2VQ7A

Bacterial flavin-containing monooxygenase in complex with nadp: native data
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
443
structure length
443
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
molecule tags Oxidoreductase
total genus 159
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vq7A02
5IQ4A 2IIDA 2C3DA 1GOSA 4TM3A 2BC1A 4H4WA 5BUKA 3C96A 4EMWA 2QA1A 2QA2A 4KPRA 1GRTA 2Y6QA 4OPUA 2WESA 2V60A 4A7AA 3AECA 3VR9A 3EANA 4H2QA 2X8GA 1D7YA 1DOBA 5EB4A 1PDHA 1H86A 2ACZA 4U2SA 1VG9A 2FJDA 4WX1A 1KNPA 1OJDA 1CC6A 3AE2A 5L46A 2GH5A 1ZP0A 1MO9A 4EQSA 1PBDA 4Z24A 3WE0A 2RGJA 1E7PA 3NTDA 1K0IA 4NEVA 1ZMCA 4H4YA 2VRLA 4NTCA 4AT0A 2EQ9A 2XVFA 3EAOA 4EMJA 1Z6LA 1RP0A 5JCMA 3QVRA 1GT8A 1QLBA 3QFBA 3V3NA 2V3AA 2YVFA 3COXA 1GESA 4H2PA 4TM0A 4IA5A 3KKJA 3UOXA 1D4CA 2ZZBA 3UP4A 3AE3A 3VRBA 4RSLA 5C2TA 1NHQA 2WPEA 1N4VA 2QAEA 3I3LA 4A6NA 2YWLA 4LU6A 2C75A 1CHUA 3AWIA 4A99A 1ZY8A 3DJDA 1XPQA 1CJ4A 5FMHA 3RNMA 5KWFA 1D5TA 2JB1A 3CGDA 2YR6A 3CGCA 5GRTA 1AOGA 4K5RA 4JY3A 1Y56A 4U8NA 4BK2A 3GSIA 3IF9A 3RP6A 4X9MA 1QJDA 1L9DA 4JDRA 2TMDA 4B63A 4AP1A 2BC0A 1GRFA 3AEFA 2A8XA 3NN0X 1OJTA 1IUTA 4CNKA 2XFOA 3B3RA 1L9EA 3DA1A 1S2YA 5BRTA 3E1TA 2VZ2A 1PBCA 4U8OA 3URHA 1ZKQA 2OLNA 1CC4A 1UKVG 5C3JA 4KX6A 4B69A 4BV6A 5HHFA 4GDPA 2C65A 4UDQA 3CN8A 5BULA 5BVAA 1F8SA 2C3CA 4APNA 3NNEA 3VRAA 1PBEA 1DOEA 2VQ7A 4EQRA 4U8IA 4A5LA 5KOXA 4TLZA 3UKQA 5FS7A 2V3BA 2XYOA 4NZHA 1PXBA 1NAAA 3NGCX 5KVIA 4BJZA 3RP7A 5FS6A 2GRTA 4CNJA 3NRNA 1H6VA 4TLXA 2X8HA 4YSZA 2WP6A 3LXDA 4ZN0A 1Y0PA 3ICTA 1DJNA 4WCTA 4CRTA 5HXIA 4B68A 3PO7A 2XLUA 2GR1A 3L8KA 1RSGA 3Q9TA 2R4JA 1Q1WA 3FBSA 4REKA 2AAQA 4JNQA 2Z5YA 2YLRA 2YG6A 3AE7A 4C74A 2Y6RA 1O95A 1H83A 5U25A 3UKFA 4H7UA 3V3OA 4O5QA 1GERA 1Q1RA 3C4NA 5IPYA 1CJCA 1F3PA 3Q6JA 1KFYA 3CIRA 3DGHA 4H4UA 4E0VA 2AQJA 2B76A 2GMHA 4GRTA 3AE5A 3VQRA 5JCNA 2RABA 3F8DA 1P2EA 4C3XA 5JCIA 3PVCA 1GRHA 1B5QA 1N4WA 4Z26A 3GYIA 1B8SA 2XCGA 2F5ZA 2XLPA 3LZXA 2XFUA 4YWOA 1TDKA 1YY5A 2BABA 1H81A 1NENA 2XLSA 1VQWA 3NT6A 3P4QA 4H4TA 4NTEA 2YM1A 2C64A 2YVGA 3GYJA 3CNTA 2PYXA 4FDCB 2VVMA 4IV9A 5HYMA 3S61A 3C4AA 2W0HA 5EOWA 3LZWA 4C77A 1GRAA 2EQ6A 3CGBA 3DGZA 4XWRA 4D04A 1ONFA 2BS3A 4YSHA 2YLTA 3VRDB 2BS2A 5TR3A 3KVEA 2C66A 4ZCDA 2WBAA 5JCLA 2JKCA 1LQUA 1NHPA 3S5WA 1E1NA 1EL9A 1REOA 2XVJA 4Y4MA 4H2NA 3EPTA 4YTPA 2JB3A 2GQFA 3P1WA 2YM2A 4C5OA 2GF3A 2VVLA 5U1OA 3DJEA 3M0OA 1NHRA 3P4SA 1D7LA 3K7MX 4C3YA 3UCLA 4XWZA 2BK4A 2UZZA 1DOCA 1GEUA 4GCMA 1YQ3A 2X3NA 1TDEA 1EL7A 1CBOA 2X8CA 3CPJG 1NEKA 4TM1A 4H4VA 1CF3A 4K8DA 2FJBA 3AE1A 4DNAA 1E1MA 2EQ8A 2FJEA 4Y4NA 1PJ7A 4GF7A 3GDPA 4YSYA 3AEAA 3LADA 3NKSA 1JNZA 1F8RA 1JRYA 4O5UA 5IQ1A 2R9ZA 3HZLA 2OA1A 3K7QX 1GV4A 1H7XA 1JU2A 4YT0A 2B7SA 1H7WA 3AEGA 4Y4LA 3SQPA 1CC2A 4JN9A 4AT2A 1FL2A 3UKAA 1TRBA 2WOIA 4NTDA 4B1BA 3K7TA 2C70A 1ZOVA 1F8WA 1KSSA 1K0JA 2GV8A 3DMEA 2VVLG 3KLJA 4JY2A 2CFYA 5FS9A 3R9UA 3GMBA 2WP9A 1BGNA 3BNMA 3CPHG 4DGKA 1TYTA 1XANA 2WPFA 3SFEA 2WHDA 3BI4A 4UP3A 2EQ7A 4FK1A 2ARDA 1O5WA 1FECA 2BXSA 1GNDA 2GAHB 2YG3A 3JSKA 3NK2X 4J56A 1VDCA 3AE9A 2R0CA 3AD9B 1GREA 4ICYA 4U8KA 1E1LA 2V6OA 1PHHA 2CDUA 2GQWA 3GWFA 3IHMA 1F6MA 5EBKA 1GTEA 2WOWA 2GB0A 3P9UA 1L0VA 1ZK7A 3AD8B 1HYUA 4CY8A 5ER0A 3DK8A 5U63A 3FPZA 1PJ5A 2V5ZA 4K7ZA 3DK9A 4USQA 3ATRA 3KA7A 4K22A 3ADAB 3IHGA 4H4SA 3QSEA 3AEBA 4A79A 2WP5A 2E5VA 3FG2P 3AE6A 3I6DA 1JNRA 1JEHA 4ADWA 3UKLA 4CCQA 1LPFA 3NHOX 1ZMDA 2WS3A 4OPDA 1COYA 1VG0A 2J3NA 1GRBA 2IVEA 1FEAA 1CL0A 3NTAA 3DH9A 2JBVA 1IUXA 3F8RA 3ICRA 1PBFA 2WU5A 2XFNA 2ZZCA 3M13A 4H2RA 2CULA 1DODA 2YLXA 3REDA 2Q7VA 2YR4A 1XHCA 2WOVA 4TM4A 3UKKA 1NG4A 2A87A 3ATQA 3SM8A 4H4QA 3BHFA 1BF3A 2DKHA 4Z43A 2C72A 3QJ4A 1YKJA 2BCPA 1TDNA 3O0HA 1IUSA 2VQBA 3GDNA 1D4DA 1ELIA 2VRMA 3ZYXA 4GDEA 1TDFA 2WEUA 3DJGX 4K2XA 4OCGA 2XLTA 3II4A 3UKHA 2JK6A 4U8LA 2O9ZA 4Z2TA 3IC9A 2E4GA 4EQWA 1IJHA 4RG3A 2OLOA 2X99A 1ZDLA 2AR8A 2RGOA 4J33A 3AYJA 1BGJA 4PABA 2OAMA 3CGEA 4UDPA 4OPCA 4EMIA 5M0ZA 1PN0A 4Z25A 2X50A 1GPEA 3UTGA 4YTNA 2GEWA 1S3BA 3NYFA 3ZDNA 1PXAA 3PS9A 1Q9IA 2GVCA 2Q6UA 3CTYA 3AYIA 1LVLA 2YQUA 5GSNA 5KOWA 2YLZA 1H82A 1M6IA 3CNPA 3G5SA 4D03A 3LOVA 2WQYA 3IWAA 4H4XA 1MXTA 4OPIA 1LV0A 3P4PA 2VOUA 3UP5A 2HQMA 3AEEA 4A6NB 1TYPA 4H4PA 4Z2UA 2A89A 4AOSA 1YQ4A 3QVPA 4H4RA 4HA6A 2Q0LA 2WDVA 3B6DA 3D8XA 1LQTA 2XDOA 1Y56B 4DSGA 2BK5A 4AOXA 2B9XA 3ABVA 4B66A 2TPRA 2FJAA 3L1RA 4GUVA 4JQ9A 4BJYA 3KD9A 2WU2A 3OZ2A 2GAGB 4X4JA 2WDRA 2BS4A 2XFPA 2XVIA 4PAAA 3SGLA 2NVKX 3VR8A 2YLWA 1CJ2A 1NG3A 2XFQA 4U8PA 1GTHA 3AYLA 3FIMB 2BXRA 2WPCA 3RHAA 1NPXA 4BK1A 2WETA 3AD7B 4BURA 3NLCA 2V61A 2I0ZA 5EB5A 4XXGA 1W4XA 1JRXA 1BWCA 2YAUA 3RP8A 4GR1A 2Q0KA 1M64A 1BKWA 2FBWA 3AB1A 4HB9A 4K5SA 3H4KA 2B7RA 3BI5A 1B4VA 3GD3A 3CPIG 3ICSA 1P2HA 2DKIA 1PJ6A 5HY5A 1FOHA 1LTXR 1E1KA 4JNAA 5KXJA 4YTMA 1GRGA 4J57A 1K4QA 3NG7X 2R0GA 4A65A 2R46A 2GR0A 2BCGG 1N1PA 1DNCA 1K0LA 4P9SA 1O94A 2ZBWA 2PHHA 4EQXA 3CNDA 4U8JA 2B9WA 3BHKA 2ZZ0A 4M52A 4YKGA 2BYBA 3BNUA 2BK3A 4B65A 4OPGA 2H88A 2YR5A 4FK1C 1GETA 1JOAA 2C76A 3GD4A 4IVOB 4UDRA 3NYEA 2XVHA 5KVHA 4J36A 4YKFA 2OALA 3CNJA 1GALA 1QO8A 1GSNA 3FMWA 3H8IA 3AXBA 3F8PA 3NK1X 1KNRA 3T37A 5KRQA 1KDGA 2CVJA 1B37A 3DJJA 3GMCA 3M12A 2R45A 1KF6A 2YG7A 3ALMA 3QSMA 1KSUA 2RGHA 5DBJA 5J60A 3QSSA 4YSXA 3ISHA 2GMJA 3AE8A 2YLSA 3G5QA 1H84A 3SFDA 2Z5XA 1IUWA 4USRA 5JCKA 2JAEA 2GR3A 2GR2A 5FS8A 4LIIA 1IUUA 1NHSA 1GXFA 2H89A 3ALLA 4OPLA 4ECHA 1E39A 2YVJA 1LJ1A 3NIXA 1BZLA 4CCRA 2JB2A 4I58A 4B67A 1TDOA 4N9XA 3UTFA 2R4EA 1EL8A 4CBQA 4J31A 5CKUA 1EL5A 3EF6A 2C7GA 4EM4A 3DK4A 3LJPA 3NYCA 4IA6A 3P4RA 3CNSA 2QCUA 3AE4A 5CQFA 3KU9A 1NDAA 1OJCA 3H8LA 3QFAA 1CJ3A 4J2WA 4X9NA 4U8MA 3ALJA 3UTEA 4EIQA 1OJAA 3D1CA 1JRZA 4RG4A 3V76A 3KPFA 4I59A 4OPTA 3LB8A 3UKPA 1D4EA 5LV9A 5M10A 1L9CA 2XLRA 3GRTA 2APGA 1X31B 1MOKA 4J34A 1V59A 1DXLA 3OC4A 2C67A 1PBBA 2C73A 1SEZA 1OJ9A 1FCDA 4DSHA 4B64A 2NPXA 4EM3A 2R0PA 1E6EA 1DJQA 4Z2RA 3G5RA 3ITJA 2YG5A 4NEWA 4H4ZA 4OVIA 4ZCCA 1N4UA 1PXCA 3K30A 3NH3X 3AEDA 4U2LA 3UOVA 2E1MA 1ZOYA 1EBDA 4EIPA 4YXDA 1PS9A 4Z44A 3NK0X 4FX9A 4CY6A 4MJWA 5J7XA 1VRQB 4BK3A 3UTHA 1RYIA 1S3EA 2BA9A 2BACA 3UOZA 4A9WA 2IVDA 4IVMB 4H50A 4AP3A 3GWDA 2XVEA 1S2QA 4U2TA 3BI2A 2YG4A 4LA1A 1IUVA 2B9YA 2WDQA 1YQZA 1XDIA 3GRSA 3NN6X 1ZX9A 3UOYA 1FEBA
chains in the Genus database with same CATH superfamily
5IQ4A 2IIDA 2C3DA 1GOSA 4TM3A 2BC1A 4H4WA 5BUKA 3C96A 4EMWA 2QA1A 2QA2A 4KPRA 1GRTA 2Y6QA 4OPUA 2WESA 2V60A 4II2A 4A7AA 3AECA 3VR9A 3EANA 4H2QA 2X8GA 1D7YA 1DOBA 5EB4A 1PDHA 1H86A 2ACZA 4U2SA 1VG9A 2FJDA 4WX1A 1KNPA 1OJDA 1CC6A 3AE2A 5L46A 2GH5A 1ZP0A 1MO9A 4EQSA 1PBDA 4Z24A 3WE0A 2RGJA 1E7PA 3NTDA 1K0IA 4NEVA 1ZMCA 4H4YA 2VRLA 3GYXA 4NTCA 4AT0A 2EQ9A 2XVFA 3EAOA 4EMJA 1Z6LA 1RP0A 5JCMA 3QVRA 1GT8A 1QLBA 3QFBA 3V3NA 2V3AA 2YVFA 3COXA 1GESA 4H2PA 4TM0A 4IA5A 3KKJA 3UOXA 1D4CA 2ZZBA 3UP4A 3AE3A 3VRBA 4RSLA 5C2TA 1NHQA 2WPEA 1N4VA 2QAEA 3I3LA 4A6NA 2YWLA 4LU6A 2C75A 1CHUA 3AWIA 4A99A 1ZY8A 3DJDA 1XPQA 1CJ4A 5FMHA 3RNMA 5KWFA 1D5TA 2JB1A 3CGDA 2YR6A 3CGCA 5GRTA 1AOGA 4K5RA 4JY3A 1Y56A 4U8NA 4BK2A 3GSIA 3IF9A 3RP6A 4X9MA 3HYXA 1QJDA 1L9DA 4JDRA 2TMDA 4B63A 4AP1A 2BC0A 1GRFA 3AEFA 2A8XA 3NN0X 1OJTA 1IUTA 4CNKA 2XFOA 3B3RA 1L9EA 3DA1A 1S2YA 5BRTA 3E1TA 2VZ2A 1PBCA 4U8OA 3URHA 1ZKQA 2OLNA 1CC4A 1UKVG 5C3JA 4KX6A 4B69A 4BV6A 5HHFA 4GDPA 2C65A 4UDQA 3CN8A 5BULA 5BVAA 1F8SA 2C3CA 4APNA 3NNEA 3VRAA 1PBEA 1DOEA 2VQ7A 4EQRA 4U8IA 4A5LA 5KOXA 4TLZA 3UKQA 5FS7A 2V3BA 2XYOA 4NZHA 1PXBA 1NAAA 3NGCX 5KVIA 4BJZA 3RP7A 5FS6A 2GRTA 4CNJA 3NRNA 1H6VA 4TLXA 3SYIA 2X8HA 4YSZA 2WP6A 3LXDA 4ZN0A 1Y0PA 3ICTA 5KMPA 1DJNA 4WCTA 4NWZA 4CRTA 5HXIA 4B68A 3PO7A 2XLUA 2GR1A 3L8KA 1RSGA 3Q9TA 2R4JA 1Q1WA 3FBSA 4REKA 2AAQA 4JNQA 2Z5YA 2YLRA 2YG6A 3AE7A 4C74A 2Y6RA 1O95A 1H83A 5U25A 3UKFA 4H7UA 3V3OA 4O5QA 1GERA 1Q1RA 3C4NA 5IPYA 1CJCA 1F3PA 3Q6JA 1KFYA 3CIRA 3DGHA 4H4UA 4E0VA 2AQJA 2B76A 3HYWA 2GMHA 4GRTA 3AE5A 3VQRA 5JCNA 2RABA 3F8DA 1P2EA 4C3XA 5JCIA 3PVCA 1GRHA 1B5QA 1N4WA 4Z26A 3GYIA 1B8SA 2XCGA 2F5ZA 2XLPA 3LZXA 2XFUA 4YWOA 1TDKA 1YY5A 2BABA 1H81A 1NENA 2XLSA 1VQWA 3NT6A 3P4QA 4H4TA 4NTEA 2YM1A 2C64A 2YVGA 3GYJA 3CNTA 2PYXA 3HYVA 2VVMA 4FDCB 4IV9A 3S61A 5HYMA 3C4AA 2W0HA 5EOWA 3LZWA 4C77A 1GRAA 2EQ6A 3CGBA 3DGZA 4XWRA 4D04A 1ONFA 2BS3A 4YSHA 2YLTA 3VRDB 2BS2A 5TR3A 3KVEA 2C66A 4ZCDA 2WBAA 5JCLA 2JKCA 1LQUA 1NHPA 3S5WA 1E1NA 1EL9A 1REOA 3SY4A 2XVJA 4Y4MA 4H2NA 3EPTA 4YTPA 2JB3A 2GQFA 3P1WA 2YM2A 4C5OA 2GF3A 2VVLA 5U1OA 3DJEA 3M0OA 1NHRA 3P4SA 1D7LA 3K7MX 4C3YA 3UCLA 4XWZA 2BK4A 2UZZA 1DOCA 1GEUA 4GCMA 1YQ3A 2X3NA 1TDEA 1EL7A 1CBOA 2X8CA 3CPJG 1NEKA 4TM1A 4H4VA 1CF3A 4K8DA 2FJBA 3AE1A 4DNAA 1E1MA 2EQ8A 2FJEA 4Y4NA 1PJ7A 4GF7A 3GDPA 4YSYA 3AEAA 3LADA 3NKSA 1JNZA 1F8RA 1JRYA 4O5UA 5IQ1A 2R9ZA 3HZLA 2OA1A 3K7QX 1GV4A 1H7XA 1JU2A 4YT0A 2B7SA 1H7WA 3AEGA 4Y4LA 3SQPA 1CC2A 3SXIA 4JN9A 4AT2A 1FL2A 3UKAA 1TRBA 2WOIA 4NTDA 4B1BA 3K7TA 2C70A 1ZOVA 1F8WA 1KSSA 1K0JA 2GV8A 3DMEA 2VVLG 3KLJA 4JY2A 2CFYA 5FS9A 3R9UA 3GMBA 2WP9A 3SZWA 5KMSA 1BGNA 3BNMA 3CPHG 4DGKA 1TYTA 1XANA 2WPFA 3SFEA 2WHDA 3BI4A 4UP3A 2EQ7A 4FK1A 2ARDA 1O5WA 1FECA 2BXSA 1GNDA 2GAHB 2YG3A 3JSKA 3NK2X 4J56A 1VDCA 3AE9A 2C4CA 2R0CA 1GREA 3AD9B 4ICYA 4U8KA 1E1LA 2V6OA 1PHHA 2CDUA 2GQWA 3GWFA 3IHMA 1F6MA 5EBKA 1GTEA 4G6HA 2WOWA 2GB0A 3P9UA 1L0VA 1ZK7A 3AD8B 1HYUA 4CY8A 5ER0A 3DK8A 5U63A 3FPZA 1PJ5A 2V5ZA 4K7ZA 3DK9A 4USQA 3ATRA 3KA7A 4K22A 3ADAB 3IHGA 4H4SA 3QSEA 3AEBA 4A79A 2WP5A 2E5VA 3FG2P 3AE6A 3I6DA 1JNRA 1JEHA 4ADWA 3UKLA 5KMQA 4CCQA 1LPFA 3NHOX 1ZMDA 2WS3A 4OPDA 1COYA 1VG0A 2J3NA 1GRBA 2IVEA 1FEAA 1CL0A 3NTAA 3DH9A 2JBVA 1IUXA 3F8RA 3ICRA 1PBFA 2WU5A 2XFNA 2ZZCA 3M13A 4H2RA 2CULA 1DODA 2YLXA 3REDA 2Q7VA 2YR4A 1XHCA 2WOVA 4TM4A 3UKKA 1NG4A 2A87A 3ATQA 3SM8A 4G74A 3BHFA 4H4QA 1BF3A 2DKHA 4Z43A 2C72A 3QJ4A 1YKJA 2BCPA 1TDNA 3O0HA 1IUSA 2VQBA 3GDNA 1D4DA 1ELIA 2VRMA 3ZYXA 4GDEA 1TDFA 2WEUA 3DJGX 4K2XA 4OCGA 2XLTA 3II4A 3UKHA 2JK6A 4U8LA 2O9ZA 3T0KA 4Z2TA 3IC9A 2E4GA 4EQWA 1IJHA 4RG3A 2OLOA 2X99A 1ZDLA 2AR8A 2RGOA 4J33A 3AYJA 1BGJA 4PABA 2OAMA 3CGEA 4UDPA 4OPCA 4EMIA 5M0ZA 1PN0A 4Z25A 2X50A 1GPEA 3UTGA 4YTNA 2GEWA 4NNJA 1S3BA 3NYFA 3ZDNA 1PXAA 3PS9A 1Q9IA 2GVCA 2Q6UA 3CTYA 3AYIA 1LVLA 2YQUA 5GSNA 5KOWA 2YLZA 1H82A 1M6IA 3CNPA 3G5SA 4D03A 4GAPA 3LOVA 2WQYA 3IWAA 4H4XA 1MXTA 4OPIA 1LV0A 3P4PA 2VOUA 3UP5A 2HQMA 3AEEA 4A6NB 1TYPA 4H4PA 4Z2UA 3T2YA 2A89A 4AOSA 1YQ4A 3QVPA 4H4RA 4HA6A 2Q0LA 2WDVA 3B6DA 3D8XA 1LQTA 2XDOA 1Y56B 4DSGA 2BK5A 4AOXA 2B9XA 3ABVA 4B66A 2TPRA 5KNLA 2FJAA 3L1RA 4GUVA 4JQ9A 4BJYA 3KD9A 2WU2A 3OZ2A 2GAGB 4X4JA 2WDRA 2BS4A 2XFPA 2XVIA 4PAAA 3SGLA 2NVKX 3VR8A 2YLWA 1CJ2A 4G73A 1NG3A 2XFQA 4U8PA 1GTHA 3AYLA 3FIMB 2BXRA 2WPCA 3RHAA 1NPXA 4BK1A 2WETA 3AD7B 4BURA 3NLCA 2V61A 2I0ZA 5EB5A 4XXGA 1W4XA 1JRXA 1BWCA 2YAUA 3RP8A 4GR1A 2Q0KA 5KMRA 1M64A 1BKWA 2FBWA 3AB1A 4HB9A 4K5SA 3H4KA 2B7RA 3BI5A 1B4VA 3GD3A 3CPIG 3ICSA 1P2HA 2DKIA 1PJ6A 5HY5A 1FOHA 1LTXR 1E1KA 3KPKA 4JNAA 5KXJA 4YTMA 1GRGA 4J57A 1K4QA 3NG7X 2R0GA 4G9KA 2R46A 4A65A 2GR0A 2BCGG 1N1PA 2BRYA 1DNCA 1K0LA 4P9SA 1O94A 2ZBWA 2PHHA 2BRAA 4EQXA 3CNDA 4U8JA 2B9WA 3BHKA 2ZZ0A 4M52A 4YKGA 2BYBA 3BNUA 2BK3A 3SX6A 4B65A 4OPGA 2H88A 2YR5A 4FK1C 1GETA 1JOAA 2C76A 3GD4A 4IVOB 4UDRA 3NYEA 2XVHA 5KVHA 4J36A 4YKFA 2OALA 3CNJA 1GALA 1QO8A 1GSNA 3FMWA 3H8IA 3AXBA 3F8PA 3NK1X 1KNRA 3T37A 5KRQA 1KDGA 2CVJA 1B37A 3DJJA 3GMCA 3M12A 2R45A 1KF6A 2YG7A 3ALMA 3QSMA 1KSUA 2RGHA 5DBJA 5J60A 3QSSA 4YSXA 3ISHA 2GMJA 3AE8A 2YLSA 3G5QA 1H84A 3SFDA 2Z5XA 1IUWA 4USRA 5JCKA 2JAEA 2GR3A 2GR2A 5FS8A 4LIIA 1IUUA 1NHSA 1GXFA 2H89A 3ALLA 4OPLA 4ECHA 1E39A 3T14A 2YVJA 1LJ1A 3NIXA 3SZFA 1BZLA 3SZCA 4CCRA 2JB2A 4G6GA 4I58A 4B67A 1TDOA 4N9XA 3UTFA 2R4EA 1EL8A 4CBQA 4J31A 5CKUA 1EL5A 3EF6A 2C7GA 4EM4A 3DK4A 3LJPA 3NYCA 4IA6A 3P4RA 3CNSA 2QCUA 3AE4A 5CQFA 3KU9A 1NDAA 1OJCA 3H8LA 3QFAA 1CJ3A 4J2WA 4X9NA 4U8MA 3ALJA 3UTEA 4EIQA 1OJAA 3CMMA 3D1CA 1JRZA 4RG4A 3V76A 3KPFA 4I59A 3SZ0A 4OPTA 3LB8A 3UKPA 1D4EA 5LV9A 5M10A 1L9CA 2XLRA 3GRTA 2APGA 1X31B 1MOKA 4J34A 1V59A 1DXLA 3OC4A 2C67A 1PBBA 2C73A 1SEZA 1OJ9A 1FCDA 4DSHA 4B64A 2NPXA 4EM3A 2R0PA 1E6EA 1DJQA 4Z2RA 3G5RA 3ITJA 2YG5A 4II3A 4NEWA 4H4ZA 4OVIA 3T31A 4ZCCA 1N4UA 1PXCA 3K30A 3NH3X 3AEDA 3T2ZA 4U2LA 3UOVA 2E1MA 1ZOYA 1EBDA 4EIPA 4YXDA 1PS9A 4Z44A 3NK0X 4FX9A 4CY6A 4MJWA 5J7XA 1VRQB 4GAVA 4BK3A 3UTHA 1RYIA 1S3EA 2BA9A 2BACA 3T2KA 3UOZA 4A9WA 2IVDA 4IVMB 4H50A 4AP3A 3GWDA 2XVEA 1S2QA 4U2TA 3BI2A 2YG4A 4LA1A 1IUVA 2B9YA 2WDQA 1YQZA 1XDIA 3GRSA 3NN6X 1ZX9A 3UOYA 1FEBA
chains in the Genus database with same CATH topology
5IQ4A 2IIDA 2C3DA 1GOSA 4TM3A 2BC1A 4H4WA 5BUKA 3C96A 4EMWA 2QA1A 2QA2A 4KPRA 1GRTA 2Y6QA 4OPUA 2WESA 2V60A 4II2A 4A7AA 3AECA 3VR9A 3EANA 4H2QA 2X8GA 1D7YA 1DOBA 5EB4A 1PDHA 1H86A 2ACZA 4U2SA 1VG9A 2FJDA 4WX1A 1KNPA 1OJDA 1CC6A 3AE2A 5L46A 2GH5A 1ZP0A 1MO9A 4EQSA 1PBDA 4Z24A 3WE0A 2RGJA 1E7PA 3NTDA 1K0IA 4NEVA 1ZMCA 4H4YA 2VRLA 3GYXA 4NTCA 4AT0A 2EQ9A 2XVFA 3EAOA 4EMJA 1Z6LA 1RP0A 5JCMA 3QVRA 1GT8A 1QLBA 3QFBA 3V3NA 2V3AA 2YVFA 3COXA 1GESA 4H2PA 4TM0A 4IA5A 3KKJA 3UOXA 1D4CA 2ZZBA 3UP4A 3AE3A 3VRBA 4RSLA 5C2TA 1NHQA 2WPEA 1N4VA 2QAEA 3I3LA 4A6NA 2YWLA 4LU6A 2C75A 1CHUA 3AWIA 4A99A 1ZY8A 3DJDA 1XPQA 1CJ4A 5FMHA 3RNMA 5KWFA 1D5TA 2JB1A 3CGDA 2YR6A 3CGCA 5GRTA 1AOGA 4K5RA 4JY3A 1Y56A 4U8NA 4BK2A 3GSIA 3IF9A 3RP6A 4X9MA 3HYXA 1QJDA 1L9DA 4JDRA 2TMDA 4B63A 4AP1A 2BC0A 1GRFA 3AEFA 2A8XA 3NN0X 1OJTA 1IUTA 4CNKA 2XFOA 3B3RA 1L9EA 3DA1A 1S2YA 5BRTA 3E1TA 2VZ2A 1PBCA 4U8OA 3URHA 1ZKQA 2OLNA 1CC4A 1UKVG 5C3JA 4KX6A 4B69A 4BV6A 5HHFA 4GDPA 2C65A 4UDQA 3CN8A 5BULA 5BVAA 1F8SA 2C3CA 4APNA 3NNEA 3VRAA 1PBEA 1DOEA 2VQ7A 4EQRA 4U8IA 4A5LA 5KOXA 4TLZA 3UKQA 5FS7A 2V3BA 2XYOA 4NZHA 1PXBA 1NAAA 3NGCX 5KVIA 4BJZA 3RP7A 5FS6A 2GRTA 4CNJA 3NRNA 1H6VA 4TLXA 3SYIA 2X8HA 4YSZA 2WP6A 3LXDA 4ZN0A 1Y0PA 3ICTA 5KMPA 1DJNA 4WCTA 4NWZA 4CRTA 5HXIA 4B68A 3PO7A 2XLUA 2GR1A 3L8KA 1RSGA 3Q9TA 2R4JA 1Q1WA 3FBSA 4REKA 2AAQA 4JNQA 2Z5YA 2YLRA 2YG6A 3AE7A 4C74A 2Y6RA 1O95A 1H83A 5U25A 3UKFA 4H7UA 3V3OA 4O5QA 1GERA 1Q1RA 3C4NA 5IPYA 1CJCA 1F3PA 3Q6JA 1KFYA 3CIRA 3DGHA 4H4UA 4E0VA 2AQJA 2B76A 3HYWA 2GMHA 4GRTA 3AE5A 3VQRA 5JCNA 2RABA 3F8DA 1P2EA 4C3XA 5JCIA 3PVCA 1GRHA 1B5QA 1N4WA 4Z26A 3GYIA 1B8SA 2XCGA 2F5ZA 2XLPA 3LZXA 2XFUA 4YWOA 1TDKA 1YY5A 2BABA 1H81A 1NENA 2XLSA 1VQWA 3NT6A 3P4QA 4H4TA 4NTEA 2YM1A 2C64A 2YVGA 3GYJA 3CNTA 2PYXA 3HYVA 2VVMA 4FDCB 4IV9A 3S61A 5HYMA 3C4AA 2W0HA 5EOWA 3LZWA 4C77A 1GRAA 2EQ6A 3CGBA 3DGZA 4XWRA 4D04A 1ONFA 2BS3A 4YSHA 2YLTA 3VRDB 2BS2A 5TR3A 3KVEA 2C66A 4ZCDA 2WBAA 5JCLA 2JKCA 1LQUA 1NHPA 3S5WA 1E1NA 1EL9A 1REOA 3SY4A 2XVJA 4Y4MA 4H2NA 3EPTA 4YTPA 2JB3A 2GQFA 3P1WA 2YM2A 4C5OA 2GF3A 2VVLA 5U1OA 3DJEA 3M0OA 1NHRA 3P4SA 1D7LA 3K7MX 4C3YA 3UCLA 4XWZA 2BK4A 2UZZA 1DOCA 1GEUA 4GCMA 1YQ3A 2X3NA 1TDEA 1EL7A 1CBOA 2X8CA 3CPJG 1NEKA 4TM1A 4H4VA 1CF3A 4K8DA 2FJBA 3AE1A 4DNAA 1E1MA 2EQ8A 2FJEA 4Y4NA 1PJ7A 4GF7A 3GDPA 4YSYA 3AEAA 3LADA 3NKSA 1JNZA 1F8RA 1JRYA 4O5UA 5IQ1A 2R9ZA 3HZLA 2OA1A 3K7QX 1GV4A 1H7XA 1JU2A 4YT0A 2B7SA 1H7WA 3AEGA 4Y4LA 3SQPA 1CC2A 3SXIA 4JN9A 4AT2A 1FL2A 3UKAA 1TRBA 2WOIA 4NTDA 4B1BA 3K7TA 2C70A 1ZOVA 1F8WA 1KSSA 1K0JA 2GV8A 3DMEA 2VVLG 3KLJA 4JY2A 2CFYA 5FS9A 3R9UA 3GMBA 2WP9A 3SZWA 5KMSA 1BGNA 3BNMA 3CPHG 4DGKA 1TYTA 1XANA 2WPFA 3SFEA 2WHDA 3BI4A 4UP3A 2EQ7A 4FK1A 2ARDA 1O5WA 1FECA 2BXSA 1GNDA 2GAHB 2YG3A 3JSKA 3NK2X 4J56A 1VDCA 3AE9A 2C4CA 2R0CA 1GREA 3AD9B 4ICYA 4U8KA 1E1LA 2V6OA 1PHHA 2CDUA 2GQWA 3GWFA 3IHMA 1F6MA 5EBKA 1GTEA 4G6HA 2WOWA 2GB0A 3P9UA 1L0VA 1ZK7A 3AD8B 1HYUA 4CY8A 5ER0A 3DK8A 5U63A 3FPZA 1PJ5A 2V5ZA 4K7ZA 3DK9A 4USQA 3ATRA 3KA7A 4K22A 3ADAB 3IHGA 4H4SA 3QSEA 3AEBA 4A79A 2WP5A 2E5VA 3FG2P 3AE6A 3I6DA 1JNRA 1JEHA 4ADWA 3UKLA 5KMQA 4CCQA 1LPFA 3NHOX 1ZMDA 2WS3A 4OPDA 1COYA 1VG0A 2J3NA 1GRBA 2IVEA 1FEAA 1CL0A 3NTAA 3DH9A 2JBVA 1IUXA 3F8RA 3ICRA 1PBFA 2WU5A 2XFNA 2ZZCA 3M13A 4H2RA 2CULA 1DODA 2YLXA 3REDA 2Q7VA 2YR4A 1XHCA 2WOVA 4TM4A 3UKKA 1NG4A 2A87A 3ATQA 3SM8A 4G74A 3BHFA 4H4QA 1BF3A 2DKHA 4Z43A 2C72A 3QJ4A 1YKJA 2BCPA 1TDNA 3O0HA 1IUSA 2VQBA 3GDNA 1D4DA 1ELIA 2VRMA 3ZYXA 4GDEA 1TDFA 2WEUA 3DJGX 4K2XA 4OCGA 2XLTA 3II4A 3UKHA 2JK6A 4U8LA 2O9ZA 3T0KA 4Z2TA 3IC9A 2E4GA 4EQWA 1IJHA 4RG3A 2OLOA 2X99A 1ZDLA 2AR8A 2RGOA 4J33A 3AYJA 1BGJA 4PABA 2OAMA 3CGEA 4UDPA 4OPCA 4EMIA 5M0ZA 1PN0A 4Z25A 2X50A 1GPEA 3UTGA 4YTNA 2GEWA 4NNJA 1S3BA 3NYFA 3ZDNA 1PXAA 3PS9A 1Q9IA 2GVCA 2Q6UA 3CTYA 3AYIA 1LVLA 2YQUA 5GSNA 5KOWA 2YLZA 1H82A 1M6IA 3CNPA 3G5SA 4D03A 4GAPA 3LOVA 2WQYA 3IWAA 4H4XA 1MXTA 4OPIA 1LV0A 3P4PA 2VOUA 3UP5A 2HQMA 3AEEA 4A6NB 1TYPA 4H4PA 4Z2UA 3T2YA 2A89A 4AOSA 1YQ4A 3QVPA 4H4RA 4HA6A 2Q0LA 2WDVA 3B6DA 3D8XA 1LQTA 2XDOA 1Y56B 4DSGA 2BK5A 4AOXA 2B9XA 3ABVA 4B66A 2TPRA 5KNLA 2FJAA 3L1RA 4GUVA 4JQ9A 4BJYA 3KD9A 2WU2A 3OZ2A 2GAGB 4X4JA 2WDRA 2BS4A 2XFPA 2XVIA 4PAAA 3SGLA 2NVKX 3VR8A 2YLWA 1CJ2A 4G73A 1NG3A 2XFQA 4U8PA 1GTHA 3AYLA 3FIMB 2BXRA 2WPCA 3RHAA 1NPXA 4BK1A 2WETA 3AD7B 4BURA 3NLCA 2V61A 2I0ZA 5EB5A 4XXGA 1W4XA 1JRXA 1BWCA 2YAUA 3RP8A 4GR1A 2Q0KA 5KMRA 1M64A 1BKWA 2FBWA 3AB1A 4HB9A 4K5SA 3H4KA 2B7RA 3BI5A 1B4VA 3GD3A 3CPIG 3ICSA 1P2HA 2DKIA 1PJ6A 5HY5A 1FOHA 1LTXR 1E1KA 3KPKA 4JNAA 5KXJA 4YTMA 1GRGA 4J57A 1K4QA 3NG7X 2R0GA 4G9KA 2R46A 4A65A 2GR0A 2BCGG 1N1PA 2BRYA 1DNCA 1K0LA 4P9SA 1O94A 2ZBWA 2PHHA 2BRAA 4EQXA 3CNDA 4U8JA 2B9WA 3BHKA 2ZZ0A 4M52A 4YKGA 2BYBA 3BNUA 2BK3A 3SX6A 4B65A 4OPGA 2H88A 2YR5A 4FK1C 1GETA 1JOAA 2C76A 3GD4A 4IVOB 4UDRA 3NYEA 2XVHA 5KVHA 4J36A 4YKFA 2OALA 3CNJA 1GALA 1QO8A 1GSNA 3FMWA 3H8IA 3AXBA 3F8PA 3NK1X 1KNRA 3T37A 5KRQA 1KDGA 2CVJA 1B37A 3DJJA 3GMCA 3M12A 2R45A 1KF6A 2YG7A 3ALMA 3QSMA 1KSUA 2RGHA 5DBJA 5J60A 3QSSA 4YSXA 3ISHA 2GMJA 3AE8A 2YLSA 3G5QA 1H84A 3SFDA 2Z5XA 1IUWA 4USRA 5JCKA 2JAEA 2GR3A 2GR2A 5FS8A 4LIIA 1IUUA 1NHSA 1GXFA 2H89A 3ALLA 4OPLA 4ECHA 1E39A 3T14A 2YVJA 1LJ1A 3NIXA 3SZFA 1BZLA 3SZCA 4CCRA 2JB2A 4G6GA 4I58A 4B67A 1TDOA 4N9XA 3UTFA 2R4EA 1EL8A 4CBQA 4J31A 5CKUA 1EL5A 3EF6A 2C7GA 4EM4A 3DK4A 3LJPA 3NYCA 4IA6A 3P4RA 3CNSA 2QCUA 3AE4A 5CQFA 3KU9A 1NDAA 1OJCA 3H8LA 3QFAA 1CJ3A 4J2WA 4X9NA 4U8MA 3ALJA 3UTEA 4EIQA 1OJAA 3CMMA 3D1CA 1JRZA 4RG4A 3V76A 3KPFA 4I59A 3SZ0A 4OPTA 3LB8A 3UKPA 1D4EA 5LV9A 5M10A 1L9CA 2XLRA 3GRTA 2APGA 1X31B 1MOKA 4J34A 1V59A 1DXLA 3OC4A 2C67A 1PBBA 2C73A 1SEZA 1OJ9A 1FCDA 4DSHA 4B64A 2NPXA 4EM3A 2R0PA 1E6EA 1DJQA 4Z2RA 3G5RA 3ITJA 2YG5A 4II3A 4NEWA 4H4ZA 4OVIA 3T31A 4ZCCA 1N4UA 1PXCA 3K30A 3NH3X 3AEDA 3T2ZA 4U2LA 3UOVA 2E1MA 1ZOYA 1EBDA 4EIPA 4YXDA 1PS9A 4Z44A 3NK0X 4FX9A 4CY6A 4MJWA 5J7XA 1VRQB 4GAVA 4BK3A 3UTHA 1RYIA 1S3EA 2BA9A 2BACA 3T2KA 3UOZA 4A9WA 2IVDA 4IVMB 4H50A 4AP3A 3GWDA 2XVEA 1S2QA 4U2TA 3BI2A 2YG4A 4LA1A 1IUVA 2B9YA 2WDQA 1YQZA 1XDIA 3GRSA 3NN6X 1ZX9A 3UOYA 1FEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IQ4 A;  2IID A;  2C3D A;  1GOS A;  4TM3 A;  2BC1 A;  4H4W A;  5BUK A;  3C96 A;  4EMW A;  2QA1 A;  2QA2 A;  4KPR A;  1GRT A;  2Y6Q A;  4OPU A;  2WES A;  2V60 A;  4A7A A;  3AEC A;  3VR9 A;  3EAN A;  4H2Q A;  2X8G A;  1D7Y A;  1DOB A;  5EB4 A;  1PDH A;  1H86 A;  2ACZ A;  4U2S A;  1VG9 A;  2FJD A;  4WX1 A;  1KNP A;  1OJD A;  1CC6 A;  3AE2 A;  5L46 A;  2GH5 A;  1ZP0 A;  1MO9 A;  4EQS A;  1PBD A;  4Z24 A;  3WE0 A;  2RGJ A;  1E7P A;  3NTD A;  1K0I A;  4NEV A;  1ZMC A;  4H4Y A;  2VRL A;  4NTC A;  4AT0 A;  2EQ9 A;  2XVF A;  3EAO A;  4EMJ A;  1Z6L A;  1RP0 A;  5JCM A;  3QVR A;  1GT8 A;  1QLB A;  3QFB A;  3V3N A;  2V3A A;  2YVF A;  3COX A;  1GES A;  4H2P A;  4TM0 A;  4IA5 A;  3KKJ A;  3UOX A;  1D4C A;  2ZZB A;  3UP4 A;  3AE3 A;  3VRB A;  4RSL A;  5C2T A;  1NHQ A;  2WPE A;  1N4V A;  2QAE A;  3I3L A;  4A6N A;  2YWL A;  4LU6 A;  2C75 A;  1CHU A;  3AWI A;  4A99 A;  1ZY8 A;  3DJD A;  1XPQ A;  1CJ4 A;  5FMH A;  3RNM A;  5KWF A;  1D5T A;  2JB1 A;  3CGD A;  2YR6 A;  3CGC A;  5GRT A;  1AOG A;  4K5R A;  4JY3 A;  1Y56 A;  4U8N A;  4BK2 A;  3GSI A;  3IF9 A;  3RP6 A;  4X9M A;  1QJD A;  1L9D A;  4JDR A;  2TMD A;  4B63 A;  4AP1 A;  2BC0 A;  1GRF A;  3AEF A;  2A8X A;  3NN0 X;  1OJT A;  1IUT A;  4CNK A;  2XFO A;  3B3R A;  1L9E A;  3DA1 A;  1S2Y A;  5BRT A;  3E1T A;  2VZ2 A;  1PBC A;  4U8O A;  3URH A;  1ZKQ A;  2OLN A;  1CC4 A;  1UKV G;  5C3J A;  4KX6 A;  4B69 A;  4BV6 A;  5HHF A;  4GDP A;  2C65 A;  4UDQ A;  3CN8 A;  5BUL A;  5BVA A;  1F8S A;  2C3C A;  4APN A;  3NNE A;  3VRA A;  1PBE A;  1DOE A;  2VQ7 A;  4EQR A;  4U8I A;  4A5L A;  5KOX A;  4TLZ A;  3UKQ A;  5FS7 A;  2V3B A;  2XYO A;  4NZH A;  1PXB A;  1NAA A;  3NGC X;  5KVI A;  4BJZ A;  3RP7 A;  5FS6 A;  2GRT A;  4CNJ A;  3NRN A;  1H6V A;  4TLX A;  2X8H A;  4YSZ A;  2WP6 A;  3LXD A;  4ZN0 A;  1Y0P A;  3ICT A;  1DJN A;  4WCT A;  4CRT A;  5HXI A;  4B68 A;  3PO7 A;  2XLU A;  2GR1 A;  3L8K A;  1RSG A;  3Q9T A;  2R4J A;  1Q1W A;  3FBS A;  4REK A;  2AAQ A;  4JNQ A;  2Z5Y A;  2YLR A;  2YG6 A;  3AE7 A;  4C74 A;  2Y6R A;  1O95 A;  1H83 A;  5U25 A;  3UKF A;  4H7U A;  3V3O A;  4O5Q A;  1GER A;  1Q1R A;  3C4N A;  5IPY A;  1CJC A;  1F3P A;  3Q6J A;  1KFY A;  3CIR A;  3DGH A;  4H4U A;  4E0V A;  2AQJ A;  2B76 A;  2GMH A;  4GRT A;  3AE5 A;  3VQR A;  5JCN A;  2RAB A;  3F8D A;  1P2E A;  4C3X A;  5JCI A;  3PVC A;  1GRH A;  1B5Q A;  1N4W A;  4Z26 A;  3GYI A;  1B8S A;  2XCG A;  2F5Z A;  2XLP A;  3LZX A;  2XFU A;  4YWO A;  1TDK A;  1YY5 A;  2BAB A;  1H81 A;  1NEN A;  2XLS A;  1VQW A;  3NT6 A;  3P4Q A;  4H4T A;  4NTE A;  2YM1 A;  2C64 A;  2YVG A;  3GYJ A;  3CNT A;  2PYX A;  4FDC B;  2VVM A;  4IV9 A;  5HYM A;  3S61 A;  3C4A A;  2W0H A;  5EOW A;  3LZW A;  4C77 A;  1GRA A;  2EQ6 A;  3CGB A;  3DGZ A;  4XWR A;  4D04 A;  1ONF A;  2BS3 A;  4YSH A;  2YLT A;  3VRD B;  2BS2 A;  5TR3 A;  3KVE A;  2C66 A;  4ZCD A;  2WBA A;  5JCL A;  2JKC A;  1LQU A;  1NHP A;  3S5W A;  1E1N A;  1EL9 A;  1REO A;  2XVJ A;  4Y4M A;  4H2N A;  3EPT A;  4YTP A;  2JB3 A;  2GQF A;  3P1W A;  2YM2 A;  4C5O A;  2GF3 A;  2VVL A;  5U1O A;  3DJE A;  3M0O A;  1NHR A;  3P4S A;  1D7L A;  3K7M X;  4C3Y A;  3UCL A;  4XWZ A;  2BK4 A;  2UZZ A;  1DOC A;  1GEU A;  4GCM A;  1YQ3 A;  2X3N A;  1TDE A;  1EL7 A;  1CBO A;  2X8C A;  3CPJ G;  1NEK A;  4TM1 A;  4H4V A;  1CF3 A;  4K8D A;  2FJB A;  3AE1 A;  4DNA A;  1E1M A;  2EQ8 A;  2FJE A;  4Y4N A;  1PJ7 A;  4GF7 A;  3GDP A;  4YSY A;  3AEA A;  3LAD A;  3NKS A;  1JNZ A;  1F8R A;  1JRY A;  4O5U A;  5IQ1 A;  2R9Z A;  3HZL A;  2OA1 A;  3K7Q X;  1GV4 A;  1H7X A;  1JU2 A;  4YT0 A;  2B7S A;  1H7W A;  3AEG A;  4Y4L A;  3SQP A;  1CC2 A;  4JN9 A;  4AT2 A;  1FL2 A;  3UKA A;  1TRB A;  2WOI A;  4NTD A;  4B1B A;  3K7T A;  2C70 A;  1ZOV A;  1F8W A;  1KSS A;  1K0J A;  2GV8 A;  3DME A;  2VVL G;  3KLJ A;  4JY2 A;  2CFY A;  5FS9 A;  3R9U A;  3GMB A;  2WP9 A;  1BGN A;  3BNM A;  3CPH G;  4DGK A;  1TYT A;  1XAN A;  2WPF A;  3SFE A;  2WHD A;  3BI4 A;  4UP3 A;  2EQ7 A;  4FK1 A;  2ARD A;  1O5W A;  1FEC A;  2BXS A;  1GND A;  2GAH B;  2YG3 A;  3JSK A;  3NK2 X;  4J56 A;  1VDC A;  3AE9 A;  2R0C A;  3AD9 B;  1GRE A;  4ICY A;  4U8K A;  1E1L A;  2V6O A;  1PHH A;  2CDU A;  2GQW A;  3GWF A;  3IHM A;  1F6M A;  5EBK A;  1GTE A;  2WOW A;  2GB0 A;  3P9U A;  1L0V A;  1ZK7 A;  3AD8 B;  1HYU A;  4CY8 A;  5ER0 A;  3DK8 A;  5U63 A;  3FPZ A;  1PJ5 A;  2V5Z A;  4K7Z A;  3DK9 A;  4USQ A;  3ATR A;  3KA7 A;  4K22 A;  3ADA B;  3IHG A;  4H4S A;  3QSE A;  3AEB A;  4A79 A;  2WP5 A;  2E5V A;  3FG2 P;  3AE6 A;  3I6D A;  1JNR A;  1JEH A;  4ADW A;  3UKL A;  4CCQ A;  1LPF A;  3NHO X;  1ZMD A;  2WS3 A;  4OPD A;  1COY A;  1VG0 A;  2J3N A;  1GRB A;  2IVE A;  1FEA A;  1CL0 A;  3NTA A;  3DH9 A;  2JBV A;  1IUX A;  3F8R A;  3ICR A;  1PBF A;  2WU5 A;  2XFN A;  2ZZC A;  3M13 A;  4H2R A;  2CUL A;  1DOD A;  2YLX A;  3RED A;  2Q7V A;  2YR4 A;  1XHC A;  2WOV A;  4TM4 A;  3UKK A;  1NG4 A;  2A87 A;  3ATQ A;  3SM8 A;  4H4Q A;  3BHF A;  1BF3 A;  2DKH A;  4Z43 A;  2C72 A;  3QJ4 A;  1YKJ A;  2BCP A;  1TDN A;  3O0H A;  1IUS A;  2VQB A;  3GDN A;  1D4D A;  1ELI A;  2VRM A;  3ZYX A;  4GDE A;  1TDF A;  2WEU A;  3DJG X;  4K2X A;  4OCG A;  2XLT A;  3II4 A;  3UKH A;  2JK6 A;  4U8L A;  2O9Z A;  4Z2T A;  3IC9 A;  2E4G A;  4EQW A;  1IJH A;  4RG3 A;  2OLO A;  2X99 A;  1ZDL A;  2AR8 A;  2RGO A;  4J33 A;  3AYJ A;  1BGJ A;  4PAB A;  2OAM A;  3CGE A;  4UDP A;  4OPC A;  4EMI A;  5M0Z A;  1PN0 A;  4Z25 A;  2X50 A;  1GPE A;  3UTG A;  4YTN A;  2GEW A;  1S3B A;  3NYF A;  3ZDN A;  1PXA A;  3PS9 A;  1Q9I A;  2GVC A;  2Q6U A;  3CTY A;  3AYI A;  1LVL A;  2YQU A;  5GSN A;  5KOW A;  2YLZ A;  1H82 A;  1M6I A;  3CNP A;  3G5S A;  4D03 A;  3LOV A;  2WQY A;  3IWA A;  4H4X A;  1MXT A;  4OPI A;  1LV0 A;  3P4P A;  2VOU A;  3UP5 A;  2HQM A;  3AEE A;  4A6N B;  1TYP A;  4H4P A;  4Z2U A;  2A89 A;  4AOS A;  1YQ4 A;  3QVP A;  4H4R A;  4HA6 A;  2Q0L A;  2WDV A;  3B6D A;  3D8X A;  1LQT A;  2XDO A;  1Y56 B;  4DSG A;  2BK5 A;  4AOX A;  2B9X A;  3ABV A;  4B66 A;  2TPR A;  2FJA A;  3L1R A;  4GUV A;  4JQ9 A;  4BJY A;  3KD9 A;  2WU2 A;  3OZ2 A;  2GAG B;  4X4J A;  2WDR A;  2BS4 A;  2XFP A;  2XVI A;  4PAA A;  3SGL A;  2NVK X;  3VR8 A;  2YLW A;  1CJ2 A;  1NG3 A;  2XFQ A;  4U8P A;  1GTH A;  3AYL A;  3FIM B;  2BXR A;  2WPC A;  3RHA A;  1NPX A;  4BK1 A;  2WET A;  3AD7 B;  4BUR A;  3NLC A;  2V61 A;  2I0Z A;  5EB5 A;  4XXG A;  1W4X A;  1JRX A;  1BWC A;  2YAU A;  3RP8 A;  4GR1 A;  2Q0K A;  1M64 A;  1BKW A;  2FBW A;  3AB1 A;  4HB9 A;  4K5S A;  3H4K A;  2B7R A;  3BI5 A;  1B4V A;  3GD3 A;  3CPI G;  3ICS A;  1P2H A;  2DKI A;  1PJ6 A;  5HY5 A;  1FOH A;  1LTX R;  1E1K A;  4JNA A;  5KXJ A;  4YTM A;  1GRG A;  4J57 A;  1K4Q A;  3NG7 X;  2R0G A;  4A65 A;  2R46 A;  2GR0 A;  2BCG G;  1N1P A;  1DNC A;  1K0L A;  4P9S A;  1O94 A;  2ZBW A;  2PHH A;  4EQX A;  3CND A;  4U8J A;  2B9W A;  3BHK A;  2ZZ0 A;  4M52 A;  4YKG A;  2BYB A;  3BNU A;  2BK3 A;  4B65 A;  4OPG A;  2H88 A;  2YR5 A;  4FK1 C;  1GET A;  1JOA A;  2C76 A;  3GD4 A;  4IVO B;  4UDR A;  3NYE A;  2XVH A;  5KVH A;  4J36 A;  4YKF A;  2OAL A;  3CNJ A;  1GAL A;  1QO8 A;  1GSN A;  3FMW A;  3H8I A;  3AXB A;  3F8P A;  3NK1 X;  1KNR A;  3T37 A;  5KRQ A;  1KDG A;  2CVJ A;  1B37 A;  3DJJ A;  3GMC A;  3M12 A;  2R45 A;  1KF6 A;  2YG7 A;  3ALM A;  3QSM A;  1KSU A;  2RGH A;  5DBJ A;  5J60 A;  3QSS A;  4YSX A;  3ISH A;  2GMJ A;  3AE8 A;  2YLS A;  3G5Q A;  1H84 A;  3SFD A;  2Z5X A;  1IUW A;  4USR A;  5JCK A;  2JAE A;  2GR3 A;  2GR2 A;  5FS8 A;  4LII A;  1IUU A;  1NHS A;  1GXF A;  2H89 A;  3ALL A;  4OPL A;  4ECH A;  1E39 A;  2YVJ A;  1LJ1 A;  3NIX A;  1BZL A;  4CCR A;  2JB2 A;  4I58 A;  4B67 A;  1TDO A;  4N9X A;  3UTF A;  2R4E A;  1EL8 A;  4CBQ A;  4J31 A;  5CKU A;  1EL5 A;  3EF6 A;  2C7G A;  4EM4 A;  3DK4 A;  3LJP A;  3NYC A;  4IA6 A;  3P4R A;  3CNS A;  2QCU A;  3AE4 A;  5CQF A;  3KU9 A;  1NDA A;  1OJC A;  3H8L A;  3QFA A;  1CJ3 A;  4J2W A;  4X9N A;  4U8M A;  3ALJ A;  3UTE A;  4EIQ A;  1OJA A;  3D1C A;  1JRZ A;  4RG4 A;  3V76 A;  3KPF A;  4I59 A;  4OPT A;  3LB8 A;  3UKP A;  1D4E A;  5LV9 A;  5M10 A;  1L9C A;  2XLR A;  3GRT A;  2APG A;  1X31 B;  1MOK A;  4J34 A;  1V59 A;  1DXL A;  3OC4 A;  2C67 A;  1PBB A;  2C73 A;  1SEZ A;  1OJ9 A;  1FCD A;  4DSH A;  4B64 A;  2NPX A;  4EM3 A;  2R0P A;  1E6E A;  1DJQ A;  4Z2R A;  3G5R A;  3ITJ A;  2YG5 A;  4NEW A;  4H4Z A;  4OVI A;  4ZCC A;  1N4U A;  1PXC A;  3K30 A;  3NH3 X;  3AED A;  4U2L A;  3UOV A;  2E1M A;  1ZOY A;  1EBD A;  4EIP A;  4YXD A;  1PS9 A;  4Z44 A;  3NK0 X;  4FX9 A;  4CY6 A;  4MJW A;  5J7X A;  1VRQ B;  4BK3 A;  3UTH A;  1RYI A;  1S3E A;  2BA9 A;  2BAC A;  3UOZ A;  4A9W A;  2IVD A;  4IVM B;  4H50 A;  4AP3 A;  3GWD A;  2XVE A;  1S2Q A;  4U2T A;  3BI2 A;  2YG4 A;  4LA1 A;  1IUV A;  2B9Y A;  2WDQ A;  1YQZ A;  1XDI A;  3GRS A;  3NN6 X;  1ZX9 A;  3UOY A;  1FEB A; 
#chains in the Genus database with same CATH topology
 5IQ4 A;  2IID A;  2C3D A;  1GOS A;  4TM3 A;  2BC1 A;  4H4W A;  5BUK A;  3C96 A;  4EMW A;  2QA1 A;  2QA2 A;  4KPR A;  1GRT A;  2Y6Q A;  4OPU A;  2WES A;  2V60 A;  4II2 A;  4A7A A;  3AEC A;  3VR9 A;  3EAN A;  4H2Q A;  2X8G A;  1D7Y A;  1DOB A;  5EB4 A;  1PDH A;  1H86 A;  2ACZ A;  4U2S A;  1VG9 A;  2FJD A;  4WX1 A;  1KNP A;  1OJD A;  1CC6 A;  3AE2 A;  5L46 A;  2GH5 A;  1ZP0 A;  1MO9 A;  4EQS A;  1PBD A;  4Z24 A;  3WE0 A;  2RGJ A;  1E7P A;  3NTD A;  1K0I A;  4NEV A;  1ZMC A;  4H4Y A;  2VRL A;  3GYX A;  4NTC A;  4AT0 A;  2EQ9 A;  2XVF A;  3EAO A;  4EMJ A;  1Z6L A;  1RP0 A;  5JCM A;  3QVR A;  1GT8 A;  1QLB A;  3QFB A;  3V3N A;  2V3A A;  2YVF A;  3COX A;  1GES A;  4H2P A;  4TM0 A;  4IA5 A;  3KKJ A;  3UOX A;  1D4C A;  2ZZB A;  3UP4 A;  3AE3 A;  3VRB A;  4RSL A;  5C2T A;  1NHQ A;  2WPE A;  1N4V A;  2QAE A;  3I3L A;  4A6N A;  2YWL A;  4LU6 A;  2C75 A;  1CHU A;  3AWI A;  4A99 A;  1ZY8 A;  3DJD A;  1XPQ A;  1CJ4 A;  5FMH A;  3RNM A;  5KWF A;  1D5T A;  2JB1 A;  3CGD A;  2YR6 A;  3CGC A;  5GRT A;  1AOG A;  4K5R A;  4JY3 A;  1Y56 A;  4U8N A;  4BK2 A;  3GSI A;  3IF9 A;  3RP6 A;  4X9M A;  3HYX A;  1QJD A;  1L9D A;  4JDR A;  2TMD A;  4B63 A;  4AP1 A;  2BC0 A;  1GRF A;  3AEF A;  2A8X A;  3NN0 X;  1OJT A;  1IUT A;  4CNK A;  2XFO A;  3B3R A;  1L9E A;  3DA1 A;  1S2Y A;  5BRT A;  3E1T A;  2VZ2 A;  1PBC A;  4U8O A;  3URH A;  1ZKQ A;  2OLN A;  1CC4 A;  1UKV G;  5C3J A;  4KX6 A;  4B69 A;  4BV6 A;  5HHF A;  4GDP A;  2C65 A;  4UDQ A;  3CN8 A;  5BUL A;  5BVA A;  1F8S A;  2C3C A;  4APN A;  3NNE A;  3VRA A;  1PBE A;  1DOE A;  2VQ7 A;  4EQR A;  4U8I A;  4A5L A;  5KOX A;  4TLZ A;  3UKQ A;  5FS7 A;  2V3B A;  2XYO A;  4NZH A;  1PXB A;  1NAA A;  3NGC X;  5KVI A;  4BJZ A;  3RP7 A;  5FS6 A;  2GRT A;  4CNJ A;  3NRN A;  1H6V A;  4TLX A;  3SYI A;  2X8H A;  4YSZ A;  2WP6 A;  3LXD A;  4ZN0 A;  1Y0P A;  3ICT A;  5KMP A;  1DJN A;  4WCT A;  4NWZ A;  4CRT A;  5HXI A;  4B68 A;  3PO7 A;  2XLU A;  2GR1 A;  3L8K A;  1RSG A;  3Q9T A;  2R4J A;  1Q1W A;  3FBS A;  4REK A;  2AAQ A;  4JNQ A;  2Z5Y A;  2YLR A;  2YG6 A;  3AE7 A;  4C74 A;  2Y6R A;  1O95 A;  1H83 A;  5U25 A;  3UKF A;  4H7U A;  3V3O A;  4O5Q A;  1GER A;  1Q1R A;  3C4N A;  5IPY A;  1CJC A;  1F3P A;  3Q6J A;  1KFY A;  3CIR A;  3DGH A;  4H4U A;  4E0V A;  2AQJ A;  2B76 A;  3HYW A;  2GMH A;  4GRT A;  3AE5 A;  3VQR A;  5JCN A;  2RAB A;  3F8D A;  1P2E A;  4C3X A;  5JCI A;  3PVC A;  1GRH A;  1B5Q A;  1N4W A;  4Z26 A;  3GYI A;  1B8S A;  2XCG A;  2F5Z A;  2XLP A;  3LZX A;  2XFU A;  4YWO A;  1TDK A;  1YY5 A;  2BAB A;  1H81 A;  1NEN A;  2XLS A;  1VQW A;  3NT6 A;  3P4Q A;  4H4T A;  4NTE A;  2YM1 A;  2C64 A;  2YVG A;  3GYJ A;  3CNT A;  2PYX A;  3HYV A;  2VVM A;  4FDC B;  4IV9 A;  3S61 A;  5HYM A;  3C4A A;  2W0H A;  5EOW A;  3LZW A;  4C77 A;  1GRA A;  2EQ6 A;  3CGB A;  3DGZ A;  4XWR A;  4D04 A;  1ONF A;  2BS3 A;  4YSH A;  2YLT A;  3VRD B;  2BS2 A;  5TR3 A;  3KVE A;  2C66 A;  4ZCD A;  2WBA A;  5JCL A;  2JKC A;  1LQU A;  1NHP A;  3S5W A;  1E1N A;  1EL9 A;  1REO A;  3SY4 A;  2XVJ A;  4Y4M A;  4H2N A;  3EPT A;  4YTP A;  2JB3 A;  2GQF A;  3P1W A;  2YM2 A;  4C5O A;  2GF3 A;  2VVL A;  5U1O A;  3DJE A;  3M0O A;  1NHR A;  3P4S A;  1D7L A;  3K7M X;  4C3Y A;  3UCL A;  4XWZ A;  2BK4 A;  2UZZ A;  1DOC A;  1GEU A;  4GCM A;  1YQ3 A;  2X3N A;  1TDE A;  1EL7 A;  1CBO A;  2X8C A;  3CPJ G;  1NEK A;  4TM1 A;  4H4V A;  1CF3 A;  4K8D A;  2FJB A;  3AE1 A;  4DNA A;  1E1M A;  2EQ8 A;  2FJE A;  4Y4N A;  1PJ7 A;  4GF7 A;  3GDP A;  4YSY A;  3AEA A;  3LAD A;  3NKS A;  1JNZ A;  1F8R A;  1JRY A;  4O5U A;  5IQ1 A;  2R9Z A;  3HZL A;  2OA1 A;  3K7Q X;  1GV4 A;  1H7X A;  1JU2 A;  4YT0 A;  2B7S A;  1H7W A;  3AEG A;  4Y4L A;  3SQP A;  1CC2 A;  3SXI A;  4JN9 A;  4AT2 A;  1FL2 A;  3UKA A;  1TRB A;  2WOI A;  4NTD A;  4B1B A;  3K7T A;  2C70 A;  1ZOV A;  1F8W A;  1KSS A;  1K0J A;  2GV8 A;  3DME A;  2VVL G;  3KLJ A;  4JY2 A;  2CFY A;  5FS9 A;  3R9U A;  3GMB A;  2WP9 A;  3SZW A;  5KMS A;  1BGN A;  3BNM A;  3CPH G;  4DGK A;  1TYT A;  1XAN A;  2WPF A;  3SFE A;  2WHD A;  3BI4 A;  4UP3 A;  2EQ7 A;  4FK1 A;  2ARD A;  1O5W A;  1FEC A;  2BXS A;  1GND A;  2GAH B;  2YG3 A;  3JSK A;  3NK2 X;  4J56 A;  1VDC A;  3AE9 A;  2C4C A;  2R0C A;  1GRE A;  3AD9 B;  4ICY A;  4U8K A;  1E1L A;  2V6O A;  1PHH A;  2CDU A;  2GQW A;  3GWF A;  3IHM A;  1F6M A;  5EBK A;  1GTE A;  4G6H A;  2WOW A;  2GB0 A;  3P9U A;  1L0V A;  1ZK7 A;  3AD8 B;  1HYU A;  4CY8 A;  5ER0 A;  3DK8 A;  5U63 A;  3FPZ A;  1PJ5 A;  2V5Z A;  4K7Z A;  3DK9 A;  4USQ A;  3ATR A;  3KA7 A;  4K22 A;  3ADA B;  3IHG A;  4H4S A;  3QSE A;  3AEB A;  4A79 A;  2WP5 A;  2E5V A;  3FG2 P;  3AE6 A;  3I6D A;  1JNR A;  1JEH A;  4ADW A;  3UKL A;  5KMQ A;  4CCQ A;  1LPF A;  3NHO X;  1ZMD A;  2WS3 A;  4OPD A;  1COY A;  1VG0 A;  2J3N A;  1GRB A;  2IVE A;  1FEA A;  1CL0 A;  3NTA A;  3DH9 A;  2JBV A;  1IUX A;  3F8R A;  3ICR A;  1PBF A;  2WU5 A;  2XFN A;  2ZZC A;  3M13 A;  4H2R A;  2CUL A;  1DOD A;  2YLX A;  3RED A;  2Q7V A;  2YR4 A;  1XHC A;  2WOV A;  4TM4 A;  3UKK A;  1NG4 A;  2A87 A;  3ATQ A;  3SM8 A;  4G74 A;  3BHF A;  4H4Q A;  1BF3 A;  2DKH A;  4Z43 A;  2C72 A;  3QJ4 A;  1YKJ A;  2BCP A;  1TDN A;  3O0H A;  1IUS A;  2VQB A;  3GDN A;  1D4D A;  1ELI A;  2VRM A;  3ZYX A;  4GDE A;  1TDF A;  2WEU A;  3DJG X;  4K2X A;  4OCG A;  2XLT A;  3II4 A;  3UKH A;  2JK6 A;  4U8L A;  2O9Z A;  3T0K A;  4Z2T A;  3IC9 A;  2E4G A;  4EQW A;  1IJH A;  4RG3 A;  2OLO A;  2X99 A;  1ZDL A;  2AR8 A;  2RGO A;  4J33 A;  3AYJ A;  1BGJ A;  4PAB A;  2OAM A;  3CGE A;  4UDP A;  4OPC A;  4EMI A;  5M0Z A;  1PN0 A;  4Z25 A;  2X50 A;  1GPE A;  3UTG A;  4YTN A;  2GEW A;  4NNJ A;  1S3B A;  3NYF A;  3ZDN A;  1PXA A;  3PS9 A;  1Q9I A;  2GVC A;  2Q6U A;  3CTY A;  3AYI A;  1LVL A;  2YQU A;  5GSN A;  5KOW A;  2YLZ A;  1H82 A;  1M6I A;  3CNP A;  3G5S A;  4D03 A;  4GAP A;  3LOV A;  2WQY A;  3IWA A;  4H4X A;  1MXT A;  4OPI A;  1LV0 A;  3P4P A;  2VOU A;  3UP5 A;  2HQM A;  3AEE A;  4A6N B;  1TYP A;  4H4P A;  4Z2U A;  3T2Y A;  2A89 A;  4AOS A;  1YQ4 A;  3QVP A;  4H4R A;  4HA6 A;  2Q0L A;  2WDV A;  3B6D A;  3D8X A;  1LQT A;  2XDO A;  1Y56 B;  4DSG A;  2BK5 A;  4AOX A;  2B9X A;  3ABV A;  4B66 A;  2TPR A;  5KNL A;  2FJA A;  3L1R A;  4GUV A;  4JQ9 A;  4BJY A;  3KD9 A;  2WU2 A;  3OZ2 A;  2GAG B;  4X4J A;  2WDR A;  2BS4 A;  2XFP A;  2XVI A;  4PAA A;  3SGL A;  2NVK X;  3VR8 A;  2YLW A;  1CJ2 A;  4G73 A;  1NG3 A;  2XFQ A;  4U8P A;  1GTH A;  3AYL A;  3FIM B;  2BXR A;  2WPC A;  3RHA A;  1NPX A;  4BK1 A;  2WET A;  3AD7 B;  4BUR A;  3NLC A;  2V61 A;  2I0Z A;  5EB5 A;  4XXG A;  1W4X A;  1JRX A;  1BWC A;  2YAU A;  3RP8 A;  4GR1 A;  2Q0K A;  5KMR A;  1M64 A;  1BKW A;  2FBW A;  3AB1 A;  4HB9 A;  4K5S A;  3H4K A;  2B7R A;  3BI5 A;  1B4V A;  3GD3 A;  3CPI G;  3ICS A;  1P2H A;  2DKI A;  1PJ6 A;  5HY5 A;  1FOH A;  1LTX R;  1E1K A;  3KPK A;  4JNA A;  5KXJ A;  4YTM A;  1GRG A;  4J57 A;  1K4Q A;  3NG7 X;  2R0G A;  4G9K A;  2R46 A;  4A65 A;  2GR0 A;  2BCG G;  1N1P A;  2BRY A;  1DNC A;  1K0L A;  4P9S A;  1O94 A;  2ZBW A;  2PHH A;  2BRA A;  4EQX A;  3CND A;  4U8J A;  2B9W A;  3BHK A;  2ZZ0 A;  4M52 A;  4YKG A;  2BYB A;  3BNU A;  2BK3 A;  3SX6 A;  4B65 A;  4OPG A;  2H88 A;  2YR5 A;  4FK1 C;  1GET A;  1JOA A;  2C76 A;  3GD4 A;  4IVO B;  4UDR A;  3NYE A;  2XVH A;  5KVH A;  4J36 A;  4YKF A;  2OAL A;  3CNJ A;  1GAL A;  1QO8 A;  1GSN A;  3FMW A;  3H8I A;  3AXB A;  3F8P A;  3NK1 X;  1KNR A;  3T37 A;  5KRQ A;  1KDG A;  2CVJ A;  1B37 A;  3DJJ A;  3GMC A;  3M12 A;  2R45 A;  1KF6 A;  2YG7 A;  3ALM A;  3QSM A;  1KSU A;  2RGH A;  5DBJ A;  5J60 A;  3QSS A;  4YSX A;  3ISH A;  2GMJ A;  3AE8 A;  2YLS A;  3G5Q A;  1H84 A;  3SFD A;  2Z5X A;  1IUW A;  4USR A;  5JCK A;  2JAE A;  2GR3 A;  2GR2 A;  5FS8 A;  4LII A;  1IUU A;  1NHS A;  1GXF A;  2H89 A;  3ALL A;  4OPL A;  4ECH A;  1E39 A;  3T14 A;  2YVJ A;  1LJ1 A;  3NIX A;  3SZF A;  1BZL A;  3SZC A;  4CCR A;  2JB2 A;  4G6G A;  4I58 A;  4B67 A;  1TDO A;  4N9X A;  3UTF A;  2R4E A;  1EL8 A;  4CBQ A;  4J31 A;  5CKU A;  1EL5 A;  3EF6 A;  2C7G A;  4EM4 A;  3DK4 A;  3LJP A;  3NYC A;  4IA6 A;  3P4R A;  3CNS A;  2QCU A;  3AE4 A;  5CQF A;  3KU9 A;  1NDA A;  1OJC A;  3H8L A;  3QFA A;  1CJ3 A;  4J2W A;  4X9N A;  4U8M A;  3ALJ A;  3UTE A;  4EIQ A;  1OJA A;  3CMM A;  3D1C A;  1JRZ A;  4RG4 A;  3V76 A;  3KPF A;  4I59 A;  3SZ0 A;  4OPT A;  3LB8 A;  3UKP A;  1D4E A;  5LV9 A;  5M10 A;  1L9C A;  2XLR A;  3GRT A;  2APG A;  1X31 B;  1MOK A;  4J34 A;  1V59 A;  1DXL A;  3OC4 A;  2C67 A;  1PBB A;  2C73 A;  1SEZ A;  1OJ9 A;  1FCD A;  4DSH A;  4B64 A;  2NPX A;  4EM3 A;  2R0P A;  1E6E A;  1DJQ A;  4Z2R A;  3G5R A;  3ITJ A;  2YG5 A;  4II3 A;  4NEW A;  4H4Z A;  4OVI A;  3T31 A;  4ZCC A;  1N4U A;  1PXC A;  3K30 A;  3NH3 X;  3AED A;  3T2Z A;  4U2L A;  3UOV A;  2E1M A;  1ZOY A;  1EBD A;  4EIP A;  4YXD A;  1PS9 A;  4Z44 A;  3NK0 X;  4FX9 A;  4CY6 A;  4MJW A;  5J7X A;  1VRQ B;  4GAV A;  4BK3 A;  3UTH A;  1RYI A;  1S3E A;  2BA9 A;  2BAC A;  3T2K A;  3UOZ A;  4A9W A;  2IVD A;  4IVM B;  4H50 A;  4AP3 A;  3GWD A;  2XVE A;  1S2Q A;  4U2T A;  3BI2 A;  2YG4 A;  4LA1 A;  1IUV A;  2B9Y A;  2WDQ A;  1YQZ A;  1XDI A;  3GRS A;  3NN6 X;  1ZX9 A;  3UOY A;  1FEB A; 
#chains in the Genus database with same CATH homology
 5IQ4 A;  2IID A;  2C3D A;  1GOS A;  4TM3 A;  2BC1 A;  4H4W A;  5BUK A;  3C96 A;  4EMW A;  2QA1 A;  2QA2 A;  4KPR A;  1GRT A;  2Y6Q A;  4OPU A;  2WES A;  2V60 A;  4II2 A;  4A7A A;  3AEC A;  3VR9 A;  3EAN A;  4H2Q A;  2X8G A;  1D7Y A;  1DOB A;  5EB4 A;  1PDH A;  1H86 A;  2ACZ A;  4U2S A;  1VG9 A;  2FJD A;  4WX1 A;  1KNP A;  1OJD A;  1CC6 A;  3AE2 A;  5L46 A;  2GH5 A;  1ZP0 A;  1MO9 A;  4EQS A;  1PBD A;  4Z24 A;  3WE0 A;  2RGJ A;  1E7P A;  3NTD A;  1K0I A;  4NEV A;  1ZMC A;  4H4Y A;  2VRL A;  3GYX A;  4NTC A;  4AT0 A;  2EQ9 A;  2XVF A;  3EAO A;  4EMJ A;  1Z6L A;  1RP0 A;  5JCM A;  3QVR A;  1GT8 A;  1QLB A;  3QFB A;  3V3N A;  2V3A A;  2YVF A;  3COX A;  1GES A;  4H2P A;  4TM0 A;  4IA5 A;  3KKJ A;  3UOX A;  1D4C A;  2ZZB A;  3UP4 A;  3AE3 A;  3VRB A;  4RSL A;  5C2T A;  1NHQ A;  2WPE A;  1N4V A;  2QAE A;  3I3L A;  4A6N A;  2YWL A;  4LU6 A;  2C75 A;  1CHU A;  3AWI A;  4A99 A;  1ZY8 A;  3DJD A;  1XPQ A;  1CJ4 A;  5FMH A;  3RNM A;  5KWF A;  1D5T A;  2JB1 A;  3CGD A;  2YR6 A;  3CGC A;  5GRT A;  1AOG A;  4K5R A;  4JY3 A;  1Y56 A;  4U8N A;  4BK2 A;  3GSI A;  3IF9 A;  3RP6 A;  4X9M A;  3HYX A;  1QJD A;  1L9D A;  4JDR A;  2TMD A;  4B63 A;  4AP1 A;  2BC0 A;  1GRF A;  3AEF A;  2A8X A;  3NN0 X;  1OJT A;  1IUT A;  4CNK A;  2XFO A;  3B3R A;  1L9E A;  3DA1 A;  1S2Y A;  5BRT A;  3E1T A;  2VZ2 A;  1PBC A;  4U8O A;  3URH A;  1ZKQ A;  2OLN A;  1CC4 A;  1UKV G;  5C3J A;  4KX6 A;  4B69 A;  4BV6 A;  5HHF A;  4GDP A;  2C65 A;  4UDQ A;  3CN8 A;  5BUL A;  5BVA A;  1F8S A;  2C3C A;  4APN A;  3NNE A;  3VRA A;  1PBE A;  1DOE A;  2VQ7 A;  4EQR A;  4U8I A;  4A5L A;  5KOX A;  4TLZ A;  3UKQ A;  5FS7 A;  2V3B A;  2XYO A;  4NZH A;  1PXB A;  1NAA A;  3NGC X;  5KVI A;  4BJZ A;  3RP7 A;  5FS6 A;  2GRT A;  4CNJ A;  3NRN A;  1H6V A;  4TLX A;  3SYI A;  2X8H A;  4YSZ A;  2WP6 A;  3LXD A;  4ZN0 A;  1Y0P A;  3ICT A;  5KMP A;  1DJN A;  4WCT A;  4NWZ A;  4CRT A;  5HXI A;  4B68 A;  3PO7 A;  2XLU A;  2GR1 A;  3L8K A;  1RSG A;  3Q9T A;  2R4J A;  1Q1W A;  3FBS A;  4REK A;  2AAQ A;  4JNQ A;  2Z5Y A;  2YLR A;  2YG6 A;  3AE7 A;  4C74 A;  2Y6R A;  1O95 A;  1H83 A;  5U25 A;  3UKF A;  4H7U A;  3V3O A;  4O5Q A;  1GER A;  1Q1R A;  3C4N A;  5IPY A;  1CJC A;  1F3P A;  3Q6J A;  1KFY A;  3CIR A;  3DGH A;  4H4U A;  4E0V A;  2AQJ A;  2B76 A;  3HYW A;  2GMH A;  4GRT A;  3AE5 A;  3VQR A;  5JCN A;  2RAB A;  3F8D A;  1P2E A;  4C3X A;  5JCI A;  3PVC A;  1GRH A;  1B5Q A;  1N4W A;  4Z26 A;  3GYI A;  1B8S A;  2XCG A;  2F5Z A;  2XLP A;  3LZX A;  2XFU A;  4YWO A;  1TDK A;  1YY5 A;  2BAB A;  1H81 A;  1NEN A;  2XLS A;  1VQW A;  3NT6 A;  3P4Q A;  4H4T A;  4NTE A;  2YM1 A;  2C64 A;  2YVG A;  3GYJ A;  3CNT A;  2PYX A;  3HYV A;  2VVM A;  4FDC B;  4IV9 A;  3S61 A;  5HYM A;  3C4A A;  2W0H A;  5EOW A;  3LZW A;  4C77 A;  1GRA A;  2EQ6 A;  3CGB A;  3DGZ A;  4XWR A;  4D04 A;  1ONF A;  2BS3 A;  4YSH A;  2YLT A;  3VRD B;  2BS2 A;  5TR3 A;  3KVE A;  2C66 A;  4ZCD A;  2WBA A;  5JCL A;  2JKC A;  1LQU A;  1NHP A;  3S5W A;  1E1N A;  1EL9 A;  1REO A;  3SY4 A;  2XVJ A;  4Y4M A;  4H2N A;  3EPT A;  4YTP A;  2JB3 A;  2GQF A;  3P1W A;  2YM2 A;  4C5O A;  2GF3 A;  2VVL A;  5U1O A;  3DJE A;  3M0O A;  1NHR A;  3P4S A;  1D7L A;  3K7M X;  4C3Y A;  3UCL A;  4XWZ A;  2BK4 A;  2UZZ A;  1DOC A;  1GEU A;  4GCM A;  1YQ3 A;  2X3N A;  1TDE A;  1EL7 A;  1CBO A;  2X8C A;  3CPJ G;  1NEK A;  4TM1 A;  4H4V A;  1CF3 A;  4K8D A;  2FJB A;  3AE1 A;  4DNA A;  1E1M A;  2EQ8 A;  2FJE A;  4Y4N A;  1PJ7 A;  4GF7 A;  3GDP A;  4YSY A;  3AEA A;  3LAD A;  3NKS A;  1JNZ A;  1F8R A;  1JRY A;  4O5U A;  5IQ1 A;  2R9Z A;  3HZL A;  2OA1 A;  3K7Q X;  1GV4 A;  1H7X A;  1JU2 A;  4YT0 A;  2B7S A;  1H7W A;  3AEG A;  4Y4L A;  3SQP A;  1CC2 A;  3SXI A;  4JN9 A;  4AT2 A;  1FL2 A;  3UKA A;  1TRB A;  2WOI A;  4NTD A;  4B1B A;  3K7T A;  2C70 A;  1ZOV A;  1F8W A;  1KSS A;  1K0J A;  2GV8 A;  3DME A;  2VVL G;  3KLJ A;  4JY2 A;  2CFY A;  5FS9 A;  3R9U A;  3GMB A;  2WP9 A;  3SZW A;  5KMS A;  1BGN A;  3BNM A;  3CPH G;  4DGK A;  1TYT A;  1XAN A;  2WPF A;  3SFE A;  2WHD A;  3BI4 A;  4UP3 A;  2EQ7 A;  4FK1 A;  2ARD A;  1O5W A;  1FEC A;  2BXS A;  1GND A;  2GAH B;  2YG3 A;  3JSK A;  3NK2 X;  4J56 A;  1VDC A;  3AE9 A;  2C4C A;  2R0C A;  1GRE A;  3AD9 B;  4ICY A;  4U8K A;  1E1L A;  2V6O A;  1PHH A;  2CDU A;  2GQW A;  3GWF A;  3IHM A;  1F6M A;  5EBK A;  1GTE A;  4G6H A;  2WOW A;  2GB0 A;  3P9U A;  1L0V A;  1ZK7 A;  3AD8 B;  1HYU A;  4CY8 A;  5ER0 A;  3DK8 A;  5U63 A;  3FPZ A;  1PJ5 A;  2V5Z A;  4K7Z A;  3DK9 A;  4USQ A;  3ATR A;  3KA7 A;  4K22 A;  3ADA B;  3IHG A;  4H4S A;  3QSE A;  3AEB A;  4A79 A;  2WP5 A;  2E5V A;  3FG2 P;  3AE6 A;  3I6D A;  1JNR A;  1JEH A;  4ADW A;  3UKL A;  5KMQ A;  4CCQ A;  1LPF A;  3NHO X;  1ZMD A;  2WS3 A;  4OPD A;  1COY A;  1VG0 A;  2J3N A;  1GRB A;  2IVE A;  1FEA A;  1CL0 A;  3NTA A;  3DH9 A;  2JBV A;  1IUX A;  3F8R A;  3ICR A;  1PBF A;  2WU5 A;  2XFN A;  2ZZC A;  3M13 A;  4H2R A;  2CUL A;  1DOD A;  2YLX A;  3RED A;  2Q7V A;  2YR4 A;  1XHC A;  2WOV A;  4TM4 A;  3UKK A;  1NG4 A;  2A87 A;  3ATQ A;  3SM8 A;  4G74 A;  3BHF A;  4H4Q A;  1BF3 A;  2DKH A;  4Z43 A;  2C72 A;  3QJ4 A;  1YKJ A;  2BCP A;  1TDN A;  3O0H A;  1IUS A;  2VQB A;  3GDN A;  1D4D A;  1ELI A;  2VRM A;  3ZYX A;  4GDE A;  1TDF A;  2WEU A;  3DJG X;  4K2X A;  4OCG A;  2XLT A;  3II4 A;  3UKH A;  2JK6 A;  4U8L A;  2O9Z A;  3T0K A;  4Z2T A;  3IC9 A;  2E4G A;  4EQW A;  1IJH A;  4RG3 A;  2OLO A;  2X99 A;  1ZDL A;  2AR8 A;  2RGO A;  4J33 A;  3AYJ A;  1BGJ A;  4PAB A;  2OAM A;  3CGE A;  4UDP A;  4OPC A;  4EMI A;  5M0Z A;  1PN0 A;  4Z25 A;  2X50 A;  1GPE A;  3UTG A;  4YTN A;  2GEW A;  4NNJ A;  1S3B A;  3NYF A;  3ZDN A;  1PXA A;  3PS9 A;  1Q9I A;  2GVC A;  2Q6U A;  3CTY A;  3AYI A;  1LVL A;  2YQU A;  5GSN A;  5KOW A;  2YLZ A;  1H82 A;  1M6I A;  3CNP A;  3G5S A;  4D03 A;  4GAP A;  3LOV A;  2WQY A;  3IWA A;  4H4X A;  1MXT A;  4OPI A;  1LV0 A;  3P4P A;  2VOU A;  3UP5 A;  2HQM A;  3AEE A;  4A6N B;  1TYP A;  4H4P A;  4Z2U A;  3T2Y A;  2A89 A;  4AOS A;  1YQ4 A;  3QVP A;  4H4R A;  4HA6 A;  2Q0L A;  2WDV A;  3B6D A;  3D8X A;  1LQT A;  2XDO A;  1Y56 B;  4DSG A;  2BK5 A;  4AOX A;  2B9X A;  3ABV A;  4B66 A;  2TPR A;  5KNL A;  2FJA A;  3L1R A;  4GUV A;  4JQ9 A;  4BJY A;  3KD9 A;  2WU2 A;  3OZ2 A;  2GAG B;  4X4J A;  2WDR A;  2BS4 A;  2XFP A;  2XVI A;  4PAA A;  3SGL A;  2NVK X;  3VR8 A;  2YLW A;  1CJ2 A;  4G73 A;  1NG3 A;  2XFQ A;  4U8P A;  1GTH A;  3AYL A;  3FIM B;  2BXR A;  2WPC A;  3RHA A;  1NPX A;  4BK1 A;  2WET A;  3AD7 B;  4BUR A;  3NLC A;  2V61 A;  2I0Z A;  5EB5 A;  4XXG A;  1W4X A;  1JRX A;  1BWC A;  2YAU A;  3RP8 A;  4GR1 A;  2Q0K A;  5KMR A;  1M64 A;  1BKW A;  2FBW A;  3AB1 A;  4HB9 A;  4K5S A;  3H4K A;  2B7R A;  3BI5 A;  1B4V A;  3GD3 A;  3CPI G;  3ICS A;  1P2H A;  2DKI A;  1PJ6 A;  5HY5 A;  1FOH A;  1LTX R;  1E1K A;  3KPK A;  4JNA A;  5KXJ A;  4YTM A;  1GRG A;  4J57 A;  1K4Q A;  3NG7 X;  2R0G A;  4G9K A;  2R46 A;  4A65 A;  2GR0 A;  2BCG G;  1N1P A;  2BRY A;  1DNC A;  1K0L A;  4P9S A;  1O94 A;  2ZBW A;  2PHH A;  2BRA A;  4EQX A;  3CND A;  4U8J A;  2B9W A;  3BHK A;  2ZZ0 A;  4M52 A;  4YKG A;  2BYB A;  3BNU A;  2BK3 A;  3SX6 A;  4B65 A;  4OPG A;  2H88 A;  2YR5 A;  4FK1 C;  1GET A;  1JOA A;  2C76 A;  3GD4 A;  4IVO B;  4UDR A;  3NYE A;  2XVH A;  5KVH A;  4J36 A;  4YKF A;  2OAL A;  3CNJ A;  1GAL A;  1QO8 A;  1GSN A;  3FMW A;  3H8I A;  3AXB A;  3F8P A;  3NK1 X;  1KNR A;  3T37 A;  5KRQ A;  1KDG A;  2CVJ A;  1B37 A;  3DJJ A;  3GMC A;  3M12 A;  2R45 A;  1KF6 A;  2YG7 A;  3ALM A;  3QSM A;  1KSU A;  2RGH A;  5DBJ A;  5J60 A;  3QSS A;  4YSX A;  3ISH A;  2GMJ A;  3AE8 A;  2YLS A;  3G5Q A;  1H84 A;  3SFD A;  2Z5X A;  1IUW A;  4USR A;  5JCK A;  2JAE A;  2GR3 A;  2GR2 A;  5FS8 A;  4LII A;  1IUU A;  1NHS A;  1GXF A;  2H89 A;  3ALL A;  4OPL A;  4ECH A;  1E39 A;  3T14 A;  2YVJ A;  1LJ1 A;  3NIX A;  3SZF A;  1BZL A;  3SZC A;  4CCR A;  2JB2 A;  4G6G A;  4I58 A;  4B67 A;  1TDO A;  4N9X A;  3UTF A;  2R4E A;  1EL8 A;  4CBQ A;  4J31 A;  5CKU A;  1EL5 A;  3EF6 A;  2C7G A;  4EM4 A;  3DK4 A;  3LJP A;  3NYC A;  4IA6 A;  3P4R A;  3CNS A;  2QCU A;  3AE4 A;  5CQF A;  3KU9 A;  1NDA A;  1OJC A;  3H8L A;  3QFA A;  1CJ3 A;  4J2W A;  4X9N A;  4U8M A;  3ALJ A;  3UTE A;  4EIQ A;  1OJA A;  3CMM A;  3D1C A;  1JRZ A;  4RG4 A;  3V76 A;  3KPF A;  4I59 A;  3SZ0 A;  4OPT A;  3LB8 A;  3UKP A;  1D4E A;  5LV9 A;  5M10 A;  1L9C A;  2XLR A;  3GRT A;  2APG A;  1X31 B;  1MOK A;  4J34 A;  1V59 A;  1DXL A;  3OC4 A;  2C67 A;  1PBB A;  2C73 A;  1SEZ A;  1OJ9 A;  1FCD A;  4DSH A;  4B64 A;  2NPX A;  4EM3 A;  2R0P A;  1E6E A;  1DJQ A;  4Z2R A;  3G5R A;  3ITJ A;  2YG5 A;  4II3 A;  4NEW A;  4H4Z A;  4OVI A;  3T31 A;  4ZCC A;  1N4U A;  1PXC A;  3K30 A;  3NH3 X;  3AED A;  3T2Z A;  4U2L A;  3UOV A;  2E1M A;  1ZOY A;  1EBD A;  4EIP A;  4YXD A;  1PS9 A;  4Z44 A;  3NK0 X;  4FX9 A;  4CY6 A;  4MJW A;  5J7X A;  1VRQ B;  4GAV A;  4BK3 A;  3UTH A;  1RYI A;  1S3E A;  2BA9 A;  2BAC A;  3T2K A;  3UOZ A;  4A9W A;  2IVD A;  4IVM B;  4H50 A;  4AP3 A;  3GWD A;  2XVE A;  1S2Q A;  4U2T A;  3BI2 A;  2YG4 A;  4LA1 A;  1IUV A;  2B9Y A;  2WDQ A;  1YQZ A;  1XDI A;  3GRS A;  3NN6 X;  1ZX9 A;  3UOY A;  1FEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...