3NYEA

Crystal structure of pseudomonas aeruginosa d-arginine dehydrogenase in complex with imino-arginine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
381
structure length
381
Chain Sequence
HHHHHHPIEADYLVIGAGIAGASTGYWLSAHGRVVVLEREAQPGYHSTGRSAAHYTVAYGTPQVRALTAASRAFFDNPPAGFCEHPLLSPRPEMVVDFSDDPEELRRQYESGKALVPQMRLLDAEQACSIVPVLRRDKVFGATYDPTGADIDTDALHQGYLRGIRRNQGQVLCNHEALEIRRVDGAWEVRCDAGSYRAAVLVNAAGAWCDAIAGLAGVRPLGLQPKRRSAFIFAPPPGIDCHDWPMLVSLDESFYLKPDAGMLLGSPANADPVEAHDVQPEQLDIATGMYLIEEATTLTIRRPEHTWAGLRSFVADGDLVAGYAANAEGFFWVAAQGGYGIQTSAAMGEASAALIRHQPLPAHLREHGLDEAMLSPRRLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords D-Arginine Dehydrogenase
publication title Conformational changes and substrate recognition in Pseudomonas aeruginosa D-arginine dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 118
structure length 381
sequence length 381
ec nomenclature ec 1.4.99.6: D-arginine dehydrogenase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01266 DAO FAD dependent oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.10 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase, subunit A, domain 2 3nyeA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3nyeA01
1UKVG 4JQ9A 3O0HA 4ICYA 2DKIA 3FIMB 3V76A 4GR1A 1S2QA 1ZY8A 3DK8A 2YG3A 4RSLA 1YY5A 3ZNOA 3SQPA 3L1RA 2E5VA 1PJ5A 1F8RA 3RP6A 4B64A 3EANA 3F8DA 2Y6QA 1PXCA 4UDPA 1Q9IA 3SGLA 3GWDA 2JK6A 3NIXA 1W4XA 1Z6LA 2GQWA 4AT0A 4ECHA 5JCLA 5JCIA 2ZZCA 4EIQA 4JNQA 4H4XA 4DSGA 3COXA 2X8CA 2X8GA 3QSMA 2WS3A 2WETA 1QLBA 3FG2P 4J31A 2BABA 3NG7X 1GRFA 2E48A 3BNUA 3II4A 1L9EA 1D4CA 1LV0A 2CVJA 3NK2X 1CF3A 3BI4A 4FX9A 1GT8A 2WESA 2XCGA 3ZNNA 2V3BA 4C74A 4KPRA 2GR0A 2WEUA 4ZCCA 3EF6A 3NN0X 1E6EA 5BULA 1VG9A 1DJNA 2XVEA 4LIIA 3DGHA 2GMJA 1BGNA 3GSIA 3NYEA 4QFDA 2ARDA 1TYPA 1JOAA 1B5QA 3AEFA 1E1LA 3DMEA 3FPZA 1EL8A 3K30A 2YM1A 5KOWA 3K7MX 1GSNA 4P9SA 2B7SA 2CFYA 3GWFA 5FMHA 4C5OA 4H4UA 4U8LA 2ZZ0A 4CNJA 1GREA 3SFDA 2C67A 1YKJA 2B7RA 1RSGA 2FJAA 1PBEA 2WPCA 2YVJA 2VRMA 2AAQA 4J57A 2VRLA 4YJFB 1K0JA 3ICRA 2XLSA 5HYMA 3NGCX 1ZX9A 1NHPA 2BS4A 1EBDA 2AR8A 3NTAA 3AYJA 1F8SA 1XHCA 3NLCA 4B65A 1ONFA 1L9DA 5CKUA 1GV4A 1O95A 4O5UA 4H2NA 1AN9A 3KKJA 2IVDA 3VR8A 1B4VA 5ER0A 3C4NA 1D7YA 2YQUA 1FEAA 1F3PA 2C3CA 2WU2A 1NAAA 1GTEA 2YG5A 3AE3A 3EAOA 2BC1A 4J56A 3BHFA 3PVCA 4DNAA 2V5ZA 2YLWA 4OPGA 3G5QA 3QFAA 1Y56A 3BHKA 4DGKA 1OJAA 3ALJA 1RYIA 2GEWA 3JSKA 4BK2A 5FS6A 1D4EA 3K7QX 3QVRA 1C0PA 1IUVA 1NENA 4D03A 1PHHA 4CBQA 3FBSA 2WP9A 2Y6RA 1H82A 1IUWA 1GETA 3NK0X 3CGDA 5EB5A 1KFYA 5TR3A 3CPHG 1F6MA 2V3AA 3CGBA 1TDEA 1NG3A 4OPCA 2GR2A 3AEDA 4NZHA 1CJ3A 1O5WA 1DAOA 2VQ7A 2YAUA 2X3NA 4K5SA 4OCGA 2E4AA 2WBAA 4B68A 1PJ7A 4OPLA 2BK5A 1YQZA 3UKQA 4BV6A 4FK1A 2APGA 2B9WA 4HB9A 1S2YA 4Y4NA 3GYJA 1OJCA 4LA1A 3VRAA 1ZOYA 1GOSA 1BZLA 3M13A 4X9NA 2YLXA 3UTFA 4H2QA 4CY6A 4MJWA 1CHUA 2XVIA 3LZXA 2HQMA 1JU2A 4B63A 2QCUA 2PHHA 2BCGG 4UP3A 4GDEA 2B9XA 2E49A 4CCRA 2WDRA 2XYOA 3UTEA 3AEGA 2JAEA 3E1TA 3NYFA 3K7TA 3URHA 1H7WA 2C72A 5LV9A 3OZ2A 1CJ2A 1IJHA 2VVMA 3NKSA 4EMJA 3QJ4A 3PS9A 1CC2A 3DH9A 1NHSA 1XDIA 2R46A 4YJHB 3AEEA 3ALMA 2A8XA 2VQBA 3ALLA 3NT6A 1TDFA 3UP4A 4Z2TA 1AOGA 1DOEA 3AEBA 3GDNA 1E1MA 1N4VA 4H4RA 4U8OA 1CC6A 3P4RA 3RP8A 4DSHA 3G5SA 5BUKA 2JBVA 1DODA 3QSSA 4IV9A 4TM3A 1S3BA 1LVLA 1TDNA 1GTHA 3KLJA 3IHMA 1NHRA 1D5TA 2FJEA 5IQ1A 1V59A 2Q7VA 1DJQA 4Y4LA 3ICTA 1GEUA 3CNJA 5FS7A 3H8IA 3CNSA 4UDQA 3T37A 4I58A 3Q9TA 2OAMA 2OALA 4H4ZA 4YTNA 2B9YA 2WDQA 1COYA 3AE9A 1H83A 1RP0A 1IUTA 3CPIG 3I3LA 3DA1A 3CPJG 5JCNA 2C7GA 4IA5A 1E1KA 2B76A 4RG4A 3S61A 2X8HA 1BGJA 1Q1RA 3KU9A 4TM4A 1HYUA 1LJ1A 1C0LA 2C73A 2OLOA 3ZNPA 3UTHA 4B1BA 4BK1A 2O9ZA 2RGJA 2BA9A 3KPFA 4HA6A 5CQFA 2QA1A 4EQWA 3AE8A 2YLZA 3DJGX 2IIDA 1QJDA 4C3XA 4CCQA 1H81A 4BJYA 3I6DA 3DK9A 4IVMB 3AD8B 1NEKA 1GXFA 2PYXA 2WU5A 3GDPA 4B67A 3P9UA 2ACZA 1CJCA 4U2TA 4B69A 4A7AA 4B66A 2R4JA 3WGTA 1L0VA 2R0CA 4K7ZA 3LZWA 3P1WA 5IPYA 3AE7A 2Z5YA 4YKGA 4EQRA 4IVOB 1VG0A 2J3NA 1PBDA 3LB8A 3NH3X 1OJ9A 4PAAA 1NDAA 1PS9A 3WE0A 4WCTA 3L8KA 3UKFA 1BF3A 4H7UA 1VDCA 3P4QA 3UOXA 3PO7A 2H88A 3DJDA 3VRDB 4E0VA 4YSYA 2DKHA 2C75A 2C64A 4ZCDA 2Q0LA 1PN0A 4JDRA 4OPUA 3CIRA 1E39A 5EBKA 2BC0A 5KOXA 2XFUA 4J33A 4Z43A 4A5LA 2YLRA 3RHAA 3CNDA 4YSHA 4A6NA 2DU8A 1JNRA 3CNTA 2JB2A 4EQXA 3VR9A 1H84A 1EVIA 2VZ2A 4H4TA 2CDUA 3UKPA 2R0PA 5M10A 4K2XA 2BS2A 2C66A 2A87A 1D7LA 1VRQB 3IC9A 2GRTA 3C96A 3ADAB 2XVHA 2OLNA 3W4KA 1ZMCA 2WP5A 2E1MA 5IQ4A 5J7XA 1SEZA 1BWCA 4GF7A 4GDPA 3NK1X 5DBJA 4JN9A 3RNMA 2C76A 1MO9A 3UOVA 4Z25A 2YM2A 4ADWA 1F8WA 3GD3A 1KF6A 2GQFA 5C3JA 5J60A 1PJ6A 4AOSA 3HZLA 3NNEA 4OPTA 1MOKA 4AOXA 2YR5A 5FS9A 5HXIA 1E7PA 2C70A 2GVCA 4BURA 1GESA 3H4KA 1P2EA 2GV8A 1IUXA 1VE9A 2E82A 2TPRA 1QO8A 4GCMA 2YR4A 1L9CA 3CGCA 4I59A 2FBWA 2WQYA 2YLSA 4AT2A 1PXBA 2XFNA 4NTCA 4ZN0A 1EL7A 1GRHA 4K8DA 2VOUA 2XLTA 4KX6A 5JCMA 3AE1A 3BI2A 1CBOA 2WPEA 3AE2A 2FJBA 2XVJA 2Q6UA 3S5WA 3P4SA 3DJEA 3QFBA 5GRTA 3F8PA 4U2SA 2JB3A 4H4YA 4NTDA 1GRAA 4JY2A 3GRSA 2JKCA 2ZBWA 1NPXA 1DXLA 2ZZBA 4CRTA 2R45A 2NPXA 3AB1A 4H50A 4D04A 3GYIA 4TLXA 2RGOA 4CNKA 1DDOA 2Z5XA 1NG4A 2WOWA 3ICSA 1N4UA 1LTXR 4XWZA 3G5RA 4QFCA 2H89A 4REKA 1B8SA 4YTMA 1PXAA 4EQSA 2EQ7A 3LJPA 2RGHA 4USQA 2C3DA 1GRBA 1ZMDA 4OPDA 4YKFA 4PABA 3LOVA 4Z44A 2GAHB 3KA7A 3B3RA 4X4JA 1CC4A 1REOA 2BS3A 4BJZA 1M64A 4XWRA 4YJFA 3B6DA 4GRTA 4LU6A 4Y4MA 2X99A 4U8MA 5BVAA 3OC4A 4WX1A 1EL9A 2XDOA 2BXRA 5KRQA 3UKKA 3SM8A 4RG3A 4IA6A 2BCPA 3AEAA 4Z24A 1GRTA 2BXSA 2YG6A 4FDCB 4J34A 1GALA 2QAEA 1JEHA 4XXGA 1TRBA 2GH5A 3D8XA 3UCLA 1ZP0A 3EPTA 2E4GA 4EM3A 1KSSA 5GSNA 5KWFA 5FS8A 1Q1WA 1C0KA 3M12A 2XLRA 3UOYA 4YTPA 5M0ZA 3C4AA 1DOCA 2GB0A 1E1NA 3AE5A 3ZDNA 2BK4A 2VVLG 2AQJA 4H4WA 3R9UA 4A79A 2XFQA 3NYCA 1GPEA 4BK3A 3M0OA 4FK1C 4NEWA 3BI5A 1FL2A 5KXJA 5EB4A 4A65A 1D4DA 1PBBA 4TM1A 1FEBA 4J36A 3UTGA 4YJGB 4USRA 4UDRA 4EMWA 3UKHA 4O5QA 1BKWA 5HHFA 1N1PA 2XLUA 3UKAA 3QVPA 2X50A 1DNCA 1H6VA 2V61A 2W0HA 2WOVA 2XVFA 4YSZA 3AD7B 5JCKA 1XANA 3NHOX 4C3YA 1KNPA 1O94A 3ISHA 4U2LA 2F5ZA 1TDKA 3ATQA 1DOBA 1YQ3A 3GRTA 5KVHA 3KD9A 3UKLA 2YG4A 4YSXA 1KIFA 4U8PA 2C65A 2EQ9A 2WP6A 3IHGA 4H4PA 3DK4A 4Z2UA 1ZDLA 4NTEA 3CTYA 3DJJA 4J2WA 4EMIA 3AXBA 1CJ4A 3AYLA 1XPQA 1X31B 1JNZA 4CY8A 1TDOA 4JNAA 3UP5A 1PBFA 3REDA 1H7XA 1C0IA 1LQUA 1YQ4A 3FMWA 3NRNA 3LADA 4U8NA 3ZYXA 4AP1A 2YR6A 2I0ZA 4H4VA 2R4EA 2WDVA 2BYBA 1TYTA 3IF9A 4GUVA 1PDHA 3DGZA 2GR1A 3CN8A 1M6IA 3BNMA 1IUSA 1B37A 1FECA 3AE4A 3ATRA 1S3EA 1EL5A 2VVLA 4N9XA 5U1OA 2XFOA 1GERA 3UOZA 1FOHA 2YLTA 3F8RA 4JY3A 1ZK7A 4YT0A 3ZNQA 1IUUA 4YXDA 3RP7A 4YJHA 2YWLA 2WPFA 1K0LA 2IVEA 3AD9B 2EQ6A 3QSEA 1OJTA 3ABVA 4OPIA 5HY5A 3W4JA 1ZKQA 3G3EA 3IWAA 2NVKX 2WOIA 3NTDA 4H2PA 4NEVA 4U8KA 1ELIA 2GAGB 1ZOVA 1NHQA 1P2HA 1K0IA 2BACA 3AECA 3D1CA 3GMBA 3Q6JA 4H2RA 1FCDA 4U8JA 4U8IA 3KVEA 2GMHA 1MXTA 4APNA 3W4IA 1VQWA 1H86A 4Z2RA 2XLPA 3V3NA 4EIPA 1KSUA 2FJDA 4H4QA 2A89A 3AWIA 4YWOA 1KDGA 3CUKA 3AYIA 3CGEA 1JRXA 4YJDA 2V60A 4EM4A 2EQ8A 5BRTA 1KNRA 5KVIA 4C77A 5L46A 1K4QA 4A6NB 5EOWA 3LXDA 1OJDA 3P4PA 3VRBA 1PBCA 4A9WA 1Y0PA 1Y56B 2XFPA 3CNPA 4H4SA 2V6OA 1N4WA 1LQTA 1JRZA 2CULA 2YVFA 4A99A 3GMCA 1GNDA 3VQRA 2UZZA 2OA1A 2WHDA 3ITJA 3V3OA 4M52A 1GRGA 4OVIA 2Q0KA 4X9MA 4K22A 3SFEA 1CL0A 2GR3A 2RABA 4Z26A 3NN6X 3GD4A 2YVGA 2GF3A 3AE6A 4AP3A 2R9ZA 3H8LA 5U63A 4TLZA 4YJGA 5U25A 2R0GA 4K5RA 2YG7A 1LPFA 2BK3A 1JRYA 5C2TA 2QA2A 2TMDA 2JB1A 4TM0A
chains in the Genus database with same CATH superfamily
1UKVG 4JQ9A 3O0HA 4ICYA 2DKIA 3FIMB 3V76A 4GR1A 1S2QA 1ZY8A 3DK8A 2YG3A 4RSLA 1YY5A 3ZNOA 3SQPA 3L1RA 2E5VA 1PJ5A 1F8RA 3SX6A 4B64A 3EANA 3F8DA 2Y6QA 1PXCA 4UDPA 1Q9IA 3SGLA 3GWDA 2JK6A 3NIXA 1W4XA 1Z6LA 2GQWA 4AT0A 4ECHA 5JCLA 5JCIA 2ZZCA 3SZCA 4EIQA 4JNQA 4H4XA 4DSGA 3COXA 2X8CA 2X8GA 3QSMA 2WS3A 2WETA 1QLBA 3FG2P 4J31A 2BABA 3NG7X 1GRFA 2E48A 3BNUA 3II4A 1L9EA 1D4CA 1LV0A 2CVJA 3NK2X 1CF3A 3BI4A 4FX9A 1GT8A 2WESA 2XCGA 3ZNNA 2V3BA 4C74A 4KPRA 2GR0A 2WEUA 4ZCCA 3EF6A 3NN0X 1E6EA 5BULA 1VG9A 1DJNA 2XVEA 4LIIA 3DGHA 2GMJA 1BGNA 3GSIA 3NYEA 4QFDA 2ARDA 1TYPA 1JOAA 1B5QA 3AEFA 1E1LA 3DMEA 3FPZA 1EL8A 3K30A 2YM1A 4AP1A 5KOWA 3K7MX 1GSNA 4P9SA 2B7SA 2CFYA 3GWFA 5FMHA 4C5OA 4H4UA 4U8LA 2ZZ0A 4CNJA 1GREA 3SFDA 2C67A 1YKJA 2B7RA 1RSGA 2FJAA 1PBEA 2WPCA 2YVJA 2VRMA 2AAQA 4J57A 2VRLA 4YJFB 1K0JA 3ICRA 2XLSA 5HYMA 3NGCX 1ZX9A 1NHPA 2BS4A 1EBDA 2AR8A 3NTAA 3AYJA 1F8SA 1XHCA 3NLCA 4NWZA 1ONFA 1L9DA 5CKUA 4B65A 3CMMA 1GV4A 1O95A 4O5UA 4H2NA 1AN9A 3KKJA 2IVDA 3VR8A 1B4VA 5ER0A 3C4NA 1D7YA 2YQUA 1FEAA 1F3PA 2C3CA 2WU2A 1NAAA 1GTEA 2YG5A 3AE3A 3EAOA 2BC1A 4J56A 3BHFA 3PVCA 4DNAA 2V5ZA 2YLWA 4OPGA 3G5QA 3QFAA 1Y56A 3BHKA 4DGKA 1OJAA 3ALJA 1RYIA 4BK2A 2GEWA 3JSKA 5FS6A 1D4EA 3K7QX 3QVRA 1C0PA 1IUVA 1NENA 4D03A 1PHHA 4CBQA 3FBSA 2WP9A 2Y6RA 1H82A 1IUWA 1GETA 3NK0X 3CGDA 5EB5A 1KFYA 5TR3A 3CPHG 1F6MA 2V3AA 3CGBA 1TDEA 1NG3A 4OPCA 2GR2A 3AEDA 4NZHA 1CJ3A 1O5WA 1DAOA 2VQ7A 2YAUA 2X3NA 4K5SA 4OCGA 2E4AA 2WBAA 4B68A 1PJ7A 4OPLA 2BK5A 1YQZA 3UKQA 4BV6A 4FK1A 2APGA 2B9WA 4HB9A 4G6GA 1S2YA 4NNJA 4Y4NA 3GYJA 1OJCA 4LA1A 3VRAA 1ZOYA 1GOSA 1BZLA 3M13A 4X9NA 2YLXA 3UTFA 4H2QA 4CY6A 4MJWA 1CHUA 2XVIA 3LZXA 2HQMA 1JU2A 4B63A 2QCUA 2PHHA 2BCGG 4UP3A 2JB1A 4GDEA 2B9XA 2E49A 4CCRA 2WDRA 2XYOA 3T31A 3UTEA 3AEGA 3E1TA 2JAEA 3NYFA 3K7TA 3URHA 1H7WA 2C72A 5LV9A 3OZ2A 1CJ2A 1IJHA 2VVMA 3NKSA 4EMJA 3QJ4A 3PS9A 1CC2A 3DH9A 1NHSA 1XDIA 2R46A 4GAVA 4YJHB 3AEEA 3ALMA 3ALLA 2A8XA 2VQBA 3NT6A 1TDFA 3UP4A 4Z2TA 1AOGA 1DOEA 2C4CA 3AEBA 3GDNA 1E1MA 1N4VA 4H4RA 4U8OA 1CC6A 3P4RA 3RP8A 4DSHA 3G5SA 5BUKA 2JBVA 1DODA 3QSSA 4IV9A 4TM3A 1S3BA 4U8IA 1LVLA 3HYWA 1TDNA 1GTHA 3KLJA 3IHMA 3KPKA 1NHRA 1D5TA 2FJEA 5IQ1A 1V59A 2Q7VA 1DJQA 4Y4LA 3ICTA 1GEUA 3CNJA 5FS7A 3H8IA 3CNSA 4UDQA 3T37A 4I58A 3Q9TA 2OAMA 2OALA 4H4ZA 4YTNA 2B9YA 2WDQA 1COYA 3AE9A 1H83A 1RP0A 1IUTA 3CPIG 3I3LA 3DA1A 3CPJG 5JCNA 2C7GA 4IA5A 1E1KA 2B76A 4RG4A 3S61A 2X8HA 1BGJA 1Q1RA 3KU9A 4TM4A 1LJ1A 1HYUA 1C0LA 4BK1A 2OLOA 3ZNPA 2C73A 3UTHA 4B1BA 2RGJA 2O9ZA 2BA9A 3KPFA 4HA6A 5CQFA 2QA1A 4EQWA 3AE8A 2YLZA 3DJGX 5KMPA 2IIDA 1QJDA 4C3XA 4CCQA 1H81A 4BJYA 3I6DA 3DK9A 4IVMB 3AD8B 1NEKA 1GXFA 2PYXA 2WU5A 3GDPA 4B67A 3P9UA 2ACZA 1CJCA 4U2TA 4B69A 4A7AA 4B66A 2R4JA 3WGTA 1L0VA 2R0CA 4K7ZA 3LZWA 3P1WA 5IPYA 3AE7A 2Z5YA 4YKGA 4EQRA 4IVOB 1VG0A 2J3NA 1PBDA 3LB8A 3NH3X 1OJ9A 4PAAA 1NDAA 1PS9A 3WE0A 4WCTA 5KMSA 3L8KA 3SXIA 3UKFA 1BF3A 4H7UA 1VDCA 3P4QA 3UOXA 3PO7A 2H88A 3DJDA 3VRDB 4E0VA 4YSYA 4G9KA 2DKHA 2C75A 2C64A 4ZCDA 2Q0LA 1PN0A 4JDRA 4OPUA 3CIRA 1E39A 5EBKA 2BC0A 5KOXA 2XFUA 4J33A 4Z43A 4A5LA 2YLRA 4G6HA 3RHAA 3CNDA 4YSHA 4A6NA 2DU8A 1JNRA 3CNTA 2JB2A 4EQXA 3VR9A 1H84A 1EVIA 2VZ2A 3GYXA 4H4TA 2CDUA 3UKPA 2R0PA 5M10A 4K2XA 2BS2A 2C66A 2A87A 1D7LA 1VRQB 3IC9A 2GRTA 4GAPA 3C96A 3ADAB 2XVHA 2OLNA 3W4KA 1ZMCA 2WP5A 2E1MA 5IQ4A 5J7XA 1SEZA 4GF7A 1BWCA 4GDPA 3NK1X 5DBJA 4JN9A 3RNMA 2C76A 3T14A 1MO9A 3UOVA 4Z25A 2YM2A 4ADWA 1F8WA 3GD3A 1KF6A 2GQFA 5C3JA 5J60A 1PJ6A 4AOSA 3HZLA 3NNEA 4OPTA 1MOKA 4AOXA 2YR5A 5HXIA 5FS9A 1E7PA 2C70A 2GVCA 4BURA 1GESA 3H4KA 1P2EA 2GV8A 1IUXA 1VE9A 2E82A 2TPRA 1QO8A 4GCMA 2YR4A 1L9CA 3CGCA 4I59A 2FBWA 2WQYA 2YLSA 4AT2A 1PXBA 2XFNA 4NTCA 4ZN0A 1EL7A 1GRHA 4K8DA 2VOUA 2XLTA 4KX6A 5JCMA 5KMRA 3AE1A 3BI2A 1CBOA 2WPEA 3AE2A 2FJBA 2XVJA 2Q6UA 3S5WA 2BRYA 3SZFA 3P4SA 3DJEA 3QFBA 5GRTA 3F8PA 4U2SA 2JB3A 4H4YA 4NTDA 1GRAA 4JY2A 3GRSA 2JKCA 2ZBWA 1NPXA 1DXLA 2ZZBA 4CRTA 2R45A 2NPXA 3AB1A 4H50A 4D04A 3GYIA 4TLXA 2RGOA 4CNKA 1DDOA 2Z5XA 1NG4A 2WOWA 3ICSA 1N4UA 1LTXR 4XWZA 3G5RA 4QFCA 2H89A 4REKA 1B8SA 4YTMA 3T2KA 1PXAA 4EQSA 2EQ7A 3LJPA 3SYIA 2RGHA 4USQA 2C3DA 1GRBA 1ZMDA 4OPDA 4YKFA 4PABA 3LOVA 4Z44A 2GAHB 3KA7A 3B3RA 4X4JA 1CC4A 1REOA 2BS3A 4BJZA 1M64A 4XWRA 4YJFA 3B6DA 4GRTA 4LU6A 4Y4MA 2X99A 4U8MA 3SZWA 5BVAA 3OC4A 4WX1A 1EL9A 2XDOA 2BXRA 5KRQA 3UKKA 3SM8A 4RG3A 4IA6A 2BCPA 3AEAA 4Z24A 1GRTA 2BXSA 2YG6A 4FDCB 4J34A 1GALA 4G74A 2QAEA 1JEHA 4XXGA 1TRBA 2GH5A 3D8XA 3UCLA 1ZP0A 3EPTA 2E4GA 4EM3A 1KSSA 5GSNA 5KWFA 5FS8A 1Q1WA 1C0KA 3M12A 2XLRA 4II2A 3UOYA 4YTPA 5M0ZA 3C4AA 1DOCA 2GB0A 1E1NA 3AE5A 3ZDNA 2BK4A 2VVLG 2AQJA 4H4WA 3R9UA 4A79A 2XFQA 3NYCA 1GPEA 4BK3A 3M0OA 4FK1C 3HYXA 4NEWA 3BI5A 1FL2A 5KXJA 5EB4A 4A65A 1D4DA 1PBBA 4TM1A 1FEBA 4J36A 3UTGA 4YJGB 4USRA 4UDRA 4EMWA 3UKHA 4O5QA 1BKWA 5HHFA 1N1PA 2XLUA 3UKAA 3QVPA 2X50A 1DNCA 1H6VA 2V61A 2W0HA 2WOVA 2XVFA 3SY4A 3AD7B 4YSZA 5JCKA 1XANA 3NHOX 4C3YA 1KNPA 1O94A 3ISHA 4U2LA 2F5ZA 1TDKA 3ATQA 1DOBA 1YQ3A 3GRTA 5KVHA 3KD9A 3UKLA 2YG4A 4YSXA 1KIFA 4U8PA 3T2YA 2C65A 3IHGA 2EQ9A 2WP6A 4H4PA 3DK4A 4Z2UA 1ZDLA 5KMQA 4NTEA 3CTYA 3DJJA 4J2WA 4EMIA 3AXBA 1CJ4A 3AYLA 1XPQA 1X31B 1JNZA 4CY8A 1TDOA 4JNAA 3UP5A 1PBFA 3REDA 1H7XA 1C0IA 1LQUA 1YQ4A 2BRAA 3FMWA 3LADA 3NRNA 4U8NA 3ZYXA 2YR6A 2I0ZA 4H4VA 2R4EA 2WDVA 2BYBA 1TYTA 3IF9A 4GUVA 1PDHA 3T2ZA 3DGZA 2GR1A 3CN8A 1M6IA 3BNMA 1IUSA 1B37A 1FECA 3AE4A 3ATRA 1S3EA 1EL5A 2VVLA 4N9XA 5U1OA 2XFOA 1GERA 3UOZA 1FOHA 4JY3A 2YLTA 3F8RA 1ZK7A 4YT0A 3ZNQA 1IUUA 4YXDA 3RP7A 4YJHA 2YWLA 2WPFA 1K0LA 2IVEA 3AD9B 2EQ6A 3QSEA 1OJTA 3ABVA 4OPIA 5HY5A 3W4JA 1ZKQA 3G3EA 3IWAA 2NVKX 4H2PA 2WOIA 3NTDA 4NEVA 4U8KA 3SZ0A 1ELIA 2GAGB 1ZOVA 1NHQA 1P2HA 1K0IA 2BACA 3GMBA 3AECA 3D1CA 4H2RA 3Q6JA 1FCDA 4II3A 4U8JA 3KVEA 2GMHA 1MXTA 4APNA 3W4IA 1VQWA 1H86A 4G73A 4Z2RA 2XLPA 3V3NA 4EIPA 1KSUA 2FJDA 4H4QA 2A89A 3AWIA 4YWOA 5KNLA 1KDGA 3CUKA 3AYIA 3CGEA 1JRXA 4YJDA 2V60A 4EM4A 2EQ8A 5BRTA 1KNRA 5KVIA 4C77A 5L46A 1K4QA 4A6NB 5EOWA 3LXDA 1OJDA 3P4PA 3VRBA 1PBCA 4A9WA 1Y0PA 1Y56B 2XFPA 3CNPA 4H4SA 2V6OA 1N4WA 1LQTA 1JRZA 2CULA 2YVFA 4A99A 3GMCA 1GNDA 3VQRA 2UZZA 2OA1A 2WHDA 3ITJA 3V3OA 3HYVA 4M52A 1GRGA 4OVIA 3T0KA 2Q0KA 4K22A 4X9MA 3SFEA 1CL0A 2GR3A 2RABA 4Z26A 3NN6X 3GD4A 2YVGA 2GF3A 3AE6A 4AP3A 2R9ZA 3H8LA 5U63A 4TLZA 4YJGA 5U25A 2R0GA 4K5RA 2YG7A 1LPFA 2BK3A 1JRYA 5C2TA 2QA2A 2TMDA 3RP6A 4TM0A
chains in the Genus database with same CATH topology
1UKVG 4JQ9A 3O0HA 4ICYA 2DKIA 3FIMB 3V76A 4GR1A 1S2QA 1ZY8A 3DK8A 2YG3A 4RSLA 1YY5A 3ZNOA 3SQPA 3L1RA 2E5VA 1PJ5A 1F8RA 3RP6A 3SX6A 4B64A 3EANA 3F8DA 2Y6QA 1PXCA 4UDPA 1Q9IA 3SGLA 3GWDA 2JK6A 3NIXA 1W4XA 1Z6LA 2GQWA 4AT0A 4ECHA 5JCLA 5JCIA 2ZZCA 3SZCA 4EIQA 4JNQA 4H4XA 4DSGA 3COXA 2X8CA 2X8GA 3QSMA 2WS3A 2WETA 1QLBA 3FG2P 4J31A 2BABA 3NG7X 1GRFA 2E48A 3BNUA 3II4A 1L9EA 1D4CA 1LV0A 2CVJA 3NK2X 1CF3A 3BI4A 4FX9A 1GT8A 2WESA 2XCGA 3ZNNA 2V3BA 4C74A 4KPRA 2GR0A 2WEUA 4ZCCA 3EF6A 3NN0X 1E6EA 5BULA 1VG9A 1DJNA 2XVEA 4LIIA 3DGHA 2GMJA 1BGNA 3GSIA 3NYEA 4QFDA 2ARDA 1TYPA 1JOAA 1B5QA 3AEFA 1E1LA 3DMEA 3FPZA 1EL8A 3K30A 2YM1A 4AP1A 5KOWA 3K7MX 1GSNA 4P9SA 2B7SA 2CFYA 3GWFA 5FMHA 4C5OA 4H4UA 4U8LA 2ZZ0A 4CNJA 1GREA 3SFDA 2C67A 1YKJA 2B7RA 1RSGA 2FJAA 1PBEA 2WPCA 2YVJA 2VRMA 2AAQA 4J57A 2VRLA 4YJFB 1K0JA 3ICRA 2XLSA 5HYMA 3NGCX 1ZX9A 1NHPA 2BS4A 1EBDA 2AR8A 3NTAA 3AYJA 1F8SA 1XHCA 3NLCA 4NWZA 1ONFA 1L9DA 5CKUA 4B65A 3CMMA 1GV4A 1O95A 4O5UA 4H2NA 1AN9A 3KKJA 2IVDA 3VR8A 1B4VA 5ER0A 3C4NA 1D7YA 2YQUA 1FEAA 1F3PA 2C3CA 2WU2A 1NAAA 1GTEA 2YG5A 3AE3A 3EAOA 2BC1A 4J56A 3BHFA 3PVCA 4DNAA 2V5ZA 2YLWA 4OPGA 3G5QA 3QFAA 1Y56A 3BHKA 4DGKA 1OJAA 3ALJA 1RYIA 2GEWA 3JSKA 4BK2A 5FS6A 1D4EA 3K7QX 3QVRA 1C0PA 1IUVA 1NENA 4D03A 1PHHA 4CBQA 3FBSA 2WP9A 2Y6RA 1H82A 1IUWA 1GETA 3NK0X 3CGDA 5EB5A 1KFYA 5TR3A 3CPHG 1F6MA 2V3AA 3CGBA 1TDEA 1NG3A 4OPCA 2GR2A 3AEDA 4NZHA 1CJ3A 1O5WA 1DAOA 2VQ7A 2YAUA 2X3NA 4K5SA 4OCGA 2E4AA 2WBAA 4B68A 1PJ7A 4OPLA 2BK5A 1YQZA 3UKQA 4BV6A 4FK1A 2APGA 2B9WA 4HB9A 4G6GA 1S2YA 4NNJA 4Y4NA 3GYJA 1OJCA 4LA1A 3VRAA 1ZOYA 1GOSA 1BZLA 3M13A 4X9NA 2YLXA 3UTFA 4H2QA 4CY6A 4MJWA 1CHUA 2XVIA 3LZXA 2HQMA 1JU2A 4B63A 2QCUA 2PHHA 2BCGG 4UP3A 4GDEA 2B9XA 2E49A 4CCRA 2WDRA 2XYOA 3T31A 3UTEA 3AEGA 2JAEA 3E1TA 3NYFA 3K7TA 3URHA 1H7WA 2C72A 5LV9A 3OZ2A 1CJ2A 1IJHA 2VVMA 3NKSA 4EMJA 3QJ4A 3PS9A 1CC2A 3DH9A 1NHSA 1XDIA 2R46A 4GAVA 4YJHB 3AEEA 3ALMA 2A8XA 2VQBA 3ALLA 3NT6A 1TDFA 3UP4A 4Z2TA 1AOGA 1DOEA 2C4CA 3AEBA 3GDNA 1E1MA 1N4VA 4H4RA 4U8OA 1CC6A 3P4RA 3RP8A 4DSHA 3G5SA 5BUKA 2JBVA 1DODA 3QSSA 4IV9A 4TM3A 1S3BA 4U8IA 1LVLA 3HYWA 1TDNA 1GTHA 3KLJA 3IHMA 3KPKA 1NHRA 1D5TA 2FJEA 5IQ1A 1V59A 2Q7VA 1DJQA 4Y4LA 3ICTA 1GEUA 3CNJA 5FS7A 3H8IA 3CNSA 4UDQA 3T37A 4I58A 3Q9TA 2OAMA 2OALA 4H4ZA 4YTNA 2B9YA 2WDQA 1COYA 3AE9A 1H83A 1RP0A 1IUTA 3CPIG 3I3LA 3DA1A 3CPJG 5JCNA 2C7GA 4IA5A 1E1KA 2B76A 4RG4A 3S61A 2X8HA 1BGJA 1Q1RA 3KU9A 4TM4A 1HYUA 1LJ1A 1C0LA 2C73A 2OLOA 3ZNPA 3UTHA 4B1BA 4BK1A 2O9ZA 2RGJA 2BA9A 3KPFA 4HA6A 5CQFA 2QA1A 4EQWA 3AE8A 2YLZA 3DJGX 5KMPA 2IIDA 1QJDA 4C3XA 4CCQA 1H81A 4BJYA 3I6DA 3DK9A 4IVMB 3AD8B 1NEKA 1GXFA 2PYXA 2WU5A 3GDPA 4B67A 3P9UA 2ACZA 1CJCA 4U2TA 4B69A 4A7AA 4B66A 2R4JA 3WGTA 1L0VA 2R0CA 4K7ZA 3LZWA 3P1WA 5IPYA 3AE7A 2Z5YA 4YKGA 4EQRA 4IVOB 1VG0A 2J3NA 1PBDA 3LB8A 3NH3X 1OJ9A 4PAAA 1NDAA 1PS9A 3WE0A 4WCTA 5KMSA 3L8KA 3SXIA 3UKFA 1BF3A 4H7UA 1VDCA 3P4QA 3UOXA 3PO7A 2H88A 3DJDA 3VRDB 4E0VA 4YSYA 4G9KA 2DKHA 2C75A 2C64A 4ZCDA 2Q0LA 1PN0A 4JDRA 4OPUA 3CIRA 1E39A 5EBKA 2BC0A 5KOXA 2XFUA 4J33A 4Z43A 4A5LA 2YLRA 4G6HA 3RHAA 3CNDA 4YSHA 4A6NA 2DU8A 1JNRA 3CNTA 2JB2A 4EQXA 3VR9A 1H84A 1EVIA 2VZ2A 3GYXA 4H4TA 2CDUA 3UKPA 2R0PA 5M10A 4K2XA 2BS2A 2C66A 2A87A 1D7LA 1VRQB 3IC9A 2GRTA 4GAPA 3C96A 3ADAB 2XVHA 2OLNA 3W4KA 1ZMCA 2WP5A 2E1MA 5IQ4A 5J7XA 1SEZA 1BWCA 4GF7A 4GDPA 3NK1X 5DBJA 4JN9A 3RNMA 2C76A 3T14A 1MO9A 3UOVA 4Z25A 2YM2A 4ADWA 1F8WA 3GD3A 1KF6A 2GQFA 5C3JA 5J60A 1PJ6A 4AOSA 3HZLA 3NNEA 4OPTA 1MOKA 4AOXA 2YR5A 5FS9A 5HXIA 1E7PA 2C70A 2GVCA 4BURA 1GESA 3H4KA 1P2EA 2GV8A 1IUXA 1VE9A 2E82A 2TPRA 1QO8A 4GCMA 2YR4A 1L9CA 3CGCA 4I59A 2FBWA 2WQYA 2YLSA 4AT2A 1PXBA 2XFNA 4NTCA 4ZN0A 1EL7A 1GRHA 4K8DA 2VOUA 2XLTA 4KX6A 5JCMA 5KMRA 3AE1A 3BI2A 1CBOA 2WPEA 3AE2A 2FJBA 2XVJA 2Q6UA 3S5WA 2BRYA 3SZFA 3P4SA 3DJEA 3QFBA 5GRTA 3F8PA 4U2SA 2JB3A 4H4YA 4NTDA 1GRAA 4JY2A 3GRSA 2JKCA 2ZBWA 1NPXA 1DXLA 2ZZBA 4CRTA 2R45A 2NPXA 3AB1A 4H50A 4D04A 3GYIA 4TLXA 2RGOA 4CNKA 1DDOA 2Z5XA 1NG4A 2WOWA 3ICSA 1N4UA 1LTXR 4XWZA 3G5RA 4QFCA 2H89A 4REKA 1B8SA 4YTMA 3T2KA 1PXAA 4EQSA 2EQ7A 3LJPA 3SYIA 2RGHA 4USQA 2C3DA 1GRBA 1ZMDA 4OPDA 4YKFA 4PABA 3LOVA 4Z44A 2GAHB 3KA7A 3B3RA 4X4JA 1CC4A 1REOA 2BS3A 4BJZA 1M64A 4XWRA 4YJFA 3B6DA 4GRTA 4LU6A 4Y4MA 2X99A 4U8MA 3SZWA 5BVAA 3OC4A 4WX1A 1EL9A 2XDOA 2BXRA 5KRQA 3UKKA 3SM8A 4RG3A 4IA6A 2BCPA 3AEAA 4Z24A 1GRTA 2BXSA 2YG6A 4FDCB 4J34A 1GALA 4G74A 2QAEA 1JEHA 4XXGA 1TRBA 2GH5A 3D8XA 3UCLA 1ZP0A 3EPTA 2E4GA 4EM3A 1KSSA 5GSNA 5KWFA 5FS8A 1Q1WA 1C0KA 3M12A 2XLRA 4II2A 3UOYA 4YTPA 5M0ZA 3C4AA 1DOCA 2GB0A 1E1NA 3AE5A 3ZDNA 2BK4A 2VVLG 2AQJA 4H4WA 3R9UA 4A79A 2XFQA 3NYCA 1GPEA 4BK3A 3M0OA 4FK1C 3HYXA 4NEWA 3BI5A 1FL2A 5KXJA 5EB4A 4A65A 1D4DA 1PBBA 4TM1A 1FEBA 4J36A 3UTGA 4YJGB 4USRA 4UDRA 4EMWA 3UKHA 4O5QA 1BKWA 5HHFA 1N1PA 2XLUA 3UKAA 3QVPA 2X50A 1DNCA 1H6VA 2V61A 2W0HA 2WOVA 2XVFA 3SY4A 3AD7B 4YSZA 5JCKA 1XANA 3NHOX 4C3YA 1KNPA 1O94A 3ISHA 4U2LA 2F5ZA 1TDKA 3ATQA 1DOBA 1YQ3A 3GRTA 5KVHA 3KD9A 3UKLA 2YG4A 4YSXA 1KIFA 4U8PA 3T2YA 2C65A 2EQ9A 2WP6A 3IHGA 4H4PA 3DK4A 4Z2UA 1ZDLA 5KMQA 4NTEA 3CTYA 3DJJA 4J2WA 4EMIA 3AXBA 1CJ4A 3AYLA 1XPQA 1X31B 1JNZA 4CY8A 1TDOA 4JNAA 3UP5A 1PBFA 3REDA 1H7XA 1C0IA 1LQUA 1YQ4A 2BRAA 3FMWA 3LADA 3NRNA 4U8NA 3ZYXA 2YR6A 2I0ZA 4H4VA 2R4EA 2WDVA 2BYBA 1TYTA 3IF9A 4GUVA 1PDHA 3T2ZA 3DGZA 2GR1A 3CN8A 1M6IA 3BNMA 1IUSA 1B37A 1FECA 3AE4A 3ATRA 1S3EA 1EL5A 2VVLA 4N9XA 5U1OA 2XFOA 1GERA 3UOZA 1FOHA 2YLTA 3F8RA 4JY3A 1ZK7A 4YT0A 3ZNQA 1IUUA 4YXDA 3RP7A 4YJHA 2YWLA 2WPFA 1K0LA 2IVEA 3AD9B 2EQ6A 3QSEA 1OJTA 3ABVA 4OPIA 5HY5A 3W4JA 1ZKQA 3G3EA 3IWAA 2NVKX 2WOIA 3NTDA 4H2PA 4NEVA 4U8KA 3SZ0A 1ELIA 2GAGB 1ZOVA 1NHQA 1P2HA 1K0IA 2BACA 3AECA 3D1CA 3GMBA 3Q6JA 4H2RA 1FCDA 4II3A 4U8JA 3KVEA 2GMHA 1MXTA 4APNA 3W4IA 1VQWA 1H86A 4G73A 4Z2RA 2XLPA 3V3NA 4EIPA 1KSUA 2FJDA 4H4QA 2A89A 3AWIA 4YWOA 5KNLA 1KDGA 3CUKA 3AYIA 3CGEA 1JRXA 4YJDA 2V60A 4EM4A 2EQ8A 5BRTA 1KNRA 5KVIA 4C77A 5L46A 1K4QA 4A6NB 5EOWA 3LXDA 1OJDA 3P4PA 3VRBA 1PBCA 4A9WA 1Y0PA 1Y56B 2XFPA 3CNPA 4H4SA 2V6OA 1N4WA 1LQTA 1JRZA 2CULA 2YVFA 4A99A 3GMCA 1GNDA 3VQRA 2UZZA 2OA1A 2WHDA 3ITJA 3V3OA 3HYVA 4M52A 1GRGA 4OVIA 3T0KA 2Q0KA 4X9MA 4K22A 3SFEA 1CL0A 2GR3A 2RABA 4Z26A 3NN6X 3GD4A 2YVGA 2GF3A 3AE6A 4AP3A 2R9ZA 3H8LA 5U63A 4TLZA 4YJGA 5U25A 2R0GA 4K5RA 2YG7A 1LPFA 2BK3A 1JRYA 5C2TA 2QA2A 2TMDA 2JB1A 4TM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UKV G;  4JQ9 A;  3O0H A;  4ICY A;  2DKI A;  3FIM B;  3V76 A;  4GR1 A;  1S2Q A;  1ZY8 A;  3DK8 A;  2YG3 A;  4RSL A;  1YY5 A;  3ZNO A;  3SQP A;  3L1R A;  2E5V A;  1PJ5 A;  1F8R A;  3RP6 A;  4B64 A;  3EAN A;  3F8D A;  2Y6Q A;  1PXC A;  4UDP A;  1Q9I A;  3SGL A;  3GWD A;  2JK6 A;  3NIX A;  1W4X A;  1Z6L A;  2GQW A;  4AT0 A;  4ECH A;  5JCL A;  5JCI A;  2ZZC A;  4EIQ A;  4JNQ A;  4H4X A;  4DSG A;  3COX A;  2X8C A;  2X8G A;  3QSM A;  2WS3 A;  2WET A;  1QLB A;  3FG2 P;  4J31 A;  2BAB A;  3NG7 X;  1GRF A;  2E48 A;  3BNU A;  3II4 A;  1L9E A;  1D4C A;  1LV0 A;  2CVJ A;  3NK2 X;  1CF3 A;  3BI4 A;  4FX9 A;  1GT8 A;  2WES A;  2XCG A;  3ZNN A;  2V3B A;  4C74 A;  4KPR A;  2GR0 A;  2WEU A;  4ZCC A;  3EF6 A;  3NN0 X;  1E6E A;  5BUL A;  1VG9 A;  1DJN A;  2XVE A;  4LII A;  3DGH A;  2GMJ A;  1BGN A;  3GSI A;  3NYE A;  4QFD A;  2ARD A;  1TYP A;  1JOA A;  1B5Q A;  3AEF A;  1E1L A;  3DME A;  3FPZ A;  1EL8 A;  3K30 A;  2YM1 A;  5KOW A;  3K7M X;  1GSN A;  4P9S A;  2B7S A;  2CFY A;  3GWF A;  5FMH A;  4C5O A;  4H4U A;  4U8L A;  2ZZ0 A;  4CNJ A;  1GRE A;  3SFD A;  2C67 A;  1YKJ A;  2B7R A;  1RSG A;  2FJA A;  1PBE A;  2WPC A;  2YVJ A;  2VRM A;  2AAQ A;  4J57 A;  2VRL A;  4YJF B;  1K0J A;  3ICR A;  2XLS A;  5HYM A;  3NGC X;  1ZX9 A;  1NHP A;  2BS4 A;  1EBD A;  2AR8 A;  3NTA A;  3AYJ A;  1F8S A;  1XHC A;  3NLC A;  4B65 A;  1ONF A;  1L9D A;  5CKU A;  1GV4 A;  1O95 A;  4O5U A;  4H2N A;  1AN9 A;  3KKJ A;  2IVD A;  3VR8 A;  1B4V A;  5ER0 A;  3C4N A;  1D7Y A;  2YQU A;  1FEA A;  1F3P A;  2C3C A;  2WU2 A;  1NAA A;  1GTE A;  2YG5 A;  3AE3 A;  3EAO A;  2BC1 A;  4J56 A;  3BHF A;  3PVC A;  4DNA A;  2V5Z A;  2YLW A;  4OPG A;  3G5Q A;  3QFA A;  1Y56 A;  3BHK A;  4DGK A;  1OJA A;  3ALJ A;  1RYI A;  2GEW A;  3JSK A;  4BK2 A;  5FS6 A;  1D4E A;  3K7Q X;  3QVR A;  1C0P A;  1IUV A;  1NEN A;  4D03 A;  1PHH A;  4CBQ A;  3FBS A;  2WP9 A;  2Y6R A;  1H82 A;  1IUW A;  1GET A;  3NK0 X;  3CGD A;  5EB5 A;  1KFY A;  5TR3 A;  3CPH G;  1F6M A;  2V3A A;  3CGB A;  1TDE A;  1NG3 A;  4OPC A;  2GR2 A;  3AED A;  4NZH A;  1CJ3 A;  1O5W A;  1DAO A;  2VQ7 A;  2YAU A;  2X3N A;  4K5S A;  4OCG A;  2E4A A;  2WBA A;  4B68 A;  1PJ7 A;  4OPL A;  2BK5 A;  1YQZ A;  3UKQ A;  4BV6 A;  4FK1 A;  2APG A;  2B9W A;  4HB9 A;  1S2Y A;  4Y4N A;  3GYJ A;  1OJC A;  4LA1 A;  3VRA A;  1ZOY A;  1GOS A;  1BZL A;  3M13 A;  4X9N A;  2YLX A;  3UTF A;  4H2Q A;  4CY6 A;  4MJW A;  1CHU A;  2XVI A;  3LZX A;  2HQM A;  1JU2 A;  4B63 A;  2QCU A;  2PHH A;  2BCG G;  4UP3 A;  4GDE A;  2B9X A;  2E49 A;  4CCR A;  2WDR A;  2XYO A;  3UTE A;  3AEG A;  2JAE A;  3E1T A;  3NYF A;  3K7T A;  3URH A;  1H7W A;  2C72 A;  5LV9 A;  3OZ2 A;  1CJ2 A;  1IJH A;  2VVM A;  3NKS A;  4EMJ A;  3QJ4 A;  3PS9 A;  1CC2 A;  3DH9 A;  1NHS A;  1XDI A;  2R46 A;  4YJH B;  3AEE A;  3ALM A;  2A8X A;  2VQB A;  3ALL A;  3NT6 A;  1TDF A;  3UP4 A;  4Z2T A;  1AOG A;  1DOE A;  3AEB A;  3GDN A;  1E1M A;  1N4V A;  4H4R A;  4U8O A;  1CC6 A;  3P4R A;  3RP8 A;  4DSH A;  3G5S A;  5BUK A;  2JBV A;  1DOD A;  3QSS A;  4IV9 A;  4TM3 A;  1S3B A;  1LVL A;  1TDN A;  1GTH A;  3KLJ A;  3IHM A;  1NHR A;  1D5T A;  2FJE A;  5IQ1 A;  1V59 A;  2Q7V A;  1DJQ A;  4Y4L A;  3ICT A;  1GEU A;  3CNJ A;  5FS7 A;  3H8I A;  3CNS A;  4UDQ A;  3T37 A;  4I58 A;  3Q9T A;  2OAM A;  2OAL A;  4H4Z A;  4YTN A;  2B9Y A;  2WDQ A;  1COY A;  3AE9 A;  1H83 A;  1RP0 A;  1IUT A;  3CPI G;  3I3L A;  3DA1 A;  3CPJ G;  5JCN A;  2C7G A;  4IA5 A;  1E1K A;  2B76 A;  4RG4 A;  3S61 A;  2X8H A;  1BGJ A;  1Q1R A;  3KU9 A;  4TM4 A;  1HYU A;  1LJ1 A;  1C0L A;  2C73 A;  2OLO A;  3ZNP A;  3UTH A;  4B1B A;  4BK1 A;  2O9Z A;  2RGJ A;  2BA9 A;  3KPF A;  4HA6 A;  5CQF A;  2QA1 A;  4EQW A;  3AE8 A;  2YLZ A;  3DJG X;  2IID A;  1QJD A;  4C3X A;  4CCQ A;  1H81 A;  4BJY A;  3I6D A;  3DK9 A;  4IVM B;  3AD8 B;  1NEK A;  1GXF A;  2PYX A;  2WU5 A;  3GDP A;  4B67 A;  3P9U A;  2ACZ A;  1CJC A;  4U2T A;  4B69 A;  4A7A A;  4B66 A;  2R4J A;  3WGT A;  1L0V A;  2R0C A;  4K7Z A;  3LZW A;  3P1W A;  5IPY A;  3AE7 A;  2Z5Y A;  4YKG A;  4EQR A;  4IVO B;  1VG0 A;  2J3N A;  1PBD A;  3LB8 A;  3NH3 X;  1OJ9 A;  4PAA A;  1NDA A;  1PS9 A;  3WE0 A;  4WCT A;  3L8K A;  3UKF A;  1BF3 A;  4H7U A;  1VDC A;  3P4Q A;  3UOX A;  3PO7 A;  2H88 A;  3DJD A;  3VRD B;  4E0V A;  4YSY A;  2DKH A;  2C75 A;  2C64 A;  4ZCD A;  2Q0L A;  1PN0 A;  4JDR A;  4OPU A;  3CIR A;  1E39 A;  5EBK A;  2BC0 A;  5KOX A;  2XFU A;  4J33 A;  4Z43 A;  4A5L A;  2YLR A;  3RHA A;  3CND A;  4YSH A;  4A6N A;  2DU8 A;  1JNR A;  3CNT A;  2JB2 A;  4EQX A;  3VR9 A;  1H84 A;  1EVI A;  2VZ2 A;  4H4T A;  2CDU A;  3UKP A;  2R0P A;  5M10 A;  4K2X A;  2BS2 A;  2C66 A;  2A87 A;  1D7L A;  1VRQ B;  3IC9 A;  2GRT A;  3C96 A;  3ADA B;  2XVH A;  2OLN A;  3W4K A;  1ZMC A;  2WP5 A;  2E1M A;  5IQ4 A;  5J7X A;  1SEZ A;  1BWC A;  4GF7 A;  4GDP A;  3NK1 X;  5DBJ A;  4JN9 A;  3RNM A;  2C76 A;  1MO9 A;  3UOV A;  4Z25 A;  2YM2 A;  4ADW A;  1F8W A;  3GD3 A;  1KF6 A;  2GQF A;  5C3J A;  5J60 A;  1PJ6 A;  4AOS A;  3HZL A;  3NNE A;  4OPT A;  1MOK A;  4AOX A;  2YR5 A;  5FS9 A;  5HXI A;  1E7P A;  2C70 A;  2GVC A;  4BUR A;  1GES A;  3H4K A;  1P2E A;  2GV8 A;  1IUX A;  1VE9 A;  2E82 A;  2TPR A;  1QO8 A;  4GCM A;  2YR4 A;  1L9C A;  3CGC A;  4I59 A;  2FBW A;  2WQY A;  2YLS A;  4AT2 A;  1PXB A;  2XFN A;  4NTC A;  4ZN0 A;  1EL7 A;  1GRH A;  4K8D A;  2VOU A;  2XLT A;  4KX6 A;  5JCM A;  3AE1 A;  3BI2 A;  1CBO A;  2WPE A;  3AE2 A;  2FJB A;  2XVJ A;  2Q6U A;  3S5W A;  3P4S A;  3DJE A;  3QFB A;  5GRT A;  3F8P A;  4U2S A;  2JB3 A;  4H4Y A;  4NTD A;  1GRA A;  4JY2 A;  3GRS A;  2JKC A;  2ZBW A;  1NPX A;  1DXL A;  2ZZB A;  4CRT A;  2R45 A;  2NPX A;  3AB1 A;  4H50 A;  4D04 A;  3GYI A;  4TLX A;  2RGO A;  4CNK A;  1DDO A;  2Z5X A;  1NG4 A;  2WOW A;  3ICS A;  1N4U A;  1LTX R;  4XWZ A;  3G5R A;  4QFC A;  2H89 A;  4REK A;  1B8S A;  4YTM A;  1PXA A;  4EQS A;  2EQ7 A;  3LJP A;  2RGH A;  4USQ A;  2C3D A;  1GRB A;  1ZMD A;  4OPD A;  4YKF A;  4PAB A;  3LOV A;  4Z44 A;  2GAH B;  3KA7 A;  3B3R A;  4X4J A;  1CC4 A;  1REO A;  2BS3 A;  4BJZ A;  1M64 A;  4XWR A;  4YJF A;  3B6D A;  4GRT A;  4LU6 A;  4Y4M A;  2X99 A;  4U8M A;  5BVA A;  3OC4 A;  4WX1 A;  1EL9 A;  2XDO A;  2BXR A;  5KRQ A;  3UKK A;  3SM8 A;  4RG3 A;  4IA6 A;  2BCP A;  3AEA A;  4Z24 A;  1GRT A;  2BXS A;  2YG6 A;  4FDC B;  4J34 A;  1GAL A;  2QAE A;  1JEH A;  4XXG A;  1TRB A;  2GH5 A;  3D8X A;  3UCL A;  1ZP0 A;  3EPT A;  2E4G A;  4EM3 A;  1KSS A;  5GSN A;  5KWF A;  5FS8 A;  1Q1W A;  1C0K A;  3M12 A;  2XLR A;  3UOY A;  4YTP A;  5M0Z A;  3C4A A;  1DOC A;  2GB0 A;  1E1N A;  3AE5 A;  3ZDN A;  2BK4 A;  2VVL G;  2AQJ A;  4H4W A;  3R9U A;  4A79 A;  2XFQ A;  3NYC A;  1GPE A;  4BK3 A;  3M0O A;  4FK1 C;  4NEW A;  3BI5 A;  1FL2 A;  5KXJ A;  5EB4 A;  4A65 A;  1D4D A;  1PBB A;  4TM1 A;  1FEB A;  4J36 A;  3UTG A;  4YJG B;  4USR A;  4UDR A;  4EMW A;  3UKH A;  4O5Q A;  1BKW A;  5HHF A;  1N1P A;  2XLU A;  3UKA A;  3QVP A;  2X50 A;  1DNC A;  1H6V A;  2V61 A;  2W0H A;  2WOV A;  2XVF A;  4YSZ A;  3AD7 B;  5JCK A;  1XAN A;  3NHO X;  4C3Y A;  1KNP A;  1O94 A;  3ISH A;  4U2L A;  2F5Z A;  1TDK A;  3ATQ A;  1DOB A;  1YQ3 A;  3GRT A;  5KVH A;  3KD9 A;  3UKL A;  2YG4 A;  4YSX A;  1KIF A;  4U8P A;  2C65 A;  2EQ9 A;  2WP6 A;  3IHG A;  4H4P A;  3DK4 A;  4Z2U A;  1ZDL A;  4NTE A;  3CTY A;  3DJJ A;  4J2W A;  4EMI A;  3AXB A;  1CJ4 A;  3AYL A;  1XPQ A;  1X31 B;  1JNZ A;  4CY8 A;  1TDO A;  4JNA A;  3UP5 A;  1PBF A;  3RED A;  1H7X A;  1C0I A;  1LQU A;  1YQ4 A;  3FMW A;  3NRN A;  3LAD A;  4U8N A;  3ZYX A;  4AP1 A;  2YR6 A;  2I0Z A;  4H4V A;  2R4E A;  2WDV A;  2BYB A;  1TYT A;  3IF9 A;  4GUV A;  1PDH A;  3DGZ A;  2GR1 A;  3CN8 A;  1M6I A;  3BNM A;  1IUS A;  1B37 A;  1FEC A;  3AE4 A;  3ATR A;  1S3E A;  1EL5 A;  2VVL A;  4N9X A;  5U1O A;  2XFO A;  1GER A;  3UOZ A;  1FOH A;  2YLT A;  3F8R A;  4JY3 A;  1ZK7 A;  4YT0 A;  3ZNQ A;  1IUU A;  4YXD A;  3RP7 A;  4YJH A;  2YWL A;  2WPF A;  1K0L A;  2IVE A;  3AD9 B;  2EQ6 A;  3QSE A;  1OJT A;  3ABV A;  4OPI A;  5HY5 A;  3W4J A;  1ZKQ A;  3G3E A;  3IWA A;  2NVK X;  2WOI A;  3NTD A;  4H2P A;  4NEV A;  4U8K A;  1ELI A;  2GAG B;  1ZOV A;  1NHQ A;  1P2H A;  1K0I A;  2BAC A;  3AEC A;  3D1C A;  3GMB A;  3Q6J A;  4H2R A;  1FCD A;  4U8J A;  4U8I A;  3KVE A;  2GMH A;  1MXT A;  4APN A;  3W4I A;  1VQW A;  1H86 A;  4Z2R A;  2XLP A;  3V3N A;  4EIP A;  1KSU A;  2FJD A;  4H4Q A;  2A89 A;  3AWI A;  4YWO A;  1KDG A;  3CUK A;  3AYI A;  3CGE A;  1JRX A;  4YJD A;  2V60 A;  4EM4 A;  2EQ8 A;  5BRT A;  1KNR A;  5KVI A;  4C77 A;  5L46 A;  1K4Q A;  4A6N B;  5EOW A;  3LXD A;  1OJD A;  3P4P A;  3VRB A;  1PBC A;  4A9W A;  1Y0P A;  1Y56 B;  2XFP A;  3CNP A;  4H4S A;  2V6O A;  1N4W A;  1LQT A;  1JRZ A;  2CUL A;  2YVF A;  4A99 A;  3GMC A;  1GND A;  3VQR A;  2UZZ A;  2OA1 A;  2WHD A;  3ITJ A;  3V3O A;  4M52 A;  1GRG A;  4OVI A;  2Q0K A;  4X9M A;  4K22 A;  3SFE A;  1CL0 A;  2GR3 A;  2RAB A;  4Z26 A;  3NN6 X;  3GD4 A;  2YVG A;  2GF3 A;  3AE6 A;  4AP3 A;  2R9Z A;  3H8L A;  5U63 A;  4TLZ A;  4YJG A;  5U25 A;  2R0G A;  4K5R A;  2YG7 A;  1LPF A;  2BK3 A;  1JRY A;  5C2T A;  2QA2 A;  2TMD A;  2JB1 A;  4TM0 A; 
#chains in the Genus database with same CATH topology
 1UKV G;  4JQ9 A;  3O0H A;  4ICY A;  2DKI A;  3FIM B;  3V76 A;  4GR1 A;  1S2Q A;  1ZY8 A;  3DK8 A;  2YG3 A;  4RSL A;  1YY5 A;  3ZNO A;  3SQP A;  3L1R A;  2E5V A;  1PJ5 A;  1F8R A;  3SX6 A;  4B64 A;  3EAN A;  3F8D A;  2Y6Q A;  1PXC A;  4UDP A;  1Q9I A;  3SGL A;  3GWD A;  2JK6 A;  3NIX A;  1W4X A;  1Z6L A;  2GQW A;  4AT0 A;  4ECH A;  5JCL A;  5JCI A;  2ZZC A;  3SZC A;  4EIQ A;  4JNQ A;  4H4X A;  4DSG A;  3COX A;  2X8C A;  2X8G A;  3QSM A;  2WS3 A;  2WET A;  1QLB A;  3FG2 P;  4J31 A;  2BAB A;  3NG7 X;  1GRF A;  2E48 A;  3BNU A;  3II4 A;  1L9E A;  1D4C A;  1LV0 A;  2CVJ A;  3NK2 X;  1CF3 A;  3BI4 A;  4FX9 A;  1GT8 A;  2WES A;  2XCG A;  3ZNN A;  2V3B A;  4C74 A;  4KPR A;  2GR0 A;  2WEU A;  4ZCC A;  3EF6 A;  3NN0 X;  1E6E A;  5BUL A;  1VG9 A;  1DJN A;  2XVE A;  4LII A;  3DGH A;  2GMJ A;  1BGN A;  3GSI A;  3NYE A;  4QFD A;  2ARD A;  1TYP A;  1JOA A;  1B5Q A;  3AEF A;  1E1L A;  3DME A;  3FPZ A;  1EL8 A;  3K30 A;  2YM1 A;  4AP1 A;  5KOW A;  3K7M X;  1GSN A;  4P9S A;  2B7S A;  2CFY A;  3GWF A;  5FMH A;  4C5O A;  4H4U A;  4U8L A;  2ZZ0 A;  4CNJ A;  1GRE A;  3SFD A;  2C67 A;  1YKJ A;  2B7R A;  1RSG A;  2FJA A;  1PBE A;  2WPC A;  2YVJ A;  2VRM A;  2AAQ A;  4J57 A;  2VRL A;  4YJF B;  1K0J A;  3ICR A;  2XLS A;  5HYM A;  3NGC X;  1ZX9 A;  1NHP A;  2BS4 A;  1EBD A;  2AR8 A;  3NTA A;  3AYJ A;  1F8S A;  1XHC A;  3NLC A;  4NWZ A;  1ONF A;  1L9D A;  5CKU A;  4B65 A;  3CMM A;  1GV4 A;  1O95 A;  4O5U A;  4H2N A;  1AN9 A;  3KKJ A;  2IVD A;  3VR8 A;  1B4V A;  5ER0 A;  3C4N A;  1D7Y A;  2YQU A;  1FEA A;  1F3P A;  2C3C A;  2WU2 A;  1NAA A;  1GTE A;  2YG5 A;  3AE3 A;  3EAO A;  2BC1 A;  4J56 A;  3BHF A;  3PVC A;  4DNA A;  2V5Z A;  2YLW A;  4OPG A;  3G5Q A;  3QFA A;  1Y56 A;  3BHK A;  4DGK A;  1OJA A;  3ALJ A;  1RYI A;  4BK2 A;  2GEW A;  3JSK A;  5FS6 A;  1D4E A;  3K7Q X;  3QVR A;  1C0P A;  1IUV A;  1NEN A;  4D03 A;  1PHH A;  4CBQ A;  3FBS A;  2WP9 A;  2Y6R A;  1H82 A;  1IUW A;  1GET A;  3NK0 X;  3CGD A;  5EB5 A;  1KFY A;  5TR3 A;  3CPH G;  1F6M A;  2V3A A;  3CGB A;  1TDE A;  1NG3 A;  4OPC A;  2GR2 A;  3AED A;  4NZH A;  1CJ3 A;  1O5W A;  1DAO A;  2VQ7 A;  2YAU A;  2X3N A;  4K5S A;  4OCG A;  2E4A A;  2WBA A;  4B68 A;  1PJ7 A;  4OPL A;  2BK5 A;  1YQZ A;  3UKQ A;  4BV6 A;  4FK1 A;  2APG A;  2B9W A;  4HB9 A;  4G6G A;  1S2Y A;  4NNJ A;  4Y4N A;  3GYJ A;  1OJC A;  4LA1 A;  3VRA A;  1ZOY A;  1GOS A;  1BZL A;  3M13 A;  4X9N A;  2YLX A;  3UTF A;  4H2Q A;  4CY6 A;  4MJW A;  1CHU A;  2XVI A;  3LZX A;  2HQM A;  1JU2 A;  4B63 A;  2QCU A;  2PHH A;  2BCG G;  4UP3 A;  2JB1 A;  4GDE A;  2B9X A;  2E49 A;  4CCR A;  2WDR A;  2XYO A;  3T31 A;  3UTE A;  3AEG A;  3E1T A;  2JAE A;  3NYF A;  3K7T A;  3URH A;  1H7W A;  2C72 A;  5LV9 A;  3OZ2 A;  1CJ2 A;  1IJH A;  2VVM A;  3NKS A;  4EMJ A;  3QJ4 A;  3PS9 A;  1CC2 A;  3DH9 A;  1NHS A;  1XDI A;  2R46 A;  4GAV A;  4YJH B;  3AEE A;  3ALM A;  3ALL A;  2A8X A;  2VQB A;  3NT6 A;  1TDF A;  3UP4 A;  4Z2T A;  1AOG A;  1DOE A;  2C4C A;  3AEB A;  3GDN A;  1E1M A;  1N4V A;  4H4R A;  4U8O A;  1CC6 A;  3P4R A;  3RP8 A;  4DSH A;  3G5S A;  5BUK A;  2JBV A;  1DOD A;  3QSS A;  4IV9 A;  4TM3 A;  1S3B A;  4U8I A;  1LVL A;  3HYW A;  1TDN A;  1GTH A;  3KLJ A;  3IHM A;  3KPK A;  1NHR A;  1D5T A;  2FJE A;  5IQ1 A;  1V59 A;  2Q7V A;  1DJQ A;  4Y4L A;  3ICT A;  1GEU A;  3CNJ A;  5FS7 A;  3H8I A;  3CNS A;  4UDQ A;  3T37 A;  4I58 A;  3Q9T A;  2OAM A;  2OAL A;  4H4Z A;  4YTN A;  2B9Y A;  2WDQ A;  1COY A;  3AE9 A;  1H83 A;  1RP0 A;  1IUT A;  3CPI G;  3I3L A;  3DA1 A;  3CPJ G;  5JCN A;  2C7G A;  4IA5 A;  1E1K A;  2B76 A;  4RG4 A;  3S61 A;  2X8H A;  1BGJ A;  1Q1R A;  3KU9 A;  4TM4 A;  1LJ1 A;  1HYU A;  1C0L A;  4BK1 A;  2OLO A;  3ZNP A;  2C73 A;  3UTH A;  4B1B A;  2RGJ A;  2O9Z A;  2BA9 A;  3KPF A;  4HA6 A;  5CQF A;  2QA1 A;  4EQW A;  3AE8 A;  2YLZ A;  3DJG X;  5KMP A;  2IID A;  1QJD A;  4C3X A;  4CCQ A;  1H81 A;  4BJY A;  3I6D A;  3DK9 A;  4IVM B;  3AD8 B;  1NEK A;  1GXF A;  2PYX A;  2WU5 A;  3GDP A;  4B67 A;  3P9U A;  2ACZ A;  1CJC A;  4U2T A;  4B69 A;  4A7A A;  4B66 A;  2R4J A;  3WGT A;  1L0V A;  2R0C A;  4K7Z A;  3LZW A;  3P1W A;  5IPY A;  3AE7 A;  2Z5Y A;  4YKG A;  4EQR A;  4IVO B;  1VG0 A;  2J3N A;  1PBD A;  3LB8 A;  3NH3 X;  1OJ9 A;  4PAA A;  1NDA A;  1PS9 A;  3WE0 A;  4WCT A;  5KMS A;  3L8K A;  3SXI A;  3UKF A;  1BF3 A;  4H7U A;  1VDC A;  3P4Q A;  3UOX A;  3PO7 A;  2H88 A;  3DJD A;  3VRD B;  4E0V A;  4YSY A;  4G9K A;  2DKH A;  2C75 A;  2C64 A;  4ZCD A;  2Q0L A;  1PN0 A;  4JDR A;  4OPU A;  3CIR A;  1E39 A;  5EBK A;  2BC0 A;  5KOX A;  2XFU A;  4J33 A;  4Z43 A;  4A5L A;  2YLR A;  4G6H A;  3RHA A;  3CND A;  4YSH A;  4A6N A;  2DU8 A;  1JNR A;  3CNT A;  2JB2 A;  4EQX A;  3VR9 A;  1H84 A;  1EVI A;  2VZ2 A;  3GYX A;  4H4T A;  2CDU A;  3UKP A;  2R0P A;  5M10 A;  4K2X A;  2BS2 A;  2C66 A;  2A87 A;  1D7L A;  1VRQ B;  3IC9 A;  2GRT A;  4GAP A;  3C96 A;  3ADA B;  2XVH A;  2OLN A;  3W4K A;  1ZMC A;  2WP5 A;  2E1M A;  5IQ4 A;  5J7X A;  1SEZ A;  4GF7 A;  1BWC A;  4GDP A;  3NK1 X;  5DBJ A;  4JN9 A;  3RNM A;  2C76 A;  3T14 A;  1MO9 A;  3UOV A;  4Z25 A;  2YM2 A;  4ADW A;  1F8W A;  3GD3 A;  1KF6 A;  2GQF A;  5C3J A;  5J60 A;  1PJ6 A;  4AOS A;  3HZL A;  3NNE A;  4OPT A;  1MOK A;  4AOX A;  2YR5 A;  5HXI A;  5FS9 A;  1E7P A;  2C70 A;  2GVC A;  4BUR A;  1GES A;  3H4K A;  1P2E A;  2GV8 A;  1IUX A;  1VE9 A;  2E82 A;  2TPR A;  1QO8 A;  4GCM A;  2YR4 A;  1L9C A;  3CGC A;  4I59 A;  2FBW A;  2WQY A;  2YLS A;  4AT2 A;  1PXB A;  2XFN A;  4NTC A;  4ZN0 A;  1EL7 A;  1GRH A;  4K8D A;  2VOU A;  2XLT A;  4KX6 A;  5JCM A;  5KMR A;  3AE1 A;  3BI2 A;  1CBO A;  2WPE A;  3AE2 A;  2FJB A;  2XVJ A;  2Q6U A;  3S5W A;  2BRY A;  3SZF A;  3P4S A;  3DJE A;  3QFB A;  5GRT A;  3F8P A;  4U2S A;  2JB3 A;  4H4Y A;  4NTD A;  1GRA A;  4JY2 A;  3GRS A;  2JKC A;  2ZBW A;  1NPX A;  1DXL A;  2ZZB A;  4CRT A;  2R45 A;  2NPX A;  3AB1 A;  4H50 A;  4D04 A;  3GYI A;  4TLX A;  2RGO A;  4CNK A;  1DDO A;  2Z5X A;  1NG4 A;  2WOW A;  3ICS A;  1N4U A;  1LTX R;  4XWZ A;  3G5R A;  4QFC A;  2H89 A;  4REK A;  1B8S A;  4YTM A;  3T2K A;  1PXA A;  4EQS A;  2EQ7 A;  3LJP A;  3SYI A;  2RGH A;  4USQ A;  2C3D A;  1GRB A;  1ZMD A;  4OPD A;  4YKF A;  4PAB A;  3LOV A;  4Z44 A;  2GAH B;  3KA7 A;  3B3R A;  4X4J A;  1CC4 A;  1REO A;  2BS3 A;  4BJZ A;  1M64 A;  4XWR A;  4YJF A;  3B6D A;  4GRT A;  4LU6 A;  4Y4M A;  2X99 A;  4U8M A;  3SZW A;  5BVA A;  3OC4 A;  4WX1 A;  1EL9 A;  2XDO A;  2BXR A;  5KRQ A;  3UKK A;  3SM8 A;  4RG3 A;  4IA6 A;  2BCP A;  3AEA A;  4Z24 A;  1GRT A;  2BXS A;  2YG6 A;  4FDC B;  4J34 A;  1GAL A;  4G74 A;  2QAE A;  1JEH A;  4XXG A;  1TRB A;  2GH5 A;  3D8X A;  3UCL A;  1ZP0 A;  3EPT A;  2E4G A;  4EM3 A;  1KSS A;  5GSN A;  5KWF A;  5FS8 A;  1Q1W A;  1C0K A;  3M12 A;  2XLR A;  4II2 A;  3UOY A;  4YTP A;  5M0Z A;  3C4A A;  1DOC A;  2GB0 A;  1E1N A;  3AE5 A;  3ZDN A;  2BK4 A;  2VVL G;  2AQJ A;  4H4W A;  3R9U A;  4A79 A;  2XFQ A;  3NYC A;  1GPE A;  4BK3 A;  3M0O A;  4FK1 C;  3HYX A;  4NEW A;  3BI5 A;  1FL2 A;  5KXJ A;  5EB4 A;  4A65 A;  1D4D A;  1PBB A;  4TM1 A;  1FEB A;  4J36 A;  3UTG A;  4YJG B;  4USR A;  4UDR A;  4EMW A;  3UKH A;  4O5Q A;  1BKW A;  5HHF A;  1N1P A;  2XLU A;  3UKA A;  3QVP A;  2X50 A;  1DNC A;  1H6V A;  2V61 A;  2W0H A;  2WOV A;  2XVF A;  3SY4 A;  3AD7 B;  4YSZ A;  5JCK A;  1XAN A;  3NHO X;  4C3Y A;  1KNP A;  1O94 A;  3ISH A;  4U2L A;  2F5Z A;  1TDK A;  3ATQ A;  1DOB A;  1YQ3 A;  3GRT A;  5KVH A;  3KD9 A;  3UKL A;  2YG4 A;  4YSX A;  1KIF A;  4U8P A;  3T2Y A;  2C65 A;  3IHG A;  2EQ9 A;  2WP6 A;  4H4P A;  3DK4 A;  4Z2U A;  1ZDL A;  5KMQ A;  4NTE A;  3CTY A;  3DJJ A;  4J2W A;  4EMI A;  3AXB A;  1CJ4 A;  3AYL A;  1XPQ A;  1X31 B;  1JNZ A;  4CY8 A;  1TDO A;  4JNA A;  3UP5 A;  1PBF A;  3RED A;  1H7X A;  1C0I A;  1LQU A;  1YQ4 A;  2BRA A;  3FMW A;  3LAD A;  3NRN A;  4U8N A;  3ZYX A;  2YR6 A;  2I0Z A;  4H4V A;  2R4E A;  2WDV A;  2BYB A;  1TYT A;  3IF9 A;  4GUV A;  1PDH A;  3T2Z A;  3DGZ A;  2GR1 A;  3CN8 A;  1M6I A;  3BNM A;  1IUS A;  1B37 A;  1FEC A;  3AE4 A;  3ATR A;  1S3E A;  1EL5 A;  2VVL A;  4N9X A;  5U1O A;  2XFO A;  1GER A;  3UOZ A;  1FOH A;  4JY3 A;  2YLT A;  3F8R A;  1ZK7 A;  4YT0 A;  3ZNQ A;  1IUU A;  4YXD A;  3RP7 A;  4YJH A;  2YWL A;  2WPF A;  1K0L A;  2IVE A;  3AD9 B;  2EQ6 A;  3QSE A;  1OJT A;  3ABV A;  4OPI A;  5HY5 A;  3W4J A;  1ZKQ A;  3G3E A;  3IWA A;  2NVK X;  4H2P A;  2WOI A;  3NTD A;  4NEV A;  4U8K A;  3SZ0 A;  1ELI A;  2GAG B;  1ZOV A;  1NHQ A;  1P2H A;  1K0I A;  2BAC A;  3GMB A;  3AEC A;  3D1C A;  4H2R A;  3Q6J A;  1FCD A;  4II3 A;  4U8J A;  3KVE A;  2GMH A;  1MXT A;  4APN A;  3W4I A;  1VQW A;  1H86 A;  4G73 A;  4Z2R A;  2XLP A;  3V3N A;  4EIP A;  1KSU A;  2FJD A;  4H4Q A;  2A89 A;  3AWI A;  4YWO A;  5KNL A;  1KDG A;  3CUK A;  3AYI A;  3CGE A;  1JRX A;  4YJD A;  2V60 A;  4EM4 A;  2EQ8 A;  5BRT A;  1KNR A;  5KVI A;  4C77 A;  5L46 A;  1K4Q A;  4A6N B;  5EOW A;  3LXD A;  1OJD A;  3P4P A;  3VRB A;  1PBC A;  4A9W A;  1Y0P A;  1Y56 B;  2XFP A;  3CNP A;  4H4S A;  2V6O A;  1N4W A;  1LQT A;  1JRZ A;  2CUL A;  2YVF A;  4A99 A;  3GMC A;  1GND A;  3VQR A;  2UZZ A;  2OA1 A;  2WHD A;  3ITJ A;  3V3O A;  3HYV A;  4M52 A;  1GRG A;  4OVI A;  3T0K A;  2Q0K A;  4K22 A;  4X9M A;  3SFE A;  1CL0 A;  2GR3 A;  2RAB A;  4Z26 A;  3NN6 X;  3GD4 A;  2YVG A;  2GF3 A;  3AE6 A;  4AP3 A;  2R9Z A;  3H8L A;  5U63 A;  4TLZ A;  4YJG A;  5U25 A;  2R0G A;  4K5R A;  2YG7 A;  1LPF A;  2BK3 A;  1JRY A;  5C2T A;  2QA2 A;  2TMD A;  3RP6 A;  4TM0 A; 
#chains in the Genus database with same CATH homology
 1UKV G;  4JQ9 A;  3O0H A;  4ICY A;  2DKI A;  3FIM B;  3V76 A;  4GR1 A;  1S2Q A;  1ZY8 A;  3DK8 A;  2YG3 A;  4RSL A;  1YY5 A;  3ZNO A;  3SQP A;  3L1R A;  2E5V A;  1PJ5 A;  1F8R A;  3RP6 A;  3SX6 A;  4B64 A;  3EAN A;  3F8D A;  2Y6Q A;  1PXC A;  4UDP A;  1Q9I A;  3SGL A;  3GWD A;  2JK6 A;  3NIX A;  1W4X A;  1Z6L A;  2GQW A;  4AT0 A;  4ECH A;  5JCL A;  5JCI A;  2ZZC A;  3SZC A;  4EIQ A;  4JNQ A;  4H4X A;  4DSG A;  3COX A;  2X8C A;  2X8G A;  3QSM A;  2WS3 A;  2WET A;  1QLB A;  3FG2 P;  4J31 A;  2BAB A;  3NG7 X;  1GRF A;  2E48 A;  3BNU A;  3II4 A;  1L9E A;  1D4C A;  1LV0 A;  2CVJ A;  3NK2 X;  1CF3 A;  3BI4 A;  4FX9 A;  1GT8 A;  2WES A;  2XCG A;  3ZNN A;  2V3B A;  4C74 A;  4KPR A;  2GR0 A;  2WEU A;  4ZCC A;  3EF6 A;  3NN0 X;  1E6E A;  5BUL A;  1VG9 A;  1DJN A;  2XVE A;  4LII A;  3DGH A;  2GMJ A;  1BGN A;  3GSI A;  3NYE A;  4QFD A;  2ARD A;  1TYP A;  1JOA A;  1B5Q A;  3AEF A;  1E1L A;  3DME A;  3FPZ A;  1EL8 A;  3K30 A;  2YM1 A;  4AP1 A;  5KOW A;  3K7M X;  1GSN A;  4P9S A;  2B7S A;  2CFY A;  3GWF A;  5FMH A;  4C5O A;  4H4U A;  4U8L A;  2ZZ0 A;  4CNJ A;  1GRE A;  3SFD A;  2C67 A;  1YKJ A;  2B7R A;  1RSG A;  2FJA A;  1PBE A;  2WPC A;  2YVJ A;  2VRM A;  2AAQ A;  4J57 A;  2VRL A;  4YJF B;  1K0J A;  3ICR A;  2XLS A;  5HYM A;  3NGC X;  1ZX9 A;  1NHP A;  2BS4 A;  1EBD A;  2AR8 A;  3NTA A;  3AYJ A;  1F8S A;  1XHC A;  3NLC A;  4NWZ A;  1ONF A;  1L9D A;  5CKU A;  4B65 A;  3CMM A;  1GV4 A;  1O95 A;  4O5U A;  4H2N A;  1AN9 A;  3KKJ A;  2IVD A;  3VR8 A;  1B4V A;  5ER0 A;  3C4N A;  1D7Y A;  2YQU A;  1FEA A;  1F3P A;  2C3C A;  2WU2 A;  1NAA A;  1GTE A;  2YG5 A;  3AE3 A;  3EAO A;  2BC1 A;  4J56 A;  3BHF A;  3PVC A;  4DNA A;  2V5Z A;  2YLW A;  4OPG A;  3G5Q A;  3QFA A;  1Y56 A;  3BHK A;  4DGK A;  1OJA A;  3ALJ A;  1RYI A;  2GEW A;  3JSK A;  4BK2 A;  5FS6 A;  1D4E A;  3K7Q X;  3QVR A;  1C0P A;  1IUV A;  1NEN A;  4D03 A;  1PHH A;  4CBQ A;  3FBS A;  2WP9 A;  2Y6R A;  1H82 A;  1IUW A;  1GET A;  3NK0 X;  3CGD A;  5EB5 A;  1KFY A;  5TR3 A;  3CPH G;  1F6M A;  2V3A A;  3CGB A;  1TDE A;  1NG3 A;  4OPC A;  2GR2 A;  3AED A;  4NZH A;  1CJ3 A;  1O5W A;  1DAO A;  2VQ7 A;  2YAU A;  2X3N A;  4K5S A;  4OCG A;  2E4A A;  2WBA A;  4B68 A;  1PJ7 A;  4OPL A;  2BK5 A;  1YQZ A;  3UKQ A;  4BV6 A;  4FK1 A;  2APG A;  2B9W A;  4HB9 A;  4G6G A;  1S2Y A;  4NNJ A;  4Y4N A;  3GYJ A;  1OJC A;  4LA1 A;  3VRA A;  1ZOY A;  1GOS A;  1BZL A;  3M13 A;  4X9N A;  2YLX A;  3UTF A;  4H2Q A;  4CY6 A;  4MJW A;  1CHU A;  2XVI A;  3LZX A;  2HQM A;  1JU2 A;  4B63 A;  2QCU A;  2PHH A;  2BCG G;  4UP3 A;  4GDE A;  2B9X A;  2E49 A;  4CCR A;  2WDR A;  2XYO A;  3T31 A;  3UTE A;  3AEG A;  2JAE A;  3E1T A;  3NYF A;  3K7T A;  3URH A;  1H7W A;  2C72 A;  5LV9 A;  3OZ2 A;  1CJ2 A;  1IJH A;  2VVM A;  3NKS A;  4EMJ A;  3QJ4 A;  3PS9 A;  1CC2 A;  3DH9 A;  1NHS A;  1XDI A;  2R46 A;  4GAV A;  4YJH B;  3AEE A;  3ALM A;  2A8X A;  2VQB A;  3ALL A;  3NT6 A;  1TDF A;  3UP4 A;  4Z2T A;  1AOG A;  1DOE A;  2C4C A;  3AEB A;  3GDN A;  1E1M A;  1N4V A;  4H4R A;  4U8O A;  1CC6 A;  3P4R A;  3RP8 A;  4DSH A;  3G5S A;  5BUK A;  2JBV A;  1DOD A;  3QSS A;  4IV9 A;  4TM3 A;  1S3B A;  4U8I A;  1LVL A;  3HYW A;  1TDN A;  1GTH A;  3KLJ A;  3IHM A;  3KPK A;  1NHR A;  1D5T A;  2FJE A;  5IQ1 A;  1V59 A;  2Q7V A;  1DJQ A;  4Y4L A;  3ICT A;  1GEU A;  3CNJ A;  5FS7 A;  3H8I A;  3CNS A;  4UDQ A;  3T37 A;  4I58 A;  3Q9T A;  2OAM A;  2OAL A;  4H4Z A;  4YTN A;  2B9Y A;  2WDQ A;  1COY A;  3AE9 A;  1H83 A;  1RP0 A;  1IUT A;  3CPI G;  3I3L A;  3DA1 A;  3CPJ G;  5JCN A;  2C7G A;  4IA5 A;  1E1K A;  2B76 A;  4RG4 A;  3S61 A;  2X8H A;  1BGJ A;  1Q1R A;  3KU9 A;  4TM4 A;  1HYU A;  1LJ1 A;  1C0L A;  2C73 A;  2OLO A;  3ZNP A;  3UTH A;  4B1B A;  4BK1 A;  2O9Z A;  2RGJ A;  2BA9 A;  3KPF A;  4HA6 A;  5CQF A;  2QA1 A;  4EQW A;  3AE8 A;  2YLZ A;  3DJG X;  5KMP A;  2IID A;  1QJD A;  4C3X A;  4CCQ A;  1H81 A;  4BJY A;  3I6D A;  3DK9 A;  4IVM B;  3AD8 B;  1NEK A;  1GXF A;  2PYX A;  2WU5 A;  3GDP A;  4B67 A;  3P9U A;  2ACZ A;  1CJC A;  4U2T A;  4B69 A;  4A7A A;  4B66 A;  2R4J A;  3WGT A;  1L0V A;  2R0C A;  4K7Z A;  3LZW A;  3P1W A;  5IPY A;  3AE7 A;  2Z5Y A;  4YKG A;  4EQR A;  4IVO B;  1VG0 A;  2J3N A;  1PBD A;  3LB8 A;  3NH3 X;  1OJ9 A;  4PAA A;  1NDA A;  1PS9 A;  3WE0 A;  4WCT A;  5KMS A;  3L8K A;  3SXI A;  3UKF A;  1BF3 A;  4H7U A;  1VDC A;  3P4Q A;  3UOX A;  3PO7 A;  2H88 A;  3DJD A;  3VRD B;  4E0V A;  4YSY A;  4G9K A;  2DKH A;  2C75 A;  2C64 A;  4ZCD A;  2Q0L A;  1PN0 A;  4JDR A;  4OPU A;  3CIR A;  1E39 A;  5EBK A;  2BC0 A;  5KOX A;  2XFU A;  4J33 A;  4Z43 A;  4A5L A;  2YLR A;  4G6H A;  3RHA A;  3CND A;  4YSH A;  4A6N A;  2DU8 A;  1JNR A;  3CNT A;  2JB2 A;  4EQX A;  3VR9 A;  1H84 A;  1EVI A;  2VZ2 A;  3GYX A;  4H4T A;  2CDU A;  3UKP A;  2R0P A;  5M10 A;  4K2X A;  2BS2 A;  2C66 A;  2A87 A;  1D7L A;  1VRQ B;  3IC9 A;  2GRT A;  4GAP A;  3C96 A;  3ADA B;  2XVH A;  2OLN A;  3W4K A;  1ZMC A;  2WP5 A;  2E1M A;  5IQ4 A;  5J7X A;  1SEZ A;  1BWC A;  4GF7 A;  4GDP A;  3NK1 X;  5DBJ A;  4JN9 A;  3RNM A;  2C76 A;  3T14 A;  1MO9 A;  3UOV A;  4Z25 A;  2YM2 A;  4ADW A;  1F8W A;  3GD3 A;  1KF6 A;  2GQF A;  5C3J A;  5J60 A;  1PJ6 A;  4AOS A;  3HZL A;  3NNE A;  4OPT A;  1MOK A;  4AOX A;  2YR5 A;  5FS9 A;  5HXI A;  1E7P A;  2C70 A;  2GVC A;  4BUR A;  1GES A;  3H4K A;  1P2E A;  2GV8 A;  1IUX A;  1VE9 A;  2E82 A;  2TPR A;  1QO8 A;  4GCM A;  2YR4 A;  1L9C A;  3CGC A;  4I59 A;  2FBW A;  2WQY A;  2YLS A;  4AT2 A;  1PXB A;  2XFN A;  4NTC A;  4ZN0 A;  1EL7 A;  1GRH A;  4K8D A;  2VOU A;  2XLT A;  4KX6 A;  5JCM A;  5KMR A;  3AE1 A;  3BI2 A;  1CBO A;  2WPE A;  3AE2 A;  2FJB A;  2XVJ A;  2Q6U A;  3S5W A;  2BRY A;  3SZF A;  3P4S A;  3DJE A;  3QFB A;  5GRT A;  3F8P A;  4U2S A;  2JB3 A;  4H4Y A;  4NTD A;  1GRA A;  4JY2 A;  3GRS A;  2JKC A;  2ZBW A;  1NPX A;  1DXL A;  2ZZB A;  4CRT A;  2R45 A;  2NPX A;  3AB1 A;  4H50 A;  4D04 A;  3GYI A;  4TLX A;  2RGO A;  4CNK A;  1DDO A;  2Z5X A;  1NG4 A;  2WOW A;  3ICS A;  1N4U A;  1LTX R;  4XWZ A;  3G5R A;  4QFC A;  2H89 A;  4REK A;  1B8S A;  4YTM A;  3T2K A;  1PXA A;  4EQS A;  2EQ7 A;  3LJP A;  3SYI A;  2RGH A;  4USQ A;  2C3D A;  1GRB A;  1ZMD A;  4OPD A;  4YKF A;  4PAB A;  3LOV A;  4Z44 A;  2GAH B;  3KA7 A;  3B3R A;  4X4J A;  1CC4 A;  1REO A;  2BS3 A;  4BJZ A;  1M64 A;  4XWR A;  4YJF A;  3B6D A;  4GRT A;  4LU6 A;  4Y4M A;  2X99 A;  4U8M A;  3SZW A;  5BVA A;  3OC4 A;  4WX1 A;  1EL9 A;  2XDO A;  2BXR A;  5KRQ A;  3UKK A;  3SM8 A;  4RG3 A;  4IA6 A;  2BCP A;  3AEA A;  4Z24 A;  1GRT A;  2BXS A;  2YG6 A;  4FDC B;  4J34 A;  1GAL A;  4G74 A;  2QAE A;  1JEH A;  4XXG A;  1TRB A;  2GH5 A;  3D8X A;  3UCL A;  1ZP0 A;  3EPT A;  2E4G A;  4EM3 A;  1KSS A;  5GSN A;  5KWF A;  5FS8 A;  1Q1W A;  1C0K A;  3M12 A;  2XLR A;  4II2 A;  3UOY A;  4YTP A;  5M0Z A;  3C4A A;  1DOC A;  2GB0 A;  1E1N A;  3AE5 A;  3ZDN A;  2BK4 A;  2VVL G;  2AQJ A;  4H4W A;  3R9U A;  4A79 A;  2XFQ A;  3NYC A;  1GPE A;  4BK3 A;  3M0O A;  4FK1 C;  3HYX A;  4NEW A;  3BI5 A;  1FL2 A;  5KXJ A;  5EB4 A;  4A65 A;  1D4D A;  1PBB A;  4TM1 A;  1FEB A;  4J36 A;  3UTG A;  4YJG B;  4USR A;  4UDR A;  4EMW A;  3UKH A;  4O5Q A;  1BKW A;  5HHF A;  1N1P A;  2XLU A;  3UKA A;  3QVP A;  2X50 A;  1DNC A;  1H6V A;  2V61 A;  2W0H A;  2WOV A;  2XVF A;  3SY4 A;  3AD7 B;  4YSZ A;  5JCK A;  1XAN A;  3NHO X;  4C3Y A;  1KNP A;  1O94 A;  3ISH A;  4U2L A;  2F5Z A;  1TDK A;  3ATQ A;  1DOB A;  1YQ3 A;  3GRT A;  5KVH A;  3KD9 A;  3UKL A;  2YG4 A;  4YSX A;  1KIF A;  4U8P A;  3T2Y A;  2C65 A;  2EQ9 A;  2WP6 A;  3IHG A;  4H4P A;  3DK4 A;  4Z2U A;  1ZDL A;  5KMQ A;  4NTE A;  3CTY A;  3DJJ A;  4J2W A;  4EMI A;  3AXB A;  1CJ4 A;  3AYL A;  1XPQ A;  1X31 B;  1JNZ A;  4CY8 A;  1TDO A;  4JNA A;  3UP5 A;  1PBF A;  3RED A;  1H7X A;  1C0I A;  1LQU A;  1YQ4 A;  2BRA A;  3FMW A;  3LAD A;  3NRN A;  4U8N A;  3ZYX A;  2YR6 A;  2I0Z A;  4H4V A;  2R4E A;  2WDV A;  2BYB A;  1TYT A;  3IF9 A;  4GUV A;  1PDH A;  3T2Z A;  3DGZ A;  2GR1 A;  3CN8 A;  1M6I A;  3BNM A;  1IUS A;  1B37 A;  1FEC A;  3AE4 A;  3ATR A;  1S3E A;  1EL5 A;  2VVL A;  4N9X A;  5U1O A;  2XFO A;  1GER A;  3UOZ A;  1FOH A;  2YLT A;  3F8R A;  4JY3 A;  1ZK7 A;  4YT0 A;  3ZNQ A;  1IUU A;  4YXD A;  3RP7 A;  4YJH A;  2YWL A;  2WPF A;  1K0L A;  2IVE A;  3AD9 B;  2EQ6 A;  3QSE A;  1OJT A;  3ABV A;  4OPI A;  5HY5 A;  3W4J A;  1ZKQ A;  3G3E A;  3IWA A;  2NVK X;  2WOI A;  3NTD A;  4H2P A;  4NEV A;  4U8K A;  3SZ0 A;  1ELI A;  2GAG B;  1ZOV A;  1NHQ A;  1P2H A;  1K0I A;  2BAC A;  3AEC A;  3D1C A;  3GMB A;  3Q6J A;  4H2R A;  1FCD A;  4II3 A;  4U8J A;  3KVE A;  2GMH A;  1MXT A;  4APN A;  3W4I A;  1VQW A;  1H86 A;  4G73 A;  4Z2R A;  2XLP A;  3V3N A;  4EIP A;  1KSU A;  2FJD A;  4H4Q A;  2A89 A;  3AWI A;  4YWO A;  5KNL A;  1KDG A;  3CUK A;  3AYI A;  3CGE A;  1JRX A;  4YJD A;  2V60 A;  4EM4 A;  2EQ8 A;  5BRT A;  1KNR A;  5KVI A;  4C77 A;  5L46 A;  1K4Q A;  4A6N B;  5EOW A;  3LXD A;  1OJD A;  3P4P A;  3VRB A;  1PBC A;  4A9W A;  1Y0P A;  1Y56 B;  2XFP A;  3CNP A;  4H4S A;  2V6O A;  1N4W A;  1LQT A;  1JRZ A;  2CUL A;  2YVF A;  4A99 A;  3GMC A;  1GND A;  3VQR A;  2UZZ A;  2OA1 A;  2WHD A;  3ITJ A;  3V3O A;  3HYV A;  4M52 A;  1GRG A;  4OVI A;  3T0K A;  2Q0K A;  4X9M A;  4K22 A;  3SFE A;  1CL0 A;  2GR3 A;  2RAB A;  4Z26 A;  3NN6 X;  3GD4 A;  2YVG A;  2GF3 A;  3AE6 A;  4AP3 A;  2R9Z A;  3H8L A;  5U63 A;  4TLZ A;  4YJG A;  5U25 A;  2R0G A;  4K5R A;  2YG7 A;  1LPF A;  2BK3 A;  1JRY A;  5C2T A;  2QA2 A;  2TMD A;  2JB1 A;  4TM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...