2VQ7A

Bacterial flavin-containing monooxygenase in complex with nadp: native data
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
443
structure length
443
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
molecule tags Oxidoreductase
total genus 159
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A02
2Q0KA 2YG4A 3UKHA 3DJJA 4A9WA 1GT8A 3UKFA 3DH9A 4OPUA 1CC6A 2O9ZA 4C5OA 2Z5XA 2XFOA 4ADWA 1PJ6A 3AE7A 3F8PA 5J7XA 1V59A 4XXGA 5BUKA 2XFNA 4ICYA 4TM0A 1B5QA 1JNRA 2DKHA 4X9NA 3AE6A 4JY2A 4H4TA 1D7LA 2HQMA 4TLXA 2X50A 2C73A 3ITJA 1RP0A 3BNMA 2JAEA 3KLJA 4RG4A 5U63A 4JY3A 4CY8A 2BS3A 1IUVA 1QJDA 1BF3A 5U1OA 2B76A 2WP5A 4EQRA 4U8LA 3GMCA 4UP3A 3NYCA 2Q7VA 1IUXA 1DNCA 1FEBA 2XYOA 4OPDA 3ZDNA 4Z25A 1KSSA 2YLTA 2RABA 1CBOA 4P9SA 4H4UA 1GPEA 3CGBA 2C3DA 1TDKA 1DOCA 2QA2A 4TLZA 3UOZA 4DNAA 5FS9A 2ARDA 3KKJA 4FX9A 4YKFA 1NG4A 2E5VA 1TRBA 2XCGA 3QFBA 3AEBA 3VR9A 2BS4A 3EPTA 4J2WA 4CBQA 3DJGX 4EIPA 5JCMA 3AD8B 2VRLA 3GYJA 4C3YA 4UDRA 3T37A 1YQ4A 3VRDB 1D4CA 2ZZCA 3ICTA 4AT2A 1LTXR 2VRMA 4A7AA 4EQSA 1E1LA 3B6DA 1L9EA 3M0OA 3CPIG 3GD4A 3WE0A 4RG3A 1IUUA 3GRTA 3BNUA 2CULA 4OVIA 5IPYA 2OALA 2BC0A 2C70A 4B68A 4CCRA 2JB1A 1SEZA 3ICRA 2A8XA 4ZCDA 4O5QA 4WX1A 3DK8A 4C77A 2XVIA 4CCQA 4EQWA 3AEGA 4CNJA 1GNDA 2C67A 4B67A 3UP4A 3IHGA 2C66A 1PJ5A 4H4VA 4HB9A 4K22A 2B7SA 1BKWA 3LZWA 1ZX9A 2ZZ0A 1O5WA 2RGOA 1B37A 2OLOA 3ATQA 4H2QA 3FBSA 4XWZA 4Z26A 1ONFA 3AEFA 4OPGA 3AE9A 4PABA 2GVCA 4BK3A 4EQXA 1F3PA 2YG5A 1MOKA 3UKQA 2C76A 4Y4NA 3NYEA 3GRSA 3D1CA 4BK2A 1NDAA 4YTPA 1GESA 1CJ3A 2YR6A 3EF6A 3AD7B 3UKAA 4A99A 3LXDA 3UTHA 2TMDA 4NTCA 2EQ6A 4H4RA 1RYIA 3P4RA 3GSIA 1IUSA 1JOAA 1DJNA 5GSNA 3D8XA 3GDNA 4AOSA 2FJAA 1GV4A 3CNJA 3S5WA 1JRZA 3I6DA 2VVLG 4X4JA 1DODA 2C75A 3II4A 4A6NB 2BCPA 2BXRA 4M52A 3K30A 1GXFA 3ABVA 5KVHA 1ZOYA 4B64A 1PS9A 2JBVA 1NEKA 1Z6LA 1RSGA 4N9XA 2XLTA 1YQZA 1EL9A 4NEVA 1D4DA 3UOVA 1EBDA 2BS2A 2V60A 2BA9A 2WOVA 2F5ZA 4H4ZA 3VRBA 2WPCA 2YWLA 2X3NA 3DA1A 1VG9A 3OC4A 4I58A 2GH5A 2IIDA 1GEUA 2WBAA 3C4NA 2YVFA 2NPXA 3P9UA 1O94A 2J3NA 4A6NA 2BYBA 3QFAA 5C3JA 1Q1WA 1H7XA 2EQ9A 1PXCA 5LV9A 2BK5A 1NG3A 2GEWA 4OPTA 1OJDA 2JB2A 2C7GA 2VVLA 4K2XA 5EB5A 4D04A 2E4GA 1GRFA 1JRYA 3CN8A 1VG0A 1CF3A 3M13A 4E0VA 5KOWA 2JB3A 3LZXA 4JDRA 1PBFA 3REDA 1VDCA 1MXTA 2QCUA 5BRTA 2WQYA 2XFPA 3R9UA 3CTYA 2YLXA 1XANA 3DJEA 3H8LA 2YQUA 1FOHA 4H4QA 1M64A 2ACZA 2W0HA 3CIRA 1GRGA 3AD9B 1PBBA 2WOWA 2FJDA 5JCLA 1X31B 4NEWA 1EL8A 2WDVA 4EM3A 4YTNA 1OJ9A 1GETA 4B63A 1H84A 1HYUA 3NK0X 3ALMA 3CNDA 4TM3A 3URHA 2C64A 3UKPA 4ZCCA 5TR3A 4OPIA 4JNQA 4EIQA 1GREA 4B65A 4C74A 2XFQA 3AE8A 4BJYA 4H4YA 3CNPA 4LU6A 5U25A 4BURA 2YLRA 3SFDA 1ZMCA 5EOWA 4H2PA 4AOXA 4Z44A 1W4XA 1NHRA 3CPJG 1CJ4A 4GDPA 2WHDA 3CGCA 3GWDA 2X8HA 4DSHA 3VR8A 2ZZBA 2WP9A 4Z2RA 3C4AA 4UDPA 2RGJA 3AEDA 4Z24A 1ELIA 2H89A 4YT0A 3S61A 3NRNA 5KXJA 2FBWA 3ADAB 5IQ4A 1H7WA 2CVJA 4U8OA 5HYMA 4YTMA 4Z43A 2X99A 3HZLA 3PO7A 2ZBWA 1B8SA 4H4PA 4U2TA 3NK2X 3CPHG 3KVEA 2EQ7A 1PBDA 2BK4A 1PN0A 2YLWA 3IHMA 1FL2A 3AEEA 4U8JA 1QLBA 2E1MA 2GR1A 3M12A 4H4SA 3SFEA 4CY6A 3COXA 2H88A 1TYTA 4K5SA 5FMHA 5GRTA 1CC2A 1S2YA 4Z2TA 1TDNA 3PVCA 1AOGA 1EL7A 1GTEA 1TYPA 2GR0A 3OZ2A 2XVJA 2YG3A 4H4WA 1PDHA 1JU2A 3FPZA 1NAAA 2YR5A 4J34A 3UCLA 1XPQA 1CJCA 3L1RA 1PXAA 1DOEA 1LPFA 3EAOA 1GRBA 3IC9A 2WP6A 1GRHA 1CHUA 3PS9A 4NTDA 2FJBA 4EMJA 1H6VA 3BI5A 1NPXA 1ZY8A 3LADA 2BACA 2YR4A 4IV9A 1H83A 3NGCX 1TDFA 3E1TA 3I3LA 4GCMA 4NZHA 1QO8A 3AXBA 1N1PA 4U2SA 1S2QA 1B4VA 2C3CA 1XHCA 2WEUA 3NTDA 4U8PA 2GR2A 4B66A 4CRTA 3GD3A 1DJQA 2VOUA 4EMWA 3RP6A 2C65A 2NVKX 2A87A 2V6OA 3K7TA 1ZP0A 1H86A 1YQ3A 1P2EA 2PYXA 1KFYA 4D03A 1CJ2A 3P4PA 3O0HA 1IJHA 1BWCA 1S3EA 4CNKA 2GAGB 1GSNA 2PHHA 2YM2A 3JSKA 1PBEA 1XDIA 3H4KA 3ISHA 5EB4A 4K5RA 4MJWA 2JKCA 2BCGG 1S3BA 1DOBA 1JEHA 1ZOVA 2WS3A 3NK1X 4K7ZA 3UTEA 3V76A 4YKGA 2BC1A 2R4JA 2XLUA 3AYJA 2VZ2A 3CGEA 4WCTA 4U8MA 3KPFA 5BULA 5JCKA 3AWIA 1O95A 4H4XA 4YSZA 3AB1A 2IVEA 1ZMDA 1KSUA 2B9XA 1IUTA 2VQ7A 4U2LA 4OPLA 1N4WA 3G5SA 5CKUA 5M10A 3UKKA 3AECA 2WDRA 5BVAA 2WOIA 4PAAA 4JN9A 2EQ8A 4TM1A 2A89A 1VQWA 2XVEA 2XVFA 2GMJA 2XVHA 5FS8A 1LV0A 3CNTA 4U8NA 3NIXA 4REKA 1D7YA 2I0ZA 3SGLA 3ATRA 1E1KA 4OCGA 1L0VA 1PHHA 1VRQB 2XDOA 1OJTA 3ALJA 2Q6UA 2YLZA 4GF7A 3KA7A 2WU2A 3NN0X 4LA1A 3K7MX 4IVMB 4DGKA 5KWFA 1EL5A 3AYIA 1N4UA 3LOVA 2GAHB 2R0GA 4IA6A 4USQA 5FS6A 4GUVA 5HHFA 2CDUA 2V61A 2UZZA 4H7UA 4B1BA 1IUWA 3GMBA 1YKJA 5JCNA 2GV8A 1E39A 3UP5A 4YSXA 3FMWA 3NTAA 2XLPA 3AE1A 2AQJA 3CGDA 2WESA 1COYA 3EANA 3NT6A 1N4VA 1ZK7A 4GR1A 4X9MA 5ER0A 4NTEA 4BJZA 3DK4A 2YLSA 3UOYA 1PJ7A 3RP7A 3VQRA 1UKVG 2BXSA 3ALLA 3BI4A 4IVOB 5FS7A 4U8IA 3NHOX 2OA1A 4USRA 1K0JA 3QJ4A 2YG6A 1H81A 2XLRA 1FECA 3NH3X 4LIIA 3F8RA 3UTGA 4A65A 3ZYXA 2FJEA 2GRTA 3QSEA 3G5QA 1K4QA 3ICSA 2BABA 3NG7X 3DK9A 5EBKA 3V3OA 4YXDA 4JQ9A 1K0LA 4J31A 1TDEA 1NENA 2AAQA 2GQWA 2YAUA 2Y6RA 2Y6QA 3BHKA 3KU9A 1YY5A 4Y4LA 3RHAA 2XLSA 3VRAA 3IF9A 1L9CA 1F8WA 2WDQA 2GMHA 4A79A 3LB8A 3G5RA 4ZN0A 1JNZA 1LQUA 3V3NA 1BGJA 2GB0A 3F8DA 1GERA 4BK1A 2VQBA 3SM8A 1NHQA 2V3AA 2OLNA 2QA1A 5M0ZA 4ECHA 3RP8A 4BV6A 3DGHA 4I59A 3NLCA 1L9DA 1GTHA 3P1WA 2R46A 4O5UA 1CC4A 3BHFA 2GQFA 1D5TA 1ZKQA 2YG7A 3AE4A 5HY5A 3NNEA 4YSYA 4TM4A 3QVPA 4IA5A 1GOSA 3AYLA 4XWRA 1DXLA 1KNRA 1TDOA 4UDQA 2R0CA 2BK3A 2X8GA 2XFUA 1NHPA 1H82A 3FIMB 3Q9TA 4OPCA 3AE2A 2QAEA 4AT0A 1Y56B 4GDEA 4Z2UA 3IWAA 4KPRA 3NYFA 4B69A 1REOA 5C2TA 2GR3A 5KOXA 2DKIA 2R4EA 4A5LA 1F6MA 2IVDA 4JNAA 4J33A 5IQ1A 1E7PA 1KDGA 3NKSA 2RGHA 4K8DA 2C72A 2R0PA 4EMIA 3H8IA 2JK6A 1LVLA 4GRTA 3FG2P 1K0IA 3GDPA 4YWOA 2WPFA 3DMEA 4APNA 5HXIA 2APGA 2Q0LA 3GWFA 1CL0A 4EM4A 1ZDLA 2X8CA 1LJ1A 3DJDA 3DGZA 4FDCB 4FK1A 3SQPA 3QSSA 3UKLA 1Q9IA 5J60A 2WU5A 4J36A 3UTFA 1P2HA 2GF3A 3L8KA 4H2RA 1F8RA 2VVMA 5KVIA 4AP1A 4AP3A 1KF6A 3AEAA 3K7QX 1Y56A 1KNPA 4HA6A 1OJCA 1PBCA 2YVGA 1Q1RA 1JRXA 4H2NA 2AR8A 2YM1A 1MO9A 5DBJA 1Y0PA 1M6IA 3UOXA 1NHSA 1OJAA 4Y4MA 2YVJA 4U8KA 3LJPA 1D4EA 3NN6X 5CQFA 1GRAA 2B9YA 3P4SA 1FCDA 2WPEA 3QVRA 4FK1C 1F8SA 1LQTA 2OAMA 3RNMA 1GALA 3C96A 3P4QA 2B9WA 1E1MA 2V5ZA 2CFYA 3CNSA 4KX6A 2WETA 2R45A 4J57A 3GYIA 5JCIA 1BGNA 4C3XA 3AE5A 1E1NA 1E6EA 1FEAA 1GRTA 3Q6JA 2R9ZA 4RSLA 4J56A 2V3BA 3QSMA 3AE3A 4YSHA 2B7RA 5L46A 1PXBA 1BZLA 2Z5YA 4DSGA 3BI2A 3KD9A 3B3RA 5KRQA 4H50A 2TPRA
chains in the Genus database with same CATH superfamily
2Q0KA 2YG4A 3UKHA 3DJJA 4A9WA 1GT8A 3UKFA 3DH9A 4OPUA 1CC6A 2O9ZA 4C5OA 2Z5XA 2XFOA 3HYXA 4ADWA 1PJ6A 3AE7A 3F8PA 5J7XA 1V59A 4XXGA 5BUKA 2XFNA 4ICYA 4TM0A 1B5QA 1JNRA 2DKHA 4X9NA 3AE6A 4JY2A 4H4TA 1D7LA 2HQMA 4TLXA 2X50A 2C73A 3ITJA 1RP0A 3BNMA 2JAEA 3KLJA 4RG4A 5U63A 4JY3A 4CY8A 2BS3A 1IUVA 1QJDA 1BF3A 5U1OA 2B76A 2WP5A 4EQRA 4U8LA 3GMCA 4UP3A 3NYCA 2Q7VA 1IUXA 1DNCA 1FEBA 2XYOA 4OPDA 3ZDNA 4Z25A 1KSSA 2YLTA 2RABA 1CBOA 4P9SA 4H4UA 1GPEA 3CGBA 2C3DA 1TDKA 1DOCA 2QA2A 4TLZA 3UOZA 4DNAA 5FS9A 2ARDA 3KKJA 4FX9A 4YKFA 1NG4A 2E5VA 1TRBA 2XCGA 3QFBA 3AEBA 3VR9A 2BS4A 3EPTA 4J2WA 4CBQA 3DJGX 4EIPA 5JCMA 3AD8B 2VRLA 3GYJA 4C3YA 4UDRA 3T37A 1YQ4A 3VRDB 1D4CA 2ZZCA 3ICTA 4AT2A 1LTXR 2VRMA 4A7AA 4EQSA 1E1LA 3B6DA 1L9EA 3M0OA 3CPIG 3GD4A 3WE0A 4RG3A 1IUUA 3GRTA 3BNUA 2CULA 4OVIA 5IPYA 2OALA 2BC0A 2C70A 4B68A 4CCRA 2JB1A 1SEZA 3ICRA 2A8XA 4ZCDA 4O5QA 4WX1A 3DK8A 4C77A 2XVIA 4CCQA 4EQWA 3AEGA 4CNJA 1GNDA 2C67A 4B67A 3UP4A 3IHGA 2C66A 1PJ5A 4H4VA 4HB9A 4K22A 2B7SA 1BKWA 3LZWA 1ZX9A 2ZZ0A 1O5WA 2RGOA 1B37A 2OLOA 3ATQA 4H2QA 3FBSA 4XWZA 4Z26A 1ONFA 3AEFA 4OPGA 3AE9A 4PABA 2GVCA 4BK3A 4NWZA 1F3PA 4EQXA 2YG5A 5KMPA 1MOKA 3UKQA 2C76A 4Y4NA 3NYEA 3GRSA 3D1CA 4BK2A 1NDAA 4YTPA 1GESA 1CJ3A 2YR6A 3EF6A 3AD7B 3UKAA 4A99A 3LXDA 3UTHA 2TMDA 4NTCA 2EQ6A 4H4RA 1RYIA 3P4RA 3GSIA 1IUSA 1JOAA 1DJNA 4II2A 5GSNA 3D8XA 3GDNA 4AOSA 2C4CA 2FJAA 1GV4A 3CNJA 3S5WA 1JRZA 3I6DA 2VVLG 4X4JA 1DODA 2C75A 3II4A 4A6NB 2BCPA 3CMMA 2BXRA 4M52A 3K30A 1GXFA 3ABVA 5KVHA 1ZOYA 4B64A 1PS9A 2JBVA 1NEKA 1Z6LA 1RSGA 4N9XA 2XLTA 1YQZA 1EL9A 4NEVA 1D4DA 4G74A 1EBDA 2BS2A 2V60A 2BA9A 2WOVA 4NNJA 3UOVA 2F5ZA 4H4ZA 3VRBA 2WPCA 2YWLA 2X3NA 3DA1A 1VG9A 3OC4A 4I58A 2GH5A 2IIDA 1GEUA 2WBAA 4GAVA 3C4NA 2YVFA 2NPXA 3P9UA 1O94A 2J3NA 4A6NA 2BYBA 3QFAA 5C3JA 1Q1WA 3SZCA 1H7XA 2EQ9A 1PXCA 5LV9A 2BK5A 1NG3A 2GEWA 4OPTA 1OJDA 2JB2A 2C7GA 2VVLA 4K2XA 5EB5A 4D04A 2E4GA 1GRFA 4G9KA 1JRYA 3CN8A 1VG0A 1CF3A 3M13A 4E0VA 5KOWA 2JB3A 3LZXA 4JDRA 1PBFA 4G73A 3REDA 1VDCA 1MXTA 2QCUA 5BRTA 2WQYA 5KNLA 2XFPA 3R9UA 3CTYA 2YLXA 1XANA 3DJEA 3H8LA 4II3A 2YQUA 1FOHA 4H4QA 1M64A 2ACZA 2W0HA 3CIRA 1GRGA 3AD9B 1PBBA 2WOWA 2FJDA 5JCLA 1X31B 4NEWA 1EL8A 2WDVA 4EM3A 4YTNA 1OJ9A 1GETA 4B63A 1H84A 1HYUA 3NK0X 3ALMA 3CNDA 4TM3A 3URHA 2C64A 3UKPA 4ZCCA 4G6GA 4OPIA 4JNQA 5TR3A 4EIQA 1GREA 4B65A 3T2KA 2XFQA 3AE8A 4BJYA 4H4YA 4C74A 3CNPA 4LU6A 5U25A 4BURA 2YLRA 3SFDA 1ZMCA 5EOWA 4H2PA 4AOXA 4Z44A 1W4XA 1NHRA 3CPJG 1CJ4A 4GDPA 2WHDA 3CGCA 3GWDA 2X8HA 4DSHA 3VR8A 2ZZBA 2WP9A 4Z2RA 3C4AA 4UDPA 2RGJA 3AEDA 4Z24A 1ELIA 2H89A 4YT0A 3S61A 3NRNA 5KXJA 2FBWA 5KMQA 3ADAB 5IQ4A 1H7WA 2CVJA 4U8OA 5HYMA 4YTMA 4Z43A 2X99A 3HZLA 3PO7A 2ZBWA 1B8SA 4H4PA 4U2TA 3NK2X 3CPHG 3KVEA 2EQ7A 1PBDA 2BK4A 1PN0A 2BRAA 2YLWA 3IHMA 1FL2A 3AEEA 4U8JA 1QLBA 2E1MA 2GR1A 3M12A 4H4SA 3SFEA 4CY6A 3COXA 2H88A 1TYTA 4K5SA 5FMHA 5GRTA 1CC2A 1S2YA 4Z2TA 1TDNA 3PVCA 1AOGA 1EL7A 1GTEA 1TYPA 2GR0A 3OZ2A 2XVJA 2YG3A 4H4WA 1PDHA 1JU2A 3FPZA 1NAAA 2YR5A 4J34A 3UCLA 1XPQA 1CJCA 3L1RA 1PXAA 1DOEA 1LPFA 3EAOA 1GRBA 3IC9A 2WP6A 1GRHA 1CHUA 3PS9A 4NTDA 2FJBA 4EMJA 1H6VA 3BI5A 1NPXA 1ZY8A 3LADA 2BACA 3T14A 2YR4A 4IV9A 1H83A 3NGCX 1TDFA 3E1TA 3I3LA 4GCMA 4NZHA 1QO8A 3AXBA 1N1PA 4U2SA 1S2QA 1B4VA 2C3CA 1XHCA 2WEUA 3NTDA 4U8PA 2GR2A 4B66A 4CRTA 3GD3A 1DJQA 2VOUA 4EMWA 3RP6A 2C65A 2NVKX 2A87A 2V6OA 3K7TA 1ZP0A 1H86A 1YQ3A 1P2EA 2PYXA 1KFYA 3SY4A 4D03A 1CJ2A 3P4PA 3O0HA 1IJHA 1BWCA 1S3EA 4CNKA 2GAGB 1GSNA 2PHHA 2YM2A 3JSKA 1PBEA 1XDIA 3T2ZA 3H4KA 3ISHA 5EB4A 4K5RA 4MJWA 2JKCA 2BCGG 1S3BA 1DOBA 1JEHA 1ZOVA 2WS3A 3NK1X 4K7ZA 3UTEA 3V76A 4YKGA 2BC1A 2R4JA 2XLUA 3AYJA 2VZ2A 3CGEA 4WCTA 4U8MA 3KPFA 3GYXA 5BULA 5JCKA 3AWIA 1O95A 4H4XA 3SZ0A 4YSZA 3AB1A 2IVEA 1ZMDA 1KSUA 2B9XA 1IUTA 2VQ7A 4U2LA 4OPLA 1N4WA 3G5SA 5CKUA 5M10A 3UKKA 3AECA 2WDRA 5BVAA 2WOIA 4PAAA 4JN9A 2EQ8A 4TM1A 2A89A 1VQWA 2XVEA 2XVFA 2GMJA 2XVHA 5FS8A 1LV0A 3CNTA 4U8NA 3NIXA 4REKA 1D7YA 2I0ZA 3SGLA 3ATRA 1E1KA 4OCGA 1L0VA 1PHHA 1VRQB 2XDOA 1OJTA 3ALJA 2Q6UA 2YLZA 4GF7A 3KA7A 2WU2A 3NN0X 4LA1A 3K7MX 4IVMB 4DGKA 5KWFA 1EL5A 4GAPA 3AYIA 1N4UA 3LOVA 2GAHB 2R0GA 4IA6A 4USQA 5FS6A 4GUVA 5HHFA 2CDUA 2V61A 2UZZA 4H7UA 4B1BA 3SX6A 1IUWA 3GMBA 1YKJA 5JCNA 2GV8A 1E39A 3UP5A 4YSXA 3FMWA 3SYIA 3NTAA 2XLPA 3AE1A 2AQJA 3CGDA 2WESA 1COYA 3EANA 3NT6A 1N4VA 1ZK7A 4GR1A 4X9MA 5ER0A 4NTEA 4BJZA 3DK4A 2YLSA 3UOYA 1PJ7A 3T0KA 3RP7A 3VQRA 1UKVG 2BXSA 3ALLA 3BI4A 4IVOB 5FS7A 4U8IA 3NHOX 5KMRA 2OA1A 4USRA 1K0JA 3QJ4A 2YG6A 1H81A 2XLRA 1FECA 3NH3X 4LIIA 3F8RA 3UTGA 4A65A 3ZYXA 2FJEA 2GRTA 3QSEA 3G5QA 1K4QA 3HYWA 3ICSA 2BABA 3NG7X 3DK9A 5EBKA 3V3OA 4YXDA 4JQ9A 1K0LA 4J31A 1TDEA 1NENA 2AAQA 2GQWA 2YAUA 2Y6RA 2Y6QA 3BHKA 3KU9A 1YY5A 4Y4LA 3RHAA 2XLSA 3VRAA 3IF9A 1L9CA 1F8WA 2WDQA 2GMHA 4A79A 3LB8A 3G5RA 4ZN0A 1JNZA 1LQUA 3V3NA 1BGJA 2GB0A 3F8DA 1GERA 4BK1A 2VQBA 3SM8A 1NHQA 3T31A 2V3AA 2OLNA 2QA1A 5M0ZA 4ECHA 3RP8A 4BV6A 3DGHA 4I59A 3NLCA 1L9DA 1GTHA 3P1WA 2R46A 4O5UA 1CC4A 3BHFA 2GQFA 1D5TA 1ZKQA 3SXIA 2YG7A 3AE4A 5HY5A 3NNEA 4YSYA 4TM4A 3QVPA 4IA5A 1GOSA 3AYLA 4XWRA 1DXLA 1KNRA 1TDOA 4UDQA 2R0CA 2BK3A 2X8GA 2XFUA 1NHPA 1H82A 3FIMB 3SZWA 3Q9TA 4OPCA 5KMSA 3AE2A 2QAEA 4AT0A 1Y56B 4GDEA 4Z2UA 3IWAA 4KPRA 3NYFA 4B69A 1REOA 5C2TA 2GR3A 5KOXA 2DKIA 2R4EA 4A5LA 1F6MA 2IVDA 4JNAA 4J33A 5IQ1A 1E7PA 1KDGA 3NKSA 2RGHA 3KPKA 4K8DA 2C72A 2R0PA 4EMIA 3H8IA 2JK6A 1LVLA 4GRTA 3FG2P 1K0IA 3GDPA 4YWOA 2WPFA 3DMEA 4APNA 5HXIA 2APGA 2Q0LA 3GWFA 1CL0A 4EM4A 1ZDLA 2X8CA 1LJ1A 3DJDA 3DGZA 4FDCB 4FK1A 3SQPA 3QSSA 3UKLA 1Q9IA 5J60A 2WU5A 4J36A 3UTFA 1P2HA 2GF3A 3L8KA 4G6HA 1F8RA 2VVMA 4H2RA 5KVIA 4AP1A 1KF6A 3AEAA 4AP3A 3K7QX 1Y56A 1KNPA 4HA6A 1OJCA 1PBCA 2YVGA 1Q1RA 1JRXA 4H2NA 2AR8A 3HYVA 2YM1A 1MO9A 5DBJA 1Y0PA 1M6IA 3UOXA 1NHSA 1OJAA 4Y4MA 2YVJA 4U8KA 3LJPA 1D4EA 3NN6X 5CQFA 1GRAA 2B9YA 3P4SA 1FCDA 2WPEA 3QVRA 4FK1C 1F8SA 1LQTA 2OAMA 3RNMA 1GALA 3C96A 3P4QA 2B9WA 3T2YA 1E1MA 2V5ZA 2CFYA 3CNSA 4KX6A 2WETA 2R45A 4J57A 3GYIA 3SZFA 5JCIA 2BRYA 1BGNA 4C3XA 3AE5A 1E1NA 1E6EA 1FEAA 1GRTA 3Q6JA 2R9ZA 4RSLA 4J56A 2V3BA 3QSMA 3AE3A 4YSHA 2B7RA 5L46A 1PXBA 1BZLA 2Z5YA 4DSGA 3BI2A 3KD9A 3B3RA 5KRQA 4H50A 2TPRA
chains in the Genus database with same CATH topology
2Q0KA 2YG4A 3UKHA 3DJJA 4A9WA 1GT8A 3UKFA 3DH9A 4OPUA 1CC6A 2O9ZA 4C5OA 2Z5XA 2XFOA 3HYXA 4ADWA 1PJ6A 3AE7A 3F8PA 5J7XA 1V59A 4XXGA 5BUKA 2XFNA 4ICYA 4TM0A 1B5QA 1JNRA 2DKHA 4X9NA 3AE6A 4JY2A 4H4TA 1D7LA 2HQMA 4TLXA 2X50A 2C73A 3ITJA 1RP0A 3BNMA 2JAEA 3KLJA 4RG4A 5U63A 4JY3A 4CY8A 2BS3A 1IUVA 1QJDA 1BF3A 5U1OA 2B76A 2WP5A 4EQRA 4U8LA 3GMCA 4UP3A 3NYCA 2Q7VA 1IUXA 1DNCA 1FEBA 2XYOA 4OPDA 3ZDNA 4Z25A 1KSSA 2YLTA 2RABA 1CBOA 4P9SA 4H4UA 1GPEA 3CGBA 2C3DA 1TDKA 1DOCA 2QA2A 4TLZA 3UOZA 4DNAA 5FS9A 2ARDA 3KKJA 4FX9A 4YKFA 1NG4A 2E5VA 1TRBA 2XCGA 3QFBA 3AEBA 3VR9A 2BS4A 3EPTA 4J2WA 4CBQA 3DJGX 4EIPA 5JCMA 3AD8B 2VRLA 3GYJA 4C3YA 4UDRA 3T37A 1YQ4A 3VRDB 1D4CA 2ZZCA 3ICTA 4AT2A 1LTXR 2VRMA 4A7AA 4EQSA 1E1LA 3B6DA 1L9EA 3M0OA 3CPIG 3GD4A 3WE0A 4RG3A 1IUUA 3GRTA 3BNUA 2CULA 4OVIA 5IPYA 2OALA 2BC0A 2C70A 4B68A 4CCRA 2JB1A 1SEZA 3ICRA 2A8XA 4ZCDA 4O5QA 4WX1A 3DK8A 4C77A 2XVIA 4CCQA 4EQWA 3AEGA 4CNJA 1GNDA 2C67A 4B67A 3UP4A 3IHGA 2C66A 1PJ5A 4H4VA 4HB9A 4K22A 2B7SA 1BKWA 3LZWA 1ZX9A 2ZZ0A 1O5WA 2RGOA 1B37A 2OLOA 3ATQA 4H2QA 3FBSA 4XWZA 4Z26A 1ONFA 3AEFA 4OPGA 3AE9A 4PABA 2GVCA 4BK3A 4NWZA 1F3PA 4EQXA 2YG5A 5KMPA 1MOKA 3UKQA 2C76A 4Y4NA 3NYEA 3GRSA 3D1CA 4BK2A 1NDAA 4YTPA 1GESA 1CJ3A 2YR6A 3EF6A 3AD7B 3UKAA 4A99A 3LXDA 3UTHA 2TMDA 4NTCA 2EQ6A 4H4RA 1RYIA 3P4RA 3GSIA 1IUSA 1JOAA 1DJNA 4II2A 5GSNA 3D8XA 3GDNA 4AOSA 2C4CA 2FJAA 1GV4A 3CNJA 3S5WA 1JRZA 3I6DA 2VVLG 4X4JA 1DODA 2C75A 3II4A 4A6NB 2BCPA 3CMMA 2BXRA 4M52A 3K30A 1GXFA 3ABVA 5KVHA 1ZOYA 4B64A 1PS9A 2JBVA 1NEKA 1Z6LA 1RSGA 4N9XA 2XLTA 1YQZA 1EL9A 4NEVA 1D4DA 4G74A 1EBDA 2BS2A 2V60A 2BA9A 2WOVA 4NNJA 3UOVA 2F5ZA 4H4ZA 3VRBA 2WPCA 2YWLA 2X3NA 3DA1A 1VG9A 3OC4A 4I58A 2GH5A 2IIDA 1GEUA 2WBAA 4GAVA 3C4NA 2YVFA 2NPXA 3P9UA 1O94A 2J3NA 4A6NA 2BYBA 3QFAA 5C3JA 1Q1WA 3SZCA 1H7XA 2EQ9A 1PXCA 5LV9A 2BK5A 1NG3A 2GEWA 4OPTA 1OJDA 2JB2A 2C7GA 2VVLA 4K2XA 5EB5A 4D04A 2E4GA 1GRFA 4G9KA 1JRYA 3CN8A 1VG0A 1CF3A 3M13A 4E0VA 5KOWA 2JB3A 3LZXA 4JDRA 1PBFA 4G73A 3REDA 1VDCA 1MXTA 2QCUA 5BRTA 2WQYA 5KNLA 2XFPA 3R9UA 3CTYA 2YLXA 1XANA 3DJEA 3H8LA 4II3A 2YQUA 1FOHA 4H4QA 1M64A 2ACZA 2W0HA 3CIRA 1GRGA 3AD9B 1PBBA 2WOWA 2FJDA 5JCLA 1X31B 4NEWA 1EL8A 2WDVA 4EM3A 4YTNA 1OJ9A 1GETA 4B63A 1H84A 1HYUA 3NK0X 3ALMA 3CNDA 4TM3A 3URHA 2C64A 3UKPA 4ZCCA 4G6GA 4OPIA 4JNQA 5TR3A 4EIQA 1GREA 4B65A 3T2KA 2XFQA 3AE8A 4BJYA 4H4YA 4C74A 3CNPA 4LU6A 5U25A 4BURA 2YLRA 3SFDA 1ZMCA 5EOWA 4H2PA 4AOXA 4Z44A 1W4XA 1NHRA 3CPJG 1CJ4A 4GDPA 2WHDA 3CGCA 3GWDA 2X8HA 4DSHA 3VR8A 2ZZBA 2WP9A 4Z2RA 3C4AA 4UDPA 2RGJA 3AEDA 4Z24A 1ELIA 2H89A 4YT0A 3S61A 3NRNA 5KXJA 2FBWA 5KMQA 3ADAB 5IQ4A 1H7WA 2CVJA 4U8OA 5HYMA 4YTMA 4Z43A 2X99A 3HZLA 3PO7A 2ZBWA 1B8SA 4H4PA 4U2TA 3NK2X 3CPHG 3KVEA 2EQ7A 1PBDA 2BK4A 1PN0A 2BRAA 2YLWA 3IHMA 1FL2A 3AEEA 4U8JA 1QLBA 2E1MA 2GR1A 3M12A 4H4SA 3SFEA 4CY6A 3COXA 2H88A 1TYTA 4K5SA 5FMHA 5GRTA 1CC2A 1S2YA 4Z2TA 1TDNA 3PVCA 1AOGA 1EL7A 1GTEA 1TYPA 2GR0A 3OZ2A 2XVJA 2YG3A 4H4WA 1PDHA 1JU2A 3FPZA 1NAAA 2YR5A 4J34A 3UCLA 1XPQA 1CJCA 3L1RA 1PXAA 1DOEA 1LPFA 3EAOA 1GRBA 3IC9A 2WP6A 1GRHA 1CHUA 3PS9A 4NTDA 2FJBA 4EMJA 1H6VA 3BI5A 1NPXA 1ZY8A 3LADA 2BACA 3T14A 2YR4A 4IV9A 1H83A 3NGCX 1TDFA 3E1TA 3I3LA 4GCMA 4NZHA 1QO8A 3AXBA 1N1PA 4U2SA 1S2QA 1B4VA 2C3CA 1XHCA 2WEUA 3NTDA 4U8PA 2GR2A 4B66A 4CRTA 3GD3A 1DJQA 2VOUA 4EMWA 3RP6A 2C65A 2NVKX 2A87A 2V6OA 3K7TA 1ZP0A 1H86A 1YQ3A 1P2EA 2PYXA 1KFYA 3SY4A 4D03A 1CJ2A 3P4PA 3O0HA 1IJHA 1BWCA 1S3EA 4CNKA 2GAGB 1GSNA 2PHHA 2YM2A 3JSKA 1PBEA 1XDIA 3T2ZA 3H4KA 3ISHA 5EB4A 4K5RA 4MJWA 2JKCA 2BCGG 1S3BA 1DOBA 1JEHA 1ZOVA 2WS3A 3NK1X 4K7ZA 3UTEA 3V76A 4YKGA 2BC1A 2R4JA 2XLUA 3AYJA 2VZ2A 3CGEA 4WCTA 4U8MA 3KPFA 3GYXA 5BULA 5JCKA 3AWIA 1O95A 4H4XA 3SZ0A 4YSZA 3AB1A 2IVEA 1ZMDA 1KSUA 2B9XA 1IUTA 2VQ7A 4U2LA 4OPLA 1N4WA 3G5SA 5CKUA 5M10A 3UKKA 3AECA 2WDRA 5BVAA 2WOIA 4PAAA 4JN9A 2EQ8A 4TM1A 2A89A 1VQWA 2XVEA 2XVFA 2GMJA 2XVHA 5FS8A 1LV0A 3CNTA 4U8NA 3NIXA 4REKA 1D7YA 2I0ZA 3SGLA 3ATRA 1E1KA 4OCGA 1L0VA 1PHHA 1VRQB 2XDOA 1OJTA 3ALJA 2Q6UA 2YLZA 4GF7A 3KA7A 2WU2A 3NN0X 4LA1A 3K7MX 4IVMB 4DGKA 5KWFA 1EL5A 4GAPA 3AYIA 1N4UA 3LOVA 2GAHB 2R0GA 4IA6A 4USQA 5FS6A 4GUVA 5HHFA 2CDUA 2V61A 2UZZA 4H7UA 4B1BA 3SX6A 1IUWA 3GMBA 1YKJA 5JCNA 2GV8A 1E39A 3UP5A 4YSXA 3FMWA 3SYIA 3NTAA 2XLPA 3AE1A 2AQJA 3CGDA 2WESA 1COYA 3EANA 3NT6A 1N4VA 1ZK7A 4GR1A 4X9MA 5ER0A 4NTEA 4BJZA 3DK4A 2YLSA 3UOYA 1PJ7A 3T0KA 3RP7A 3VQRA 1UKVG 2BXSA 3ALLA 3BI4A 4IVOB 5FS7A 4U8IA 3NHOX 5KMRA 2OA1A 4USRA 1K0JA 3QJ4A 2YG6A 1H81A 2XLRA 1FECA 3NH3X 4LIIA 3F8RA 3UTGA 4A65A 3ZYXA 2FJEA 2GRTA 3QSEA 3G5QA 1K4QA 3HYWA 3ICSA 2BABA 3NG7X 3DK9A 5EBKA 3V3OA 4YXDA 4JQ9A 1K0LA 4J31A 1TDEA 1NENA 2AAQA 2GQWA 2YAUA 2Y6RA 2Y6QA 3BHKA 3KU9A 1YY5A 4Y4LA 3RHAA 2XLSA 3VRAA 3IF9A 1L9CA 1F8WA 2WDQA 2GMHA 4A79A 3LB8A 3G5RA 4ZN0A 1JNZA 1LQUA 3V3NA 1BGJA 2GB0A 3F8DA 1GERA 4BK1A 2VQBA 3SM8A 1NHQA 3T31A 2V3AA 2OLNA 2QA1A 5M0ZA 4ECHA 3RP8A 4BV6A 3DGHA 4I59A 3NLCA 1L9DA 1GTHA 3P1WA 2R46A 4O5UA 1CC4A 3BHFA 2GQFA 1D5TA 1ZKQA 3SXIA 2YG7A 3AE4A 5HY5A 3NNEA 4YSYA 4TM4A 3QVPA 4IA5A 1GOSA 3AYLA 4XWRA 1DXLA 1KNRA 1TDOA 4UDQA 2R0CA 2BK3A 2X8GA 2XFUA 1NHPA 1H82A 3FIMB 3SZWA 3Q9TA 4OPCA 5KMSA 3AE2A 2QAEA 4AT0A 1Y56B 4GDEA 4Z2UA 3IWAA 4KPRA 3NYFA 4B69A 1REOA 5C2TA 2GR3A 5KOXA 2DKIA 2R4EA 4A5LA 1F6MA 2IVDA 4JNAA 4J33A 5IQ1A 1E7PA 1KDGA 3NKSA 2RGHA 3KPKA 4K8DA 2C72A 2R0PA 4EMIA 3H8IA 2JK6A 1LVLA 4GRTA 3FG2P 1K0IA 3GDPA 4YWOA 2WPFA 3DMEA 4APNA 5HXIA 2APGA 2Q0LA 3GWFA 1CL0A 4EM4A 1ZDLA 2X8CA 1LJ1A 3DJDA 3DGZA 4FDCB 4FK1A 3SQPA 3QSSA 3UKLA 1Q9IA 5J60A 2WU5A 4J36A 3UTFA 1P2HA 2GF3A 3L8KA 4G6HA 1F8RA 2VVMA 4H2RA 5KVIA 4AP1A 1KF6A 3AEAA 4AP3A 3K7QX 1Y56A 1KNPA 4HA6A 1OJCA 1PBCA 2YVGA 1Q1RA 1JRXA 4H2NA 2AR8A 3HYVA 2YM1A 1MO9A 5DBJA 1Y0PA 1M6IA 3UOXA 1NHSA 1OJAA 4Y4MA 2YVJA 4U8KA 3LJPA 1D4EA 3NN6X 5CQFA 1GRAA 2B9YA 3P4SA 1FCDA 2WPEA 3QVRA 4FK1C 1F8SA 1LQTA 2OAMA 3RNMA 1GALA 3C96A 3P4QA 2B9WA 3T2YA 1E1MA 2V5ZA 2CFYA 3CNSA 4KX6A 2WETA 2R45A 4J57A 3GYIA 3SZFA 5JCIA 2BRYA 1BGNA 4C3XA 3AE5A 1E1NA 1E6EA 1FEAA 1GRTA 3Q6JA 2R9ZA 4RSLA 4J56A 2V3BA 3QSMA 3AE3A 4YSHA 2B7RA 5L46A 1PXBA 1BZLA 2Z5YA 4DSGA 3BI2A 3KD9A 3B3RA 5KRQA 4H50A 2TPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0K A;  2YG4 A;  3UKH A;  3DJJ A;  4A9W A;  1GT8 A;  3UKF A;  3DH9 A;  4OPU A;  1CC6 A;  2O9Z A;  4C5O A;  2Z5X A;  2XFO A;  4ADW A;  1PJ6 A;  3AE7 A;  3F8P A;  5J7X A;  1V59 A;  4XXG A;  5BUK A;  2XFN A;  4ICY A;  4TM0 A;  1B5Q A;  1JNR A;  2DKH A;  4X9N A;  3AE6 A;  4JY2 A;  4H4T A;  1D7L A;  2HQM A;  4TLX A;  2X50 A;  2C73 A;  3ITJ A;  1RP0 A;  3BNM A;  2JAE A;  3KLJ A;  4RG4 A;  5U63 A;  4JY3 A;  4CY8 A;  2BS3 A;  1IUV A;  1QJD A;  1BF3 A;  5U1O A;  2B76 A;  2WP5 A;  4EQR A;  4U8L A;  3GMC A;  4UP3 A;  3NYC A;  2Q7V A;  1IUX A;  1DNC A;  1FEB A;  2XYO A;  4OPD A;  3ZDN A;  4Z25 A;  1KSS A;  2YLT A;  2RAB A;  1CBO A;  4P9S A;  4H4U A;  1GPE A;  3CGB A;  2C3D A;  1TDK A;  1DOC A;  2QA2 A;  4TLZ A;  3UOZ A;  4DNA A;  5FS9 A;  2ARD A;  3KKJ A;  4FX9 A;  4YKF A;  1NG4 A;  2E5V A;  1TRB A;  2XCG A;  3QFB A;  3AEB A;  3VR9 A;  2BS4 A;  3EPT A;  4J2W A;  4CBQ A;  3DJG X;  4EIP A;  5JCM A;  3AD8 B;  2VRL A;  3GYJ A;  4C3Y A;  4UDR A;  3T37 A;  1YQ4 A;  3VRD B;  1D4C A;  2ZZC A;  3ICT A;  4AT2 A;  1LTX R;  2VRM A;  4A7A A;  4EQS A;  1E1L A;  3B6D A;  1L9E A;  3M0O A;  3CPI G;  3GD4 A;  3WE0 A;  4RG3 A;  1IUU A;  3GRT A;  3BNU A;  2CUL A;  4OVI A;  5IPY A;  2OAL A;  2BC0 A;  2C70 A;  4B68 A;  4CCR A;  2JB1 A;  1SEZ A;  3ICR A;  2A8X A;  4ZCD A;  4O5Q A;  4WX1 A;  3DK8 A;  4C77 A;  2XVI A;  4CCQ A;  4EQW A;  3AEG A;  4CNJ A;  1GND A;  2C67 A;  4B67 A;  3UP4 A;  3IHG A;  2C66 A;  1PJ5 A;  4H4V A;  4HB9 A;  4K22 A;  2B7S A;  1BKW A;  3LZW A;  1ZX9 A;  2ZZ0 A;  1O5W A;  2RGO A;  1B37 A;  2OLO A;  3ATQ A;  4H2Q A;  3FBS A;  4XWZ A;  4Z26 A;  1ONF A;  3AEF A;  4OPG A;  3AE9 A;  4PAB A;  2GVC A;  4BK3 A;  4EQX A;  1F3P A;  2YG5 A;  1MOK A;  3UKQ A;  2C76 A;  4Y4N A;  3NYE A;  3GRS A;  3D1C A;  4BK2 A;  1NDA A;  4YTP A;  1GES A;  1CJ3 A;  2YR6 A;  3EF6 A;  3AD7 B;  3UKA A;  4A99 A;  3LXD A;  3UTH A;  2TMD A;  4NTC A;  2EQ6 A;  4H4R A;  1RYI A;  3P4R A;  3GSI A;  1IUS A;  1JOA A;  1DJN A;  5GSN A;  3D8X A;  3GDN A;  4AOS A;  2FJA A;  1GV4 A;  3CNJ A;  3S5W A;  1JRZ A;  3I6D A;  2VVL G;  4X4J A;  1DOD A;  2C75 A;  3II4 A;  4A6N B;  2BCP A;  2BXR A;  4M52 A;  3K30 A;  1GXF A;  3ABV A;  5KVH A;  1ZOY A;  4B64 A;  1PS9 A;  2JBV A;  1NEK A;  1Z6L A;  1RSG A;  4N9X A;  2XLT A;  1YQZ A;  1EL9 A;  4NEV A;  1D4D A;  3UOV A;  1EBD A;  2BS2 A;  2V60 A;  2BA9 A;  2WOV A;  2F5Z A;  4H4Z A;  3VRB A;  2WPC A;  2YWL A;  2X3N A;  3DA1 A;  1VG9 A;  3OC4 A;  4I58 A;  2GH5 A;  2IID A;  1GEU A;  2WBA A;  3C4N A;  2YVF A;  2NPX A;  3P9U A;  1O94 A;  2J3N A;  4A6N A;  2BYB A;  3QFA A;  5C3J A;  1Q1W A;  1H7X A;  2EQ9 A;  1PXC A;  5LV9 A;  2BK5 A;  1NG3 A;  2GEW A;  4OPT A;  1OJD A;  2JB2 A;  2C7G A;  2VVL A;  4K2X A;  5EB5 A;  4D04 A;  2E4G A;  1GRF A;  1JRY A;  3CN8 A;  1VG0 A;  1CF3 A;  3M13 A;  4E0V A;  5KOW A;  2JB3 A;  3LZX A;  4JDR A;  1PBF A;  3RED A;  1VDC A;  1MXT A;  2QCU A;  5BRT A;  2WQY A;  2XFP A;  3R9U A;  3CTY A;  2YLX A;  1XAN A;  3DJE A;  3H8L A;  2YQU A;  1FOH A;  4H4Q A;  1M64 A;  2ACZ A;  2W0H A;  3CIR A;  1GRG A;  3AD9 B;  1PBB A;  2WOW A;  2FJD A;  5JCL A;  1X31 B;  4NEW A;  1EL8 A;  2WDV A;  4EM3 A;  4YTN A;  1OJ9 A;  1GET A;  4B63 A;  1H84 A;  1HYU A;  3NK0 X;  3ALM A;  3CND A;  4TM3 A;  3URH A;  2C64 A;  3UKP A;  4ZCC A;  5TR3 A;  4OPI A;  4JNQ A;  4EIQ A;  1GRE A;  4B65 A;  4C74 A;  2XFQ A;  3AE8 A;  4BJY A;  4H4Y A;  3CNP A;  4LU6 A;  5U25 A;  4BUR A;  2YLR A;  3SFD A;  1ZMC A;  5EOW A;  4H2P A;  4AOX A;  4Z44 A;  1W4X A;  1NHR A;  3CPJ G;  1CJ4 A;  4GDP A;  2WHD A;  3CGC A;  3GWD A;  2X8H A;  4DSH A;  3VR8 A;  2ZZB A;  2WP9 A;  4Z2R A;  3C4A A;  4UDP A;  2RGJ A;  3AED A;  4Z24 A;  1ELI A;  2H89 A;  4YT0 A;  3S61 A;  3NRN A;  5KXJ A;  2FBW A;  3ADA B;  5IQ4 A;  1H7W A;  2CVJ A;  4U8O A;  5HYM A;  4YTM A;  4Z43 A;  2X99 A;  3HZL A;  3PO7 A;  2ZBW A;  1B8S A;  4H4P A;  4U2T A;  3NK2 X;  3CPH G;  3KVE A;  2EQ7 A;  1PBD A;  2BK4 A;  1PN0 A;  2YLW A;  3IHM A;  1FL2 A;  3AEE A;  4U8J A;  1QLB A;  2E1M A;  2GR1 A;  3M12 A;  4H4S A;  3SFE A;  4CY6 A;  3COX A;  2H88 A;  1TYT A;  4K5S A;  5FMH A;  5GRT A;  1CC2 A;  1S2Y A;  4Z2T A;  1TDN A;  3PVC A;  1AOG A;  1EL7 A;  1GTE A;  1TYP A;  2GR0 A;  3OZ2 A;  2XVJ A;  2YG3 A;  4H4W A;  1PDH A;  1JU2 A;  3FPZ A;  1NAA A;  2YR5 A;  4J34 A;  3UCL A;  1XPQ A;  1CJC A;  3L1R A;  1PXA A;  1DOE A;  1LPF A;  3EAO A;  1GRB A;  3IC9 A;  2WP6 A;  1GRH A;  1CHU A;  3PS9 A;  4NTD A;  2FJB A;  4EMJ A;  1H6V A;  3BI5 A;  1NPX A;  1ZY8 A;  3LAD A;  2BAC A;  2YR4 A;  4IV9 A;  1H83 A;  3NGC X;  1TDF A;  3E1T A;  3I3L A;  4GCM A;  4NZH A;  1QO8 A;  3AXB A;  1N1P A;  4U2S A;  1S2Q A;  1B4V A;  2C3C A;  1XHC A;  2WEU A;  3NTD A;  4U8P A;  2GR2 A;  4B66 A;  4CRT A;  3GD3 A;  1DJQ A;  2VOU A;  4EMW A;  3RP6 A;  2C65 A;  2NVK X;  2A87 A;  2V6O A;  3K7T A;  1ZP0 A;  1H86 A;  1YQ3 A;  1P2E A;  2PYX A;  1KFY A;  4D03 A;  1CJ2 A;  3P4P A;  3O0H A;  1IJH A;  1BWC A;  1S3E A;  4CNK A;  2GAG B;  1GSN A;  2PHH A;  2YM2 A;  3JSK A;  1PBE A;  1XDI A;  3H4K A;  3ISH A;  5EB4 A;  4K5R A;  4MJW A;  2JKC A;  2BCG G;  1S3B A;  1DOB A;  1JEH A;  1ZOV A;  2WS3 A;  3NK1 X;  4K7Z A;  3UTE A;  3V76 A;  4YKG A;  2BC1 A;  2R4J A;  2XLU A;  3AYJ A;  2VZ2 A;  3CGE A;  4WCT A;  4U8M A;  3KPF A;  5BUL A;  5JCK A;  3AWI A;  1O95 A;  4H4X A;  4YSZ A;  3AB1 A;  2IVE A;  1ZMD A;  1KSU A;  2B9X A;  1IUT A;  2VQ7 A;  4U2L A;  4OPL A;  1N4W A;  3G5S A;  5CKU A;  5M10 A;  3UKK A;  3AEC A;  2WDR A;  5BVA A;  2WOI A;  4PAA A;  4JN9 A;  2EQ8 A;  4TM1 A;  2A89 A;  1VQW A;  2XVE A;  2XVF A;  2GMJ A;  2XVH A;  5FS8 A;  1LV0 A;  3CNT A;  4U8N A;  3NIX A;  4REK A;  1D7Y A;  2I0Z A;  3SGL A;  3ATR A;  1E1K A;  4OCG A;  1L0V A;  1PHH A;  1VRQ B;  2XDO A;  1OJT A;  3ALJ A;  2Q6U A;  2YLZ A;  4GF7 A;  3KA7 A;  2WU2 A;  3NN0 X;  4LA1 A;  3K7M X;  4IVM B;  4DGK A;  5KWF A;  1EL5 A;  3AYI A;  1N4U A;  3LOV A;  2GAH B;  2R0G A;  4IA6 A;  4USQ A;  5FS6 A;  4GUV A;  5HHF A;  2CDU A;  2V61 A;  2UZZ A;  4H7U A;  4B1B A;  1IUW A;  3GMB A;  1YKJ A;  5JCN A;  2GV8 A;  1E39 A;  3UP5 A;  4YSX A;  3FMW A;  3NTA A;  2XLP A;  3AE1 A;  2AQJ A;  3CGD A;  2WES A;  1COY A;  3EAN A;  3NT6 A;  1N4V A;  1ZK7 A;  4GR1 A;  4X9M A;  5ER0 A;  4NTE A;  4BJZ A;  3DK4 A;  2YLS A;  3UOY A;  1PJ7 A;  3RP7 A;  3VQR A;  1UKV G;  2BXS A;  3ALL A;  3BI4 A;  4IVO B;  5FS7 A;  4U8I A;  3NHO X;  2OA1 A;  4USR A;  1K0J A;  3QJ4 A;  2YG6 A;  1H81 A;  2XLR A;  1FEC A;  3NH3 X;  4LII A;  3F8R A;  3UTG A;  4A65 A;  3ZYX A;  2FJE A;  2GRT A;  3QSE A;  3G5Q A;  1K4Q A;  3ICS A;  2BAB A;  3NG7 X;  3DK9 A;  5EBK A;  3V3O A;  4YXD A;  4JQ9 A;  1K0L A;  4J31 A;  1TDE A;  1NEN A;  2AAQ A;  2GQW A;  2YAU A;  2Y6R A;  2Y6Q A;  3BHK A;  3KU9 A;  1YY5 A;  4Y4L A;  3RHA A;  2XLS A;  3VRA A;  3IF9 A;  1L9C A;  1F8W A;  2WDQ A;  2GMH A;  4A79 A;  3LB8 A;  3G5R A;  4ZN0 A;  1JNZ A;  1LQU A;  3V3N A;  1BGJ A;  2GB0 A;  3F8D A;  1GER A;  4BK1 A;  2VQB A;  3SM8 A;  1NHQ A;  2V3A A;  2OLN A;  2QA1 A;  5M0Z A;  4ECH A;  3RP8 A;  4BV6 A;  3DGH A;  4I59 A;  3NLC A;  1L9D A;  1GTH A;  3P1W A;  2R46 A;  4O5U A;  1CC4 A;  3BHF A;  2GQF A;  1D5T A;  1ZKQ A;  2YG7 A;  3AE4 A;  5HY5 A;  3NNE A;  4YSY A;  4TM4 A;  3QVP A;  4IA5 A;  1GOS A;  3AYL A;  4XWR A;  1DXL A;  1KNR A;  1TDO A;  4UDQ A;  2R0C A;  2BK3 A;  2X8G A;  2XFU A;  1NHP A;  1H82 A;  3FIM B;  3Q9T A;  4OPC A;  3AE2 A;  2QAE A;  4AT0 A;  1Y56 B;  4GDE A;  4Z2U A;  3IWA A;  4KPR A;  3NYF A;  4B69 A;  1REO A;  5C2T A;  2GR3 A;  5KOX A;  2DKI A;  2R4E A;  4A5L A;  1F6M A;  2IVD A;  4JNA A;  4J33 A;  5IQ1 A;  1E7P A;  1KDG A;  3NKS A;  2RGH A;  4K8D A;  2C72 A;  2R0P A;  4EMI A;  3H8I A;  2JK6 A;  1LVL A;  4GRT A;  3FG2 P;  1K0I A;  3GDP A;  4YWO A;  2WPF A;  3DME A;  4APN A;  5HXI A;  2APG A;  2Q0L A;  3GWF A;  1CL0 A;  4EM4 A;  1ZDL A;  2X8C A;  1LJ1 A;  3DJD A;  3DGZ A;  4FDC B;  4FK1 A;  3SQP A;  3QSS A;  3UKL A;  1Q9I A;  5J60 A;  2WU5 A;  4J36 A;  3UTF A;  1P2H A;  2GF3 A;  3L8K A;  4H2R A;  1F8R A;  2VVM A;  5KVI A;  4AP1 A;  4AP3 A;  1KF6 A;  3AEA A;  3K7Q X;  1Y56 A;  1KNP A;  4HA6 A;  1OJC A;  1PBC A;  2YVG A;  1Q1R A;  1JRX A;  4H2N A;  2AR8 A;  2YM1 A;  1MO9 A;  5DBJ A;  1Y0P A;  1M6I A;  3UOX A;  1NHS A;  1OJA A;  4Y4M A;  2YVJ A;  4U8K A;  3LJP A;  1D4E A;  3NN6 X;  5CQF A;  1GRA A;  2B9Y A;  3P4S A;  1FCD A;  2WPE A;  3QVR A;  4FK1 C;  1F8S A;  1LQT A;  2OAM A;  3RNM A;  1GAL A;  3C96 A;  3P4Q A;  2B9W A;  1E1M A;  2V5Z A;  2CFY A;  3CNS A;  4KX6 A;  2WET A;  2R45 A;  4J57 A;  3GYI A;  5JCI A;  1BGN A;  4C3X A;  3AE5 A;  1E1N A;  1E6E A;  1FEA A;  1GRT A;  3Q6J A;  2R9Z A;  4RSL A;  4J56 A;  2V3B A;  3QSM A;  3AE3 A;  4YSH A;  2B7R A;  5L46 A;  1PXB A;  1BZL A;  2Z5Y A;  4DSG A;  3BI2 A;  3KD9 A;  3B3R A;  5KRQ A;  4H50 A;  2TPR A; 
#chains in the Genus database with same CATH topology
 2Q0K A;  2YG4 A;  3UKH A;  3DJJ A;  4A9W A;  1GT8 A;  3UKF A;  3DH9 A;  4OPU A;  1CC6 A;  2O9Z A;  4C5O A;  2Z5X A;  2XFO A;  3HYX A;  4ADW A;  1PJ6 A;  3AE7 A;  3F8P A;  5J7X A;  1V59 A;  4XXG A;  5BUK A;  2XFN A;  4ICY A;  4TM0 A;  1B5Q A;  1JNR A;  2DKH A;  4X9N A;  3AE6 A;  4JY2 A;  4H4T A;  1D7L A;  2HQM A;  4TLX A;  2X50 A;  2C73 A;  3ITJ A;  1RP0 A;  3BNM A;  2JAE A;  3KLJ A;  4RG4 A;  5U63 A;  4JY3 A;  4CY8 A;  2BS3 A;  1IUV A;  1QJD A;  1BF3 A;  5U1O A;  2B76 A;  2WP5 A;  4EQR A;  4U8L A;  3GMC A;  4UP3 A;  3NYC A;  2Q7V A;  1IUX A;  1DNC A;  1FEB A;  2XYO A;  4OPD A;  3ZDN A;  4Z25 A;  1KSS A;  2YLT A;  2RAB A;  1CBO A;  4P9S A;  4H4U A;  1GPE A;  3CGB A;  2C3D A;  1TDK A;  1DOC A;  2QA2 A;  4TLZ A;  3UOZ A;  4DNA A;  5FS9 A;  2ARD A;  3KKJ A;  4FX9 A;  4YKF A;  1NG4 A;  2E5V A;  1TRB A;  2XCG A;  3QFB A;  3AEB A;  3VR9 A;  2BS4 A;  3EPT A;  4J2W A;  4CBQ A;  3DJG X;  4EIP A;  5JCM A;  3AD8 B;  2VRL A;  3GYJ A;  4C3Y A;  4UDR A;  3T37 A;  1YQ4 A;  3VRD B;  1D4C A;  2ZZC A;  3ICT A;  4AT2 A;  1LTX R;  2VRM A;  4A7A A;  4EQS A;  1E1L A;  3B6D A;  1L9E A;  3M0O A;  3CPI G;  3GD4 A;  3WE0 A;  4RG3 A;  1IUU A;  3GRT A;  3BNU A;  2CUL A;  4OVI A;  5IPY A;  2OAL A;  2BC0 A;  2C70 A;  4B68 A;  4CCR A;  2JB1 A;  1SEZ A;  3ICR A;  2A8X A;  4ZCD A;  4O5Q A;  4WX1 A;  3DK8 A;  4C77 A;  2XVI A;  4CCQ A;  4EQW A;  3AEG A;  4CNJ A;  1GND A;  2C67 A;  4B67 A;  3UP4 A;  3IHG A;  2C66 A;  1PJ5 A;  4H4V A;  4HB9 A;  4K22 A;  2B7S A;  1BKW A;  3LZW A;  1ZX9 A;  2ZZ0 A;  1O5W A;  2RGO A;  1B37 A;  2OLO A;  3ATQ A;  4H2Q A;  3FBS A;  4XWZ A;  4Z26 A;  1ONF A;  3AEF A;  4OPG A;  3AE9 A;  4PAB A;  2GVC A;  4BK3 A;  4NWZ A;  1F3P A;  4EQX A;  2YG5 A;  5KMP A;  1MOK A;  3UKQ A;  2C76 A;  4Y4N A;  3NYE A;  3GRS A;  3D1C A;  4BK2 A;  1NDA A;  4YTP A;  1GES A;  1CJ3 A;  2YR6 A;  3EF6 A;  3AD7 B;  3UKA A;  4A99 A;  3LXD A;  3UTH A;  2TMD A;  4NTC A;  2EQ6 A;  4H4R A;  1RYI A;  3P4R A;  3GSI A;  1IUS A;  1JOA A;  1DJN A;  4II2 A;  5GSN A;  3D8X A;  3GDN A;  4AOS A;  2C4C A;  2FJA A;  1GV4 A;  3CNJ A;  3S5W A;  1JRZ A;  3I6D A;  2VVL G;  4X4J A;  1DOD A;  2C75 A;  3II4 A;  4A6N B;  2BCP A;  3CMM A;  2BXR A;  4M52 A;  3K30 A;  1GXF A;  3ABV A;  5KVH A;  1ZOY A;  4B64 A;  1PS9 A;  2JBV A;  1NEK A;  1Z6L A;  1RSG A;  4N9X A;  2XLT A;  1YQZ A;  1EL9 A;  4NEV A;  1D4D A;  4G74 A;  1EBD A;  2BS2 A;  2V60 A;  2BA9 A;  2WOV A;  4NNJ A;  3UOV A;  2F5Z A;  4H4Z A;  3VRB A;  2WPC A;  2YWL A;  2X3N A;  3DA1 A;  1VG9 A;  3OC4 A;  4I58 A;  2GH5 A;  2IID A;  1GEU A;  2WBA A;  4GAV A;  3C4N A;  2YVF A;  2NPX A;  3P9U A;  1O94 A;  2J3N A;  4A6N A;  2BYB A;  3QFA A;  5C3J A;  1Q1W A;  3SZC A;  1H7X A;  2EQ9 A;  1PXC A;  5LV9 A;  2BK5 A;  1NG3 A;  2GEW A;  4OPT A;  1OJD A;  2JB2 A;  2C7G A;  2VVL A;  4K2X A;  5EB5 A;  4D04 A;  2E4G A;  1GRF A;  4G9K A;  1JRY A;  3CN8 A;  1VG0 A;  1CF3 A;  3M13 A;  4E0V A;  5KOW A;  2JB3 A;  3LZX A;  4JDR A;  1PBF A;  4G73 A;  3RED A;  1VDC A;  1MXT A;  2QCU A;  5BRT A;  2WQY A;  5KNL A;  2XFP A;  3R9U A;  3CTY A;  2YLX A;  1XAN A;  3DJE A;  3H8L A;  4II3 A;  2YQU A;  1FOH A;  4H4Q A;  1M64 A;  2ACZ A;  2W0H A;  3CIR A;  1GRG A;  3AD9 B;  1PBB A;  2WOW A;  2FJD A;  5JCL A;  1X31 B;  4NEW A;  1EL8 A;  2WDV A;  4EM3 A;  4YTN A;  1OJ9 A;  1GET A;  4B63 A;  1H84 A;  1HYU A;  3NK0 X;  3ALM A;  3CND A;  4TM3 A;  3URH A;  2C64 A;  3UKP A;  4ZCC A;  4G6G A;  4OPI A;  4JNQ A;  5TR3 A;  4EIQ A;  1GRE A;  4B65 A;  3T2K A;  2XFQ A;  3AE8 A;  4BJY A;  4H4Y A;  4C74 A;  3CNP A;  4LU6 A;  5U25 A;  4BUR A;  2YLR A;  3SFD A;  1ZMC A;  5EOW A;  4H2P A;  4AOX A;  4Z44 A;  1W4X A;  1NHR A;  3CPJ G;  1CJ4 A;  4GDP A;  2WHD A;  3CGC A;  3GWD A;  2X8H A;  4DSH A;  3VR8 A;  2ZZB A;  2WP9 A;  4Z2R A;  3C4A A;  4UDP A;  2RGJ A;  3AED A;  4Z24 A;  1ELI A;  2H89 A;  4YT0 A;  3S61 A;  3NRN A;  5KXJ A;  2FBW A;  5KMQ A;  3ADA B;  5IQ4 A;  1H7W A;  2CVJ A;  4U8O A;  5HYM A;  4YTM A;  4Z43 A;  2X99 A;  3HZL A;  3PO7 A;  2ZBW A;  1B8S A;  4H4P A;  4U2T A;  3NK2 X;  3CPH G;  3KVE A;  2EQ7 A;  1PBD A;  2BK4 A;  1PN0 A;  2BRA A;  2YLW A;  3IHM A;  1FL2 A;  3AEE A;  4U8J A;  1QLB A;  2E1M A;  2GR1 A;  3M12 A;  4H4S A;  3SFE A;  4CY6 A;  3COX A;  2H88 A;  1TYT A;  4K5S A;  5FMH A;  5GRT A;  1CC2 A;  1S2Y A;  4Z2T A;  1TDN A;  3PVC A;  1AOG A;  1EL7 A;  1GTE A;  1TYP A;  2GR0 A;  3OZ2 A;  2XVJ A;  2YG3 A;  4H4W A;  1PDH A;  1JU2 A;  3FPZ A;  1NAA A;  2YR5 A;  4J34 A;  3UCL A;  1XPQ A;  1CJC A;  3L1R A;  1PXA A;  1DOE A;  1LPF A;  3EAO A;  1GRB A;  3IC9 A;  2WP6 A;  1GRH A;  1CHU A;  3PS9 A;  4NTD A;  2FJB A;  4EMJ A;  1H6V A;  3BI5 A;  1NPX A;  1ZY8 A;  3LAD A;  2BAC A;  3T14 A;  2YR4 A;  4IV9 A;  1H83 A;  3NGC X;  1TDF A;  3E1T A;  3I3L A;  4GCM A;  4NZH A;  1QO8 A;  3AXB A;  1N1P A;  4U2S A;  1S2Q A;  1B4V A;  2C3C A;  1XHC A;  2WEU A;  3NTD A;  4U8P A;  2GR2 A;  4B66 A;  4CRT A;  3GD3 A;  1DJQ A;  2VOU A;  4EMW A;  3RP6 A;  2C65 A;  2NVK X;  2A87 A;  2V6O A;  3K7T A;  1ZP0 A;  1H86 A;  1YQ3 A;  1P2E A;  2PYX A;  1KFY A;  3SY4 A;  4D03 A;  1CJ2 A;  3P4P A;  3O0H A;  1IJH A;  1BWC A;  1S3E A;  4CNK A;  2GAG B;  1GSN A;  2PHH A;  2YM2 A;  3JSK A;  1PBE A;  1XDI A;  3T2Z A;  3H4K A;  3ISH A;  5EB4 A;  4K5R A;  4MJW A;  2JKC A;  2BCG G;  1S3B A;  1DOB A;  1JEH A;  1ZOV A;  2WS3 A;  3NK1 X;  4K7Z A;  3UTE A;  3V76 A;  4YKG A;  2BC1 A;  2R4J A;  2XLU A;  3AYJ A;  2VZ2 A;  3CGE A;  4WCT A;  4U8M A;  3KPF A;  3GYX A;  5BUL A;  5JCK A;  3AWI A;  1O95 A;  4H4X A;  3SZ0 A;  4YSZ A;  3AB1 A;  2IVE A;  1ZMD A;  1KSU A;  2B9X A;  1IUT A;  2VQ7 A;  4U2L A;  4OPL A;  1N4W A;  3G5S A;  5CKU A;  5M10 A;  3UKK A;  3AEC A;  2WDR A;  5BVA A;  2WOI A;  4PAA A;  4JN9 A;  2EQ8 A;  4TM1 A;  2A89 A;  1VQW A;  2XVE A;  2XVF A;  2GMJ A;  2XVH A;  5FS8 A;  1LV0 A;  3CNT A;  4U8N A;  3NIX A;  4REK A;  1D7Y A;  2I0Z A;  3SGL A;  3ATR A;  1E1K A;  4OCG A;  1L0V A;  1PHH A;  1VRQ B;  2XDO A;  1OJT A;  3ALJ A;  2Q6U A;  2YLZ A;  4GF7 A;  3KA7 A;  2WU2 A;  3NN0 X;  4LA1 A;  3K7M X;  4IVM B;  4DGK A;  5KWF A;  1EL5 A;  4GAP A;  3AYI A;  1N4U A;  3LOV A;  2GAH B;  2R0G A;  4IA6 A;  4USQ A;  5FS6 A;  4GUV A;  5HHF A;  2CDU A;  2V61 A;  2UZZ A;  4H7U A;  4B1B A;  3SX6 A;  1IUW A;  3GMB A;  1YKJ A;  5JCN A;  2GV8 A;  1E39 A;  3UP5 A;  4YSX A;  3FMW A;  3SYI A;  3NTA A;  2XLP A;  3AE1 A;  2AQJ A;  3CGD A;  2WES A;  1COY A;  3EAN A;  3NT6 A;  1N4V A;  1ZK7 A;  4GR1 A;  4X9M A;  5ER0 A;  4NTE A;  4BJZ A;  3DK4 A;  2YLS A;  3UOY A;  1PJ7 A;  3T0K A;  3RP7 A;  3VQR A;  1UKV G;  2BXS A;  3ALL A;  3BI4 A;  4IVO B;  5FS7 A;  4U8I A;  3NHO X;  5KMR A;  2OA1 A;  4USR A;  1K0J A;  3QJ4 A;  2YG6 A;  1H81 A;  2XLR A;  1FEC A;  3NH3 X;  4LII A;  3F8R A;  3UTG A;  4A65 A;  3ZYX A;  2FJE A;  2GRT A;  3QSE A;  3G5Q A;  1K4Q A;  3HYW A;  3ICS A;  2BAB A;  3NG7 X;  3DK9 A;  5EBK A;  3V3O A;  4YXD A;  4JQ9 A;  1K0L A;  4J31 A;  1TDE A;  1NEN A;  2AAQ A;  2GQW A;  2YAU A;  2Y6R A;  2Y6Q A;  3BHK A;  3KU9 A;  1YY5 A;  4Y4L A;  3RHA A;  2XLS A;  3VRA A;  3IF9 A;  1L9C A;  1F8W A;  2WDQ A;  2GMH A;  4A79 A;  3LB8 A;  3G5R A;  4ZN0 A;  1JNZ A;  1LQU A;  3V3N A;  1BGJ A;  2GB0 A;  3F8D A;  1GER A;  4BK1 A;  2VQB A;  3SM8 A;  1NHQ A;  3T31 A;  2V3A A;  2OLN A;  2QA1 A;  5M0Z A;  4ECH A;  3RP8 A;  4BV6 A;  3DGH A;  4I59 A;  3NLC A;  1L9D A;  1GTH A;  3P1W A;  2R46 A;  4O5U A;  1CC4 A;  3BHF A;  2GQF A;  1D5T A;  1ZKQ A;  3SXI A;  2YG7 A;  3AE4 A;  5HY5 A;  3NNE A;  4YSY A;  4TM4 A;  3QVP A;  4IA5 A;  1GOS A;  3AYL A;  4XWR A;  1DXL A;  1KNR A;  1TDO A;  4UDQ A;  2R0C A;  2BK3 A;  2X8G A;  2XFU A;  1NHP A;  1H82 A;  3FIM B;  3SZW A;  3Q9T A;  4OPC A;  5KMS A;  3AE2 A;  2QAE A;  4AT0 A;  1Y56 B;  4GDE A;  4Z2U A;  3IWA A;  4KPR A;  3NYF A;  4B69 A;  1REO A;  5C2T A;  2GR3 A;  5KOX A;  2DKI A;  2R4E A;  4A5L A;  1F6M A;  2IVD A;  4JNA A;  4J33 A;  5IQ1 A;  1E7P A;  1KDG A;  3NKS A;  2RGH A;  3KPK A;  4K8D A;  2C72 A;  2R0P A;  4EMI A;  3H8I A;  2JK6 A;  1LVL A;  4GRT A;  3FG2 P;  1K0I A;  3GDP A;  4YWO A;  2WPF A;  3DME A;  4APN A;  5HXI A;  2APG A;  2Q0L A;  3GWF A;  1CL0 A;  4EM4 A;  1ZDL A;  2X8C A;  1LJ1 A;  3DJD A;  3DGZ A;  4FDC B;  4FK1 A;  3SQP A;  3QSS A;  3UKL A;  1Q9I A;  5J60 A;  2WU5 A;  4J36 A;  3UTF A;  1P2H A;  2GF3 A;  3L8K A;  4G6H A;  1F8R A;  2VVM A;  4H2R A;  5KVI A;  4AP1 A;  1KF6 A;  3AEA A;  4AP3 A;  3K7Q X;  1Y56 A;  1KNP A;  4HA6 A;  1OJC A;  1PBC A;  2YVG A;  1Q1R A;  1JRX A;  4H2N A;  2AR8 A;  3HYV A;  2YM1 A;  1MO9 A;  5DBJ A;  1Y0P A;  1M6I A;  3UOX A;  1NHS A;  1OJA A;  4Y4M A;  2YVJ A;  4U8K A;  3LJP A;  1D4E A;  3NN6 X;  5CQF A;  1GRA A;  2B9Y A;  3P4S A;  1FCD A;  2WPE A;  3QVR A;  4FK1 C;  1F8S A;  1LQT A;  2OAM A;  3RNM A;  1GAL A;  3C96 A;  3P4Q A;  2B9W A;  3T2Y A;  1E1M A;  2V5Z A;  2CFY A;  3CNS A;  4KX6 A;  2WET A;  2R45 A;  4J57 A;  3GYI A;  3SZF A;  5JCI A;  2BRY A;  1BGN A;  4C3X A;  3AE5 A;  1E1N A;  1E6E A;  1FEA A;  1GRT A;  3Q6J A;  2R9Z A;  4RSL A;  4J56 A;  2V3B A;  3QSM A;  3AE3 A;  4YSH A;  2B7R A;  5L46 A;  1PXB A;  1BZL A;  2Z5Y A;  4DSG A;  3BI2 A;  3KD9 A;  3B3R A;  5KRQ A;  4H50 A;  2TPR A; 
#chains in the Genus database with same CATH homology
 2Q0K A;  2YG4 A;  3UKH A;  3DJJ A;  4A9W A;  1GT8 A;  3UKF A;  3DH9 A;  4OPU A;  1CC6 A;  2O9Z A;  4C5O A;  2Z5X A;  2XFO A;  3HYX A;  4ADW A;  1PJ6 A;  3AE7 A;  3F8P A;  5J7X A;  1V59 A;  4XXG A;  5BUK A;  2XFN A;  4ICY A;  4TM0 A;  1B5Q A;  1JNR A;  2DKH A;  4X9N A;  3AE6 A;  4JY2 A;  4H4T A;  1D7L A;  2HQM A;  4TLX A;  2X50 A;  2C73 A;  3ITJ A;  1RP0 A;  3BNM A;  2JAE A;  3KLJ A;  4RG4 A;  5U63 A;  4JY3 A;  4CY8 A;  2BS3 A;  1IUV A;  1QJD A;  1BF3 A;  5U1O A;  2B76 A;  2WP5 A;  4EQR A;  4U8L A;  3GMC A;  4UP3 A;  3NYC A;  2Q7V A;  1IUX A;  1DNC A;  1FEB A;  2XYO A;  4OPD A;  3ZDN A;  4Z25 A;  1KSS A;  2YLT A;  2RAB A;  1CBO A;  4P9S A;  4H4U A;  1GPE A;  3CGB A;  2C3D A;  1TDK A;  1DOC A;  2QA2 A;  4TLZ A;  3UOZ A;  4DNA A;  5FS9 A;  2ARD A;  3KKJ A;  4FX9 A;  4YKF A;  1NG4 A;  2E5V A;  1TRB A;  2XCG A;  3QFB A;  3AEB A;  3VR9 A;  2BS4 A;  3EPT A;  4J2W A;  4CBQ A;  3DJG X;  4EIP A;  5JCM A;  3AD8 B;  2VRL A;  3GYJ A;  4C3Y A;  4UDR A;  3T37 A;  1YQ4 A;  3VRD B;  1D4C A;  2ZZC A;  3ICT A;  4AT2 A;  1LTX R;  2VRM A;  4A7A A;  4EQS A;  1E1L A;  3B6D A;  1L9E A;  3M0O A;  3CPI G;  3GD4 A;  3WE0 A;  4RG3 A;  1IUU A;  3GRT A;  3BNU A;  2CUL A;  4OVI A;  5IPY A;  2OAL A;  2BC0 A;  2C70 A;  4B68 A;  4CCR A;  2JB1 A;  1SEZ A;  3ICR A;  2A8X A;  4ZCD A;  4O5Q A;  4WX1 A;  3DK8 A;  4C77 A;  2XVI A;  4CCQ A;  4EQW A;  3AEG A;  4CNJ A;  1GND A;  2C67 A;  4B67 A;  3UP4 A;  3IHG A;  2C66 A;  1PJ5 A;  4H4V A;  4HB9 A;  4K22 A;  2B7S A;  1BKW A;  3LZW A;  1ZX9 A;  2ZZ0 A;  1O5W A;  2RGO A;  1B37 A;  2OLO A;  3ATQ A;  4H2Q A;  3FBS A;  4XWZ A;  4Z26 A;  1ONF A;  3AEF A;  4OPG A;  3AE9 A;  4PAB A;  2GVC A;  4BK3 A;  4NWZ A;  1F3P A;  4EQX A;  2YG5 A;  5KMP A;  1MOK A;  3UKQ A;  2C76 A;  4Y4N A;  3NYE A;  3GRS A;  3D1C A;  4BK2 A;  1NDA A;  4YTP A;  1GES A;  1CJ3 A;  2YR6 A;  3EF6 A;  3AD7 B;  3UKA A;  4A99 A;  3LXD A;  3UTH A;  2TMD A;  4NTC A;  2EQ6 A;  4H4R A;  1RYI A;  3P4R A;  3GSI A;  1IUS A;  1JOA A;  1DJN A;  4II2 A;  5GSN A;  3D8X A;  3GDN A;  4AOS A;  2C4C A;  2FJA A;  1GV4 A;  3CNJ A;  3S5W A;  1JRZ A;  3I6D A;  2VVL G;  4X4J A;  1DOD A;  2C75 A;  3II4 A;  4A6N B;  2BCP A;  3CMM A;  2BXR A;  4M52 A;  3K30 A;  1GXF A;  3ABV A;  5KVH A;  1ZOY A;  4B64 A;  1PS9 A;  2JBV A;  1NEK A;  1Z6L A;  1RSG A;  4N9X A;  2XLT A;  1YQZ A;  1EL9 A;  4NEV A;  1D4D A;  4G74 A;  1EBD A;  2BS2 A;  2V60 A;  2BA9 A;  2WOV A;  4NNJ A;  3UOV A;  2F5Z A;  4H4Z A;  3VRB A;  2WPC A;  2YWL A;  2X3N A;  3DA1 A;  1VG9 A;  3OC4 A;  4I58 A;  2GH5 A;  2IID A;  1GEU A;  2WBA A;  4GAV A;  3C4N A;  2YVF A;  2NPX A;  3P9U A;  1O94 A;  2J3N A;  4A6N A;  2BYB A;  3QFA A;  5C3J A;  1Q1W A;  3SZC A;  1H7X A;  2EQ9 A;  1PXC A;  5LV9 A;  2BK5 A;  1NG3 A;  2GEW A;  4OPT A;  1OJD A;  2JB2 A;  2C7G A;  2VVL A;  4K2X A;  5EB5 A;  4D04 A;  2E4G A;  1GRF A;  4G9K A;  1JRY A;  3CN8 A;  1VG0 A;  1CF3 A;  3M13 A;  4E0V A;  5KOW A;  2JB3 A;  3LZX A;  4JDR A;  1PBF A;  4G73 A;  3RED A;  1VDC A;  1MXT A;  2QCU A;  5BRT A;  2WQY A;  5KNL A;  2XFP A;  3R9U A;  3CTY A;  2YLX A;  1XAN A;  3DJE A;  3H8L A;  4II3 A;  2YQU A;  1FOH A;  4H4Q A;  1M64 A;  2ACZ A;  2W0H A;  3CIR A;  1GRG A;  3AD9 B;  1PBB A;  2WOW A;  2FJD A;  5JCL A;  1X31 B;  4NEW A;  1EL8 A;  2WDV A;  4EM3 A;  4YTN A;  1OJ9 A;  1GET A;  4B63 A;  1H84 A;  1HYU A;  3NK0 X;  3ALM A;  3CND A;  4TM3 A;  3URH A;  2C64 A;  3UKP A;  4ZCC A;  4G6G A;  4OPI A;  4JNQ A;  5TR3 A;  4EIQ A;  1GRE A;  4B65 A;  3T2K A;  2XFQ A;  3AE8 A;  4BJY A;  4H4Y A;  4C74 A;  3CNP A;  4LU6 A;  5U25 A;  4BUR A;  2YLR A;  3SFD A;  1ZMC A;  5EOW A;  4H2P A;  4AOX A;  4Z44 A;  1W4X A;  1NHR A;  3CPJ G;  1CJ4 A;  4GDP A;  2WHD A;  3CGC A;  3GWD A;  2X8H A;  4DSH A;  3VR8 A;  2ZZB A;  2WP9 A;  4Z2R A;  3C4A A;  4UDP A;  2RGJ A;  3AED A;  4Z24 A;  1ELI A;  2H89 A;  4YT0 A;  3S61 A;  3NRN A;  5KXJ A;  2FBW A;  5KMQ A;  3ADA B;  5IQ4 A;  1H7W A;  2CVJ A;  4U8O A;  5HYM A;  4YTM A;  4Z43 A;  2X99 A;  3HZL A;  3PO7 A;  2ZBW A;  1B8S A;  4H4P A;  4U2T A;  3NK2 X;  3CPH G;  3KVE A;  2EQ7 A;  1PBD A;  2BK4 A;  1PN0 A;  2BRA A;  2YLW A;  3IHM A;  1FL2 A;  3AEE A;  4U8J A;  1QLB A;  2E1M A;  2GR1 A;  3M12 A;  4H4S A;  3SFE A;  4CY6 A;  3COX A;  2H88 A;  1TYT A;  4K5S A;  5FMH A;  5GRT A;  1CC2 A;  1S2Y A;  4Z2T A;  1TDN A;  3PVC A;  1AOG A;  1EL7 A;  1GTE A;  1TYP A;  2GR0 A;  3OZ2 A;  2XVJ A;  2YG3 A;  4H4W A;  1PDH A;  1JU2 A;  3FPZ A;  1NAA A;  2YR5 A;  4J34 A;  3UCL A;  1XPQ A;  1CJC A;  3L1R A;  1PXA A;  1DOE A;  1LPF A;  3EAO A;  1GRB A;  3IC9 A;  2WP6 A;  1GRH A;  1CHU A;  3PS9 A;  4NTD A;  2FJB A;  4EMJ A;  1H6V A;  3BI5 A;  1NPX A;  1ZY8 A;  3LAD A;  2BAC A;  3T14 A;  2YR4 A;  4IV9 A;  1H83 A;  3NGC X;  1TDF A;  3E1T A;  3I3L A;  4GCM A;  4NZH A;  1QO8 A;  3AXB A;  1N1P A;  4U2S A;  1S2Q A;  1B4V A;  2C3C A;  1XHC A;  2WEU A;  3NTD A;  4U8P A;  2GR2 A;  4B66 A;  4CRT A;  3GD3 A;  1DJQ A;  2VOU A;  4EMW A;  3RP6 A;  2C65 A;  2NVK X;  2A87 A;  2V6O A;  3K7T A;  1ZP0 A;  1H86 A;  1YQ3 A;  1P2E A;  2PYX A;  1KFY A;  3SY4 A;  4D03 A;  1CJ2 A;  3P4P A;  3O0H A;  1IJH A;  1BWC A;  1S3E A;  4CNK A;  2GAG B;  1GSN A;  2PHH A;  2YM2 A;  3JSK A;  1PBE A;  1XDI A;  3T2Z A;  3H4K A;  3ISH A;  5EB4 A;  4K5R A;  4MJW A;  2JKC A;  2BCG G;  1S3B A;  1DOB A;  1JEH A;  1ZOV A;  2WS3 A;  3NK1 X;  4K7Z A;  3UTE A;  3V76 A;  4YKG A;  2BC1 A;  2R4J A;  2XLU A;  3AYJ A;  2VZ2 A;  3CGE A;  4WCT A;  4U8M A;  3KPF A;  3GYX A;  5BUL A;  5JCK A;  3AWI A;  1O95 A;  4H4X A;  3SZ0 A;  4YSZ A;  3AB1 A;  2IVE A;  1ZMD A;  1KSU A;  2B9X A;  1IUT A;  2VQ7 A;  4U2L A;  4OPL A;  1N4W A;  3G5S A;  5CKU A;  5M10 A;  3UKK A;  3AEC A;  2WDR A;  5BVA A;  2WOI A;  4PAA A;  4JN9 A;  2EQ8 A;  4TM1 A;  2A89 A;  1VQW A;  2XVE A;  2XVF A;  2GMJ A;  2XVH A;  5FS8 A;  1LV0 A;  3CNT A;  4U8N A;  3NIX A;  4REK A;  1D7Y A;  2I0Z A;  3SGL A;  3ATR A;  1E1K A;  4OCG A;  1L0V A;  1PHH A;  1VRQ B;  2XDO A;  1OJT A;  3ALJ A;  2Q6U A;  2YLZ A;  4GF7 A;  3KA7 A;  2WU2 A;  3NN0 X;  4LA1 A;  3K7M X;  4IVM B;  4DGK A;  5KWF A;  1EL5 A;  4GAP A;  3AYI A;  1N4U A;  3LOV A;  2GAH B;  2R0G A;  4IA6 A;  4USQ A;  5FS6 A;  4GUV A;  5HHF A;  2CDU A;  2V61 A;  2UZZ A;  4H7U A;  4B1B A;  3SX6 A;  1IUW A;  3GMB A;  1YKJ A;  5JCN A;  2GV8 A;  1E39 A;  3UP5 A;  4YSX A;  3FMW A;  3SYI A;  3NTA A;  2XLP A;  3AE1 A;  2AQJ A;  3CGD A;  2WES A;  1COY A;  3EAN A;  3NT6 A;  1N4V A;  1ZK7 A;  4GR1 A;  4X9M A;  5ER0 A;  4NTE A;  4BJZ A;  3DK4 A;  2YLS A;  3UOY A;  1PJ7 A;  3T0K A;  3RP7 A;  3VQR A;  1UKV G;  2BXS A;  3ALL A;  3BI4 A;  4IVO B;  5FS7 A;  4U8I A;  3NHO X;  5KMR A;  2OA1 A;  4USR A;  1K0J A;  3QJ4 A;  2YG6 A;  1H81 A;  2XLR A;  1FEC A;  3NH3 X;  4LII A;  3F8R A;  3UTG A;  4A65 A;  3ZYX A;  2FJE A;  2GRT A;  3QSE A;  3G5Q A;  1K4Q A;  3HYW A;  3ICS A;  2BAB A;  3NG7 X;  3DK9 A;  5EBK A;  3V3O A;  4YXD A;  4JQ9 A;  1K0L A;  4J31 A;  1TDE A;  1NEN A;  2AAQ A;  2GQW A;  2YAU A;  2Y6R A;  2Y6Q A;  3BHK A;  3KU9 A;  1YY5 A;  4Y4L A;  3RHA A;  2XLS A;  3VRA A;  3IF9 A;  1L9C A;  1F8W A;  2WDQ A;  2GMH A;  4A79 A;  3LB8 A;  3G5R A;  4ZN0 A;  1JNZ A;  1LQU A;  3V3N A;  1BGJ A;  2GB0 A;  3F8D A;  1GER A;  4BK1 A;  2VQB A;  3SM8 A;  1NHQ A;  3T31 A;  2V3A A;  2OLN A;  2QA1 A;  5M0Z A;  4ECH A;  3RP8 A;  4BV6 A;  3DGH A;  4I59 A;  3NLC A;  1L9D A;  1GTH A;  3P1W A;  2R46 A;  4O5U A;  1CC4 A;  3BHF A;  2GQF A;  1D5T A;  1ZKQ A;  3SXI A;  2YG7 A;  3AE4 A;  5HY5 A;  3NNE A;  4YSY A;  4TM4 A;  3QVP A;  4IA5 A;  1GOS A;  3AYL A;  4XWR A;  1DXL A;  1KNR A;  1TDO A;  4UDQ A;  2R0C A;  2BK3 A;  2X8G A;  2XFU A;  1NHP A;  1H82 A;  3FIM B;  3SZW A;  3Q9T A;  4OPC A;  5KMS A;  3AE2 A;  2QAE A;  4AT0 A;  1Y56 B;  4GDE A;  4Z2U A;  3IWA A;  4KPR A;  3NYF A;  4B69 A;  1REO A;  5C2T A;  2GR3 A;  5KOX A;  2DKI A;  2R4E A;  4A5L A;  1F6M A;  2IVD A;  4JNA A;  4J33 A;  5IQ1 A;  1E7P A;  1KDG A;  3NKS A;  2RGH A;  3KPK A;  4K8D A;  2C72 A;  2R0P A;  4EMI A;  3H8I A;  2JK6 A;  1LVL A;  4GRT A;  3FG2 P;  1K0I A;  3GDP A;  4YWO A;  2WPF A;  3DME A;  4APN A;  5HXI A;  2APG A;  2Q0L A;  3GWF A;  1CL0 A;  4EM4 A;  1ZDL A;  2X8C A;  1LJ1 A;  3DJD A;  3DGZ A;  4FDC B;  4FK1 A;  3SQP A;  3QSS A;  3UKL A;  1Q9I A;  5J60 A;  2WU5 A;  4J36 A;  3UTF A;  1P2H A;  2GF3 A;  3L8K A;  4G6H A;  1F8R A;  2VVM A;  4H2R A;  5KVI A;  4AP1 A;  1KF6 A;  3AEA A;  4AP3 A;  3K7Q X;  1Y56 A;  1KNP A;  4HA6 A;  1OJC A;  1PBC A;  2YVG A;  1Q1R A;  1JRX A;  4H2N A;  2AR8 A;  3HYV A;  2YM1 A;  1MO9 A;  5DBJ A;  1Y0P A;  1M6I A;  3UOX A;  1NHS A;  1OJA A;  4Y4M A;  2YVJ A;  4U8K A;  3LJP A;  1D4E A;  3NN6 X;  5CQF A;  1GRA A;  2B9Y A;  3P4S A;  1FCD A;  2WPE A;  3QVR A;  4FK1 C;  1F8S A;  1LQT A;  2OAM A;  3RNM A;  1GAL A;  3C96 A;  3P4Q A;  2B9W A;  3T2Y A;  1E1M A;  2V5Z A;  2CFY A;  3CNS A;  4KX6 A;  2WET A;  2R45 A;  4J57 A;  3GYI A;  3SZF A;  5JCI A;  2BRY A;  1BGN A;  4C3X A;  3AE5 A;  1E1N A;  1E6E A;  1FEA A;  1GRT A;  3Q6J A;  2R9Z A;  4RSL A;  4J56 A;  2V3B A;  3QSM A;  3AE3 A;  4YSH A;  2B7R A;  5L46 A;  1PXB A;  1BZL A;  2Z5Y A;  4DSG A;  3BI2 A;  3KD9 A;  3B3R A;  5KRQ A;  4H50 A;  2TPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...