2VQ7A

Bacterial flavin-containing monooxygenase in complex with nadp: native data
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
443
structure length
443
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
total genus 159
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A02
5DBJA 2XVEA 1KSUA 3DA1A 3SFEA 4U8IA 5IQ1A 4H4XA 3V76A 1D4DA 2YVGA 2B7SA 4JY3A 4ZCDA 4YTNA 1EL5A 4Z44A 4H4SA 3II4A 1CBOA 1COYA 4TLXA 1XANA 1LTXR 1PHHA 4I58A 3KA7A 1OJDA 2WDQA 1CC6A 4YKGA 2C76A 2V3BA 1UKVG 3DJGX 4GDEA 3GYJA 2BCGG 2WETA 3FBSA 3AYIA 3CTYA 1PDHA 4HB9A 2VVMA 3QVRA 2WP6A 4A6NB 2R4EA 3DJJA 1NDAA 4JN9A 2BABA 4AP1A 2VRMA 1PXCA 2YLZA 4UP3A 4WCTA 2BK3A 4AOSA 1BF3A 2EQ7A 1L9DA 1Y0PA 4OVIA 4B69A 3GD4A 1O94A 4BJYA 1ZMCA 4M52A 2BXRA 1TYTA 3AEDA 3LZWA 1GRHA 4H2NA 3CGCA 1EBDA 3GYIA 3LADA 1E1NA 1DXLA 2YR6A 1VG9A 2GMHA 3I3LA 3AE5A 1K0LA 1KDGA 4X9NA 2YLRA 4IA5A 2OA1A 1E1MA 1JNZA 4JDRA 1EL7A 1H7WA 2GAGB 2R9ZA 2YG7A 4P9SA 3UTHA 5M10A 4FX9A 3UKLA 2W0HA 4U8JA 4CBQA 4EMJA 2WPCA 3NH3X 2TPRA 3GWFA 1TDKA 1IUUA 2I0ZA 3RNMA 1P2HA 4AT2A 3NYEA 2QCUA 3CNTA 4USQA 1JEHA 4NEVA 3UKHA 1IJHA 3AE1A 1M64A 3UKFA 3AE8A 1BGJA 2FJDA 3L1RA 4A65A 4A99A 4ADWA 4AT0A 4DSGA 2OALA 1ZMDA 4NTEA 4C3YA 4BK1A 1N4VA 3DK9A 3FPZA 3UP5A 4E0VA 4OPCA 4K5SA 3ATQA 4Z2TA 3AE7A 4BK3A 4EQRA 2PYXA 5KOXA 3GRTA 1PXAA 2R0GA 3C4AA 2BK4A 3LB8A 2JB3A 2XLRA 2ZBWA 3ALJA 3CNSA 2ZZ0A 4H4RA 3AECA 3KU9A 4C3XA 4YXDA 1GETA 1N4UA 2FJAA 4YT0A 1H7XA 2YWLA 3O0HA 2GR2A 3ALMA 4OPIA 4EQWA 3H4KA 4DSHA 2AQJA 2BXSA 3CNDA 4O5QA 1KSSA 2WU5A 1NEKA 1CC2A 2XVFA 1GALA 1IUVA 3CPIG 2VQ7A 5CKUA 1O5WA 1N4WA 1YQ3A 3F8RA 3NYFA 4N9XA 4Z2UA 2X8HA 3UP4A 4U8OA 1RYIA 3BI4A 4USRA 3NK1X 1EL8A 2EQ9A 2TMDA 4IA6A 4YWOA 5U63A 2XFNA 1DJNA 2JK6A 2X99A 3GMCA 2VZ2A 3NLCA 3NTDA 1Q9IA 3QSEA 3R9UA 4Y4LA 2XYOA 3AWIA 1L0VA 4A9WA 2HQMA 2WDVA 1H81A 4B63A 1CJ4A 3K30A 1H83A 2X8CA 3UTGA 4B65A 3G5QA 1JNRA 1KFYA 4BURA 2XCGA 1VRQB 1L9CA 2WESA 1PXBA 2YAUA 2E4GA 5KRQA 3SGLA 3KKJA 3AE9A 2GB0A 3FG2P 1PJ5A 1PBBA 4JNAA 1GNDA 1GSNA 3NTAA 3IHGA 2A87A 2B9WA 3CNPA 1LPFA 2DKHA 1EL9A 3AD7B 1H86A 4JNQA 4YSHA 3NIXA 2EQ6A 1H84A 1LQUA 4TM1A 3JSKA 2O9ZA 2WHDA 2X50A 2GR1A 5FMHA 3ICTA 3QSMA 3IF9A 3DJEA 4EMIA 2C72A 4GUVA 2YVFA 5J7XA 1JU2A 4OPTA 2J3NA 3SM8A 1ZKQA 1KNRA 2GQWA 2Q0LA 1F8WA 3EAOA 4IV9A 2BYBA 2XFQA 3S61A 1D5TA 1P2EA 2H89A 3NN0X 5L46A 1CF3A 1NG3A 2C67A 1VDCA 1KNPA 3H8LA 3CPHG 2BS3A 1JRXA 3AYLA 4LA1A 2GAHB 5IQ4A 2XLTA 4U2LA 2XFUA 3QFAA 1Y56A 1N1PA 3EF6A 3AB1A 2YM2A 1BWCA 1YKJA 4NEWA 4U8KA 4H4YA 1ONFA 2FBWA 2WOIA 4PAAA 1M6IA 1CC4A 1FOHA 2OLNA 4U2SA 1NAAA 1PBCA 2B9XA 3EPTA 4FDCB 2EQ8A 3BI2A 2YM1A 3K7QX 4K7ZA 2X3NA 1TDNA 4H4PA 5HYMA 1LQTA 3AE2A 2E1MA 5FS9A 4J57A 1B5QA 3ZDNA 4A5LA 2BS4A 4NZHA 4D04A 2X8GA 1OJ9A 2B76A 3AXBA 5FS8A 4OPUA 3P4SA 4RG3A 2YLXA 2GEWA 4B67A 1TDOA 4RSLA 2BC1A 3T37A 4BV6A 5JCLA 1CHUA 1NPXA 2GQFA 2XVHA 3DMEA 3KPFA 5BVAA 1NG4A 1CJCA 3DGZA 5KXJA 2CVJA 3PS9A 1GRBA 2A89A 2Q0KA 5FS6A 3BNUA 1E7PA 1O95A 3GDNA 4ECHA 4FK1C 2CFYA 3E1TA 4EQXA 4APNA 2YR5A 3AEAA 2BACA 1PBDA 3UKQA 2APGA 1Q1RA 1VG0A 4H4VA 1YQ4A 1DODA 3LJPA 4J34A 4EQSA 1V59A 1DOEA 1SEZA 2XDOA 4OPGA 5KWFA 2YG6A 3CN8A 1FCDA 3BI5A 2BCPA 3P4QA 4B68A 4GCMA 1E39A 4GR1A 1PBEA 4K5RA 3URHA 1RP0A 5GRTA 2XFPA 1GESA 4H4UA 2BC0A 2XLSA 4H4QA 1JRYA 2YLSA 1GRGA 5ER0A 1TDEA 4PABA 4REKA 3WE0A 3ZYXA 1NHQA 1MOKA 3QVPA 1TRBA 4ZCCA 2JAEA 3DH9A 4TLZA 1F8SA 1GXFA 2V61A 5GSNA 3UTEA 4TM3A 3DK4A 2XLPA 3LXDA 5KVIA 2Z5YA 4OPLA 4CY6A 4CCQA 3K7MX 1REOA 3M12A 1BZLA 3Q9TA 3BNMA 4AP3A 1CL0A 2JBVA 3ICSA 1PS9A 2XVJA 3LZXA 3CIRA 2YG3A 4HA6A 3HZLA 2XVIA 1F8RA 3H8IA 1D4CA 4NTCA 2WU2A 3DGHA 2GVCA 3C4NA 3NK0X 1FECA 3NRNA 2BK5A 2WOWA 3UKKA 4H7UA 1BKWA 4A79A 4YSYA 1B8SA 1XPQA 1KF6A 4KPRA 4UDQA 3C96A 1DNCA 3FIMB 1DOCA 3P1WA 4BK2A 1K0IA 1IUTA 4J33A 5HY5A 1ZK7A 3DJDA 1GRTA 4B64A 1FEBA 1S3BA 1ZP0A 3KVEA 2WBAA 3LOVA 2C3CA 1QJDA 4UDPA 4EMWA 2WOVA 4J56A 1LVLA 3AEEA 3OC4A 3RP7A 2C3DA 2C66A 4TM0A 5KOWA 3ISHA 4H2QA 3P4PA 3F8DA 2V5ZA 3F8PA 1QLBA 2GRTA 3ADAB 3REDA 4H4TA 1JOAA 3IC9A 4Z43A 1OJCA 2GV8A 1H82A 1Z6LA 3UOYA 3UTFA 3CGEA 3QJ4A 1GREA 1S2QA 2WP5A 3DK8A 1Y56B 2C75A 4XWZA 1D7YA 2ARDA 4B66A 5C2TA 2OAMA 1PJ6A 3IHMA 4K8DA 5BUKA 2XLUA 1XHCA 2XFOA 3NHOX 1CJ3A 4C74A 1ZOVA 2C64A 2QAEA 3G5SA 3PO7A 3RP6A 2GR0A 3CPJG 1YQZA 4H4ZA 3VRBA 2RABA 4DGKA 2OLOA 2YLWA 3GMBA 1VQWA 2E5VA 3M13A 1E6EA 1GPEA 4CCRA 2R45A 1PJ7A 2WQYA 1GOSA 3B3RA 4H4WA 1TDFA 1L9EA 2RGOA 1D4EA 2H88A 3Q6JA 4U8NA 2NVKX 2BS2A 4XXGA 2NPXA 4LU6A 4FK1A 2PHHA 3K7TA 2CULA 3PVCA 4H2RA 3V3NA 1QO8A 3BHFA 1X31B 3CGDA 4A7AA 3NKSA 3M0OA 1FL2A 1BGNA 1DOBA 3ICRA 3NGCX 1PN0A 1CJ2A 3NG7X 1GEUA 1OJAA 4I59A 4DNAA 3AE6A 4WX1A 1NHSA 4YSZA 3L8KA 3AD8B 3IWAA 5JCKA 2Q7VA 1FEAA 2Q6UA 1MO9A 1ZOYA 3NT6A 4K2XA 2V6OA 5JCMA 4U8PA 1TYPA 2YLTA 2IVEA 5C3JA 4X4JA 4YTPA 3VRAA 2GF3A 4KX6A 1GTEA 3SQPA 4Y4NA 3D1CA 5FS7A 5JCNA 5U1OA 1F6MA 1H6VA 1D7LA 4YSXA 4CRTA 2QA1A 2YR4A 3AEFA 3CGBA 4LIIA 1GV4A 4TM4A 4U8LA 4XWRA 4OCGA 2A8XA 2WPFA 4J2WA 3UOXA 3CNJA 4C5OA 1S2YA 5CQFA 2B7RA 4AOXA 4A6NA 3NK2X 2BA9A 3UCLA 3B6DA 1NHPA 1ZX9A 2IIDA 4CY8A 2VVLG 1B37A 1GERA 4EM3A 3S5WA 2R4JA 3EANA 4D03A 4K22A 2YVJA 2VRLA 2V60A 3KLJA 4U2TA 4IVMB 4CNJA 1MXTA 3QFBA 1NENA 2QA2A 2ACZA 1S3EA 2AAQA 2C73A 1OJTA 2GR3A 1LJ1A 2WPEA 1F3PA 2Y6QA 3BHKA 3NNEA 2YG5A 1B4VA 3UOVA 2C70A 4JY2A 4NTDA 2R46A 4H2PA 2WS3A 1Q1WA 1GRAA 3AE4A 4J31A 4GDPA 4EM4A 3UKPA 4Z24A 5EB5A 4C77A 4CNKA 2DKIA 4X9MA 5EB4A 5LV9A 1GRFA 3ITJA 3ALLA 4IVOB 3COXA 2IVDA 2YQUA 5JCIA 1HYUA 2FJEA 3QSSA 5KVHA 2YG4A 1AOGA 4GRTA 2VQBA 2C65A 5U25A 4H50A 4EIQA 1PBFA 3G5RA 4UDRA 4Z26A 5IPYA 1ELIA 4BJZA 5EBKA 3AEGA 4ICYA 1XDIA 1ZY8A 2AR8A 3AYJA 4YKFA 1LV0A 1GTHA 1K4QA 2R0PA 4Y4MA 4EIPA 4U8MA 2RGJA 2WEUA 3KD9A 1IUSA 4J36A 2Z5XA 4OPDA 2ZZBA 3VR8A 5M0ZA 4Z25A 3VQRA 1DJQA 3GRSA 3I6DA 3UKAA 2VVLA 3ATRA 3GDPA 2B9YA 4JQ9A 3AEBA 3GD3A 4B1BA 5J60A 3P4RA 1W4XA 3GSIA 1K0JA 1NHRA 2Y6RA 4O5UA 5TR3A 3D8XA 3UOZA 3NYCA 1GT8A 1ZDLA 5BRTA 3RHAA 1JRZA 2VOUA 2C7GA 1YY5A 2RGHA 2FJBA 2GH5A 1IUWA 2JKCA 3AD9B 2JB2A 4MJWA 5HHFA 2UZZA 3P9UA 2JB1A 5BULA 2R0CA 3FMWA 3NN6X 1IUXA 3VRDB 2GMJA 5EOWA 3GWDA 3RP8A 2ZZCA 3SFDA 1E1LA 2WDRA 1RSGA 2CDUA 4YTMA 3VR9A 4GF7A 3ABVA 1E1KA 2F5ZA 2WP9A 2V3AA 4RG4A 3AE3A 3V3OA 4ZN0A 5HXIA 3OZ2A 4Z2RA
chains in the Genus database with same CATH superfamily
5DBJA 2XVEA 1KSUA 3DA1A 3SFEA 4U8IA 5IQ1A 4H4XA 3V76A 1D4DA 2YVGA 5KMQA 2B7SA 4JY3A 4ZCDA 4YTNA 1EL5A 4Z44A 4H4SA 3II4A 1CBOA 1COYA 4TLXA 1XANA 1LTXR 1PHHA 4I58A 3KA7A 3SYIA 1OJDA 3T2KA 2WDQA 1CC6A 4YKGA 2C76A 2V3BA 1UKVG 3DJGX 4GDEA 3GYJA 2BCGG 2WETA 3FBSA 3AYIA 3CTYA 1PDHA 4HB9A 2VVMA 3QVRA 2WP6A 4A6NB 2R4EA 3DJJA 1NDAA 4JN9A 2BABA 4AP1A 2VRMA 1PXCA 2YLZA 4UP3A 4WCTA 2BK3A 4AOSA 1BF3A 2EQ7A 1L9DA 1Y0PA 4OVIA 4B69A 3GD4A 5KNLA 1O94A 4BJYA 1ZMCA 4M52A 2BXRA 1TYTA 3AEDA 3LZWA 2BRAA 1GRHA 4H2NA 3CGCA 1EBDA 3GYIA 3LADA 1E1NA 1DXLA 2YR6A 1VG9A 2GMHA 3I3LA 3AE5A 1K0LA 1KDGA 4X9NA 2YLRA 4IA5A 2OA1A 3SXIA 1E1MA 1JNZA 4JDRA 1EL7A 1H7WA 2GAGB 2R9ZA 2YG7A 4P9SA 3UTHA 5M10A 4FX9A 3UKLA 4G6HA 2W0HA 4U8JA 4CBQA 4EMJA 2WPCA 3NH3X 2TPRA 3GWFA 1TDKA 1IUUA 2I0ZA 3RNMA 1P2HA 4AT2A 3NYEA 3HYXA 2QCUA 3CNTA 4USQA 1JEHA 4NEVA 3UKHA 1IJHA 3AE1A 1M64A 3UKFA 3AE8A 1BGJA 2FJDA 3L1RA 4A65A 4A99A 4ADWA 4AT0A 4DSGA 2OALA 1ZMDA 4NTEA 4C3YA 4BK1A 1N4VA 3DK9A 3FPZA 3UP5A 4E0VA 4OPCA 4K5SA 3ATQA 4Z2TA 3AE7A 4BK3A 4EQRA 2PYXA 5KOXA 3GRTA 1PXAA 2R0GA 3C4AA 2BK4A 3LB8A 2JB3A 2XLRA 2ZBWA 3ALJA 3CNSA 2ZZ0A 4H4RA 3AECA 3KU9A 4C3XA 4YXDA 1GETA 1N4UA 2FJAA 4YT0A 1H7XA 5KMSA 2YWLA 3O0HA 2GR2A 3ALMA 4OPIA 4EQWA 3H4KA 4DSHA 2AQJA 2BXSA 3CNDA 4O5QA 1KSSA 2WU5A 1NEKA 1CC2A 2XVFA 1GALA 1IUVA 3CPIG 2VQ7A 5CKUA 1O5WA 1N4WA 1YQ3A 3F8RA 3NYFA 4N9XA 4Z2UA 2X8HA 3UP4A 4U8OA 5KMRA 1RYIA 3BI4A 4USRA 3NK1X 1EL8A 2EQ9A 2TMDA 4IA6A 4YWOA 4GAPA 5U63A 2XFNA 1DJNA 2JK6A 2X99A 3GMCA 2VZ2A 3NLCA 3NTDA 1Q9IA 3QSEA 3R9UA 4Y4LA 2XYOA 3AWIA 1L0VA 4A9WA 2HQMA 2WDVA 1H81A 4B63A 1CJ4A 3K30A 1H83A 2X8CA 3UTGA 4B65A 3G5QA 1JNRA 1KFYA 4BURA 2XCGA 1VRQB 1L9CA 2WESA 1PXBA 2YAUA 2E4GA 5KRQA 3SGLA 3KKJA 3AE9A 2GB0A 3FG2P 1PJ5A 1PBBA 4JNAA 1GNDA 1GSNA 3NTAA 3IHGA 2A87A 2B9WA 3CNPA 1LPFA 2DKHA 1EL9A 3AD7B 4G73A 1H86A 4JNQA 4YSHA 3NIXA 2EQ6A 1H84A 1LQUA 4TM1A 3JSKA 2O9ZA 2WHDA 2X50A 2GR1A 5FMHA 3ICTA 3QSMA 3IF9A 3DJEA 4EMIA 2C72A 4GUVA 2YVFA 5J7XA 1JU2A 4OPTA 2J3NA 3SM8A 1ZKQA 3T2ZA 1KNRA 2GQWA 2Q0LA 1F8WA 3EAOA 4IV9A 2BYBA 2XFQA 3S61A 1D5TA 1P2EA 2H89A 3NN0X 5L46A 1CF3A 1NG3A 2C67A 1VDCA 1KNPA 3H8LA 3CPHG 2BS3A 1JRXA 3AYLA 4LA1A 2GAHB 5IQ4A 2XLTA 4U2LA 2XFUA 3QFAA 1Y56A 1N1PA 3EF6A 3AB1A 2YM2A 1BWCA 1YKJA 4NEWA 4U8KA 3HYWA 4H4YA 1ONFA 2FBWA 2WOIA 4PAAA 3SX6A 3T2YA 1M6IA 1CC4A 1FOHA 2OLNA 4GAVA 1NAAA 4U2SA 1PBCA 2B9XA 3EPTA 4FDCB 2EQ8A 3BI2A 2YM1A 3K7QX 4K7ZA 2X3NA 1TDNA 4H4PA 5HYMA 1LQTA 3AE2A 2E1MA 5FS9A 4J57A 1B5QA 3ZDNA 4A5LA 2BS4A 4NZHA 3SZ0A 2X8GA 4D04A 1OJ9A 2B76A 3AXBA 5FS8A 4OPUA 3P4SA 4RG3A 2YLXA 2GEWA 4B67A 1TDOA 4RSLA 2BC1A 3T37A 4BV6A 5JCLA 1CHUA 1NPXA 2GQFA 2XVHA 3DMEA 3KPFA 5BVAA 1NG4A 1CJCA 3DGZA 5KXJA 2CVJA 3PS9A 1GRBA 2A89A 2Q0KA 5FS6A 3BNUA 1E7PA 1O95A 3GDNA 4ECHA 4FK1C 2CFYA 3E1TA 4EQXA 4APNA 2YR5A 3AEAA 2BACA 1PBDA 3UKQA 2APGA 1Q1RA 1VG0A 4H4VA 1YQ4A 1DODA 3LJPA 4J34A 4EQSA 1V59A 1DOEA 1SEZA 2XDOA 4OPGA 5KWFA 2YG6A 3CN8A 1FCDA 3BI5A 2BCPA 3P4QA 4B68A 4GCMA 1E39A 4GR1A 1PBEA 4K5RA 3URHA 1RP0A 5GRTA 2XFPA 1GESA 4H4UA 2BC0A 2XLSA 3HYVA 4H4QA 1JRYA 2YLSA 1GRGA 5ER0A 1TDEA 4PABA 4REKA 3WE0A 3ZYXA 1NHQA 1MOKA 3QVPA 1TRBA 4ZCCA 2JAEA 3DH9A 4TLZA 3SY4A 1F8SA 1GXFA 2V61A 5GSNA 3SZWA 3UTEA 4TM3A 3DK4A 2XLPA 3LXDA 5KVIA 2Z5YA 4OPLA 4CY6A 4CCQA 3K7MX 1REOA 3M12A 1BZLA 3Q9TA 3BNMA 4AP3A 1CL0A 4II3A 2JBVA 3ICSA 1PS9A 2XVJA 3LZXA 3CIRA 2YG3A 4G9KA 4HA6A 3HZLA 2XVIA 1F8RA 3H8IA 1D4CA 4NTCA 2WU2A 3DGHA 2GVCA 3C4NA 3NK0X 1FECA 3NRNA 2BK5A 2WOWA 3UKKA 4H7UA 1BKWA 4A79A 4YSYA 1B8SA 1XPQA 1KF6A 3GYXA 4KPRA 4UDQA 3C96A 1DNCA 3FIMB 1DOCA 3P1WA 4BK2A 3KPKA 1K0IA 1IUTA 4J33A 4NNJA 1ZK7A 3DJDA 1GRTA 4B64A 5HY5A 1FEBA 1S3BA 1ZP0A 3KVEA 2WBAA 3LOVA 2C3CA 1QJDA 4UDPA 4EMWA 2WOVA 4J56A 1LVLA 3AEEA 3OC4A 3RP7A 2C3DA 2C66A 4TM0A 5KOWA 3ISHA 4H2QA 3P4PA 3F8DA 2V5ZA 3F8PA 1QLBA 2GRTA 3ADAB 3REDA 4H4TA 1JOAA 3IC9A 4Z43A 1OJCA 2GV8A 1H82A 1Z6LA 3UOYA 3UTFA 3CGEA 3QJ4A 1GREA 1S2QA 2WP5A 3DK8A 1Y56B 2C75A 4XWZA 1D7YA 2ARDA 4B66A 5C2TA 2OAMA 1PJ6A 3IHMA 4K8DA 5BUKA 2XLUA 1XHCA 2XFOA 3NHOX 1CJ3A 4C74A 1ZOVA 2C64A 2QAEA 3G5SA 3PO7A 3RP6A 2GR0A 3CPJG 1YQZA 4H4ZA 3VRBA 2RABA 4DGKA 2OLOA 2YLWA 3GMBA 1VQWA 2E5VA 3M13A 1E6EA 4G6GA 1GPEA 4CCRA 2R45A 1PJ7A 2WQYA 1GOSA 3B3RA 4H4WA 1TDFA 1L9EA 2RGOA 1D4EA 2H88A 3Q6JA 4U8NA 2NVKX 2BS2A 4XXGA 2NPXA 4LU6A 4FK1A 2PHHA 3K7TA 2CULA 3PVCA 4H2RA 3V3NA 1QO8A 3BHFA 1X31B 3CGDA 4A7AA 3NKSA 3M0OA 3T0KA 1FL2A 1BGNA 1DOBA 3ICRA 3NGCX 1PN0A 1CJ2A 3NG7X 1GEUA 1OJAA 4I59A 4NWZA 4DNAA 3AE6A 4WX1A 1NHSA 5KMPA 4YSZA 3L8KA 3AD8B 3IWAA 5JCKA 3T31A 2Q7VA 1FEAA 2Q6UA 1MO9A 1ZOYA 3NT6A 4K2XA 2V6OA 5JCMA 4U8PA 1TYPA 2YLTA 2IVEA 5C3JA 4X4JA 4YTPA 3VRAA 2GF3A 4KX6A 1GTEA 3SQPA 4Y4NA 3D1CA 5FS7A 5JCNA 5U1OA 1F6MA 1H6VA 1D7LA 4YSXA 4CRTA 2QA1A 2YR4A 3AEFA 3CGBA 4LIIA 1GV4A 4TM4A 4U8LA 4XWRA 4OCGA 2A8XA 2WPFA 4J2WA 3UOXA 3CNJA 4C5OA 1S2YA 5CQFA 2B7RA 4AOXA 4A6NA 3NK2X 2BA9A 3UCLA 3B6DA 1NHPA 1ZX9A 2IIDA 4CY8A 2VVLG 1B37A 1GERA 4EM3A 3S5WA 2R4JA 3EANA 4D03A 4K22A 2YVJA 2VRLA 2V60A 3KLJA 4U2TA 4IVMB 4CNJA 1MXTA 3QFBA 1NENA 2QA2A 2ACZA 4G74A 1S3EA 2AAQA 2C73A 1OJTA 2GR3A 1LJ1A 2WPEA 1F3PA 2Y6QA 2C4CA 3BHKA 3NNEA 2YG5A 1B4VA 3UOVA 2C70A 4JY2A 4NTDA 2R46A 4H2PA 2WS3A 1Q1WA 1GRAA 3AE4A 4J31A 4GDPA 4EM4A 3UKPA 4Z24A 5EB5A 4C77A 4CNKA 2DKIA 4X9MA 5EB4A 5LV9A 1GRFA 3ITJA 3ALLA 4IVOB 3COXA 2IVDA 2YQUA 5JCIA 1HYUA 2FJEA 3QSSA 3SZFA 2YG4A 5KVHA 1AOGA 4GRTA 2VQBA 2C65A 5U25A 4H50A 4EIQA 1PBFA 2BRYA 3G5RA 4UDRA 4Z26A 5IPYA 1ELIA 4BJZA 5EBKA 4II2A 3AEGA 4ICYA 1XDIA 1ZY8A 2AR8A 3AYJA 4YKFA 1LV0A 1GTHA 1K4QA 2R0PA 4Y4MA 4EIPA 4U8MA 2RGJA 2WEUA 3KD9A 1IUSA 4J36A 2Z5XA 4OPDA 2ZZBA 3VR8A 3T14A 5M0ZA 4Z25A 3VQRA 1DJQA 3GRSA 3I6DA 3UKAA 2VVLA 3ATRA 3GDPA 2B9YA 4JQ9A 3AEBA 3GD3A 4B1BA 5J60A 3P4RA 1W4XA 3GSIA 1K0JA 1NHRA 2Y6RA 4O5UA 5TR3A 3D8XA 3SZCA 3UOZA 3NYCA 1GT8A 1ZDLA 5BRTA 3RHAA 1JRZA 2VOUA 2C7GA 1YY5A 2RGHA 2FJBA 2GH5A 1IUWA 2JKCA 3AD9B 2JB2A 4MJWA 5HHFA 2UZZA 3P9UA 2JB1A 5BULA 2R0CA 3FMWA 3NN6X 1IUXA 3VRDB 2GMJA 5EOWA 3GWDA 3RP8A 2ZZCA 3SFDA 1E1LA 2WDRA 1RSGA 2CDUA 4YTMA 3VR9A 4GF7A 3ABVA 1E1KA 2F5ZA 2WP9A 2V3AA 4RG4A 3AE3A 3V3OA 4ZN0A 3CMMA 5HXIA 3OZ2A 4Z2RA
chains in the Genus database with same CATH topology
5DBJA 2XVEA 1KSUA 3DA1A 3SFEA 4U8IA 5IQ1A 4H4XA 3V76A 1D4DA 2YVGA 5KMQA 2B7SA 4JY3A 4ZCDA 4YTNA 1EL5A 4Z44A 4H4SA 3II4A 1CBOA 1COYA 4TLXA 1XANA 1LTXR 1PHHA 4I58A 3KA7A 3SYIA 1OJDA 3T2KA 2WDQA 1CC6A 4YKGA 2C76A 2V3BA 1UKVG 3DJGX 4GDEA 3GYJA 2BCGG 2WETA 3FBSA 3AYIA 3CTYA 1PDHA 4HB9A 2VVMA 3QVRA 2WP6A 4A6NB 2R4EA 3DJJA 1NDAA 4JN9A 2BABA 4AP1A 2VRMA 1PXCA 2YLZA 4UP3A 4WCTA 2BK3A 4AOSA 1BF3A 2EQ7A 1L9DA 1Y0PA 4OVIA 4B69A 3GD4A 5KNLA 1O94A 4BJYA 1ZMCA 4M52A 2BXRA 1TYTA 3AEDA 3LZWA 2BRAA 1GRHA 4H2NA 3CGCA 1EBDA 3GYIA 3LADA 1E1NA 1DXLA 2YR6A 1VG9A 2GMHA 3I3LA 3AE5A 1K0LA 1KDGA 4X9NA 2YLRA 4IA5A 2OA1A 3SXIA 1E1MA 1JNZA 4JDRA 1EL7A 1H7WA 2GAGB 2R9ZA 2YG7A 4P9SA 3UTHA 5M10A 4FX9A 3UKLA 4G6HA 2W0HA 4U8JA 4CBQA 4EMJA 2WPCA 3NH3X 2TPRA 3GWFA 1TDKA 1IUUA 2I0ZA 3RNMA 1P2HA 4AT2A 3NYEA 3HYXA 2QCUA 3CNTA 4USQA 1JEHA 4NEVA 3UKHA 1IJHA 3AE1A 1M64A 3UKFA 3AE8A 1BGJA 2FJDA 3L1RA 4A65A 4A99A 4ADWA 4AT0A 4DSGA 2OALA 1ZMDA 4NTEA 4C3YA 4BK1A 1N4VA 3DK9A 3FPZA 3UP5A 4E0VA 4OPCA 4K5SA 3ATQA 4Z2TA 3AE7A 4BK3A 4EQRA 2PYXA 5KOXA 3GRTA 1PXAA 2R0GA 3C4AA 2BK4A 3LB8A 2JB3A 2XLRA 2ZBWA 3ALJA 3CNSA 2ZZ0A 4H4RA 3AECA 3KU9A 4C3XA 4YXDA 1GETA 1N4UA 2FJAA 4YT0A 1H7XA 5KMSA 2YWLA 3O0HA 2GR2A 3ALMA 4OPIA 4EQWA 3H4KA 4DSHA 2AQJA 2BXSA 3CNDA 4O5QA 1KSSA 2WU5A 1NEKA 1CC2A 2XVFA 1GALA 1IUVA 3CPIG 2VQ7A 5CKUA 1O5WA 1N4WA 1YQ3A 3F8RA 3NYFA 4N9XA 4Z2UA 2X8HA 3UP4A 4U8OA 5KMRA 1RYIA 3BI4A 4USRA 3NK1X 1EL8A 2EQ9A 2TMDA 4IA6A 4YWOA 4GAPA 5U63A 2XFNA 1DJNA 2JK6A 2X99A 3GMCA 2VZ2A 3NLCA 3NTDA 1Q9IA 3QSEA 3R9UA 4Y4LA 2XYOA 3AWIA 1L0VA 4A9WA 2HQMA 2WDVA 1H81A 4B63A 1CJ4A 3K30A 1H83A 2X8CA 3UTGA 4B65A 3G5QA 1JNRA 1KFYA 4BURA 2XCGA 1VRQB 1L9CA 2WESA 1PXBA 2YAUA 2E4GA 5KRQA 3SGLA 3KKJA 3AE9A 2GB0A 3FG2P 1PJ5A 1PBBA 4JNAA 1GNDA 1GSNA 3NTAA 3IHGA 2A87A 2B9WA 3CNPA 1LPFA 2DKHA 1EL9A 3AD7B 4G73A 1H86A 4JNQA 4YSHA 3NIXA 2EQ6A 1H84A 1LQUA 4TM1A 3JSKA 2O9ZA 2WHDA 2X50A 2GR1A 5FMHA 3ICTA 3QSMA 3IF9A 3DJEA 4EMIA 2C72A 4GUVA 2YVFA 5J7XA 1JU2A 4OPTA 2J3NA 3SM8A 1ZKQA 3T2ZA 1KNRA 2GQWA 2Q0LA 1F8WA 3EAOA 4IV9A 2BYBA 2XFQA 3S61A 1D5TA 1P2EA 2H89A 3NN0X 5L46A 1CF3A 1NG3A 2C67A 1VDCA 1KNPA 3H8LA 3CPHG 2BS3A 1JRXA 3AYLA 4LA1A 2GAHB 5IQ4A 2XLTA 4U2LA 2XFUA 3QFAA 1Y56A 1N1PA 3EF6A 3AB1A 2YM2A 1BWCA 1YKJA 4NEWA 4U8KA 3HYWA 4H4YA 1ONFA 2FBWA 2WOIA 4PAAA 3SX6A 3T2YA 1M6IA 1CC4A 1FOHA 2OLNA 4GAVA 1NAAA 4U2SA 1PBCA 2B9XA 3EPTA 4FDCB 2EQ8A 3BI2A 2YM1A 3K7QX 4K7ZA 2X3NA 1TDNA 4H4PA 5HYMA 1LQTA 3AE2A 2E1MA 5FS9A 4J57A 1B5QA 3ZDNA 4A5LA 2BS4A 4NZHA 3SZ0A 2X8GA 4D04A 1OJ9A 2B76A 3AXBA 5FS8A 4OPUA 3P4SA 4RG3A 2YLXA 2GEWA 4B67A 1TDOA 4RSLA 2BC1A 3T37A 4BV6A 5JCLA 1CHUA 1NPXA 2GQFA 2XVHA 3DMEA 3KPFA 5BVAA 1NG4A 1CJCA 3DGZA 5KXJA 2CVJA 3PS9A 1GRBA 2A89A 2Q0KA 5FS6A 3BNUA 1E7PA 1O95A 3GDNA 4ECHA 4FK1C 2CFYA 3E1TA 4EQXA 4APNA 2YR5A 3AEAA 2BACA 1PBDA 3UKQA 2APGA 1Q1RA 1VG0A 4H4VA 1YQ4A 1DODA 3LJPA 4J34A 4EQSA 1V59A 1DOEA 1SEZA 2XDOA 4OPGA 5KWFA 2YG6A 3CN8A 1FCDA 3BI5A 2BCPA 3P4QA 4B68A 4GCMA 1E39A 4GR1A 1PBEA 4K5RA 3URHA 1RP0A 5GRTA 2XFPA 1GESA 4H4UA 2BC0A 2XLSA 3HYVA 4H4QA 1JRYA 2YLSA 1GRGA 5ER0A 1TDEA 4PABA 4REKA 3WE0A 3ZYXA 1NHQA 1MOKA 3QVPA 1TRBA 4ZCCA 2JAEA 3DH9A 4TLZA 3SY4A 1F8SA 1GXFA 2V61A 5GSNA 3SZWA 3UTEA 4TM3A 3DK4A 2XLPA 3LXDA 5KVIA 2Z5YA 4OPLA 4CY6A 4CCQA 3K7MX 1REOA 3M12A 1BZLA 3Q9TA 3BNMA 4AP3A 1CL0A 4II3A 2JBVA 3ICSA 1PS9A 2XVJA 3LZXA 3CIRA 2YG3A 4G9KA 4HA6A 3HZLA 2XVIA 1F8RA 3H8IA 1D4CA 4NTCA 2WU2A 3DGHA 2GVCA 3C4NA 3NK0X 1FECA 3NRNA 2BK5A 2WOWA 3UKKA 4H7UA 1BKWA 4A79A 4YSYA 1B8SA 1XPQA 1KF6A 3GYXA 4KPRA 4UDQA 3C96A 1DNCA 3FIMB 1DOCA 3P1WA 4BK2A 3KPKA 1K0IA 1IUTA 4J33A 4NNJA 1ZK7A 3DJDA 1GRTA 4B64A 5HY5A 1FEBA 1S3BA 1ZP0A 3KVEA 2WBAA 3LOVA 2C3CA 1QJDA 4UDPA 4EMWA 2WOVA 4J56A 1LVLA 3AEEA 3OC4A 3RP7A 2C3DA 2C66A 4TM0A 5KOWA 3ISHA 4H2QA 3P4PA 3F8DA 2V5ZA 3F8PA 1QLBA 2GRTA 3ADAB 3REDA 4H4TA 1JOAA 3IC9A 4Z43A 1OJCA 2GV8A 1H82A 1Z6LA 3UOYA 3UTFA 3CGEA 3QJ4A 1GREA 1S2QA 2WP5A 3DK8A 1Y56B 2C75A 4XWZA 1D7YA 2ARDA 4B66A 5C2TA 2OAMA 1PJ6A 3IHMA 4K8DA 5BUKA 2XLUA 1XHCA 2XFOA 3NHOX 1CJ3A 4C74A 1ZOVA 2C64A 2QAEA 3G5SA 3PO7A 3RP6A 2GR0A 3CPJG 1YQZA 4H4ZA 3VRBA 2RABA 4DGKA 2OLOA 2YLWA 3GMBA 1VQWA 2E5VA 3M13A 1E6EA 4G6GA 1GPEA 4CCRA 2R45A 1PJ7A 2WQYA 1GOSA 3B3RA 4H4WA 1TDFA 1L9EA 2RGOA 1D4EA 2H88A 3Q6JA 4U8NA 2NVKX 2BS2A 4XXGA 2NPXA 4LU6A 4FK1A 2PHHA 3K7TA 2CULA 3PVCA 4H2RA 3V3NA 1QO8A 3BHFA 1X31B 3CGDA 4A7AA 3NKSA 3M0OA 3T0KA 1FL2A 1BGNA 1DOBA 3ICRA 3NGCX 1PN0A 1CJ2A 3NG7X 1GEUA 1OJAA 4I59A 4NWZA 4DNAA 3AE6A 4WX1A 1NHSA 5KMPA 4YSZA 3L8KA 3AD8B 3IWAA 5JCKA 3T31A 2Q7VA 1FEAA 2Q6UA 1MO9A 1ZOYA 3NT6A 4K2XA 2V6OA 5JCMA 4U8PA 1TYPA 2YLTA 2IVEA 5C3JA 4X4JA 4YTPA 3VRAA 2GF3A 4KX6A 1GTEA 3SQPA 4Y4NA 3D1CA 5FS7A 5JCNA 5U1OA 1F6MA 1H6VA 1D7LA 4YSXA 4CRTA 2QA1A 2YR4A 3AEFA 3CGBA 4LIIA 1GV4A 4TM4A 4U8LA 4XWRA 4OCGA 2A8XA 2WPFA 4J2WA 3UOXA 3CNJA 4C5OA 1S2YA 5CQFA 2B7RA 4AOXA 4A6NA 3NK2X 2BA9A 3UCLA 3B6DA 1NHPA 1ZX9A 2IIDA 4CY8A 2VVLG 1B37A 1GERA 4EM3A 3S5WA 2R4JA 3EANA 4D03A 4K22A 2YVJA 2VRLA 2V60A 3KLJA 4U2TA 4IVMB 4CNJA 1MXTA 3QFBA 1NENA 2QA2A 2ACZA 4G74A 1S3EA 2AAQA 2C73A 1OJTA 2GR3A 1LJ1A 2WPEA 1F3PA 2Y6QA 2C4CA 3BHKA 3NNEA 2YG5A 1B4VA 3UOVA 2C70A 4JY2A 4NTDA 2R46A 4H2PA 2WS3A 1Q1WA 1GRAA 3AE4A 4J31A 4GDPA 4EM4A 3UKPA 4Z24A 5EB5A 4C77A 4CNKA 2DKIA 4X9MA 5EB4A 5LV9A 1GRFA 3ITJA 3ALLA 4IVOB 3COXA 2IVDA 2YQUA 5JCIA 1HYUA 2FJEA 3QSSA 3SZFA 2YG4A 5KVHA 1AOGA 4GRTA 2VQBA 2C65A 5U25A 4H50A 4EIQA 1PBFA 2BRYA 3G5RA 4UDRA 4Z26A 5IPYA 1ELIA 4BJZA 5EBKA 4II2A 3AEGA 4ICYA 1XDIA 1ZY8A 2AR8A 3AYJA 4YKFA 1LV0A 1GTHA 1K4QA 2R0PA 4Y4MA 4EIPA 4U8MA 2RGJA 2WEUA 3KD9A 1IUSA 4J36A 2Z5XA 4OPDA 2ZZBA 3VR8A 3T14A 5M0ZA 4Z25A 3VQRA 1DJQA 3GRSA 3I6DA 3UKAA 2VVLA 3ATRA 3GDPA 2B9YA 4JQ9A 3AEBA 3GD3A 4B1BA 5J60A 3P4RA 1W4XA 3GSIA 1K0JA 1NHRA 2Y6RA 4O5UA 5TR3A 3D8XA 3SZCA 3UOZA 3NYCA 1GT8A 1ZDLA 5BRTA 3RHAA 1JRZA 2VOUA 2C7GA 1YY5A 2RGHA 2FJBA 2GH5A 1IUWA 2JKCA 3AD9B 2JB2A 4MJWA 5HHFA 2UZZA 3P9UA 2JB1A 5BULA 2R0CA 3FMWA 3NN6X 1IUXA 3VRDB 2GMJA 5EOWA 3GWDA 3RP8A 2ZZCA 3SFDA 1E1LA 2WDRA 1RSGA 2CDUA 4YTMA 3VR9A 4GF7A 3ABVA 1E1KA 2F5ZA 2WP9A 2V3AA 4RG4A 3AE3A 3V3OA 4ZN0A 3CMMA 5HXIA 3OZ2A 4Z2RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DBJ A;  2XVE A;  1KSU A;  3DA1 A;  3SFE A;  4U8I A;  5IQ1 A;  4H4X A;  3V76 A;  1D4D A;  2YVG A;  2B7S A;  4JY3 A;  4ZCD A;  4YTN A;  1EL5 A;  4Z44 A;  4H4S A;  3II4 A;  1CBO A;  1COY A;  4TLX A;  1XAN A;  1LTX R;  1PHH A;  4I58 A;  3KA7 A;  1OJD A;  2WDQ A;  1CC6 A;  4YKG A;  2C76 A;  2V3B A;  1UKV G;  3DJG X;  4GDE A;  3GYJ A;  2BCG G;  2WET A;  3FBS A;  3AYI A;  3CTY A;  1PDH A;  4HB9 A;  2VVM A;  3QVR A;  2WP6 A;  4A6N B;  2R4E A;  3DJJ A;  1NDA A;  4JN9 A;  2BAB A;  4AP1 A;  2VRM A;  1PXC A;  2YLZ A;  4UP3 A;  4WCT A;  2BK3 A;  4AOS A;  1BF3 A;  2EQ7 A;  1L9D A;  1Y0P A;  4OVI A;  4B69 A;  3GD4 A;  1O94 A;  4BJY A;  1ZMC A;  4M52 A;  2BXR A;  1TYT A;  3AED A;  3LZW A;  1GRH A;  4H2N A;  3CGC A;  1EBD A;  3GYI A;  3LAD A;  1E1N A;  1DXL A;  2YR6 A;  1VG9 A;  2GMH A;  3I3L A;  3AE5 A;  1K0L A;  1KDG A;  4X9N A;  2YLR A;  4IA5 A;  2OA1 A;  1E1M A;  1JNZ A;  4JDR A;  1EL7 A;  1H7W A;  2GAG B;  2R9Z A;  2YG7 A;  4P9S A;  3UTH A;  5M10 A;  4FX9 A;  3UKL A;  2W0H A;  4U8J A;  4CBQ A;  4EMJ A;  2WPC A;  3NH3 X;  2TPR A;  3GWF A;  1TDK A;  1IUU A;  2I0Z A;  3RNM A;  1P2H A;  4AT2 A;  3NYE A;  2QCU A;  3CNT A;  4USQ A;  1JEH A;  4NEV A;  3UKH A;  1IJH A;  3AE1 A;  1M64 A;  3UKF A;  3AE8 A;  1BGJ A;  2FJD A;  3L1R A;  4A65 A;  4A99 A;  4ADW A;  4AT0 A;  4DSG A;  2OAL A;  1ZMD A;  4NTE A;  4C3Y A;  4BK1 A;  1N4V A;  3DK9 A;  3FPZ A;  3UP5 A;  4E0V A;  4OPC A;  4K5S A;  3ATQ A;  4Z2T A;  3AE7 A;  4BK3 A;  4EQR A;  2PYX A;  5KOX A;  3GRT A;  1PXA A;  2R0G A;  3C4A A;  2BK4 A;  3LB8 A;  2JB3 A;  2XLR A;  2ZBW A;  3ALJ A;  3CNS A;  2ZZ0 A;  4H4R A;  3AEC A;  3KU9 A;  4C3X A;  4YXD A;  1GET A;  1N4U A;  2FJA A;  4YT0 A;  1H7X A;  2YWL A;  3O0H A;  2GR2 A;  3ALM A;  4OPI A;  4EQW A;  3H4K A;  4DSH A;  2AQJ A;  2BXS A;  3CND A;  4O5Q A;  1KSS A;  2WU5 A;  1NEK A;  1CC2 A;  2XVF A;  1GAL A;  1IUV A;  3CPI G;  2VQ7 A;  5CKU A;  1O5W A;  1N4W A;  1YQ3 A;  3F8R A;  3NYF A;  4N9X A;  4Z2U A;  2X8H A;  3UP4 A;  4U8O A;  1RYI A;  3BI4 A;  4USR A;  3NK1 X;  1EL8 A;  2EQ9 A;  2TMD A;  4IA6 A;  4YWO A;  5U63 A;  2XFN A;  1DJN A;  2JK6 A;  2X99 A;  3GMC A;  2VZ2 A;  3NLC A;  3NTD A;  1Q9I A;  3QSE A;  3R9U A;  4Y4L A;  2XYO A;  3AWI A;  1L0V A;  4A9W A;  2HQM A;  2WDV A;  1H81 A;  4B63 A;  1CJ4 A;  3K30 A;  1H83 A;  2X8C A;  3UTG A;  4B65 A;  3G5Q A;  1JNR A;  1KFY A;  4BUR A;  2XCG A;  1VRQ B;  1L9C A;  2WES A;  1PXB A;  2YAU A;  2E4G A;  5KRQ A;  3SGL A;  3KKJ A;  3AE9 A;  2GB0 A;  3FG2 P;  1PJ5 A;  1PBB A;  4JNA A;  1GND A;  1GSN A;  3NTA A;  3IHG A;  2A87 A;  2B9W A;  3CNP A;  1LPF A;  2DKH A;  1EL9 A;  3AD7 B;  1H86 A;  4JNQ A;  4YSH A;  3NIX A;  2EQ6 A;  1H84 A;  1LQU A;  4TM1 A;  3JSK A;  2O9Z A;  2WHD A;  2X50 A;  2GR1 A;  5FMH A;  3ICT A;  3QSM A;  3IF9 A;  3DJE A;  4EMI A;  2C72 A;  4GUV A;  2YVF A;  5J7X A;  1JU2 A;  4OPT A;  2J3N A;  3SM8 A;  1ZKQ A;  1KNR A;  2GQW A;  2Q0L A;  1F8W A;  3EAO A;  4IV9 A;  2BYB A;  2XFQ A;  3S61 A;  1D5T A;  1P2E A;  2H89 A;  3NN0 X;  5L46 A;  1CF3 A;  1NG3 A;  2C67 A;  1VDC A;  1KNP A;  3H8L A;  3CPH G;  2BS3 A;  1JRX A;  3AYL A;  4LA1 A;  2GAH B;  5IQ4 A;  2XLT A;  4U2L A;  2XFU A;  3QFA A;  1Y56 A;  1N1P A;  3EF6 A;  3AB1 A;  2YM2 A;  1BWC A;  1YKJ A;  4NEW A;  4U8K A;  4H4Y A;  1ONF A;  2FBW A;  2WOI A;  4PAA A;  1M6I A;  1CC4 A;  1FOH A;  2OLN A;  4U2S A;  1NAA A;  1PBC A;  2B9X A;  3EPT A;  4FDC B;  2EQ8 A;  3BI2 A;  2YM1 A;  3K7Q X;  4K7Z A;  2X3N A;  1TDN A;  4H4P A;  5HYM A;  1LQT A;  3AE2 A;  2E1M A;  5FS9 A;  4J57 A;  1B5Q A;  3ZDN A;  4A5L A;  2BS4 A;  4NZH A;  4D04 A;  2X8G A;  1OJ9 A;  2B76 A;  3AXB A;  5FS8 A;  4OPU A;  3P4S A;  4RG3 A;  2YLX A;  2GEW A;  4B67 A;  1TDO A;  4RSL A;  2BC1 A;  3T37 A;  4BV6 A;  5JCL A;  1CHU A;  1NPX A;  2GQF A;  2XVH A;  3DME A;  3KPF A;  5BVA A;  1NG4 A;  1CJC A;  3DGZ A;  5KXJ A;  2CVJ A;  3PS9 A;  1GRB A;  2A89 A;  2Q0K A;  5FS6 A;  3BNU A;  1E7P A;  1O95 A;  3GDN A;  4ECH A;  4FK1 C;  2CFY A;  3E1T A;  4EQX A;  4APN A;  2YR5 A;  3AEA A;  2BAC A;  1PBD A;  3UKQ A;  2APG A;  1Q1R A;  1VG0 A;  4H4V A;  1YQ4 A;  1DOD A;  3LJP A;  4J34 A;  4EQS A;  1V59 A;  1DOE A;  1SEZ A;  2XDO A;  4OPG A;  5KWF A;  2YG6 A;  3CN8 A;  1FCD A;  3BI5 A;  2BCP A;  3P4Q A;  4B68 A;  4GCM A;  1E39 A;  4GR1 A;  1PBE A;  4K5R A;  3URH A;  1RP0 A;  5GRT A;  2XFP A;  1GES A;  4H4U A;  2BC0 A;  2XLS A;  4H4Q A;  1JRY A;  2YLS A;  1GRG A;  5ER0 A;  1TDE A;  4PAB A;  4REK A;  3WE0 A;  3ZYX A;  1NHQ A;  1MOK A;  3QVP A;  1TRB A;  4ZCC A;  2JAE A;  3DH9 A;  4TLZ A;  1F8S A;  1GXF A;  2V61 A;  5GSN A;  3UTE A;  4TM3 A;  3DK4 A;  2XLP A;  3LXD A;  5KVI A;  2Z5Y A;  4OPL A;  4CY6 A;  4CCQ A;  3K7M X;  1REO A;  3M12 A;  1BZL A;  3Q9T A;  3BNM A;  4AP3 A;  1CL0 A;  2JBV A;  3ICS A;  1PS9 A;  2XVJ A;  3LZX A;  3CIR A;  2YG3 A;  4HA6 A;  3HZL A;  2XVI A;  1F8R A;  3H8I A;  1D4C A;  4NTC A;  2WU2 A;  3DGH A;  2GVC A;  3C4N A;  3NK0 X;  1FEC A;  3NRN A;  2BK5 A;  2WOW A;  3UKK A;  4H7U A;  1BKW A;  4A79 A;  4YSY A;  1B8S A;  1XPQ A;  1KF6 A;  4KPR A;  4UDQ A;  3C96 A;  1DNC A;  3FIM B;  1DOC A;  3P1W A;  4BK2 A;  1K0I A;  1IUT A;  4J33 A;  5HY5 A;  1ZK7 A;  3DJD A;  1GRT A;  4B64 A;  1FEB A;  1S3B A;  1ZP0 A;  3KVE A;  2WBA A;  3LOV A;  2C3C A;  1QJD A;  4UDP A;  4EMW A;  2WOV A;  4J56 A;  1LVL A;  3AEE A;  3OC4 A;  3RP7 A;  2C3D A;  2C66 A;  4TM0 A;  5KOW A;  3ISH A;  4H2Q A;  3P4P A;  3F8D A;  2V5Z A;  3F8P A;  1QLB A;  2GRT A;  3ADA B;  3RED A;  4H4T A;  1JOA A;  3IC9 A;  4Z43 A;  1OJC A;  2GV8 A;  1H82 A;  1Z6L A;  3UOY A;  3UTF A;  3CGE A;  3QJ4 A;  1GRE A;  1S2Q A;  2WP5 A;  3DK8 A;  1Y56 B;  2C75 A;  4XWZ A;  1D7Y A;  2ARD A;  4B66 A;  5C2T A;  2OAM A;  1PJ6 A;  3IHM A;  4K8D A;  5BUK A;  2XLU A;  1XHC A;  2XFO A;  3NHO X;  1CJ3 A;  4C74 A;  1ZOV A;  2C64 A;  2QAE A;  3G5S A;  3PO7 A;  3RP6 A;  2GR0 A;  3CPJ G;  1YQZ A;  4H4Z A;  3VRB A;  2RAB A;  4DGK A;  2OLO A;  2YLW A;  3GMB A;  1VQW A;  2E5V A;  3M13 A;  1E6E A;  1GPE A;  4CCR A;  2R45 A;  1PJ7 A;  2WQY A;  1GOS A;  3B3R A;  4H4W A;  1TDF A;  1L9E A;  2RGO A;  1D4E A;  2H88 A;  3Q6J A;  4U8N A;  2NVK X;  2BS2 A;  4XXG A;  2NPX A;  4LU6 A;  4FK1 A;  2PHH A;  3K7T A;  2CUL A;  3PVC A;  4H2R A;  3V3N A;  1QO8 A;  3BHF A;  1X31 B;  3CGD A;  4A7A A;  3NKS A;  3M0O A;  1FL2 A;  1BGN A;  1DOB A;  3ICR A;  3NGC X;  1PN0 A;  1CJ2 A;  3NG7 X;  1GEU A;  1OJA A;  4I59 A;  4DNA A;  3AE6 A;  4WX1 A;  1NHS A;  4YSZ A;  3L8K A;  3AD8 B;  3IWA A;  5JCK A;  2Q7V A;  1FEA A;  2Q6U A;  1MO9 A;  1ZOY A;  3NT6 A;  4K2X A;  2V6O A;  5JCM A;  4U8P A;  1TYP A;  2YLT A;  2IVE A;  5C3J A;  4X4J A;  4YTP A;  3VRA A;  2GF3 A;  4KX6 A;  1GTE A;  3SQP A;  4Y4N A;  3D1C A;  5FS7 A;  5JCN A;  5U1O A;  1F6M A;  1H6V A;  1D7L A;  4YSX A;  4CRT A;  2QA1 A;  2YR4 A;  3AEF A;  3CGB A;  4LII A;  1GV4 A;  4TM4 A;  4U8L A;  4XWR A;  4OCG A;  2A8X A;  2WPF A;  4J2W A;  3UOX A;  3CNJ A;  4C5O A;  1S2Y A;  5CQF A;  2B7R A;  4AOX A;  4A6N A;  3NK2 X;  2BA9 A;  3UCL A;  3B6D A;  1NHP A;  1ZX9 A;  2IID A;  4CY8 A;  2VVL G;  1B37 A;  1GER A;  4EM3 A;  3S5W A;  2R4J A;  3EAN A;  4D03 A;  4K22 A;  2YVJ A;  2VRL A;  2V60 A;  3KLJ A;  4U2T A;  4IVM B;  4CNJ A;  1MXT A;  3QFB A;  1NEN A;  2QA2 A;  2ACZ A;  1S3E A;  2AAQ A;  2C73 A;  1OJT A;  2GR3 A;  1LJ1 A;  2WPE A;  1F3P A;  2Y6Q A;  3BHK A;  3NNE A;  2YG5 A;  1B4V A;  3UOV A;  2C70 A;  4JY2 A;  4NTD A;  2R46 A;  4H2P A;  2WS3 A;  1Q1W A;  1GRA A;  3AE4 A;  4J31 A;  4GDP A;  4EM4 A;  3UKP A;  4Z24 A;  5EB5 A;  4C77 A;  4CNK A;  2DKI A;  4X9M A;  5EB4 A;  5LV9 A;  1GRF A;  3ITJ A;  3ALL A;  4IVO B;  3COX A;  2IVD A;  2YQU A;  5JCI A;  1HYU A;  2FJE A;  3QSS A;  5KVH A;  2YG4 A;  1AOG A;  4GRT A;  2VQB A;  2C65 A;  5U25 A;  4H50 A;  4EIQ A;  1PBF A;  3G5R A;  4UDR A;  4Z26 A;  5IPY A;  1ELI A;  4BJZ A;  5EBK A;  3AEG A;  4ICY A;  1XDI A;  1ZY8 A;  2AR8 A;  3AYJ A;  4YKF A;  1LV0 A;  1GTH A;  1K4Q A;  2R0P A;  4Y4M A;  4EIP A;  4U8M A;  2RGJ A;  2WEU A;  3KD9 A;  1IUS A;  4J36 A;  2Z5X A;  4OPD A;  2ZZB A;  3VR8 A;  5M0Z A;  4Z25 A;  3VQR A;  1DJQ A;  3GRS A;  3I6D A;  3UKA A;  2VVL A;  3ATR A;  3GDP A;  2B9Y A;  4JQ9 A;  3AEB A;  3GD3 A;  4B1B A;  5J60 A;  3P4R A;  1W4X A;  3GSI A;  1K0J A;  1NHR A;  2Y6R A;  4O5U A;  5TR3 A;  3D8X A;  3UOZ A;  3NYC A;  1GT8 A;  1ZDL A;  5BRT A;  3RHA A;  1JRZ A;  2VOU A;  2C7G A;  1YY5 A;  2RGH A;  2FJB A;  2GH5 A;  1IUW A;  2JKC A;  3AD9 B;  2JB2 A;  4MJW A;  5HHF A;  2UZZ A;  3P9U A;  2JB1 A;  5BUL A;  2R0C A;  3FMW A;  3NN6 X;  1IUX A;  3VRD B;  2GMJ A;  5EOW A;  3GWD A;  3RP8 A;  2ZZC A;  3SFD A;  1E1L A;  2WDR A;  1RSG A;  2CDU A;  4YTM A;  3VR9 A;  4GF7 A;  3ABV A;  1E1K A;  2F5Z A;  2WP9 A;  2V3A A;  4RG4 A;  3AE3 A;  3V3O A;  4ZN0 A;  5HXI A;  3OZ2 A;  4Z2R A; 
#chains in the Genus database with same CATH topology
 5DBJ A;  2XVE A;  1KSU A;  3DA1 A;  3SFE A;  4U8I A;  5IQ1 A;  4H4X A;  3V76 A;  1D4D A;  2YVG A;  5KMQ A;  2B7S A;  4JY3 A;  4ZCD A;  4YTN A;  1EL5 A;  4Z44 A;  4H4S A;  3II4 A;  1CBO A;  1COY A;  4TLX A;  1XAN A;  1LTX R;  1PHH A;  4I58 A;  3KA7 A;  3SYI A;  1OJD A;  3T2K A;  2WDQ A;  1CC6 A;  4YKG A;  2C76 A;  2V3B A;  1UKV G;  3DJG X;  4GDE A;  3GYJ A;  2BCG G;  2WET A;  3FBS A;  3AYI A;  3CTY A;  1PDH A;  4HB9 A;  2VVM A;  3QVR A;  2WP6 A;  4A6N B;  2R4E A;  3DJJ A;  1NDA A;  4JN9 A;  2BAB A;  4AP1 A;  2VRM A;  1PXC A;  2YLZ A;  4UP3 A;  4WCT A;  2BK3 A;  4AOS A;  1BF3 A;  2EQ7 A;  1L9D A;  1Y0P A;  4OVI A;  4B69 A;  3GD4 A;  5KNL A;  1O94 A;  4BJY A;  1ZMC A;  4M52 A;  2BXR A;  1TYT A;  3AED A;  3LZW A;  2BRA A;  1GRH A;  4H2N A;  3CGC A;  1EBD A;  3GYI A;  3LAD A;  1E1N A;  1DXL A;  2YR6 A;  1VG9 A;  2GMH A;  3I3L A;  3AE5 A;  1K0L A;  1KDG A;  4X9N A;  2YLR A;  4IA5 A;  2OA1 A;  3SXI A;  1E1M A;  1JNZ A;  4JDR A;  1EL7 A;  1H7W A;  2GAG B;  2R9Z A;  2YG7 A;  4P9S A;  3UTH A;  5M10 A;  4FX9 A;  3UKL A;  4G6H A;  2W0H A;  4U8J A;  4CBQ A;  4EMJ A;  2WPC A;  3NH3 X;  2TPR A;  3GWF A;  1TDK A;  1IUU A;  2I0Z A;  3RNM A;  1P2H A;  4AT2 A;  3NYE A;  3HYX A;  2QCU A;  3CNT A;  4USQ A;  1JEH A;  4NEV A;  3UKH A;  1IJH A;  3AE1 A;  1M64 A;  3UKF A;  3AE8 A;  1BGJ A;  2FJD A;  3L1R A;  4A65 A;  4A99 A;  4ADW A;  4AT0 A;  4DSG A;  2OAL A;  1ZMD A;  4NTE A;  4C3Y A;  4BK1 A;  1N4V A;  3DK9 A;  3FPZ A;  3UP5 A;  4E0V A;  4OPC A;  4K5S A;  3ATQ A;  4Z2T A;  3AE7 A;  4BK3 A;  4EQR A;  2PYX A;  5KOX A;  3GRT A;  1PXA A;  2R0G A;  3C4A A;  2BK4 A;  3LB8 A;  2JB3 A;  2XLR A;  2ZBW A;  3ALJ A;  3CNS A;  2ZZ0 A;  4H4R A;  3AEC A;  3KU9 A;  4C3X A;  4YXD A;  1GET A;  1N4U A;  2FJA A;  4YT0 A;  1H7X A;  5KMS A;  2YWL A;  3O0H A;  2GR2 A;  3ALM A;  4OPI A;  4EQW A;  3H4K A;  4DSH A;  2AQJ A;  2BXS A;  3CND A;  4O5Q A;  1KSS A;  2WU5 A;  1NEK A;  1CC2 A;  2XVF A;  1GAL A;  1IUV A;  3CPI G;  2VQ7 A;  5CKU A;  1O5W A;  1N4W A;  1YQ3 A;  3F8R A;  3NYF A;  4N9X A;  4Z2U A;  2X8H A;  3UP4 A;  4U8O A;  5KMR A;  1RYI A;  3BI4 A;  4USR A;  3NK1 X;  1EL8 A;  2EQ9 A;  2TMD A;  4IA6 A;  4YWO A;  4GAP A;  5U63 A;  2XFN A;  1DJN A;  2JK6 A;  2X99 A;  3GMC A;  2VZ2 A;  3NLC A;  3NTD A;  1Q9I A;  3QSE A;  3R9U A;  4Y4L A;  2XYO A;  3AWI A;  1L0V A;  4A9W A;  2HQM A;  2WDV A;  1H81 A;  4B63 A;  1CJ4 A;  3K30 A;  1H83 A;  2X8C A;  3UTG A;  4B65 A;  3G5Q A;  1JNR A;  1KFY A;  4BUR A;  2XCG A;  1VRQ B;  1L9C A;  2WES A;  1PXB A;  2YAU A;  2E4G A;  5KRQ A;  3SGL A;  3KKJ A;  3AE9 A;  2GB0 A;  3FG2 P;  1PJ5 A;  1PBB A;  4JNA A;  1GND A;  1GSN A;  3NTA A;  3IHG A;  2A87 A;  2B9W A;  3CNP A;  1LPF A;  2DKH A;  1EL9 A;  3AD7 B;  4G73 A;  1H86 A;  4JNQ A;  4YSH A;  3NIX A;  2EQ6 A;  1H84 A;  1LQU A;  4TM1 A;  3JSK A;  2O9Z A;  2WHD A;  2X50 A;  2GR1 A;  5FMH A;  3ICT A;  3QSM A;  3IF9 A;  3DJE A;  4EMI A;  2C72 A;  4GUV A;  2YVF A;  5J7X A;  1JU2 A;  4OPT A;  2J3N A;  3SM8 A;  1ZKQ A;  3T2Z A;  1KNR A;  2GQW A;  2Q0L A;  1F8W A;  3EAO A;  4IV9 A;  2BYB A;  2XFQ A;  3S61 A;  1D5T A;  1P2E A;  2H89 A;  3NN0 X;  5L46 A;  1CF3 A;  1NG3 A;  2C67 A;  1VDC A;  1KNP A;  3H8L A;  3CPH G;  2BS3 A;  1JRX A;  3AYL A;  4LA1 A;  2GAH B;  5IQ4 A;  2XLT A;  4U2L A;  2XFU A;  3QFA A;  1Y56 A;  1N1P A;  3EF6 A;  3AB1 A;  2YM2 A;  1BWC A;  1YKJ A;  4NEW A;  4U8K A;  3HYW A;  4H4Y A;  1ONF A;  2FBW A;  2WOI A;  4PAA A;  3SX6 A;  3T2Y A;  1M6I A;  1CC4 A;  1FOH A;  2OLN A;  4GAV A;  1NAA A;  4U2S A;  1PBC A;  2B9X A;  3EPT A;  4FDC B;  2EQ8 A;  3BI2 A;  2YM1 A;  3K7Q X;  4K7Z A;  2X3N A;  1TDN A;  4H4P A;  5HYM A;  1LQT A;  3AE2 A;  2E1M A;  5FS9 A;  4J57 A;  1B5Q A;  3ZDN A;  4A5L A;  2BS4 A;  4NZH A;  3SZ0 A;  2X8G A;  4D04 A;  1OJ9 A;  2B76 A;  3AXB A;  5FS8 A;  4OPU A;  3P4S A;  4RG3 A;  2YLX A;  2GEW A;  4B67 A;  1TDO A;  4RSL A;  2BC1 A;  3T37 A;  4BV6 A;  5JCL A;  1CHU A;  1NPX A;  2GQF A;  2XVH A;  3DME A;  3KPF A;  5BVA A;  1NG4 A;  1CJC A;  3DGZ A;  5KXJ A;  2CVJ A;  3PS9 A;  1GRB A;  2A89 A;  2Q0K A;  5FS6 A;  3BNU A;  1E7P A;  1O95 A;  3GDN A;  4ECH A;  4FK1 C;  2CFY A;  3E1T A;  4EQX A;  4APN A;  2YR5 A;  3AEA A;  2BAC A;  1PBD A;  3UKQ A;  2APG A;  1Q1R A;  1VG0 A;  4H4V A;  1YQ4 A;  1DOD A;  3LJP A;  4J34 A;  4EQS A;  1V59 A;  1DOE A;  1SEZ A;  2XDO A;  4OPG A;  5KWF A;  2YG6 A;  3CN8 A;  1FCD A;  3BI5 A;  2BCP A;  3P4Q A;  4B68 A;  4GCM A;  1E39 A;  4GR1 A;  1PBE A;  4K5R A;  3URH A;  1RP0 A;  5GRT A;  2XFP A;  1GES A;  4H4U A;  2BC0 A;  2XLS A;  3HYV A;  4H4Q A;  1JRY A;  2YLS A;  1GRG A;  5ER0 A;  1TDE A;  4PAB A;  4REK A;  3WE0 A;  3ZYX A;  1NHQ A;  1MOK A;  3QVP A;  1TRB A;  4ZCC A;  2JAE A;  3DH9 A;  4TLZ A;  3SY4 A;  1F8S A;  1GXF A;  2V61 A;  5GSN A;  3SZW A;  3UTE A;  4TM3 A;  3DK4 A;  2XLP A;  3LXD A;  5KVI A;  2Z5Y A;  4OPL A;  4CY6 A;  4CCQ A;  3K7M X;  1REO A;  3M12 A;  1BZL A;  3Q9T A;  3BNM A;  4AP3 A;  1CL0 A;  4II3 A;  2JBV A;  3ICS A;  1PS9 A;  2XVJ A;  3LZX A;  3CIR A;  2YG3 A;  4G9K A;  4HA6 A;  3HZL A;  2XVI A;  1F8R A;  3H8I A;  1D4C A;  4NTC A;  2WU2 A;  3DGH A;  2GVC A;  3C4N A;  3NK0 X;  1FEC A;  3NRN A;  2BK5 A;  2WOW A;  3UKK A;  4H7U A;  1BKW A;  4A79 A;  4YSY A;  1B8S A;  1XPQ A;  1KF6 A;  3GYX A;  4KPR A;  4UDQ A;  3C96 A;  1DNC A;  3FIM B;  1DOC A;  3P1W A;  4BK2 A;  3KPK A;  1K0I A;  1IUT A;  4J33 A;  4NNJ A;  1ZK7 A;  3DJD A;  1GRT A;  4B64 A;  5HY5 A;  1FEB A;  1S3B A;  1ZP0 A;  3KVE A;  2WBA A;  3LOV A;  2C3C A;  1QJD A;  4UDP A;  4EMW A;  2WOV A;  4J56 A;  1LVL A;  3AEE A;  3OC4 A;  3RP7 A;  2C3D A;  2C66 A;  4TM0 A;  5KOW A;  3ISH A;  4H2Q A;  3P4P A;  3F8D A;  2V5Z A;  3F8P A;  1QLB A;  2GRT A;  3ADA B;  3RED A;  4H4T A;  1JOA A;  3IC9 A;  4Z43 A;  1OJC A;  2GV8 A;  1H82 A;  1Z6L A;  3UOY A;  3UTF A;  3CGE A;  3QJ4 A;  1GRE A;  1S2Q A;  2WP5 A;  3DK8 A;  1Y56 B;  2C75 A;  4XWZ A;  1D7Y A;  2ARD A;  4B66 A;  5C2T A;  2OAM A;  1PJ6 A;  3IHM A;  4K8D A;  5BUK A;  2XLU A;  1XHC A;  2XFO A;  3NHO X;  1CJ3 A;  4C74 A;  1ZOV A;  2C64 A;  2QAE A;  3G5S A;  3PO7 A;  3RP6 A;  2GR0 A;  3CPJ G;  1YQZ A;  4H4Z A;  3VRB A;  2RAB A;  4DGK A;  2OLO A;  2YLW A;  3GMB A;  1VQW A;  2E5V A;  3M13 A;  1E6E A;  4G6G A;  1GPE A;  4CCR A;  2R45 A;  1PJ7 A;  2WQY A;  1GOS A;  3B3R A;  4H4W A;  1TDF A;  1L9E A;  2RGO A;  1D4E A;  2H88 A;  3Q6J A;  4U8N A;  2NVK X;  2BS2 A;  4XXG A;  2NPX A;  4LU6 A;  4FK1 A;  2PHH A;  3K7T A;  2CUL A;  3PVC A;  4H2R A;  3V3N A;  1QO8 A;  3BHF A;  1X31 B;  3CGD A;  4A7A A;  3NKS A;  3M0O A;  3T0K A;  1FL2 A;  1BGN A;  1DOB A;  3ICR A;  3NGC X;  1PN0 A;  1CJ2 A;  3NG7 X;  1GEU A;  1OJA A;  4I59 A;  4NWZ A;  4DNA A;  3AE6 A;  4WX1 A;  1NHS A;  5KMP A;  4YSZ A;  3L8K A;  3AD8 B;  3IWA A;  5JCK A;  3T31 A;  2Q7V A;  1FEA A;  2Q6U A;  1MO9 A;  1ZOY A;  3NT6 A;  4K2X A;  2V6O A;  5JCM A;  4U8P A;  1TYP A;  2YLT A;  2IVE A;  5C3J A;  4X4J A;  4YTP A;  3VRA A;  2GF3 A;  4KX6 A;  1GTE A;  3SQP A;  4Y4N A;  3D1C A;  5FS7 A;  5JCN A;  5U1O A;  1F6M A;  1H6V A;  1D7L A;  4YSX A;  4CRT A;  2QA1 A;  2YR4 A;  3AEF A;  3CGB A;  4LII A;  1GV4 A;  4TM4 A;  4U8L A;  4XWR A;  4OCG A;  2A8X A;  2WPF A;  4J2W A;  3UOX A;  3CNJ A;  4C5O A;  1S2Y A;  5CQF A;  2B7R A;  4AOX A;  4A6N A;  3NK2 X;  2BA9 A;  3UCL A;  3B6D A;  1NHP A;  1ZX9 A;  2IID A;  4CY8 A;  2VVL G;  1B37 A;  1GER A;  4EM3 A;  3S5W A;  2R4J A;  3EAN A;  4D03 A;  4K22 A;  2YVJ A;  2VRL A;  2V60 A;  3KLJ A;  4U2T A;  4IVM B;  4CNJ A;  1MXT A;  3QFB A;  1NEN A;  2QA2 A;  2ACZ A;  4G74 A;  1S3E A;  2AAQ A;  2C73 A;  1OJT A;  2GR3 A;  1LJ1 A;  2WPE A;  1F3P A;  2Y6Q A;  2C4C A;  3BHK A;  3NNE A;  2YG5 A;  1B4V A;  3UOV A;  2C70 A;  4JY2 A;  4NTD A;  2R46 A;  4H2P A;  2WS3 A;  1Q1W A;  1GRA A;  3AE4 A;  4J31 A;  4GDP A;  4EM4 A;  3UKP A;  4Z24 A;  5EB5 A;  4C77 A;  4CNK A;  2DKI A;  4X9M A;  5EB4 A;  5LV9 A;  1GRF A;  3ITJ A;  3ALL A;  4IVO B;  3COX A;  2IVD A;  2YQU A;  5JCI A;  1HYU A;  2FJE A;  3QSS A;  3SZF A;  2YG4 A;  5KVH A;  1AOG A;  4GRT A;  2VQB A;  2C65 A;  5U25 A;  4H50 A;  4EIQ A;  1PBF A;  2BRY A;  3G5R A;  4UDR A;  4Z26 A;  5IPY A;  1ELI A;  4BJZ A;  5EBK A;  4II2 A;  3AEG A;  4ICY A;  1XDI A;  1ZY8 A;  2AR8 A;  3AYJ A;  4YKF A;  1LV0 A;  1GTH A;  1K4Q A;  2R0P A;  4Y4M A;  4EIP A;  4U8M A;  2RGJ A;  2WEU A;  3KD9 A;  1IUS A;  4J36 A;  2Z5X A;  4OPD A;  2ZZB A;  3VR8 A;  3T14 A;  5M0Z A;  4Z25 A;  3VQR A;  1DJQ A;  3GRS A;  3I6D A;  3UKA A;  2VVL A;  3ATR A;  3GDP A;  2B9Y A;  4JQ9 A;  3AEB A;  3GD3 A;  4B1B A;  5J60 A;  3P4R A;  1W4X A;  3GSI A;  1K0J A;  1NHR A;  2Y6R A;  4O5U A;  5TR3 A;  3D8X A;  3SZC A;  3UOZ A;  3NYC A;  1GT8 A;  1ZDL A;  5BRT A;  3RHA A;  1JRZ A;  2VOU A;  2C7G A;  1YY5 A;  2RGH A;  2FJB A;  2GH5 A;  1IUW A;  2JKC A;  3AD9 B;  2JB2 A;  4MJW A;  5HHF A;  2UZZ A;  3P9U A;  2JB1 A;  5BUL A;  2R0C A;  3FMW A;  3NN6 X;  1IUX A;  3VRD B;  2GMJ A;  5EOW A;  3GWD A;  3RP8 A;  2ZZC A;  3SFD A;  1E1L A;  2WDR A;  1RSG A;  2CDU A;  4YTM A;  3VR9 A;  4GF7 A;  3ABV A;  1E1K A;  2F5Z A;  2WP9 A;  2V3A A;  4RG4 A;  3AE3 A;  3V3O A;  4ZN0 A;  3CMM A;  5HXI A;  3OZ2 A;  4Z2R A; 
#chains in the Genus database with same CATH homology
 5DBJ A;  2XVE A;  1KSU A;  3DA1 A;  3SFE A;  4U8I A;  5IQ1 A;  4H4X A;  3V76 A;  1D4D A;  2YVG A;  5KMQ A;  2B7S A;  4JY3 A;  4ZCD A;  4YTN A;  1EL5 A;  4Z44 A;  4H4S A;  3II4 A;  1CBO A;  1COY A;  4TLX A;  1XAN A;  1LTX R;  1PHH A;  4I58 A;  3KA7 A;  3SYI A;  1OJD A;  3T2K A;  2WDQ A;  1CC6 A;  4YKG A;  2C76 A;  2V3B A;  1UKV G;  3DJG X;  4GDE A;  3GYJ A;  2BCG G;  2WET A;  3FBS A;  3AYI A;  3CTY A;  1PDH A;  4HB9 A;  2VVM A;  3QVR A;  2WP6 A;  4A6N B;  2R4E A;  3DJJ A;  1NDA A;  4JN9 A;  2BAB A;  4AP1 A;  2VRM A;  1PXC A;  2YLZ A;  4UP3 A;  4WCT A;  2BK3 A;  4AOS A;  1BF3 A;  2EQ7 A;  1L9D A;  1Y0P A;  4OVI A;  4B69 A;  3GD4 A;  5KNL A;  1O94 A;  4BJY A;  1ZMC A;  4M52 A;  2BXR A;  1TYT A;  3AED A;  3LZW A;  2BRA A;  1GRH A;  4H2N A;  3CGC A;  1EBD A;  3GYI A;  3LAD A;  1E1N A;  1DXL A;  2YR6 A;  1VG9 A;  2GMH A;  3I3L A;  3AE5 A;  1K0L A;  1KDG A;  4X9N A;  2YLR A;  4IA5 A;  2OA1 A;  3SXI A;  1E1M A;  1JNZ A;  4JDR A;  1EL7 A;  1H7W A;  2GAG B;  2R9Z A;  2YG7 A;  4P9S A;  3UTH A;  5M10 A;  4FX9 A;  3UKL A;  4G6H A;  2W0H A;  4U8J A;  4CBQ A;  4EMJ A;  2WPC A;  3NH3 X;  2TPR A;  3GWF A;  1TDK A;  1IUU A;  2I0Z A;  3RNM A;  1P2H A;  4AT2 A;  3NYE A;  3HYX A;  2QCU A;  3CNT A;  4USQ A;  1JEH A;  4NEV A;  3UKH A;  1IJH A;  3AE1 A;  1M64 A;  3UKF A;  3AE8 A;  1BGJ A;  2FJD A;  3L1R A;  4A65 A;  4A99 A;  4ADW A;  4AT0 A;  4DSG A;  2OAL A;  1ZMD A;  4NTE A;  4C3Y A;  4BK1 A;  1N4V A;  3DK9 A;  3FPZ A;  3UP5 A;  4E0V A;  4OPC A;  4K5S A;  3ATQ A;  4Z2T A;  3AE7 A;  4BK3 A;  4EQR A;  2PYX A;  5KOX A;  3GRT A;  1PXA A;  2R0G A;  3C4A A;  2BK4 A;  3LB8 A;  2JB3 A;  2XLR A;  2ZBW A;  3ALJ A;  3CNS A;  2ZZ0 A;  4H4R A;  3AEC A;  3KU9 A;  4C3X A;  4YXD A;  1GET A;  1N4U A;  2FJA A;  4YT0 A;  1H7X A;  5KMS A;  2YWL A;  3O0H A;  2GR2 A;  3ALM A;  4OPI A;  4EQW A;  3H4K A;  4DSH A;  2AQJ A;  2BXS A;  3CND A;  4O5Q A;  1KSS A;  2WU5 A;  1NEK A;  1CC2 A;  2XVF A;  1GAL A;  1IUV A;  3CPI G;  2VQ7 A;  5CKU A;  1O5W A;  1N4W A;  1YQ3 A;  3F8R A;  3NYF A;  4N9X A;  4Z2U A;  2X8H A;  3UP4 A;  4U8O A;  5KMR A;  1RYI A;  3BI4 A;  4USR A;  3NK1 X;  1EL8 A;  2EQ9 A;  2TMD A;  4IA6 A;  4YWO A;  4GAP A;  5U63 A;  2XFN A;  1DJN A;  2JK6 A;  2X99 A;  3GMC A;  2VZ2 A;  3NLC A;  3NTD A;  1Q9I A;  3QSE A;  3R9U A;  4Y4L A;  2XYO A;  3AWI A;  1L0V A;  4A9W A;  2HQM A;  2WDV A;  1H81 A;  4B63 A;  1CJ4 A;  3K30 A;  1H83 A;  2X8C A;  3UTG A;  4B65 A;  3G5Q A;  1JNR A;  1KFY A;  4BUR A;  2XCG A;  1VRQ B;  1L9C A;  2WES A;  1PXB A;  2YAU A;  2E4G A;  5KRQ A;  3SGL A;  3KKJ A;  3AE9 A;  2GB0 A;  3FG2 P;  1PJ5 A;  1PBB A;  4JNA A;  1GND A;  1GSN A;  3NTA A;  3IHG A;  2A87 A;  2B9W A;  3CNP A;  1LPF A;  2DKH A;  1EL9 A;  3AD7 B;  4G73 A;  1H86 A;  4JNQ A;  4YSH A;  3NIX A;  2EQ6 A;  1H84 A;  1LQU A;  4TM1 A;  3JSK A;  2O9Z A;  2WHD A;  2X50 A;  2GR1 A;  5FMH A;  3ICT A;  3QSM A;  3IF9 A;  3DJE A;  4EMI A;  2C72 A;  4GUV A;  2YVF A;  5J7X A;  1JU2 A;  4OPT A;  2J3N A;  3SM8 A;  1ZKQ A;  3T2Z A;  1KNR A;  2GQW A;  2Q0L A;  1F8W A;  3EAO A;  4IV9 A;  2BYB A;  2XFQ A;  3S61 A;  1D5T A;  1P2E A;  2H89 A;  3NN0 X;  5L46 A;  1CF3 A;  1NG3 A;  2C67 A;  1VDC A;  1KNP A;  3H8L A;  3CPH G;  2BS3 A;  1JRX A;  3AYL A;  4LA1 A;  2GAH B;  5IQ4 A;  2XLT A;  4U2L A;  2XFU A;  3QFA A;  1Y56 A;  1N1P A;  3EF6 A;  3AB1 A;  2YM2 A;  1BWC A;  1YKJ A;  4NEW A;  4U8K A;  3HYW A;  4H4Y A;  1ONF A;  2FBW A;  2WOI A;  4PAA A;  3SX6 A;  3T2Y A;  1M6I A;  1CC4 A;  1FOH A;  2OLN A;  4GAV A;  1NAA A;  4U2S A;  1PBC A;  2B9X A;  3EPT A;  4FDC B;  2EQ8 A;  3BI2 A;  2YM1 A;  3K7Q X;  4K7Z A;  2X3N A;  1TDN A;  4H4P A;  5HYM A;  1LQT A;  3AE2 A;  2E1M A;  5FS9 A;  4J57 A;  1B5Q A;  3ZDN A;  4A5L A;  2BS4 A;  4NZH A;  3SZ0 A;  2X8G A;  4D04 A;  1OJ9 A;  2B76 A;  3AXB A;  5FS8 A;  4OPU A;  3P4S A;  4RG3 A;  2YLX A;  2GEW A;  4B67 A;  1TDO A;  4RSL A;  2BC1 A;  3T37 A;  4BV6 A;  5JCL A;  1CHU A;  1NPX A;  2GQF A;  2XVH A;  3DME A;  3KPF A;  5BVA A;  1NG4 A;  1CJC A;  3DGZ A;  5KXJ A;  2CVJ A;  3PS9 A;  1GRB A;  2A89 A;  2Q0K A;  5FS6 A;  3BNU A;  1E7P A;  1O95 A;  3GDN A;  4ECH A;  4FK1 C;  2CFY A;  3E1T A;  4EQX A;  4APN A;  2YR5 A;  3AEA A;  2BAC A;  1PBD A;  3UKQ A;  2APG A;  1Q1R A;  1VG0 A;  4H4V A;  1YQ4 A;  1DOD A;  3LJP A;  4J34 A;  4EQS A;  1V59 A;  1DOE A;  1SEZ A;  2XDO A;  4OPG A;  5KWF A;  2YG6 A;  3CN8 A;  1FCD A;  3BI5 A;  2BCP A;  3P4Q A;  4B68 A;  4GCM A;  1E39 A;  4GR1 A;  1PBE A;  4K5R A;  3URH A;  1RP0 A;  5GRT A;  2XFP A;  1GES A;  4H4U A;  2BC0 A;  2XLS A;  3HYV A;  4H4Q A;  1JRY A;  2YLS A;  1GRG A;  5ER0 A;  1TDE A;  4PAB A;  4REK A;  3WE0 A;  3ZYX A;  1NHQ A;  1MOK A;  3QVP A;  1TRB A;  4ZCC A;  2JAE A;  3DH9 A;  4TLZ A;  3SY4 A;  1F8S A;  1GXF A;  2V61 A;  5GSN A;  3SZW A;  3UTE A;  4TM3 A;  3DK4 A;  2XLP A;  3LXD A;  5KVI A;  2Z5Y A;  4OPL A;  4CY6 A;  4CCQ A;  3K7M X;  1REO A;  3M12 A;  1BZL A;  3Q9T A;  3BNM A;  4AP3 A;  1CL0 A;  4II3 A;  2JBV A;  3ICS A;  1PS9 A;  2XVJ A;  3LZX A;  3CIR A;  2YG3 A;  4G9K A;  4HA6 A;  3HZL A;  2XVI A;  1F8R A;  3H8I A;  1D4C A;  4NTC A;  2WU2 A;  3DGH A;  2GVC A;  3C4N A;  3NK0 X;  1FEC A;  3NRN A;  2BK5 A;  2WOW A;  3UKK A;  4H7U A;  1BKW A;  4A79 A;  4YSY A;  1B8S A;  1XPQ A;  1KF6 A;  3GYX A;  4KPR A;  4UDQ A;  3C96 A;  1DNC A;  3FIM B;  1DOC A;  3P1W A;  4BK2 A;  3KPK A;  1K0I A;  1IUT A;  4J33 A;  4NNJ A;  1ZK7 A;  3DJD A;  1GRT A;  4B64 A;  5HY5 A;  1FEB A;  1S3B A;  1ZP0 A;  3KVE A;  2WBA A;  3LOV A;  2C3C A;  1QJD A;  4UDP A;  4EMW A;  2WOV A;  4J56 A;  1LVL A;  3AEE A;  3OC4 A;  3RP7 A;  2C3D A;  2C66 A;  4TM0 A;  5KOW A;  3ISH A;  4H2Q A;  3P4P A;  3F8D A;  2V5Z A;  3F8P A;  1QLB A;  2GRT A;  3ADA B;  3RED A;  4H4T A;  1JOA A;  3IC9 A;  4Z43 A;  1OJC A;  2GV8 A;  1H82 A;  1Z6L A;  3UOY A;  3UTF A;  3CGE A;  3QJ4 A;  1GRE A;  1S2Q A;  2WP5 A;  3DK8 A;  1Y56 B;  2C75 A;  4XWZ A;  1D7Y A;  2ARD A;  4B66 A;  5C2T A;  2OAM A;  1PJ6 A;  3IHM A;  4K8D A;  5BUK A;  2XLU A;  1XHC A;  2XFO A;  3NHO X;  1CJ3 A;  4C74 A;  1ZOV A;  2C64 A;  2QAE A;  3G5S A;  3PO7 A;  3RP6 A;  2GR0 A;  3CPJ G;  1YQZ A;  4H4Z A;  3VRB A;  2RAB A;  4DGK A;  2OLO A;  2YLW A;  3GMB A;  1VQW A;  2E5V A;  3M13 A;  1E6E A;  4G6G A;  1GPE A;  4CCR A;  2R45 A;  1PJ7 A;  2WQY A;  1GOS A;  3B3R A;  4H4W A;  1TDF A;  1L9E A;  2RGO A;  1D4E A;  2H88 A;  3Q6J A;  4U8N A;  2NVK X;  2BS2 A;  4XXG A;  2NPX A;  4LU6 A;  4FK1 A;  2PHH A;  3K7T A;  2CUL A;  3PVC A;  4H2R A;  3V3N A;  1QO8 A;  3BHF A;  1X31 B;  3CGD A;  4A7A A;  3NKS A;  3M0O A;  3T0K A;  1FL2 A;  1BGN A;  1DOB A;  3ICR A;  3NGC X;  1PN0 A;  1CJ2 A;  3NG7 X;  1GEU A;  1OJA A;  4I59 A;  4NWZ A;  4DNA A;  3AE6 A;  4WX1 A;  1NHS A;  5KMP A;  4YSZ A;  3L8K A;  3AD8 B;  3IWA A;  5JCK A;  3T31 A;  2Q7V A;  1FEA A;  2Q6U A;  1MO9 A;  1ZOY A;  3NT6 A;  4K2X A;  2V6O A;  5JCM A;  4U8P A;  1TYP A;  2YLT A;  2IVE A;  5C3J A;  4X4J A;  4YTP A;  3VRA A;  2GF3 A;  4KX6 A;  1GTE A;  3SQP A;  4Y4N A;  3D1C A;  5FS7 A;  5JCN A;  5U1O A;  1F6M A;  1H6V A;  1D7L A;  4YSX A;  4CRT A;  2QA1 A;  2YR4 A;  3AEF A;  3CGB A;  4LII A;  1GV4 A;  4TM4 A;  4U8L A;  4XWR A;  4OCG A;  2A8X A;  2WPF A;  4J2W A;  3UOX A;  3CNJ A;  4C5O A;  1S2Y A;  5CQF A;  2B7R A;  4AOX A;  4A6N A;  3NK2 X;  2BA9 A;  3UCL A;  3B6D A;  1NHP A;  1ZX9 A;  2IID A;  4CY8 A;  2VVL G;  1B37 A;  1GER A;  4EM3 A;  3S5W A;  2R4J A;  3EAN A;  4D03 A;  4K22 A;  2YVJ A;  2VRL A;  2V60 A;  3KLJ A;  4U2T A;  4IVM B;  4CNJ A;  1MXT A;  3QFB A;  1NEN A;  2QA2 A;  2ACZ A;  4G74 A;  1S3E A;  2AAQ A;  2C73 A;  1OJT A;  2GR3 A;  1LJ1 A;  2WPE A;  1F3P A;  2Y6Q A;  2C4C A;  3BHK A;  3NNE A;  2YG5 A;  1B4V A;  3UOV A;  2C70 A;  4JY2 A;  4NTD A;  2R46 A;  4H2P A;  2WS3 A;  1Q1W A;  1GRA A;  3AE4 A;  4J31 A;  4GDP A;  4EM4 A;  3UKP A;  4Z24 A;  5EB5 A;  4C77 A;  4CNK A;  2DKI A;  4X9M A;  5EB4 A;  5LV9 A;  1GRF A;  3ITJ A;  3ALL A;  4IVO B;  3COX A;  2IVD A;  2YQU A;  5JCI A;  1HYU A;  2FJE A;  3QSS A;  3SZF A;  2YG4 A;  5KVH A;  1AOG A;  4GRT A;  2VQB A;  2C65 A;  5U25 A;  4H50 A;  4EIQ A;  1PBF A;  2BRY A;  3G5R A;  4UDR A;  4Z26 A;  5IPY A;  1ELI A;  4BJZ A;  5EBK A;  4II2 A;  3AEG A;  4ICY A;  1XDI A;  1ZY8 A;  2AR8 A;  3AYJ A;  4YKF A;  1LV0 A;  1GTH A;  1K4Q A;  2R0P A;  4Y4M A;  4EIP A;  4U8M A;  2RGJ A;  2WEU A;  3KD9 A;  1IUS A;  4J36 A;  2Z5X A;  4OPD A;  2ZZB A;  3VR8 A;  3T14 A;  5M0Z A;  4Z25 A;  3VQR A;  1DJQ A;  3GRS A;  3I6D A;  3UKA A;  2VVL A;  3ATR A;  3GDP A;  2B9Y A;  4JQ9 A;  3AEB A;  3GD3 A;  4B1B A;  5J60 A;  3P4R A;  1W4X A;  3GSI A;  1K0J A;  1NHR A;  2Y6R A;  4O5U A;  5TR3 A;  3D8X A;  3SZC A;  3UOZ A;  3NYC A;  1GT8 A;  1ZDL A;  5BRT A;  3RHA A;  1JRZ A;  2VOU A;  2C7G A;  1YY5 A;  2RGH A;  2FJB A;  2GH5 A;  1IUW A;  2JKC A;  3AD9 B;  2JB2 A;  4MJW A;  5HHF A;  2UZZ A;  3P9U A;  2JB1 A;  5BUL A;  2R0C A;  3FMW A;  3NN6 X;  1IUX A;  3VRD B;  2GMJ A;  5EOW A;  3GWD A;  3RP8 A;  2ZZC A;  3SFD A;  1E1L A;  2WDR A;  1RSG A;  2CDU A;  4YTM A;  3VR9 A;  4GF7 A;  3ABV A;  1E1K A;  2F5Z A;  2WP9 A;  2V3A A;  4RG4 A;  3AE3 A;  3V3O A;  4ZN0 A;  3CMM A;  5HXI A;  3OZ2 A;  4Z2R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...