2VQ7A

Bacterial flavin-containing monooxygenase in complex with nadp: native data
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
443
structure length
443
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
total genus 159
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A02
1NHPA 3UOXA 3VQRA 1E1NA 5BUKA 3UOVA 4Z2RA 2A8XA 2CULA 5KRQA 5U63A 4K2XA 4U8NA 3IWAA 5KVHA 4H2QA 3II4A 1CJ3A 4NTEA 3T37A 2XFOA 2IIDA 4FK1A 4C77A 3C4NA 5J7XA 3BHFA 3F8PA 4H4UA 4J31A 2WU2A 4X4JA 3C4AA 1OJCA 4CCRA 3L1RA 1FCDA 3QFBA 4BK2A 4ADWA 2YLXA 2GRTA 2ACZA 1L9CA 2X50A 2ZZCA 1L9DA 1PBFA 1Z6LA 2GEWA 3ATQA 1NHSA 3ICRA 3AEFA 3RP6A 3UKLA 4ICYA 3KLJA 2B7SA 1OJAA 4TLZA 4A99A 4BK1A 4J2WA 4B65A 3AD7B 1S3EA 3BI4A 2GAGB 1KF6A 1DJNA 1CHUA 1NHQA 1ZOVA 1RSGA 4Y4LA 2EQ8A 4YTPA 4BV6A 4TM4A 2WPFA 1XANA 5FS8A 2V3AA 4A6NB 4B64A 1NPXA 3IHMA 2BCGG 5C3JA 5FMHA 3P9UA 3V76A 2WOVA 5HHFA 1VQWA 4N9XA 5EB4A 2XVJA 3UP5A 5GSNA 3BHKA 3RHAA 1N1PA 3NLCA 1TDEA 1F8WA 2XFNA 1QJDA 4J33A 4IV9A 1GALA 2RABA 3QSSA 1ZMDA 4K22A 4OPTA 2TPRA 5FS7A 3IHGA 3CNPA 4OPDA 3AE3A 1AOGA 4FK1C 2NPXA 2YLZA 1ZDLA 1V59A 2EQ6A 2VRLA 1B4VA 1BGJA 3SFDA 3FG2P 4J56A 2C7GA 2C66A 4DSGA 2JK6A 4U8PA 3RP8A 3PS9A 4B1BA 3D1CA 1BZLA 4E0VA 4U8IA 1NHRA 3EAOA 2RGHA 3GD4A 2X8HA 4K8DA 1FECA 2X3NA 4REKA 4EQRA 4EM4A 1LQUA 1ZY8A 2BS2A 1H6VA 2YLRA 3EANA 3H4KA 3VRBA 3DJJA 2RGJA 1VG0A 2WP6A 1H83A 2FJBA 1B37A 5LV9A 1GEUA 3UKHA 2V3BA 1CC4A 4H2RA 3GYJA 3GWDA 3AD8B 2BACA 4C3YA 4YSZA 1OJ9A 1MO9A 2CDUA 1PXAA 3NT6A 3UP4A 1CJ4A 3NK2X 3P4PA 1IUWA 4A7AA 4EQWA 4EQSA 4YXDA 4DNAA 3AYJA 3D8XA 2OA1A 3K30A 3K7QX 5IQ4A 3GRTA 2A89A 4KX6A 2Y6QA 1K0IA 3ABVA 4H4YA 4U2LA 5ER0A 2BA9A 3AD9B 3DH9A 4OVIA 1TRBA 2GQWA 2YLTA 3BNUA 2BK3A 2XLRA 2JBVA 1B8SA 2YVJA 4NTCA 2YQUA 2AAQA 3EPTA 3NG7X 3M0OA 5HXIA 3UTFA 1TDNA 4U8OA 2C72A 3H8LA 1D4EA 1BKWA 1F6MA 4EMIA 1QLBA 1H7XA 2OLOA 5HY5A 1MOKA 1REOA 4I58A 4TLXA 3ALJA 3I3LA 2B76A 3QSMA 2RGOA 1VG9A 3NTAA 4RG4A 1GXFA 1YQ3A 4BK3A 3UKAA 3C96A 1Q1RA 1S2YA 1CL0A 1DNCA 3Q6JA 3QJ4A 1NG3A 4USQA 3V3NA 5IPYA 1E6EA 1D5TA 2ARDA 3AE8A 4IVOB 1GT8A 4C5OA 1DODA 3UKKA 4EIPA 4H7UA 1PXCA 1ZX9A 4C74A 2GR3A 4HB9A 1P2EA 3K7TA 2WPEA 1E1LA 4JN9A 4TM3A 4EM3A 2C70A 2VVLA 1CJCA 2YR5A 5KOWA 3AE6A 3NYEA 3URHA 1IJHA 1TYPA 2FBWA 2UZZA 2WBAA 2Q0KA 2WOWA 3NKSA 4GDEA 4GR1A 4Z2UA 3CNJA 3NK1X 4P9SA 2QA2A 3UTEA 5EBKA 5HYMA 4UDPA 3UOZA 2VOUA 4I59A 3SFEA 1KNRA 1ONFA 1O95A 2H88A 4CY8A 1P2HA 1FEBA 4H4QA 4H4TA 2OLNA 2XCGA 2XVEA 1NAAA 2WU5A 3AE7A 4CY6A 3NYCA 3V3OA 1ZKQA 4B67A 1D7YA 2WETA 1GPEA 2FJDA 2YM1A 1EL8A 2BK4A 4FX9A 3ZYXA 2BS3A 2XLPA 4H2NA 1JNRA 3GRSA 3DMEA 1GRFA 5M0ZA 2O9ZA 3VR8A 3NYFA 1IUXA 1O5WA 2B7RA 3VRDB 1IUTA 2YG6A 4H4ZA 5C2TA 4A6NA 1M6IA 3P4SA 4AT2A 2WHDA 1PBDA 5CQFA 1Y56A 4A65A 1GV4A 1Y0PA 1PBEA 4NTDA 3REDA 1E1MA 2HQMA 4H4PA 4ECHA 1TYTA 3CIRA 5KWFA 4YWOA 5L46A 2OALA 5EB5A 3AE4A 2JB1A 3AYIA 4HA6A 4USRA 4AOSA 1FL2A 4AOXA 4IVMB 3AE2A 5CKUA 1KNPA 4CCQA 4IA5A 3ALMA 4ZN0A 3BNMA 4JY3A 3M12A 4Z25A 3QVRA 2JB2A 2GV8A 3CPHG 1PS9A 4M52A 3AB1A 1JU2A 1EBDA 3KPFA 4Z43A 1KFYA 2Q0LA 2WS3A 1H82A 2BK5A 3WE0A 1CC6A 2B9XA 2OAMA 2WOIA 5U1OA 1K4QA 4LU6A 4D03A 5JCNA 4Y4NA 2JB3A 4H4VA 3VRAA 2X8GA 2ZZBA 1GERA 1CC2A 2YG4A 1L9EA 3AE5A 3O0HA 4J57A 4U2TA 2E4GA 1DOCA 3M13A 2GH5A 2F5ZA 2XFQA 3NHOX 1ZOYA 1PJ6A 4XWRA 3CGDA 1GRTA 3S5WA 3UKPA 2WP5A 3JSKA 3AEAA 2YR6A 1TDFA 2C67A 5M10A 1K0JA 2VRMA 3NN6X 1GRHA 1PN0A 2XFUA 4OPUA 5KVIA 4OPIA 3ICSA 3P4QA 4JDRA 4Z26A 4GDPA 2PYXA 3DJEA 3KD9A 1W4XA 1VRQB 2Z5XA 2WP9A 4UDRA 3NN0X 2GR0A 3S61A 2XDOA 2BC1A 2BS4A 1GETA 2PHHA 1Y56B 3GMCA 2B9YA 4YTNA 4ZCDA 4AT0A 4EQXA 2C64A 3H8IA 2YVGA 2QA1A 4CNJA 3HZLA 3DK9A 1GTHA 1JRZA 1PXBA 3RP7A 5DBJA 1PBBA 4MJWA 2FJAA 3QVPA 3AWIA 3UOYA 3SGLA 3LZXA 3P4RA 1IUUA 4YKGA 3DGZA 3K7MX 3NGCX 3GDNA 3CGCA 2C76A 1UKVG 1DXLA 2R4JA 1E39A 3CNTA 4U2SA 2JAEA 1KSSA 4H4XA 4RG3A 1GREA 2R0CA 2V60A 2IVDA 4NZHA 5FS6A 2YLSA 2YVFA 3LOVA 2EQ7A 1JOAA 4YKFA 4Z44A 5BULA 2YG7A 3LADA 2XVHA 2X99A 3B3RA 3IF9A 4JY2A 3UTGA 4JQ9A 3GMBA 4Y4MA 2R9ZA 3BI2A 3ICTA 2GR2A 2Z5YA 4OPCA 2ZZ0A 1DOBA 4EMWA 1IUVA 3CN8A 3EF6A 4PAAA 2TMDA 1KDGA 5TR3A 4B69A 4X9MA 4WCTA 4UDQA 2C65A 2XLUA 2R0PA 2XYOA 1ZK7A 2WDQA 2C3DA 3UCLA 1CBOA 4YSXA 2R4EA 4JNAA 3L8KA 1PJ7A 2R46A 1RP0A 1IUSA 2CVJA 2W0HA 4H2PA 2C73A 1GNDA 4H4SA 1YY5A 4IA6A 3OZ2A 2GVCA 3NIXA 4H4WA 2VVMA 3CPJG 4J36A 3R9UA 2BXSA 4YSHA 3AEBA 1H81A 2XLSA 3KKJA 3DGHA 4OCGA 1EL9A 4OPGA 3KA7A 3ITJA 1CJ2A 2R45A 2WDRA 2GQFA 1JNZA 1MXTA 1TDOA 2BABA 1BWCA 3CGEA 3GWFA 1JRXA 3KU9A 3P1WA 2A87A 4Z2TA 2GR1A 4XXGA 3QFAA 2YLWA 5KXJA 2WEUA 1F8RA 4PABA 5U25A 3BI5A 2E1MA 4YTMA 1GSNA 2Q6UA 3GYIA 2YG5A 1E7PA 1EL7A 1H86A 3DJDA 4O5UA 2FJEA 3ALLA 2XFPA 2GF3A 3FIMB 1BF3A 1EL5A 2WESA 1N4WA 4U8KA 4B63A 3E1TA 3FPZA 4JNQA 1QO8A 4A79A 3DA1A 3NNEA 4CNKA 5JCKA 3ISHA 4EIQA 2R0GA 4GCMA 4B66A 5JCMA 4X9NA 1LJ1A 1YKJA 1FOHA 3ADAB 4CBQA 2YG3A 3NH3X 1PJ5A 3B6DA 3NK0X 5KOXA 1RYIA 1S2QA 2VQ7A 1PDHA 4OPLA 2BC0A 1LTXR 1NEKA 3AECA 3ATRA 4K7ZA 2J3NA 2GAHB 3GSIA 5GRTA 1K0LA 3CNSA 3FBSA 3PO7A 1GRBA 3RNMA 5FS9A 3G5RA 4A9WA 3UKFA 2AQJA 1FEAA 2YWLA 4CRTA 3KVEA 2GMHA 2IVEA 1Q9IA 1JEHA 1LVLA 4AP1A 1SEZA 1S3BA 2V61A 3FMWA 3GD3A 4APNA 2H89A 1D4DA 2JKCA 2YM2A 4BURA 5EOWA 3GDPA 4U8JA 1O94A 1XHCA 5BVAA 4WX1A 5JCIA 1M64A 2GB0A 3QSEA 4GUVA 5BRTA 2E5VA 1E1KA 2Q7VA 2XLTA 3CPIG 2AR8A 1N4UA 4A5LA 2X8CA 3I6DA 1F3PA 1YQ4A 2QAEA 2YAUA 2C3CA 4K5RA 3SQPA 1B5QA 3DK8A 4TM0A 2XVIA 3NRNA 4B68A 1COYA 2QCUA 2WDVA 4C3XA 4YT0A 3CGBA 1GOSA 2DKHA 1NENA 1GRGA 1OJDA 2VZ2A 1GRAA 3AEDA 4XWZA 2I0ZA 4DSHA 1L0VA 1X31B 3NTDA 1LV0A 4H50A 1DJQA 1BGNA 1OJTA 1JRYA 3AEGA 2VVLG 4GRTA 4EMJA 3ZDNA 4KPRA 1XDIA 1GTEA 1HYUA 4LIIA 4TM1A 2GMJA 4ZCCA 3AYLA 3LZWA 2ZBWA 4Z24A 5J60A 2Y6RA 4AP3A 2WPCA 3PVCA 3IC9A 4FDCB 1D4CA 2XVFA 3AXBA 1NG4A 3Q9TA 5JCLA 1H84A 3F8DA 4NEWA 1F8SA 3F8RA 4BJYA 1LQTA 4BJZA 1ELIA 3LJPA 1CF3A 4H4RA 2BCPA 3COXA 3G5SA 2YR4A 1D7LA 2WQYA 1ZP0A 4J34A 4U8LA 1N4VA 1VDCA 1KSUA 4K5SA 3CNDA 1XPQA 3CTYA 2V6OA 2EQ9A 2V5ZA 3UKQA 1NDAA 5IQ1A 1H7WA 2CFYA 4GF7A 2VQBA 1DOEA 1ZMCA 4LA1A 1GESA 4YSYA 2C75A 3DK4A 3LB8A 3DJGX 2BXRA 1YQZA 2DKIA 3LXDA 3SM8A 4NEVA 2NVKX 3G5QA 4UP3A 1PHHA 3AE9A 4RSLA 4D04A 4O5QA 1Q1WA 2B9WA 3AE1A 3AEEA 1PBCA 1LPFA 2BYBA 4U8MA 3UTHA 2APGA 4DGKA 3OC4A 3VR9A 1TDKA
chains in the Genus database with same CATH superfamily
1NHPA 3UOXA 3VQRA 1E1NA 5BUKA 3UOVA 4Z2RA 2A8XA 2CULA 5KRQA 5U63A 4K2XA 4U8NA 3IWAA 5KVHA 4H2QA 3II4A 1CJ3A 4NTEA 3T37A 2XFOA 2IIDA 4FK1A 4C77A 3C4NA 5J7XA 3BHFA 3F8PA 4H4UA 3CMMA 4J31A 2WU2A 4X4JA 3C4AA 1OJCA 4CCRA 3L1RA 1FCDA 3QFBA 4BK2A 4ADWA 2YLXA 2GRTA 2ACZA 1L9CA 2X50A 2ZZCA 1L9DA 1PBFA 1Z6LA 2GEWA 3ATQA 1NHSA 3ICRA 3AEFA 3RP6A 3UKLA 4ICYA 3KLJA 2B7SA 1OJAA 4TLZA 4A99A 4BK1A 4J2WA 4B65A 3AD7B 1S3EA 3BI4A 2GAGB 1KF6A 1DJNA 4G6GA 1CHUA 1NHQA 1ZOVA 1RSGA 4Y4LA 2EQ8A 4YTPA 4BV6A 4TM4A 2WPFA 1XANA 5FS8A 2V3AA 4A6NB 4B64A 1NPXA 3IHMA 2BCGG 5C3JA 5FMHA 3P9UA 3V76A 2WOVA 5HHFA 1VQWA 4N9XA 5EB4A 2XVJA 3UP5A 5GSNA 3BHKA 3RHAA 1N1PA 3NLCA 1TDEA 1F8WA 2XFNA 1QJDA 4J33A 4IV9A 1GALA 2RABA 3QSSA 1ZMDA 4K22A 4OPTA 2TPRA 5FS7A 3IHGA 3CNPA 4OPDA 3AE3A 1AOGA 4FK1C 2NPXA 2YLZA 1ZDLA 1V59A 2EQ6A 2VRLA 1B4VA 1BGJA 3SFDA 3FG2P 4J56A 2C7GA 3SZ0A 2C66A 4DSGA 2JK6A 4U8PA 3RP8A 3PS9A 4B1BA 3D1CA 1BZLA 4E0VA 4G6HA 4U8IA 1NHRA 3EAOA 4NNJA 2RGHA 3GD4A 2X8HA 4K8DA 1FECA 2X3NA 4REKA 4EQRA 4EM4A 1LQUA 1ZY8A 2BS2A 1H6VA 2YLRA 3EANA 3H4KA 3VRBA 3DJJA 2RGJA 1VG0A 2WP6A 4GAVA 1H83A 2FJBA 1B37A 5LV9A 1GEUA 3UKHA 2V3BA 1CC4A 4H2RA 3GYJA 3GWDA 3AD8B 2BACA 4C3YA 4YSZA 1OJ9A 1MO9A 2CDUA 1PXAA 3NT6A 3UP4A 1CJ4A 3NK2X 3P4PA 1IUWA 4A7AA 4EQWA 4EQSA 4YXDA 4DNAA 3AYJA 3D8XA 2OA1A 3K30A 3K7QX 5IQ4A 3GRTA 2A89A 4KX6A 2Y6QA 1K0IA 3ABVA 4H4YA 4U2LA 5ER0A 2BA9A 3AD9B 3DH9A 4OVIA 1TRBA 2GQWA 2YLTA 3BNUA 2BK3A 2XLRA 2JBVA 1B8SA 2YVJA 4NTCA 2YQUA 2AAQA 3EPTA 3NG7X 3M0OA 5HXIA 3UTFA 1TDNA 4U8OA 2C72A 3H8LA 1D4EA 1BKWA 1F6MA 4EMIA 5KNLA 5KMQA 1QLBA 1H7XA 2OLOA 5HY5A 1MOKA 1REOA 4I58A 4TLXA 3ALJA 3I3LA 2B76A 3QSMA 2RGOA 1VG9A 3NTAA 4RG4A 1GXFA 3SX6A 1YQ3A 4BK3A 3UKAA 3C96A 5KMRA 1Q1RA 1S2YA 1CL0A 1DNCA 3Q6JA 3QJ4A 1NG3A 4USQA 3V3NA 5IPYA 1E6EA 1D5TA 2ARDA 3AE8A 4IVOB 1GT8A 4C5OA 1DODA 3UKKA 4EIPA 4H7UA 1PXCA 1ZX9A 4C74A 2GR3A 4HB9A 1P2EA 3SYIA 3K7TA 2WPEA 1E1LA 4JN9A 4TM3A 4EM3A 2C70A 2VVLA 1CJCA 2YR5A 5KOWA 3AE6A 3NYEA 3URHA 1IJHA 1TYPA 2FBWA 2UZZA 2WBAA 2Q0KA 2WOWA 3NKSA 4GDEA 4GR1A 4Z2UA 3CNJA 3NK1X 4P9SA 2QA2A 3UTEA 5EBKA 5HYMA 4UDPA 4G73A 3UOZA 2VOUA 4I59A 3SFEA 1KNRA 1ONFA 1O95A 2H88A 4CY8A 1P2HA 1FEBA 4H4QA 4H4TA 2OLNA 2XCGA 2XVEA 1NAAA 2WU5A 3AE7A 4CY6A 3NYCA 3V3OA 1ZKQA 4B67A 1D7YA 2WETA 1GPEA 2FJDA 2YM1A 1EL8A 2BK4A 4FX9A 3ZYXA 2BS3A 2XLPA 4H2NA 1JNRA 3GRSA 3DMEA 1GRFA 5M0ZA 2O9ZA 3VR8A 3NYFA 1IUXA 1O5WA 2B7RA 3VRDB 1IUTA 2YG6A 4H4ZA 5C2TA 4A6NA 1M6IA 3T2YA 3P4SA 4AT2A 2WHDA 1PBDA 5CQFA 1Y56A 4A65A 1GV4A 1Y0PA 1PBEA 4NTDA 3REDA 1E1MA 2HQMA 4H4PA 4ECHA 1TYTA 3CIRA 5KMSA 4YWOA 5KWFA 5L46A 2OALA 5EB5A 3AE4A 3KPKA 2JB1A 3AYIA 4HA6A 4USRA 4AOSA 1FL2A 4AOXA 4IVMB 3AE2A 5CKUA 1KNPA 4CCQA 4IA5A 3ALMA 4ZN0A 3BNMA 4JY3A 3M12A 4Z25A 3QVRA 2JB2A 2GV8A 3CPHG 1PS9A 3HYXA 4M52A 3AB1A 1JU2A 1EBDA 3KPFA 4Z43A 1KFYA 2Q0LA 2WS3A 1H82A 2BK5A 3WE0A 1CC6A 2B9XA 2OAMA 2WOIA 5U1OA 1K4QA 4LU6A 4D03A 5JCNA 4Y4NA 2JB3A 4H4VA 3VRAA 2X8GA 2ZZBA 1GERA 1CC2A 2YG4A 1L9EA 3AE5A 3O0HA 4J57A 4U2TA 2E4GA 1DOCA 5KMPA 2BRAA 3M13A 2GH5A 2F5ZA 2XFQA 3NHOX 1ZOYA 1PJ6A 4XWRA 3CGDA 1GRTA 3S5WA 3UKPA 2WP5A 3JSKA 3AEAA 2YR6A 1TDFA 2C67A 5M10A 1K0JA 2VRMA 3NN6X 1GRHA 1PN0A 2XFUA 4OPUA 5KVIA 4OPIA 3ICSA 3P4QA 4JDRA 4Z26A 4GDPA 2PYXA 3DJEA 3KD9A 1W4XA 1VRQB 2Z5XA 2WP9A 4UDRA 3NN0X 2GR0A 3S61A 2XDOA 2BC1A 2BS4A 1GETA 2PHHA 1Y56B 3GMCA 2B9YA 4YTNA 4ZCDA 4AT0A 4EQXA 2C4CA 2C64A 3H8IA 2YVGA 2QA1A 4CNJA 3HZLA 3DK9A 1GTHA 1JRZA 1PXBA 3RP7A 5DBJA 1PBBA 4MJWA 2FJAA 3QVPA 3AWIA 3UOYA 3SGLA 3LZXA 3P4RA 1IUUA 4YKGA 3DGZA 3K7MX 3NGCX 3GDNA 3CGCA 2C76A 1UKVG 1DXLA 2R4JA 1E39A 3CNTA 4U2SA 2JAEA 1KSSA 4H4XA 4RG3A 1GREA 2R0CA 2V60A 2IVDA 4NZHA 5FS6A 2YLSA 2YVFA 3HYWA 2EQ7A 1JOAA 3LOVA 4YKFA 4Z44A 5BULA 2YG7A 3LADA 2XVHA 2X99A 3B3RA 3IF9A 4JY2A 3UTGA 4JQ9A 3GMBA 4Y4MA 2R9ZA 3BI2A 3ICTA 2GR2A 2Z5YA 4OPCA 2ZZ0A 1DOBA 4EMWA 1IUVA 3CN8A 3EF6A 4PAAA 3T0KA 3SZFA 2TMDA 1KDGA 5TR3A 4B69A 4X9MA 4WCTA 4UDQA 2C65A 2XLUA 2R0PA 2XYOA 1ZK7A 4II3A 2WDQA 2C3DA 3UCLA 1CBOA 4YSXA 3T14A 2R4EA 4JNAA 3L8KA 1PJ7A 2R46A 1RP0A 1IUSA 2CVJA 2W0HA 4H2PA 2C73A 1GNDA 4H4SA 1YY5A 4IA6A 3OZ2A 2GVCA 3T31A 3NIXA 4GAPA 2VVMA 3CPJG 4H4WA 4J36A 3R9UA 2BXSA 4YSHA 3AEBA 1H81A 2XLSA 3KKJA 3DGHA 4OCGA 1EL9A 4OPGA 3KA7A 3ITJA 1CJ2A 2R45A 2WDRA 2GQFA 1JNZA 1MXTA 1TDOA 2BABA 1BWCA 3CGEA 3GWFA 1JRXA 3KU9A 3P1WA 2A87A 4Z2TA 2GR1A 3GYXA 3QFAA 4XXGA 2YLWA 5KXJA 2WEUA 1F8RA 4PABA 5U25A 3BI5A 2E1MA 4YTMA 1GSNA 2Q6UA 3GYIA 2YG5A 1E7PA 1EL7A 1H86A 3DJDA 4O5UA 2FJEA 3ALLA 2XFPA 2GF3A 3FIMB 1BF3A 1EL5A 2WESA 1N4WA 4U8KA 3SY4A 4B63A 3E1TA 3FPZA 4JNQA 1QO8A 4A79A 3DA1A 3NNEA 4CNKA 5JCKA 3ISHA 4G9KA 4EIQA 2R0GA 4GCMA 4B66A 5JCMA 4X9NA 1LJ1A 1YKJA 1FOHA 3ADAB 4CBQA 2YG3A 3NH3X 1PJ5A 3B6DA 3NK0X 5KOXA 1RYIA 1S2QA 2VQ7A 1PDHA 4OPLA 2BC0A 1LTXR 1NEKA 3AECA 3ATRA 4K7ZA 2J3NA 2GAHB 3GSIA 5GRTA 1K0LA 3CNSA 3FBSA 3PO7A 1GRBA 3RNMA 5FS9A 3G5RA 4A9WA 3UKFA 2AQJA 1FEAA 2YWLA 4CRTA 3KVEA 2GMHA 2IVEA 4G74A 1Q9IA 1JEHA 1LVLA 4AP1A 1SEZA 1S3BA 2V61A 3FMWA 3GD3A 4APNA 2H89A 1D4DA 2JKCA 2YM2A 4BURA 5EOWA 3HYVA 3GDPA 4U8JA 1O94A 1XHCA 5BVAA 4WX1A 5JCIA 1M64A 2GB0A 3QSEA 4GUVA 5BRTA 2E5VA 1E1KA 2Q7VA 2XLTA 3CPIG 2AR8A 1N4UA 4A5LA 2X8CA 3I6DA 1F3PA 1YQ4A 2QAEA 2YAUA 2C3CA 4K5RA 3SQPA 1B5QA 3DK8A 4TM0A 2XVIA 3NRNA 4B68A 1COYA 2QCUA 2WDVA 4C3XA 4YT0A 3CGBA 1GOSA 2DKHA 1NENA 1GRGA 1OJDA 2VZ2A 1GRAA 3AEDA 4XWZA 2I0ZA 4DSHA 1L0VA 1X31B 3NTDA 1LV0A 4H50A 1DJQA 1BGNA 1OJTA 1JRYA 3SZCA 3AEGA 2VVLG 4GRTA 4EMJA 3ZDNA 4KPRA 1XDIA 1GTEA 1HYUA 4LIIA 4TM1A 2GMJA 4ZCCA 3AYLA 3LZWA 2ZBWA 4Z24A 5J60A 2Y6RA 4AP3A 2WPCA 3PVCA 3IC9A 4FDCB 1D4CA 2XVFA 3AXBA 3SZWA 1NG4A 3Q9TA 5JCLA 1H84A 3F8DA 4NEWA 1F8SA 3F8RA 4BJYA 1LQTA 4BJZA 1ELIA 3LJPA 1CF3A 4H4RA 4NWZA 2BCPA 3COXA 3G5SA 2YR4A 1D7LA 2WQYA 1ZP0A 4J34A 4U8LA 3T2ZA 1N4VA 1VDCA 1KSUA 4K5SA 3CNDA 1XPQA 3CTYA 2V6OA 2EQ9A 2V5ZA 3UKQA 1NDAA 5IQ1A 1H7WA 2CFYA 4GF7A 2VQBA 1DOEA 1ZMCA 4LA1A 1GESA 3SXIA 4YSYA 2C75A 3DK4A 3LB8A 3DJGX 2BXRA 3T2KA 1YQZA 2DKIA 3LXDA 3SM8A 4NEVA 2NVKX 3G5QA 2BRYA 4UP3A 1PHHA 3AE9A 4RSLA 4D04A 4O5QA 1Q1WA 2B9WA 3AE1A 3AEEA 1PBCA 1LPFA 2BYBA 4U8MA 3UTHA 2APGA 4II2A 4DGKA 3OC4A 3VR9A 1TDKA
chains in the Genus database with same CATH topology
1NHPA 3UOXA 3VQRA 1E1NA 5BUKA 3UOVA 4Z2RA 2A8XA 2CULA 5KRQA 5U63A 4K2XA 4U8NA 3IWAA 5KVHA 4H2QA 3II4A 1CJ3A 4NTEA 3T37A 2XFOA 2IIDA 4FK1A 4C77A 3C4NA 5J7XA 3BHFA 3F8PA 4H4UA 3CMMA 4J31A 2WU2A 4X4JA 3C4AA 1OJCA 4CCRA 3L1RA 1FCDA 3QFBA 4BK2A 4ADWA 2YLXA 2GRTA 2ACZA 1L9CA 2X50A 2ZZCA 1L9DA 1PBFA 1Z6LA 2GEWA 3ATQA 1NHSA 3ICRA 3AEFA 3RP6A 3UKLA 4ICYA 3KLJA 2B7SA 1OJAA 4TLZA 4A99A 4BK1A 4J2WA 4B65A 3AD7B 1S3EA 3BI4A 2GAGB 1KF6A 1DJNA 4G6GA 1CHUA 1NHQA 1ZOVA 1RSGA 4Y4LA 2EQ8A 4YTPA 4BV6A 4TM4A 2WPFA 1XANA 5FS8A 2V3AA 4A6NB 4B64A 1NPXA 3IHMA 2BCGG 5C3JA 5FMHA 3P9UA 3V76A 2WOVA 5HHFA 1VQWA 4N9XA 5EB4A 2XVJA 3UP5A 5GSNA 3BHKA 3RHAA 1N1PA 3NLCA 1TDEA 1F8WA 2XFNA 1QJDA 4J33A 4IV9A 1GALA 2RABA 3QSSA 1ZMDA 4K22A 4OPTA 2TPRA 5FS7A 3IHGA 3CNPA 4OPDA 3AE3A 1AOGA 4FK1C 2NPXA 2YLZA 1ZDLA 1V59A 2EQ6A 2VRLA 1B4VA 1BGJA 3SFDA 3FG2P 4J56A 2C7GA 3SZ0A 2C66A 4DSGA 2JK6A 4U8PA 3RP8A 3PS9A 4B1BA 3D1CA 1BZLA 4E0VA 4G6HA 4U8IA 1NHRA 3EAOA 4NNJA 2RGHA 3GD4A 2X8HA 4K8DA 1FECA 2X3NA 4REKA 4EQRA 4EM4A 1LQUA 1ZY8A 2BS2A 1H6VA 2YLRA 3EANA 3H4KA 3VRBA 3DJJA 2RGJA 1VG0A 2WP6A 4GAVA 1H83A 2FJBA 1B37A 5LV9A 1GEUA 3UKHA 2V3BA 1CC4A 4H2RA 3GYJA 3GWDA 3AD8B 2BACA 4C3YA 4YSZA 1OJ9A 1MO9A 2CDUA 1PXAA 3NT6A 3UP4A 1CJ4A 3NK2X 3P4PA 1IUWA 4A7AA 4EQWA 4EQSA 4YXDA 4DNAA 3AYJA 3D8XA 2OA1A 3K30A 3K7QX 5IQ4A 3GRTA 2A89A 4KX6A 2Y6QA 1K0IA 3ABVA 4H4YA 4U2LA 5ER0A 2BA9A 3AD9B 3DH9A 4OVIA 1TRBA 2GQWA 2YLTA 3BNUA 2BK3A 2XLRA 2JBVA 1B8SA 2YVJA 4NTCA 2YQUA 2AAQA 3EPTA 3NG7X 3M0OA 5HXIA 3UTFA 1TDNA 4U8OA 2C72A 3H8LA 1D4EA 1BKWA 1F6MA 4EMIA 5KNLA 5KMQA 1QLBA 1H7XA 2OLOA 5HY5A 1MOKA 1REOA 4I58A 4TLXA 3ALJA 3I3LA 2B76A 3QSMA 2RGOA 1VG9A 3NTAA 4RG4A 1GXFA 3SX6A 1YQ3A 4BK3A 3UKAA 3C96A 5KMRA 1Q1RA 1S2YA 1CL0A 1DNCA 3Q6JA 3QJ4A 1NG3A 4USQA 3V3NA 5IPYA 1E6EA 1D5TA 2ARDA 3AE8A 4IVOB 1GT8A 4C5OA 1DODA 3UKKA 4EIPA 4H7UA 1PXCA 1ZX9A 4C74A 2GR3A 4HB9A 1P2EA 3SYIA 3K7TA 2WPEA 1E1LA 4JN9A 4TM3A 4EM3A 2C70A 2VVLA 1CJCA 2YR5A 5KOWA 3AE6A 3NYEA 3URHA 1IJHA 1TYPA 2FBWA 2UZZA 2WBAA 2Q0KA 2WOWA 3NKSA 4GDEA 4GR1A 4Z2UA 3CNJA 3NK1X 4P9SA 2QA2A 3UTEA 5EBKA 5HYMA 4UDPA 4G73A 3UOZA 2VOUA 4I59A 3SFEA 1KNRA 1ONFA 1O95A 2H88A 4CY8A 1P2HA 1FEBA 4H4QA 4H4TA 2OLNA 2XCGA 2XVEA 1NAAA 2WU5A 3AE7A 4CY6A 3NYCA 3V3OA 1ZKQA 4B67A 1D7YA 2WETA 1GPEA 2FJDA 2YM1A 1EL8A 2BK4A 4FX9A 3ZYXA 2BS3A 2XLPA 4H2NA 1JNRA 3GRSA 3DMEA 1GRFA 5M0ZA 2O9ZA 3VR8A 3NYFA 1IUXA 1O5WA 2B7RA 3VRDB 1IUTA 2YG6A 4H4ZA 5C2TA 4A6NA 1M6IA 3T2YA 3P4SA 4AT2A 2WHDA 1PBDA 5CQFA 1Y56A 4A65A 1GV4A 1Y0PA 1PBEA 4NTDA 3REDA 1E1MA 2HQMA 4H4PA 4ECHA 1TYTA 3CIRA 5KMSA 4YWOA 5KWFA 5L46A 2OALA 5EB5A 3AE4A 3KPKA 2JB1A 3AYIA 4HA6A 4USRA 4AOSA 1FL2A 4AOXA 4IVMB 3AE2A 5CKUA 1KNPA 4CCQA 4IA5A 3ALMA 4ZN0A 3BNMA 4JY3A 3M12A 4Z25A 3QVRA 2JB2A 2GV8A 3CPHG 1PS9A 3HYXA 4M52A 3AB1A 1JU2A 1EBDA 3KPFA 4Z43A 1KFYA 2Q0LA 2WS3A 1H82A 2BK5A 3WE0A 1CC6A 2B9XA 2OAMA 2WOIA 5U1OA 1K4QA 4LU6A 4D03A 5JCNA 4Y4NA 2JB3A 4H4VA 3VRAA 2X8GA 2ZZBA 1GERA 1CC2A 2YG4A 1L9EA 3AE5A 3O0HA 4J57A 4U2TA 2E4GA 1DOCA 5KMPA 2BRAA 3M13A 2GH5A 2F5ZA 2XFQA 3NHOX 1ZOYA 1PJ6A 4XWRA 3CGDA 1GRTA 3S5WA 3UKPA 2WP5A 3JSKA 3AEAA 2YR6A 1TDFA 2C67A 5M10A 1K0JA 2VRMA 3NN6X 1GRHA 1PN0A 2XFUA 4OPUA 5KVIA 4OPIA 3ICSA 3P4QA 4JDRA 4Z26A 4GDPA 2PYXA 3DJEA 3KD9A 1W4XA 1VRQB 2Z5XA 2WP9A 4UDRA 3NN0X 2GR0A 3S61A 2XDOA 2BC1A 2BS4A 1GETA 2PHHA 1Y56B 3GMCA 2B9YA 4YTNA 4ZCDA 4AT0A 4EQXA 2C4CA 2C64A 3H8IA 2YVGA 2QA1A 4CNJA 3HZLA 3DK9A 1GTHA 1JRZA 1PXBA 3RP7A 5DBJA 1PBBA 4MJWA 2FJAA 3QVPA 3AWIA 3UOYA 3SGLA 3LZXA 3P4RA 1IUUA 4YKGA 3DGZA 3K7MX 3NGCX 3GDNA 3CGCA 2C76A 1UKVG 1DXLA 2R4JA 1E39A 3CNTA 4U2SA 2JAEA 1KSSA 4H4XA 4RG3A 1GREA 2R0CA 2V60A 2IVDA 4NZHA 5FS6A 2YLSA 2YVFA 3HYWA 2EQ7A 1JOAA 3LOVA 4YKFA 4Z44A 5BULA 2YG7A 3LADA 2XVHA 2X99A 3B3RA 3IF9A 4JY2A 3UTGA 4JQ9A 3GMBA 4Y4MA 2R9ZA 3BI2A 3ICTA 2GR2A 2Z5YA 4OPCA 2ZZ0A 1DOBA 4EMWA 1IUVA 3CN8A 3EF6A 4PAAA 3T0KA 3SZFA 2TMDA 1KDGA 5TR3A 4B69A 4X9MA 4WCTA 4UDQA 2C65A 2XLUA 2R0PA 2XYOA 1ZK7A 4II3A 2WDQA 2C3DA 3UCLA 1CBOA 4YSXA 3T14A 2R4EA 4JNAA 3L8KA 1PJ7A 2R46A 1RP0A 1IUSA 2CVJA 2W0HA 4H2PA 2C73A 1GNDA 4H4SA 1YY5A 4IA6A 3OZ2A 2GVCA 3T31A 3NIXA 4GAPA 2VVMA 3CPJG 4H4WA 4J36A 3R9UA 2BXSA 4YSHA 3AEBA 1H81A 2XLSA 3KKJA 3DGHA 4OCGA 1EL9A 4OPGA 3KA7A 3ITJA 1CJ2A 2R45A 2WDRA 2GQFA 1JNZA 1MXTA 1TDOA 2BABA 1BWCA 3CGEA 3GWFA 1JRXA 3KU9A 3P1WA 2A87A 4Z2TA 2GR1A 3GYXA 3QFAA 4XXGA 2YLWA 5KXJA 2WEUA 1F8RA 4PABA 5U25A 3BI5A 2E1MA 4YTMA 1GSNA 2Q6UA 3GYIA 2YG5A 1E7PA 1EL7A 1H86A 3DJDA 4O5UA 2FJEA 3ALLA 2XFPA 2GF3A 3FIMB 1BF3A 1EL5A 2WESA 1N4WA 4U8KA 3SY4A 4B63A 3E1TA 3FPZA 4JNQA 1QO8A 4A79A 3DA1A 3NNEA 4CNKA 5JCKA 3ISHA 4G9KA 4EIQA 2R0GA 4GCMA 4B66A 5JCMA 4X9NA 1LJ1A 1YKJA 1FOHA 3ADAB 4CBQA 2YG3A 3NH3X 1PJ5A 3B6DA 3NK0X 5KOXA 1RYIA 1S2QA 2VQ7A 1PDHA 4OPLA 2BC0A 1LTXR 1NEKA 3AECA 3ATRA 4K7ZA 2J3NA 2GAHB 3GSIA 5GRTA 1K0LA 3CNSA 3FBSA 3PO7A 1GRBA 3RNMA 5FS9A 3G5RA 4A9WA 3UKFA 2AQJA 1FEAA 2YWLA 4CRTA 3KVEA 2GMHA 2IVEA 4G74A 1Q9IA 1JEHA 1LVLA 4AP1A 1SEZA 1S3BA 2V61A 3FMWA 3GD3A 4APNA 2H89A 1D4DA 2JKCA 2YM2A 4BURA 5EOWA 3HYVA 3GDPA 4U8JA 1O94A 1XHCA 5BVAA 4WX1A 5JCIA 1M64A 2GB0A 3QSEA 4GUVA 5BRTA 2E5VA 1E1KA 2Q7VA 2XLTA 3CPIG 2AR8A 1N4UA 4A5LA 2X8CA 3I6DA 1F3PA 1YQ4A 2QAEA 2YAUA 2C3CA 4K5RA 3SQPA 1B5QA 3DK8A 4TM0A 2XVIA 3NRNA 4B68A 1COYA 2QCUA 2WDVA 4C3XA 4YT0A 3CGBA 1GOSA 2DKHA 1NENA 1GRGA 1OJDA 2VZ2A 1GRAA 3AEDA 4XWZA 2I0ZA 4DSHA 1L0VA 1X31B 3NTDA 1LV0A 4H50A 1DJQA 1BGNA 1OJTA 1JRYA 3SZCA 3AEGA 2VVLG 4GRTA 4EMJA 3ZDNA 4KPRA 1XDIA 1GTEA 1HYUA 4LIIA 4TM1A 2GMJA 4ZCCA 3AYLA 3LZWA 2ZBWA 4Z24A 5J60A 2Y6RA 4AP3A 2WPCA 3PVCA 3IC9A 4FDCB 1D4CA 2XVFA 3AXBA 3SZWA 1NG4A 3Q9TA 5JCLA 1H84A 3F8DA 4NEWA 1F8SA 3F8RA 4BJYA 1LQTA 4BJZA 1ELIA 3LJPA 1CF3A 4H4RA 4NWZA 2BCPA 3COXA 3G5SA 2YR4A 1D7LA 2WQYA 1ZP0A 4J34A 4U8LA 3T2ZA 1N4VA 1VDCA 1KSUA 4K5SA 3CNDA 1XPQA 3CTYA 2V6OA 2EQ9A 2V5ZA 3UKQA 1NDAA 5IQ1A 1H7WA 2CFYA 4GF7A 2VQBA 1DOEA 1ZMCA 4LA1A 1GESA 3SXIA 4YSYA 2C75A 3DK4A 3LB8A 3DJGX 2BXRA 3T2KA 1YQZA 2DKIA 3LXDA 3SM8A 4NEVA 2NVKX 3G5QA 2BRYA 4UP3A 1PHHA 3AE9A 4RSLA 4D04A 4O5QA 1Q1WA 2B9WA 3AE1A 3AEEA 1PBCA 1LPFA 2BYBA 4U8MA 3UTHA 2APGA 4II2A 4DGKA 3OC4A 3VR9A 1TDKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHP A;  3UOX A;  3VQR A;  1E1N A;  5BUK A;  3UOV A;  4Z2R A;  2A8X A;  2CUL A;  5KRQ A;  5U63 A;  4K2X A;  4U8N A;  3IWA A;  5KVH A;  4H2Q A;  3II4 A;  1CJ3 A;  4NTE A;  3T37 A;  2XFO A;  2IID A;  4FK1 A;  4C77 A;  3C4N A;  5J7X A;  3BHF A;  3F8P A;  4H4U A;  4J31 A;  2WU2 A;  4X4J A;  3C4A A;  1OJC A;  4CCR A;  3L1R A;  1FCD A;  3QFB A;  4BK2 A;  4ADW A;  2YLX A;  2GRT A;  2ACZ A;  1L9C A;  2X50 A;  2ZZC A;  1L9D A;  1PBF A;  1Z6L A;  2GEW A;  3ATQ A;  1NHS A;  3ICR A;  3AEF A;  3RP6 A;  3UKL A;  4ICY A;  3KLJ A;  2B7S A;  1OJA A;  4TLZ A;  4A99 A;  4BK1 A;  4J2W A;  4B65 A;  3AD7 B;  1S3E A;  3BI4 A;  2GAG B;  1KF6 A;  1DJN A;  1CHU A;  1NHQ A;  1ZOV A;  1RSG A;  4Y4L A;  2EQ8 A;  4YTP A;  4BV6 A;  4TM4 A;  2WPF A;  1XAN A;  5FS8 A;  2V3A A;  4A6N B;  4B64 A;  1NPX A;  3IHM A;  2BCG G;  5C3J A;  5FMH A;  3P9U A;  3V76 A;  2WOV A;  5HHF A;  1VQW A;  4N9X A;  5EB4 A;  2XVJ A;  3UP5 A;  5GSN A;  3BHK A;  3RHA A;  1N1P A;  3NLC A;  1TDE A;  1F8W A;  2XFN A;  1QJD A;  4J33 A;  4IV9 A;  1GAL A;  2RAB A;  3QSS A;  1ZMD A;  4K22 A;  4OPT A;  2TPR A;  5FS7 A;  3IHG A;  3CNP A;  4OPD A;  3AE3 A;  1AOG A;  4FK1 C;  2NPX A;  2YLZ A;  1ZDL A;  1V59 A;  2EQ6 A;  2VRL A;  1B4V A;  1BGJ A;  3SFD A;  3FG2 P;  4J56 A;  2C7G A;  2C66 A;  4DSG A;  2JK6 A;  4U8P A;  3RP8 A;  3PS9 A;  4B1B A;  3D1C A;  1BZL A;  4E0V A;  4U8I A;  1NHR A;  3EAO A;  2RGH A;  3GD4 A;  2X8H A;  4K8D A;  1FEC A;  2X3N A;  4REK A;  4EQR A;  4EM4 A;  1LQU A;  1ZY8 A;  2BS2 A;  1H6V A;  2YLR A;  3EAN A;  3H4K A;  3VRB A;  3DJJ A;  2RGJ A;  1VG0 A;  2WP6 A;  1H83 A;  2FJB A;  1B37 A;  5LV9 A;  1GEU A;  3UKH A;  2V3B A;  1CC4 A;  4H2R A;  3GYJ A;  3GWD A;  3AD8 B;  2BAC A;  4C3Y A;  4YSZ A;  1OJ9 A;  1MO9 A;  2CDU A;  1PXA A;  3NT6 A;  3UP4 A;  1CJ4 A;  3NK2 X;  3P4P A;  1IUW A;  4A7A A;  4EQW A;  4EQS A;  4YXD A;  4DNA A;  3AYJ A;  3D8X A;  2OA1 A;  3K30 A;  3K7Q X;  5IQ4 A;  3GRT A;  2A89 A;  4KX6 A;  2Y6Q A;  1K0I A;  3ABV A;  4H4Y A;  4U2L A;  5ER0 A;  2BA9 A;  3AD9 B;  3DH9 A;  4OVI A;  1TRB A;  2GQW A;  2YLT A;  3BNU A;  2BK3 A;  2XLR A;  2JBV A;  1B8S A;  2YVJ A;  4NTC A;  2YQU A;  2AAQ A;  3EPT A;  3NG7 X;  3M0O A;  5HXI A;  3UTF A;  1TDN A;  4U8O A;  2C72 A;  3H8L A;  1D4E A;  1BKW A;  1F6M A;  4EMI A;  1QLB A;  1H7X A;  2OLO A;  5HY5 A;  1MOK A;  1REO A;  4I58 A;  4TLX A;  3ALJ A;  3I3L A;  2B76 A;  3QSM A;  2RGO A;  1VG9 A;  3NTA A;  4RG4 A;  1GXF A;  1YQ3 A;  4BK3 A;  3UKA A;  3C96 A;  1Q1R A;  1S2Y A;  1CL0 A;  1DNC A;  3Q6J A;  3QJ4 A;  1NG3 A;  4USQ A;  3V3N A;  5IPY A;  1E6E A;  1D5T A;  2ARD A;  3AE8 A;  4IVO B;  1GT8 A;  4C5O A;  1DOD A;  3UKK A;  4EIP A;  4H7U A;  1PXC A;  1ZX9 A;  4C74 A;  2GR3 A;  4HB9 A;  1P2E A;  3K7T A;  2WPE A;  1E1L A;  4JN9 A;  4TM3 A;  4EM3 A;  2C70 A;  2VVL A;  1CJC A;  2YR5 A;  5KOW A;  3AE6 A;  3NYE A;  3URH A;  1IJH A;  1TYP A;  2FBW A;  2UZZ A;  2WBA A;  2Q0K A;  2WOW A;  3NKS A;  4GDE A;  4GR1 A;  4Z2U A;  3CNJ A;  3NK1 X;  4P9S A;  2QA2 A;  3UTE A;  5EBK A;  5HYM A;  4UDP A;  3UOZ A;  2VOU A;  4I59 A;  3SFE A;  1KNR A;  1ONF A;  1O95 A;  2H88 A;  4CY8 A;  1P2H A;  1FEB A;  4H4Q A;  4H4T A;  2OLN A;  2XCG A;  2XVE A;  1NAA A;  2WU5 A;  3AE7 A;  4CY6 A;  3NYC A;  3V3O A;  1ZKQ A;  4B67 A;  1D7Y A;  2WET A;  1GPE A;  2FJD A;  2YM1 A;  1EL8 A;  2BK4 A;  4FX9 A;  3ZYX A;  2BS3 A;  2XLP A;  4H2N A;  1JNR A;  3GRS A;  3DME A;  1GRF A;  5M0Z A;  2O9Z A;  3VR8 A;  3NYF A;  1IUX A;  1O5W A;  2B7R A;  3VRD B;  1IUT A;  2YG6 A;  4H4Z A;  5C2T A;  4A6N A;  1M6I A;  3P4S A;  4AT2 A;  2WHD A;  1PBD A;  5CQF A;  1Y56 A;  4A65 A;  1GV4 A;  1Y0P A;  1PBE A;  4NTD A;  3RED A;  1E1M A;  2HQM A;  4H4P A;  4ECH A;  1TYT A;  3CIR A;  5KWF A;  4YWO A;  5L46 A;  2OAL A;  5EB5 A;  3AE4 A;  2JB1 A;  3AYI A;  4HA6 A;  4USR A;  4AOS A;  1FL2 A;  4AOX A;  4IVM B;  3AE2 A;  5CKU A;  1KNP A;  4CCQ A;  4IA5 A;  3ALM A;  4ZN0 A;  3BNM A;  4JY3 A;  3M12 A;  4Z25 A;  3QVR A;  2JB2 A;  2GV8 A;  3CPH G;  1PS9 A;  4M52 A;  3AB1 A;  1JU2 A;  1EBD A;  3KPF A;  4Z43 A;  1KFY A;  2Q0L A;  2WS3 A;  1H82 A;  2BK5 A;  3WE0 A;  1CC6 A;  2B9X A;  2OAM A;  2WOI A;  5U1O A;  1K4Q A;  4LU6 A;  4D03 A;  5JCN A;  4Y4N A;  2JB3 A;  4H4V A;  3VRA A;  2X8G A;  2ZZB A;  1GER A;  1CC2 A;  2YG4 A;  1L9E A;  3AE5 A;  3O0H A;  4J57 A;  4U2T A;  2E4G A;  1DOC A;  3M13 A;  2GH5 A;  2F5Z A;  2XFQ A;  3NHO X;  1ZOY A;  1PJ6 A;  4XWR A;  3CGD A;  1GRT A;  3S5W A;  3UKP A;  2WP5 A;  3JSK A;  3AEA A;  2YR6 A;  1TDF A;  2C67 A;  5M10 A;  1K0J A;  2VRM A;  3NN6 X;  1GRH A;  1PN0 A;  2XFU A;  4OPU A;  5KVI A;  4OPI A;  3ICS A;  3P4Q A;  4JDR A;  4Z26 A;  4GDP A;  2PYX A;  3DJE A;  3KD9 A;  1W4X A;  1VRQ B;  2Z5X A;  2WP9 A;  4UDR A;  3NN0 X;  2GR0 A;  3S61 A;  2XDO A;  2BC1 A;  2BS4 A;  1GET A;  2PHH A;  1Y56 B;  3GMC A;  2B9Y A;  4YTN A;  4ZCD A;  4AT0 A;  4EQX A;  2C64 A;  3H8I A;  2YVG A;  2QA1 A;  4CNJ A;  3HZL A;  3DK9 A;  1GTH A;  1JRZ A;  1PXB A;  3RP7 A;  5DBJ A;  1PBB A;  4MJW A;  2FJA A;  3QVP A;  3AWI A;  3UOY A;  3SGL A;  3LZX A;  3P4R A;  1IUU A;  4YKG A;  3DGZ A;  3K7M X;  3NGC X;  3GDN A;  3CGC A;  2C76 A;  1UKV G;  1DXL A;  2R4J A;  1E39 A;  3CNT A;  4U2S A;  2JAE A;  1KSS A;  4H4X A;  4RG3 A;  1GRE A;  2R0C A;  2V60 A;  2IVD A;  4NZH A;  5FS6 A;  2YLS A;  2YVF A;  3LOV A;  2EQ7 A;  1JOA A;  4YKF A;  4Z44 A;  5BUL A;  2YG7 A;  3LAD A;  2XVH A;  2X99 A;  3B3R A;  3IF9 A;  4JY2 A;  3UTG A;  4JQ9 A;  3GMB A;  4Y4M A;  2R9Z A;  3BI2 A;  3ICT A;  2GR2 A;  2Z5Y A;  4OPC A;  2ZZ0 A;  1DOB A;  4EMW A;  1IUV A;  3CN8 A;  3EF6 A;  4PAA A;  2TMD A;  1KDG A;  5TR3 A;  4B69 A;  4X9M A;  4WCT A;  4UDQ A;  2C65 A;  2XLU A;  2R0P A;  2XYO A;  1ZK7 A;  2WDQ A;  2C3D A;  3UCL A;  1CBO A;  4YSX A;  2R4E A;  4JNA A;  3L8K A;  1PJ7 A;  2R46 A;  1RP0 A;  1IUS A;  2CVJ A;  2W0H A;  4H2P A;  2C73 A;  1GND A;  4H4S A;  1YY5 A;  4IA6 A;  3OZ2 A;  2GVC A;  3NIX A;  4H4W A;  2VVM A;  3CPJ G;  4J36 A;  3R9U A;  2BXS A;  4YSH A;  3AEB A;  1H81 A;  2XLS A;  3KKJ A;  3DGH A;  4OCG A;  1EL9 A;  4OPG A;  3KA7 A;  3ITJ A;  1CJ2 A;  2R45 A;  2WDR A;  2GQF A;  1JNZ A;  1MXT A;  1TDO A;  2BAB A;  1BWC A;  3CGE A;  3GWF A;  1JRX A;  3KU9 A;  3P1W A;  2A87 A;  4Z2T A;  2GR1 A;  4XXG A;  3QFA A;  2YLW A;  5KXJ A;  2WEU A;  1F8R A;  4PAB A;  5U25 A;  3BI5 A;  2E1M A;  4YTM A;  1GSN A;  2Q6U A;  3GYI A;  2YG5 A;  1E7P A;  1EL7 A;  1H86 A;  3DJD A;  4O5U A;  2FJE A;  3ALL A;  2XFP A;  2GF3 A;  3FIM B;  1BF3 A;  1EL5 A;  2WES A;  1N4W A;  4U8K A;  4B63 A;  3E1T A;  3FPZ A;  4JNQ A;  1QO8 A;  4A79 A;  3DA1 A;  3NNE A;  4CNK A;  5JCK A;  3ISH A;  4EIQ A;  2R0G A;  4GCM A;  4B66 A;  5JCM A;  4X9N A;  1LJ1 A;  1YKJ A;  1FOH A;  3ADA B;  4CBQ A;  2YG3 A;  3NH3 X;  1PJ5 A;  3B6D A;  3NK0 X;  5KOX A;  1RYI A;  1S2Q A;  2VQ7 A;  1PDH A;  4OPL A;  2BC0 A;  1LTX R;  1NEK A;  3AEC A;  3ATR A;  4K7Z A;  2J3N A;  2GAH B;  3GSI A;  5GRT A;  1K0L A;  3CNS A;  3FBS A;  3PO7 A;  1GRB A;  3RNM A;  5FS9 A;  3G5R A;  4A9W A;  3UKF A;  2AQJ A;  1FEA A;  2YWL A;  4CRT A;  3KVE A;  2GMH A;  2IVE A;  1Q9I A;  1JEH A;  1LVL A;  4AP1 A;  1SEZ A;  1S3B A;  2V61 A;  3FMW A;  3GD3 A;  4APN A;  2H89 A;  1D4D A;  2JKC A;  2YM2 A;  4BUR A;  5EOW A;  3GDP A;  4U8J A;  1O94 A;  1XHC A;  5BVA A;  4WX1 A;  5JCI A;  1M64 A;  2GB0 A;  3QSE A;  4GUV A;  5BRT A;  2E5V A;  1E1K A;  2Q7V A;  2XLT A;  3CPI G;  2AR8 A;  1N4U A;  4A5L A;  2X8C A;  3I6D A;  1F3P A;  1YQ4 A;  2QAE A;  2YAU A;  2C3C A;  4K5R A;  3SQP A;  1B5Q A;  3DK8 A;  4TM0 A;  2XVI A;  3NRN A;  4B68 A;  1COY A;  2QCU A;  2WDV A;  4C3X A;  4YT0 A;  3CGB A;  1GOS A;  2DKH A;  1NEN A;  1GRG A;  1OJD A;  2VZ2 A;  1GRA A;  3AED A;  4XWZ A;  2I0Z A;  4DSH A;  1L0V A;  1X31 B;  3NTD A;  1LV0 A;  4H50 A;  1DJQ A;  1BGN A;  1OJT A;  1JRY A;  3AEG A;  2VVL G;  4GRT A;  4EMJ A;  3ZDN A;  4KPR A;  1XDI A;  1GTE A;  1HYU A;  4LII A;  4TM1 A;  2GMJ A;  4ZCC A;  3AYL A;  3LZW A;  2ZBW A;  4Z24 A;  5J60 A;  2Y6R A;  4AP3 A;  2WPC A;  3PVC A;  3IC9 A;  4FDC B;  1D4C A;  2XVF A;  3AXB A;  1NG4 A;  3Q9T A;  5JCL A;  1H84 A;  3F8D A;  4NEW A;  1F8S A;  3F8R A;  4BJY A;  1LQT A;  4BJZ A;  1ELI A;  3LJP A;  1CF3 A;  4H4R A;  2BCP A;  3COX A;  3G5S A;  2YR4 A;  1D7L A;  2WQY A;  1ZP0 A;  4J34 A;  4U8L A;  1N4V A;  1VDC A;  1KSU A;  4K5S A;  3CND A;  1XPQ A;  3CTY A;  2V6O A;  2EQ9 A;  2V5Z A;  3UKQ A;  1NDA A;  5IQ1 A;  1H7W A;  2CFY A;  4GF7 A;  2VQB A;  1DOE A;  1ZMC A;  4LA1 A;  1GES A;  4YSY A;  2C75 A;  3DK4 A;  3LB8 A;  3DJG X;  2BXR A;  1YQZ A;  2DKI A;  3LXD A;  3SM8 A;  4NEV A;  2NVK X;  3G5Q A;  4UP3 A;  1PHH A;  3AE9 A;  4RSL A;  4D04 A;  4O5Q A;  1Q1W A;  2B9W A;  3AE1 A;  3AEE A;  1PBC A;  1LPF A;  2BYB A;  4U8M A;  3UTH A;  2APG A;  4DGK A;  3OC4 A;  3VR9 A;  1TDK A; 
#chains in the Genus database with same CATH topology
 1NHP A;  3UOX A;  3VQR A;  1E1N A;  5BUK A;  3UOV A;  4Z2R A;  2A8X A;  2CUL A;  5KRQ A;  5U63 A;  4K2X A;  4U8N A;  3IWA A;  5KVH A;  4H2Q A;  3II4 A;  1CJ3 A;  4NTE A;  3T37 A;  2XFO A;  2IID A;  4FK1 A;  4C77 A;  3C4N A;  5J7X A;  3BHF A;  3F8P A;  4H4U A;  3CMM A;  4J31 A;  2WU2 A;  4X4J A;  3C4A A;  1OJC A;  4CCR A;  3L1R A;  1FCD A;  3QFB A;  4BK2 A;  4ADW A;  2YLX A;  2GRT A;  2ACZ A;  1L9C A;  2X50 A;  2ZZC A;  1L9D A;  1PBF A;  1Z6L A;  2GEW A;  3ATQ A;  1NHS A;  3ICR A;  3AEF A;  3RP6 A;  3UKL A;  4ICY A;  3KLJ A;  2B7S A;  1OJA A;  4TLZ A;  4A99 A;  4BK1 A;  4J2W A;  4B65 A;  3AD7 B;  1S3E A;  3BI4 A;  2GAG B;  1KF6 A;  1DJN A;  4G6G A;  1CHU A;  1NHQ A;  1ZOV A;  1RSG A;  4Y4L A;  2EQ8 A;  4YTP A;  4BV6 A;  4TM4 A;  2WPF A;  1XAN A;  5FS8 A;  2V3A A;  4A6N B;  4B64 A;  1NPX A;  3IHM A;  2BCG G;  5C3J A;  5FMH A;  3P9U A;  3V76 A;  2WOV A;  5HHF A;  1VQW A;  4N9X A;  5EB4 A;  2XVJ A;  3UP5 A;  5GSN A;  3BHK A;  3RHA A;  1N1P A;  3NLC A;  1TDE A;  1F8W A;  2XFN A;  1QJD A;  4J33 A;  4IV9 A;  1GAL A;  2RAB A;  3QSS A;  1ZMD A;  4K22 A;  4OPT A;  2TPR A;  5FS7 A;  3IHG A;  3CNP A;  4OPD A;  3AE3 A;  1AOG A;  4FK1 C;  2NPX A;  2YLZ A;  1ZDL A;  1V59 A;  2EQ6 A;  2VRL A;  1B4V A;  1BGJ A;  3SFD A;  3FG2 P;  4J56 A;  2C7G A;  3SZ0 A;  2C66 A;  4DSG A;  2JK6 A;  4U8P A;  3RP8 A;  3PS9 A;  4B1B A;  3D1C A;  1BZL A;  4E0V A;  4G6H A;  4U8I A;  1NHR A;  3EAO A;  4NNJ A;  2RGH A;  3GD4 A;  2X8H A;  4K8D A;  1FEC A;  2X3N A;  4REK A;  4EQR A;  4EM4 A;  1LQU A;  1ZY8 A;  2BS2 A;  1H6V A;  2YLR A;  3EAN A;  3H4K A;  3VRB A;  3DJJ A;  2RGJ A;  1VG0 A;  2WP6 A;  4GAV A;  1H83 A;  2FJB A;  1B37 A;  5LV9 A;  1GEU A;  3UKH A;  2V3B A;  1CC4 A;  4H2R A;  3GYJ A;  3GWD A;  3AD8 B;  2BAC A;  4C3Y A;  4YSZ A;  1OJ9 A;  1MO9 A;  2CDU A;  1PXA A;  3NT6 A;  3UP4 A;  1CJ4 A;  3NK2 X;  3P4P A;  1IUW A;  4A7A A;  4EQW A;  4EQS A;  4YXD A;  4DNA A;  3AYJ A;  3D8X A;  2OA1 A;  3K30 A;  3K7Q X;  5IQ4 A;  3GRT A;  2A89 A;  4KX6 A;  2Y6Q A;  1K0I A;  3ABV A;  4H4Y A;  4U2L A;  5ER0 A;  2BA9 A;  3AD9 B;  3DH9 A;  4OVI A;  1TRB A;  2GQW A;  2YLT A;  3BNU A;  2BK3 A;  2XLR A;  2JBV A;  1B8S A;  2YVJ A;  4NTC A;  2YQU A;  2AAQ A;  3EPT A;  3NG7 X;  3M0O A;  5HXI A;  3UTF A;  1TDN A;  4U8O A;  2C72 A;  3H8L A;  1D4E A;  1BKW A;  1F6M A;  4EMI A;  5KNL A;  5KMQ A;  1QLB A;  1H7X A;  2OLO A;  5HY5 A;  1MOK A;  1REO A;  4I58 A;  4TLX A;  3ALJ A;  3I3L A;  2B76 A;  3QSM A;  2RGO A;  1VG9 A;  3NTA A;  4RG4 A;  1GXF A;  3SX6 A;  1YQ3 A;  4BK3 A;  3UKA A;  3C96 A;  5KMR A;  1Q1R A;  1S2Y A;  1CL0 A;  1DNC A;  3Q6J A;  3QJ4 A;  1NG3 A;  4USQ A;  3V3N A;  5IPY A;  1E6E A;  1D5T A;  2ARD A;  3AE8 A;  4IVO B;  1GT8 A;  4C5O A;  1DOD A;  3UKK A;  4EIP A;  4H7U A;  1PXC A;  1ZX9 A;  4C74 A;  2GR3 A;  4HB9 A;  1P2E A;  3SYI A;  3K7T A;  2WPE A;  1E1L A;  4JN9 A;  4TM3 A;  4EM3 A;  2C70 A;  2VVL A;  1CJC A;  2YR5 A;  5KOW A;  3AE6 A;  3NYE A;  3URH A;  1IJH A;  1TYP A;  2FBW A;  2UZZ A;  2WBA A;  2Q0K A;  2WOW A;  3NKS A;  4GDE A;  4GR1 A;  4Z2U A;  3CNJ A;  3NK1 X;  4P9S A;  2QA2 A;  3UTE A;  5EBK A;  5HYM A;  4UDP A;  4G73 A;  3UOZ A;  2VOU A;  4I59 A;  3SFE A;  1KNR A;  1ONF A;  1O95 A;  2H88 A;  4CY8 A;  1P2H A;  1FEB A;  4H4Q A;  4H4T A;  2OLN A;  2XCG A;  2XVE A;  1NAA A;  2WU5 A;  3AE7 A;  4CY6 A;  3NYC A;  3V3O A;  1ZKQ A;  4B67 A;  1D7Y A;  2WET A;  1GPE A;  2FJD A;  2YM1 A;  1EL8 A;  2BK4 A;  4FX9 A;  3ZYX A;  2BS3 A;  2XLP A;  4H2N A;  1JNR A;  3GRS A;  3DME A;  1GRF A;  5M0Z A;  2O9Z A;  3VR8 A;  3NYF A;  1IUX A;  1O5W A;  2B7R A;  3VRD B;  1IUT A;  2YG6 A;  4H4Z A;  5C2T A;  4A6N A;  1M6I A;  3T2Y A;  3P4S A;  4AT2 A;  2WHD A;  1PBD A;  5CQF A;  1Y56 A;  4A65 A;  1GV4 A;  1Y0P A;  1PBE A;  4NTD A;  3RED A;  1E1M A;  2HQM A;  4H4P A;  4ECH A;  1TYT A;  3CIR A;  5KMS A;  4YWO A;  5KWF A;  5L46 A;  2OAL A;  5EB5 A;  3AE4 A;  3KPK A;  2JB1 A;  3AYI A;  4HA6 A;  4USR A;  4AOS A;  1FL2 A;  4AOX A;  4IVM B;  3AE2 A;  5CKU A;  1KNP A;  4CCQ A;  4IA5 A;  3ALM A;  4ZN0 A;  3BNM A;  4JY3 A;  3M12 A;  4Z25 A;  3QVR A;  2JB2 A;  2GV8 A;  3CPH G;  1PS9 A;  3HYX A;  4M52 A;  3AB1 A;  1JU2 A;  1EBD A;  3KPF A;  4Z43 A;  1KFY A;  2Q0L A;  2WS3 A;  1H82 A;  2BK5 A;  3WE0 A;  1CC6 A;  2B9X A;  2OAM A;  2WOI A;  5U1O A;  1K4Q A;  4LU6 A;  4D03 A;  5JCN A;  4Y4N A;  2JB3 A;  4H4V A;  3VRA A;  2X8G A;  2ZZB A;  1GER A;  1CC2 A;  2YG4 A;  1L9E A;  3AE5 A;  3O0H A;  4J57 A;  4U2T A;  2E4G A;  1DOC A;  5KMP A;  2BRA A;  3M13 A;  2GH5 A;  2F5Z A;  2XFQ A;  3NHO X;  1ZOY A;  1PJ6 A;  4XWR A;  3CGD A;  1GRT A;  3S5W A;  3UKP A;  2WP5 A;  3JSK A;  3AEA A;  2YR6 A;  1TDF A;  2C67 A;  5M10 A;  1K0J A;  2VRM A;  3NN6 X;  1GRH A;  1PN0 A;  2XFU A;  4OPU A;  5KVI A;  4OPI A;  3ICS A;  3P4Q A;  4JDR A;  4Z26 A;  4GDP A;  2PYX A;  3DJE A;  3KD9 A;  1W4X A;  1VRQ B;  2Z5X A;  2WP9 A;  4UDR A;  3NN0 X;  2GR0 A;  3S61 A;  2XDO A;  2BC1 A;  2BS4 A;  1GET A;  2PHH A;  1Y56 B;  3GMC A;  2B9Y A;  4YTN A;  4ZCD A;  4AT0 A;  4EQX A;  2C4C A;  2C64 A;  3H8I A;  2YVG A;  2QA1 A;  4CNJ A;  3HZL A;  3DK9 A;  1GTH A;  1JRZ A;  1PXB A;  3RP7 A;  5DBJ A;  1PBB A;  4MJW A;  2FJA A;  3QVP A;  3AWI A;  3UOY A;  3SGL A;  3LZX A;  3P4R A;  1IUU A;  4YKG A;  3DGZ A;  3K7M X;  3NGC X;  3GDN A;  3CGC A;  2C76 A;  1UKV G;  1DXL A;  2R4J A;  1E39 A;  3CNT A;  4U2S A;  2JAE A;  1KSS A;  4H4X A;  4RG3 A;  1GRE A;  2R0C A;  2V60 A;  2IVD A;  4NZH A;  5FS6 A;  2YLS A;  2YVF A;  3HYW A;  2EQ7 A;  1JOA A;  3LOV A;  4YKF A;  4Z44 A;  5BUL A;  2YG7 A;  3LAD A;  2XVH A;  2X99 A;  3B3R A;  3IF9 A;  4JY2 A;  3UTG A;  4JQ9 A;  3GMB A;  4Y4M A;  2R9Z A;  3BI2 A;  3ICT A;  2GR2 A;  2Z5Y A;  4OPC A;  2ZZ0 A;  1DOB A;  4EMW A;  1IUV A;  3CN8 A;  3EF6 A;  4PAA A;  3T0K A;  3SZF A;  2TMD A;  1KDG A;  5TR3 A;  4B69 A;  4X9M A;  4WCT A;  4UDQ A;  2C65 A;  2XLU A;  2R0P A;  2XYO A;  1ZK7 A;  4II3 A;  2WDQ A;  2C3D A;  3UCL A;  1CBO A;  4YSX A;  3T14 A;  2R4E A;  4JNA A;  3L8K A;  1PJ7 A;  2R46 A;  1RP0 A;  1IUS A;  2CVJ A;  2W0H A;  4H2P A;  2C73 A;  1GND A;  4H4S A;  1YY5 A;  4IA6 A;  3OZ2 A;  2GVC A;  3T31 A;  3NIX A;  4GAP A;  2VVM A;  3CPJ G;  4H4W A;  4J36 A;  3R9U A;  2BXS A;  4YSH A;  3AEB A;  1H81 A;  2XLS A;  3KKJ A;  3DGH A;  4OCG A;  1EL9 A;  4OPG A;  3KA7 A;  3ITJ A;  1CJ2 A;  2R45 A;  2WDR A;  2GQF A;  1JNZ A;  1MXT A;  1TDO A;  2BAB A;  1BWC A;  3CGE A;  3GWF A;  1JRX A;  3KU9 A;  3P1W A;  2A87 A;  4Z2T A;  2GR1 A;  3GYX A;  3QFA A;  4XXG A;  2YLW A;  5KXJ A;  2WEU A;  1F8R A;  4PAB A;  5U25 A;  3BI5 A;  2E1M A;  4YTM A;  1GSN A;  2Q6U A;  3GYI A;  2YG5 A;  1E7P A;  1EL7 A;  1H86 A;  3DJD A;  4O5U A;  2FJE A;  3ALL A;  2XFP A;  2GF3 A;  3FIM B;  1BF3 A;  1EL5 A;  2WES A;  1N4W A;  4U8K A;  3SY4 A;  4B63 A;  3E1T A;  3FPZ A;  4JNQ A;  1QO8 A;  4A79 A;  3DA1 A;  3NNE A;  4CNK A;  5JCK A;  3ISH A;  4G9K A;  4EIQ A;  2R0G A;  4GCM A;  4B66 A;  5JCM A;  4X9N A;  1LJ1 A;  1YKJ A;  1FOH A;  3ADA B;  4CBQ A;  2YG3 A;  3NH3 X;  1PJ5 A;  3B6D A;  3NK0 X;  5KOX A;  1RYI A;  1S2Q A;  2VQ7 A;  1PDH A;  4OPL A;  2BC0 A;  1LTX R;  1NEK A;  3AEC A;  3ATR A;  4K7Z A;  2J3N A;  2GAH B;  3GSI A;  5GRT A;  1K0L A;  3CNS A;  3FBS A;  3PO7 A;  1GRB A;  3RNM A;  5FS9 A;  3G5R A;  4A9W A;  3UKF A;  2AQJ A;  1FEA A;  2YWL A;  4CRT A;  3KVE A;  2GMH A;  2IVE A;  4G74 A;  1Q9I A;  1JEH A;  1LVL A;  4AP1 A;  1SEZ A;  1S3B A;  2V61 A;  3FMW A;  3GD3 A;  4APN A;  2H89 A;  1D4D A;  2JKC A;  2YM2 A;  4BUR A;  5EOW A;  3HYV A;  3GDP A;  4U8J A;  1O94 A;  1XHC A;  5BVA A;  4WX1 A;  5JCI A;  1M64 A;  2GB0 A;  3QSE A;  4GUV A;  5BRT A;  2E5V A;  1E1K A;  2Q7V A;  2XLT A;  3CPI G;  2AR8 A;  1N4U A;  4A5L A;  2X8C A;  3I6D A;  1F3P A;  1YQ4 A;  2QAE A;  2YAU A;  2C3C A;  4K5R A;  3SQP A;  1B5Q A;  3DK8 A;  4TM0 A;  2XVI A;  3NRN A;  4B68 A;  1COY A;  2QCU A;  2WDV A;  4C3X A;  4YT0 A;  3CGB A;  1GOS A;  2DKH A;  1NEN A;  1GRG A;  1OJD A;  2VZ2 A;  1GRA A;  3AED A;  4XWZ A;  2I0Z A;  4DSH A;  1L0V A;  1X31 B;  3NTD A;  1LV0 A;  4H50 A;  1DJQ A;  1BGN A;  1OJT A;  1JRY A;  3SZC A;  3AEG A;  2VVL G;  4GRT A;  4EMJ A;  3ZDN A;  4KPR A;  1XDI A;  1GTE A;  1HYU A;  4LII A;  4TM1 A;  2GMJ A;  4ZCC A;  3AYL A;  3LZW A;  2ZBW A;  4Z24 A;  5J60 A;  2Y6R A;  4AP3 A;  2WPC A;  3PVC A;  3IC9 A;  4FDC B;  1D4C A;  2XVF A;  3AXB A;  3SZW A;  1NG4 A;  3Q9T A;  5JCL A;  1H84 A;  3F8D A;  4NEW A;  1F8S A;  3F8R A;  4BJY A;  1LQT A;  4BJZ A;  1ELI A;  3LJP A;  1CF3 A;  4H4R A;  4NWZ A;  2BCP A;  3COX A;  3G5S A;  2YR4 A;  1D7L A;  2WQY A;  1ZP0 A;  4J34 A;  4U8L A;  3T2Z A;  1N4V A;  1VDC A;  1KSU A;  4K5S A;  3CND A;  1XPQ A;  3CTY A;  2V6O A;  2EQ9 A;  2V5Z A;  3UKQ A;  1NDA A;  5IQ1 A;  1H7W A;  2CFY A;  4GF7 A;  2VQB A;  1DOE A;  1ZMC A;  4LA1 A;  1GES A;  3SXI A;  4YSY A;  2C75 A;  3DK4 A;  3LB8 A;  3DJG X;  2BXR A;  3T2K A;  1YQZ A;  2DKI A;  3LXD A;  3SM8 A;  4NEV A;  2NVK X;  3G5Q A;  2BRY A;  4UP3 A;  1PHH A;  3AE9 A;  4RSL A;  4D04 A;  4O5Q A;  1Q1W A;  2B9W A;  3AE1 A;  3AEE A;  1PBC A;  1LPF A;  2BYB A;  4U8M A;  3UTH A;  2APG A;  4II2 A;  4DGK A;  3OC4 A;  3VR9 A;  1TDK A; 
#chains in the Genus database with same CATH homology
 1NHP A;  3UOX A;  3VQR A;  1E1N A;  5BUK A;  3UOV A;  4Z2R A;  2A8X A;  2CUL A;  5KRQ A;  5U63 A;  4K2X A;  4U8N A;  3IWA A;  5KVH A;  4H2Q A;  3II4 A;  1CJ3 A;  4NTE A;  3T37 A;  2XFO A;  2IID A;  4FK1 A;  4C77 A;  3C4N A;  5J7X A;  3BHF A;  3F8P A;  4H4U A;  3CMM A;  4J31 A;  2WU2 A;  4X4J A;  3C4A A;  1OJC A;  4CCR A;  3L1R A;  1FCD A;  3QFB A;  4BK2 A;  4ADW A;  2YLX A;  2GRT A;  2ACZ A;  1L9C A;  2X50 A;  2ZZC A;  1L9D A;  1PBF A;  1Z6L A;  2GEW A;  3ATQ A;  1NHS A;  3ICR A;  3AEF A;  3RP6 A;  3UKL A;  4ICY A;  3KLJ A;  2B7S A;  1OJA A;  4TLZ A;  4A99 A;  4BK1 A;  4J2W A;  4B65 A;  3AD7 B;  1S3E A;  3BI4 A;  2GAG B;  1KF6 A;  1DJN A;  4G6G A;  1CHU A;  1NHQ A;  1ZOV A;  1RSG A;  4Y4L A;  2EQ8 A;  4YTP A;  4BV6 A;  4TM4 A;  2WPF A;  1XAN A;  5FS8 A;  2V3A A;  4A6N B;  4B64 A;  1NPX A;  3IHM A;  2BCG G;  5C3J A;  5FMH A;  3P9U A;  3V76 A;  2WOV A;  5HHF A;  1VQW A;  4N9X A;  5EB4 A;  2XVJ A;  3UP5 A;  5GSN A;  3BHK A;  3RHA A;  1N1P A;  3NLC A;  1TDE A;  1F8W A;  2XFN A;  1QJD A;  4J33 A;  4IV9 A;  1GAL A;  2RAB A;  3QSS A;  1ZMD A;  4K22 A;  4OPT A;  2TPR A;  5FS7 A;  3IHG A;  3CNP A;  4OPD A;  3AE3 A;  1AOG A;  4FK1 C;  2NPX A;  2YLZ A;  1ZDL A;  1V59 A;  2EQ6 A;  2VRL A;  1B4V A;  1BGJ A;  3SFD A;  3FG2 P;  4J56 A;  2C7G A;  3SZ0 A;  2C66 A;  4DSG A;  2JK6 A;  4U8P A;  3RP8 A;  3PS9 A;  4B1B A;  3D1C A;  1BZL A;  4E0V A;  4G6H A;  4U8I A;  1NHR A;  3EAO A;  4NNJ A;  2RGH A;  3GD4 A;  2X8H A;  4K8D A;  1FEC A;  2X3N A;  4REK A;  4EQR A;  4EM4 A;  1LQU A;  1ZY8 A;  2BS2 A;  1H6V A;  2YLR A;  3EAN A;  3H4K A;  3VRB A;  3DJJ A;  2RGJ A;  1VG0 A;  2WP6 A;  4GAV A;  1H83 A;  2FJB A;  1B37 A;  5LV9 A;  1GEU A;  3UKH A;  2V3B A;  1CC4 A;  4H2R A;  3GYJ A;  3GWD A;  3AD8 B;  2BAC A;  4C3Y A;  4YSZ A;  1OJ9 A;  1MO9 A;  2CDU A;  1PXA A;  3NT6 A;  3UP4 A;  1CJ4 A;  3NK2 X;  3P4P A;  1IUW A;  4A7A A;  4EQW A;  4EQS A;  4YXD A;  4DNA A;  3AYJ A;  3D8X A;  2OA1 A;  3K30 A;  3K7Q X;  5IQ4 A;  3GRT A;  2A89 A;  4KX6 A;  2Y6Q A;  1K0I A;  3ABV A;  4H4Y A;  4U2L A;  5ER0 A;  2BA9 A;  3AD9 B;  3DH9 A;  4OVI A;  1TRB A;  2GQW A;  2YLT A;  3BNU A;  2BK3 A;  2XLR A;  2JBV A;  1B8S A;  2YVJ A;  4NTC A;  2YQU A;  2AAQ A;  3EPT A;  3NG7 X;  3M0O A;  5HXI A;  3UTF A;  1TDN A;  4U8O A;  2C72 A;  3H8L A;  1D4E A;  1BKW A;  1F6M A;  4EMI A;  5KNL A;  5KMQ A;  1QLB A;  1H7X A;  2OLO A;  5HY5 A;  1MOK A;  1REO A;  4I58 A;  4TLX A;  3ALJ A;  3I3L A;  2B76 A;  3QSM A;  2RGO A;  1VG9 A;  3NTA A;  4RG4 A;  1GXF A;  3SX6 A;  1YQ3 A;  4BK3 A;  3UKA A;  3C96 A;  5KMR A;  1Q1R A;  1S2Y A;  1CL0 A;  1DNC A;  3Q6J A;  3QJ4 A;  1NG3 A;  4USQ A;  3V3N A;  5IPY A;  1E6E A;  1D5T A;  2ARD A;  3AE8 A;  4IVO B;  1GT8 A;  4C5O A;  1DOD A;  3UKK A;  4EIP A;  4H7U A;  1PXC A;  1ZX9 A;  4C74 A;  2GR3 A;  4HB9 A;  1P2E A;  3SYI A;  3K7T A;  2WPE A;  1E1L A;  4JN9 A;  4TM3 A;  4EM3 A;  2C70 A;  2VVL A;  1CJC A;  2YR5 A;  5KOW A;  3AE6 A;  3NYE A;  3URH A;  1IJH A;  1TYP A;  2FBW A;  2UZZ A;  2WBA A;  2Q0K A;  2WOW A;  3NKS A;  4GDE A;  4GR1 A;  4Z2U A;  3CNJ A;  3NK1 X;  4P9S A;  2QA2 A;  3UTE A;  5EBK A;  5HYM A;  4UDP A;  4G73 A;  3UOZ A;  2VOU A;  4I59 A;  3SFE A;  1KNR A;  1ONF A;  1O95 A;  2H88 A;  4CY8 A;  1P2H A;  1FEB A;  4H4Q A;  4H4T A;  2OLN A;  2XCG A;  2XVE A;  1NAA A;  2WU5 A;  3AE7 A;  4CY6 A;  3NYC A;  3V3O A;  1ZKQ A;  4B67 A;  1D7Y A;  2WET A;  1GPE A;  2FJD A;  2YM1 A;  1EL8 A;  2BK4 A;  4FX9 A;  3ZYX A;  2BS3 A;  2XLP A;  4H2N A;  1JNR A;  3GRS A;  3DME A;  1GRF A;  5M0Z A;  2O9Z A;  3VR8 A;  3NYF A;  1IUX A;  1O5W A;  2B7R A;  3VRD B;  1IUT A;  2YG6 A;  4H4Z A;  5C2T A;  4A6N A;  1M6I A;  3T2Y A;  3P4S A;  4AT2 A;  2WHD A;  1PBD A;  5CQF A;  1Y56 A;  4A65 A;  1GV4 A;  1Y0P A;  1PBE A;  4NTD A;  3RED A;  1E1M A;  2HQM A;  4H4P A;  4ECH A;  1TYT A;  3CIR A;  5KMS A;  4YWO A;  5KWF A;  5L46 A;  2OAL A;  5EB5 A;  3AE4 A;  3KPK A;  2JB1 A;  3AYI A;  4HA6 A;  4USR A;  4AOS A;  1FL2 A;  4AOX A;  4IVM B;  3AE2 A;  5CKU A;  1KNP A;  4CCQ A;  4IA5 A;  3ALM A;  4ZN0 A;  3BNM A;  4JY3 A;  3M12 A;  4Z25 A;  3QVR A;  2JB2 A;  2GV8 A;  3CPH G;  1PS9 A;  3HYX A;  4M52 A;  3AB1 A;  1JU2 A;  1EBD A;  3KPF A;  4Z43 A;  1KFY A;  2Q0L A;  2WS3 A;  1H82 A;  2BK5 A;  3WE0 A;  1CC6 A;  2B9X A;  2OAM A;  2WOI A;  5U1O A;  1K4Q A;  4LU6 A;  4D03 A;  5JCN A;  4Y4N A;  2JB3 A;  4H4V A;  3VRA A;  2X8G A;  2ZZB A;  1GER A;  1CC2 A;  2YG4 A;  1L9E A;  3AE5 A;  3O0H A;  4J57 A;  4U2T A;  2E4G A;  1DOC A;  5KMP A;  2BRA A;  3M13 A;  2GH5 A;  2F5Z A;  2XFQ A;  3NHO X;  1ZOY A;  1PJ6 A;  4XWR A;  3CGD A;  1GRT A;  3S5W A;  3UKP A;  2WP5 A;  3JSK A;  3AEA A;  2YR6 A;  1TDF A;  2C67 A;  5M10 A;  1K0J A;  2VRM A;  3NN6 X;  1GRH A;  1PN0 A;  2XFU A;  4OPU A;  5KVI A;  4OPI A;  3ICS A;  3P4Q A;  4JDR A;  4Z26 A;  4GDP A;  2PYX A;  3DJE A;  3KD9 A;  1W4X A;  1VRQ B;  2Z5X A;  2WP9 A;  4UDR A;  3NN0 X;  2GR0 A;  3S61 A;  2XDO A;  2BC1 A;  2BS4 A;  1GET A;  2PHH A;  1Y56 B;  3GMC A;  2B9Y A;  4YTN A;  4ZCD A;  4AT0 A;  4EQX A;  2C4C A;  2C64 A;  3H8I A;  2YVG A;  2QA1 A;  4CNJ A;  3HZL A;  3DK9 A;  1GTH A;  1JRZ A;  1PXB A;  3RP7 A;  5DBJ A;  1PBB A;  4MJW A;  2FJA A;  3QVP A;  3AWI A;  3UOY A;  3SGL A;  3LZX A;  3P4R A;  1IUU A;  4YKG A;  3DGZ A;  3K7M X;  3NGC X;  3GDN A;  3CGC A;  2C76 A;  1UKV G;  1DXL A;  2R4J A;  1E39 A;  3CNT A;  4U2S A;  2JAE A;  1KSS A;  4H4X A;  4RG3 A;  1GRE A;  2R0C A;  2V60 A;  2IVD A;  4NZH A;  5FS6 A;  2YLS A;  2YVF A;  3HYW A;  2EQ7 A;  1JOA A;  3LOV A;  4YKF A;  4Z44 A;  5BUL A;  2YG7 A;  3LAD A;  2XVH A;  2X99 A;  3B3R A;  3IF9 A;  4JY2 A;  3UTG A;  4JQ9 A;  3GMB A;  4Y4M A;  2R9Z A;  3BI2 A;  3ICT A;  2GR2 A;  2Z5Y A;  4OPC A;  2ZZ0 A;  1DOB A;  4EMW A;  1IUV A;  3CN8 A;  3EF6 A;  4PAA A;  3T0K A;  3SZF A;  2TMD A;  1KDG A;  5TR3 A;  4B69 A;  4X9M A;  4WCT A;  4UDQ A;  2C65 A;  2XLU A;  2R0P A;  2XYO A;  1ZK7 A;  4II3 A;  2WDQ A;  2C3D A;  3UCL A;  1CBO A;  4YSX A;  3T14 A;  2R4E A;  4JNA A;  3L8K A;  1PJ7 A;  2R46 A;  1RP0 A;  1IUS A;  2CVJ A;  2W0H A;  4H2P A;  2C73 A;  1GND A;  4H4S A;  1YY5 A;  4IA6 A;  3OZ2 A;  2GVC A;  3T31 A;  3NIX A;  4GAP A;  2VVM A;  3CPJ G;  4H4W A;  4J36 A;  3R9U A;  2BXS A;  4YSH A;  3AEB A;  1H81 A;  2XLS A;  3KKJ A;  3DGH A;  4OCG A;  1EL9 A;  4OPG A;  3KA7 A;  3ITJ A;  1CJ2 A;  2R45 A;  2WDR A;  2GQF A;  1JNZ A;  1MXT A;  1TDO A;  2BAB A;  1BWC A;  3CGE A;  3GWF A;  1JRX A;  3KU9 A;  3P1W A;  2A87 A;  4Z2T A;  2GR1 A;  3GYX A;  3QFA A;  4XXG A;  2YLW A;  5KXJ A;  2WEU A;  1F8R A;  4PAB A;  5U25 A;  3BI5 A;  2E1M A;  4YTM A;  1GSN A;  2Q6U A;  3GYI A;  2YG5 A;  1E7P A;  1EL7 A;  1H86 A;  3DJD A;  4O5U A;  2FJE A;  3ALL A;  2XFP A;  2GF3 A;  3FIM B;  1BF3 A;  1EL5 A;  2WES A;  1N4W A;  4U8K A;  3SY4 A;  4B63 A;  3E1T A;  3FPZ A;  4JNQ A;  1QO8 A;  4A79 A;  3DA1 A;  3NNE A;  4CNK A;  5JCK A;  3ISH A;  4G9K A;  4EIQ A;  2R0G A;  4GCM A;  4B66 A;  5JCM A;  4X9N A;  1LJ1 A;  1YKJ A;  1FOH A;  3ADA B;  4CBQ A;  2YG3 A;  3NH3 X;  1PJ5 A;  3B6D A;  3NK0 X;  5KOX A;  1RYI A;  1S2Q A;  2VQ7 A;  1PDH A;  4OPL A;  2BC0 A;  1LTX R;  1NEK A;  3AEC A;  3ATR A;  4K7Z A;  2J3N A;  2GAH B;  3GSI A;  5GRT A;  1K0L A;  3CNS A;  3FBS A;  3PO7 A;  1GRB A;  3RNM A;  5FS9 A;  3G5R A;  4A9W A;  3UKF A;  2AQJ A;  1FEA A;  2YWL A;  4CRT A;  3KVE A;  2GMH A;  2IVE A;  4G74 A;  1Q9I A;  1JEH A;  1LVL A;  4AP1 A;  1SEZ A;  1S3B A;  2V61 A;  3FMW A;  3GD3 A;  4APN A;  2H89 A;  1D4D A;  2JKC A;  2YM2 A;  4BUR A;  5EOW A;  3HYV A;  3GDP A;  4U8J A;  1O94 A;  1XHC A;  5BVA A;  4WX1 A;  5JCI A;  1M64 A;  2GB0 A;  3QSE A;  4GUV A;  5BRT A;  2E5V A;  1E1K A;  2Q7V A;  2XLT A;  3CPI G;  2AR8 A;  1N4U A;  4A5L A;  2X8C A;  3I6D A;  1F3P A;  1YQ4 A;  2QAE A;  2YAU A;  2C3C A;  4K5R A;  3SQP A;  1B5Q A;  3DK8 A;  4TM0 A;  2XVI A;  3NRN A;  4B68 A;  1COY A;  2QCU A;  2WDV A;  4C3X A;  4YT0 A;  3CGB A;  1GOS A;  2DKH A;  1NEN A;  1GRG A;  1OJD A;  2VZ2 A;  1GRA A;  3AED A;  4XWZ A;  2I0Z A;  4DSH A;  1L0V A;  1X31 B;  3NTD A;  1LV0 A;  4H50 A;  1DJQ A;  1BGN A;  1OJT A;  1JRY A;  3SZC A;  3AEG A;  2VVL G;  4GRT A;  4EMJ A;  3ZDN A;  4KPR A;  1XDI A;  1GTE A;  1HYU A;  4LII A;  4TM1 A;  2GMJ A;  4ZCC A;  3AYL A;  3LZW A;  2ZBW A;  4Z24 A;  5J60 A;  2Y6R A;  4AP3 A;  2WPC A;  3PVC A;  3IC9 A;  4FDC B;  1D4C A;  2XVF A;  3AXB A;  3SZW A;  1NG4 A;  3Q9T A;  5JCL A;  1H84 A;  3F8D A;  4NEW A;  1F8S A;  3F8R A;  4BJY A;  1LQT A;  4BJZ A;  1ELI A;  3LJP A;  1CF3 A;  4H4R A;  4NWZ A;  2BCP A;  3COX A;  3G5S A;  2YR4 A;  1D7L A;  2WQY A;  1ZP0 A;  4J34 A;  4U8L A;  3T2Z A;  1N4V A;  1VDC A;  1KSU A;  4K5S A;  3CND A;  1XPQ A;  3CTY A;  2V6O A;  2EQ9 A;  2V5Z A;  3UKQ A;  1NDA A;  5IQ1 A;  1H7W A;  2CFY A;  4GF7 A;  2VQB A;  1DOE A;  1ZMC A;  4LA1 A;  1GES A;  3SXI A;  4YSY A;  2C75 A;  3DK4 A;  3LB8 A;  3DJG X;  2BXR A;  3T2K A;  1YQZ A;  2DKI A;  3LXD A;  3SM8 A;  4NEV A;  2NVK X;  3G5Q A;  2BRY A;  4UP3 A;  1PHH A;  3AE9 A;  4RSL A;  4D04 A;  4O5Q A;  1Q1W A;  2B9W A;  3AE1 A;  3AEE A;  1PBC A;  1LPF A;  2BYB A;  4U8M A;  3UTH A;  2APG A;  4II2 A;  4DGK A;  3OC4 A;  3VR9 A;  1TDK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...