4EQX A;  3AEA A;  2Z5X A;  4GUV A;  5FS6 A;  1E7P A;  4H4Y A;  4MJW A;  4FX9 A;  1H86 A;  1QLB A;  2B9Y A;  4YSY A;  1NAA A;  2BXS A;  3L8K A;  1NEN A;  1P2H A;  4PAB A;  3GYJ A;  1DJN A;  3D1C A;  2R45 A;  2CVJ A;  3UKA A;  1JRZ A;  3LB8 A;  1CC2 A;  2RAB A;  3IF9 A;  1KSU A;  4IVM B;  2V3A A;  3EAN A;  5J60 A;  1GRE A;  2ARD A;  2VVL A;  3WE0 A;  3H8I A;  2GAH B;  4A6N B;  3GD3 A;  3K7M X;  2WU5 A;  2XCG A;  3DJJ A;  3UTE A;  5JCN A;  2R4J A;  4IA6 A;  1B5Q A;  1FEA A;  2V3B A;  2YG5 A;  1B4V A;  1IUS A;  2WPF A;  1F8W A;  2BS2 A;  3LXD A;  2QA2 A;  2TMD A;  1O95 A;  3IC9 A;  1H7X A;  3CIR A;  3RP8 A;  2PYX A;  2VVM A;  3S61 A;  1EL5 A;  5JCM A;  2XYO A;  4B65 A;  1CJ4 A;  3ZDN A;  2RGO A;  4ADW A;  3R9U A;  5BUK A;  2XFN A;  4WCT A;  3NRN A;  4CCR A;  2Z5Y A;  2R46 A;  3AD7 B;  3KVE A;  4EIQ A;  5FS7 A;  3K30 A;  3ALL A;  3ZYX A;  3B6D A;  4EMJ A;  2JAE A;  4NTC A;  1B37 A;  1Y0P A;  1JEH A;  3CNP A;  3AEB A;  1NPX A;  4KX6 A;  4UDQ A;  3CNT A;  2VQB A;  2DKH A;  4C74 A;  4UP3 A;  2E5V A;  2CDU A;  4NEW A;  3UOV A;  4U8N A;  2C67 A;  3P4P A;  2ACZ A;  4B67 A;  4H4W A;  1JRX A;  2Q0K A;  5GSN A;  3GWD A;  4OPT A;  5J7X A;  3C96 A;  2VOU A;  2FJA A;  3DJD A;  2XVH A;  2FJB A;  2WP5 A;  3DME A;  3UKF A;  3UOZ A;  3CNS A;  5M0Z A;  3QJ4 A;  3GDP A;  1BF3 A;  2BS3 A;  5U25 A;  1P2E A;  3NIX A;  3NLC A;  5BVA A;  1OJD A;  2GEW A;  3CND A;  4OPL A;  3BNU A;  3GMC A;  3P4S A;  4H4Q A;  2Q0L A;  4Z24 A;  4YXD A;  3GRT A;  3DJG X;  3G5S A;  2WPC A;  3AYJ A;  4B68 A;  3ATQ A;  4B63 A;  4EIP A;  1MOK A;  1PBC A;  5KOX A;  2YM2 A;  2C66 A;  3ISH A;  3F8P A;  3Q9T A;  5BRT A;  1JU2 A;  1E1K A;  1Q9I A;  1GRT A;  1PBF A;  1YY5 A;  4Z43 A;  1GRB A;  3RHA A;  1H84 A;  4Z44 A;  4OPI A;  1UKV G;  3KKJ A;  3VRD B;  4D04 A;  4K22 A;  1TYT A;  1K0J A;  4C5O A;  3ALJ A;  1BWC A;  1YKJ A;  3KU9 A;  3AWI A;  4U2T A;  4DSG A;  2C3C A;  1CJ3 A;  1NG3 A;  2JK6 A;  4JQ9 A;  3NG7 X;  5CKU A;  4YKF A;  1DOE A;  3UKL A;  5KOW A;  3UOX A;  3GDN A;  1H82 A;  1OJ9 A;  1JNZ A;  2JB2 A;  1S3E A;  4H4Z A;  3VQR A;  4U8L A;  2XVE A;  4EQS A;  1CHU A;  2WDR A;  3GMB A;  1GPE A;  2H88 A;  2YLX A;  3RP7 A;  4FK1 A;  1KFY A;  3V3O A;  3NTD A;  1K0L A;  1M6I A;  1FL2 A;  1X31 B;  2EQ7 A;  3M12 A;  4JDR A;  2WOW A;  3ABV A;  1DXL A;  1D4D A;  1DOC A;  1TDK A;  3AD8 B;  4CCQ A;  1S2Y A;  2A8X A;  4FDC B;  3AE6 A;  5KRQ A;  1BZL A;  3AYL A;  3G5R A;  2X99 A;  2GR3 A;  4BK2 A;  3LZX A;  4GF7 A;  2C70 A;  1E1M A;  2C65 A;  4H4R A;  1YQ3 A;  4TM1 A;  2JB3 A;  5C3J A;  1F8S A;  4Z2U A;  4H2N A;  4GR1 A;  3CPI G;  5U63 A;  4Z2T A;  3LOV A;  1EL9 A;  3F8D A;  3S5W A;  5FS8 A;  1TDN A;  2WOV A;  3EAO A;  2XVI A;  1XPQ A;  4YTM A;  2YG6 A;  1DOB A;  5ER0 A;  3UCL A;  2Y6Q A;  4RG3 A;  3RNM A;  1XHC A;  1GTH A;  1GRG A;  2O9Z A;  3QSM A;  1L0V A;  3UKK A;  1IUW A;  3CGC A;  1OJT A;  3ATR A;  2GR2 A;  3SM8 A;  3IHM A;  3UKQ A;  1MO9 A;  3DGH A;  4HB9 A;  4Z25 A;  3ADA B;  2PHH A;  1O5W A;  3ALM A;  4CBQ A;  1IUT A;  3L1R A;  4IA5 A;  2V6O A;  1F6M A;  4A7A A;  1DOD A;  4E0V A;  5KVI A;  3P1W A;  3I3L A;  2BC1 A;  2YG7 A;  2B9W A;  3LAD A;  1ZOV A;  4U8M A;  1ZMD A;  5FMH A;  4OPC A;  3SGL A;  2Q7V A;  4OPG A;  1VG0 A;  2ZZC A;  4OPD A;  4Y4M A;  1ONF A;  3F8R A;  1GRF A;  2A89 A;  2WOI A;  5JCI A;  3CN8 A;  4UDR A;  1LJ1 A;  4RG4 A;  2IVE A;  3UKP A;  2B7S A;  2YLZ A;  3NNE A;  3DK9 A;  4U8P A;  3URH A;  4YSZ A;  3VR8 A;  1TDF A;  1BGJ A;  2XVJ A;  1IUU A;  1GT8 A;  2YVJ A;  1RYI A;  4NEV A;  1DNC A;  1NHQ A;  2F5Z A;  1PS9 A;  1N1P A;  1E6E A;  4JY3 A;  4Y4L A;  1E1N A;  2V61 A;  2X3N A;  3AE3 A;  3COX A;  3RED A;  2YQU A;  1HYU A;  4I58 A;  1PHH A;  4AP3 A;  3QVR A;  1ZMC A;  2C72 A;  4YSH A;  2C64 A;  4K7Z A;  4IVO B;  2XLP A;  4I59 A;  1PXA A;  4OPU A;  2EQ6 A;  2XFU A;  2GMJ A;  4YTN A;  4TM0 A;  1FEB A;  2EQ9 A;  2CFY A;  2R9Z A;  4NZH A;  5EB4 A;  4A5L A;  1H83 A;  2GQW A;  1LPF A;  3IHG A;  1CL0 A;  1YQZ A;  4YWO A;  2H89 A;  1GAL A;  3BHK A;  5IQ1 A;  4EMW A;  3OZ2 A;  2GR1 A;  1E39 A;  4DNA A;  5JCK A;  1N4U A;  3QSE A;  2JB1 A;  2R4E A;  3DJE A;  2BXR A;  5HHF A;  4ZN0 A;  5EBK A;  3AD9 B;  4XXG A;  1BGN A;  1K4Q A;  4CRT A;  2YLW A;  5U1O A;  2GRT A;  4KPR A;  3OC4 A;  1Z6L A;  3AXB A;  4YT0 A;  2ZBW A;  4UDP A;  2BC0 A;  2APG A;  1EL7 A;  2EQ8 A;  4J57 A;  4H4T A;  4J33 A;  4K5R A;  4EM4 A;  3II4 A;  5BUL A;  4APN A;  4J34 A;  4CY8 A;  3GYI A;  2B7R A;  4LII A;  3H4K A;  3E1T A;  1ZDL A;  3QSS A;  4X9N A;  2J3N A;  1NDA A;  2GH5 A;  2WPE A;  1ZKQ A;  4Z2R A;  4AT2 A;  1PN0 A;  1QO8 A;  4CNJ A;  3K7T A;  3NT6 A;  2WBA A;  3PO7 A;  1Y56 A;  4U8J A;  2GVC A;  3PVC A;  3NHO X;  1IUX A;  1CJ2 A;  1JNR A;  2E1M A;  4TLX A;  3AE9 A;  4BK3 A;  1AOG A;  1D7L A;  2QAE A;  3C4A A;  4JN9 A;  4B1B A;  1JOA A;  1JRY A;  2BA9 A;  4P9S A;  4YSX A;  1CJC A;  2X8H A;  1PJ7 A;  4IV9 A;  4USR A;  3QVP A;  1GEU A;  1PXB A;  4ECH A;  1VDC A;  5C2T A;  4A9W A;  3KA7 A;  2FJE A;  2XFP A;  1GND A;  1L9E A;  2QCU A;  3BI5 A;  4M52 A;  4B64 A;  4DGK A;  2XLT A;  5JCL A;  2ZZB A;  3FBS A;  2XFO A;  5CQF A;  3RP6 A;  1XAN A;  3NK2 X;  1Y56 B;  3CGB A;  4ZCC A;  4O5U A;  2JBV A;  1FOH A;  1N4V A;  1PJ6 A;  4U8O A;  4AOS A;  3SFD A;  1EL8 A;  1ZX9 A;  3AEC A;  2A87 A;  1D5T A;  2YVG A;  1Q1R A;  1S3B A;  1W4X A;  2BK3 A;  2FJD A;  1NG4 A;  2IID A;  3KD9 A;  3NK0 X;  4GCM A;  3V76 A;  2V60 A;  4WX1 A;  3BI4 A;  2XLU A;  4YTP A;  4OVI A;  3GRS A;  3VR9 A;  2XLR A;  1K0I A;  1KF6 A;  1TRB A;  2YM1 A;  2WHD A;  2NPX A;  4H4V A;  1YQ4 A;  2YR5 A;  2FBW A;  2YG4 A;  1QJD A;  3DK4 A;  1PBE A;  3UTG A;  4U2L A;  4J31 A;  5IPY A;  3KLJ A;  2BAC A;  3SFE A;  2WES A;  3NTA A;  3DA1 A;  1F3P A;  3NYE A;  4X9M A;  3GWF A;  1GXF A;  3H8L A;  2BCP A;  1VQW A;  2BK4 A;  3AEF A;  1L9D A;  2YR4 A;  3CGD A;  3LZW A;  4LU6 A;  4U8I A;  5GRT A;  1VRQ B;  3NYC A;  1F8R A;  4EM3 A;  1Q1W A;  4BV6 A;  5HY5 A;  1ZP0 A;  1CBO A;  4GRT A;  4A79 A;  2YLT A;  1PJ5 A;  3NN6 X;  2C7G A;  3AE7 A;  2WEU A;  3AE5 A;  1D7Y A;  1TDE A;  3BHF A;  4AOX A;  4H4U A;  2QA1 A;  2VVL G;  2R0P A;  4EMI A;  3FPZ A;  1L9C A;  4H7U A;  2JKC A;  2IVD A;  4K8D A;  5EOW A;  4RSL A;  3DK8 A;  5LV9 A;  2AQJ A;  3FIM B;  5KVH A;  1GTE A;  2BS4 A;  2X8C A;  3P9U A;  1CC4 A;  4TM3 A;  5M10 A;  3DGZ A;  4D03 A;  2OLO A;  2WET A;  5TR3 A;  4FK1 C;  1BKW A;  4PAA A;  3NYF A;  2WU2 A;  2W0H A;  2V5Z A;  2VQ7 A;  4NTE A;  3VRA A;  1O94 A;  3IWA A;  2I0Z A;  2B9X A;  5HXI A;  3B3R A;  1LQU A;  3BNM A;  2X50 A;  4H4X A;  2GQF A;  3Q6J A;  1FEC A;  3BI2 A;  2HQM A;  2WP9 A;  3UTF A;  3CPH G;  2VZ2 A;  3UP4 A;  4ZCD A;  3NK1 X;  1GES A;  3UKH A;  2GF3 A;  1RSG A;  1LV0 A;  4GDE A;  2BCG G;  3O0H A;  2AR8 A;  4H4S A;  4K5S A;  3AYI A;  1H6V A;  4XWR A;  4A99 A;  4Y4N A;  4CY6 A;  3M0O A;  3DH9 A;  1IUV A;  4OCG A;  1ELI A;  3G5Q A;  3QFA A;  3QFB A;  1EBD A;  1CF3 A;  2WS3 A;  4EQW A;  1GET A;  3ICT A;  3UTH A;  1PBB A;  4Z26 A;  5FS9 A;  3UOY A;  2OA1 A;  4H50 A;  3AEG A;  3AE4 A;  4LA1 A;  3NGC X;  1M64 A;  1LVL A;  3CPJ G;  5KXJ A;  4H2P A;  2TPR A;  2VRL A;  4DSH A;  1KNR A;  3EF6 A;  3P4Q A;  1PXC A;  3KPF A;  2BAB A;  1KNP A;  1D4C A;  2Q6U A;  2XFQ A;  4BJY A;  1N4W A;  3JSK A;  2X8G A;  2GAG B;  4J36 A;  1PDH A;  3FG2 P;  2GV8 A;  2Y6R A;  3I6D A;  1B8S A;  3HZL A;  2RGJ A;  1ZK7 A;  4J2W A;  1NHR A;  3LJP A;  3AE2 A;  1FCD A;  2C75 A;  4K2X A;  2GMH A;  2C3D A;  4XWZ A;  4BK1 A;  4AP1 A;  1DJQ A;  1VG9 A;  2YVF A;  4JY2 A;  2YR6 A;  4HA6 A;  2XVF A;  3FMW A;  1KDG A;  2XDO A;  2RGH A;  1GRH A;  1COY A;  1SEZ A;  5DBJ A;  3NN0 X;  1TYP A;  2YLS A;  2XLS A;  5EB5 A;  1MXT A;  3ICS A;  1LTX R;  4CNK A;  3UP5 A;  1OJC A;  1REO A;  1ZOY A;  4AT0 A;  1IJH A;  1OJA A;  2WDQ A;  3AE8 A;  3D8X A;  4TM4 A;  2YG3 A;  3NKS A;  2R0G A;  1D4E A;  5L46 A;  4J56 A;  1LQT A;  1V59 A;  1GRA A;  2AAQ A;  4C3Y A;  1GV4 A;  4NTD A;  4BJZ A;  4USQ A;  2E4G A;  2DKI A;  3VRB A;  2OAM A;  4H4P A;  3AE1 A; 
#chains in the Genus database with same CATH topology
 1PBD A;  4C77 A;  2GB0 A;  3SQP A;  3M13 A;  1E1L A;  4B69 A;  2ZZ0 A;  3SZW A;  1NHS A;  4X4J A;  2C76 A;  2YLR A;  3P4R A;  3HYX A;  4ICY A;  3K7Q X;  4REK A;  1KSS A;  3ICR A;  4YKG A;  3AED A;  1CC6 A;  1RP0 A;  3GD4 A;  3CTY A;  2WQY A;  5KWF A;  4JNA A;  2BK5 A;  2WDV A;  4BUR A;  4JNQ A;  3T37 A;  2YWL A;  4EQR A;  1NHP A;  2GR0 A;  2B76 A;  2R0C A;  2NVK X;  3GSI A;  1GER A;  3C4N A;  1TDO A;  2OLN A;  4N9X A;  3AEE A;  2BYB A;  2C73 A;  4H2Q A;  3PS9 A;  1H7W A;  3NH3 X;  1XDI A;  3CGE A;  1NEK A;  1ZY8 A;  3ITJ A;  4H2R A;  3AB1 A;  3CNJ A;  1GOS A;  1S2Q A;  3EPT A;  4C3X A;  5HYM A;  5IQ4 A;  4U2S A;  1GSN A;  4TLZ A;  4GDP A;  2CUL A;  3V3N A;  2WP6 A;  2VRM A;  2YAU A;  4U8K A;  2UZZ A;  4A6N A;  4O5Q A;  2OAL A;  4A65 A;  4B66 A;  1H81 A;  4EQX A;  3AEA A;  2Z5X A;  4GUV A;  5FS6 A;  1E7P A;  4H4Y A;  4MJW A;  4FX9 A;  1H86 A;  1QLB A;  2B9Y A;  4YSY A;  1NAA A;  2BXS A;  3L8K A;  3T0K A;  1NEN A;  1P2H A;  4PAB A;  3GYJ A;  3SZ0 A;  1DJN A;  3D1C A;  2R45 A;  2CVJ A;  3UKA A;  1JRZ A;  3LB8 A;  1CC2 A;  2RAB A;  3IF9 A;  1KSU A;  4IVM B;  2V3A A;  3EAN A;  5J60 A;  1GRE A;  2ARD A;  2VVL A;  3WE0 A;  3H8I A;  2GAH B;  4A6N B;  3GD3 A;  3K7M X;  2WU5 A;  2XCG A;  3DJJ A;  3UTE A;  5JCN A;  2R4J A;  4IA6 A;  1B5Q A;  1FEA A;  2V3B A;  4II2 A;  2YG5 A;  1B4V A;  1IUS A;  2WPF A;  1F8W A;  2BS2 A;  3LXD A;  2QA2 A;  2TMD A;  1O95 A;  3IC9 A;  1H7X A;  3CIR A;  3RP8 A;  2PYX A;  2VVM A;  3S61 A;  1EL5 A;  5JCM A;  2XYO A;  4B65 A;  1CJ4 A;  3ZDN A;  2RGO A;  4ADW A;  3R9U A;  5BUK A;  2XFN A;  4WCT A;  3NRN A;  4CCR A;  2Z5Y A;  2R46 A;  3AD7 B;  3KVE A;  4EIQ A;  5FS7 A;  3K30 A;  3ALL A;  3ZYX A;  3B6D A;  4EMJ A;  2JAE A;  4NTC A;  1B37 A;  1Y0P A;  1JEH A;  3CNP A;  3AEB A;  1NPX A;  4KX6 A;  4UDQ A;  3CNT A;  2VQB A;  2DKH A;  4C74 A;  4UP3 A;  2E5V A;  2CDU A;  4NEW A;  3SXI A;  4G73 A;  3UOV A;  4U8N A;  2C67 A;  3P4P A;  2ACZ A;  4B67 A;  4H4W A;  1JRX A;  2Q0K A;  5GSN A;  3GWD A;  4OPT A;  5J7X A;  3C96 A;  2VOU A;  2FJA A;  3DJD A;  2XVH A;  2FJB A;  2WP5 A;  3DME A;  3UKF A;  3UOZ A;  3CNS A;  5M0Z A;  3QJ4 A;  3GDP A;  1BF3 A;  2BS3 A;  5U25 A;  1P2E A;  3NIX A;  3NLC A;  5BVA A;  1OJD A;  2GEW A;  3CND A;  4OPL A;  3BNU A;  3GMC A;  3P4S A;  2BRA A;  4H4Q A;  2Q0L A;  4Z24 A;  4YXD A;  3GRT A;  3DJG X;  3G5S A;  2WPC A;  3AYJ A;  4B68 A;  3ATQ A;  4B63 A;  4EIP A;  1MOK A;  1PBC A;  5KOX A;  2YM2 A;  2C66 A;  3ISH A;  3F8P A;  3Q9T A;  5BRT A;  1JU2 A;  1E1K A;  1Q9I A;  1GRT A;  1PBF A;  1YY5 A;  4Z43 A;  1GRB A;  3RHA A;  1H84 A;  4Z44 A;  4OPI A;  1UKV G;  3KKJ A;  3VRD B;  4D04 A;  3SYI A;  4K22 A;  1TYT A;  1K0J A;  3T2Y A;  4C5O A;  3ALJ A;  1BWC A;  1YKJ A;  3KU9 A;  3AWI A;  4U2T A;  4DSG A;  2C3C A;  1CJ3 A;  1NG3 A;  2JK6 A;  4JQ9 A;  3NG7 X;  5CKU A;  4YKF A;  1DOE A;  3UKL A;  5KOW A;  3UOX A;  3GDN A;  1H82 A;  1OJ9 A;  1JNZ A;  2JB2 A;  1S3E A;  4H4Z A;  3VQR A;  4U8L A;  2XVE A;  4EQS A;  1CHU A;  2WDR A;  3GMB A;  1GPE A;  2H88 A;  2YLX A;  3RP7 A;  4FK1 A;  1KFY A;  3V3O A;  3NTD A;  1K0L A;  1M6I A;  1FL2 A;  1X31 B;  2EQ7 A;  3M12 A;  4JDR A;  2WOW A;  3ABV A;  1DXL A;  1D4D A;  1DOC A;  1TDK A;  3AD8 B;  3T14 A;  4CCQ A;  1S2Y A;  2A8X A;  4FDC B;  3AE6 A;  5KRQ A;  1BZL A;  3AYL A;  3T31 A;  3G5R A;  2X99 A;  2GR3 A;  4BK2 A;  3LZX A;  4GF7 A;  2C70 A;  1E1M A;  2C65 A;  4H4R A;  1YQ3 A;  4TM1 A;  2JB3 A;  5C3J A;  1F8S A;  4Z2U A;  4H2N A;  3SY4 A;  3HYV A;  4GR1 A;  3CPI G;  5U63 A;  4Z2T A;  3LOV A;  1EL9 A;  3F8D A;  3S5W A;  5FS8 A;  1TDN A;  2WOV A;  3EAO A;  2XVI A;  1XPQ A;  4YTM A;  2YG6 A;  1DOB A;  5ER0 A;  3UCL A;  2Y6Q A;  4RG3 A;  3RNM A;  1XHC A;  1GTH A;  1GRG A;  2O9Z A;  3QSM A;  1L0V A;  3UKK A;  1IUW A;  3CGC A;  1OJT A;  3ATR A;  2GR2 A;  3SM8 A;  3IHM A;  3T2Z A;  3UKQ A;  1MO9 A;  3DGH A;  4HB9 A;  4Z25 A;  3ADA B;  4NNJ A;  2PHH A;  1O5W A;  3ALM A;  4CBQ A;  1IUT A;  3L1R A;  4IA5 A;  2V6O A;  1F6M A;  4A7A A;  1DOD A;  4E0V A;  5KVI A;  3P1W A;  3I3L A;  2BC1 A;  2YG7 A;  2B9W A;  3LAD A;  1ZOV A;  4U8M A;  1ZMD A;  5FMH A;  4OPC A;  3SGL A;  2Q7V A;  4OPG A;  1VG0 A;  2ZZC A;  4OPD A;  4Y4M A;  1ONF A;  3F8R A;  1GRF A;  2A89 A;  2WOI A;  5JCI A;  3CN8 A;  4UDR A;  1LJ1 A;  4RG4 A;  2IVE A;  3UKP A;  2B7S A;  2YLZ A;  3NNE A;  3DK9 A;  4U8P A;  3URH A;  4YSZ A;  3VR8 A;  1TDF A;  1BGJ A;  2XVJ A;  1IUU A;  1GT8 A;  2YVJ A;  1RYI A;  4NEV A;  1DNC A;  1NHQ A;  2F5Z A;  1PS9 A;  1N1P A;  1E6E A;  4JY3 A;  4Y4L A;  1E1N A;  2V61 A;  2X3N A;  3AE3 A;  3COX A;  3RED A;  2YQU A;  1HYU A;  4I58 A;  1PHH A;  4AP3 A;  3QVR A;  1ZMC A;  2C4C A;  2C72 A;  4YSH A;  2C64 A;  4K7Z A;  2BRY A;  2XLP A;  4IVO B;  4I59 A;  1PXA A;  4OPU A;  2EQ6 A;  3SZC A;  2XFU A;  2GMJ A;  4YTN A;  4TM0 A;  1FEB A;  2EQ9 A;  2CFY A;  2R9Z A;  4NZH A;  5EB4 A;  4A5L A;  1H83 A;  2GQW A;  1LPF A;  3IHG A;  1CL0 A;  1YQZ A;  4YWO A;  2H89 A;  1GAL A;  3BHK A;  5IQ1 A;  4EMW A;  3OZ2 A;  2GR1 A;  1E39 A;  4DNA A;  5JCK A;  1N4U A;  3QSE A;  2JB1 A;  2R4E A;  3DJE A;  2BXR A;  5HHF A;  4ZN0 A;  5EBK A;  3AD9 B;  4XXG A;  1BGN A;  1K4Q A;  4CRT A;  2YLW A;  5U1O A;  4G9K A;  2GRT A;  4KPR A;  3OC4 A;  1Z6L A;  3AXB A;  3CMM A;  4YT0 A;  2ZBW A;  4UDP A;  2BC0 A;  2APG A;  1EL7 A;  2EQ8 A;  4J57 A;  4H4T A;  4J33 A;  4K5R A;  4EM4 A;  3II4 A;  5BUL A;  4APN A;  4J34 A;  4CY8 A;  3GYI A;  2B7R A;  4LII A;  3H4K A;  3E1T A;  1ZDL A;  3QSS A;  4X9N A;  2J3N A;  1NDA A;  2GH5 A;  2WPE A;  1ZKQ A;  4Z2R A;  4AT2 A;  1PN0 A;  1QO8 A;  4CNJ A;  3K7T A;  3NT6 A;  2WBA A;  3PO7 A;  1Y56 A;  4U8J A;  2GVC A;  3PVC A;  3NHO X;  5KMP A;  1IUX A;  1CJ2 A;  1JNR A;  2E1M A;  4TLX A;  3AE9 A;  4BK3 A;  1AOG A;  1D7L A;  2QAE A;  3C4A A;  4JN9 A;  4B1B A;  1JOA A;  1JRY A;  2BA9 A;  4GAV A;  4P9S A;  4YSX A;  1CJC A;  2X8H A;  1PJ7 A;  4IV9 A;  4USR A;  3T2K A;  3QVP A;  1GEU A;  5KMR A;  1PXB A;  4ECH A;  1VDC A;  5C2T A;  4A9W A;  3KA7 A;  2FJE A;  2XFP A;  1GND A;  1L9E A;  2QCU A;  3BI5 A;  4M52 A;  4B64 A;  4DGK A;  2XLT A;  5JCL A;  2ZZB A;  3FBS A;  2XFO A;  5CQF A;  3RP6 A;  1XAN A;  3NK2 X;  1Y56 B;  3CGB A;  4ZCC A;  4O5U A;  2JBV A;  1FOH A;  3SZF A;  1N4V A;  1PJ6 A;  4U8O A;  4AOS A;  3SFD A;  1EL8 A;  1ZX9 A;  3AEC A;  2A87 A;  1D5T A;  2YVG A;  1Q1R A;  1S3B A;  1W4X A;  2BK3 A;  2FJD A;  1NG4 A;  2IID A;  3KD9 A;  3NK0 X;  4GCM A;  3V76 A;  2V60 A;  4WX1 A;  3BI4 A;  2XLU A;  4YTP A;  4OVI A;  3GRS A;  3VR9 A;  5KNL A;  2XLR A;  1K0I A;  1KF6 A;  1TRB A;  2YM1 A;  2WHD A;  2NPX A;  4H4V A;  1YQ4 A;  2YR5 A;  2FBW A;  2YG4 A;  5KMQ A;  5KMS A;  1QJD A;  3DK4 A;  1PBE A;  3UTG A;  4U2L A;  4J31 A;  5IPY A;  3KLJ A;  2BAC A;  3GYX A;  2WES A;  3NTA A;  3DA1 A;  3SFE A;  1F3P A;  3NYE A;  4X9M A;  3GWF A;  1GXF A;  3H8L A;  2BCP A;  1VQW A;  2BK4 A;  3AEF A;  1L9D A;  2YR4 A;  3CGD A;  3LZW A;  4LU6 A;  4U8I A;  5GRT A;  1VRQ B;  3NYC A;  1F8R A;  4EM3 A;  1Q1W A;  4BV6 A;  5HY5 A;  1ZP0 A;  1CBO A;  4GRT A;  4A79 A;  2YLT A;  1PJ5 A;  4NWZ A;  3NN6 X;  2C7G A;  3AE7 A;  2WEU A;  3AE5 A;  1D7Y A;  1TDE A;  3BHF A;  4AOX A;  4H4U A;  2QA1 A;  2VVL G;  2R0P A;  4II3 A;  3FPZ A;  1L9C A;  4EMI A;  4H7U A;  2JKC A;  2IVD A;  4K8D A;  5EOW A;  4RSL A;  3DK8 A;  5LV9 A;  2AQJ A;  3FIM B;  5KVH A;  1GTE A;  2BS4 A;  2X8C A;  3P9U A;  1CC4 A;  4TM3 A;  5M10 A;  3DGZ A;  4D03 A;  2OLO A;  2WET A;  5TR3 A;  4FK1 C;  1BKW A;  4PAA A;  3NYF A;  2WU2 A;  4GAP A;  2W0H A;  2V5Z A;  2VQ7 A;  4NTE A;  3VRA A;  1O94 A;  3IWA A;  2I0Z A;  2B9X A;  5HXI A;  3B3R A;  1LQU A;  3BNM A;  2X50 A;  4H4X A;  2GQF A;  3Q6J A;  1FEC A;  3BI2 A;  3HYW A;  2HQM A;  2WP9 A;  3UTF A;  3CPH G;  2VZ2 A;  3UP4 A;  4ZCD A;  4G74 A;  3NK1 X;  1GES A;  3UKH A;  2GF3 A;  1RSG A;  1LV0 A;  4GDE A;  2BCG G;  3O0H A;  2AR8 A;  4H4S A;  4K5S A;  3AYI A;  1H6V A;  4XWR A;  4A99 A;  4Y4N A;  4CY6 A;  3M0O A;  3DH9 A;  1IUV A;  4OCG A;  1ELI A;  3G5Q A;  3QFA A;  3QFB A;  1EBD A;  1CF3 A;  2WS3 A;  4EQW A;  1GET A;  4G6H A;  3ICT A;  3UTH A;  1PBB A;  4Z26 A;  5FS9 A;  3UOY A;  2OA1 A;  4H50 A;  3AEG A;  3AE4 A;  4LA1 A;  3NGC X;  1M64 A;  1LVL A;  3CPJ G;  5KXJ A;  4H2P A;  2TPR A;  2VRL A;  4DSH A;  1KNR A;  3EF6 A;  3P4Q A;  1PXC A;  3KPF A;  2BAB A;  1KNP A;  1D4C A;  2Q6U A;  2XFQ A;  4BJY A;  1N4W A;  3JSK A;  2X8G A;  2GAG B;  4J36 A;  1PDH A;  3FG2 P;  2GV8 A;  2Y6R A;  3I6D A;  1B8S A;  4G6G A;  3HZL A;  2RGJ A;  1ZK7 A;  4J2W A;  1NHR A;  3LJP A;  3AE2 A;  1FCD A;  2C75 A;  4K2X A;  2GMH A;  2C3D A;  4XWZ A;  4BK1 A;  4AP1 A;  1DJQ A;  1VG9 A;  2YVF A;  4JY2 A;  3KPK A;  2YR6 A;  4HA6 A;  3SX6 A;  2XVF A;  3FMW A;  1KDG A;  2XDO A;  2RGH A;  1GRH A;  1COY A;  1SEZ A;  5DBJ A;  3NN0 X;  1TYP A;  2YLS A;  2XLS A;  5EB5 A;  1MXT A;  3ICS A;  1LTX R;  4CNK A;  3UP5 A;  1OJC A;  1REO A;  1ZOY A;  4AT0 A;  1IJH A;  1OJA A;  2WDQ A;  3AE8 A;  3D8X A;  4TM4 A;  2YG3 A;  3NKS A;  2R0G A;  1D4E A;  5L46 A;  4J56 A;  1LQT A;  1V59 A;  1GRA A;  2AAQ A;  4C3Y A;  1GV4 A;  4NTD A;  4BJZ A;  4USQ A;  2E4G A;  2DKI A;  3VRB A;  2OAM A;  4H4P A;  3AE1 A; 
#chains in the Genus database with same CATH homology
 1PBD A;  4C77 A;  2GB0 A;  3SQP A;  3M13 A;  1E1L A;  4B69 A;  2ZZ0 A;  3SZW A;  1NHS A;  4X4J A;  2C76 A;  2YLR A;  3P4R A;  3HYX A;  4ICY A;  3K7Q X;  4REK A;  1KSS A;  3ICR A;  4YKG A;  3AED A;  1CC6 A;  1RP0 A;  3GD4 A;  3CTY A;  2WQY A;  5KWF A;  4JNA A;  2BK5 A;  2WDV A;  4BUR A;  4JNQ A;  3T37 A;  2YWL A;  4EQR A;  1NHP A;  2GR0 A;  2B76 A;  2R0C A;  2NVK X;  3GSI A;  1GER A;  3C4N A;  1TDO A;  2OLN A;  4N9X A;  3AEE A;  2BYB A;  2C73 A;  4H2Q A;  3PS9 A;  1H7W A;  3NH3 X;  1XDI A;  3CGE A;  1NEK A;  1ZY8 A;  3ITJ A;  4H2R A;  3AB1 A;  3CNJ A;  1GOS A;  1S2Q A;  3EPT A;  4C3X A;  5HYM A;  5IQ4 A;  4U2S A;  1GSN A;  4TLZ A;  4GDP A;  2CUL A;  3V3N A;  2WP6 A;  2VRM A;  2YAU A;  4U8K A;  2UZZ A;  4A6N A;  4O5Q A;  2OAL A;  4A65 A;  4B66 A;  1H81 A;  4EQX A;  3AEA A;  2Z5X A;  4GUV A;  5FS6 A;  1E7P A;  4H4Y A;  4MJW A;  4FX9 A;  1H86 A;  1QLB A;  2B9Y A;  4YSY A;  1NAA A;  2BXS A;  3L8K A;  3T0K A;  1NEN A;  1P2H A;  4PAB A;  3GYJ A;  3SZ0 A;  1DJN A;  3D1C A;  2R45 A;  2CVJ A;  3UKA A;  1JRZ A;  3LB8 A;  1CC2 A;  2RAB A;  3IF9 A;  1KSU A;  4IVM B;  2V3A A;  3EAN A;  5J60 A;  1GRE A;  2ARD A;  2VVL A;  3WE0 A;  3H8I A;  2GAH B;  4A6N B;  3GD3 A;  3K7M X;  2WU5 A;  2XCG A;  3DJJ A;  3UTE A;  5JCN A;  2R4J A;  4IA6 A;  1B5Q A;  1FEA A;  2V3B A;  4II2 A;  2YG5 A;  1B4V A;  1IUS A;  2WPF A;  1F8W A;  2BS2 A;  3LXD A;  2QA2 A;  2TMD A;  1O95 A;  3IC9 A;  1H7X A;  3CIR A;  3RP8 A;  2PYX A;  2VVM A;  3S61 A;  1EL5 A;  5JCM A;  2XYO A;  4B65 A;  1CJ4 A;  3ZDN A;  2RGO A;  4ADW A;  3R9U A;  5BUK A;  2XFN A;  4WCT A;  3NRN A;  4CCR A;  2Z5Y A;  2R46 A;  3AD7 B;  3KVE A;  4EIQ A;  5FS7 A;  3K30 A;  3ALL A;  3ZYX A;  3B6D A;  4EMJ A;  2JAE A;  4NTC A;  1B37 A;  1Y0P A;  1JEH A;  3CNP A;  3AEB A;  1NPX A;  4KX6 A;  4UDQ A;  3CNT A;  2VQB A;  2DKH A;  4C74 A;  4UP3 A;  2E5V A;  2CDU A;  4NEW A;  3SXI A;  4G73 A;  3UOV A;  4U8N A;  2C67 A;  3P4P A;  2ACZ A;  4B67 A;  4H4W A;  1JRX A;  2Q0K A;  5GSN A;  3GWD A;  4OPT A;  5J7X A;  3C96 A;  2VOU A;  2FJA A;  3DJD A;  2XVH A;  2FJB A;  2WP5 A;  3DME A;  3UKF A;  3UOZ A;  3CNS A;  5M0Z A;  3QJ4 A;  3GDP A;  1BF3 A;  2BS3 A;  5U25 A;  1P2E A;  3NIX A;  3NLC A;  5BVA A;  1OJD A;  2GEW A;  3CND A;  4OPL A;  3BNU A;  3GMC A;  3P4S A;  2BRA A;  4H4Q A;  2Q0L A;  4Z24 A;  4YXD A;  3GRT A;  3DJG X;  3G5S A;  2WPC A;  3AYJ A;  4B68 A;  3ATQ A;  4B63 A;  4EIP A;  1MOK A;  1PBC A;  5KOX A;  2YM2 A;  2C66 A;  3ISH A;  3F8P A;  3Q9T A;  5BRT A;  1JU2 A;  1E1K A;  1Q9I A;  1GRT A;  1PBF A;  1YY5 A;  4Z43 A;  1GRB A;  3RHA A;  1H84 A;  4Z44 A;  4OPI A;  1UKV G;  3KKJ A;  3VRD B;  4D04 A;  3SYI A;  4K22 A;  1TYT A;  1K0J A;  3T2Y A;  4C5O A;  3ALJ A;  1BWC A;  1YKJ A;  3KU9 A;  3AWI A;  4U2T A;  4DSG A;  2C3C A;  1CJ3 A;  1NG3 A;  2JK6 A;  4JQ9 A;  3NG7 X;  5CKU A;  4YKF A;  1DOE A;  3UKL A;  5KOW A;  3UOX A;  3GDN A;  1H82 A;  1OJ9 A;  1JNZ A;  2JB2 A;  1S3E A;  4H4Z A;  3VQR A;  4U8L A;  2XVE A;  4EQS A;  1CHU A;  2WDR A;  3GMB A;  1GPE A;  2H88 A;  2YLX A;  3RP7 A;  4FK1 A;  1KFY A;  3V3O A;  3NTD A;  1K0L A;  1M6I A;  1FL2 A;  1X31 B;  2EQ7 A;  3M12 A;  4JDR A;  2WOW A;  3ABV A;  1DXL A;  1D4D A;  1DOC A;  1TDK A;  3AD8 B;  3T14 A;  4CCQ A;  1S2Y A;  2A8X A;  4FDC B;  3AE6 A;  5KRQ A;  1BZL A;  3AYL A;  3T31 A;  3G5R A;  2X99 A;  2GR3 A;  4BK2 A;  3LZX A;  4GF7 A;  2C70 A;  1E1M A;  2C65 A;  4H4R A;  1YQ3 A;  4TM1 A;  2JB3 A;  5C3J A;  1F8S A;  4Z2U A;  4H2N A;  3SY4 A;  3HYV A;  4GR1 A;  3CPI G;  5U63 A;  4Z2T A;  3LOV A;  1EL9 A;  3F8D A;  3S5W A;  5FS8 A;  1TDN A;  2WOV A;  3EAO A;  2XVI A;  1XPQ A;  4YTM A;  2YG6 A;  1DOB A;  5ER0 A;  3UCL A;  2Y6Q A;  4RG3 A;  3RNM A;  1XHC A;  1GTH A;  1GRG A;  2O9Z A;  3QSM A;  1L0V A;  3UKK A;  1IUW A;  3CGC A;  1OJT A;  3ATR A;  2GR2 A;  3SM8 A;  3IHM A;  3T2Z A;  3UKQ A;  1MO9 A;  3DGH A;  4HB9 A;  4Z25 A;  3ADA B;  4NNJ A;  2PHH A;  1O5W A;  3ALM A;  4CBQ A;  1IUT A;  3L1R A;  4IA5 A;  2V6O A;  1F6M A;  4A7A A;  1DOD A;  4E0V A;  5KVI A;  3P1W A;  3I3L A;  2BC1 A;  2YG7 A;  2B9W A;  3LAD A;  1ZOV A;  4U8M A;  1ZMD A;  5FMH A;  4OPC A;  3SGL A;  2Q7V A;  4OPG A;  1VG0 A;  2ZZC A;  4OPD A;  4Y4M A;  1ONF A;  3F8R A;  1GRF A;  2A89 A;  2WOI A;  5JCI A;  3CN8 A;  4UDR A;  1LJ1 A;  4RG4 A;  2IVE A;  3UKP A;  2B7S A;  2YLZ A;  3NNE A;  3DK9 A;  4U8P A;  3URH A;  4YSZ A;  3VR8 A;  1TDF A;  1BGJ A;  2XVJ A;  1IUU A;  1GT8 A;  2YVJ A;  1RYI A;  4NEV A;  1DNC A;  1NHQ A;  2F5Z A;  1PS9 A;  1N1P A;  1E6E A;  4JY3 A;  4Y4L A;  1E1N A;  2V61 A;  2X3N A;  3AE3 A;  3COX A;  3RED A;  2YQU A;  1HYU A;  4I58 A;  1PHH A;  4AP3 A;  3QVR A;  1ZMC A;  2C4C A;  2C72 A;  4YSH A;  2C64 A;  4K7Z A;  2BRY A;  2XLP A;  4IVO B;  4I59 A;  1PXA A;  4OPU A;  2EQ6 A;  3SZC A;  2XFU A;  2GMJ A;  4YTN A;  4TM0 A;  1FEB A;  2EQ9 A;  2CFY A;  2R9Z A;  4NZH A;  5EB4 A;  4A5L A;  1H83 A;  2GQW A;  1LPF A;  3IHG A;  1CL0 A;  1YQZ A;  4YWO A;  2H89 A;  1GAL A;  3BHK A;  5IQ1 A;  4EMW A;  3OZ2 A;  2GR1 A;  1E39 A;  4DNA A;  5JCK A;  1N4U A;  3QSE A;  2JB1 A;  2R4E A;  3DJE A;  2BXR A;  5HHF A;  4ZN0 A;  5EBK A;  3AD9 B;  4XXG A;  1BGN A;  1K4Q A;  4CRT A;  2YLW A;  5U1O A;  4G9K A;  2GRT A;  4KPR A;  3OC4 A;  1Z6L A;  3AXB A;  3CMM A;  4YT0 A;  2ZBW A;  4UDP A;  2BC0 A;  2APG A;  1EL7 A;  2EQ8 A;  4J57 A;  4H4T A;  4J33 A;  4K5R A;  4EM4 A;  3II4 A;  5BUL A;  4APN A;  4J34 A;  4CY8 A;  3GYI A;  2B7R A;  4LII A;  3H4K A;  3E1T A;  1ZDL A;  3QSS A;  4X9N A;  2J3N A;  1NDA A;  2GH5 A;  2WPE A;  1ZKQ A;  4Z2R A;  4AT2 A;  1PN0 A;  1QO8 A;  4CNJ A;  3K7T A;  3NT6 A;  2WBA A;  3PO7 A;  1Y56 A;  4U8J A;  2GVC A;  3PVC A;  3NHO X;  5KMP A;  1IUX A;  1CJ2 A;  1JNR A;  2E1M A;  4TLX A;  3AE9 A;  4BK3 A;  1AOG A;  1D7L A;  2QAE A;  3C4A A;  4JN9 A;  4B1B A;  1JOA A;  1JRY A;  2BA9 A;  4GAV A;  4P9S A;  4YSX A;  1CJC A;  2X8H A;  1PJ7 A;  4IV9 A;  4USR A;  3T2K A;  3QVP A;  1GEU A;  5KMR A;  1PXB A;  4ECH A;  1VDC A;  5C2T A;  4A9W A;  3KA7 A;  2FJE A;  2XFP A;  1GND A;  1L9E A;  2QCU A;  3BI5 A;  4M52 A;  4B64 A;  4DGK A;  2XLT A;  5JCL A;  2ZZB A;  3FBS A;  2XFO A;  5CQF A;  3RP6 A;  1XAN A;  3NK2 X;  1Y56 B;  3CGB A;  4ZCC A;  4O5U A;  2JBV A;  1FOH A;  3SZF A;  1N4V A;  1PJ6 A;  4U8O A;  4AOS A;  3SFD A;  1EL8 A;  1ZX9 A;  3AEC A;  2A87 A;  1D5T A;  2YVG A;  1Q1R A;  1S3B A;  1W4X A;  2BK3 A;  2FJD A;  1NG4 A;  2IID A;  3KD9 A;  3NK0 X;  4GCM A;  3V76 A;  2V60 A;  4WX1 A;  3BI4 A;  2XLU A;  4YTP A;  4OVI A;  3GRS A;  3VR9 A;  5KNL A;  2XLR A;  1K0I A;  1KF6 A;  1TRB A;  2YM1 A;  2WHD A;  2NPX A;  4H4V A;  1YQ4 A;  2YR5 A;  2FBW A;  2YG4 A;  5KMQ A;  5KMS A;  1QJD A;  3DK4 A;  1PBE A;  3UTG A;  4U2L A;  4J31 A;  5IPY A;  3KLJ A;  2BAC A;  3GYX A;  2WES A;  3NTA A;  3DA1 A;  3SFE A;  1F3P A;  3NYE A;  4X9M A;  3GWF A;  1GXF A;  3H8L A;  2BCP A;  1VQW A;  2BK4 A;  3AEF A;  1L9D A;  2YR4 A;  3CGD A;  3LZW A;  4LU6 A;  4U8I A;  5GRT A;  1VRQ B;  3NYC A;  1F8R A;  4EM3 A;  1Q1W A;  4BV6 A;  5HY5 A;  1ZP0 A;  1CBO A;  4GRT A;  4A79 A;  2YLT A;  1PJ5 A;  4NWZ A;  3NN6 X;  2C7G A;  3AE7 A;  2WEU A;  3AE5 A;  1D7Y A;  1TDE A;  3BHF A;  4AOX A;  4H4U A;  2QA1 A;  2VVL G;  2R0P A;  4II3 A;  3FPZ A;  1L9C A;  4EMI A;  4H7U A;  2JKC A;  2IVD A;  4K8D A;  5EOW A;  4RSL A;  3DK8 A;  5LV9 A;  2AQJ A;  3FIM B;  5KVH A;  1GTE A;  2BS4 A;  2X8C A;  3P9U A;  1CC4 A;  4TM3 A;  5M10 A;  3DGZ A;  4D03 A;  2OLO A;  2WET A;  5TR3 A;  4FK1 C;  1BKW A;  4PAA A;  3NYF A;  2WU2 A;  4GAP A;  2W0H A;  2V5Z A;  2VQ7 A;  4NTE A;  3VRA A;  1O94 A;  3IWA A;  2I0Z A;  2B9X A;  5HXI A;  3B3R A;  1LQU A;  3BNM A;  2X50 A;  4H4X A;  2GQF A;  3Q6J A;  1FEC A;  3BI2 A;  3HYW A;  2HQM A;  2WP9 A;  3UTF A;  3CPH G;  2VZ2 A;  3UP4 A;  4ZCD A;  4G74 A;  3NK1 X;  1GES A;  3UKH A;  2GF3 A;  1RSG A;  1LV0 A;  4GDE A;  2BCG G;  3O0H A;  2AR8 A;  4H4S A;  4K5S A;  3AYI A;  1H6V A;  4XWR A;  4A99 A;  4Y4N A;  4CY6 A;  3M0O A;  3DH9 A;  1IUV A;  4OCG A;  1ELI A;  3G5Q A;  3QFA A;  3QFB A;  1EBD A;  1CF3 A;  2WS3 A;  4EQW A;  1GET A;  4G6H A;  3ICT A;  3UTH A;  1PBB A;  4Z26 A;  5FS9 A;  3UOY A;  2OA1 A;  4H50 A;  3AEG A;  3AE4 A;  4LA1 A;  3NGC X;  1M64 A;  1LVL A;  3CPJ G;  5KXJ A;  4H2P A;  2TPR A;  2VRL A;  4DSH A;  1KNR A;  3EF6 A;  3P4Q A;  1PXC A;  3KPF A;  2BAB A;  1KNP A;  1D4C A;  2Q6U A;  2XFQ A;  4BJY A;  1N4W A;  3JSK A;  2X8G A;  2GAG B;  4J36 A;  1PDH A;  3FG2 P;  2GV8 A;  2Y6R A;  3I6D A;  1B8S A;  4G6G A;  3HZL A;  2RGJ A;  1ZK7 A;  4J2W A;  1NHR A;  3LJP A;  3AE2 A;  1FCD A;  2C75 A;  4K2X A;  2GMH A;  2C3D A;  4XWZ A;  4BK1 A;  4AP1 A;  1DJQ A;  1VG9 A;  2YVF A;  4JY2 A;  3KPK A;  2YR6 A;  4HA6 A;  3SX6 A;  2XVF A;  3FMW A;  1KDG A;  2XDO A;  2RGH A;  1GRH A;  1COY A;  1SEZ A;  5DBJ A;  3NN0 X;  1TYP A;  2YLS A;  2XLS A;  5EB5 A;  1MXT A;  3ICS A;  1LTX R;  4CNK A;  3UP5 A;  1OJC A;  1REO A;  1ZOY A;  4AT0 A;  1IJH A;  1OJA A;  2WDQ A;  3AE8 A;  3D8X A;  4TM4 A;  2YG3 A;  3NKS A;  2R0G A;  1D4E A;  5L46 A;  4J56 A;  1LQT A;  1V59 A;  1GRA A;  2AAQ A;  4C3Y A;  1GV4 A;  4NTD A;  4BJZ A;  4USQ A;  2E4G A;  2DKI A;  3VRB A;  2OAM A;  4H4P A;  3AE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...