3KKJA

X-ray structure of p. syringae q888a4 oxidoreductase at resolution 2.5a, northeast structural genomics consortium target psr10
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
328
structure length
328
Chain Sequence
TVPIAIIGTGIAGLSAAQALTAAGHQVHLFDKSRGSGGRMSSKRSDAGALDMGAQYFTARDRRFATAVKQWQAQGHVAEWTPLLYNFHAGRLSPSPDEQVRWVGKPGMSAITRAMRGDMPVSFSCRITEVFRGEEHWNLLDAEGQNHGPFSHVIIATPAPQASTLLAAAPKLASVVAGVKMDPTWAVALAFETPLQTPMQGCFVQDSPLDWLARNRSKPERDDTLDTWILHATSQWSRQNLDASREQVIEHLHGAFAELIDCTMPAPVFSLAHRWLYARPAGAHEWGALSDADLGIYVCGDWCLSGRVEGAWLSGQEAARRLLEHLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Amine oxidase, flavin-containing
publication title X-ray structure of P. syringae q888a4 Oxidoreductase at resolution 2.5A, Northeast Structural Genomics Consortium target PsR10
rcsb
source organism Pseudomonas syringae pv. tomato
total genus 88
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature ec 1.6.3.5: Renalase.
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
A PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3kkjA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3kkjA02
1YKJA 2ZZCA 3UP5A 3G5SA 2GVCA 3CN8A 1DOCA 3DA1A 1MO9A 4A99A 3F8PA 3AECA 2ZZ0A 2E1MA 2B9WA 3AEFA 3O0HA 4GUVA 4BK1A 1D4DA 4RG4A 2VRMA 4OPUA 4U8NA 3SQPA 4CY8A 2YG7A 5C3JA 1JOAA 4USQA 4AT0A 1GRFA 1KNRA 1VG9A 3AE4A 2X8GA 1L9CA 3GMCA 3ATRA 2WPCA 3UKLA 4A79A 4DSHA 4H4XA 1PBBA 4U8LA 3M13A 4EM3A 1GTHA 1TRBA 1GERA 4EM4A 2V6OA 4YSZA 2A87A 3LZWA 1FOHA 1H7WA 4EIQA 1B5QA 3G5RA 4IVMB 1E1MA 2R9ZA 1GRAA 4PAAA 1OJCA 1H84A 4H4RA 1E6EA 5BVAA 1OJDA 2WP9A 4UDRA 3B6DA 3UTHA 2IVDA 3IF9A 2GRTA 1N1PA 1TDEA 4D03A 1XHCA 4H4SA 1NDAA 1Y0PA 1VDCA 2YG5A 4Z2UA 1KF6A 3Q6JA 2BS3A 1B8SA 5KVHA 2GR3A 3II4A 3GRTA 1NHQA 1PBCA 4NEVA 2VRLA 3AWIA 3LXDA 2JB2A 3AB1A 4JNQA 1M64A 4CY6A 1ZKQA 2GR0A 4FK1A 2YQUA 1DOEA 4YKFA 3I6DA 1KFYA 1OJAA 1DJQA 3F8DA 3NKSA 1ZX9A 2C3DA 3H4KA 3DGHA 4JNAA 1CL0A 1P2HA 3CNSA 1PJ7A 5GSNA 1KNPA 4BURA 2YLTA 3NYFA 1EL5A 1YQ4A 3PO7A 4U8JA 2PHHA 3ABVA 4O5QA 4Y4MA 4ZCDA 4YSYA 5KXJA 4EMJA 3NK1X 4K5SA 2B7SA 3RP8A 2X8HA 1KDGA 3M12A 4REKA 1JRZA 1KSUA 1H82A 1NHRA 4H4QA 5U25A 3G5QA 1ZP0A 2A89A 1MOKA 2X50A 2C72A 2X99A 2R45A 2YVGA 1JNRA 4AOXA 4J36A 2NPXA 1FEBA 3P1WA 4N9XA 3RNMA 2EQ6A 3NNEA 2XVHA 4KPRA 2B76A 2JBVA 4RG3A 4AP1A 4X9MA 2IVEA 5JCKA 1PDHA 1E39A 2BC1A 4C77A 5HHFA 1GRHA 1LV0A 3CGCA 3UTFA 4JN9A 3CNJA 3LJPA 5JCMA 2FJEA 4BK2A 3IHMA 3NIXA 5DBJA 2VZ2A 2YLRA 2GF3A 2Q0LA 4ICYA 2YVFA 4ADWA 5KWFA 1QO8A 3DJJA 2YM1A 4OPCA 3IC9A 1GRTA 2AQJA 2OLNA 2XVIA 3IHGA 1CC2A 3DGZA 2XDOA 2B7RA 1NENA 2XVJA 4IV9A 2CDUA 1REOA 1YQZA 4OCGA 1GALA 1CJ4A 3QSEA 3VR8A 4B64A 1GETA 3DK8A 1GXFA 2WU2A 3DJDA 3E1TA 4H4YA 3L1RA 3AEGA 3AE9A 3ALLA 5KRQA 1KSSA 2FBWA 3AE5A 1LJ1A 1LQUA 3RHAA 5C2TA 2DKIA 5KOXA 2ZZBA 4Z44A 2YR4A 4IA6A 3H8IA 2F5ZA 3SGLA 3REDA 2WDVA 2FJAA 3ATQA 2BABA 4H2PA 4OPGA 4LU6A 3GRSA 3ICSA 5CQFA 2YLSA 2BA9A 3LZXA 2EQ8A 1YQ3A 2VVLA 4YSXA 2JK6A 2APGA 3K7MX 5BUKA 5JCLA 4YT0A 3KA7A 1TDOA 1H83A 5CKUA 4TM0A 3CNDA 4TM4A 5EB4A 4CNKA 1BKWA 3P4PA 3ZDNA 1Q1WA 3AEAA 3DK9A 2XFPA 2XFOA 2AAQA 2GR2A 2GEWA 2WEUA 1MXTA 4E0VA 1TYPA 4J56A 3JSKA 1D7YA 2GB0A 2BXRA 4WCTA 3UKPA 4A6NA 4Z2TA 5TR3A 2XLTA 3L8KA 1FCDA 4M52A 4BV6A 3OZ2A 2JB3A 1TDNA 2Y6QA 1O95A 1JRXA 3C4NA 3BHKA 3VR9A 3KD9A 4GR1A 4KX6A 2E5VA 2OALA 3UKAA 1CHUA 4YTMA 2C66A 2EQ7A 2C67A 4Z26A 2I0ZA 2OLOA 1NHPA 3UKKA 2H88A 2YG4A 4CNJA 3GMBA 2WU5A 2OA1A 3NH3X 1BGJA 2V61A 3CPIG 2JKCA 4U2SA 1PXBA 2ZBWA 3AEEA 4TM1A 1YY5A 1F8RA 5L46A 1GRGA 2YG6A 4AOSA 2R0GA 4Y4NA 3OC4A 2C3CA 2GQFA 1N4WA 1W4XA 5HXIA 5IQ4A 1PN0A 2BXSA 2YR6A 4A65A 3FPZA 4B1BA 4J2WA 2WOWA 3NGCX 5J60A 4EQXA 2XFQA 1GSNA 4Z2RA 2WDQA 2GV8A 3EAOA 2V3BA 1IUTA 1B37A 3SFEA 2R0PA 1BF3A 1ONFA 1DXLA 4X4JA 2WDRA 3KKJA 4DNAA 5M0ZA 2C73A 1JEHA 1JRYA 4UDPA 2QCUA 3DJEA 4EQSA 1LQTA 4B69A 4NEWA 3ICRA 4TLXA 4GDEA 3EANA 3LADA 3AE6A 3VRAA 2C7GA 1RP0A 4A5LA 2W0HA 3AXBA 2AR8A 1RSGA 3V3OA 3CPJG 1GTEA 1CC4A 3ISHA 2Z5YA 1AOGA 3QFAA 4OPDA 3NN6X 2OAMA 3AYLA 3DMEA 1B4VA 4HB9A 4J57A 4A7AA 5KOWA 1NG4A 2QA1A 4B67A 1PXCA 2YG3A 5ER0A 3UTEA 3K7QX 1XPQA 4U2TA 2VQBA 1BWCA 1S2YA 1EBDA 1N4VA 3P9UA 1K0IA 2CVJA 3ITJA 4J33A 3NRNA 4FK1C 1ZY8A 1PBDA 2BCGG 2WETA 4UP3A 1DNCA 4Z24A 3UP4A 1QLBA 3DH9A 1L0VA 2C64A 4PABA 1EL9A 1IUVA 1K0JA 1CJ2A 3AYJA 1D7LA 3FMWA 1GT8A 2BYBA 1H81A 3C4AA 5U1OA 2GR1A 2IIDA 5FS7A 3SFDA 4YTNA 2WHDA 4JY3A 1EL8A 1NAAA 4IA5A 3LB8A 3VRDB 3UOVA 4NZHA 1PHHA 4MJWA 3NYCA 4GRTA 1Q9IA 4I59A 1CC6A 3VQRA 3AD8B 3S5WA 1S3EA 1GOSA 3GD3A 3AE7A 2BS4A 1GPEA 3BNUA 5FS9A 1PS9A 1FL2A 3HZLA 3DJGX 1NPXA 1N4UA 3M0OA 2YLWA 4JY2A 1VG0A 4BK3A 2ARDA 4A6NB 3ALJA 5LV9A 1GEUA 2WBAA 3RP6A 4B66A 3QSMA 4H4VA 2XCGA 3GDNA 2O9ZA 3I3LA 2XFUA 3P4SA 4H2NA 2YLXA 4EQWA 3DK4A 4ZCCA 1ZK7A 2Q6UA 4H4PA 2GMHA 2HQMA 1Q1RA 1DOBA 4NTEA 2V60A 2DKHA 1PBFA 2R4EA 2BK5A 2WS3A 3PVCA 2RGOA 3D1CA 4TLZA 2RGJA 5GRTA 1IUXA 2V5ZA 4GF7A 4GDPA 3KVEA 4CCQA 4ECHA 4IVOB 5HY5A 3IWAA 3NK0X 3UKHA 2TMDA 3KU9A 1LPFA 1V59A 1VRQB 2GQWA 3AYIA 2X8CA 3H8LA 2C70A 2WP6A 4YKGA 2GAGB 5HYMA 4NTCA 2ACZA 3F8RA 3UTGA 1O94A 1O5WA 5FS8A 5IQ1A 3RP7A 1E1NA 1H7XA 2YWLA 1RYIA 1CF3A 1ZOYA 3Q9TA 1LVLA 5M10A 3CNPA 2WOIA 3UOZA 4HA6A 2XLPA 4K22A 4RSLA 3UCLA 1D4EA 1Y56B 4YXDA 2GAHB 2YM2A 2J3NA 2XYOA 3GWFA 3WE0A 3GDPA 1JNZA 1PJ5A 1D4CA 3B3RA 3V3NA 3KPFA 1E1KA 1SEZA 2UZZA 3AD9B 3UKQA 1F6MA 4Y4LA 2BACA 5BRTA 2WESA 2C65A 2C76A 3ALMA 3CGEA 4H2QA 3QJ4A 4AP3A 3NHOX 4H4UA 2Y6RA 1QJDA 4H2RA 3ADAB 1P2EA 1K0LA 2R46A 4DGKA 2BCPA 2XVEA 1NG3A 3QVRA 1ZMCA 1FEAA 4USRA 3QFBA 3AE3A 1TYTA 1L9DA 3GYIA 4U8PA 1XDIA 4JDRA 1COYA 2B9XA 2XFNA 4CBQA 1Y56A 3NYEA 3UKFA 3URHA 4H4TA 4DSGA 4OPIA 1OJ9A 3CIRA 4P9SA 3FBSA 2GMJA 2BK4A 3S61A 4EMWA 1DJNA 4OPLA 3AE8A 2XVFA 2XLRA 4B65A 1NEKA 1FECA 1BZLA 1UKVG 2BK3A 1M6IA 1JU2A 4LIIA 3C96A 1PJ6A 2Q0KA 3BI4A 4H7UA 5EB5A 2JAEA 3BI5A 1GESA 3QSSA 1IJHA 4J31A 2R0CA 1GRBA 3R9UA 3T37A 1E7PA 4K5RA 1X31B 1TDKA 1PXAA 4U8IA 1S3BA 4Z25A 1BGNA 5FS6A 3GD4A 4U8OA 3NG7X 2WP5A 1CJCA 3COXA 3ZYXA 3SM8A 4YSHA 1OJTA 3UOYA 2YR5A 4X9NA 4AT2A 3GSIA 2QAEA 3QVPA 4I58A 2BS2A 1K4QA 2YVJA 4XWRA 2R4JA 3BI2A 4BJYA 4BJZA 1HYUA 5U63A 2XLSA 5EBKA 4Z43A 3GWDA 2WOVA 1LTXR 1CBOA 2VVMA 4WX1A 4XWZA 3NTDA 3ICTA 4YWOA 4EQRA 5EOWA 1D5TA 1DODA 3NTAA 1VQWA 2E4GA 2Z5XA 3AEBA 3CGBA 3EPTA 5BULA 4UDQA 2JB1A 3LOVA 2WQYA 1IUSA 1L9EA 2GH5A 2PYXA 3FIMB 4K8DA 4B63A 4H4ZA 1XANA 3FG2P 4FX9A 4U8KA 2FJDA 2Q7VA 2V3AA 1H86A 4CRTA 2NVKX 3KLJA 1PBEA 1E1LA 1F8WA 4FDCB 4C74A 4JQ9A 3CPHG 3NT6A 5FMHA 5JCNA 1CJ3A 5IPYA 4APNA 3BHFA 2VOUA 3K30A 3AEDA 1ELIA 4OVIA 1H6VA 4O5UA 4XXGA 4B68A 1EL7A 3CNTA 4CCRA 3NLCA 3P4QA 4K7ZA 2CULA 3AE2A 3GYJA 2WPEA 2WPFA 4H4WA 1Z6LA 5JCIA 2YLZA 3K7TA 4A9WA 2X3NA 2C75A 3PS9A 4C3XA 1GREA 4C3YA 4GCMA 3BNMA 3UOXA 2VQ7A 2H89A 2YAUA 2B9YA 4ZN0A 4EIPA 2A8XA 3NN0X 4U8MA 4EMIA 3CGDA 4J34A 5J7XA 2RABA 3EF6A 1IUWA 4OPTA 3D8XA 4LA1A 4H50A 1ZOVA 1GNDA 2EQ9A 1ZDLA 1F8SA 1IUUA 2FJBA 3CTYA 4C5OA 3V76A 2RGHA 4YTPA 3P4RA 1F3PA 1GV4A 3AE1A 1TDFA 2TPRA 2CFYA 1S2QA 3VRBA 1NHSA 2VVLG 4TM3A 4U2LA 2QA2A 4D04A 2BC0A 1ZMDA 4K2XA 4NTDA 2XLUA 3NK2X 3AD7B 5KVIA
chains in the Genus database with same CATH superfamily
1YKJA 2ZZCA 3UP5A 3G5SA 2GVCA 3CN8A 5KMSA 1DOCA 3DA1A 1MO9A 4A99A 3F8PA 3AECA 2ZZ0A 2E1MA 2B9WA 3AEFA 3O0HA 4GUVA 4BK1A 1D4DA 4RG4A 2VRMA 4OPUA 4U8NA 3SQPA 4CY8A 2YG7A 5C3JA 1JOAA 4USQA 4AT0A 1GRFA 1KNRA 1VG9A 3AE4A 2X8GA 1L9CA 3GMCA 3ATRA 2WPCA 3UKLA 4A79A 4DSHA 4H4XA 1PBBA 4U8LA 3M13A 4EM3A 1GTHA 1TRBA 1GERA 4EM4A 2V6OA 4YSZA 2A87A 3LZWA 1FOHA 1H7WA 4EIQA 1B5QA 3G5RA 4IVMB 1E1MA 2R9ZA 1GRAA 4PAAA 1OJCA 4G74A 1H84A 4H4RA 1E6EA 5BVAA 1OJDA 2WP9A 4UDRA 3B6DA 3UTHA 2IVDA 3IF9A 2GRTA 1N1PA 1TDEA 4D03A 1XHCA 4H4SA 1NDAA 1Y0PA 1VDCA 2YG5A 4Z2UA 1KF6A 3Q6JA 2BS3A 1B8SA 5KVHA 2GR3A 3II4A 3GRTA 1NHQA 1PBCA 4NEVA 2VRLA 3AWIA 3LXDA 2JB2A 3AB1A 4JNQA 1M64A 4CY6A 1ZKQA 2GR0A 4FK1A 2YQUA 1DOEA 4YKFA 3I6DA 1KFYA 1OJAA 1DJQA 3F8DA 3NKSA 1ZX9A 2C3DA 3H4KA 3DGHA 4JNAA 1CL0A 1P2HA 3CNSA 1PJ7A 5GSNA 1KNPA 4BURA 2YLTA 3NYFA 1EL5A 1YQ4A 3PO7A 4NWZA 2PHHA 3ABVA 4O5QA 4U8JA 4Y4MA 4ZCDA 4YSYA 5KMPA 5KXJA 4EMJA 3NK1X 4K5SA 2B7SA 3RP8A 2X8HA 1KDGA 3M12A 4REKA 1JRZA 1KSUA 1H82A 1NHRA 4H4QA 5U25A 3G5QA 1ZP0A 2A89A 1MOKA 2X50A 2C72A 2X99A 2R45A 2YVGA 1JNRA 3SYIA 4AOXA 4J36A 2NPXA 4GAVA 1FEBA 3SZCA 3P1WA 4N9XA 3RNMA 2EQ6A 3NNEA 2XVHA 4KPRA 2B76A 2JBVA 4RG3A 4AP1A 4X9MA 2IVEA 5JCKA 1PDHA 1E39A 2BC1A 4C77A 3T2YA 5HHFA 1GRHA 1LV0A 3CGCA 3UTFA 4JN9A 3CNJA 3LJPA 5JCMA 2FJEA 3T31A 4BK2A 3IHMA 3NIXA 5DBJA 2VZ2A 2YLRA 2GF3A 2Q0LA 4ICYA 2YVFA 4ADWA 5KWFA 1QO8A 3DJJA 2YM1A 4II3A 4OPCA 3IC9A 1GRTA 2AQJA 2OLNA 2XVIA 3IHGA 1CC2A 3DGZA 2XDOA 3SZ0A 2B7RA 1NENA 2XVJA 4IV9A 2CDUA 1REOA 1YQZA 4OCGA 1GALA 1CJ4A 3QSEA 3VR8A 4B64A 1GETA 3DK8A 1GXFA 2WU2A 3DJDA 4G9KA 3E1TA 4H4YA 3L1RA 3AEGA 3AE9A 3ALLA 5KRQA 3KPKA 1KSSA 2FBWA 3AE5A 1LJ1A 1LQUA 3RHAA 5C2TA 2DKIA 5KOXA 2ZZBA 4Z44A 2YR4A 4IA6A 3H8IA 2F5ZA 3SGLA 3REDA 2WDVA 2FJAA 3ATQA 2BABA 4H2PA 4OPGA 4LU6A 3GRSA 3ICSA 5CQFA 2YLSA 2BA9A 3LZXA 2EQ8A 1YQ3A 2VVLA 4YSXA 2JK6A 2APGA 3K7MX 5BUKA 5JCLA 4YT0A 3KA7A 1TDOA 1H83A 5CKUA 4TM0A 3CNDA 4TM4A 5EB4A 4CNKA 1BKWA 3P4PA 3ZDNA 1Q1WA 3AEAA 3DK9A 2XFPA 2XFOA 2AAQA 2GR2A 2GEWA 2WEUA 1MXTA 4E0VA 1TYPA 4J56A 3JSKA 1D7YA 4NNJA 2GB0A 2BXRA 4WCTA 3UKPA 4A6NA 4Z2TA 5TR3A 2XLTA 3L8KA 1FCDA 4M52A 4BV6A 3OZ2A 2JB3A 1TDNA 2Y6QA 1O95A 1JRXA 3C4NA 3BHKA 3VR9A 3KD9A 4GR1A 4KX6A 2E5VA 2OALA 3UKAA 1CHUA 4YTMA 2C66A 2EQ7A 2BRYA 2C67A 4Z26A 2I0ZA 2OLOA 1NHPA 3UKKA 2H88A 2YG4A 4CNJA 3GMBA 2WU5A 2OA1A 3NH3X 1BGJA 2V61A 3CPIG 2JKCA 4U2SA 1PXBA 2ZBWA 3AEEA 4TM1A 3T14A 1YY5A 1F8RA 5L46A 1GRGA 2YG6A 4AOSA 2R0GA 4Y4NA 3OC4A 2C3CA 2GQFA 1N4WA 1W4XA 5HXIA 5IQ4A 1PN0A 2BRAA 2BXSA 2YR6A 4A65A 3FPZA 4B1BA 4J2WA 2WOWA 3NGCX 5J60A 4EQXA 2XFQA 1GSNA 4Z2RA 2WDQA 2GV8A 3EAOA 2V3BA 1IUTA 1B37A 3SFEA 2R0PA 1BF3A 1ONFA 3HYXA 1DXLA 4X4JA 2WDRA 3KKJA 4DNAA 5M0ZA 3CMMA 3SX6A 2C73A 1JEHA 1JRYA 4UDPA 2QCUA 3DJEA 4EQSA 1LQTA 4GAPA 4B69A 4NEWA 3ICRA 4TLXA 4GDEA 3EANA 3LADA 3AE6A 3VRAA 2C7GA 1RP0A 4A5LA 2W0HA 3AXBA 2AR8A 1RSGA 3V3OA 3CPJG 5KNLA 1GTEA 1CC4A 3ISHA 2Z5YA 1AOGA 3QFAA 4OPDA 3NN6X 2OAMA 3AYLA 3DMEA 1B4VA 4HB9A 4J57A 4A7AA 5KOWA 1NG4A 2QA1A 4B67A 1PXCA 2YG3A 5ER0A 3T2KA 3UTEA 3K7QX 3SZFA 1XPQA 4U2TA 2VQBA 1BWCA 1S2YA 1EBDA 1N4VA 3P9UA 1K0IA 2CVJA 3ITJA 3HYVA 4J33A 3NRNA 4FK1C 1ZY8A 1PBDA 2BCGG 2WETA 4UP3A 1DNCA 4Z24A 3UP4A 1QLBA 3DH9A 1L0VA 2C64A 4PABA 1EL9A 1IUVA 1K0JA 1CJ2A 3AYJA 1D7LA 5KMRA 3FMWA 1GT8A 2BYBA 1H81A 3C4AA 5U1OA 2GR1A 2IIDA 5FS7A 3SFDA 4YTNA 2WHDA 4JY3A 1EL8A 1NAAA 4IA5A 3LB8A 3VRDB 3UOVA 4NZHA 1PHHA 4MJWA 3NYCA 4GRTA 1Q9IA 4I59A 1CC6A 3VQRA 3AD8B 3S5WA 1S3EA 1GOSA 3GD3A 3SZWA 3T2ZA 3AE7A 2BS4A 1GPEA 3BNUA 5FS9A 1PS9A 1FL2A 3GYXA 3HZLA 3DJGX 1NPXA 1N4UA 3M0OA 2YLWA 4JY2A 1VG0A 4BK3A 2ARDA 4A6NB 3ALJA 5LV9A 1GEUA 3SY4A 2WBAA 3RP6A 4B66A 3QSMA 4H4VA 2XCGA 3GDNA 2O9ZA 3I3LA 2XFUA 3P4SA 4H2NA 2YLXA 4EQWA 3DK4A 4ZCCA 1ZK7A 2Q6UA 4H4PA 2GMHA 2HQMA 1Q1RA 1DOBA 4NTEA 2V60A 2DKHA 1PBFA 2R4EA 2BK5A 2WS3A 3PVCA 2RGOA 4II2A 3D1CA 4TLZA 2RGJA 5GRTA 1IUXA 2V5ZA 4GF7A 4GDPA 3KVEA 4CCQA 4ECHA 4IVOB 5HY5A 3IWAA 3NK0X 3UKHA 2TMDA 3KU9A 1LPFA 1V59A 1VRQB 2GQWA 3AYIA 2X8CA 3H8LA 2C70A 2WP6A 4YKGA 2GAGB 5HYMA 4NTCA 2ACZA 3F8RA 3UTGA 1O94A 1O5WA 5FS8A 5IQ1A 3RP7A 1E1NA 1H7XA 2YWLA 1RYIA 1CF3A 1ZOYA 3Q9TA 1LVLA 5M10A 3CNPA 2WOIA 3UOZA 4HA6A 2XLPA 4K22A 4RSLA 3UCLA 1D4EA 1Y56B 4YXDA 2GAHB 2YM2A 2J3NA 2XYOA 3GWFA 3WE0A 3HYWA 3GDPA 1JNZA 1PJ5A 1D4CA 3B3RA 3V3NA 3KPFA 1E1KA 1SEZA 2UZZA 3AD9B 3UKQA 1F6MA 4Y4LA 2BACA 5BRTA 2WESA 2C65A 2C76A 3ALMA 3CGEA 4H2QA 3QJ4A 4G73A 4AP3A 3NHOX 4H4UA 2Y6RA 1QJDA 4H2RA 3ADAB 1P2EA 1K0LA 2R46A 4DGKA 2BCPA 2XVEA 1NG3A 3QVRA 1ZMCA 1FEAA 4USRA 3QFBA 3AE3A 1TYTA 1L9DA 3GYIA 4U8PA 1XDIA 4JDRA 1COYA 2B9XA 2XFNA 4CBQA 1Y56A 3NYEA 3UKFA 3URHA 4H4TA 4DSGA 4OPIA 1OJ9A 3CIRA 4P9SA 3FBSA 2GMJA 2BK4A 3S61A 4EMWA 1DJNA 4OPLA 3AE8A 2XVFA 2XLRA 4B65A 1NEKA 1FECA 1BZLA 1UKVG 2BK3A 1M6IA 1JU2A 4LIIA 3C96A 1PJ6A 2Q0KA 2C4CA 3BI4A 4H7UA 5EB5A 2JAEA 3BI5A 1GESA 3QSSA 1IJHA 4J31A 2R0CA 1GRBA 3R9UA 3T37A 1E7PA 4K5RA 1X31B 1TDKA 1PXAA 4U8IA 1S3BA 4Z25A 1BGNA 5FS6A 3GD4A 4U8OA 3NG7X 2WP5A 1CJCA 3COXA 3ZYXA 3SM8A 4YSHA 1OJTA 3UOYA 2YR5A 4X9NA 4AT2A 3GSIA 2QAEA 3QVPA 4I58A 2BS2A 1K4QA 2YVJA 4XWRA 2R4JA 3BI2A 4BJYA 4BJZA 1HYUA 5U63A 2XLSA 5KMQA 5EBKA 4Z43A 3GWDA 2WOVA 1LTXR 1CBOA 2VVMA 4WX1A 4XWZA 3NTDA 3ICTA 4YWOA 4EQRA 5EOWA 1D5TA 1DODA 3NTAA 1VQWA 2E4GA 2Z5XA 3AEBA 3CGBA 3EPTA 5BULA 4UDQA 2JB1A 3LOVA 2WQYA 1IUSA 1L9EA 2GH5A 2PYXA 3FIMB 4K8DA 4B63A 4H4ZA 1XANA 3FG2P 4FX9A 4U8KA 2FJDA 2Q7VA 2V3AA 3SXIA 1H86A 4CRTA 2NVKX 3KLJA 1PBEA 1E1LA 1F8WA 4FDCB 4C74A 4JQ9A 3CPHG 3NT6A 5FMHA 5JCNA 1CJ3A 5IPYA 4APNA 3BHFA 2VOUA 3K30A 3AEDA 1ELIA 4OVIA 1H6VA 4O5UA 4XXGA 4B68A 1EL7A 3CNTA 4CCRA 3NLCA 3P4QA 4K7ZA 2CULA 3AE2A 3GYJA 2WPEA 2WPFA 4H4WA 1Z6LA 3T0KA 5JCIA 2YLZA 4G6GA 3K7TA 4A9WA 2X3NA 2C75A 4G6HA 3PS9A 4C3XA 1GREA 4C3YA 4GCMA 3BNMA 3UOXA 2VQ7A 2H89A 2YAUA 2B9YA 4ZN0A 4EIPA 2A8XA 3NN0X 4U8MA 4EMIA 3CGDA 4J34A 5J7XA 2RABA 3EF6A 1IUWA 4OPTA 3D8XA 4LA1A 4H50A 1ZOVA 1GNDA 2EQ9A 1ZDLA 1F8SA 1IUUA 2FJBA 3CTYA 4C5OA 3V76A 2RGHA 4YTPA 3P4RA 1F3PA 1GV4A 3AE1A 1TDFA 2TPRA 2CFYA 1S2QA 3VRBA 1NHSA 2VVLG 4TM3A 4U2LA 2QA2A 4D04A 2BC0A 1ZMDA 4K2XA 4NTDA 2XLUA 3NK2X 3AD7B 5KVIA
chains in the Genus database with same CATH topology
1YKJA 2ZZCA 3UP5A 3G5SA 2GVCA 3CN8A 5KMSA 1DOCA 3DA1A 1MO9A 4A99A 3F8PA 3AECA 2ZZ0A 2E1MA 2B9WA 3AEFA 3O0HA 4GUVA 4BK1A 1D4DA 4RG4A 2VRMA 4OPUA 4U8NA 3SQPA 4CY8A 2YG7A 5C3JA 1JOAA 4USQA 4AT0A 1GRFA 1KNRA 1VG9A 3AE4A 2X8GA 1L9CA 3GMCA 3ATRA 2WPCA 3UKLA 4A79A 4DSHA 4H4XA 1PBBA 4U8LA 3M13A 4EM3A 1GTHA 1TRBA 1GERA 4EM4A 2V6OA 4YSZA 2A87A 3LZWA 1FOHA 1H7WA 4EIQA 1B5QA 3G5RA 4IVMB 1E1MA 2R9ZA 1GRAA 4PAAA 1OJCA 4G74A 1H84A 4H4RA 1E6EA 5BVAA 1OJDA 2WP9A 4UDRA 3B6DA 3UTHA 2IVDA 3IF9A 2GRTA 1N1PA 1TDEA 4D03A 1XHCA 4H4SA 1NDAA 1Y0PA 1VDCA 2YG5A 4Z2UA 1KF6A 3Q6JA 2BS3A 1B8SA 5KVHA 2GR3A 3II4A 3GRTA 1NHQA 1PBCA 4NEVA 2VRLA 3AWIA 3LXDA 2JB2A 3AB1A 4JNQA 1M64A 4CY6A 1ZKQA 2GR0A 4FK1A 2YQUA 1DOEA 4YKFA 3I6DA 1KFYA 1OJAA 1DJQA 3F8DA 3NKSA 1ZX9A 2C3DA 3H4KA 3DGHA 4JNAA 1CL0A 1P2HA 3CNSA 1PJ7A 5GSNA 1KNPA 4BURA 2YLTA 3NYFA 1EL5A 1YQ4A 3PO7A 4NWZA 2PHHA 3ABVA 4O5QA 4U8JA 4Y4MA 4ZCDA 4YSYA 5KMPA 5KXJA 4EMJA 3NK1X 4K5SA 2B7SA 3RP8A 2X8HA 1KDGA 3M12A 4REKA 1JRZA 1KSUA 1H82A 1NHRA 4H4QA 5U25A 3G5QA 1ZP0A 2A89A 1MOKA 2X50A 2C72A 2X99A 2R45A 2YVGA 1JNRA 3SYIA 4AOXA 4J36A 2NPXA 4GAVA 1FEBA 3SZCA 3P1WA 4N9XA 3RNMA 2EQ6A 3NNEA 2XVHA 4KPRA 2B76A 2JBVA 4RG3A 4AP1A 4X9MA 2IVEA 5JCKA 1PDHA 1E39A 2BC1A 4C77A 3T2YA 5HHFA 1GRHA 1LV0A 3CGCA 3UTFA 4JN9A 3CNJA 3LJPA 5JCMA 2FJEA 3T31A 4BK2A 3IHMA 3NIXA 5DBJA 2VZ2A 2YLRA 2GF3A 2Q0LA 4ICYA 2YVFA 4ADWA 5KWFA 1QO8A 3DJJA 2YM1A 4II3A 4OPCA 3IC9A 1GRTA 2AQJA 2OLNA 2XVIA 3IHGA 1CC2A 3DGZA 2XDOA 3SZ0A 2B7RA 1NENA 2XVJA 4IV9A 2CDUA 1REOA 1YQZA 4OCGA 1GALA 1CJ4A 3QSEA 3VR8A 4B64A 1GETA 3DK8A 1GXFA 2WU2A 3DJDA 4G9KA 3E1TA 4H4YA 3L1RA 3AEGA 3AE9A 3ALLA 5KRQA 3KPKA 1KSSA 2FBWA 3AE5A 1LJ1A 1LQUA 3RHAA 5C2TA 2DKIA 5KOXA 2ZZBA 4Z44A 2YR4A 4IA6A 3H8IA 2F5ZA 3SGLA 3REDA 2WDVA 2FJAA 3ATQA 2BABA 4H2PA 4OPGA 4LU6A 3GRSA 3ICSA 5CQFA 2YLSA 2BA9A 3LZXA 2EQ8A 1YQ3A 2VVLA 4YSXA 2JK6A 2APGA 3K7MX 5BUKA 5JCLA 4YT0A 3KA7A 1TDOA 1H83A 5CKUA 4TM0A 3CNDA 4TM4A 5EB4A 4CNKA 1BKWA 3P4PA 3ZDNA 1Q1WA 3AEAA 3DK9A 2XFPA 2XFOA 2AAQA 2GR2A 2GEWA 2WEUA 1MXTA 4E0VA 1TYPA 4J56A 3JSKA 1D7YA 4NNJA 2GB0A 2BXRA 4WCTA 3UKPA 4A6NA 4Z2TA 5TR3A 2XLTA 3L8KA 1FCDA 4M52A 4BV6A 3OZ2A 2JB3A 1TDNA 2Y6QA 1O95A 1JRXA 3C4NA 3BHKA 3VR9A 3KD9A 4GR1A 4KX6A 2E5VA 2OALA 3UKAA 1CHUA 4YTMA 2C66A 2EQ7A 2BRYA 2C67A 4Z26A 2I0ZA 2OLOA 1NHPA 3UKKA 2H88A 2YG4A 4CNJA 3GMBA 2WU5A 2OA1A 3NH3X 1BGJA 2V61A 3CPIG 2JKCA 4U2SA 1PXBA 2ZBWA 3AEEA 4TM1A 3T14A 1YY5A 1F8RA 5L46A 1GRGA 2YG6A 4AOSA 2R0GA 4Y4NA 3OC4A 2C3CA 2GQFA 1N4WA 1W4XA 5HXIA 5IQ4A 1PN0A 2BRAA 2BXSA 2YR6A 4A65A 3FPZA 4B1BA 4J2WA 2WOWA 3NGCX 5J60A 4EQXA 2XFQA 1GSNA 4Z2RA 2WDQA 2GV8A 3EAOA 2V3BA 1IUTA 1B37A 3SFEA 2R0PA 1BF3A 1ONFA 3HYXA 1DXLA 4X4JA 2WDRA 3KKJA 4DNAA 5M0ZA 3CMMA 3SX6A 2C73A 1JEHA 1JRYA 4UDPA 2QCUA 3DJEA 4EQSA 1LQTA 4GAPA 4B69A 4NEWA 3ICRA 4TLXA 4GDEA 3EANA 3LADA 3AE6A 3VRAA 2C7GA 1RP0A 4A5LA 2W0HA 3AXBA 2AR8A 1RSGA 3V3OA 3CPJG 5KNLA 1GTEA 1CC4A 3ISHA 2Z5YA 1AOGA 3QFAA 4OPDA 3NN6X 2OAMA 3AYLA 3DMEA 1B4VA 4HB9A 4J57A 4A7AA 5KOWA 1NG4A 2QA1A 4B67A 1PXCA 2YG3A 5ER0A 3T2KA 3UTEA 3K7QX 3SZFA 1XPQA 4U2TA 2VQBA 1BWCA 1S2YA 1EBDA 1N4VA 3P9UA 1K0IA 2CVJA 3ITJA 3HYVA 4J33A 3NRNA 4FK1C 1ZY8A 1PBDA 2BCGG 2WETA 4UP3A 1DNCA 4Z24A 3UP4A 1QLBA 3DH9A 1L0VA 2C64A 4PABA 1EL9A 1IUVA 1K0JA 1CJ2A 3AYJA 1D7LA 5KMRA 3FMWA 1GT8A 2BYBA 1H81A 3C4AA 5U1OA 2GR1A 2IIDA 5FS7A 3SFDA 4YTNA 2WHDA 4JY3A 1EL8A 1NAAA 4IA5A 3LB8A 3VRDB 3UOVA 4NZHA 1PHHA 4MJWA 3NYCA 4GRTA 1Q9IA 4I59A 1CC6A 3VQRA 3AD8B 3S5WA 1S3EA 1GOSA 3GD3A 3SZWA 3T2ZA 3AE7A 2BS4A 1GPEA 3BNUA 5FS9A 1PS9A 1FL2A 3GYXA 3HZLA 3DJGX 1NPXA 1N4UA 3M0OA 2YLWA 4JY2A 1VG0A 4BK3A 2ARDA 4A6NB 3ALJA 5LV9A 1GEUA 3SY4A 2WBAA 3RP6A 4B66A 3QSMA 4H4VA 2XCGA 3GDNA 2O9ZA 3I3LA 2XFUA 3P4SA 4H2NA 2YLXA 4EQWA 3DK4A 4ZCCA 1ZK7A 2Q6UA 4H4PA 2GMHA 2HQMA 1Q1RA 1DOBA 4NTEA 2V60A 2DKHA 1PBFA 2R4EA 2BK5A 2WS3A 3PVCA 2RGOA 4II2A 3D1CA 4TLZA 2RGJA 5GRTA 1IUXA 2V5ZA 4GF7A 4GDPA 3KVEA 4CCQA 4ECHA 4IVOB 5HY5A 3IWAA 3NK0X 3UKHA 2TMDA 3KU9A 1LPFA 1V59A 1VRQB 2GQWA 3AYIA 2X8CA 3H8LA 2C70A 2WP6A 4YKGA 2GAGB 5HYMA 4NTCA 2ACZA 3F8RA 3UTGA 1O94A 1O5WA 5FS8A 5IQ1A 3RP7A 1E1NA 1H7XA 2YWLA 1RYIA 1CF3A 1ZOYA 3Q9TA 1LVLA 5M10A 3CNPA 2WOIA 3UOZA 4HA6A 2XLPA 4K22A 4RSLA 3UCLA 1D4EA 1Y56B 4YXDA 2GAHB 2YM2A 2J3NA 2XYOA 3GWFA 3WE0A 3HYWA 3GDPA 1JNZA 1PJ5A 1D4CA 3B3RA 3V3NA 3KPFA 1E1KA 1SEZA 2UZZA 3AD9B 3UKQA 1F6MA 4Y4LA 2BACA 5BRTA 2WESA 2C65A 2C76A 3ALMA 3CGEA 4H2QA 3QJ4A 4G73A 4AP3A 3NHOX 4H4UA 2Y6RA 1QJDA 4H2RA 3ADAB 1P2EA 1K0LA 2R46A 4DGKA 2BCPA 2XVEA 1NG3A 3QVRA 1ZMCA 1FEAA 4USRA 3QFBA 3AE3A 1TYTA 1L9DA 3GYIA 4U8PA 1XDIA 4JDRA 1COYA 2B9XA 2XFNA 4CBQA 1Y56A 3NYEA 3UKFA 3URHA 4H4TA 4DSGA 4OPIA 1OJ9A 3CIRA 4P9SA 3FBSA 2GMJA 2BK4A 3S61A 4EMWA 1DJNA 4OPLA 3AE8A 2XVFA 2XLRA 4B65A 1NEKA 1FECA 1BZLA 1UKVG 2BK3A 1M6IA 1JU2A 4LIIA 3C96A 1PJ6A 2Q0KA 2C4CA 3BI4A 4H7UA 5EB5A 2JAEA 3BI5A 1GESA 3QSSA 1IJHA 4J31A 2R0CA 1GRBA 3R9UA 3T37A 1E7PA 4K5RA 1X31B 1TDKA 1PXAA 4U8IA 1S3BA 4Z25A 1BGNA 5FS6A 3GD4A 4U8OA 3NG7X 2WP5A 1CJCA 3COXA 3ZYXA 3SM8A 4YSHA 1OJTA 3UOYA 2YR5A 4X9NA 4AT2A 3GSIA 2QAEA 3QVPA 4I58A 2BS2A 1K4QA 2YVJA 4XWRA 2R4JA 3BI2A 4BJYA 4BJZA 1HYUA 5U63A 2XLSA 5KMQA 5EBKA 4Z43A 3GWDA 2WOVA 1LTXR 1CBOA 2VVMA 4WX1A 4XWZA 3NTDA 3ICTA 4YWOA 4EQRA 5EOWA 1D5TA 1DODA 3NTAA 1VQWA 2E4GA 2Z5XA 3AEBA 3CGBA 3EPTA 5BULA 4UDQA 2JB1A 3LOVA 2WQYA 1IUSA 1L9EA 2GH5A 2PYXA 3FIMB 4K8DA 4B63A 4H4ZA 1XANA 3FG2P 4FX9A 4U8KA 2FJDA 2Q7VA 2V3AA 3SXIA 1H86A 4CRTA 2NVKX 3KLJA 1PBEA 1E1LA 1F8WA 4FDCB 4C74A 4JQ9A 3CPHG 3NT6A 5FMHA 5JCNA 1CJ3A 5IPYA 4APNA 3BHFA 2VOUA 3K30A 3AEDA 1ELIA 4OVIA 1H6VA 4O5UA 4XXGA 4B68A 1EL7A 3CNTA 4CCRA 3NLCA 3P4QA 4K7ZA 2CULA 3AE2A 3GYJA 2WPEA 2WPFA 4H4WA 1Z6LA 3T0KA 5JCIA 2YLZA 4G6GA 3K7TA 4A9WA 2X3NA 2C75A 4G6HA 3PS9A 4C3XA 1GREA 4C3YA 4GCMA 3BNMA 3UOXA 2VQ7A 2H89A 2YAUA 2B9YA 4ZN0A 4EIPA 2A8XA 3NN0X 4U8MA 4EMIA 3CGDA 4J34A 5J7XA 2RABA 3EF6A 1IUWA 4OPTA 3D8XA 4LA1A 4H50A 1ZOVA 1GNDA 2EQ9A 1ZDLA 1F8SA 1IUUA 2FJBA 3CTYA 4C5OA 3V76A 2RGHA 4YTPA 3P4RA 1F3PA 1GV4A 3AE1A 1TDFA 2TPRA 2CFYA 1S2QA 3VRBA 1NHSA 2VVLG 4TM3A 4U2LA 2QA2A 4D04A 2BC0A 1ZMDA 4K2XA 4NTDA 2XLUA 3NK2X 3AD7B 5KVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YKJ A;  2ZZC A;  3UP5 A;  3G5S A;  2GVC A;  3CN8 A;  1DOC A;  3DA1 A;  1MO9 A;  4A99 A;  3F8P A;  3AEC A;  2ZZ0 A;  2E1M A;  2B9W A;  3AEF A;  3O0H A;  4GUV A;  4BK1 A;  1D4D A;  4RG4 A;  2VRM A;  4OPU A;  4U8N A;  3SQP A;  4CY8 A;  2YG7 A;  5C3J A;  1JOA A;  4USQ A;  4AT0 A;  1GRF A;  1KNR A;  1VG9 A;  3AE4 A;  2X8G A;  1L9C A;  3GMC A;  3ATR A;  2WPC A;  3UKL A;  4A79 A;  4DSH A;  4H4X A;  1PBB A;  4U8L A;  3M13 A;  4EM3 A;  1GTH A;  1TRB A;  1GER A;  4EM4 A;  2V6O A;  4YSZ A;  2A87 A;  3LZW A;  1FOH A;  1H7W A;  4EIQ A;  1B5Q A;  3G5R A;  4IVM B;  1E1M A;  2R9Z A;  1GRA A;  4PAA A;  1OJC A;  1H84 A;  4H4R A;  1E6E A;  5BVA A;  1OJD A;  2WP9 A;  4UDR A;  3B6D A;  3UTH A;  2IVD A;  3IF9 A;  2GRT A;  1N1P A;  1TDE A;  4D03 A;  1XHC A;  4H4S A;  1NDA A;  1Y0P A;  1VDC A;  2YG5 A;  4Z2U A;  1KF6 A;  3Q6J A;  2BS3 A;  1B8S A;  5KVH A;  2GR3 A;  3II4 A;  3GRT A;  1NHQ A;  1PBC A;  4NEV A;  2VRL A;  3AWI A;  3LXD A;  2JB2 A;  3AB1 A;  4JNQ A;  1M64 A;  4CY6 A;  1ZKQ A;  2GR0 A;  4FK1 A;  2YQU A;  1DOE A;  4YKF A;  3I6D A;  1KFY A;  1OJA A;  1DJQ A;  3F8D A;  3NKS A;  1ZX9 A;  2C3D A;  3H4K A;  3DGH A;  4JNA A;  1CL0 A;  1P2H A;  3CNS A;  1PJ7 A;  5GSN A;  1KNP A;  4BUR A;  2YLT A;  3NYF A;  1EL5 A;  1YQ4 A;  3PO7 A;  4U8J A;  2PHH A;  3ABV A;  4O5Q A;  4Y4M A;  4ZCD A;  4YSY A;  5KXJ A;  4EMJ A;  3NK1 X;  4K5S A;  2B7S A;  3RP8 A;  2X8H A;  1KDG A;  3M12 A;  4REK A;  1JRZ A;  1KSU A;  1H82 A;  1NHR A;  4H4Q A;  5U25 A;  3G5Q A;  1ZP0 A;  2A89 A;  1MOK A;  2X50 A;  2C72 A;  2X99 A;  2R45 A;  2YVG A;  1JNR A;  4AOX A;  4J36 A;  2NPX A;  1FEB A;  3P1W A;  4N9X A;  3RNM A;  2EQ6 A;  3NNE A;  2XVH A;  4KPR A;  2B76 A;  2JBV A;  4RG3 A;  4AP1 A;  4X9M A;  2IVE A;  5JCK A;  1PDH A;  1E39 A;  2BC1 A;  4C77 A;  5HHF A;  1GRH A;  1LV0 A;  3CGC A;  3UTF A;  4JN9 A;  3CNJ A;  3LJP A;  5JCM A;  2FJE A;  4BK2 A;  3IHM A;  3NIX A;  5DBJ A;  2VZ2 A;  2YLR A;  2GF3 A;  2Q0L A;  4ICY A;  2YVF A;  4ADW A;  5KWF A;  1QO8 A;  3DJJ A;  2YM1 A;  4OPC A;  3IC9 A;  1GRT A;  2AQJ A;  2OLN A;  2XVI A;  3IHG A;  1CC2 A;  3DGZ A;  2XDO A;  2B7R A;  1NEN A;  2XVJ A;  4IV9 A;  2CDU A;  1REO A;  1YQZ A;  4OCG A;  1GAL A;  1CJ4 A;  3QSE A;  3VR8 A;  4B64 A;  1GET A;  3DK8 A;  1GXF A;  2WU2 A;  3DJD A;  3E1T A;  4H4Y A;  3L1R A;  3AEG A;  3AE9 A;  3ALL A;  5KRQ A;  1KSS A;  2FBW A;  3AE5 A;  1LJ1 A;  1LQU A;  3RHA A;  5C2T A;  2DKI A;  5KOX A;  2ZZB A;  4Z44 A;  2YR4 A;  4IA6 A;  3H8I A;  2F5Z A;  3SGL A;  3RED A;  2WDV A;  2FJA A;  3ATQ A;  2BAB A;  4H2P A;  4OPG A;  4LU6 A;  3GRS A;  3ICS A;  5CQF A;  2YLS A;  2BA9 A;  3LZX A;  2EQ8 A;  1YQ3 A;  2VVL A;  4YSX A;  2JK6 A;  2APG A;  3K7M X;  5BUK A;  5JCL A;  4YT0 A;  3KA7 A;  1TDO A;  1H83 A;  5CKU A;  4TM0 A;  3CND A;  4TM4 A;  5EB4 A;  4CNK A;  1BKW A;  3P4P A;  3ZDN A;  1Q1W A;  3AEA A;  3DK9 A;  2XFP A;  2XFO A;  2AAQ A;  2GR2 A;  2GEW A;  2WEU A;  1MXT A;  4E0V A;  1TYP A;  4J56 A;  3JSK A;  1D7Y A;  2GB0 A;  2BXR A;  4WCT A;  3UKP A;  4A6N A;  4Z2T A;  5TR3 A;  2XLT A;  3L8K A;  1FCD A;  4M52 A;  4BV6 A;  3OZ2 A;  2JB3 A;  1TDN A;  2Y6Q A;  1O95 A;  1JRX A;  3C4N A;  3BHK A;  3VR9 A;  3KD9 A;  4GR1 A;  4KX6 A;  2E5V A;  2OAL A;  3UKA A;  1CHU A;  4YTM A;  2C66 A;  2EQ7 A;  2C67 A;  4Z26 A;  2I0Z A;  2OLO A;  1NHP A;  3UKK A;  2H88 A;  2YG4 A;  4CNJ A;  3GMB A;  2WU5 A;  2OA1 A;  3NH3 X;  1BGJ A;  2V61 A;  3CPI G;  2JKC A;  4U2S A;  1PXB A;  2ZBW A;  3AEE A;  4TM1 A;  1YY5 A;  1F8R A;  5L46 A;  1GRG A;  2YG6 A;  4AOS A;  2R0G A;  4Y4N A;  3OC4 A;  2C3C A;  2GQF A;  1N4W A;  1W4X A;  5HXI A;  5IQ4 A;  1PN0 A;  2BXS A;  2YR6 A;  4A65 A;  3FPZ A;  4B1B A;  4J2W A;  2WOW A;  3NGC X;  5J60 A;  4EQX A;  2XFQ A;  1GSN A;  4Z2R A;  2WDQ A;  2GV8 A;  3EAO A;  2V3B A;  1IUT A;  1B37 A;  3SFE A;  2R0P A;  1BF3 A;  1ONF A;  1DXL A;  4X4J A;  2WDR A;  3KKJ A;  4DNA A;  5M0Z A;  2C73 A;  1JEH A;  1JRY A;  4UDP A;  2QCU A;  3DJE A;  4EQS A;  1LQT A;  4B69 A;  4NEW A;  3ICR A;  4TLX A;  4GDE A;  3EAN A;  3LAD A;  3AE6 A;  3VRA A;  2C7G A;  1RP0 A;  4A5L A;  2W0H A;  3AXB A;  2AR8 A;  1RSG A;  3V3O A;  3CPJ G;  1GTE A;  1CC4 A;  3ISH A;  2Z5Y A;  1AOG A;  3QFA A;  4OPD A;  3NN6 X;  2OAM A;  3AYL A;  3DME A;  1B4V A;  4HB9 A;  4J57 A;  4A7A A;  5KOW A;  1NG4 A;  2QA1 A;  4B67 A;  1PXC A;  2YG3 A;  5ER0 A;  3UTE A;  3K7Q X;  1XPQ A;  4U2T A;  2VQB A;  1BWC A;  1S2Y A;  1EBD A;  1N4V A;  3P9U A;  1K0I A;  2CVJ A;  3ITJ A;  4J33 A;  3NRN A;  4FK1 C;  1ZY8 A;  1PBD A;  2BCG G;  2WET A;  4UP3 A;  1DNC A;  4Z24 A;  3UP4 A;  1QLB A;  3DH9 A;  1L0V A;  2C64 A;  4PAB A;  1EL9 A;  1IUV A;  1K0J A;  1CJ2 A;  3AYJ A;  1D7L A;  3FMW A;  1GT8 A;  2BYB A;  1H81 A;  3C4A A;  5U1O A;  2GR1 A;  2IID A;  5FS7 A;  3SFD A;  4YTN A;  2WHD A;  4JY3 A;  1EL8 A;  1NAA A;  4IA5 A;  3LB8 A;  3VRD B;  3UOV A;  4NZH A;  1PHH A;  4MJW A;  3NYC A;  4GRT A;  1Q9I A;  4I59 A;  1CC6 A;  3VQR A;  3AD8 B;  3S5W A;  1S3E A;  1GOS A;  3GD3 A;  3AE7 A;  2BS4 A;  1GPE A;  3BNU A;  5FS9 A;  1PS9 A;  1FL2 A;  3HZL A;  3DJG X;  1NPX A;  1N4U A;  3M0O A;  2YLW A;  4JY2 A;  1VG0 A;  4BK3 A;  2ARD A;  4A6N B;  3ALJ A;  5LV9 A;  1GEU A;  2WBA A;  3RP6 A;  4B66 A;  3QSM A;  4H4V A;  2XCG A;  3GDN A;  2O9Z A;  3I3L A;  2XFU A;  3P4S A;  4H2N A;  2YLX A;  4EQW A;  3DK4 A;  4ZCC A;  1ZK7 A;  2Q6U A;  4H4P A;  2GMH A;  2HQM A;  1Q1R A;  1DOB A;  4NTE A;  2V60 A;  2DKH A;  1PBF A;  2R4E A;  2BK5 A;  2WS3 A;  3PVC A;  2RGO A;  3D1C A;  4TLZ A;  2RGJ A;  5GRT A;  1IUX A;  2V5Z A;  4GF7 A;  4GDP A;  3KVE A;  4CCQ A;  4ECH A;  4IVO B;  5HY5 A;  3IWA A;  3NK0 X;  3UKH A;  2TMD A;  3KU9 A;  1LPF A;  1V59 A;  1VRQ B;  2GQW A;  3AYI A;  2X8C A;  3H8L A;  2C70 A;  2WP6 A;  4YKG A;  2GAG B;  5HYM A;  4NTC A;  2ACZ A;  3F8R A;  3UTG A;  1O94 A;  1O5W A;  5FS8 A;  5IQ1 A;  3RP7 A;  1E1N A;  1H7X A;  2YWL A;  1RYI A;  1CF3 A;  1ZOY A;  3Q9T A;  1LVL A;  5M10 A;  3CNP A;  2WOI A;  3UOZ A;  4HA6 A;  2XLP A;  4K22 A;  4RSL A;  3UCL A;  1D4E A;  1Y56 B;  4YXD A;  2GAH B;  2YM2 A;  2J3N A;  2XYO A;  3GWF A;  3WE0 A;  3GDP A;  1JNZ A;  1PJ5 A;  1D4C A;  3B3R A;  3V3N A;  3KPF A;  1E1K A;  1SEZ A;  2UZZ A;  3AD9 B;  3UKQ A;  1F6M A;  4Y4L A;  2BAC A;  5BRT A;  2WES A;  2C65 A;  2C76 A;  3ALM A;  3CGE A;  4H2Q A;  3QJ4 A;  4AP3 A;  3NHO X;  4H4U A;  2Y6R A;  1QJD A;  4H2R A;  3ADA B;  1P2E A;  1K0L A;  2R46 A;  4DGK A;  2BCP A;  2XVE A;  1NG3 A;  3QVR A;  1ZMC A;  1FEA A;  4USR A;  3QFB A;  3AE3 A;  1TYT A;  1L9D A;  3GYI A;  4U8P A;  1XDI A;  4JDR A;  1COY A;  2B9X A;  2XFN A;  4CBQ A;  1Y56 A;  3NYE A;  3UKF A;  3URH A;  4H4T A;  4DSG A;  4OPI A;  1OJ9 A;  3CIR A;  4P9S A;  3FBS A;  2GMJ A;  2BK4 A;  3S61 A;  4EMW A;  1DJN A;  4OPL A;  3AE8 A;  2XVF A;  2XLR A;  4B65 A;  1NEK A;  1FEC A;  1BZL A;  1UKV G;  2BK3 A;  1M6I A;  1JU2 A;  4LII A;  3C96 A;  1PJ6 A;  2Q0K A;  3BI4 A;  4H7U A;  5EB5 A;  2JAE A;  3BI5 A;  1GES A;  3QSS A;  1IJH A;  4J31 A;  2R0C A;  1GRB A;  3R9U A;  3T37 A;  1E7P A;  4K5R A;  1X31 B;  1TDK A;  1PXA A;  4U8I A;  1S3B A;  4Z25 A;  1BGN A;  5FS6 A;  3GD4 A;  4U8O A;  3NG7 X;  2WP5 A;  1CJC A;  3COX A;  3ZYX A;  3SM8 A;  4YSH A;  1OJT A;  3UOY A;  2YR5 A;  4X9N A;  4AT2 A;  3GSI A;  2QAE A;  3QVP A;  4I58 A;  2BS2 A;  1K4Q A;  2YVJ A;  4XWR A;  2R4J A;  3BI2 A;  4BJY A;  4BJZ A;  1HYU A;  5U63 A;  2XLS A;  5EBK A;  4Z43 A;  3GWD A;  2WOV A;  1LTX R;  1CBO A;  2VVM A;  4WX1 A;  4XWZ A;  3NTD A;  3ICT A;  4YWO A;  4EQR A;  5EOW A;  1D5T A;  1DOD A;  3NTA A;  1VQW A;  2E4G A;  2Z5X A;  3AEB A;  3CGB A;  3EPT A;  5BUL A;  4UDQ A;  2JB1 A;  3LOV A;  2WQY A;  1IUS A;  1L9E A;  2GH5 A;  2PYX A;  3FIM B;  4K8D A;  4B63 A;  4H4Z A;  1XAN A;  3FG2 P;  4FX9 A;  4U8K A;  2FJD A;  2Q7V A;  2V3A A;  1H86 A;  4CRT A;  2NVK X;  3KLJ A;  1PBE A;  1E1L A;  1F8W A;  4FDC B;  4C74 A;  4JQ9 A;  3CPH G;  3NT6 A;  5FMH A;  5JCN A;  1CJ3 A;  5IPY A;  4APN A;  3BHF A;  2VOU A;  3K30 A;  3AED A;  1ELI A;  4OVI A;  1H6V A;  4O5U A;  4XXG A;  4B68 A;  1EL7 A;  3CNT A;  4CCR A;  3NLC A;  3P4Q A;  4K7Z A;  2CUL A;  3AE2 A;  3GYJ A;  2WPE A;  2WPF A;  4H4W A;  1Z6L A;  5JCI A;  2YLZ A;  3K7T A;  4A9W A;  2X3N A;  2C75 A;  3PS9 A;  4C3X A;  1GRE A;  4C3Y A;  4GCM A;  3BNM A;  3UOX A;  2VQ7 A;  2H89 A;  2YAU A;  2B9Y A;  4ZN0 A;  4EIP A;  2A8X A;  3NN0 X;  4U8M A;  4EMI A;  3CGD A;  4J34 A;  5J7X A;  2RAB A;  3EF6 A;  1IUW A;  4OPT A;  3D8X A;  4LA1 A;  4H50 A;  1ZOV A;  1GND A;  2EQ9 A;  1ZDL A;  1F8S A;  1IUU A;  2FJB A;  3CTY A;  4C5O A;  3V76 A;  2RGH A;  4YTP A;  3P4R A;  1F3P A;  1GV4 A;  3AE1 A;  1TDF A;  2TPR A;  2CFY A;  1S2Q A;  3VRB A;  1NHS A;  2VVL G;  4TM3 A;  4U2L A;  2QA2 A;  4D04 A;  2BC0 A;  1ZMD A;  4K2X A;  4NTD A;  2XLU A;  3NK2 X;  3AD7 B;  5KVI A; 
#chains in the Genus database with same CATH topology
 1YKJ A;  2ZZC A;  3UP5 A;  3G5S A;  2GVC A;  3CN8 A;  5KMS A;  1DOC A;  3DA1 A;  1MO9 A;  4A99 A;  3F8P A;  3AEC A;  2ZZ0 A;  2E1M A;  2B9W A;  3AEF A;  3O0H A;  4GUV A;  4BK1 A;  1D4D A;  4RG4 A;  2VRM A;  4OPU A;  4U8N A;  3SQP A;  4CY8 A;  2YG7 A;  5C3J A;  1JOA A;  4USQ A;  4AT0 A;  1GRF A;  1KNR A;  1VG9 A;  3AE4 A;  2X8G A;  1L9C A;  3GMC A;  3ATR A;  2WPC A;  3UKL A;  4A79 A;  4DSH A;  4H4X A;  1PBB A;  4U8L A;  3M13 A;  4EM3 A;  1GTH A;  1TRB A;  1GER A;  4EM4 A;  2V6O A;  4YSZ A;  2A87 A;  3LZW A;  1FOH A;  1H7W A;  4EIQ A;  1B5Q A;  3G5R A;  4IVM B;  1E1M A;  2R9Z A;  1GRA A;  4PAA A;  1OJC A;  4G74 A;  1H84 A;  4H4R A;  1E6E A;  5BVA A;  1OJD A;  2WP9 A;  4UDR A;  3B6D A;  3UTH A;  2IVD A;  3IF9 A;  2GRT A;  1N1P A;  1TDE A;  4D03 A;  1XHC A;  4H4S A;  1NDA A;  1Y0P A;  1VDC A;  2YG5 A;  4Z2U A;  1KF6 A;  3Q6J A;  2BS3 A;  1B8S A;  5KVH A;  2GR3 A;  3II4 A;  3GRT A;  1NHQ A;  1PBC A;  4NEV A;  2VRL A;  3AWI A;  3LXD A;  2JB2 A;  3AB1 A;  4JNQ A;  1M64 A;  4CY6 A;  1ZKQ A;  2GR0 A;  4FK1 A;  2YQU A;  1DOE A;  4YKF A;  3I6D A;  1KFY A;  1OJA A;  1DJQ A;  3F8D A;  3NKS A;  1ZX9 A;  2C3D A;  3H4K A;  3DGH A;  4JNA A;  1CL0 A;  1P2H A;  3CNS A;  1PJ7 A;  5GSN A;  1KNP A;  4BUR A;  2YLT A;  3NYF A;  1EL5 A;  1YQ4 A;  3PO7 A;  4NWZ A;  2PHH A;  3ABV A;  4O5Q A;  4U8J A;  4Y4M A;  4ZCD A;  4YSY A;  5KMP A;  5KXJ A;  4EMJ A;  3NK1 X;  4K5S A;  2B7S A;  3RP8 A;  2X8H A;  1KDG A;  3M12 A;  4REK A;  1JRZ A;  1KSU A;  1H82 A;  1NHR A;  4H4Q A;  5U25 A;  3G5Q A;  1ZP0 A;  2A89 A;  1MOK A;  2X50 A;  2C72 A;  2X99 A;  2R45 A;  2YVG A;  1JNR A;  3SYI A;  4AOX A;  4J36 A;  2NPX A;  4GAV A;  1FEB A;  3SZC A;  3P1W A;  4N9X A;  3RNM A;  2EQ6 A;  3NNE A;  2XVH A;  4KPR A;  2B76 A;  2JBV A;  4RG3 A;  4AP1 A;  4X9M A;  2IVE A;  5JCK A;  1PDH A;  1E39 A;  2BC1 A;  4C77 A;  3T2Y A;  5HHF A;  1GRH A;  1LV0 A;  3CGC A;  3UTF A;  4JN9 A;  3CNJ A;  3LJP A;  5JCM A;  2FJE A;  3T31 A;  4BK2 A;  3IHM A;  3NIX A;  5DBJ A;  2VZ2 A;  2YLR A;  2GF3 A;  2Q0L A;  4ICY A;  2YVF A;  4ADW A;  5KWF A;  1QO8 A;  3DJJ A;  2YM1 A;  4II3 A;  4OPC A;  3IC9 A;  1GRT A;  2AQJ A;  2OLN A;  2XVI A;  3IHG A;  1CC2 A;  3DGZ A;  2XDO A;  3SZ0 A;  2B7R A;  1NEN A;  2XVJ A;  4IV9 A;  2CDU A;  1REO A;  1YQZ A;  4OCG A;  1GAL A;  1CJ4 A;  3QSE A;  3VR8 A;  4B64 A;  1GET A;  3DK8 A;  1GXF A;  2WU2 A;  3DJD A;  4G9K A;  3E1T A;  4H4Y A;  3L1R A;  3AEG A;  3AE9 A;  3ALL A;  5KRQ A;  3KPK A;  1KSS A;  2FBW A;  3AE5 A;  1LJ1 A;  1LQU A;  3RHA A;  5C2T A;  2DKI A;  5KOX A;  2ZZB A;  4Z44 A;  2YR4 A;  4IA6 A;  3H8I A;  2F5Z A;  3SGL A;  3RED A;  2WDV A;  2FJA A;  3ATQ A;  2BAB A;  4H2P A;  4OPG A;  4LU6 A;  3GRS A;  3ICS A;  5CQF A;  2YLS A;  2BA9 A;  3LZX A;  2EQ8 A;  1YQ3 A;  2VVL A;  4YSX A;  2JK6 A;  2APG A;  3K7M X;  5BUK A;  5JCL A;  4YT0 A;  3KA7 A;  1TDO A;  1H83 A;  5CKU A;  4TM0 A;  3CND A;  4TM4 A;  5EB4 A;  4CNK A;  1BKW A;  3P4P A;  3ZDN A;  1Q1W A;  3AEA A;  3DK9 A;  2XFP A;  2XFO A;  2AAQ A;  2GR2 A;  2GEW A;  2WEU A;  1MXT A;  4E0V A;  1TYP A;  4J56 A;  3JSK A;  1D7Y A;  4NNJ A;  2GB0 A;  2BXR A;  4WCT A;  3UKP A;  4A6N A;  4Z2T A;  5TR3 A;  2XLT A;  3L8K A;  1FCD A;  4M52 A;  4BV6 A;  3OZ2 A;  2JB3 A;  1TDN A;  2Y6Q A;  1O95 A;  1JRX A;  3C4N A;  3BHK A;  3VR9 A;  3KD9 A;  4GR1 A;  4KX6 A;  2E5V A;  2OAL A;  3UKA A;  1CHU A;  4YTM A;  2C66 A;  2EQ7 A;  2BRY A;  2C67 A;  4Z26 A;  2I0Z A;  2OLO A;  1NHP A;  3UKK A;  2H88 A;  2YG4 A;  4CNJ A;  3GMB A;  2WU5 A;  2OA1 A;  3NH3 X;  1BGJ A;  2V61 A;  3CPI G;  2JKC A;  4U2S A;  1PXB A;  2ZBW A;  3AEE A;  4TM1 A;  3T14 A;  1YY5 A;  1F8R A;  5L46 A;  1GRG A;  2YG6 A;  4AOS A;  2R0G A;  4Y4N A;  3OC4 A;  2C3C A;  2GQF A;  1N4W A;  1W4X A;  5HXI A;  5IQ4 A;  1PN0 A;  2BRA A;  2BXS A;  2YR6 A;  4A65 A;  3FPZ A;  4B1B A;  4J2W A;  2WOW A;  3NGC X;  5J60 A;  4EQX A;  2XFQ A;  1GSN A;  4Z2R A;  2WDQ A;  2GV8 A;  3EAO A;  2V3B A;  1IUT A;  1B37 A;  3SFE A;  2R0P A;  1BF3 A;  1ONF A;  3HYX A;  1DXL A;  4X4J A;  2WDR A;  3KKJ A;  4DNA A;  5M0Z A;  3CMM A;  3SX6 A;  2C73 A;  1JEH A;  1JRY A;  4UDP A;  2QCU A;  3DJE A;  4EQS A;  1LQT A;  4GAP A;  4B69 A;  4NEW A;  3ICR A;  4TLX A;  4GDE A;  3EAN A;  3LAD A;  3AE6 A;  3VRA A;  2C7G A;  1RP0 A;  4A5L A;  2W0H A;  3AXB A;  2AR8 A;  1RSG A;  3V3O A;  3CPJ G;  5KNL A;  1GTE A;  1CC4 A;  3ISH A;  2Z5Y A;  1AOG A;  3QFA A;  4OPD A;  3NN6 X;  2OAM A;  3AYL A;  3DME A;  1B4V A;  4HB9 A;  4J57 A;  4A7A A;  5KOW A;  1NG4 A;  2QA1 A;  4B67 A;  1PXC A;  2YG3 A;  5ER0 A;  3T2K A;  3UTE A;  3K7Q X;  3SZF A;  1XPQ A;  4U2T A;  2VQB A;  1BWC A;  1S2Y A;  1EBD A;  1N4V A;  3P9U A;  1K0I A;  2CVJ A;  3ITJ A;  3HYV A;  4J33 A;  3NRN A;  4FK1 C;  1ZY8 A;  1PBD A;  2BCG G;  2WET A;  4UP3 A;  1DNC A;  4Z24 A;  3UP4 A;  1QLB A;  3DH9 A;  1L0V A;  2C64 A;  4PAB A;  1EL9 A;  1IUV A;  1K0J A;  1CJ2 A;  3AYJ A;  1D7L A;  5KMR A;  3FMW A;  1GT8 A;  2BYB A;  1H81 A;  3C4A A;  5U1O A;  2GR1 A;  2IID A;  5FS7 A;  3SFD A;  4YTN A;  2WHD A;  4JY3 A;  1EL8 A;  1NAA A;  4IA5 A;  3LB8 A;  3VRD B;  3UOV A;  4NZH A;  1PHH A;  4MJW A;  3NYC A;  4GRT A;  1Q9I A;  4I59 A;  1CC6 A;  3VQR A;  3AD8 B;  3S5W A;  1S3E A;  1GOS A;  3GD3 A;  3SZW A;  3T2Z A;  3AE7 A;  2BS4 A;  1GPE A;  3BNU A;  5FS9 A;  1PS9 A;  1FL2 A;  3GYX A;  3HZL A;  3DJG X;  1NPX A;  1N4U A;  3M0O A;  2YLW A;  4JY2 A;  1VG0 A;  4BK3 A;  2ARD A;  4A6N B;  3ALJ A;  5LV9 A;  1GEU A;  3SY4 A;  2WBA A;  3RP6 A;  4B66 A;  3QSM A;  4H4V A;  2XCG A;  3GDN A;  2O9Z A;  3I3L A;  2XFU A;  3P4S A;  4H2N A;  2YLX A;  4EQW A;  3DK4 A;  4ZCC A;  1ZK7 A;  2Q6U A;  4H4P A;  2GMH A;  2HQM A;  1Q1R A;  1DOB A;  4NTE A;  2V60 A;  2DKH A;  1PBF A;  2R4E A;  2BK5 A;  2WS3 A;  3PVC A;  2RGO A;  4II2 A;  3D1C A;  4TLZ A;  2RGJ A;  5GRT A;  1IUX A;  2V5Z A;  4GF7 A;  4GDP A;  3KVE A;  4CCQ A;  4ECH A;  4IVO B;  5HY5 A;  3IWA A;  3NK0 X;  3UKH A;  2TMD A;  3KU9 A;  1LPF A;  1V59 A;  1VRQ B;  2GQW A;  3AYI A;  2X8C A;  3H8L A;  2C70 A;  2WP6 A;  4YKG A;  2GAG B;  5HYM A;  4NTC A;  2ACZ A;  3F8R A;  3UTG A;  1O94 A;  1O5W A;  5FS8 A;  5IQ1 A;  3RP7 A;  1E1N A;  1H7X A;  2YWL A;  1RYI A;  1CF3 A;  1ZOY A;  3Q9T A;  1LVL A;  5M10 A;  3CNP A;  2WOI A;  3UOZ A;  4HA6 A;  2XLP A;  4K22 A;  4RSL A;  3UCL A;  1D4E A;  1Y56 B;  4YXD A;  2GAH B;  2YM2 A;  2J3N A;  2XYO A;  3GWF A;  3WE0 A;  3HYW A;  3GDP A;  1JNZ A;  1PJ5 A;  1D4C A;  3B3R A;  3V3N A;  3KPF A;  1E1K A;  1SEZ A;  2UZZ A;  3AD9 B;  3UKQ A;  1F6M A;  4Y4L A;  2BAC A;  5BRT A;  2WES A;  2C65 A;  2C76 A;  3ALM A;  3CGE A;  4H2Q A;  3QJ4 A;  4G73 A;  4AP3 A;  3NHO X;  4H4U A;  2Y6R A;  1QJD A;  4H2R A;  3ADA B;  1P2E A;  1K0L A;  2R46 A;  4DGK A;  2BCP A;  2XVE A;  1NG3 A;  3QVR A;  1ZMC A;  1FEA A;  4USR A;  3QFB A;  3AE3 A;  1TYT A;  1L9D A;  3GYI A;  4U8P A;  1XDI A;  4JDR A;  1COY A;  2B9X A;  2XFN A;  4CBQ A;  1Y56 A;  3NYE A;  3UKF A;  3URH A;  4H4T A;  4DSG A;  4OPI A;  1OJ9 A;  3CIR A;  4P9S A;  3FBS A;  2GMJ A;  2BK4 A;  3S61 A;  4EMW A;  1DJN A;  4OPL A;  3AE8 A;  2XVF A;  2XLR A;  4B65 A;  1NEK A;  1FEC A;  1BZL A;  1UKV G;  2BK3 A;  1M6I A;  1JU2 A;  4LII A;  3C96 A;  1PJ6 A;  2Q0K A;  2C4C A;  3BI4 A;  4H7U A;  5EB5 A;  2JAE A;  3BI5 A;  1GES A;  3QSS A;  1IJH A;  4J31 A;  2R0C A;  1GRB A;  3R9U A;  3T37 A;  1E7P A;  4K5R A;  1X31 B;  1TDK A;  1PXA A;  4U8I A;  1S3B A;  4Z25 A;  1BGN A;  5FS6 A;  3GD4 A;  4U8O A;  3NG7 X;  2WP5 A;  1CJC A;  3COX A;  3ZYX A;  3SM8 A;  4YSH A;  1OJT A;  3UOY A;  2YR5 A;  4X9N A;  4AT2 A;  3GSI A;  2QAE A;  3QVP A;  4I58 A;  2BS2 A;  1K4Q A;  2YVJ A;  4XWR A;  2R4J A;  3BI2 A;  4BJY A;  4BJZ A;  1HYU A;  5U63 A;  2XLS A;  5KMQ A;  5EBK A;  4Z43 A;  3GWD A;  2WOV A;  1LTX R;  1CBO A;  2VVM A;  4WX1 A;  4XWZ A;  3NTD A;  3ICT A;  4YWO A;  4EQR A;  5EOW A;  1D5T A;  1DOD A;  3NTA A;  1VQW A;  2E4G A;  2Z5X A;  3AEB A;  3CGB A;  3EPT A;  5BUL A;  4UDQ A;  2JB1 A;  3LOV A;  2WQY A;  1IUS A;  1L9E A;  2GH5 A;  2PYX A;  3FIM B;  4K8D A;  4B63 A;  4H4Z A;  1XAN A;  3FG2 P;  4FX9 A;  4U8K A;  2FJD A;  2Q7V A;  2V3A A;  3SXI A;  1H86 A;  4CRT A;  2NVK X;  3KLJ A;  1PBE A;  1E1L A;  1F8W A;  4FDC B;  4C74 A;  4JQ9 A;  3CPH G;  3NT6 A;  5FMH A;  5JCN A;  1CJ3 A;  5IPY A;  4APN A;  3BHF A;  2VOU A;  3K30 A;  3AED A;  1ELI A;  4OVI A;  1H6V A;  4O5U A;  4XXG A;  4B68 A;  1EL7 A;  3CNT A;  4CCR A;  3NLC A;  3P4Q A;  4K7Z A;  2CUL A;  3AE2 A;  3GYJ A;  2WPE A;  2WPF A;  4H4W A;  1Z6L A;  3T0K A;  5JCI A;  2YLZ A;  4G6G A;  3K7T A;  4A9W A;  2X3N A;  2C75 A;  4G6H A;  3PS9 A;  4C3X A;  1GRE A;  4C3Y A;  4GCM A;  3BNM A;  3UOX A;  2VQ7 A;  2H89 A;  2YAU A;  2B9Y A;  4ZN0 A;  4EIP A;  2A8X A;  3NN0 X;  4U8M A;  4EMI A;  3CGD A;  4J34 A;  5J7X A;  2RAB A;  3EF6 A;  1IUW A;  4OPT A;  3D8X A;  4LA1 A;  4H50 A;  1ZOV A;  1GND A;  2EQ9 A;  1ZDL A;  1F8S A;  1IUU A;  2FJB A;  3CTY A;  4C5O A;  3V76 A;  2RGH A;  4YTP A;  3P4R A;  1F3P A;  1GV4 A;  3AE1 A;  1TDF A;  2TPR A;  2CFY A;  1S2Q A;  3VRB A;  1NHS A;  2VVL G;  4TM3 A;  4U2L A;  2QA2 A;  4D04 A;  2BC0 A;  1ZMD A;  4K2X A;  4NTD A;  2XLU A;  3NK2 X;  3AD7 B;  5KVI A; 
#chains in the Genus database with same CATH homology
 1YKJ A;  2ZZC A;  3UP5 A;  3G5S A;  2GVC A;  3CN8 A;  5KMS A;  1DOC A;  3DA1 A;  1MO9 A;  4A99 A;  3F8P A;  3AEC A;  2ZZ0 A;  2E1M A;  2B9W A;  3AEF A;  3O0H A;  4GUV A;  4BK1 A;  1D4D A;  4RG4 A;  2VRM A;  4OPU A;  4U8N A;  3SQP A;  4CY8 A;  2YG7 A;  5C3J A;  1JOA A;  4USQ A;  4AT0 A;  1GRF A;  1KNR A;  1VG9 A;  3AE4 A;  2X8G A;  1L9C A;  3GMC A;  3ATR A;  2WPC A;  3UKL A;  4A79 A;  4DSH A;  4H4X A;  1PBB A;  4U8L A;  3M13 A;  4EM3 A;  1GTH A;  1TRB A;  1GER A;  4EM4 A;  2V6O A;  4YSZ A;  2A87 A;  3LZW A;  1FOH A;  1H7W A;  4EIQ A;  1B5Q A;  3G5R A;  4IVM B;  1E1M A;  2R9Z A;  1GRA A;  4PAA A;  1OJC A;  4G74 A;  1H84 A;  4H4R A;  1E6E A;  5BVA A;  1OJD A;  2WP9 A;  4UDR A;  3B6D A;  3UTH A;  2IVD A;  3IF9 A;  2GRT A;  1N1P A;  1TDE A;  4D03 A;  1XHC A;  4H4S A;  1NDA A;  1Y0P A;  1VDC A;  2YG5 A;  4Z2U A;  1KF6 A;  3Q6J A;  2BS3 A;  1B8S A;  5KVH A;  2GR3 A;  3II4 A;  3GRT A;  1NHQ A;  1PBC A;  4NEV A;  2VRL A;  3AWI A;  3LXD A;  2JB2 A;  3AB1 A;  4JNQ A;  1M64 A;  4CY6 A;  1ZKQ A;  2GR0 A;  4FK1 A;  2YQU A;  1DOE A;  4YKF A;  3I6D A;  1KFY A;  1OJA A;  1DJQ A;  3F8D A;  3NKS A;  1ZX9 A;  2C3D A;  3H4K A;  3DGH A;  4JNA A;  1CL0 A;  1P2H A;  3CNS A;  1PJ7 A;  5GSN A;  1KNP A;  4BUR A;  2YLT A;  3NYF A;  1EL5 A;  1YQ4 A;  3PO7 A;  4NWZ A;  2PHH A;  3ABV A;  4O5Q A;  4U8J A;  4Y4M A;  4ZCD A;  4YSY A;  5KMP A;  5KXJ A;  4EMJ A;  3NK1 X;  4K5S A;  2B7S A;  3RP8 A;  2X8H A;  1KDG A;  3M12 A;  4REK A;  1JRZ A;  1KSU A;  1H82 A;  1NHR A;  4H4Q A;  5U25 A;  3G5Q A;  1ZP0 A;  2A89 A;  1MOK A;  2X50 A;  2C72 A;  2X99 A;  2R45 A;  2YVG A;  1JNR A;  3SYI A;  4AOX A;  4J36 A;  2NPX A;  4GAV A;  1FEB A;  3SZC A;  3P1W A;  4N9X A;  3RNM A;  2EQ6 A;  3NNE A;  2XVH A;  4KPR A;  2B76 A;  2JBV A;  4RG3 A;  4AP1 A;  4X9M A;  2IVE A;  5JCK A;  1PDH A;  1E39 A;  2BC1 A;  4C77 A;  3T2Y A;  5HHF A;  1GRH A;  1LV0 A;  3CGC A;  3UTF A;  4JN9 A;  3CNJ A;  3LJP A;  5JCM A;  2FJE A;  3T31 A;  4BK2 A;  3IHM A;  3NIX A;  5DBJ A;  2VZ2 A;  2YLR A;  2GF3 A;  2Q0L A;  4ICY A;  2YVF A;  4ADW A;  5KWF A;  1QO8 A;  3DJJ A;  2YM1 A;  4II3 A;  4OPC A;  3IC9 A;  1GRT A;  2AQJ A;  2OLN A;  2XVI A;  3IHG A;  1CC2 A;  3DGZ A;  2XDO A;  3SZ0 A;  2B7R A;  1NEN A;  2XVJ A;  4IV9 A;  2CDU A;  1REO A;  1YQZ A;  4OCG A;  1GAL A;  1CJ4 A;  3QSE A;  3VR8 A;  4B64 A;  1GET A;  3DK8 A;  1GXF A;  2WU2 A;  3DJD A;  4G9K A;  3E1T A;  4H4Y A;  3L1R A;  3AEG A;  3AE9 A;  3ALL A;  5KRQ A;  3KPK A;  1KSS A;  2FBW A;  3AE5 A;  1LJ1 A;  1LQU A;  3RHA A;  5C2T A;  2DKI A;  5KOX A;  2ZZB A;  4Z44 A;  2YR4 A;  4IA6 A;  3H8I A;  2F5Z A;  3SGL A;  3RED A;  2WDV A;  2FJA A;  3ATQ A;  2BAB A;  4H2P A;  4OPG A;  4LU6 A;  3GRS A;  3ICS A;  5CQF A;  2YLS A;  2BA9 A;  3LZX A;  2EQ8 A;  1YQ3 A;  2VVL A;  4YSX A;  2JK6 A;  2APG A;  3K7M X;  5BUK A;  5JCL A;  4YT0 A;  3KA7 A;  1TDO A;  1H83 A;  5CKU A;  4TM0 A;  3CND A;  4TM4 A;  5EB4 A;  4CNK A;  1BKW A;  3P4P A;  3ZDN A;  1Q1W A;  3AEA A;  3DK9 A;  2XFP A;  2XFO A;  2AAQ A;  2GR2 A;  2GEW A;  2WEU A;  1MXT A;  4E0V A;  1TYP A;  4J56 A;  3JSK A;  1D7Y A;  4NNJ A;  2GB0 A;  2BXR A;  4WCT A;  3UKP A;  4A6N A;  4Z2T A;  5TR3 A;  2XLT A;  3L8K A;  1FCD A;  4M52 A;  4BV6 A;  3OZ2 A;  2JB3 A;  1TDN A;  2Y6Q A;  1O95 A;  1JRX A;  3C4N A;  3BHK A;  3VR9 A;  3KD9 A;  4GR1 A;  4KX6 A;  2E5V A;  2OAL A;  3UKA A;  1CHU A;  4YTM A;  2C66 A;  2EQ7 A;  2BRY A;  2C67 A;  4Z26 A;  2I0Z A;  2OLO A;  1NHP A;  3UKK A;  2H88 A;  2YG4 A;  4CNJ A;  3GMB A;  2WU5 A;  2OA1 A;  3NH3 X;  1BGJ A;  2V61 A;  3CPI G;  2JKC A;  4U2S A;  1PXB A;  2ZBW A;  3AEE A;  4TM1 A;  3T14 A;  1YY5 A;  1F8R A;  5L46 A;  1GRG A;  2YG6 A;  4AOS A;  2R0G A;  4Y4N A;  3OC4 A;  2C3C A;  2GQF A;  1N4W A;  1W4X A;  5HXI A;  5IQ4 A;  1PN0 A;  2BRA A;  2BXS A;  2YR6 A;  4A65 A;  3FPZ A;  4B1B A;  4J2W A;  2WOW A;  3NGC X;  5J60 A;  4EQX A;  2XFQ A;  1GSN A;  4Z2R A;  2WDQ A;  2GV8 A;  3EAO A;  2V3B A;  1IUT A;  1B37 A;  3SFE A;  2R0P A;  1BF3 A;  1ONF A;  3HYX A;  1DXL A;  4X4J A;  2WDR A;  3KKJ A;  4DNA A;  5M0Z A;  3CMM A;  3SX6 A;  2C73 A;  1JEH A;  1JRY A;  4UDP A;  2QCU A;  3DJE A;  4EQS A;  1LQT A;  4GAP A;  4B69 A;  4NEW A;  3ICR A;  4TLX A;  4GDE A;  3EAN A;  3LAD A;  3AE6 A;  3VRA A;  2C7G A;  1RP0 A;  4A5L A;  2W0H A;  3AXB A;  2AR8 A;  1RSG A;  3V3O A;  3CPJ G;  5KNL A;  1GTE A;  1CC4 A;  3ISH A;  2Z5Y A;  1AOG A;  3QFA A;  4OPD A;  3NN6 X;  2OAM A;  3AYL A;  3DME A;  1B4V A;  4HB9 A;  4J57 A;  4A7A A;  5KOW A;  1NG4 A;  2QA1 A;  4B67 A;  1PXC A;  2YG3 A;  5ER0 A;  3T2K A;  3UTE A;  3K7Q X;  3SZF A;  1XPQ A;  4U2T A;  2VQB A;  1BWC A;  1S2Y A;  1EBD A;  1N4V A;  3P9U A;  1K0I A;  2CVJ A;  3ITJ A;  3HYV A;  4J33 A;  3NRN A;  4FK1 C;  1ZY8 A;  1PBD A;  2BCG G;  2WET A;  4UP3 A;  1DNC A;  4Z24 A;  3UP4 A;  1QLB A;  3DH9 A;  1L0V A;  2C64 A;  4PAB A;  1EL9 A;  1IUV A;  1K0J A;  1CJ2 A;  3AYJ A;  1D7L A;  5KMR A;  3FMW A;  1GT8 A;  2BYB A;  1H81 A;  3C4A A;  5U1O A;  2GR1 A;  2IID A;  5FS7 A;  3SFD A;  4YTN A;  2WHD A;  4JY3 A;  1EL8 A;  1NAA A;  4IA5 A;  3LB8 A;  3VRD B;  3UOV A;  4NZH A;  1PHH A;  4MJW A;  3NYC A;  4GRT A;  1Q9I A;  4I59 A;  1CC6 A;  3VQR A;  3AD8 B;  3S5W A;  1S3E A;  1GOS A;  3GD3 A;  3SZW A;  3T2Z A;  3AE7 A;  2BS4 A;  1GPE A;  3BNU A;  5FS9 A;  1PS9 A;  1FL2 A;  3GYX A;  3HZL A;  3DJG X;  1NPX A;  1N4U A;  3M0O A;  2YLW A;  4JY2 A;  1VG0 A;  4BK3 A;  2ARD A;  4A6N B;  3ALJ A;  5LV9 A;  1GEU A;  3SY4 A;  2WBA A;  3RP6 A;  4B66 A;  3QSM A;  4H4V A;  2XCG A;  3GDN A;  2O9Z A;  3I3L A;  2XFU A;  3P4S A;  4H2N A;  2YLX A;  4EQW A;  3DK4 A;  4ZCC A;  1ZK7 A;  2Q6U A;  4H4P A;  2GMH A;  2HQM A;  1Q1R A;  1DOB A;  4NTE A;  2V60 A;  2DKH A;  1PBF A;  2R4E A;  2BK5 A;  2WS3 A;  3PVC A;  2RGO A;  4II2 A;  3D1C A;  4TLZ A;  2RGJ A;  5GRT A;  1IUX A;  2V5Z A;  4GF7 A;  4GDP A;  3KVE A;  4CCQ A;  4ECH A;  4IVO B;  5HY5 A;  3IWA A;  3NK0 X;  3UKH A;  2TMD A;  3KU9 A;  1LPF A;  1V59 A;  1VRQ B;  2GQW A;  3AYI A;  2X8C A;  3H8L A;  2C70 A;  2WP6 A;  4YKG A;  2GAG B;  5HYM A;  4NTC A;  2ACZ A;  3F8R A;  3UTG A;  1O94 A;  1O5W A;  5FS8 A;  5IQ1 A;  3RP7 A;  1E1N A;  1H7X A;  2YWL A;  1RYI A;  1CF3 A;  1ZOY A;  3Q9T A;  1LVL A;  5M10 A;  3CNP A;  2WOI A;  3UOZ A;  4HA6 A;  2XLP A;  4K22 A;  4RSL A;  3UCL A;  1D4E A;  1Y56 B;  4YXD A;  2GAH B;  2YM2 A;  2J3N A;  2XYO A;  3GWF A;  3WE0 A;  3HYW A;  3GDP A;  1JNZ A;  1PJ5 A;  1D4C A;  3B3R A;  3V3N A;  3KPF A;  1E1K A;  1SEZ A;  2UZZ A;  3AD9 B;  3UKQ A;  1F6M A;  4Y4L A;  2BAC A;  5BRT A;  2WES A;  2C65 A;  2C76 A;  3ALM A;  3CGE A;  4H2Q A;  3QJ4 A;  4G73 A;  4AP3 A;  3NHO X;  4H4U A;  2Y6R A;  1QJD A;  4H2R A;  3ADA B;  1P2E A;  1K0L A;  2R46 A;  4DGK A;  2BCP A;  2XVE A;  1NG3 A;  3QVR A;  1ZMC A;  1FEA A;  4USR A;  3QFB A;  3AE3 A;  1TYT A;  1L9D A;  3GYI A;  4U8P A;  1XDI A;  4JDR A;  1COY A;  2B9X A;  2XFN A;  4CBQ A;  1Y56 A;  3NYE A;  3UKF A;  3URH A;  4H4T A;  4DSG A;  4OPI A;  1OJ9 A;  3CIR A;  4P9S A;  3FBS A;  2GMJ A;  2BK4 A;  3S61 A;  4EMW A;  1DJN A;  4OPL A;  3AE8 A;  2XVF A;  2XLR A;  4B65 A;  1NEK A;  1FEC A;  1BZL A;  1UKV G;  2BK3 A;  1M6I A;  1JU2 A;  4LII A;  3C96 A;  1PJ6 A;  2Q0K A;  2C4C A;  3BI4 A;  4H7U A;  5EB5 A;  2JAE A;  3BI5 A;  1GES A;  3QSS A;  1IJH A;  4J31 A;  2R0C A;  1GRB A;  3R9U A;  3T37 A;  1E7P A;  4K5R A;  1X31 B;  1TDK A;  1PXA A;  4U8I A;  1S3B A;  4Z25 A;  1BGN A;  5FS6 A;  3GD4 A;  4U8O A;  3NG7 X;  2WP5 A;  1CJC A;  3COX A;  3ZYX A;  3SM8 A;  4YSH A;  1OJT A;  3UOY A;  2YR5 A;  4X9N A;  4AT2 A;  3GSI A;  2QAE A;  3QVP A;  4I58 A;  2BS2 A;  1K4Q A;  2YVJ A;  4XWR A;  2R4J A;  3BI2 A;  4BJY A;  4BJZ A;  1HYU A;  5U63 A;  2XLS A;  5KMQ A;  5EBK A;  4Z43 A;  3GWD A;  2WOV A;  1LTX R;  1CBO A;  2VVM A;  4WX1 A;  4XWZ A;  3NTD A;  3ICT A;  4YWO A;  4EQR A;  5EOW A;  1D5T A;  1DOD A;  3NTA A;  1VQW A;  2E4G A;  2Z5X A;  3AEB A;  3CGB A;  3EPT A;  5BUL A;  4UDQ A;  2JB1 A;  3LOV A;  2WQY A;  1IUS A;  1L9E A;  2GH5 A;  2PYX A;  3FIM B;  4K8D A;  4B63 A;  4H4Z A;  1XAN A;  3FG2 P;  4FX9 A;  4U8K A;  2FJD A;  2Q7V A;  2V3A A;  3SXI A;  1H86 A;  4CRT A;  2NVK X;  3KLJ A;  1PBE A;  1E1L A;  1F8W A;  4FDC B;  4C74 A;  4JQ9 A;  3CPH G;  3NT6 A;  5FMH A;  5JCN A;  1CJ3 A;  5IPY A;  4APN A;  3BHF A;  2VOU A;  3K30 A;  3AED A;  1ELI A;  4OVI A;  1H6V A;  4O5U A;  4XXG A;  4B68 A;  1EL7 A;  3CNT A;  4CCR A;  3NLC A;  3P4Q A;  4K7Z A;  2CUL A;  3AE2 A;  3GYJ A;  2WPE A;  2WPF A;  4H4W A;  1Z6L A;  3T0K A;  5JCI A;  2YLZ A;  4G6G A;  3K7T A;  4A9W A;  2X3N A;  2C75 A;  4G6H A;  3PS9 A;  4C3X A;  1GRE A;  4C3Y A;  4GCM A;  3BNM A;  3UOX A;  2VQ7 A;  2H89 A;  2YAU A;  2B9Y A;  4ZN0 A;  4EIP A;  2A8X A;  3NN0 X;  4U8M A;  4EMI A;  3CGD A;  4J34 A;  5J7X A;  2RAB A;  3EF6 A;  1IUW A;  4OPT A;  3D8X A;  4LA1 A;  4H50 A;  1ZOV A;  1GND A;  2EQ9 A;  1ZDL A;  1F8S A;  1IUU A;  2FJB A;  3CTY A;  4C5O A;  3V76 A;  2RGH A;  4YTP A;  3P4R A;  1F3P A;  1GV4 A;  3AE1 A;  1TDF A;  2TPR A;  2CFY A;  1S2Q A;  3VRB A;  1NHS A;  2VVL G;  4TM3 A;  4U2L A;  2QA2 A;  4D04 A;  2BC0 A;  1ZMD A;  4K2X A;  4NTD A;  2XLU A;  3NK2 X;  3AD7 B;  5KVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...