2VQ7A

Bacterial flavin-containing monooxygenase in complex with nadp: native data
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
443
structure length
443
Chain Sequence
b'TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
molecule tags Oxidoreductase
total genus 159
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A02
2BYBA 2RGHA 4YSZA 5KVHA 1Q1RA 2YM2A 3AD8B 4M52A 3DJEA 5KXJA 5EB4A 3Q9TA 3DJGX 4D03A 1D7LA 1YQ3A 3BI5A 4BK1A 1RP0A 2CVJA 1GRBA 3ZYXA 5JCIA 4BJZA 2EQ9A 3CGCA 4NZHA 5JCMA 5TR3A 1GTEA 3ICSA 3UP5A 4CNKA 2V5ZA 2EQ8A 4E0VA 3AYIA 3VRDB 2HQMA 3F8DA 2GMJA 5M10A 4ZCDA 2BXSA 1F8WA 4OPTA 3GDNA 3GWDA 1PHHA 1E1LA 5EOWA 1FOHA 3KPFA 1OJAA 1NG4A 3FPZA 5KRQA 4B66A 1VQWA 1MOKA 3UOYA 1GESA 3AE6A 2BK3A 3BNMA 4TM4A 4J34A 1S3EA 2WDRA 2RGJA 3B6DA 1PDHA 2WETA 2ACZA 3P4RA 1E1KA 1GETA 4OPUA 4TM3A 2YG4A 1XDIA 3LXDA 5JCLA 1GV4A 1UKVG 3AE9A 2OLOA 1GRGA 2XFQA 4AT0A 3PO7A 1TYPA 2WOVA 1JOAA 4O5UA 1TDKA 2BC1A 3C4NA 1GRHA 4IVMB 5IPYA 2WOIA 4GDEA 3REDA 5JCKA 1NAAA 2WQYA 1L9EA 1N1PA 3BI4A 4Z2RA 3H8LA 4C5OA 4YKGA 1BZLA 1B5QA 4Z43A 4EQRA 3RNMA 4Z2TA 4NTEA 4ZCCA 4CCRA 4U8JA 2C7GA 3AE2A 4C3YA 3AB1A 3VRBA 1REOA 2YAUA 3AE8A 1BGJA 2BCGG 3OC4A 3NK0X 4H4PA 4USQA 4AP1A 2WP9A 2WS3A 3NKSA 3S61A 3AD9B 4J31A 4BK3A 1OJCA 2XFNA 2X8GA 4DSGA 2XYOA 4J33A 1FEBA 1H82A 2IIDA 3SGLA 4NTDA 2GVCA 4TLZA 2XDOA 3CN8A 5CQFA 3B3RA 1GPEA 5BUKA 2B76A 1E7PA 3CNSA 1OJTA 4Y4LA 3Q6JA 1FECA 4C74A 2V60A 1EBDA 2Q0LA 2YLWA 3QVPA 4TLXA 5J7XA 4B65A 2FJDA 4EMWA 4JNAA 4CRTA 2X50A 4IA5A 4TM1A 1Y56A 2WU2A 3GMBA 5U1OA 2GRTA 1CC2A 5IQ1A 2WEUA 1ONFA 2YLSA 4XXGA 1GNDA 2C67A 2WOWA 3CPHG 4H4UA 3UP4A 4H50A 3AE7A 4MJWA 1RSGA 2VRLA 5HHFA 1BGNA 3T37A 1CBOA 2XFPA 2VZ2A 1KDGA 1GXFA 2GQWA 1NG3A 2GR1A 2B9XA 2V3BA 3CGDA 3IC9A 3AECA 3V3OA 2JBVA 1NHQA 4H4RA 3AE4A 3DK4A 1NPXA 3ATRA 1GERA 2YVGA 4OCGA 1GEUA 1XHCA 2RABA 4Z44A 2XLSA 3P4SA 4X9MA 3UTGA 2BS4A 3NYCA 4ADWA 3GRSA 1K0JA 3IHGA 4H2RA 2BACA 1PXCA 2YVFA 4GCMA 1P2HA 3UTFA 1PBBA 2ZZCA 5M0ZA 2XVJA 5HXIA 3L1RA 4U8NA 3KU9A 3UCLA 1BKWA 3LZWA 2J3NA 4FDCB 5HY5A 3NGCX 1CHUA 4USRA 4B63A 2JB1A 2GMHA 4CY6A 1JEHA 3CTYA 3G5QA 1L0VA 1QJDA 1ZK7A 3AE5A 3CPJG 3I6DA 4EQSA 2OALA 3AEDA 1YY5A 4J57A 3NT6A 4LIIA 1K4QA 2R0PA 3ITJA 4GRTA 4B68A 2IVEA 2UZZA 5KWFA 1E39A 3UKFA 1PBDA 4YSXA 4PAAA 4A7AA 2YLXA 3RP6A 4RG4A 2XLTA 2Y6RA 4U8OA 3P4QA 5KVIA 1KNRA 1O94A 2YLTA 3NNEA 2C75A 1PXBA 3ADAB 3COXA 5ER0A 3BHKA 3O0HA 4J2WA 4K2XA 4NEWA 1DJNA 5EBKA 4HB9A 4ICYA 3SFEA 4D04A 2R4JA 2EQ6A 3NK1X 4JN9A 3GDPA 1ZY8A 2WHDA 1GRAA 2H89A 4GR1A 5KOXA 4U2SA 2BC0A 4FK1C 1QLBA 2WPFA 1D7YA 2C3DA 1CL0A 4AT2A 1LQUA 4DSHA 4FX9A 3K30A 1PS9A 4AOSA 3C96A 4YSYA 2XVHA 1D4CA 1Z6LA 3CPIG 1VDCA 2JB2A 4WCTA 4K22A 4Y4MA 5FMHA 2XVEA 3UKPA 4YSHA 1D4EA 4H2QA 4OPCA 1ELIA 1PBFA 2QA1A 2XLRA 2YG6A 3K7MX 3K7QX 5J60A 2OA1A 2BCPA 3CGEA 1N4UA 1E1NA 1YQ4A 1ZX9A 2WP5A 3ABVA 5CKUA 4A65A 4U8PA 2ZBWA 3ISHA 4X4JA 1PJ6A 3D8XA 3M13A 4A6NB 3GRTA 3K7TA 3RP8A 1EL5A 2JK6A 1KF6A 3NN0X 4B64A 3DK8A 3V76A 2C65A 3DGHA 1XANA 2B7RA 4J56A 1KFYA 2YR6A 1RYIA 2VQBA 3NIXA 1K0LA 2E1MA 4U8MA 1TDOA 2FJBA 4UP3A 3P4PA 1B8SA 4KPRA 1B37A 2V61A 2WPEA 2BA9A 2XVIA 4CCQA 4P9SA 2CDUA 4N9XA 2PYXA 4H2NA 1IUWA 2OLNA 1NEKA 1E1MA 2XLPA 4A79A 3HZLA 4B69A 2YG5A 5L46A 2V3AA 4U2LA 1V59A 1PBEA 5FS8A 4IA6A 1JRZA 2A8XA 4PABA 1L9DA 3FMWA 4Z25A 2BK4A 4JY2A 1FEAA 4K5SA 3KVEA 3QSMA 3UOXA 1FCDA 2YG3A 4U8KA 1M64A 4EIQA 2C64A 1ZKQA 4NTCA 2XFOA 1EL8A 4JNQA 1CJ3A 1KSSA 2AR8A 2AQJA 2GQFA 2I0ZA 1NHPA 4DGKA 2YLRA 3LB8A 1NDAA 4I58A 3S5WA 2C3CA 4EM3A 4H2PA 1OJ9A 2JAEA 2XVFA 4I59A 1CC6A 1QO8A 3V3NA 1IUUA 4FK1A 4OPDA 4BURA 2NVKX 4AP3A 4H4XA 3VR9A 5FS7A 3UKLA 4RG3A 3ATQA 3DJJA 3GD4A 3AYJA 1LQTA 3DH9A 1S2YA 4JY3A 1GOSA 4YTPA 3I3LA 2GF3A 3CIRA 1PBCA 3GWFA 3ALMA 3NYEA 4GF7A 4H4WA 4Y4NA 1LJ1A 2C72A 4B67A 2GAHB 3PVCA 3QJ4A 4WX1A 3SQPA 3GYIA 4A5LA 1DODA 4JQ9A 3AE1A 1NHRA 3LZXA 2W0HA 1P2EA 1H7WA 1KNPA 3R9UA 2O9ZA 3UOVA 1NHSA 5GRTA 2C73A 4A9WA 2BK5A 3CNTA 2FJAA 4REKA 4Z24A 3VRAA 2GR0A 3VR8A 4EMJA 2XFUA 4APNA 1YKJA 2VRMA 3C4AA 3AEBA 1GT8A 1IUTA 3NH3X 5KOWA 2DKHA 1GTHA 2WDVA 2YR4A 1HYUA 2Z5YA 3G5RA 3IHMA 4A6NA 1TYTA 1N4VA 4IVOB 1S3BA 3L8KA 3QVRA 3G5SA 4NEVA 4Z26A 3EPTA 1ZP0A 3ALJA 3LJPA 4U8LA 1TDFA 3UTHA 1PXAA 3ICTA 2CULA 4HA6A 5JCNA 2R45A 3FG2P 1TDNA 5IQ4A 2BABA 1H81A 3DA1A 3FIMB 5BULA 4YT0A 4H4TA 1OJDA 3AEEA 2APGA 2ZZ0A 3WE0A 2QAEA 1D5TA 2GR2A 3M12A 2QCUA 4XWZA 3EF6A 1Q9IA 1JNRA 1H6VA 2WP6A 3DMEA 3JSKA 3SM8A 1F8RA 1IUVA 2F5ZA 2H88A 3ZDNA 1PN0A 4K8DA 3SFDA 3GMCA 2EQ7A 2OAMA 4TM0A 3VQRA 3BI2A 1DJQA 4K7ZA 1ZMCA 5BVAA 3NTDA 4A99A 1LV0A 2VVMA 1DOBA 1JU2A 1EL7A 2FBWA 3ICRA 3D1CA 2CFYA 1VRQB 2YQUA 3LADA 4BJYA 1H7XA 2YG7A 3IWAA 3QSSA 2XCGA 1PJ7A 2X8CA 3AXBA 2TPRA 2WDQA 3CNJA 3AE3A 3UTEA 2X99A 2C70A 2YM1A 1ZOYA 4YWOA 2GH5A 2DKIA 3DK9A 2R9ZA 1KSUA 2YLZA 3QSEA 3KKJA 2B9YA 2IVDA 1GREA 2TMDA 1H86A 3QFAA 3CNDA 3UKAA 4H4SA 4OPLA 3UOZA 1MO9A 1F3PA 3NTAA 3OZ2A 3EANA 3ALLA 4OPGA 4ZN0A 1TDEA 1XPQA 3FBSA 4ECHA 3URHA 4H4QA 2V6OA 4YKFA 2A87A 3UKHA 1BF3A 3P1WA 4H4ZA 2Q0KA 3DJDA 4UDRA 2VOUA 1F8SA 5U63A 4DNAA 1E6EA 5HYMA 3P9UA 3DGZA 1Y0PA 2BXRA 3H8IA 4C77A 4YTNA 2PHHA 1LTXR 2R46A 2YVJA 4EMIA 2Q6UA 5C2TA 1AOGA 1Q1WA 1H83A 3E1TA 4LU6A 2ZZBA 3AWIA 1FL2A 1CJ4A 3NYFA 4H4VA 4H4YA 1ZDLA 1GSNA 4O5QA 1VG0A 2WPCA 4YTMA 2JB3A 2VVLA 1JNZA 2X3NA 3II4A 4KX6A 5EB5A 3KLJA 1LPFA 2XLUA 4GDPA 5BRTA 1PJ5A 3RP7A 1GRFA 2C76A 2WU5A 5DBJA 1CJ2A 2BS2A 1W4XA 2GV8A 3PS9A 4Z2UA 3EAOA 1VG9A 2Q7VA 2R0GA 3KA7A 3CNPA 3GSIA 4RSLA 1B4VA 1O95A 1L9CA 2RGOA 4U2TA 3RHAA 3NK2X 2QA2A 3BHFA 3IF9A 2X8HA 1K0IA 1IJHA 1EL9A 3NN6X 1ZMDA 2NPXA 1O5WA 2E5VA 1LVLA 2Z5XA 4EM4A 4CNJA 4B1BA 4OPIA 5GSNA 1COYA 3F8RA 4K5RA 2R0CA 3AYLA 3NG7X 1ZOVA 2B7SA 1BWCA 3UKKA 3F8PA 3AEFA 3BNUA 4GUVA 2WBAA 2GAGB 4BV6A 1CF3A 2GR3A 3M0OA 3AEAA 1X31B 1CJCA 3GD3A 4UDPA 3AD7B 2A89A 1D4DA 2AAQA 1MXTA 4CBQA 4YXDA 2YWLA 3CGBA 1H84A 4BK2A 1S2QA 4U8IA 2VQ7A 2C66A 4H7UA 4EIPA 4C3XA 5C3JA 2R4EA 1YQZA 4J36A 3NLCA 3UKQA 1F6MA 2B9WA 2VVLG 2Y6QA 4LA1A 1IUSA 3AEGA 4OVIA 1JRXA 4IV9A 1DXLA 1GALA 1N4WA 2YR5A 1IUXA 5U25A 1GRTA 4CY8A 5LV9A 1DOCA 3NRNA 1JRYA 1DNCA 5FS6A 4EQXA 2BS3A 3GYJA 3QFBA 1M6IA 2WESA 4JDRA 4XWRA 1Y56B 1NENA 4AOXA 2GEWA 5FS9A 2E4GA 1TRBA 2FJEA 3H4KA 4EQWA 4UDQA 2JKCA 1DOEA 3LOVA 1SEZA 2GB0A 3KD9A 2ARDA 3NHOX 1CC4A 4X9NA
chains in the Genus database with same CATH superfamily
2BYBA 2RGHA 4YSZA 5KVHA 1Q1RA 2YM2A 3HYXA 3AD8B 4M52A 3DJEA 5KXJA 5EB4A 3Q9TA 3DJGX 4II2A 4D03A 1D7LA 1YQ3A 3BI5A 4BK1A 1RP0A 2CVJA 1GRBA 3ZYXA 5JCIA 4BJZA 2EQ9A 3CGCA 4NZHA 5JCMA 5TR3A 1GTEA 3ICSA 3UP5A 4CNKA 2V5ZA 3KPKA 2EQ8A 4E0VA 3AYIA 3VRDB 2HQMA 3F8DA 2GMJA 5M10A 4ZCDA 2BXSA 1F8WA 4OPTA 3GDNA 3GWDA 1PHHA 1E1LA 5EOWA 1FOHA 3KPFA 1OJAA 1NG4A 3FPZA 4G73A 5KRQA 4B66A 3CMMA 1VQWA 1MOKA 3UOYA 1GESA 3AE6A 2BK3A 3BNMA 4TM4A 4J34A 1S3EA 2WDRA 2RGJA 3B6DA 1PDHA 2WETA 2ACZA 3P4RA 1E1KA 1GETA 5KNLA 4OPUA 4TM3A 2YG4A 1XDIA 3LXDA 5JCLA 1GV4A 1UKVG 3AE9A 2OLOA 1GRGA 2XFQA 4AT0A 3PO7A 1TYPA 2WOVA 1JOAA 4O5UA 1TDKA 2BC1A 3C4NA 1GRHA 4IVMB 5IPYA 2WOIA 4GDEA 3REDA 5JCKA 1NAAA 2WQYA 1L9EA 1N1PA 3BI4A 4Z2RA 3H8LA 4C5OA 4YKGA 1BZLA 1B5QA 4Z43A 4EQRA 3RNMA 4Z2TA 4NTEA 4ZCCA 4CCRA 4U8JA 2C7GA 3AE2A 4C3YA 3AB1A 3VRBA 1REOA 2YAUA 3AE8A 1BGJA 2BCGG 3OC4A 3NK0X 4H4PA 4USQA 4AP1A 2WP9A 2WS3A 3NKSA 3S61A 3AD9B 4J31A 4BK3A 1OJCA 2XFNA 2X8GA 4DSGA 2XYOA 4J33A 3HYVA 1FEBA 1H82A 2IIDA 3SGLA 4NTDA 2GVCA 4TLZA 2XDOA 3CN8A 5CQFA 3B3RA 1GPEA 5BUKA 2B76A 1E7PA 3CNSA 1OJTA 4Y4LA 3Q6JA 1FECA 4C74A 2V60A 1EBDA 2Q0LA 2YLWA 3QVPA 4TLXA 5J7XA 4B65A 2FJDA 4EMWA 4JNAA 4CRTA 2X50A 4IA5A 4TM1A 1Y56A 2WU2A 3GMBA 5U1OA 2GRTA 1CC2A 5IQ1A 2WEUA 1ONFA 2YLSA 4XXGA 1GNDA 2C67A 2WOWA 3CPHG 4H4UA 3UP4A 4H50A 3AE7A 4MJWA 1RSGA 3SX6A 2VRLA 5HHFA 1BGNA 3T37A 1CBOA 2XFPA 2VZ2A 1KDGA 1GXFA 2GQWA 1NG3A 2GR1A 2B9XA 2V3BA 3CGDA 3IC9A 3AECA 3T0KA 3V3OA 2JBVA 1NHQA 4H4RA 3AE4A 3DK4A 1NPXA 3ATRA 1GERA 2YVGA 4OCGA 1GEUA 1XHCA 2RABA 4Z44A 2XLSA 3P4SA 4G74A 4X9MA 3UTGA 2BS4A 3NYCA 4ADWA 3GRSA 4G6GA 1K0JA 3IHGA 4H2RA 2BACA 1PXCA 2YVFA 4GCMA 1P2HA 3UTFA 1PBBA 2ZZCA 5M0ZA 2XVJA 5HXIA 3L1RA 4U8NA 3KU9A 3UCLA 1BKWA 3LZWA 2J3NA 4FDCB 5HY5A 3NGCX 1CHUA 4USRA 4B63A 5KMPA 2JB1A 2GMHA 4CY6A 1JEHA 3CTYA 3G5QA 1L0VA 1QJDA 1ZK7A 3AE5A 3CPJG 3I6DA 4EQSA 2OALA 3AEDA 1YY5A 4J57A 3NT6A 3SYIA 4LIIA 1K4QA 2R0PA 3ITJA 4GRTA 4B68A 2IVEA 2UZZA 5KWFA 1E39A 3UKFA 1PBDA 4YSXA 4PAAA 4A7AA 2YLXA 3RP6A 4RG4A 2XLTA 2Y6RA 4U8OA 3P4QA 5KVIA 1KNRA 1O94A 2YLTA 3NNEA 2C75A 1PXBA 3ADAB 3COXA 5ER0A 3BHKA 3O0HA 4J2WA 4K2XA 4NEWA 1DJNA 5EBKA 4HB9A 4ICYA 3SFEA 4D04A 2R4JA 2EQ6A 3NK1X 4JN9A 5KMSA 3GDPA 1ZY8A 2WHDA 1GRAA 2H89A 4GR1A 5KOXA 4U2SA 2BC0A 4FK1C 1QLBA 2WPFA 1D7YA 2C3DA 1CL0A 4AT2A 1LQUA 4DSHA 4FX9A 3K30A 1PS9A 4AOSA 3C96A 4YSYA 2XVHA 1D4CA 1Z6LA 3CPIG 1VDCA 2JB2A 4WCTA 4K22A 4Y4MA 5FMHA 2XVEA 3UKPA 4YSHA 1D4EA 4H2QA 4OPCA 1ELIA 1PBFA 2QA1A 2XLRA 2YG6A 3K7MX 3K7QX 3T2ZA 2OA1A 2BCPA 3CGEA 5J60A 1N4UA 1E1NA 1YQ4A 1ZX9A 2WP5A 3ABVA 5CKUA 4A65A 4U8PA 2ZBWA 3ISHA 4X4JA 1PJ6A 3D8XA 3M13A 4A6NB 3GRTA 3K7TA 3RP8A 1EL5A 2JK6A 1KF6A 3NN0X 4B64A 3DK8A 3V76A 2C65A 3DGHA 1XANA 2B7RA 4J56A 1KFYA 2YR6A 1RYIA 2VQBA 3NIXA 1K0LA 2E1MA 4U8MA 1TDOA 2FJBA 4UP3A 3P4PA 1B8SA 4KPRA 1B37A 2V61A 2WPEA 2BA9A 2XVIA 4CCQA 4P9SA 2CDUA 4N9XA 2PYXA 4H2NA 1IUWA 2OLNA 1NEKA 1E1MA 2XLPA 4A79A 3HZLA 4B69A 2YG5A 4GAPA 5L46A 4II3A 2V3AA 4U2LA 1V59A 1PBEA 5FS8A 4IA6A 1JRZA 2A8XA 4PABA 1L9DA 3FMWA 4Z25A 2BK4A 4GAVA 1FEAA 4JY2A 4K5SA 3KVEA 3QSMA 3UOXA 1FCDA 2YG3A 4U8KA 1M64A 4EIQA 2C64A 1ZKQA 4NTCA 2XFOA 1EL8A 4JNQA 1CJ3A 1KSSA 2AR8A 2AQJA 2GQFA 2I0ZA 1NHPA 4DGKA 4G6HA 2YLRA 3LB8A 1NDAA 4I58A 3S5WA 2C3CA 3SZWA 4H2PA 1OJ9A 4EM3A 2JAEA 2XVFA 4I59A 1CC6A 1QO8A 3V3NA 1IUUA 4FK1A 3T31A 4OPDA 4BURA 2NVKX 4AP3A 4H4XA 3VR9A 5FS7A 3UKLA 4RG3A 3ATQA 3DJJA 3GD4A 3AYJA 1LQTA 3DH9A 1S2YA 4JY3A 1GOSA 4YTPA 3I3LA 2GF3A 3T2YA 3CIRA 1PBCA 3GWFA 3HYWA 3ALMA 3SZFA 3NYEA 4GF7A 4H4WA 4Y4NA 1LJ1A 2C72A 4B67A 2GAHB 3PVCA 3QJ4A 4WX1A 3SQPA 3GYIA 4A5LA 1DODA 4JQ9A 3AE1A 1NHRA 3LZXA 2W0HA 1P2EA 1H7WA 1KNPA 3R9UA 2O9ZA 3UOVA 1NHSA 5GRTA 2C73A 4A9WA 2BK5A 3CNTA 2FJAA 4REKA 4Z24A 4NNJA 3T14A 3VRAA 2GR0A 3VR8A 4EMJA 2XFUA 4APNA 1YKJA 2VRMA 3C4AA 3AEBA 1GT8A 1IUTA 3NH3X 5KOWA 2DKHA 1GTHA 2WDVA 2YR4A 1HYUA 2Z5YA 3G5RA 3IHMA 3SZ0A 4A6NA 1TYTA 1N4VA 4IVOB 1S3BA 3L8KA 3QVRA 3G5SA 4NEVA 4Z26A 3EPTA 2BRYA 1ZP0A 3ALJA 3LJPA 4U8LA 1TDFA 3UTHA 1PXAA 3ICTA 2CULA 4HA6A 5JCNA 2R45A 3FG2P 1TDNA 5IQ4A 2BABA 1H81A 3DA1A 2BRAA 3FIMB 5BULA 4YT0A 4H4TA 1OJDA 3AEEA 2APGA 2ZZ0A 3WE0A 2QAEA 1D5TA 2GR2A 3M12A 2QCUA 4XWZA 3EF6A 1Q9IA 1JNRA 1H6VA 2WP6A 3DMEA 3JSKA 3SM8A 1F8RA 1IUVA 2F5ZA 2H88A 3ZDNA 1PN0A 4K8DA 3SFDA 3GMCA 2EQ7A 2OAMA 4TM0A 3VQRA 3BI2A 1DJQA 4K7ZA 1ZMCA 5BVAA 3NTDA 4A99A 5KMRA 1LV0A 2VVMA 1DOBA 1JU2A 1EL7A 2FBWA 3ICRA 3D1CA 2CFYA 1VRQB 2YQUA 3LADA 4BJYA 3SY4A 1H7XA 2YG7A 3IWAA 3QSSA 2XCGA 1PJ7A 2X8CA 3AXBA 2TPRA 2WDQA 3CNJA 3AE3A 3UTEA 2X99A 2C70A 4NWZA 2YM1A 1ZOYA 4YWOA 2GH5A 2DKIA 3DK9A 2R9ZA 1KSUA 2YLZA 3QSEA 3KKJA 2B9YA 2IVDA 1GREA 2TMDA 1H86A 3QFAA 3CNDA 3UKAA 4H4SA 4OPLA 3UOZA 1MO9A 5KMQA 1F3PA 3NTAA 3OZ2A 3EANA 3ALLA 4OPGA 4ZN0A 1TDEA 1XPQA 3FBSA 4ECHA 3URHA 4H4QA 2V6OA 4YKFA 2A87A 3UKHA 1BF3A 3P1WA 4H4ZA 2Q0KA 3DJDA 4UDRA 2VOUA 1F8SA 5U63A 4DNAA 1E6EA 5HYMA 3P9UA 3DGZA 1Y0PA 2BXRA 3H8IA 4C77A 4YTNA 2PHHA 1LTXR 2R46A 2YVJA 4EMIA 2Q6UA 5C2TA 1AOGA 1Q1WA 1H83A 3E1TA 4LU6A 2ZZBA 3AWIA 1FL2A 3T2KA 1CJ4A 3NYFA 4H4VA 4H4YA 1ZDLA 1GSNA 4O5QA 1VG0A 2WPCA 4YTMA 2JB3A 2VVLA 1JNZA 2X3NA 3II4A 4KX6A 5EB5A 3KLJA 1LPFA 2XLUA 4GDPA 5BRTA 1PJ5A 3RP7A 1GRFA 2C76A 2WU5A 5DBJA 1CJ2A 2BS2A 1W4XA 2GV8A 3PS9A 4Z2UA 3EAOA 1VG9A 2Q7VA 2R0GA 3KA7A 3CNPA 3GSIA 4RSLA 1B4VA 1O95A 1L9CA 2RGOA 4U2TA 3RHAA 3NK2X 2QA2A 3BHFA 3IF9A 2X8HA 1K0IA 1IJHA 1EL9A 3NN6X 1ZMDA 2NPXA 1O5WA 2E5VA 1LVLA 2Z5XA 4EM4A 3SXIA 4CNJA 4B1BA 4OPIA 5GSNA 1COYA 3SZCA 3F8RA 4K5RA 2R0CA 3AYLA 3NG7X 1ZOVA 2B7SA 1BWCA 3UKKA 3F8PA 3AEFA 3BNUA 4G9KA 4GUVA 2WBAA 2GAGB 4BV6A 1CF3A 2GR3A 3M0OA 3AEAA 1X31B 1CJCA 3GD3A 4UDPA 3AD7B 2A89A 1D4DA 2AAQA 1MXTA 4CBQA 4YXDA 2YWLA 3CGBA 1H84A 4BK2A 1S2QA 4U8IA 2VQ7A 2C66A 4H7UA 4EIPA 4C3XA 5C3JA 2R4EA 1YQZA 4J36A 3NLCA 3UKQA 1F6MA 2B9WA 2VVLG 2Y6QA 4LA1A 1IUSA 3AEGA 4OVIA 1JRXA 4IV9A 2C4CA 1DXLA 1GALA 1N4WA 2YR5A 1IUXA 5U25A 1GRTA 4CY8A 5LV9A 1DOCA 3NRNA 1JRYA 1DNCA 5FS6A 4EQXA 2BS3A 3GYJA 3QFBA 1M6IA 2WESA 3GYXA 4JDRA 4XWRA 1Y56B 1NENA 4AOXA 2GEWA 5FS9A 2E4GA 1TRBA 2FJEA 3H4KA 4EQWA 4UDQA 2JKCA 1DOEA 3LOVA 1SEZA 2GB0A 3KD9A 2ARDA 3NHOX 1CC4A 4X9NA
chains in the Genus database with same CATH topology
2BYBA 2RGHA 4YSZA 5KVHA 1Q1RA 2YM2A 3HYXA 3AD8B 4M52A 3DJEA 5KXJA 5EB4A 3Q9TA 3DJGX 4II2A 4D03A 1D7LA 1YQ3A 3BI5A 4BK1A 1RP0A 2CVJA 1GRBA 3ZYXA 5JCIA 4BJZA 2EQ9A 3CGCA 4NZHA 5JCMA 5TR3A 1GTEA 3ICSA 3UP5A 4CNKA 2V5ZA 3KPKA 2EQ8A 4E0VA 3AYIA 3VRDB 2HQMA 3F8DA 2GMJA 5M10A 4ZCDA 2BXSA 1F8WA 4OPTA 3GDNA 3GWDA 1PHHA 1E1LA 5EOWA 1FOHA 3KPFA 1OJAA 1NG4A 3FPZA 4G73A 5KRQA 4B66A 3CMMA 1VQWA 1MOKA 3UOYA 1GESA 3AE6A 2BK3A 3BNMA 4TM4A 4J34A 1S3EA 2WDRA 2RGJA 3B6DA 1PDHA 2WETA 2ACZA 3P4RA 1E1KA 1GETA 5KNLA 4OPUA 4TM3A 2YG4A 1XDIA 3LXDA 5JCLA 1GV4A 1UKVG 3AE9A 2OLOA 1GRGA 2XFQA 4AT0A 3PO7A 1TYPA 2WOVA 1JOAA 4O5UA 1TDKA 2BC1A 3C4NA 1GRHA 4IVMB 5IPYA 2WOIA 4GDEA 3REDA 5JCKA 1NAAA 2WQYA 1L9EA 1N1PA 3BI4A 4Z2RA 3H8LA 4C5OA 4YKGA 1BZLA 1B5QA 4Z43A 4EQRA 3RNMA 4Z2TA 4NTEA 4ZCCA 4CCRA 4U8JA 2C7GA 3AE2A 4C3YA 3AB1A 3VRBA 1REOA 2YAUA 3AE8A 1BGJA 2BCGG 3OC4A 3NK0X 4H4PA 4USQA 4AP1A 2WP9A 2WS3A 3NKSA 3S61A 3AD9B 4J31A 4BK3A 1OJCA 2XFNA 2X8GA 4DSGA 2XYOA 4J33A 3HYVA 1FEBA 1H82A 2IIDA 3SGLA 4NTDA 2GVCA 4TLZA 2XDOA 3CN8A 5CQFA 3B3RA 1GPEA 5BUKA 2B76A 1E7PA 3CNSA 1OJTA 4Y4LA 3Q6JA 1FECA 4C74A 2V60A 1EBDA 2Q0LA 2YLWA 3QVPA 4TLXA 5J7XA 4B65A 2FJDA 4EMWA 4JNAA 4CRTA 2X50A 4IA5A 4TM1A 1Y56A 2WU2A 3GMBA 5U1OA 2GRTA 1CC2A 5IQ1A 2WEUA 1ONFA 2YLSA 4XXGA 1GNDA 2C67A 2WOWA 3CPHG 4H4UA 3UP4A 4H50A 3AE7A 4MJWA 1RSGA 3SX6A 2VRLA 5HHFA 1BGNA 3T37A 1CBOA 2XFPA 2VZ2A 1KDGA 1GXFA 2GQWA 1NG3A 2GR1A 2B9XA 2V3BA 3CGDA 3IC9A 3AECA 3T0KA 3V3OA 2JBVA 1NHQA 4H4RA 3AE4A 3DK4A 1NPXA 3ATRA 1GERA 2YVGA 4OCGA 1GEUA 1XHCA 2RABA 4Z44A 2XLSA 3P4SA 4G74A 4X9MA 3UTGA 2BS4A 3NYCA 4ADWA 3GRSA 4G6GA 1K0JA 3IHGA 4H2RA 2BACA 1PXCA 2YVFA 4GCMA 1P2HA 3UTFA 1PBBA 2ZZCA 5M0ZA 2XVJA 5HXIA 3L1RA 4U8NA 3KU9A 3UCLA 1BKWA 3LZWA 2J3NA 4FDCB 5HY5A 3NGCX 1CHUA 4USRA 4B63A 5KMPA 2JB1A 2GMHA 4CY6A 1JEHA 3CTYA 3G5QA 1L0VA 1QJDA 1ZK7A 3AE5A 3CPJG 3I6DA 4EQSA 2OALA 3AEDA 1YY5A 4J57A 3NT6A 3SYIA 4LIIA 1K4QA 2R0PA 3ITJA 4GRTA 4B68A 2IVEA 2UZZA 5KWFA 1E39A 3UKFA 1PBDA 4YSXA 4PAAA 4A7AA 2YLXA 3RP6A 4RG4A 2XLTA 2Y6RA 4U8OA 3P4QA 5KVIA 1KNRA 1O94A 2YLTA 3NNEA 2C75A 1PXBA 3ADAB 3COXA 5ER0A 3BHKA 3O0HA 4J2WA 4K2XA 4NEWA 1DJNA 5EBKA 4HB9A 4ICYA 3SFEA 4D04A 2R4JA 2EQ6A 3NK1X 4JN9A 5KMSA 3GDPA 1ZY8A 2WHDA 1GRAA 2H89A 4GR1A 5KOXA 4U2SA 2BC0A 4FK1C 1QLBA 2WPFA 1D7YA 2C3DA 1CL0A 4AT2A 1LQUA 4DSHA 4FX9A 3K30A 1PS9A 4AOSA 3C96A 4YSYA 2XVHA 1D4CA 1Z6LA 3CPIG 1VDCA 2JB2A 4WCTA 4K22A 4Y4MA 5FMHA 2XVEA 3UKPA 4YSHA 1D4EA 4H2QA 4OPCA 1ELIA 1PBFA 2QA1A 2XLRA 2YG6A 3K7MX 3K7QX 3T2ZA 2OA1A 2BCPA 3CGEA 5J60A 1N4UA 1E1NA 1YQ4A 1ZX9A 2WP5A 3ABVA 5CKUA 4A65A 4U8PA 2ZBWA 3ISHA 4X4JA 1PJ6A 3D8XA 3M13A 4A6NB 3GRTA 3K7TA 3RP8A 1EL5A 2JK6A 1KF6A 3NN0X 4B64A 3DK8A 3V76A 2C65A 3DGHA 1XANA 2B7RA 4J56A 1KFYA 2YR6A 1RYIA 2VQBA 3NIXA 1K0LA 2E1MA 4U8MA 1TDOA 2FJBA 4UP3A 3P4PA 1B8SA 4KPRA 1B37A 2V61A 2WPEA 2BA9A 2XVIA 4CCQA 4P9SA 2CDUA 4N9XA 2PYXA 4H2NA 1IUWA 2OLNA 1NEKA 1E1MA 2XLPA 4A79A 3HZLA 4B69A 2YG5A 4GAPA 5L46A 4II3A 2V3AA 4U2LA 1V59A 1PBEA 5FS8A 4IA6A 1JRZA 2A8XA 4PABA 1L9DA 3FMWA 4Z25A 2BK4A 4GAVA 1FEAA 4JY2A 4K5SA 3KVEA 3QSMA 3UOXA 1FCDA 2YG3A 4U8KA 1M64A 4EIQA 2C64A 1ZKQA 4NTCA 2XFOA 1EL8A 4JNQA 1CJ3A 1KSSA 2AR8A 2AQJA 2GQFA 2I0ZA 1NHPA 4DGKA 4G6HA 2YLRA 3LB8A 1NDAA 4I58A 3S5WA 2C3CA 3SZWA 4H2PA 1OJ9A 4EM3A 2JAEA 2XVFA 4I59A 1CC6A 1QO8A 3V3NA 1IUUA 4FK1A 3T31A 4OPDA 4BURA 2NVKX 4AP3A 4H4XA 3VR9A 5FS7A 3UKLA 4RG3A 3ATQA 3DJJA 3GD4A 3AYJA 1LQTA 3DH9A 1S2YA 4JY3A 1GOSA 4YTPA 3I3LA 2GF3A 3T2YA 3CIRA 1PBCA 3GWFA 3HYWA 3ALMA 3SZFA 3NYEA 4GF7A 4H4WA 4Y4NA 1LJ1A 2C72A 4B67A 2GAHB 3PVCA 3QJ4A 4WX1A 3SQPA 3GYIA 4A5LA 1DODA 4JQ9A 3AE1A 1NHRA 3LZXA 2W0HA 1P2EA 1H7WA 1KNPA 3R9UA 2O9ZA 3UOVA 1NHSA 5GRTA 2C73A 4A9WA 2BK5A 3CNTA 2FJAA 4REKA 4Z24A 4NNJA 3T14A 3VRAA 2GR0A 3VR8A 4EMJA 2XFUA 4APNA 1YKJA 2VRMA 3C4AA 3AEBA 1GT8A 1IUTA 3NH3X 5KOWA 2DKHA 1GTHA 2WDVA 2YR4A 1HYUA 2Z5YA 3G5RA 3IHMA 3SZ0A 4A6NA 1TYTA 1N4VA 4IVOB 1S3BA 3L8KA 3QVRA 3G5SA 4NEVA 4Z26A 3EPTA 2BRYA 1ZP0A 3ALJA 3LJPA 4U8LA 1TDFA 3UTHA 1PXAA 3ICTA 2CULA 4HA6A 5JCNA 2R45A 3FG2P 1TDNA 5IQ4A 2BABA 1H81A 3DA1A 2BRAA 3FIMB 5BULA 4YT0A 4H4TA 1OJDA 3AEEA 2APGA 2ZZ0A 3WE0A 2QAEA 1D5TA 2GR2A 3M12A 2QCUA 4XWZA 3EF6A 1Q9IA 1JNRA 1H6VA 2WP6A 3DMEA 3JSKA 3SM8A 1F8RA 1IUVA 2F5ZA 2H88A 3ZDNA 1PN0A 4K8DA 3SFDA 3GMCA 2EQ7A 2OAMA 4TM0A 3VQRA 3BI2A 1DJQA 4K7ZA 1ZMCA 5BVAA 3NTDA 4A99A 5KMRA 1LV0A 2VVMA 1DOBA 1JU2A 1EL7A 2FBWA 3ICRA 3D1CA 2CFYA 1VRQB 2YQUA 3LADA 4BJYA 3SY4A 1H7XA 2YG7A 3IWAA 3QSSA 2XCGA 1PJ7A 2X8CA 3AXBA 2TPRA 2WDQA 3CNJA 3AE3A 3UTEA 2X99A 2C70A 4NWZA 2YM1A 1ZOYA 4YWOA 2GH5A 2DKIA 3DK9A 2R9ZA 1KSUA 2YLZA 3QSEA 3KKJA 2B9YA 2IVDA 1GREA 2TMDA 1H86A 3QFAA 3CNDA 3UKAA 4H4SA 4OPLA 3UOZA 1MO9A 5KMQA 1F3PA 3NTAA 3OZ2A 3EANA 3ALLA 4OPGA 4ZN0A 1TDEA 1XPQA 3FBSA 4ECHA 3URHA 4H4QA 2V6OA 4YKFA 2A87A 3UKHA 1BF3A 3P1WA 4H4ZA 2Q0KA 3DJDA 4UDRA 2VOUA 1F8SA 5U63A 4DNAA 1E6EA 5HYMA 3P9UA 3DGZA 1Y0PA 2BXRA 3H8IA 4C77A 4YTNA 2PHHA 1LTXR 2R46A 2YVJA 4EMIA 2Q6UA 5C2TA 1AOGA 1Q1WA 1H83A 3E1TA 4LU6A 2ZZBA 3AWIA 1FL2A 3T2KA 1CJ4A 3NYFA 4H4VA 4H4YA 1ZDLA 1GSNA 4O5QA 1VG0A 2WPCA 4YTMA 2JB3A 2VVLA 1JNZA 2X3NA 3II4A 4KX6A 5EB5A 3KLJA 1LPFA 2XLUA 4GDPA 5BRTA 1PJ5A 3RP7A 1GRFA 2C76A 2WU5A 5DBJA 1CJ2A 2BS2A 1W4XA 2GV8A 3PS9A 4Z2UA 3EAOA 1VG9A 2Q7VA 2R0GA 3KA7A 3CNPA 3GSIA 4RSLA 1B4VA 1O95A 1L9CA 2RGOA 4U2TA 3RHAA 3NK2X 2QA2A 3BHFA 3IF9A 2X8HA 1K0IA 1IJHA 1EL9A 3NN6X 1ZMDA 2NPXA 1O5WA 2E5VA 1LVLA 2Z5XA 4EM4A 3SXIA 4CNJA 4B1BA 4OPIA 5GSNA 1COYA 3SZCA 3F8RA 4K5RA 2R0CA 3AYLA 3NG7X 1ZOVA 2B7SA 1BWCA 3UKKA 3F8PA 3AEFA 3BNUA 4G9KA 4GUVA 2WBAA 2GAGB 4BV6A 1CF3A 2GR3A 3M0OA 3AEAA 1X31B 1CJCA 3GD3A 4UDPA 3AD7B 2A89A 1D4DA 2AAQA 1MXTA 4CBQA 4YXDA 2YWLA 3CGBA 1H84A 4BK2A 1S2QA 4U8IA 2VQ7A 2C66A 4H7UA 4EIPA 4C3XA 5C3JA 2R4EA 1YQZA 4J36A 3NLCA 3UKQA 1F6MA 2B9WA 2VVLG 2Y6QA 4LA1A 1IUSA 3AEGA 4OVIA 1JRXA 4IV9A 2C4CA 1DXLA 1GALA 1N4WA 2YR5A 1IUXA 5U25A 1GRTA 4CY8A 5LV9A 1DOCA 3NRNA 1JRYA 1DNCA 5FS6A 4EQXA 2BS3A 3GYJA 3QFBA 1M6IA 2WESA 3GYXA 4JDRA 4XWRA 1Y56B 1NENA 4AOXA 2GEWA 5FS9A 2E4GA 1TRBA 2FJEA 3H4KA 4EQWA 4UDQA 2JKCA 1DOEA 3LOVA 1SEZA 2GB0A 3KD9A 2ARDA 3NHOX 1CC4A 4X9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYB A;  2RGH A;  4YSZ A;  5KVH A;  1Q1R A;  2YM2 A;  3AD8 B;  4M52 A;  3DJE A;  5KXJ A;  5EB4 A;  3Q9T A;  3DJG X;  4D03 A;  1D7L A;  1YQ3 A;  3BI5 A;  4BK1 A;  1RP0 A;  2CVJ A;  1GRB A;  3ZYX A;  5JCI A;  4BJZ A;  2EQ9 A;  3CGC A;  4NZH A;  5JCM A;  5TR3 A;  1GTE A;  3ICS A;  3UP5 A;  4CNK A;  2V5Z A;  2EQ8 A;  4E0V A;  3AYI A;  3VRD B;  2HQM A;  3F8D A;  2GMJ A;  5M10 A;  4ZCD A;  2BXS A;  1F8W A;  4OPT A;  3GDN A;  3GWD A;  1PHH A;  1E1L A;  5EOW A;  1FOH A;  3KPF A;  1OJA A;  1NG4 A;  3FPZ A;  5KRQ A;  4B66 A;  1VQW A;  1MOK A;  3UOY A;  1GES A;  3AE6 A;  2BK3 A;  3BNM A;  4TM4 A;  4J34 A;  1S3E A;  2WDR A;  2RGJ A;  3B6D A;  1PDH A;  2WET A;  2ACZ A;  3P4R A;  1E1K A;  1GET A;  4OPU A;  4TM3 A;  2YG4 A;  1XDI A;  3LXD A;  5JCL A;  1GV4 A;  1UKV G;  3AE9 A;  2OLO A;  1GRG A;  2XFQ A;  4AT0 A;  3PO7 A;  1TYP A;  2WOV A;  1JOA A;  4O5U A;  1TDK A;  2BC1 A;  3C4N A;  1GRH A;  4IVM B;  5IPY A;  2WOI A;  4GDE A;  3RED A;  5JCK A;  1NAA A;  2WQY A;  1L9E A;  1N1P A;  3BI4 A;  4Z2R A;  3H8L A;  4C5O A;  4YKG A;  1BZL A;  1B5Q A;  4Z43 A;  4EQR A;  3RNM A;  4Z2T A;  4NTE A;  4ZCC A;  4CCR A;  4U8J A;  2C7G A;  3AE2 A;  4C3Y A;  3AB1 A;  3VRB A;  1REO A;  2YAU A;  3AE8 A;  1BGJ A;  2BCG G;  3OC4 A;  3NK0 X;  4H4P A;  4USQ A;  4AP1 A;  2WP9 A;  2WS3 A;  3NKS A;  3S61 A;  3AD9 B;  4J31 A;  4BK3 A;  1OJC A;  2XFN A;  2X8G A;  4DSG A;  2XYO A;  4J33 A;  1FEB A;  1H82 A;  2IID A;  3SGL A;  4NTD A;  2GVC A;  4TLZ A;  2XDO A;  3CN8 A;  5CQF A;  3B3R A;  1GPE A;  5BUK A;  2B76 A;  1E7P A;  3CNS A;  1OJT A;  4Y4L A;  3Q6J A;  1FEC A;  4C74 A;  2V60 A;  1EBD A;  2Q0L A;  2YLW A;  3QVP A;  4TLX A;  5J7X A;  4B65 A;  2FJD A;  4EMW A;  4JNA A;  4CRT A;  2X50 A;  4IA5 A;  4TM1 A;  1Y56 A;  2WU2 A;  3GMB A;  5U1O A;  2GRT A;  1CC2 A;  5IQ1 A;  2WEU A;  1ONF A;  2YLS A;  4XXG A;  1GND A;  2C67 A;  2WOW A;  3CPH G;  4H4U A;  3UP4 A;  4H50 A;  3AE7 A;  4MJW A;  1RSG A;  2VRL A;  5HHF A;  1BGN A;  3T37 A;  1CBO A;  2XFP A;  2VZ2 A;  1KDG A;  1GXF A;  2GQW A;  1NG3 A;  2GR1 A;  2B9X A;  2V3B A;  3CGD A;  3IC9 A;  3AEC A;  3V3O A;  2JBV A;  1NHQ A;  4H4R A;  3AE4 A;  3DK4 A;  1NPX A;  3ATR A;  1GER A;  2YVG A;  4OCG A;  1GEU A;  1XHC A;  2RAB A;  4Z44 A;  2XLS A;  3P4S A;  4X9M A;  3UTG A;  2BS4 A;  3NYC A;  4ADW A;  3GRS A;  1K0J A;  3IHG A;  4H2R A;  2BAC A;  1PXC A;  2YVF A;  4GCM A;  1P2H A;  3UTF A;  1PBB A;  2ZZC A;  5M0Z A;  2XVJ A;  5HXI A;  3L1R A;  4U8N A;  3KU9 A;  3UCL A;  1BKW A;  3LZW A;  2J3N A;  4FDC B;  5HY5 A;  3NGC X;  1CHU A;  4USR A;  4B63 A;  2JB1 A;  2GMH A;  4CY6 A;  1JEH A;  3CTY A;  3G5Q A;  1L0V A;  1QJD A;  1ZK7 A;  3AE5 A;  3CPJ G;  3I6D A;  4EQS A;  2OAL A;  3AED A;  1YY5 A;  4J57 A;  3NT6 A;  4LII A;  1K4Q A;  2R0P A;  3ITJ A;  4GRT A;  4B68 A;  2IVE A;  2UZZ A;  5KWF A;  1E39 A;  3UKF A;  1PBD A;  4YSX A;  4PAA A;  4A7A A;  2YLX A;  3RP6 A;  4RG4 A;  2XLT A;  2Y6R A;  4U8O A;  3P4Q A;  5KVI A;  1KNR A;  1O94 A;  2YLT A;  3NNE A;  2C75 A;  1PXB A;  3ADA B;  3COX A;  5ER0 A;  3BHK A;  3O0H A;  4J2W A;  4K2X A;  4NEW A;  1DJN A;  5EBK A;  4HB9 A;  4ICY A;  3SFE A;  4D04 A;  2R4J A;  2EQ6 A;  3NK1 X;  4JN9 A;  3GDP A;  1ZY8 A;  2WHD A;  1GRA A;  2H89 A;  4GR1 A;  5KOX A;  4U2S A;  2BC0 A;  4FK1 C;  1QLB A;  2WPF A;  1D7Y A;  2C3D A;  1CL0 A;  4AT2 A;  1LQU A;  4DSH A;  4FX9 A;  3K30 A;  1PS9 A;  4AOS A;  3C96 A;  4YSY A;  2XVH A;  1D4C A;  1Z6L A;  3CPI G;  1VDC A;  2JB2 A;  4WCT A;  4K22 A;  4Y4M A;  5FMH A;  2XVE A;  3UKP A;  4YSH A;  1D4E A;  4H2Q A;  4OPC A;  1ELI A;  1PBF A;  2QA1 A;  2XLR A;  2YG6 A;  3K7M X;  3K7Q X;  5J60 A;  2OA1 A;  2BCP A;  3CGE A;  1N4U A;  1E1N A;  1YQ4 A;  1ZX9 A;  2WP5 A;  3ABV A;  5CKU A;  4A65 A;  4U8P A;  2ZBW A;  3ISH A;  4X4J A;  1PJ6 A;  3D8X A;  3M13 A;  4A6N B;  3GRT A;  3K7T A;  3RP8 A;  1EL5 A;  2JK6 A;  1KF6 A;  3NN0 X;  4B64 A;  3DK8 A;  3V76 A;  2C65 A;  3DGH A;  1XAN A;  2B7R A;  4J56 A;  1KFY A;  2YR6 A;  1RYI A;  2VQB A;  3NIX A;  1K0L A;  2E1M A;  4U8M A;  1TDO A;  2FJB A;  4UP3 A;  3P4P A;  1B8S A;  4KPR A;  1B37 A;  2V61 A;  2WPE A;  2BA9 A;  2XVI A;  4CCQ A;  4P9S A;  2CDU A;  4N9X A;  2PYX A;  4H2N A;  1IUW A;  2OLN A;  1NEK A;  1E1M A;  2XLP A;  4A79 A;  3HZL A;  4B69 A;  2YG5 A;  5L46 A;  2V3A A;  4U2L A;  1V59 A;  1PBE A;  5FS8 A;  4IA6 A;  1JRZ A;  2A8X A;  4PAB A;  1L9D A;  3FMW A;  4Z25 A;  2BK4 A;  4JY2 A;  1FEA A;  4K5S A;  3KVE A;  3QSM A;  3UOX A;  1FCD A;  2YG3 A;  4U8K A;  1M64 A;  4EIQ A;  2C64 A;  1ZKQ A;  4NTC A;  2XFO A;  1EL8 A;  4JNQ A;  1CJ3 A;  1KSS A;  2AR8 A;  2AQJ A;  2GQF A;  2I0Z A;  1NHP A;  4DGK A;  2YLR A;  3LB8 A;  1NDA A;  4I58 A;  3S5W A;  2C3C A;  4EM3 A;  4H2P A;  1OJ9 A;  2JAE A;  2XVF A;  4I59 A;  1CC6 A;  1QO8 A;  3V3N A;  1IUU A;  4FK1 A;  4OPD A;  4BUR A;  2NVK X;  4AP3 A;  4H4X A;  3VR9 A;  5FS7 A;  3UKL A;  4RG3 A;  3ATQ A;  3DJJ A;  3GD4 A;  3AYJ A;  1LQT A;  3DH9 A;  1S2Y A;  4JY3 A;  1GOS A;  4YTP A;  3I3L A;  2GF3 A;  3CIR A;  1PBC A;  3GWF A;  3ALM A;  3NYE A;  4GF7 A;  4H4W A;  4Y4N A;  1LJ1 A;  2C72 A;  4B67 A;  2GAH B;  3PVC A;  3QJ4 A;  4WX1 A;  3SQP A;  3GYI A;  4A5L A;  1DOD A;  4JQ9 A;  3AE1 A;  1NHR A;  3LZX A;  2W0H A;  1P2E A;  1H7W A;  1KNP A;  3R9U A;  2O9Z A;  3UOV A;  1NHS A;  5GRT A;  2C73 A;  4A9W A;  2BK5 A;  3CNT A;  2FJA A;  4REK A;  4Z24 A;  3VRA A;  2GR0 A;  3VR8 A;  4EMJ A;  2XFU A;  4APN A;  1YKJ A;  2VRM A;  3C4A A;  3AEB A;  1GT8 A;  1IUT A;  3NH3 X;  5KOW A;  2DKH A;  1GTH A;  2WDV A;  2YR4 A;  1HYU A;  2Z5Y A;  3G5R A;  3IHM A;  4A6N A;  1TYT A;  1N4V A;  4IVO B;  1S3B A;  3L8K A;  3QVR A;  3G5S A;  4NEV A;  4Z26 A;  3EPT A;  1ZP0 A;  3ALJ A;  3LJP A;  4U8L A;  1TDF A;  3UTH A;  1PXA A;  3ICT A;  2CUL A;  4HA6 A;  5JCN A;  2R45 A;  3FG2 P;  1TDN A;  5IQ4 A;  2BAB A;  1H81 A;  3DA1 A;  3FIM B;  5BUL A;  4YT0 A;  4H4T A;  1OJD A;  3AEE A;  2APG A;  2ZZ0 A;  3WE0 A;  2QAE A;  1D5T A;  2GR2 A;  3M12 A;  2QCU A;  4XWZ A;  3EF6 A;  1Q9I A;  1JNR A;  1H6V A;  2WP6 A;  3DME A;  3JSK A;  3SM8 A;  1F8R A;  1IUV A;  2F5Z A;  2H88 A;  3ZDN A;  1PN0 A;  4K8D A;  3SFD A;  3GMC A;  2EQ7 A;  2OAM A;  4TM0 A;  3VQR A;  3BI2 A;  1DJQ A;  4K7Z A;  1ZMC A;  5BVA A;  3NTD A;  4A99 A;  1LV0 A;  2VVM A;  1DOB A;  1JU2 A;  1EL7 A;  2FBW A;  3ICR A;  3D1C A;  2CFY A;  1VRQ B;  2YQU A;  3LAD A;  4BJY A;  1H7X A;  2YG7 A;  3IWA A;  3QSS A;  2XCG A;  1PJ7 A;  2X8C A;  3AXB A;  2TPR A;  2WDQ A;  3CNJ A;  3AE3 A;  3UTE A;  2X99 A;  2C70 A;  2YM1 A;  1ZOY A;  4YWO A;  2GH5 A;  2DKI A;  3DK9 A;  2R9Z A;  1KSU A;  2YLZ A;  3QSE A;  3KKJ A;  2B9Y A;  2IVD A;  1GRE A;  2TMD A;  1H86 A;  3QFA A;  3CND A;  3UKA A;  4H4S A;  4OPL A;  3UOZ A;  1MO9 A;  1F3P A;  3NTA A;  3OZ2 A;  3EAN A;  3ALL A;  4OPG A;  4ZN0 A;  1TDE A;  1XPQ A;  3FBS A;  4ECH A;  3URH A;  4H4Q A;  2V6O A;  4YKF A;  2A87 A;  3UKH A;  1BF3 A;  3P1W A;  4H4Z A;  2Q0K A;  3DJD A;  4UDR A;  2VOU A;  1F8S A;  5U63 A;  4DNA A;  1E6E A;  5HYM A;  3P9U A;  3DGZ A;  1Y0P A;  2BXR A;  3H8I A;  4C77 A;  4YTN A;  2PHH A;  1LTX R;  2R46 A;  2YVJ A;  4EMI A;  2Q6U A;  5C2T A;  1AOG A;  1Q1W A;  1H83 A;  3E1T A;  4LU6 A;  2ZZB A;  3AWI A;  1FL2 A;  1CJ4 A;  3NYF A;  4H4V A;  4H4Y A;  1ZDL A;  1GSN A;  4O5Q A;  1VG0 A;  2WPC A;  4YTM A;  2JB3 A;  2VVL A;  1JNZ A;  2X3N A;  3II4 A;  4KX6 A;  5EB5 A;  3KLJ A;  1LPF A;  2XLU A;  4GDP A;  5BRT A;  1PJ5 A;  3RP7 A;  1GRF A;  2C76 A;  2WU5 A;  5DBJ A;  1CJ2 A;  2BS2 A;  1W4X A;  2GV8 A;  3PS9 A;  4Z2U A;  3EAO A;  1VG9 A;  2Q7V A;  2R0G A;  3KA7 A;  3CNP A;  3GSI A;  4RSL A;  1B4V A;  1O95 A;  1L9C A;  2RGO A;  4U2T A;  3RHA A;  3NK2 X;  2QA2 A;  3BHF A;  3IF9 A;  2X8H A;  1K0I A;  1IJH A;  1EL9 A;  3NN6 X;  1ZMD A;  2NPX A;  1O5W A;  2E5V A;  1LVL A;  2Z5X A;  4EM4 A;  4CNJ A;  4B1B A;  4OPI A;  5GSN A;  1COY A;  3F8R A;  4K5R A;  2R0C A;  3AYL A;  3NG7 X;  1ZOV A;  2B7S A;  1BWC A;  3UKK A;  3F8P A;  3AEF A;  3BNU A;  4GUV A;  2WBA A;  2GAG B;  4BV6 A;  1CF3 A;  2GR3 A;  3M0O A;  3AEA A;  1X31 B;  1CJC A;  3GD3 A;  4UDP A;  3AD7 B;  2A89 A;  1D4D A;  2AAQ A;  1MXT A;  4CBQ A;  4YXD A;  2YWL A;  3CGB A;  1H84 A;  4BK2 A;  1S2Q A;  4U8I A;  2VQ7 A;  2C66 A;  4H7U A;  4EIP A;  4C3X A;  5C3J A;  2R4E A;  1YQZ A;  4J36 A;  3NLC A;  3UKQ A;  1F6M A;  2B9W A;  2VVL G;  2Y6Q A;  4LA1 A;  1IUS A;  3AEG A;  4OVI A;  1JRX A;  4IV9 A;  1DXL A;  1GAL A;  1N4W A;  2YR5 A;  1IUX A;  5U25 A;  1GRT A;  4CY8 A;  5LV9 A;  1DOC A;  3NRN A;  1JRY A;  1DNC A;  5FS6 A;  4EQX A;  2BS3 A;  3GYJ A;  3QFB A;  1M6I A;  2WES A;  4JDR A;  4XWR A;  1Y56 B;  1NEN A;  4AOX A;  2GEW A;  5FS9 A;  2E4G A;  1TRB A;  2FJE A;  3H4K A;  4EQW A;  4UDQ A;  2JKC A;  1DOE A;  3LOV A;  1SEZ A;  2GB0 A;  3KD9 A;  2ARD A;  3NHO X;  1CC4 A;  4X9N A; 
#chains in the Genus database with same CATH topology
 2BYB A;  2RGH A;  4YSZ A;  5KVH A;  1Q1R A;  2YM2 A;  3HYX A;  3AD8 B;  4M52 A;  3DJE A;  5KXJ A;  5EB4 A;  3Q9T A;  3DJG X;  4II2 A;  4D03 A;  1D7L A;  1YQ3 A;  3BI5 A;  4BK1 A;  1RP0 A;  2CVJ A;  1GRB A;  3ZYX A;  5JCI A;  4BJZ A;  2EQ9 A;  3CGC A;  4NZH A;  5JCM A;  5TR3 A;  1GTE A;  3ICS A;  3UP5 A;  4CNK A;  2V5Z A;  3KPK A;  2EQ8 A;  4E0V A;  3AYI A;  3VRD B;  2HQM A;  3F8D A;  2GMJ A;  5M10 A;  4ZCD A;  2BXS A;  1F8W A;  4OPT A;  3GDN A;  3GWD A;  1PHH A;  1E1L A;  5EOW A;  1FOH A;  3KPF A;  1OJA A;  1NG4 A;  3FPZ A;  4G73 A;  5KRQ A;  4B66 A;  3CMM A;  1VQW A;  1MOK A;  3UOY A;  1GES A;  3AE6 A;  2BK3 A;  3BNM A;  4TM4 A;  4J34 A;  1S3E A;  2WDR A;  2RGJ A;  3B6D A;  1PDH A;  2WET A;  2ACZ A;  3P4R A;  1E1K A;  1GET A;  5KNL A;  4OPU A;  4TM3 A;  2YG4 A;  1XDI A;  3LXD A;  5JCL A;  1GV4 A;  1UKV G;  3AE9 A;  2OLO A;  1GRG A;  2XFQ A;  4AT0 A;  3PO7 A;  1TYP A;  2WOV A;  1JOA A;  4O5U A;  1TDK A;  2BC1 A;  3C4N A;  1GRH A;  4IVM B;  5IPY A;  2WOI A;  4GDE A;  3RED A;  5JCK A;  1NAA A;  2WQY A;  1L9E A;  1N1P A;  3BI4 A;  4Z2R A;  3H8L A;  4C5O A;  4YKG A;  1BZL A;  1B5Q A;  4Z43 A;  4EQR A;  3RNM A;  4Z2T A;  4NTE A;  4ZCC A;  4CCR A;  4U8J A;  2C7G A;  3AE2 A;  4C3Y A;  3AB1 A;  3VRB A;  1REO A;  2YAU A;  3AE8 A;  1BGJ A;  2BCG G;  3OC4 A;  3NK0 X;  4H4P A;  4USQ A;  4AP1 A;  2WP9 A;  2WS3 A;  3NKS A;  3S61 A;  3AD9 B;  4J31 A;  4BK3 A;  1OJC A;  2XFN A;  2X8G A;  4DSG A;  2XYO A;  4J33 A;  3HYV A;  1FEB A;  1H82 A;  2IID A;  3SGL A;  4NTD A;  2GVC A;  4TLZ A;  2XDO A;  3CN8 A;  5CQF A;  3B3R A;  1GPE A;  5BUK A;  2B76 A;  1E7P A;  3CNS A;  1OJT A;  4Y4L A;  3Q6J A;  1FEC A;  4C74 A;  2V60 A;  1EBD A;  2Q0L A;  2YLW A;  3QVP A;  4TLX A;  5J7X A;  4B65 A;  2FJD A;  4EMW A;  4JNA A;  4CRT A;  2X50 A;  4IA5 A;  4TM1 A;  1Y56 A;  2WU2 A;  3GMB A;  5U1O A;  2GRT A;  1CC2 A;  5IQ1 A;  2WEU A;  1ONF A;  2YLS A;  4XXG A;  1GND A;  2C67 A;  2WOW A;  3CPH G;  4H4U A;  3UP4 A;  4H50 A;  3AE7 A;  4MJW A;  1RSG A;  3SX6 A;  2VRL A;  5HHF A;  1BGN A;  3T37 A;  1CBO A;  2XFP A;  2VZ2 A;  1KDG A;  1GXF A;  2GQW A;  1NG3 A;  2GR1 A;  2B9X A;  2V3B A;  3CGD A;  3IC9 A;  3AEC A;  3T0K A;  3V3O A;  2JBV A;  1NHQ A;  4H4R A;  3AE4 A;  3DK4 A;  1NPX A;  3ATR A;  1GER A;  2YVG A;  4OCG A;  1GEU A;  1XHC A;  2RAB A;  4Z44 A;  2XLS A;  3P4S A;  4G74 A;  4X9M A;  3UTG A;  2BS4 A;  3NYC A;  4ADW A;  3GRS A;  4G6G A;  1K0J A;  3IHG A;  4H2R A;  2BAC A;  1PXC A;  2YVF A;  4GCM A;  1P2H A;  3UTF A;  1PBB A;  2ZZC A;  5M0Z A;  2XVJ A;  5HXI A;  3L1R A;  4U8N A;  3KU9 A;  3UCL A;  1BKW A;  3LZW A;  2J3N A;  4FDC B;  5HY5 A;  3NGC X;  1CHU A;  4USR A;  4B63 A;  5KMP A;  2JB1 A;  2GMH A;  4CY6 A;  1JEH A;  3CTY A;  3G5Q A;  1L0V A;  1QJD A;  1ZK7 A;  3AE5 A;  3CPJ G;  3I6D A;  4EQS A;  2OAL A;  3AED A;  1YY5 A;  4J57 A;  3NT6 A;  3SYI A;  4LII A;  1K4Q A;  2R0P A;  3ITJ A;  4GRT A;  4B68 A;  2IVE A;  2UZZ A;  5KWF A;  1E39 A;  3UKF A;  1PBD A;  4YSX A;  4PAA A;  4A7A A;  2YLX A;  3RP6 A;  4RG4 A;  2XLT A;  2Y6R A;  4U8O A;  3P4Q A;  5KVI A;  1KNR A;  1O94 A;  2YLT A;  3NNE A;  2C75 A;  1PXB A;  3ADA B;  3COX A;  5ER0 A;  3BHK A;  3O0H A;  4J2W A;  4K2X A;  4NEW A;  1DJN A;  5EBK A;  4HB9 A;  4ICY A;  3SFE A;  4D04 A;  2R4J A;  2EQ6 A;  3NK1 X;  4JN9 A;  5KMS A;  3GDP A;  1ZY8 A;  2WHD A;  1GRA A;  2H89 A;  4GR1 A;  5KOX A;  4U2S A;  2BC0 A;  4FK1 C;  1QLB A;  2WPF A;  1D7Y A;  2C3D A;  1CL0 A;  4AT2 A;  1LQU A;  4DSH A;  4FX9 A;  3K30 A;  1PS9 A;  4AOS A;  3C96 A;  4YSY A;  2XVH A;  1D4C A;  1Z6L A;  3CPI G;  1VDC A;  2JB2 A;  4WCT A;  4K22 A;  4Y4M A;  5FMH A;  2XVE A;  3UKP A;  4YSH A;  1D4E A;  4H2Q A;  4OPC A;  1ELI A;  1PBF A;  2QA1 A;  2XLR A;  2YG6 A;  3K7M X;  3K7Q X;  3T2Z A;  2OA1 A;  2BCP A;  3CGE A;  5J60 A;  1N4U A;  1E1N A;  1YQ4 A;  1ZX9 A;  2WP5 A;  3ABV A;  5CKU A;  4A65 A;  4U8P A;  2ZBW A;  3ISH A;  4X4J A;  1PJ6 A;  3D8X A;  3M13 A;  4A6N B;  3GRT A;  3K7T A;  3RP8 A;  1EL5 A;  2JK6 A;  1KF6 A;  3NN0 X;  4B64 A;  3DK8 A;  3V76 A;  2C65 A;  3DGH A;  1XAN A;  2B7R A;  4J56 A;  1KFY A;  2YR6 A;  1RYI A;  2VQB A;  3NIX A;  1K0L A;  2E1M A;  4U8M A;  1TDO A;  2FJB A;  4UP3 A;  3P4P A;  1B8S A;  4KPR A;  1B37 A;  2V61 A;  2WPE A;  2BA9 A;  2XVI A;  4CCQ A;  4P9S A;  2CDU A;  4N9X A;  2PYX A;  4H2N A;  1IUW A;  2OLN A;  1NEK A;  1E1M A;  2XLP A;  4A79 A;  3HZL A;  4B69 A;  2YG5 A;  4GAP A;  5L46 A;  4II3 A;  2V3A A;  4U2L A;  1V59 A;  1PBE A;  5FS8 A;  4IA6 A;  1JRZ A;  2A8X A;  4PAB A;  1L9D A;  3FMW A;  4Z25 A;  2BK4 A;  4GAV A;  1FEA A;  4JY2 A;  4K5S A;  3KVE A;  3QSM A;  3UOX A;  1FCD A;  2YG3 A;  4U8K A;  1M64 A;  4EIQ A;  2C64 A;  1ZKQ A;  4NTC A;  2XFO A;  1EL8 A;  4JNQ A;  1CJ3 A;  1KSS A;  2AR8 A;  2AQJ A;  2GQF A;  2I0Z A;  1NHP A;  4DGK A;  4G6H A;  2YLR A;  3LB8 A;  1NDA A;  4I58 A;  3S5W A;  2C3C A;  3SZW A;  4H2P A;  1OJ9 A;  4EM3 A;  2JAE A;  2XVF A;  4I59 A;  1CC6 A;  1QO8 A;  3V3N A;  1IUU A;  4FK1 A;  3T31 A;  4OPD A;  4BUR A;  2NVK X;  4AP3 A;  4H4X A;  3VR9 A;  5FS7 A;  3UKL A;  4RG3 A;  3ATQ A;  3DJJ A;  3GD4 A;  3AYJ A;  1LQT A;  3DH9 A;  1S2Y A;  4JY3 A;  1GOS A;  4YTP A;  3I3L A;  2GF3 A;  3T2Y A;  3CIR A;  1PBC A;  3GWF A;  3HYW A;  3ALM A;  3SZF A;  3NYE A;  4GF7 A;  4H4W A;  4Y4N A;  1LJ1 A;  2C72 A;  4B67 A;  2GAH B;  3PVC A;  3QJ4 A;  4WX1 A;  3SQP A;  3GYI A;  4A5L A;  1DOD A;  4JQ9 A;  3AE1 A;  1NHR A;  3LZX A;  2W0H A;  1P2E A;  1H7W A;  1KNP A;  3R9U A;  2O9Z A;  3UOV A;  1NHS A;  5GRT A;  2C73 A;  4A9W A;  2BK5 A;  3CNT A;  2FJA A;  4REK A;  4Z24 A;  4NNJ A;  3T14 A;  3VRA A;  2GR0 A;  3VR8 A;  4EMJ A;  2XFU A;  4APN A;  1YKJ A;  2VRM A;  3C4A A;  3AEB A;  1GT8 A;  1IUT A;  3NH3 X;  5KOW A;  2DKH A;  1GTH A;  2WDV A;  2YR4 A;  1HYU A;  2Z5Y A;  3G5R A;  3IHM A;  3SZ0 A;  4A6N A;  1TYT A;  1N4V A;  4IVO B;  1S3B A;  3L8K A;  3QVR A;  3G5S A;  4NEV A;  4Z26 A;  3EPT A;  2BRY A;  1ZP0 A;  3ALJ A;  3LJP A;  4U8L A;  1TDF A;  3UTH A;  1PXA A;  3ICT A;  2CUL A;  4HA6 A;  5JCN A;  2R45 A;  3FG2 P;  1TDN A;  5IQ4 A;  2BAB A;  1H81 A;  3DA1 A;  2BRA A;  3FIM B;  5BUL A;  4YT0 A;  4H4T A;  1OJD A;  3AEE A;  2APG A;  2ZZ0 A;  3WE0 A;  2QAE A;  1D5T A;  2GR2 A;  3M12 A;  2QCU A;  4XWZ A;  3EF6 A;  1Q9I A;  1JNR A;  1H6V A;  2WP6 A;  3DME A;  3JSK A;  3SM8 A;  1F8R A;  1IUV A;  2F5Z A;  2H88 A;  3ZDN A;  1PN0 A;  4K8D A;  3SFD A;  3GMC A;  2EQ7 A;  2OAM A;  4TM0 A;  3VQR A;  3BI2 A;  1DJQ A;  4K7Z A;  1ZMC A;  5BVA A;  3NTD A;  4A99 A;  5KMR A;  1LV0 A;  2VVM A;  1DOB A;  1JU2 A;  1EL7 A;  2FBW A;  3ICR A;  3D1C A;  2CFY A;  1VRQ B;  2YQU A;  3LAD A;  4BJY A;  3SY4 A;  1H7X A;  2YG7 A;  3IWA A;  3QSS A;  2XCG A;  1PJ7 A;  2X8C A;  3AXB A;  2TPR A;  2WDQ A;  3CNJ A;  3AE3 A;  3UTE A;  2X99 A;  2C70 A;  4NWZ A;  2YM1 A;  1ZOY A;  4YWO A;  2GH5 A;  2DKI A;  3DK9 A;  2R9Z A;  1KSU A;  2YLZ A;  3QSE A;  3KKJ A;  2B9Y A;  2IVD A;  1GRE A;  2TMD A;  1H86 A;  3QFA A;  3CND A;  3UKA A;  4H4S A;  4OPL A;  3UOZ A;  1MO9 A;  5KMQ A;  1F3P A;  3NTA A;  3OZ2 A;  3EAN A;  3ALL A;  4OPG A;  4ZN0 A;  1TDE A;  1XPQ A;  3FBS A;  4ECH A;  3URH A;  4H4Q A;  2V6O A;  4YKF A;  2A87 A;  3UKH A;  1BF3 A;  3P1W A;  4H4Z A;  2Q0K A;  3DJD A;  4UDR A;  2VOU A;  1F8S A;  5U63 A;  4DNA A;  1E6E A;  5HYM A;  3P9U A;  3DGZ A;  1Y0P A;  2BXR A;  3H8I A;  4C77 A;  4YTN A;  2PHH A;  1LTX R;  2R46 A;  2YVJ A;  4EMI A;  2Q6U A;  5C2T A;  1AOG A;  1Q1W A;  1H83 A;  3E1T A;  4LU6 A;  2ZZB A;  3AWI A;  1FL2 A;  3T2K A;  1CJ4 A;  3NYF A;  4H4V A;  4H4Y A;  1ZDL A;  1GSN A;  4O5Q A;  1VG0 A;  2WPC A;  4YTM A;  2JB3 A;  2VVL A;  1JNZ A;  2X3N A;  3II4 A;  4KX6 A;  5EB5 A;  3KLJ A;  1LPF A;  2XLU A;  4GDP A;  5BRT A;  1PJ5 A;  3RP7 A;  1GRF A;  2C76 A;  2WU5 A;  5DBJ A;  1CJ2 A;  2BS2 A;  1W4X A;  2GV8 A;  3PS9 A;  4Z2U A;  3EAO A;  1VG9 A;  2Q7V A;  2R0G A;  3KA7 A;  3CNP A;  3GSI A;  4RSL A;  1B4V A;  1O95 A;  1L9C A;  2RGO A;  4U2T A;  3RHA A;  3NK2 X;  2QA2 A;  3BHF A;  3IF9 A;  2X8H A;  1K0I A;  1IJH A;  1EL9 A;  3NN6 X;  1ZMD A;  2NPX A;  1O5W A;  2E5V A;  1LVL A;  2Z5X A;  4EM4 A;  3SXI A;  4CNJ A;  4B1B A;  4OPI A;  5GSN A;  1COY A;  3SZC A;  3F8R A;  4K5R A;  2R0C A;  3AYL A;  3NG7 X;  1ZOV A;  2B7S A;  1BWC A;  3UKK A;  3F8P A;  3AEF A;  3BNU A;  4G9K A;  4GUV A;  2WBA A;  2GAG B;  4BV6 A;  1CF3 A;  2GR3 A;  3M0O A;  3AEA A;  1X31 B;  1CJC A;  3GD3 A;  4UDP A;  3AD7 B;  2A89 A;  1D4D A;  2AAQ A;  1MXT A;  4CBQ A;  4YXD A;  2YWL A;  3CGB A;  1H84 A;  4BK2 A;  1S2Q A;  4U8I A;  2VQ7 A;  2C66 A;  4H7U A;  4EIP A;  4C3X A;  5C3J A;  2R4E A;  1YQZ A;  4J36 A;  3NLC A;  3UKQ A;  1F6M A;  2B9W A;  2VVL G;  2Y6Q A;  4LA1 A;  1IUS A;  3AEG A;  4OVI A;  1JRX A;  4IV9 A;  2C4C A;  1DXL A;  1GAL A;  1N4W A;  2YR5 A;  1IUX A;  5U25 A;  1GRT A;  4CY8 A;  5LV9 A;  1DOC A;  3NRN A;  1JRY A;  1DNC A;  5FS6 A;  4EQX A;  2BS3 A;  3GYJ A;  3QFB A;  1M6I A;  2WES A;  3GYX A;  4JDR A;  4XWR A;  1Y56 B;  1NEN A;  4AOX A;  2GEW A;  5FS9 A;  2E4G A;  1TRB A;  2FJE A;  3H4K A;  4EQW A;  4UDQ A;  2JKC A;  1DOE A;  3LOV A;  1SEZ A;  2GB0 A;  3KD9 A;  2ARD A;  3NHO X;  1CC4 A;  4X9N A; 
#chains in the Genus database with same CATH homology
 2BYB A;  2RGH A;  4YSZ A;  5KVH A;  1Q1R A;  2YM2 A;  3HYX A;  3AD8 B;  4M52 A;  3DJE A;  5KXJ A;  5EB4 A;  3Q9T A;  3DJG X;  4II2 A;  4D03 A;  1D7L A;  1YQ3 A;  3BI5 A;  4BK1 A;  1RP0 A;  2CVJ A;  1GRB A;  3ZYX A;  5JCI A;  4BJZ A;  2EQ9 A;  3CGC A;  4NZH A;  5JCM A;  5TR3 A;  1GTE A;  3ICS A;  3UP5 A;  4CNK A;  2V5Z A;  3KPK A;  2EQ8 A;  4E0V A;  3AYI A;  3VRD B;  2HQM A;  3F8D A;  2GMJ A;  5M10 A;  4ZCD A;  2BXS A;  1F8W A;  4OPT A;  3GDN A;  3GWD A;  1PHH A;  1E1L A;  5EOW A;  1FOH A;  3KPF A;  1OJA A;  1NG4 A;  3FPZ A;  4G73 A;  5KRQ A;  4B66 A;  3CMM A;  1VQW A;  1MOK A;  3UOY A;  1GES A;  3AE6 A;  2BK3 A;  3BNM A;  4TM4 A;  4J34 A;  1S3E A;  2WDR A;  2RGJ A;  3B6D A;  1PDH A;  2WET A;  2ACZ A;  3P4R A;  1E1K A;  1GET A;  5KNL A;  4OPU A;  4TM3 A;  2YG4 A;  1XDI A;  3LXD A;  5JCL A;  1GV4 A;  1UKV G;  3AE9 A;  2OLO A;  1GRG A;  2XFQ A;  4AT0 A;  3PO7 A;  1TYP A;  2WOV A;  1JOA A;  4O5U A;  1TDK A;  2BC1 A;  3C4N A;  1GRH A;  4IVM B;  5IPY A;  2WOI A;  4GDE A;  3RED A;  5JCK A;  1NAA A;  2WQY A;  1L9E A;  1N1P A;  3BI4 A;  4Z2R A;  3H8L A;  4C5O A;  4YKG A;  1BZL A;  1B5Q A;  4Z43 A;  4EQR A;  3RNM A;  4Z2T A;  4NTE A;  4ZCC A;  4CCR A;  4U8J A;  2C7G A;  3AE2 A;  4C3Y A;  3AB1 A;  3VRB A;  1REO A;  2YAU A;  3AE8 A;  1BGJ A;  2BCG G;  3OC4 A;  3NK0 X;  4H4P A;  4USQ A;  4AP1 A;  2WP9 A;  2WS3 A;  3NKS A;  3S61 A;  3AD9 B;  4J31 A;  4BK3 A;  1OJC A;  2XFN A;  2X8G A;  4DSG A;  2XYO A;  4J33 A;  3HYV A;  1FEB A;  1H82 A;  2IID A;  3SGL A;  4NTD A;  2GVC A;  4TLZ A;  2XDO A;  3CN8 A;  5CQF A;  3B3R A;  1GPE A;  5BUK A;  2B76 A;  1E7P A;  3CNS A;  1OJT A;  4Y4L A;  3Q6J A;  1FEC A;  4C74 A;  2V60 A;  1EBD A;  2Q0L A;  2YLW A;  3QVP A;  4TLX A;  5J7X A;  4B65 A;  2FJD A;  4EMW A;  4JNA A;  4CRT A;  2X50 A;  4IA5 A;  4TM1 A;  1Y56 A;  2WU2 A;  3GMB A;  5U1O A;  2GRT A;  1CC2 A;  5IQ1 A;  2WEU A;  1ONF A;  2YLS A;  4XXG A;  1GND A;  2C67 A;  2WOW A;  3CPH G;  4H4U A;  3UP4 A;  4H50 A;  3AE7 A;  4MJW A;  1RSG A;  3SX6 A;  2VRL A;  5HHF A;  1BGN A;  3T37 A;  1CBO A;  2XFP A;  2VZ2 A;  1KDG A;  1GXF A;  2GQW A;  1NG3 A;  2GR1 A;  2B9X A;  2V3B A;  3CGD A;  3IC9 A;  3AEC A;  3T0K A;  3V3O A;  2JBV A;  1NHQ A;  4H4R A;  3AE4 A;  3DK4 A;  1NPX A;  3ATR A;  1GER A;  2YVG A;  4OCG A;  1GEU A;  1XHC A;  2RAB A;  4Z44 A;  2XLS A;  3P4S A;  4G74 A;  4X9M A;  3UTG A;  2BS4 A;  3NYC A;  4ADW A;  3GRS A;  4G6G A;  1K0J A;  3IHG A;  4H2R A;  2BAC A;  1PXC A;  2YVF A;  4GCM A;  1P2H A;  3UTF A;  1PBB A;  2ZZC A;  5M0Z A;  2XVJ A;  5HXI A;  3L1R A;  4U8N A;  3KU9 A;  3UCL A;  1BKW A;  3LZW A;  2J3N A;  4FDC B;  5HY5 A;  3NGC X;  1CHU A;  4USR A;  4B63 A;  5KMP A;  2JB1 A;  2GMH A;  4CY6 A;  1JEH A;  3CTY A;  3G5Q A;  1L0V A;  1QJD A;  1ZK7 A;  3AE5 A;  3CPJ G;  3I6D A;  4EQS A;  2OAL A;  3AED A;  1YY5 A;  4J57 A;  3NT6 A;  3SYI A;  4LII A;  1K4Q A;  2R0P A;  3ITJ A;  4GRT A;  4B68 A;  2IVE A;  2UZZ A;  5KWF A;  1E39 A;  3UKF A;  1PBD A;  4YSX A;  4PAA A;  4A7A A;  2YLX A;  3RP6 A;  4RG4 A;  2XLT A;  2Y6R A;  4U8O A;  3P4Q A;  5KVI A;  1KNR A;  1O94 A;  2YLT A;  3NNE A;  2C75 A;  1PXB A;  3ADA B;  3COX A;  5ER0 A;  3BHK A;  3O0H A;  4J2W A;  4K2X A;  4NEW A;  1DJN A;  5EBK A;  4HB9 A;  4ICY A;  3SFE A;  4D04 A;  2R4J A;  2EQ6 A;  3NK1 X;  4JN9 A;  5KMS A;  3GDP A;  1ZY8 A;  2WHD A;  1GRA A;  2H89 A;  4GR1 A;  5KOX A;  4U2S A;  2BC0 A;  4FK1 C;  1QLB A;  2WPF A;  1D7Y A;  2C3D A;  1CL0 A;  4AT2 A;  1LQU A;  4DSH A;  4FX9 A;  3K30 A;  1PS9 A;  4AOS A;  3C96 A;  4YSY A;  2XVH A;  1D4C A;  1Z6L A;  3CPI G;  1VDC A;  2JB2 A;  4WCT A;  4K22 A;  4Y4M A;  5FMH A;  2XVE A;  3UKP A;  4YSH A;  1D4E A;  4H2Q A;  4OPC A;  1ELI A;  1PBF A;  2QA1 A;  2XLR A;  2YG6 A;  3K7M X;  3K7Q X;  3T2Z A;  2OA1 A;  2BCP A;  3CGE A;  5J60 A;  1N4U A;  1E1N A;  1YQ4 A;  1ZX9 A;  2WP5 A;  3ABV A;  5CKU A;  4A65 A;  4U8P A;  2ZBW A;  3ISH A;  4X4J A;  1PJ6 A;  3D8X A;  3M13 A;  4A6N B;  3GRT A;  3K7T A;  3RP8 A;  1EL5 A;  2JK6 A;  1KF6 A;  3NN0 X;  4B64 A;  3DK8 A;  3V76 A;  2C65 A;  3DGH A;  1XAN A;  2B7R A;  4J56 A;  1KFY A;  2YR6 A;  1RYI A;  2VQB A;  3NIX A;  1K0L A;  2E1M A;  4U8M A;  1TDO A;  2FJB A;  4UP3 A;  3P4P A;  1B8S A;  4KPR A;  1B37 A;  2V61 A;  2WPE A;  2BA9 A;  2XVI A;  4CCQ A;  4P9S A;  2CDU A;  4N9X A;  2PYX A;  4H2N A;  1IUW A;  2OLN A;  1NEK A;  1E1M A;  2XLP A;  4A79 A;  3HZL A;  4B69 A;  2YG5 A;  4GAP A;  5L46 A;  4II3 A;  2V3A A;  4U2L A;  1V59 A;  1PBE A;  5FS8 A;  4IA6 A;  1JRZ A;  2A8X A;  4PAB A;  1L9D A;  3FMW A;  4Z25 A;  2BK4 A;  4GAV A;  1FEA A;  4JY2 A;  4K5S A;  3KVE A;  3QSM A;  3UOX A;  1FCD A;  2YG3 A;  4U8K A;  1M64 A;  4EIQ A;  2C64 A;  1ZKQ A;  4NTC A;  2XFO A;  1EL8 A;  4JNQ A;  1CJ3 A;  1KSS A;  2AR8 A;  2AQJ A;  2GQF A;  2I0Z A;  1NHP A;  4DGK A;  4G6H A;  2YLR A;  3LB8 A;  1NDA A;  4I58 A;  3S5W A;  2C3C A;  3SZW A;  4H2P A;  1OJ9 A;  4EM3 A;  2JAE A;  2XVF A;  4I59 A;  1CC6 A;  1QO8 A;  3V3N A;  1IUU A;  4FK1 A;  3T31 A;  4OPD A;  4BUR A;  2NVK X;  4AP3 A;  4H4X A;  3VR9 A;  5FS7 A;  3UKL A;  4RG3 A;  3ATQ A;  3DJJ A;  3GD4 A;  3AYJ A;  1LQT A;  3DH9 A;  1S2Y A;  4JY3 A;  1GOS A;  4YTP A;  3I3L A;  2GF3 A;  3T2Y A;  3CIR A;  1PBC A;  3GWF A;  3HYW A;  3ALM A;  3SZF A;  3NYE A;  4GF7 A;  4H4W A;  4Y4N A;  1LJ1 A;  2C72 A;  4B67 A;  2GAH B;  3PVC A;  3QJ4 A;  4WX1 A;  3SQP A;  3GYI A;  4A5L A;  1DOD A;  4JQ9 A;  3AE1 A;  1NHR A;  3LZX A;  2W0H A;  1P2E A;  1H7W A;  1KNP A;  3R9U A;  2O9Z A;  3UOV A;  1NHS A;  5GRT A;  2C73 A;  4A9W A;  2BK5 A;  3CNT A;  2FJA A;  4REK A;  4Z24 A;  4NNJ A;  3T14 A;  3VRA A;  2GR0 A;  3VR8 A;  4EMJ A;  2XFU A;  4APN A;  1YKJ A;  2VRM A;  3C4A A;  3AEB A;  1GT8 A;  1IUT A;  3NH3 X;  5KOW A;  2DKH A;  1GTH A;  2WDV A;  2YR4 A;  1HYU A;  2Z5Y A;  3G5R A;  3IHM A;  3SZ0 A;  4A6N A;  1TYT A;  1N4V A;  4IVO B;  1S3B A;  3L8K A;  3QVR A;  3G5S A;  4NEV A;  4Z26 A;  3EPT A;  2BRY A;  1ZP0 A;  3ALJ A;  3LJP A;  4U8L A;  1TDF A;  3UTH A;  1PXA A;  3ICT A;  2CUL A;  4HA6 A;  5JCN A;  2R45 A;  3FG2 P;  1TDN A;  5IQ4 A;  2BAB A;  1H81 A;  3DA1 A;  2BRA A;  3FIM B;  5BUL A;  4YT0 A;  4H4T A;  1OJD A;  3AEE A;  2APG A;  2ZZ0 A;  3WE0 A;  2QAE A;  1D5T A;  2GR2 A;  3M12 A;  2QCU A;  4XWZ A;  3EF6 A;  1Q9I A;  1JNR A;  1H6V A;  2WP6 A;  3DME A;  3JSK A;  3SM8 A;  1F8R A;  1IUV A;  2F5Z A;  2H88 A;  3ZDN A;  1PN0 A;  4K8D A;  3SFD A;  3GMC A;  2EQ7 A;  2OAM A;  4TM0 A;  3VQR A;  3BI2 A;  1DJQ A;  4K7Z A;  1ZMC A;  5BVA A;  3NTD A;  4A99 A;  5KMR A;  1LV0 A;  2VVM A;  1DOB A;  1JU2 A;  1EL7 A;  2FBW A;  3ICR A;  3D1C A;  2CFY A;  1VRQ B;  2YQU A;  3LAD A;  4BJY A;  3SY4 A;  1H7X A;  2YG7 A;  3IWA A;  3QSS A;  2XCG A;  1PJ7 A;  2X8C A;  3AXB A;  2TPR A;  2WDQ A;  3CNJ A;  3AE3 A;  3UTE A;  2X99 A;  2C70 A;  4NWZ A;  2YM1 A;  1ZOY A;  4YWO A;  2GH5 A;  2DKI A;  3DK9 A;  2R9Z A;  1KSU A;  2YLZ A;  3QSE A;  3KKJ A;  2B9Y A;  2IVD A;  1GRE A;  2TMD A;  1H86 A;  3QFA A;  3CND A;  3UKA A;  4H4S A;  4OPL A;  3UOZ A;  1MO9 A;  5KMQ A;  1F3P A;  3NTA A;  3OZ2 A;  3EAN A;  3ALL A;  4OPG A;  4ZN0 A;  1TDE A;  1XPQ A;  3FBS A;  4ECH A;  3URH A;  4H4Q A;  2V6O A;  4YKF A;  2A87 A;  3UKH A;  1BF3 A;  3P1W A;  4H4Z A;  2Q0K A;  3DJD A;  4UDR A;  2VOU A;  1F8S A;  5U63 A;  4DNA A;  1E6E A;  5HYM A;  3P9U A;  3DGZ A;  1Y0P A;  2BXR A;  3H8I A;  4C77 A;  4YTN A;  2PHH A;  1LTX R;  2R46 A;  2YVJ A;  4EMI A;  2Q6U A;  5C2T A;  1AOG A;  1Q1W A;  1H83 A;  3E1T A;  4LU6 A;  2ZZB A;  3AWI A;  1FL2 A;  3T2K A;  1CJ4 A;  3NYF A;  4H4V A;  4H4Y A;  1ZDL A;  1GSN A;  4O5Q A;  1VG0 A;  2WPC A;  4YTM A;  2JB3 A;  2VVL A;  1JNZ A;  2X3N A;  3II4 A;  4KX6 A;  5EB5 A;  3KLJ A;  1LPF A;  2XLU A;  4GDP A;  5BRT A;  1PJ5 A;  3RP7 A;  1GRF A;  2C76 A;  2WU5 A;  5DBJ A;  1CJ2 A;  2BS2 A;  1W4X A;  2GV8 A;  3PS9 A;  4Z2U A;  3EAO A;  1VG9 A;  2Q7V A;  2R0G A;  3KA7 A;  3CNP A;  3GSI A;  4RSL A;  1B4V A;  1O95 A;  1L9C A;  2RGO A;  4U2T A;  3RHA A;  3NK2 X;  2QA2 A;  3BHF A;  3IF9 A;  2X8H A;  1K0I A;  1IJH A;  1EL9 A;  3NN6 X;  1ZMD A;  2NPX A;  1O5W A;  2E5V A;  1LVL A;  2Z5X A;  4EM4 A;  3SXI A;  4CNJ A;  4B1B A;  4OPI A;  5GSN A;  1COY A;  3SZC A;  3F8R A;  4K5R A;  2R0C A;  3AYL A;  3NG7 X;  1ZOV A;  2B7S A;  1BWC A;  3UKK A;  3F8P A;  3AEF A;  3BNU A;  4G9K A;  4GUV A;  2WBA A;  2GAG B;  4BV6 A;  1CF3 A;  2GR3 A;  3M0O A;  3AEA A;  1X31 B;  1CJC A;  3GD3 A;  4UDP A;  3AD7 B;  2A89 A;  1D4D A;  2AAQ A;  1MXT A;  4CBQ A;  4YXD A;  2YWL A;  3CGB A;  1H84 A;  4BK2 A;  1S2Q A;  4U8I A;  2VQ7 A;  2C66 A;  4H7U A;  4EIP A;  4C3X A;  5C3J A;  2R4E A;  1YQZ A;  4J36 A;  3NLC A;  3UKQ A;  1F6M A;  2B9W A;  2VVL G;  2Y6Q A;  4LA1 A;  1IUS A;  3AEG A;  4OVI A;  1JRX A;  4IV9 A;  2C4C A;  1DXL A;  1GAL A;  1N4W A;  2YR5 A;  1IUX A;  5U25 A;  1GRT A;  4CY8 A;  5LV9 A;  1DOC A;  3NRN A;  1JRY A;  1DNC A;  5FS6 A;  4EQX A;  2BS3 A;  3GYJ A;  3QFB A;  1M6I A;  2WES A;  3GYX A;  4JDR A;  4XWR A;  1Y56 B;  1NEN A;  4AOX A;  2GEW A;  5FS9 A;  2E4G A;  1TRB A;  2FJE A;  3H4K A;  4EQW A;  4UDQ A;  2JKC A;  1DOE A;  3LOV A;  1SEZ A;  2GB0 A;  3KD9 A;  2ARD A;  3NHO X;  1CC4 A;  4X9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...