3KKJA

X-ray structure of p. syringae q888a4 oxidoreductase at resolution 2.5a, northeast structural genomics consortium target psr10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
328
structure length
328
Chain Sequence
TVPIAIIGTGIAGLSAAQALTAAGHQVHLFDKSRGSGGRMSSKRSDAGALDMGAQYFTARDRRFATAVKQWQAQGHVAEWTPLLYNFHAGRLSPSPDEQVRWVGKPGMSAITRAMRGDMPVSFSCRITEVFRGEEHWNLLDAEGQNHGPFSHVIIATPAPQASTLLAAAPKLASVVAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPERDDTLDTWILHATSQWSRQNLDASREQVIEHLHGAFAELIDCTMPAPVFSLAHRWLYARPAGAHEWGALSDADLGIYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amine oxidase, flavin-containing
publication title X-ray structure of P. syringae q888a4 Oxidoreductase at resolution 2.5A, Northeast Structural Genomics Consortium target PsR10
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Oxidoreductase
total genus 88
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kkjA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kkjA02
4H2PA 1NHPA 1EL5A 2F5ZA 4NTEA 5GSNA 4OPDA 1D5TA 4C74A 3NYFA 3QVPA 1S3EA 3NTAA 3LZXA 1IUSA 3P4RA 1GESA 5HHFA 1JOAA 2WOWA 4UDPA 3DK4A 2GF3A 1PXCA 2V5ZA 4IVOB 3B6DA 4EQRA 4E0VA 5FMHA 1E1MA 1ZP0A 4XXGA 2VOUA 4OPIA 1LVLA 1IJHA 1PJ7A 4RG4A 3NYEA 5U63A 3AE3A 1ELIA 2RGOA 1DXLA 2ZZ0A 3P4SA 4H4UA 2EQ6A 3IHMA 4Y4NA 5DBJA 3GDPA 1GT8A 3G5SA 4C3YA 3QSEA 2NVKX 2FJDA 1Q1WA 4A6NB 2WDQA 3AYIA 3BNUA 3DJEA 5IQ4A 1NHSA 2Z5YA 5ER0A 3P4QA 1JRYA 2OA1A 1ZMDA 1VQWA 1JU2A 2WPEA 2FJBA 3NH3X 4U8KA 1PS9A 1YQ3A 2WU2A 2YG4A 4JN9A 2X8HA 1QLBA 3AE8A 4OPUA 3ICSA 4AOXA 4GUVA 4H4WA 3AB1A 1VRQB 5IQ1A 2CDUA 2H88A 1GRFA 1NAAA 3NKSA 1GRBA 2QCUA 4OPLA 4ECHA 4OPGA 3NK0X 3LXDA 1LV0A 3UP5A 1NHQA 1E1KA 4JY2A 5KOWA 1GRGA 1ZY8A 2E4GA 4NEWA 2A87A 3UKAA 3AE2A 3UKFA 3V3OA 3AYLA 5HY5A 4Z2UA 1RSGA 1PBCA 1GPEA 3AEFA 3ZDNA 1CC4A 4BK3A 4EQWA 2B7SA 4I59A 4B65A 1TDKA 4GDPA 1GRAA 5KXJA 3KU9A 3ABVA 3UCLA 4X9MA 2XLPA 4XWZA 2YLTA 2WPFA 3ATRA 3K7MX 2YG3A 3VRBA 4YSXA 2BABA 2IVEA 2C76A 3NYCA 5KRQA 3GYIA 4HB9A 3T37A 2YM2A 1H7XA 2Q0LA 1EBDA 4BJYA 2GMJA 1N4UA 1EL9A 1F8WA 2GRTA 2JB1A 3UKQA 3GSIA 3BHKA 4CCRA 5FS6A 3G5QA 2YQUA 3UKPA 3SM8A 4A5LA 5BVAA 4ICYA 4YTMA 1DODA 5EB5A 1NG4A 1LTXR 1S2QA 2XVIA 1O5WA 3C4AA 3CGEA 3EANA 1FECA 1W4XA 1CJ3A 4AT0A 1BGNA 1BKWA 1NPXA 1OJCA 1CJ2A 2R0PA 2TMDA 4YT0A 2R45A 4K8DA 1GREA 3ALLA 3UP4A 2R0CA 2ZBWA 4O5UA 4GRTA 3ICTA 3P9UA 3ADAB 4OPTA 2GB0A 1L0VA 4YSZA 1DJQA 4H4QA 2XFNA 3CPHG 2XVEA 3AE1A 3P1WA 1VG9A 1BF3A 1ZKQA 3RP7A 4IV9A 1OJAA 2R4EA 1QO8A 1M64A 3NK2X 5GRTA 2WP9A 1ZOVA 2ZZCA 2XFQA 3CGCA 3QFAA 2H89A 2QAEA 3AE9A 3ATQA 1D7YA 4YSYA 4IA5A 1D4EA 3BI2A 4UDQA 4ZCCA 1SEZA 2B9WA 2GAGB 4LU6A 4JQ9A 4J56A 2DKHA 2XLRA 1LJ1A 3HZLA 1V59A 2C72A 4B68A 4UDRA 4Y4LA 2XYOA 3RHAA 1UKVG 3IC9A 2AQJA 4IVMB 4CRTA 3VR8A 2GAHB 1H83A 1YQZA 1Z6LA 2WEUA 3AD9B 4B1BA 5LV9A 2V3BA 3IHGA 1PBFA 4PABA 1TDEA 3GMBA 1BGJA 3ZYXA 1GEUA 2GMHA 2C65A 3NGCX 3O0HA 2GR0A 3AECA 3AD8B 5JCIA 3AEAA 3UKHA 1P2EA 4C5OA 1S2YA 2WP6A 3C96A 4USRA 3UOYA 4BK2A 2X8CA 2Q6UA 4Z44A 1FEAA 2W0HA 4CCQA 4KPRA 2XLUA 2XVFA 3CIRA 3QFBA 3PO7A 2YR5A 2C70A 3V3NA 3REDA 2X3NA 4EQSA 4ZN0A 1B4VA 4B69A 4K7ZA 5JCNA 1K0IA 3S5WA 4CY6A 4U2LA 4ZCDA 2GR1A 2FJAA 1GOSA 2BK4A 4N9XA 3LZWA 3CTYA 3EAOA 3DJJA 1PBDA 1JEHA 2OLOA 5FS7A 1TYPA 1COYA 4DSHA 2R0GA 3NIXA 1O94A 3FBSA 4YKFA 3UOZA 2GQWA 4TLXA 4WX1A 3G5RA 2YR6A 4IA6A 4KX6A 3GWFA 3ICRA 2R4JA 2A8XA 2RGHA 4BV6A 3OC4A 2JKCA 4USQA 4U8OA 4H2RA 1H7WA 4Z25A 4JNAA 4U8PA 4HA6A 3K7TA 1Q1RA 4DSGA 3CNTA 3JSKA 5C2TA 5CQFA 3GMCA 3DA1A 1K0LA 4RG3A 3UOVA 4NEVA 5KVHA 1PBEA 5BULA 3SFEA 1IUUA 2BYBA 2UZZA 4K22A 2YLZA 5L46A 4TM4A 2VRMA 1D7LA 4FX9A 1MO9A 1GTEA 1B5QA 1D4CA 2BC1A 3ALMA 1NG3A 4K5RA 4X4JA 1FL2A 1S3BA 4AOSA 1E1NA 1OJDA 2ARDA 4AP3A 1JRXA 2BA9A 4EM4A 3URHA 1E7PA 2JAEA 3H8IA 3VRDB 2CFYA 3AXBA 3F8PA 2EQ9A 4H50A 2YWLA 3P4PA 2VQBA 4NTCA 4Y4MA 1ZX9A 3CGDA 2X8GA 3AD7B 5BUKA 1K4QA 1LQUA 3EPTA 4H7UA 4DNAA 2GEWA 3FPZA 3CPIG 4U2SA 3AE6A 1CJCA 3DGHA 5EBKA 3CNJA 3ISHA 3AE5A 1H84A 1GV4A 5M0ZA 3E1TA 1ZOYA 2XLSA 1DOBA 2RGJA 2V60A 4J33A 4LIIA 3RP6A 3B3RA 4WCTA 2BCPA 1TYTA 5HXIA 4YWOA 2A89A 1EL7A 1O95A 2B9XA 4AT2A 1N1PA 1EL8A 4H4SA 4YTNA 1B8SA 2HQMA 2GV8A 4A7AA 5JCMA 4NZHA 3Q9TA 1GSNA 4A65A 2GH5A 1DNCA 1XDIA 3ITJA 1P2HA 3FIMB 5U1OA 4Z2TA 3KPFA 2QA1A 3NTDA 1F8SA 3UOXA 1RYIA 5EB4A 3M12A 2Y6RA 3EF6A 3SQPA 3M0OA 4X9NA 4EM3A 3GWDA 1D4DA 5BRTA 2PYXA 1TDNA 1CC6A 2BS3A 1KSUA 1PXAA 4H4VA 4A99A 2CULA 5JCLA 2I0ZA 2BXSA 1LQTA 1L9EA 1KF6A 4B64A 4MJWA 1RP0A 2V61A 1IUTA 3DJGX 4TLZA 1K0JA 3NLCA 3GRSA 1H6VA 2YG6A 2BCGG 1TRBA 2YG7A 1XHCA 3UTFA 1NENA 1OJTA 4BURA 1ZDLA 2NPXA 4C77A 2YLSA 4H4RA 1CHUA 4YSHA 4H2QA 2VQ7A 3NK1X 2JBVA 2WOVA 1PHHA 3AEBA 2YLXA 3GDNA 3KD9A 4Z2RA 1REOA 1XPQA 4H4PA 4H4XA 2C75A 5HYMA 3AWIA 1GRHA 3KLJA 2C64A 3RNMA 3C4NA 4H4TA 3VRAA 2CVJA 3WE0A 1PJ6A 4A79A 5FS8A 3ALJA 1CL0A 4I58A 3QJ4A 4FK1A 1FEBA 1FOHA 1NHRA 3CN8A 4DGKA 2BXRA 1ZMCA 2WDRA 3BNMA 2APGA 4EIQA 4M52A 4B63A 1NDAA 2WU5A 3NRNA 1QJDA 3CNSA 1CJ4A 1Y0PA 5KOXA 1E39A 1GTHA 5IPYA 2WP5A 4GDEA 2C67A 2WQYA 2EQ8A 1JNZA 2Q7VA 2WBAA 1IUXA 2XLTA 1KNPA 2XFPA 2E5VA 2V3AA 4APNA 3K30A 2WHDA 3FMWA 3AEEA 4D04A 3QVRA 2WOIA 2JK6A 4J57A 2B76A 4U8NA 3DGZA 2AR8A 2X50A 3Q6JA 1OJ9A 3UTHA 1H82A 2YLRA 4H4ZA 5J60A 2C66A 2YVFA 2XVJA 1GERA 2OLNA 2IVDA 1DJNA 4K2XA 1H81A 4CNJA 1IUVA 4BJZA 4TM0A 3L1RA 3PVCA 2ACZA 4Z43A 4GF7A 1PJ5A 4D03A 2BACA 3DMEA 3UTGA 3KVEA 3NN0X 4JDRA 2JB3A 2R46A 3NN6X 2VZ2A 1GETA 2XCGA 4XWRA 3RP8A 3FG2P 1PBBA 3LJPA 3IF9A 4GCMA 3NG7X 2O9ZA 2C73A 1JNRA 1Q9IA 2AAQA 4J31A 3UKLA 1N4WA 2BK3A 4Z24A 2WESA 3GD3A 5C3JA 4C3XA 5U25A 4YKGA 1L9CA 4J34A 5JCKA 4FK1C 3H4KA 1JRZA 1E1LA 4EMWA 2C3CA 2PHHA 1GXFA 4REKA 4UP3A 4LA1A 4EMIA 3COXA 2Q0KA 1GRTA 3D8XA 4EIPA 1XANA 1BZLA 4OPCA 2VVMA 1PN0A 3AE7A 4AP1A 1CF3A 3CGBA 4JY3A 1CC2A 4J2WA 1Y56B 1AOGA 1PDHA 3DK8A 3CNDA 1LPFA 4P9SA 1TDOA 2WS3A 1F3PA 2XDOA 3AYJA 3D1CA 3I3LA 4NTDA 3KA7A 1KFYA 5CKUA 2FBWA 2YR4A 2BS2A 2DKIA 2C7GA 2VVLA 2XVHA 4GR1A 3AE4A 2RABA 3BI4A 3BHFA 1L9DA 2BK5A 4U8MA 3V76A 4J36A 2Z5XA 3VQRA 4A6NA 1YY5A 2XFUA 1CBOA 4YXDA 3UKKA 4U8LA 4OCGA 2TPRA 3PS9A 2YG5A 3QSSA 1E6EA 3IWAA 3GD4A 3DJDA 1H86A 3K7QX 2WETA 1FCDA 1X31B 2YAUA 1BWCA 1F8RA 2OALA 1MOKA 3BI5A 1TDFA 2YM1A 1YQ4A 5KVIA 3KKJA 2V6OA 2Y6QA 3DH9A 5FS9A 3VR9A 4Z26A 3LADA 1B37A 2GQFA 3H8LA 4U8JA 4A9WA 2GVCA 2QA2A 1MXTA 3CNPA 2IIDA 1ONFA 2C3DA 3GRTA 2EQ7A 4TM3A 2R9ZA 2JB2A 4RSLA 1KSSA 4YTPA 1IUWA 2E1MA 3I6DA 3S61A 1M6IA 3NNEA 2YLWA 3AEGA 2GR2A 4O5QA 3F8DA 4B66A 1DOCA 2B7RA 1VDCA 4JNQA 1KDGA 2VRLA 5M10A 1KNRA 3GYJA 4CNKA 1Y56A 1F6MA 1GNDA 4BK1A 2OAMA 2XFOA 3L8KA 3CPJG 5EOWA 3UTEA 3II4A 3LB8A 4FDCB 1VG0A 2WDVA 3F8RA 3NT6A 4PAAA 2BC0A 3R9UA 3NHOX 3LOVA 4CBQA 4OVIA 4EMJA 2YVGA 3M13A 5J7XA 2GR3A 4H2NA 3SGLA 1PXBA 4TM1A 4CY8A 1YKJA 4EQXA 2FJEA 4H4YA 4B67A 3AEDA 4U8IA 5KWFA 3SFDA 2WPCA 3DK9A 2J3NA 2ZZBA 2VVLG 1NEKA 3OZ2A 4K5SA 5TR3A 3QSMA 1GALA 2X99A 4ADWA 4U2TA 1HYUA 1ZK7A 2B9YA 1DOEA 2BS4A 2YVJA 1N4VA
chains in the Genus database with same CATH superfamily
4H2PA 1NHPA 1EL5A 2F5ZA 4NTEA 5GSNA 4OPDA 1D5TA 4C74A 3NYFA 3QVPA 1S3EA 3NTAA 3LZXA 1IUSA 3P4RA 1GESA 5HHFA 1JOAA 2WOWA 4UDPA 3DK4A 2GF3A 4G73A 1PXCA 2V5ZA 4IVOB 3B6DA 3SZWA 4EQRA 4E0VA 5FMHA 1E1MA 1ZP0A 4XXGA 2VOUA 4OPIA 1LVLA 1IJHA 1PJ7A 4RG4A 3NYEA 5U63A 3AE3A 1ELIA 2RGOA 1DXLA 2ZZ0A 3P4SA 4H4UA 2EQ6A 3IHMA 4Y4NA 5DBJA 3GDPA 1GT8A 3G5SA 4C3YA 3QSEA 2NVKX 2FJDA 1Q1WA 4A6NB 2WDQA 3AYIA 3SX6A 3BNUA 3DJEA 5IQ4A 1NHSA 2Z5YA 5ER0A 3P4QA 1JRYA 2OA1A 1ZMDA 1VQWA 1JU2A 2WPEA 2FJBA 3HYXA 3NH3X 4U8KA 1PS9A 1YQ3A 2WU2A 2YG4A 4JN9A 2X8HA 1QLBA 3AE8A 4OPUA 3ICSA 4AOXA 4GUVA 4H4WA 3AB1A 1VRQB 5IQ1A 2CDUA 2H88A 1GRFA 1NAAA 3NKSA 1GRBA 2QCUA 4OPLA 4ECHA 4OPGA 3NK0X 3LXDA 1LV0A 3UP5A 1NHQA 1E1KA 4JY2A 5KOWA 1GRGA 1ZY8A 2E4GA 4NEWA 2A87A 3UKAA 3AE2A 3UKFA 3V3OA 3AYLA 5HY5A 4Z2UA 1RSGA 1PBCA 1GPEA 3AEFA 3ZDNA 1CC4A 4BK3A 4EQWA 2B7SA 4I59A 4B65A 1TDKA 4GDPA 3T0KA 5KMRA 1GRAA 5KXJA 3T2KA 3KU9A 3ABVA 3UCLA 4X9MA 2XLPA 4XWZA 2YLTA 2WPFA 3ATRA 3K7MX 2YG3A 3VRBA 4YSXA 2BABA 2IVEA 3KPKA 2C76A 3NYCA 5KRQA 3GYIA 4HB9A 3T37A 2YM2A 1H7XA 2Q0LA 1EBDA 4BJYA 2GMJA 1N4UA 1EL9A 1F8WA 2GRTA 2JB1A 3UKQA 3GSIA 4NWZA 3BHKA 4CCRA 5FS6A 3G5QA 2YQUA 3UKPA 3SM8A 4A5LA 5BVAA 4ICYA 4YTMA 1DODA 5EB5A 1NG4A 1LTXR 1S2QA 2XVIA 5KNLA 1O5WA 3C4AA 3CGEA 3EANA 1FECA 1W4XA 1CJ3A 4AT0A 1BGNA 1BKWA 1NPXA 1OJCA 1CJ2A 2R0PA 2TMDA 4YT0A 2R45A 4K8DA 1GREA 3ALLA 3UP4A 2R0CA 2ZBWA 4O5UA 4GRTA 3ICTA 3P9UA 3ADAB 4OPTA 2GB0A 1L0VA 4YSZA 1DJQA 4H4QA 2XFNA 3CPHG 2XVEA 3AE1A 3P1WA 1VG9A 1BF3A 1ZKQA 3HYWA 3RP7A 4IV9A 1OJAA 2R4EA 1QO8A 1M64A 3NK2X 5GRTA 2WP9A 1ZOVA 2ZZCA 3T2YA 2XFQA 3CGCA 3QFAA 2H89A 2QAEA 3AE9A 3ATQA 3T2ZA 1D7YA 4YSYA 4IA5A 1D4EA 3BI2A 4UDQA 4ZCCA 1SEZA 2B9WA 2GAGB 4LU6A 4JQ9A 4J56A 2DKHA 2XLRA 1LJ1A 3HZLA 1V59A 2C72A 4B68A 4UDRA 4Y4LA 2XYOA 3RHAA 1UKVG 3IC9A 2AQJA 4IVMB 4CRTA 3VR8A 2GAHB 1H83A 1YQZA 1Z6LA 2WEUA 3AD9B 4B1BA 5LV9A 2V3BA 3IHGA 1PBFA 4PABA 1TDEA 3GMBA 1BGJA 3ZYXA 1GEUA 2GMHA 2C65A 3NGCX 3O0HA 2GR0A 3AECA 3AD8B 5JCIA 3AEAA 3UKHA 1P2EA 3T14A 4C5OA 3SXIA 1S2YA 2WP6A 3C96A 4USRA 3UOYA 4BK2A 2X8CA 2Q6UA 4Z44A 1FEAA 2W0HA 4CCQA 4KPRA 2XLUA 2XVFA 3CIRA 3QFBA 3PO7A 2YR5A 2C70A 3V3NA 3REDA 2X3NA 4EQSA 4ZN0A 1B4VA 4B69A 4K7ZA 5JCNA 1K0IA 3S5WA 3SZ0A 4U2LA 4CY6A 4ZCDA 2GR1A 2FJAA 1GOSA 2BK4A 4N9XA 3LZWA 3CTYA 3EAOA 3GYXA 3DJJA 1PBDA 1JEHA 2OLOA 5FS7A 1TYPA 1COYA 4DSHA 2R0GA 3NIXA 1O94A 3FBSA 4YKFA 3UOZA 2GQWA 4TLXA 4WX1A 3G5RA 2YR6A 4IA6A 4KX6A 3GWFA 3ICRA 2R4JA 2A8XA 2RGHA 4BV6A 3OC4A 2JKCA 4USQA 4U8OA 4H2RA 1H7WA 4Z25A 4JNAA 4U8PA 4HA6A 4NNJA 3K7TA 1Q1RA 4DSGA 3CNTA 3JSKA 5C2TA 5CQFA 3GMCA 3DA1A 1K0LA 4RG3A 3UOVA 4NEVA 5KVHA 1PBEA 5BULA 3SFEA 1IUUA 2BYBA 2UZZA 4K22A 2YLZA 5L46A 4TM4A 2VRMA 1D7LA 4FX9A 5KMSA 1MO9A 1GTEA 1B5QA 1D4CA 2BC1A 3ALMA 1NG3A 4K5RA 4X4JA 1FL2A 1S3BA 4AOSA 1E1NA 1OJDA 2ARDA 4AP3A 1JRXA 2BA9A 4EM4A 3URHA 1E7PA 2JAEA 3H8IA 3VRDB 2CFYA 3AXBA 3F8PA 2EQ9A 4H50A 2YWLA 3P4PA 2VQBA 4NTCA 4Y4MA 1ZX9A 3CGDA 2X8GA 3AD7B 5BUKA 1K4QA 1LQUA 3EPTA 4H7UA 4DNAA 2GEWA 3FPZA 3CPIG 4U2SA 3AE6A 1CJCA 3DGHA 5EBKA 3CNJA 3ISHA 3AE5A 1H84A 1GV4A 5M0ZA 3E1TA 1ZOYA 2XLSA 1DOBA 2RGJA 2V60A 4G6HA 4GAPA 4J33A 4LIIA 3RP6A 3B3RA 4WCTA 2BCPA 1TYTA 2C4CA 4G6GA 5HXIA 2BRAA 4YWOA 2A89A 1EL7A 1O95A 2B9XA 4AT2A 1N1PA 1EL8A 4H4SA 4YTNA 1B8SA 2HQMA 2GV8A 4A7AA 5JCMA 4NZHA 3Q9TA 1GSNA 4A65A 2GH5A 1DNCA 1XDIA 3ITJA 1P2HA 3FIMB 5U1OA 4Z2TA 3KPFA 2QA1A 3NTDA 1F8SA 3UOXA 1RYIA 5EB4A 3M12A 2Y6RA 3EF6A 3HYVA 3SQPA 4II3A 3M0OA 4X9NA 4EM3A 3GWDA 1D4DA 5BRTA 2PYXA 1TDNA 1CC6A 2BS3A 1KSUA 1PXAA 4H4VA 4A99A 2CULA 5JCLA 2I0ZA 2BXSA 1LQTA 1L9EA 1KF6A 4B64A 4MJWA 1RP0A 2V61A 1IUTA 3DJGX 4TLZA 1K0JA 3CMMA 3GRSA 3NLCA 1H6VA 2YG6A 2BCGG 1TRBA 2YG7A 4GAVA 1XHCA 3UTFA 1NENA 1OJTA 4BURA 1ZDLA 2NPXA 4C77A 2YLSA 4H4RA 1CHUA 4YSHA 4H2QA 2VQ7A 3NK1X 2JBVA 2WOVA 1PHHA 3AEBA 2YLXA 3GDNA 3KD9A 4Z2RA 1REOA 1XPQA 4H4PA 4H4XA 2C75A 5HYMA 3AWIA 1GRHA 3KLJA 2C64A 3RNMA 3C4NA 4H4TA 3VRAA 2CVJA 3WE0A 1PJ6A 4A79A 5FS8A 3ALJA 1CL0A 4I58A 3QJ4A 4FK1A 1FEBA 1FOHA 1NHRA 3CN8A 4DGKA 3SZFA 2BXRA 1ZMCA 2WDRA 3BNMA 2APGA 4EIQA 4M52A 4B63A 1NDAA 2WU5A 3NRNA 1QJDA 3CNSA 1CJ4A 1Y0PA 5KOXA 1E39A 1GTHA 5IPYA 2WP5A 4GDEA 2C67A 2WQYA 2EQ8A 1JNZA 2Q7VA 2WBAA 1IUXA 2XLTA 1KNPA 2XFPA 2E5VA 2V3AA 4APNA 3K30A 2WHDA 3FMWA 3AEEA 4D04A 3QVRA 2WOIA 2JK6A 4J57A 2B76A 3SYIA 4U8NA 3DGZA 2AR8A 2X50A 3Q6JA 1OJ9A 3UTHA 1H82A 2YLRA 4H4ZA 5J60A 2C66A 2YVFA 2XVJA 1GERA 2OLNA 2IVDA 1DJNA 4K2XA 1H81A 4CNJA 1IUVA 4BJZA 4TM0A 4G74A 3L1RA 3PVCA 2ACZA 4Z43A 4GF7A 1PJ5A 4D03A 2BACA 3DMEA 3UTGA 3KVEA 3NN0X 4JDRA 2JB3A 2R46A 3NN6X 2VZ2A 1GETA 2XCGA 4XWRA 3RP8A 3FG2P 1PBBA 3LJPA 4II2A 3IF9A 4GCMA 3NG7X 2O9ZA 5KMPA 2C73A 1JNRA 1Q9IA 2AAQA 4J31A 3UKLA 1N4WA 2BK3A 4Z24A 2WESA 3GD3A 5C3JA 4C3XA 5U25A 4YKGA 1L9CA 4J34A 5JCKA 4FK1C 3H4KA 1JRZA 1E1LA 4EMWA 2C3CA 2PHHA 1GXFA 4REKA 4UP3A 4LA1A 4EMIA 3COXA 2Q0KA 1GRTA 3D8XA 4EIPA 1XANA 1BZLA 4OPCA 2VVMA 1PN0A 3AE7A 4AP1A 1CF3A 3CGBA 4JY3A 1CC2A 4J2WA 1Y56B 1AOGA 1PDHA 3DK8A 3CNDA 1LPFA 4P9SA 1TDOA 2WS3A 1F3PA 2XDOA 3AYJA 3D1CA 3I3LA 3SZCA 4NTDA 3KA7A 1KFYA 5CKUA 2FBWA 2YR4A 2BS2A 2DKIA 2C7GA 2VVLA 2XVHA 4GR1A 3AE4A 2RABA 3BI4A 3BHFA 1L9DA 2BK5A 4U8MA 3V76A 4J36A 2Z5XA 3VQRA 4A6NA 1YY5A 2XFUA 1CBOA 3T31A 4YXDA 5KMQA 4U8LA 4OCGA 3UKKA 2TPRA 3PS9A 2YG5A 3QSSA 1E6EA 3IWAA 3GD4A 3DJDA 1H86A 3K7QX 2WETA 1FCDA 1X31B 2YAUA 1BWCA 1F8RA 2OALA 1MOKA 3BI5A 1TDFA 2YM1A 1YQ4A 5KVIA 3KKJA 2V6OA 2Y6QA 3DH9A 5FS9A 3VR9A 4Z26A 3LADA 1B37A 2GQFA 3H8LA 4U8JA 4A9WA 2BRYA 2GVCA 4G9KA 2QA2A 1MXTA 3CNPA 2IIDA 1ONFA 2C3DA 3GRTA 2EQ7A 4TM3A 2R9ZA 2JB2A 4RSLA 3SY4A 1KSSA 4YTPA 1IUWA 2E1MA 3I6DA 3S61A 1M6IA 3NNEA 2YLWA 3AEGA 2GR2A 4O5QA 3F8DA 4B66A 1DOCA 2B7RA 1VDCA 4JNQA 1KDGA 2VRLA 5M10A 1KNRA 3GYJA 4CNKA 1Y56A 1F6MA 1GNDA 4BK1A 2OAMA 2XFOA 3L8KA 3CPJG 5EOWA 3UTEA 3II4A 3LB8A 4FDCB 1VG0A 2WDVA 3F8RA 3NT6A 4PAAA 2BC0A 3R9UA 3NHOX 3LOVA 4CBQA 4OVIA 4EMJA 2YVGA 3M13A 5J7XA 2GR3A 4H2NA 3SGLA 1PXBA 4TM1A 4CY8A 1YKJA 4EQXA 2FJEA 4H4YA 4B67A 3AEDA 4U8IA 5KWFA 3SFDA 2WPCA 3DK9A 2J3NA 2ZZBA 2VVLG 1NEKA 3OZ2A 4K5SA 5TR3A 3QSMA 1GALA 2X99A 4ADWA 4U2TA 1HYUA 1ZK7A 2B9YA 1DOEA 2BS4A 2YVJA 1N4VA
chains in the Genus database with same CATH topology
4H2PA 1NHPA 1EL5A 2F5ZA 4NTEA 5GSNA 4OPDA 1D5TA 4C74A 3NYFA 3QVPA 1S3EA 3NTAA 3LZXA 1IUSA 3P4RA 1GESA 5HHFA 1JOAA 2WOWA 4UDPA 3DK4A 2GF3A 4G73A 1PXCA 2V5ZA 4IVOB 3B6DA 3SZWA 4EQRA 4E0VA 5FMHA 1E1MA 1ZP0A 4XXGA 2VOUA 4OPIA 1LVLA 1IJHA 1PJ7A 4RG4A 3NYEA 5U63A 3AE3A 1ELIA 2RGOA 1DXLA 2ZZ0A 3P4SA 4H4UA 2EQ6A 3IHMA 4Y4NA 5DBJA 3GDPA 1GT8A 3G5SA 4C3YA 3QSEA 2NVKX 2FJDA 1Q1WA 4A6NB 2WDQA 3AYIA 3SX6A 3BNUA 3DJEA 5IQ4A 1NHSA 2Z5YA 5ER0A 3P4QA 1JRYA 2OA1A 1ZMDA 1VQWA 1JU2A 2WPEA 2FJBA 3HYXA 3NH3X 4U8KA 1PS9A 1YQ3A 2WU2A 2YG4A 4JN9A 2X8HA 1QLBA 3AE8A 4OPUA 3ICSA 4AOXA 4GUVA 4H4WA 3AB1A 1VRQB 5IQ1A 2CDUA 2H88A 1GRFA 1NAAA 3NKSA 1GRBA 2QCUA 4OPLA 4ECHA 4OPGA 3NK0X 3LXDA 1LV0A 3UP5A 1NHQA 1E1KA 4JY2A 5KOWA 1GRGA 1ZY8A 2E4GA 4NEWA 2A87A 3UKAA 3AE2A 3UKFA 3V3OA 3AYLA 5HY5A 4Z2UA 1RSGA 1PBCA 1GPEA 3AEFA 3ZDNA 1CC4A 4BK3A 4EQWA 2B7SA 4I59A 4B65A 1TDKA 4GDPA 3T0KA 5KMRA 1GRAA 5KXJA 3T2KA 3KU9A 3ABVA 3UCLA 4X9MA 2XLPA 4XWZA 2YLTA 2WPFA 3ATRA 3K7MX 2YG3A 3VRBA 4YSXA 2BABA 2IVEA 3KPKA 2C76A 3NYCA 5KRQA 3GYIA 4HB9A 3T37A 2YM2A 1H7XA 2Q0LA 1EBDA 4BJYA 2GMJA 1N4UA 1EL9A 1F8WA 2GRTA 2JB1A 3UKQA 3GSIA 4NWZA 3BHKA 4CCRA 5FS6A 3G5QA 2YQUA 3UKPA 3SM8A 4A5LA 5BVAA 4ICYA 4YTMA 1DODA 5EB5A 1NG4A 1LTXR 1S2QA 2XVIA 5KNLA 1O5WA 3C4AA 3CGEA 3EANA 1FECA 1W4XA 1CJ3A 4AT0A 1BGNA 1BKWA 1NPXA 1OJCA 1CJ2A 2R0PA 2TMDA 4YT0A 2R45A 4K8DA 1GREA 3ALLA 3UP4A 2R0CA 2ZBWA 4O5UA 4GRTA 3ICTA 3P9UA 3ADAB 4OPTA 2GB0A 1L0VA 4YSZA 1DJQA 4H4QA 2XFNA 3CPHG 2XVEA 3AE1A 3P1WA 1VG9A 1BF3A 1ZKQA 3HYWA 3RP7A 4IV9A 1OJAA 2R4EA 1QO8A 1M64A 3NK2X 5GRTA 2WP9A 1ZOVA 2ZZCA 3T2YA 2XFQA 3CGCA 3QFAA 2H89A 2QAEA 3AE9A 3ATQA 3T2ZA 1D7YA 4YSYA 4IA5A 1D4EA 3BI2A 4UDQA 4ZCCA 1SEZA 2B9WA 2GAGB 4LU6A 4JQ9A 4J56A 2DKHA 2XLRA 1LJ1A 3HZLA 1V59A 2C72A 4B68A 4UDRA 4Y4LA 2XYOA 3RHAA 1UKVG 3IC9A 2AQJA 4IVMB 4CRTA 3VR8A 2GAHB 1H83A 1YQZA 1Z6LA 2WEUA 3AD9B 4B1BA 5LV9A 2V3BA 3IHGA 1PBFA 4PABA 1TDEA 3GMBA 1BGJA 3ZYXA 1GEUA 2GMHA 2C65A 3NGCX 3O0HA 2GR0A 3AECA 3AD8B 5JCIA 3AEAA 3UKHA 1P2EA 3T14A 4C5OA 3SXIA 1S2YA 2WP6A 3C96A 4USRA 3UOYA 4BK2A 2X8CA 2Q6UA 4Z44A 1FEAA 2W0HA 4CCQA 4KPRA 2XLUA 2XVFA 3CIRA 3QFBA 3PO7A 2YR5A 2C70A 3V3NA 3REDA 2X3NA 4EQSA 4ZN0A 1B4VA 4B69A 4K7ZA 5JCNA 1K0IA 3S5WA 3SZ0A 4U2LA 4CY6A 4ZCDA 2GR1A 2FJAA 1GOSA 2BK4A 4N9XA 3LZWA 3CTYA 3EAOA 3GYXA 3DJJA 1PBDA 1JEHA 2OLOA 5FS7A 1TYPA 1COYA 4DSHA 2R0GA 3NIXA 1O94A 3FBSA 4YKFA 3UOZA 2GQWA 4TLXA 4WX1A 3G5RA 2YR6A 4IA6A 4KX6A 3GWFA 3ICRA 2R4JA 2A8XA 2RGHA 4BV6A 3OC4A 2JKCA 4USQA 4U8OA 4H2RA 1H7WA 4Z25A 4JNAA 4U8PA 4HA6A 4NNJA 3K7TA 1Q1RA 4DSGA 3CNTA 3JSKA 5C2TA 5CQFA 3GMCA 3DA1A 1K0LA 4RG3A 3UOVA 4NEVA 5KVHA 1PBEA 5BULA 3SFEA 1IUUA 2BYBA 2UZZA 4K22A 2YLZA 5L46A 4TM4A 2VRMA 1D7LA 4FX9A 5KMSA 1MO9A 1GTEA 1B5QA 1D4CA 2BC1A 3ALMA 1NG3A 4K5RA 4X4JA 1FL2A 1S3BA 4AOSA 1E1NA 1OJDA 2ARDA 4AP3A 1JRXA 2BA9A 4EM4A 3URHA 1E7PA 2JAEA 3H8IA 3VRDB 2CFYA 3AXBA 3F8PA 2EQ9A 4H50A 2YWLA 3P4PA 2VQBA 4NTCA 4Y4MA 1ZX9A 3CGDA 2X8GA 3AD7B 5BUKA 1K4QA 1LQUA 3EPTA 4H7UA 4DNAA 2GEWA 3FPZA 3CPIG 4U2SA 3AE6A 1CJCA 3DGHA 5EBKA 3CNJA 3ISHA 3AE5A 1H84A 1GV4A 5M0ZA 3E1TA 1ZOYA 2XLSA 1DOBA 2RGJA 2V60A 4G6HA 4GAPA 4J33A 4LIIA 3RP6A 3B3RA 4WCTA 2BCPA 1TYTA 2C4CA 4G6GA 5HXIA 2BRAA 4YWOA 2A89A 1EL7A 1O95A 2B9XA 4AT2A 1N1PA 1EL8A 4H4SA 4YTNA 1B8SA 2HQMA 2GV8A 4A7AA 5JCMA 4NZHA 3Q9TA 1GSNA 4A65A 2GH5A 1DNCA 1XDIA 3ITJA 1P2HA 3FIMB 5U1OA 4Z2TA 3KPFA 2QA1A 3NTDA 1F8SA 3UOXA 1RYIA 5EB4A 3M12A 2Y6RA 3EF6A 3HYVA 3SQPA 4II3A 3M0OA 4X9NA 4EM3A 3GWDA 1D4DA 5BRTA 2PYXA 1TDNA 1CC6A 2BS3A 1KSUA 1PXAA 4H4VA 4A99A 2CULA 5JCLA 2I0ZA 2BXSA 1LQTA 1L9EA 1KF6A 4B64A 4MJWA 1RP0A 2V61A 1IUTA 3DJGX 4TLZA 1K0JA 3CMMA 3GRSA 3NLCA 1H6VA 2YG6A 2BCGG 1TRBA 2YG7A 4GAVA 1XHCA 3UTFA 1NENA 1OJTA 4BURA 1ZDLA 2NPXA 4C77A 2YLSA 4H4RA 1CHUA 4YSHA 4H2QA 2VQ7A 3NK1X 2JBVA 2WOVA 1PHHA 3AEBA 2YLXA 3GDNA 3KD9A 4Z2RA 1REOA 1XPQA 4H4PA 4H4XA 2C75A 5HYMA 3AWIA 1GRHA 3KLJA 2C64A 3RNMA 3C4NA 4H4TA 3VRAA 2CVJA 3WE0A 1PJ6A 4A79A 5FS8A 3ALJA 1CL0A 4I58A 3QJ4A 4FK1A 1FEBA 1FOHA 1NHRA 3CN8A 4DGKA 3SZFA 2BXRA 1ZMCA 2WDRA 3BNMA 2APGA 4EIQA 4M52A 4B63A 1NDAA 2WU5A 3NRNA 1QJDA 3CNSA 1CJ4A 1Y0PA 5KOXA 1E39A 1GTHA 5IPYA 2WP5A 4GDEA 2C67A 2WQYA 2EQ8A 1JNZA 2Q7VA 2WBAA 1IUXA 2XLTA 1KNPA 2XFPA 2E5VA 2V3AA 4APNA 3K30A 2WHDA 3FMWA 3AEEA 4D04A 3QVRA 2WOIA 2JK6A 4J57A 2B76A 3SYIA 4U8NA 3DGZA 2AR8A 2X50A 3Q6JA 1OJ9A 3UTHA 1H82A 2YLRA 4H4ZA 5J60A 2C66A 2YVFA 2XVJA 1GERA 2OLNA 2IVDA 1DJNA 4K2XA 1H81A 4CNJA 1IUVA 4BJZA 4TM0A 4G74A 3L1RA 3PVCA 2ACZA 4Z43A 4GF7A 1PJ5A 4D03A 2BACA 3DMEA 3UTGA 3KVEA 3NN0X 4JDRA 2JB3A 2R46A 3NN6X 2VZ2A 1GETA 2XCGA 4XWRA 3RP8A 3FG2P 1PBBA 3LJPA 4II2A 3IF9A 4GCMA 3NG7X 2O9ZA 5KMPA 2C73A 1JNRA 1Q9IA 2AAQA 4J31A 3UKLA 1N4WA 2BK3A 4Z24A 2WESA 3GD3A 5C3JA 4C3XA 5U25A 4YKGA 1L9CA 4J34A 5JCKA 4FK1C 3H4KA 1JRZA 1E1LA 4EMWA 2C3CA 2PHHA 1GXFA 4REKA 4UP3A 4LA1A 4EMIA 3COXA 2Q0KA 1GRTA 3D8XA 4EIPA 1XANA 1BZLA 4OPCA 2VVMA 1PN0A 3AE7A 4AP1A 1CF3A 3CGBA 4JY3A 1CC2A 4J2WA 1Y56B 1AOGA 1PDHA 3DK8A 3CNDA 1LPFA 4P9SA 1TDOA 2WS3A 1F3PA 2XDOA 3AYJA 3D1CA 3I3LA 3SZCA 4NTDA 3KA7A 1KFYA 5CKUA 2FBWA 2YR4A 2BS2A 2DKIA 2C7GA 2VVLA 2XVHA 4GR1A 3AE4A 2RABA 3BI4A 3BHFA 1L9DA 2BK5A 4U8MA 3V76A 4J36A 2Z5XA 3VQRA 4A6NA 1YY5A 2XFUA 1CBOA 3T31A 4YXDA 5KMQA 4U8LA 4OCGA 3UKKA 2TPRA 3PS9A 2YG5A 3QSSA 1E6EA 3IWAA 3GD4A 3DJDA 1H86A 3K7QX 2WETA 1FCDA 1X31B 2YAUA 1BWCA 1F8RA 2OALA 1MOKA 3BI5A 1TDFA 2YM1A 1YQ4A 5KVIA 3KKJA 2V6OA 2Y6QA 3DH9A 5FS9A 3VR9A 4Z26A 3LADA 1B37A 2GQFA 3H8LA 4U8JA 4A9WA 2BRYA 2GVCA 4G9KA 2QA2A 1MXTA 3CNPA 2IIDA 1ONFA 2C3DA 3GRTA 2EQ7A 4TM3A 2R9ZA 2JB2A 4RSLA 3SY4A 1KSSA 4YTPA 1IUWA 2E1MA 3I6DA 3S61A 1M6IA 3NNEA 2YLWA 3AEGA 2GR2A 4O5QA 3F8DA 4B66A 1DOCA 2B7RA 1VDCA 4JNQA 1KDGA 2VRLA 5M10A 1KNRA 3GYJA 4CNKA 1Y56A 1F6MA 1GNDA 4BK1A 2OAMA 2XFOA 3L8KA 3CPJG 5EOWA 3UTEA 3II4A 3LB8A 4FDCB 1VG0A 2WDVA 3F8RA 3NT6A 4PAAA 2BC0A 3R9UA 3NHOX 3LOVA 4CBQA 4OVIA 4EMJA 2YVGA 3M13A 5J7XA 2GR3A 4H2NA 3SGLA 1PXBA 4TM1A 4CY8A 1YKJA 4EQXA 2FJEA 4H4YA 4B67A 3AEDA 4U8IA 5KWFA 3SFDA 2WPCA 3DK9A 2J3NA 2ZZBA 2VVLG 1NEKA 3OZ2A 4K5SA 5TR3A 3QSMA 1GALA 2X99A 4ADWA 4U2TA 1HYUA 1ZK7A 2B9YA 1DOEA 2BS4A 2YVJA 1N4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H2P A;  1NHP A;  1EL5 A;  2F5Z A;  4NTE A;  5GSN A;  4OPD A;  1D5T A;  4C74 A;  3NYF A;  3QVP A;  1S3E A;  3NTA A;  3LZX A;  1IUS A;  3P4R A;  1GES A;  5HHF A;  1JOA A;  2WOW A;  4UDP A;  3DK4 A;  2GF3 A;  1PXC A;  2V5Z A;  4IVO B;  3B6D A;  4EQR A;  4E0V A;  5FMH A;  1E1M A;  1ZP0 A;  4XXG A;  2VOU A;  4OPI A;  1LVL A;  1IJH A;  1PJ7 A;  4RG4 A;  3NYE A;  5U63 A;  3AE3 A;  1ELI A;  2RGO A;  1DXL A;  2ZZ0 A;  3P4S A;  4H4U A;  2EQ6 A;  3IHM A;  4Y4N A;  5DBJ A;  3GDP A;  1GT8 A;  3G5S A;  4C3Y A;  3QSE A;  2NVK X;  2FJD A;  1Q1W A;  4A6N B;  2WDQ A;  3AYI A;  3BNU A;  3DJE A;  5IQ4 A;  1NHS A;  2Z5Y A;  5ER0 A;  3P4Q A;  1JRY A;  2OA1 A;  1ZMD A;  1VQW A;  1JU2 A;  2WPE A;  2FJB A;  3NH3 X;  4U8K A;  1PS9 A;  1YQ3 A;  2WU2 A;  2YG4 A;  4JN9 A;  2X8H A;  1QLB A;  3AE8 A;  4OPU A;  3ICS A;  4AOX A;  4GUV A;  4H4W A;  3AB1 A;  1VRQ B;  5IQ1 A;  2CDU A;  2H88 A;  1GRF A;  1NAA A;  3NKS A;  1GRB A;  2QCU A;  4OPL A;  4ECH A;  4OPG A;  3NK0 X;  3LXD A;  1LV0 A;  3UP5 A;  1NHQ A;  1E1K A;  4JY2 A;  5KOW A;  1GRG A;  1ZY8 A;  2E4G A;  4NEW A;  2A87 A;  3UKA A;  3AE2 A;  3UKF A;  3V3O A;  3AYL A;  5HY5 A;  4Z2U A;  1RSG A;  1PBC A;  1GPE A;  3AEF A;  3ZDN A;  1CC4 A;  4BK3 A;  4EQW A;  2B7S A;  4I59 A;  4B65 A;  1TDK A;  4GDP A;  1GRA A;  5KXJ A;  3KU9 A;  3ABV A;  3UCL A;  4X9M A;  2XLP A;  4XWZ A;  2YLT A;  2WPF A;  3ATR A;  3K7M X;  2YG3 A;  3VRB A;  4YSX A;  2BAB A;  2IVE A;  2C76 A;  3NYC A;  5KRQ A;  3GYI A;  4HB9 A;  3T37 A;  2YM2 A;  1H7X A;  2Q0L A;  1EBD A;  4BJY A;  2GMJ A;  1N4U A;  1EL9 A;  1F8W A;  2GRT A;  2JB1 A;  3UKQ A;  3GSI A;  3BHK A;  4CCR A;  5FS6 A;  3G5Q A;  2YQU A;  3UKP A;  3SM8 A;  4A5L A;  5BVA A;  4ICY A;  4YTM A;  1DOD A;  5EB5 A;  1NG4 A;  1LTX R;  1S2Q A;  2XVI A;  1O5W A;  3C4A A;  3CGE A;  3EAN A;  1FEC A;  1W4X A;  1CJ3 A;  4AT0 A;  1BGN A;  1BKW A;  1NPX A;  1OJC A;  1CJ2 A;  2R0P A;  2TMD A;  4YT0 A;  2R45 A;  4K8D A;  1GRE A;  3ALL A;  3UP4 A;  2R0C A;  2ZBW A;  4O5U A;  4GRT A;  3ICT A;  3P9U A;  3ADA B;  4OPT A;  2GB0 A;  1L0V A;  4YSZ A;  1DJQ A;  4H4Q A;  2XFN A;  3CPH G;  2XVE A;  3AE1 A;  3P1W A;  1VG9 A;  1BF3 A;  1ZKQ A;  3RP7 A;  4IV9 A;  1OJA A;  2R4E A;  1QO8 A;  1M64 A;  3NK2 X;  5GRT A;  2WP9 A;  1ZOV A;  2ZZC A;  2XFQ A;  3CGC A;  3QFA A;  2H89 A;  2QAE A;  3AE9 A;  3ATQ A;  1D7Y A;  4YSY A;  4IA5 A;  1D4E A;  3BI2 A;  4UDQ A;  4ZCC A;  1SEZ A;  2B9W A;  2GAG B;  4LU6 A;  4JQ9 A;  4J56 A;  2DKH A;  2XLR A;  1LJ1 A;  3HZL A;  1V59 A;  2C72 A;  4B68 A;  4UDR A;  4Y4L A;  2XYO A;  3RHA A;  1UKV G;  3IC9 A;  2AQJ A;  4IVM B;  4CRT A;  3VR8 A;  2GAH B;  1H83 A;  1YQZ A;  1Z6L A;  2WEU A;  3AD9 B;  4B1B A;  5LV9 A;  2V3B A;  3IHG A;  1PBF A;  4PAB A;  1TDE A;  3GMB A;  1BGJ A;  3ZYX A;  1GEU A;  2GMH A;  2C65 A;  3NGC X;  3O0H A;  2GR0 A;  3AEC A;  3AD8 B;  5JCI A;  3AEA A;  3UKH A;  1P2E A;  4C5O A;  1S2Y A;  2WP6 A;  3C96 A;  4USR A;  3UOY A;  4BK2 A;  2X8C A;  2Q6U A;  4Z44 A;  1FEA A;  2W0H A;  4CCQ A;  4KPR A;  2XLU A;  2XVF A;  3CIR A;  3QFB A;  3PO7 A;  2YR5 A;  2C70 A;  3V3N A;  3RED A;  2X3N A;  4EQS A;  4ZN0 A;  1B4V A;  4B69 A;  4K7Z A;  5JCN A;  1K0I A;  3S5W A;  4CY6 A;  4U2L A;  4ZCD A;  2GR1 A;  2FJA A;  1GOS A;  2BK4 A;  4N9X A;  3LZW A;  3CTY A;  3EAO A;  3DJJ A;  1PBD A;  1JEH A;  2OLO A;  5FS7 A;  1TYP A;  1COY A;  4DSH A;  2R0G A;  3NIX A;  1O94 A;  3FBS A;  4YKF A;  3UOZ A;  2GQW A;  4TLX A;  4WX1 A;  3G5R A;  2YR6 A;  4IA6 A;  4KX6 A;  3GWF A;  3ICR A;  2R4J A;  2A8X A;  2RGH A;  4BV6 A;  3OC4 A;  2JKC A;  4USQ A;  4U8O A;  4H2R A;  1H7W A;  4Z25 A;  4JNA A;  4U8P A;  4HA6 A;  3K7T A;  1Q1R A;  4DSG A;  3CNT A;  3JSK A;  5C2T A;  5CQF A;  3GMC A;  3DA1 A;  1K0L A;  4RG3 A;  3UOV A;  4NEV A;  5KVH A;  1PBE A;  5BUL A;  3SFE A;  1IUU A;  2BYB A;  2UZZ A;  4K22 A;  2YLZ A;  5L46 A;  4TM4 A;  2VRM A;  1D7L A;  4FX9 A;  1MO9 A;  1GTE A;  1B5Q A;  1D4C A;  2BC1 A;  3ALM A;  1NG3 A;  4K5R A;  4X4J A;  1FL2 A;  1S3B A;  4AOS A;  1E1N A;  1OJD A;  2ARD A;  4AP3 A;  1JRX A;  2BA9 A;  4EM4 A;  3URH A;  1E7P A;  2JAE A;  3H8I A;  3VRD B;  2CFY A;  3AXB A;  3F8P A;  2EQ9 A;  4H50 A;  2YWL A;  3P4P A;  2VQB A;  4NTC A;  4Y4M A;  1ZX9 A;  3CGD A;  2X8G A;  3AD7 B;  5BUK A;  1K4Q A;  1LQU A;  3EPT A;  4H7U A;  4DNA A;  2GEW A;  3FPZ A;  3CPI G;  4U2S A;  3AE6 A;  1CJC A;  3DGH A;  5EBK A;  3CNJ A;  3ISH A;  3AE5 A;  1H84 A;  1GV4 A;  5M0Z A;  3E1T A;  1ZOY A;  2XLS A;  1DOB A;  2RGJ A;  2V60 A;  4J33 A;  4LII A;  3RP6 A;  3B3R A;  4WCT A;  2BCP A;  1TYT A;  5HXI A;  4YWO A;  2A89 A;  1EL7 A;  1O95 A;  2B9X A;  4AT2 A;  1N1P A;  1EL8 A;  4H4S A;  4YTN A;  1B8S A;  2HQM A;  2GV8 A;  4A7A A;  5JCM A;  4NZH A;  3Q9T A;  1GSN A;  4A65 A;  2GH5 A;  1DNC A;  1XDI A;  3ITJ A;  1P2H A;  3FIM B;  5U1O A;  4Z2T A;  3KPF A;  2QA1 A;  3NTD A;  1F8S A;  3UOX A;  1RYI A;  5EB4 A;  3M12 A;  2Y6R A;  3EF6 A;  3SQP A;  3M0O A;  4X9N A;  4EM3 A;  3GWD A;  1D4D A;  5BRT A;  2PYX A;  1TDN A;  1CC6 A;  2BS3 A;  1KSU A;  1PXA A;  4H4V A;  4A99 A;  2CUL A;  5JCL A;  2I0Z A;  2BXS A;  1LQT A;  1L9E A;  1KF6 A;  4B64 A;  4MJW A;  1RP0 A;  2V61 A;  1IUT A;  3DJG X;  4TLZ A;  1K0J A;  3NLC A;  3GRS A;  1H6V A;  2YG6 A;  2BCG G;  1TRB A;  2YG7 A;  1XHC A;  3UTF A;  1NEN A;  1OJT A;  4BUR A;  1ZDL A;  2NPX A;  4C77 A;  2YLS A;  4H4R A;  1CHU A;  4YSH A;  4H2Q A;  2VQ7 A;  3NK1 X;  2JBV A;  2WOV A;  1PHH A;  3AEB A;  2YLX A;  3GDN A;  3KD9 A;  4Z2R A;  1REO A;  1XPQ A;  4H4P A;  4H4X A;  2C75 A;  5HYM A;  3AWI A;  1GRH A;  3KLJ A;  2C64 A;  3RNM A;  3C4N A;  4H4T A;  3VRA A;  2CVJ A;  3WE0 A;  1PJ6 A;  4A79 A;  5FS8 A;  3ALJ A;  1CL0 A;  4I58 A;  3QJ4 A;  4FK1 A;  1FEB A;  1FOH A;  1NHR A;  3CN8 A;  4DGK A;  2BXR A;  1ZMC A;  2WDR A;  3BNM A;  2APG A;  4EIQ A;  4M52 A;  4B63 A;  1NDA A;  2WU5 A;  3NRN A;  1QJD A;  3CNS A;  1CJ4 A;  1Y0P A;  5KOX A;  1E39 A;  1GTH A;  5IPY A;  2WP5 A;  4GDE A;  2C67 A;  2WQY A;  2EQ8 A;  1JNZ A;  2Q7V A;  2WBA A;  1IUX A;  2XLT A;  1KNP A;  2XFP A;  2E5V A;  2V3A A;  4APN A;  3K30 A;  2WHD A;  3FMW A;  3AEE A;  4D04 A;  3QVR A;  2WOI A;  2JK6 A;  4J57 A;  2B76 A;  4U8N A;  3DGZ A;  2AR8 A;  2X50 A;  3Q6J A;  1OJ9 A;  3UTH A;  1H82 A;  2YLR A;  4H4Z A;  5J60 A;  2C66 A;  2YVF A;  2XVJ A;  1GER A;  2OLN A;  2IVD A;  1DJN A;  4K2X A;  1H81 A;  4CNJ A;  1IUV A;  4BJZ A;  4TM0 A;  3L1R A;  3PVC A;  2ACZ A;  4Z43 A;  4GF7 A;  1PJ5 A;  4D03 A;  2BAC A;  3DME A;  3UTG A;  3KVE A;  3NN0 X;  4JDR A;  2JB3 A;  2R46 A;  3NN6 X;  2VZ2 A;  1GET A;  2XCG A;  4XWR A;  3RP8 A;  3FG2 P;  1PBB A;  3LJP A;  3IF9 A;  4GCM A;  3NG7 X;  2O9Z A;  2C73 A;  1JNR A;  1Q9I A;  2AAQ A;  4J31 A;  3UKL A;  1N4W A;  2BK3 A;  4Z24 A;  2WES A;  3GD3 A;  5C3J A;  4C3X A;  5U25 A;  4YKG A;  1L9C A;  4J34 A;  5JCK A;  4FK1 C;  3H4K A;  1JRZ A;  1E1L A;  4EMW A;  2C3C A;  2PHH A;  1GXF A;  4REK A;  4UP3 A;  4LA1 A;  4EMI A;  3COX A;  2Q0K A;  1GRT A;  3D8X A;  4EIP A;  1XAN A;  1BZL A;  4OPC A;  2VVM A;  1PN0 A;  3AE7 A;  4AP1 A;  1CF3 A;  3CGB A;  4JY3 A;  1CC2 A;  4J2W A;  1Y56 B;  1AOG A;  1PDH A;  3DK8 A;  3CND A;  1LPF A;  4P9S A;  1TDO A;  2WS3 A;  1F3P A;  2XDO A;  3AYJ A;  3D1C A;  3I3L A;  4NTD A;  3KA7 A;  1KFY A;  5CKU A;  2FBW A;  2YR4 A;  2BS2 A;  2DKI A;  2C7G A;  2VVL A;  2XVH A;  4GR1 A;  3AE4 A;  2RAB A;  3BI4 A;  3BHF A;  1L9D A;  2BK5 A;  4U8M A;  3V76 A;  4J36 A;  2Z5X A;  3VQR A;  4A6N A;  1YY5 A;  2XFU A;  1CBO A;  4YXD A;  3UKK A;  4U8L A;  4OCG A;  2TPR A;  3PS9 A;  2YG5 A;  3QSS A;  1E6E A;  3IWA A;  3GD4 A;  3DJD A;  1H86 A;  3K7Q X;  2WET A;  1FCD A;  1X31 B;  2YAU A;  1BWC A;  1F8R A;  2OAL A;  1MOK A;  3BI5 A;  1TDF A;  2YM1 A;  1YQ4 A;  5KVI A;  3KKJ A;  2V6O A;  2Y6Q A;  3DH9 A;  5FS9 A;  3VR9 A;  4Z26 A;  3LAD A;  1B37 A;  2GQF A;  3H8L A;  4U8J A;  4A9W A;  2GVC A;  2QA2 A;  1MXT A;  3CNP A;  2IID A;  1ONF A;  2C3D A;  3GRT A;  2EQ7 A;  4TM3 A;  2R9Z A;  2JB2 A;  4RSL A;  1KSS A;  4YTP A;  1IUW A;  2E1M A;  3I6D A;  3S61 A;  1M6I A;  3NNE A;  2YLW A;  3AEG A;  2GR2 A;  4O5Q A;  3F8D A;  4B66 A;  1DOC A;  2B7R A;  1VDC A;  4JNQ A;  1KDG A;  2VRL A;  5M10 A;  1KNR A;  3GYJ A;  4CNK A;  1Y56 A;  1F6M A;  1GND A;  4BK1 A;  2OAM A;  2XFO A;  3L8K A;  3CPJ G;  5EOW A;  3UTE A;  3II4 A;  3LB8 A;  4FDC B;  1VG0 A;  2WDV A;  3F8R A;  3NT6 A;  4PAA A;  2BC0 A;  3R9U A;  3NHO X;  3LOV A;  4CBQ A;  4OVI A;  4EMJ A;  2YVG A;  3M13 A;  5J7X A;  2GR3 A;  4H2N A;  3SGL A;  1PXB A;  4TM1 A;  4CY8 A;  1YKJ A;  4EQX A;  2FJE A;  4H4Y A;  4B67 A;  3AED A;  4U8I A;  5KWF A;  3SFD A;  2WPC A;  3DK9 A;  2J3N A;  2ZZB A;  2VVL G;  1NEK A;  3OZ2 A;  4K5S A;  5TR3 A;  3QSM A;  1GAL A;  2X99 A;  4ADW A;  4U2T A;  1HYU A;  1ZK7 A;  2B9Y A;  1DOE A;  2BS4 A;  2YVJ A;  1N4V A; 
#chains in the Genus database with same CATH topology
 4H2P A;  1NHP A;  1EL5 A;  2F5Z A;  4NTE A;  5GSN A;  4OPD A;  1D5T A;  4C74 A;  3NYF A;  3QVP A;  1S3E A;  3NTA A;  3LZX A;  1IUS A;  3P4R A;  1GES A;  5HHF A;  1JOA A;  2WOW A;  4UDP A;  3DK4 A;  2GF3 A;  4G73 A;  1PXC A;  2V5Z A;  4IVO B;  3B6D A;  3SZW A;  4EQR A;  4E0V A;  5FMH A;  1E1M A;  1ZP0 A;  4XXG A;  2VOU A;  4OPI A;  1LVL A;  1IJH A;  1PJ7 A;  4RG4 A;  3NYE A;  5U63 A;  3AE3 A;  1ELI A;  2RGO A;  1DXL A;  2ZZ0 A;  3P4S A;  4H4U A;  2EQ6 A;  3IHM A;  4Y4N A;  5DBJ A;  3GDP A;  1GT8 A;  3G5S A;  4C3Y A;  3QSE A;  2NVK X;  2FJD A;  1Q1W A;  4A6N B;  2WDQ A;  3AYI A;  3SX6 A;  3BNU A;  3DJE A;  5IQ4 A;  1NHS A;  2Z5Y A;  5ER0 A;  3P4Q A;  1JRY A;  2OA1 A;  1ZMD A;  1VQW A;  1JU2 A;  2WPE A;  2FJB A;  3HYX A;  3NH3 X;  4U8K A;  1PS9 A;  1YQ3 A;  2WU2 A;  2YG4 A;  4JN9 A;  2X8H A;  1QLB A;  3AE8 A;  4OPU A;  3ICS A;  4AOX A;  4GUV A;  4H4W A;  3AB1 A;  1VRQ B;  5IQ1 A;  2CDU A;  2H88 A;  1GRF A;  1NAA A;  3NKS A;  1GRB A;  2QCU A;  4OPL A;  4ECH A;  4OPG A;  3NK0 X;  3LXD A;  1LV0 A;  3UP5 A;  1NHQ A;  1E1K A;  4JY2 A;  5KOW A;  1GRG A;  1ZY8 A;  2E4G A;  4NEW A;  2A87 A;  3UKA A;  3AE2 A;  3UKF A;  3V3O A;  3AYL A;  5HY5 A;  4Z2U A;  1RSG A;  1PBC A;  1GPE A;  3AEF A;  3ZDN A;  1CC4 A;  4BK3 A;  4EQW A;  2B7S A;  4I59 A;  4B65 A;  1TDK A;  4GDP A;  3T0K A;  5KMR A;  1GRA A;  5KXJ A;  3T2K A;  3KU9 A;  3ABV A;  3UCL A;  4X9M A;  2XLP A;  4XWZ A;  2YLT A;  2WPF A;  3ATR A;  3K7M X;  2YG3 A;  3VRB A;  4YSX A;  2BAB A;  2IVE A;  3KPK A;  2C76 A;  3NYC A;  5KRQ A;  3GYI A;  4HB9 A;  3T37 A;  2YM2 A;  1H7X A;  2Q0L A;  1EBD A;  4BJY A;  2GMJ A;  1N4U A;  1EL9 A;  1F8W A;  2GRT A;  2JB1 A;  3UKQ A;  3GSI A;  4NWZ A;  3BHK A;  4CCR A;  5FS6 A;  3G5Q A;  2YQU A;  3UKP A;  3SM8 A;  4A5L A;  5BVA A;  4ICY A;  4YTM A;  1DOD A;  5EB5 A;  1NG4 A;  1LTX R;  1S2Q A;  2XVI A;  5KNL A;  1O5W A;  3C4A A;  3CGE A;  3EAN A;  1FEC A;  1W4X A;  1CJ3 A;  4AT0 A;  1BGN A;  1BKW A;  1NPX A;  1OJC A;  1CJ2 A;  2R0P A;  2TMD A;  4YT0 A;  2R45 A;  4K8D A;  1GRE A;  3ALL A;  3UP4 A;  2R0C A;  2ZBW A;  4O5U A;  4GRT A;  3ICT A;  3P9U A;  3ADA B;  4OPT A;  2GB0 A;  1L0V A;  4YSZ A;  1DJQ A;  4H4Q A;  2XFN A;  3CPH G;  2XVE A;  3AE1 A;  3P1W A;  1VG9 A;  1BF3 A;  1ZKQ A;  3HYW A;  3RP7 A;  4IV9 A;  1OJA A;  2R4E A;  1QO8 A;  1M64 A;  3NK2 X;  5GRT A;  2WP9 A;  1ZOV A;  2ZZC A;  3T2Y A;  2XFQ A;  3CGC A;  3QFA A;  2H89 A;  2QAE A;  3AE9 A;  3ATQ A;  3T2Z A;  1D7Y A;  4YSY A;  4IA5 A;  1D4E A;  3BI2 A;  4UDQ A;  4ZCC A;  1SEZ A;  2B9W A;  2GAG B;  4LU6 A;  4JQ9 A;  4J56 A;  2DKH A;  2XLR A;  1LJ1 A;  3HZL A;  1V59 A;  2C72 A;  4B68 A;  4UDR A;  4Y4L A;  2XYO A;  3RHA A;  1UKV G;  3IC9 A;  2AQJ A;  4IVM B;  4CRT A;  3VR8 A;  2GAH B;  1H83 A;  1YQZ A;  1Z6L A;  2WEU A;  3AD9 B;  4B1B A;  5LV9 A;  2V3B A;  3IHG A;  1PBF A;  4PAB A;  1TDE A;  3GMB A;  1BGJ A;  3ZYX A;  1GEU A;  2GMH A;  2C65 A;  3NGC X;  3O0H A;  2GR0 A;  3AEC A;  3AD8 B;  5JCI A;  3AEA A;  3UKH A;  1P2E A;  3T14 A;  4C5O A;  3SXI A;  1S2Y A;  2WP6 A;  3C96 A;  4USR A;  3UOY A;  4BK2 A;  2X8C A;  2Q6U A;  4Z44 A;  1FEA A;  2W0H A;  4CCQ A;  4KPR A;  2XLU A;  2XVF A;  3CIR A;  3QFB A;  3PO7 A;  2YR5 A;  2C70 A;  3V3N A;  3RED A;  2X3N A;  4EQS A;  4ZN0 A;  1B4V A;  4B69 A;  4K7Z A;  5JCN A;  1K0I A;  3S5W A;  3SZ0 A;  4U2L A;  4CY6 A;  4ZCD A;  2GR1 A;  2FJA A;  1GOS A;  2BK4 A;  4N9X A;  3LZW A;  3CTY A;  3EAO A;  3GYX A;  3DJJ A;  1PBD A;  1JEH A;  2OLO A;  5FS7 A;  1TYP A;  1COY A;  4DSH A;  2R0G A;  3NIX A;  1O94 A;  3FBS A;  4YKF A;  3UOZ A;  2GQW A;  4TLX A;  4WX1 A;  3G5R A;  2YR6 A;  4IA6 A;  4KX6 A;  3GWF A;  3ICR A;  2R4J A;  2A8X A;  2RGH A;  4BV6 A;  3OC4 A;  2JKC A;  4USQ A;  4U8O A;  4H2R A;  1H7W A;  4Z25 A;  4JNA A;  4U8P A;  4HA6 A;  4NNJ A;  3K7T A;  1Q1R A;  4DSG A;  3CNT A;  3JSK A;  5C2T A;  5CQF A;  3GMC A;  3DA1 A;  1K0L A;  4RG3 A;  3UOV A;  4NEV A;  5KVH A;  1PBE A;  5BUL A;  3SFE A;  1IUU A;  2BYB A;  2UZZ A;  4K22 A;  2YLZ A;  5L46 A;  4TM4 A;  2VRM A;  1D7L A;  4FX9 A;  5KMS A;  1MO9 A;  1GTE A;  1B5Q A;  1D4C A;  2BC1 A;  3ALM A;  1NG3 A;  4K5R A;  4X4J A;  1FL2 A;  1S3B A;  4AOS A;  1E1N A;  1OJD A;  2ARD A;  4AP3 A;  1JRX A;  2BA9 A;  4EM4 A;  3URH A;  1E7P A;  2JAE A;  3H8I A;  3VRD B;  2CFY A;  3AXB A;  3F8P A;  2EQ9 A;  4H50 A;  2YWL A;  3P4P A;  2VQB A;  4NTC A;  4Y4M A;  1ZX9 A;  3CGD A;  2X8G A;  3AD7 B;  5BUK A;  1K4Q A;  1LQU A;  3EPT A;  4H7U A;  4DNA A;  2GEW A;  3FPZ A;  3CPI G;  4U2S A;  3AE6 A;  1CJC A;  3DGH A;  5EBK A;  3CNJ A;  3ISH A;  3AE5 A;  1H84 A;  1GV4 A;  5M0Z A;  3E1T A;  1ZOY A;  2XLS A;  1DOB A;  2RGJ A;  2V60 A;  4G6H A;  4GAP A;  4J33 A;  4LII A;  3RP6 A;  3B3R A;  4WCT A;  2BCP A;  1TYT A;  2C4C A;  4G6G A;  5HXI A;  2BRA A;  4YWO A;  2A89 A;  1EL7 A;  1O95 A;  2B9X A;  4AT2 A;  1N1P A;  1EL8 A;  4H4S A;  4YTN A;  1B8S A;  2HQM A;  2GV8 A;  4A7A A;  5JCM A;  4NZH A;  3Q9T A;  1GSN A;  4A65 A;  2GH5 A;  1DNC A;  1XDI A;  3ITJ A;  1P2H A;  3FIM B;  5U1O A;  4Z2T A;  3KPF A;  2QA1 A;  3NTD A;  1F8S A;  3UOX A;  1RYI A;  5EB4 A;  3M12 A;  2Y6R A;  3EF6 A;  3HYV A;  3SQP A;  4II3 A;  3M0O A;  4X9N A;  4EM3 A;  3GWD A;  1D4D A;  5BRT A;  2PYX A;  1TDN A;  1CC6 A;  2BS3 A;  1KSU A;  1PXA A;  4H4V A;  4A99 A;  2CUL A;  5JCL A;  2I0Z A;  2BXS A;  1LQT A;  1L9E A;  1KF6 A;  4B64 A;  4MJW A;  1RP0 A;  2V61 A;  1IUT A;  3DJG X;  4TLZ A;  1K0J A;  3CMM A;  3GRS A;  3NLC A;  1H6V A;  2YG6 A;  2BCG G;  1TRB A;  2YG7 A;  4GAV A;  1XHC A;  3UTF A;  1NEN A;  1OJT A;  4BUR A;  1ZDL A;  2NPX A;  4C77 A;  2YLS A;  4H4R A;  1CHU A;  4YSH A;  4H2Q A;  2VQ7 A;  3NK1 X;  2JBV A;  2WOV A;  1PHH A;  3AEB A;  2YLX A;  3GDN A;  3KD9 A;  4Z2R A;  1REO A;  1XPQ A;  4H4P A;  4H4X A;  2C75 A;  5HYM A;  3AWI A;  1GRH A;  3KLJ A;  2C64 A;  3RNM A;  3C4N A;  4H4T A;  3VRA A;  2CVJ A;  3WE0 A;  1PJ6 A;  4A79 A;  5FS8 A;  3ALJ A;  1CL0 A;  4I58 A;  3QJ4 A;  4FK1 A;  1FEB A;  1FOH A;  1NHR A;  3CN8 A;  4DGK A;  3SZF A;  2BXR A;  1ZMC A;  2WDR A;  3BNM A;  2APG A;  4EIQ A;  4M52 A;  4B63 A;  1NDA A;  2WU5 A;  3NRN A;  1QJD A;  3CNS A;  1CJ4 A;  1Y0P A;  5KOX A;  1E39 A;  1GTH A;  5IPY A;  2WP5 A;  4GDE A;  2C67 A;  2WQY A;  2EQ8 A;  1JNZ A;  2Q7V A;  2WBA A;  1IUX A;  2XLT A;  1KNP A;  2XFP A;  2E5V A;  2V3A A;  4APN A;  3K30 A;  2WHD A;  3FMW A;  3AEE A;  4D04 A;  3QVR A;  2WOI A;  2JK6 A;  4J57 A;  2B76 A;  3SYI A;  4U8N A;  3DGZ A;  2AR8 A;  2X50 A;  3Q6J A;  1OJ9 A;  3UTH A;  1H82 A;  2YLR A;  4H4Z A;  5J60 A;  2C66 A;  2YVF A;  2XVJ A;  1GER A;  2OLN A;  2IVD A;  1DJN A;  4K2X A;  1H81 A;  4CNJ A;  1IUV A;  4BJZ A;  4TM0 A;  4G74 A;  3L1R A;  3PVC A;  2ACZ A;  4Z43 A;  4GF7 A;  1PJ5 A;  4D03 A;  2BAC A;  3DME A;  3UTG A;  3KVE A;  3NN0 X;  4JDR A;  2JB3 A;  2R46 A;  3NN6 X;  2VZ2 A;  1GET A;  2XCG A;  4XWR A;  3RP8 A;  3FG2 P;  1PBB A;  3LJP A;  4II2 A;  3IF9 A;  4GCM A;  3NG7 X;  2O9Z A;  5KMP A;  2C73 A;  1JNR A;  1Q9I A;  2AAQ A;  4J31 A;  3UKL A;  1N4W A;  2BK3 A;  4Z24 A;  2WES A;  3GD3 A;  5C3J A;  4C3X A;  5U25 A;  4YKG A;  1L9C A;  4J34 A;  5JCK A;  4FK1 C;  3H4K A;  1JRZ A;  1E1L A;  4EMW A;  2C3C A;  2PHH A;  1GXF A;  4REK A;  4UP3 A;  4LA1 A;  4EMI A;  3COX A;  2Q0K A;  1GRT A;  3D8X A;  4EIP A;  1XAN A;  1BZL A;  4OPC A;  2VVM A;  1PN0 A;  3AE7 A;  4AP1 A;  1CF3 A;  3CGB A;  4JY3 A;  1CC2 A;  4J2W A;  1Y56 B;  1AOG A;  1PDH A;  3DK8 A;  3CND A;  1LPF A;  4P9S A;  1TDO A;  2WS3 A;  1F3P A;  2XDO A;  3AYJ A;  3D1C A;  3I3L A;  3SZC A;  4NTD A;  3KA7 A;  1KFY A;  5CKU A;  2FBW A;  2YR4 A;  2BS2 A;  2DKI A;  2C7G A;  2VVL A;  2XVH A;  4GR1 A;  3AE4 A;  2RAB A;  3BI4 A;  3BHF A;  1L9D A;  2BK5 A;  4U8M A;  3V76 A;  4J36 A;  2Z5X A;  3VQR A;  4A6N A;  1YY5 A;  2XFU A;  1CBO A;  3T31 A;  4YXD A;  5KMQ A;  4U8L A;  4OCG A;  3UKK A;  2TPR A;  3PS9 A;  2YG5 A;  3QSS A;  1E6E A;  3IWA A;  3GD4 A;  3DJD A;  1H86 A;  3K7Q X;  2WET A;  1FCD A;  1X31 B;  2YAU A;  1BWC A;  1F8R A;  2OAL A;  1MOK A;  3BI5 A;  1TDF A;  2YM1 A;  1YQ4 A;  5KVI A;  3KKJ A;  2V6O A;  2Y6Q A;  3DH9 A;  5FS9 A;  3VR9 A;  4Z26 A;  3LAD A;  1B37 A;  2GQF A;  3H8L A;  4U8J A;  4A9W A;  2BRY A;  2GVC A;  4G9K A;  2QA2 A;  1MXT A;  3CNP A;  2IID A;  1ONF A;  2C3D A;  3GRT A;  2EQ7 A;  4TM3 A;  2R9Z A;  2JB2 A;  4RSL A;  3SY4 A;  1KSS A;  4YTP A;  1IUW A;  2E1M A;  3I6D A;  3S61 A;  1M6I A;  3NNE A;  2YLW A;  3AEG A;  2GR2 A;  4O5Q A;  3F8D A;  4B66 A;  1DOC A;  2B7R A;  1VDC A;  4JNQ A;  1KDG A;  2VRL A;  5M10 A;  1KNR A;  3GYJ A;  4CNK A;  1Y56 A;  1F6M A;  1GND A;  4BK1 A;  2OAM A;  2XFO A;  3L8K A;  3CPJ G;  5EOW A;  3UTE A;  3II4 A;  3LB8 A;  4FDC B;  1VG0 A;  2WDV A;  3F8R A;  3NT6 A;  4PAA A;  2BC0 A;  3R9U A;  3NHO X;  3LOV A;  4CBQ A;  4OVI A;  4EMJ A;  2YVG A;  3M13 A;  5J7X A;  2GR3 A;  4H2N A;  3SGL A;  1PXB A;  4TM1 A;  4CY8 A;  1YKJ A;  4EQX A;  2FJE A;  4H4Y A;  4B67 A;  3AED A;  4U8I A;  5KWF A;  3SFD A;  2WPC A;  3DK9 A;  2J3N A;  2ZZB A;  2VVL G;  1NEK A;  3OZ2 A;  4K5S A;  5TR3 A;  3QSM A;  1GAL A;  2X99 A;  4ADW A;  4U2T A;  1HYU A;  1ZK7 A;  2B9Y A;  1DOE A;  2BS4 A;  2YVJ A;  1N4V A; 
#chains in the Genus database with same CATH homology
 4H2P A;  1NHP A;  1EL5 A;  2F5Z A;  4NTE A;  5GSN A;  4OPD A;  1D5T A;  4C74 A;  3NYF A;  3QVP A;  1S3E A;  3NTA A;  3LZX A;  1IUS A;  3P4R A;  1GES A;  5HHF A;  1JOA A;  2WOW A;  4UDP A;  3DK4 A;  2GF3 A;  4G73 A;  1PXC A;  2V5Z A;  4IVO B;  3B6D A;  3SZW A;  4EQR A;  4E0V A;  5FMH A;  1E1M A;  1ZP0 A;  4XXG A;  2VOU A;  4OPI A;  1LVL A;  1IJH A;  1PJ7 A;  4RG4 A;  3NYE A;  5U63 A;  3AE3 A;  1ELI A;  2RGO A;  1DXL A;  2ZZ0 A;  3P4S A;  4H4U A;  2EQ6 A;  3IHM A;  4Y4N A;  5DBJ A;  3GDP A;  1GT8 A;  3G5S A;  4C3Y A;  3QSE A;  2NVK X;  2FJD A;  1Q1W A;  4A6N B;  2WDQ A;  3AYI A;  3SX6 A;  3BNU A;  3DJE A;  5IQ4 A;  1NHS A;  2Z5Y A;  5ER0 A;  3P4Q A;  1JRY A;  2OA1 A;  1ZMD A;  1VQW A;  1JU2 A;  2WPE A;  2FJB A;  3HYX A;  3NH3 X;  4U8K A;  1PS9 A;  1YQ3 A;  2WU2 A;  2YG4 A;  4JN9 A;  2X8H A;  1QLB A;  3AE8 A;  4OPU A;  3ICS A;  4AOX A;  4GUV A;  4H4W A;  3AB1 A;  1VRQ B;  5IQ1 A;  2CDU A;  2H88 A;  1GRF A;  1NAA A;  3NKS A;  1GRB A;  2QCU A;  4OPL A;  4ECH A;  4OPG A;  3NK0 X;  3LXD A;  1LV0 A;  3UP5 A;  1NHQ A;  1E1K A;  4JY2 A;  5KOW A;  1GRG A;  1ZY8 A;  2E4G A;  4NEW A;  2A87 A;  3UKA A;  3AE2 A;  3UKF A;  3V3O A;  3AYL A;  5HY5 A;  4Z2U A;  1RSG A;  1PBC A;  1GPE A;  3AEF A;  3ZDN A;  1CC4 A;  4BK3 A;  4EQW A;  2B7S A;  4I59 A;  4B65 A;  1TDK A;  4GDP A;  3T0K A;  5KMR A;  1GRA A;  5KXJ A;  3T2K A;  3KU9 A;  3ABV A;  3UCL A;  4X9M A;  2XLP A;  4XWZ A;  2YLT A;  2WPF A;  3ATR A;  3K7M X;  2YG3 A;  3VRB A;  4YSX A;  2BAB A;  2IVE A;  3KPK A;  2C76 A;  3NYC A;  5KRQ A;  3GYI A;  4HB9 A;  3T37 A;  2YM2 A;  1H7X A;  2Q0L A;  1EBD A;  4BJY A;  2GMJ A;  1N4U A;  1EL9 A;  1F8W A;  2GRT A;  2JB1 A;  3UKQ A;  3GSI A;  4NWZ A;  3BHK A;  4CCR A;  5FS6 A;  3G5Q A;  2YQU A;  3UKP A;  3SM8 A;  4A5L A;  5BVA A;  4ICY A;  4YTM A;  1DOD A;  5EB5 A;  1NG4 A;  1LTX R;  1S2Q A;  2XVI A;  5KNL A;  1O5W A;  3C4A A;  3CGE A;  3EAN A;  1FEC A;  1W4X A;  1CJ3 A;  4AT0 A;  1BGN A;  1BKW A;  1NPX A;  1OJC A;  1CJ2 A;  2R0P A;  2TMD A;  4YT0 A;  2R45 A;  4K8D A;  1GRE A;  3ALL A;  3UP4 A;  2R0C A;  2ZBW A;  4O5U A;  4GRT A;  3ICT A;  3P9U A;  3ADA B;  4OPT A;  2GB0 A;  1L0V A;  4YSZ A;  1DJQ A;  4H4Q A;  2XFN A;  3CPH G;  2XVE A;  3AE1 A;  3P1W A;  1VG9 A;  1BF3 A;  1ZKQ A;  3HYW A;  3RP7 A;  4IV9 A;  1OJA A;  2R4E A;  1QO8 A;  1M64 A;  3NK2 X;  5GRT A;  2WP9 A;  1ZOV A;  2ZZC A;  3T2Y A;  2XFQ A;  3CGC A;  3QFA A;  2H89 A;  2QAE A;  3AE9 A;  3ATQ A;  3T2Z A;  1D7Y A;  4YSY A;  4IA5 A;  1D4E A;  3BI2 A;  4UDQ A;  4ZCC A;  1SEZ A;  2B9W A;  2GAG B;  4LU6 A;  4JQ9 A;  4J56 A;  2DKH A;  2XLR A;  1LJ1 A;  3HZL A;  1V59 A;  2C72 A;  4B68 A;  4UDR A;  4Y4L A;  2XYO A;  3RHA A;  1UKV G;  3IC9 A;  2AQJ A;  4IVM B;  4CRT A;  3VR8 A;  2GAH B;  1H83 A;  1YQZ A;  1Z6L A;  2WEU A;  3AD9 B;  4B1B A;  5LV9 A;  2V3B A;  3IHG A;  1PBF A;  4PAB A;  1TDE A;  3GMB A;  1BGJ A;  3ZYX A;  1GEU A;  2GMH A;  2C65 A;  3NGC X;  3O0H A;  2GR0 A;  3AEC A;  3AD8 B;  5JCI A;  3AEA A;  3UKH A;  1P2E A;  3T14 A;  4C5O A;  3SXI A;  1S2Y A;  2WP6 A;  3C96 A;  4USR A;  3UOY A;  4BK2 A;  2X8C A;  2Q6U A;  4Z44 A;  1FEA A;  2W0H A;  4CCQ A;  4KPR A;  2XLU A;  2XVF A;  3CIR A;  3QFB A;  3PO7 A;  2YR5 A;  2C70 A;  3V3N A;  3RED A;  2X3N A;  4EQS A;  4ZN0 A;  1B4V A;  4B69 A;  4K7Z A;  5JCN A;  1K0I A;  3S5W A;  3SZ0 A;  4U2L A;  4CY6 A;  4ZCD A;  2GR1 A;  2FJA A;  1GOS A;  2BK4 A;  4N9X A;  3LZW A;  3CTY A;  3EAO A;  3GYX A;  3DJJ A;  1PBD A;  1JEH A;  2OLO A;  5FS7 A;  1TYP A;  1COY A;  4DSH A;  2R0G A;  3NIX A;  1O94 A;  3FBS A;  4YKF A;  3UOZ A;  2GQW A;  4TLX A;  4WX1 A;  3G5R A;  2YR6 A;  4IA6 A;  4KX6 A;  3GWF A;  3ICR A;  2R4J A;  2A8X A;  2RGH A;  4BV6 A;  3OC4 A;  2JKC A;  4USQ A;  4U8O A;  4H2R A;  1H7W A;  4Z25 A;  4JNA A;  4U8P A;  4HA6 A;  4NNJ A;  3K7T A;  1Q1R A;  4DSG A;  3CNT A;  3JSK A;  5C2T A;  5CQF A;  3GMC A;  3DA1 A;  1K0L A;  4RG3 A;  3UOV A;  4NEV A;  5KVH A;  1PBE A;  5BUL A;  3SFE A;  1IUU A;  2BYB A;  2UZZ A;  4K22 A;  2YLZ A;  5L46 A;  4TM4 A;  2VRM A;  1D7L A;  4FX9 A;  5KMS A;  1MO9 A;  1GTE A;  1B5Q A;  1D4C A;  2BC1 A;  3ALM A;  1NG3 A;  4K5R A;  4X4J A;  1FL2 A;  1S3B A;  4AOS A;  1E1N A;  1OJD A;  2ARD A;  4AP3 A;  1JRX A;  2BA9 A;  4EM4 A;  3URH A;  1E7P A;  2JAE A;  3H8I A;  3VRD B;  2CFY A;  3AXB A;  3F8P A;  2EQ9 A;  4H50 A;  2YWL A;  3P4P A;  2VQB A;  4NTC A;  4Y4M A;  1ZX9 A;  3CGD A;  2X8G A;  3AD7 B;  5BUK A;  1K4Q A;  1LQU A;  3EPT A;  4H7U A;  4DNA A;  2GEW A;  3FPZ A;  3CPI G;  4U2S A;  3AE6 A;  1CJC A;  3DGH A;  5EBK A;  3CNJ A;  3ISH A;  3AE5 A;  1H84 A;  1GV4 A;  5M0Z A;  3E1T A;  1ZOY A;  2XLS A;  1DOB A;  2RGJ A;  2V60 A;  4G6H A;  4GAP A;  4J33 A;  4LII A;  3RP6 A;  3B3R A;  4WCT A;  2BCP A;  1TYT A;  2C4C A;  4G6G A;  5HXI A;  2BRA A;  4YWO A;  2A89 A;  1EL7 A;  1O95 A;  2B9X A;  4AT2 A;  1N1P A;  1EL8 A;  4H4S A;  4YTN A;  1B8S A;  2HQM A;  2GV8 A;  4A7A A;  5JCM A;  4NZH A;  3Q9T A;  1GSN A;  4A65 A;  2GH5 A;  1DNC A;  1XDI A;  3ITJ A;  1P2H A;  3FIM B;  5U1O A;  4Z2T A;  3KPF A;  2QA1 A;  3NTD A;  1F8S A;  3UOX A;  1RYI A;  5EB4 A;  3M12 A;  2Y6R A;  3EF6 A;  3HYV A;  3SQP A;  4II3 A;  3M0O A;  4X9N A;  4EM3 A;  3GWD A;  1D4D A;  5BRT A;  2PYX A;  1TDN A;  1CC6 A;  2BS3 A;  1KSU A;  1PXA A;  4H4V A;  4A99 A;  2CUL A;  5JCL A;  2I0Z A;  2BXS A;  1LQT A;  1L9E A;  1KF6 A;  4B64 A;  4MJW A;  1RP0 A;  2V61 A;  1IUT A;  3DJG X;  4TLZ A;  1K0J A;  3CMM A;  3GRS A;  3NLC A;  1H6V A;  2YG6 A;  2BCG G;  1TRB A;  2YG7 A;  4GAV A;  1XHC A;  3UTF A;  1NEN A;  1OJT A;  4BUR A;  1ZDL A;  2NPX A;  4C77 A;  2YLS A;  4H4R A;  1CHU A;  4YSH A;  4H2Q A;  2VQ7 A;  3NK1 X;  2JBV A;  2WOV A;  1PHH A;  3AEB A;  2YLX A;  3GDN A;  3KD9 A;  4Z2R A;  1REO A;  1XPQ A;  4H4P A;  4H4X A;  2C75 A;  5HYM A;  3AWI A;  1GRH A;  3KLJ A;  2C64 A;  3RNM A;  3C4N A;  4H4T A;  3VRA A;  2CVJ A;  3WE0 A;  1PJ6 A;  4A79 A;  5FS8 A;  3ALJ A;  1CL0 A;  4I58 A;  3QJ4 A;  4FK1 A;  1FEB A;  1FOH A;  1NHR A;  3CN8 A;  4DGK A;  3SZF A;  2BXR A;  1ZMC A;  2WDR A;  3BNM A;  2APG A;  4EIQ A;  4M52 A;  4B63 A;  1NDA A;  2WU5 A;  3NRN A;  1QJD A;  3CNS A;  1CJ4 A;  1Y0P A;  5KOX A;  1E39 A;  1GTH A;  5IPY A;  2WP5 A;  4GDE A;  2C67 A;  2WQY A;  2EQ8 A;  1JNZ A;  2Q7V A;  2WBA A;  1IUX A;  2XLT A;  1KNP A;  2XFP A;  2E5V A;  2V3A A;  4APN A;  3K30 A;  2WHD A;  3FMW A;  3AEE A;  4D04 A;  3QVR A;  2WOI A;  2JK6 A;  4J57 A;  2B76 A;  3SYI A;  4U8N A;  3DGZ A;  2AR8 A;  2X50 A;  3Q6J A;  1OJ9 A;  3UTH A;  1H82 A;  2YLR A;  4H4Z A;  5J60 A;  2C66 A;  2YVF A;  2XVJ A;  1GER A;  2OLN A;  2IVD A;  1DJN A;  4K2X A;  1H81 A;  4CNJ A;  1IUV A;  4BJZ A;  4TM0 A;  4G74 A;  3L1R A;  3PVC A;  2ACZ A;  4Z43 A;  4GF7 A;  1PJ5 A;  4D03 A;  2BAC A;  3DME A;  3UTG A;  3KVE A;  3NN0 X;  4JDR A;  2JB3 A;  2R46 A;  3NN6 X;  2VZ2 A;  1GET A;  2XCG A;  4XWR A;  3RP8 A;  3FG2 P;  1PBB A;  3LJP A;  4II2 A;  3IF9 A;  4GCM A;  3NG7 X;  2O9Z A;  5KMP A;  2C73 A;  1JNR A;  1Q9I A;  2AAQ A;  4J31 A;  3UKL A;  1N4W A;  2BK3 A;  4Z24 A;  2WES A;  3GD3 A;  5C3J A;  4C3X A;  5U25 A;  4YKG A;  1L9C A;  4J34 A;  5JCK A;  4FK1 C;  3H4K A;  1JRZ A;  1E1L A;  4EMW A;  2C3C A;  2PHH A;  1GXF A;  4REK A;  4UP3 A;  4LA1 A;  4EMI A;  3COX A;  2Q0K A;  1GRT A;  3D8X A;  4EIP A;  1XAN A;  1BZL A;  4OPC A;  2VVM A;  1PN0 A;  3AE7 A;  4AP1 A;  1CF3 A;  3CGB A;  4JY3 A;  1CC2 A;  4J2W A;  1Y56 B;  1AOG A;  1PDH A;  3DK8 A;  3CND A;  1LPF A;  4P9S A;  1TDO A;  2WS3 A;  1F3P A;  2XDO A;  3AYJ A;  3D1C A;  3I3L A;  3SZC A;  4NTD A;  3KA7 A;  1KFY A;  5CKU A;  2FBW A;  2YR4 A;  2BS2 A;  2DKI A;  2C7G A;  2VVL A;  2XVH A;  4GR1 A;  3AE4 A;  2RAB A;  3BI4 A;  3BHF A;  1L9D A;  2BK5 A;  4U8M A;  3V76 A;  4J36 A;  2Z5X A;  3VQR A;  4A6N A;  1YY5 A;  2XFU A;  1CBO A;  3T31 A;  4YXD A;  5KMQ A;  4U8L A;  4OCG A;  3UKK A;  2TPR A;  3PS9 A;  2YG5 A;  3QSS A;  1E6E A;  3IWA A;  3GD4 A;  3DJD A;  1H86 A;  3K7Q X;  2WET A;  1FCD A;  1X31 B;  2YAU A;  1BWC A;  1F8R A;  2OAL A;  1MOK A;  3BI5 A;  1TDF A;  2YM1 A;  1YQ4 A;  5KVI A;  3KKJ A;  2V6O A;  2Y6Q A;  3DH9 A;  5FS9 A;  3VR9 A;  4Z26 A;  3LAD A;  1B37 A;  2GQF A;  3H8L A;  4U8J A;  4A9W A;  2BRY A;  2GVC A;  4G9K A;  2QA2 A;  1MXT A;  3CNP A;  2IID A;  1ONF A;  2C3D A;  3GRT A;  2EQ7 A;  4TM3 A;  2R9Z A;  2JB2 A;  4RSL A;  3SY4 A;  1KSS A;  4YTP A;  1IUW A;  2E1M A;  3I6D A;  3S61 A;  1M6I A;  3NNE A;  2YLW A;  3AEG A;  2GR2 A;  4O5Q A;  3F8D A;  4B66 A;  1DOC A;  2B7R A;  1VDC A;  4JNQ A;  1KDG A;  2VRL A;  5M10 A;  1KNR A;  3GYJ A;  4CNK A;  1Y56 A;  1F6M A;  1GND A;  4BK1 A;  2OAM A;  2XFO A;  3L8K A;  3CPJ G;  5EOW A;  3UTE A;  3II4 A;  3LB8 A;  4FDC B;  1VG0 A;  2WDV A;  3F8R A;  3NT6 A;  4PAA A;  2BC0 A;  3R9U A;  3NHO X;  3LOV A;  4CBQ A;  4OVI A;  4EMJ A;  2YVG A;  3M13 A;  5J7X A;  2GR3 A;  4H2N A;  3SGL A;  1PXB A;  4TM1 A;  4CY8 A;  1YKJ A;  4EQX A;  2FJE A;  4H4Y A;  4B67 A;  3AED A;  4U8I A;  5KWF A;  3SFD A;  2WPC A;  3DK9 A;  2J3N A;  2ZZB A;  2VVL G;  1NEK A;  3OZ2 A;  4K5S A;  5TR3 A;  3QSM A;  1GAL A;  2X99 A;  4ADW A;  4U2T A;  1HYU A;  1ZK7 A;  2B9Y A;  1DOE A;  2BS4 A;  2YVJ A;  1N4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...