4N9XA

Crystal structure of the octaprenyl-methyl-methoxy-benzq molecule from erwina carotovora subsp. atroseptica strain scri 1043 / atcc baa-672, northeast structural genomics consortium (nesg) target ewr161
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
398
structure length
371
Chain Sequence
MQSFDVVIAGGGMVGLALACGLQGSGLRIAVLEKQGKGHALRVSAINAASECLLRHIGVWENLVAQRVSPYNDMQVWDKDSFGKISFSGEEFGFSHLGHIIENPVIQQVLWQRASQLSDITLLSPTSLKQVAWGENEAFITLQDDSMLTARLVVGADGADYGHHALVANIRTEHPHQSVARQAFHGDGILAFLPLDDPHLCSIVWSLSPEQALVMQSLPVEEFNRQVAMAFDMRLGLCELESERQTFPLMGRYARSFAAHRLVLVGDAAHTIHPLAGQGVNLGFMDVAELIAELKRKDIGQHLYLRRYERRRKHSAAVMLASMQGFRELFDGDNPAKKLLRDVGLVLADKLPGIKPTLVRQAMGLHDLPDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative monooxygenase
publication title Crystal Structure of the OCTAPRENYL-METHYL-METHOXY-BENZQ MOLECULE from Erwina carotovora subsp. atroseptica strain SCRI 1043 / ATCC BAA-672, Northeast Structural Genomics Consortium (NESG) Target EwR161
rcsb
source organism Pectobacterium atrosepticum
molecule tags Oxidoreductase
total genus 99
structure length 371
sequence length 398
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4n9xA01
1TDKA 2OLNA 4C74A 1NEKA 3CPHG 2C66A 4EMWA 2XLPA 2YM2A 1GOSA 3B6DA 4FK1A 3AYLA 4ZN0A 1CC6A 2YLWA 3B3RA 2YLSA 4IA5A 4CNJA 2WPCA 3CTYA 2YLXA 4AP3A 5HXIA 2VRMA 3GMCA 4H4ZA 4TM0A 2EQ9A 3SM8A 4B64A 1AOGA 3P1WA 3AWIA 2APGA 1GV4A 2AR8A 2WP9A 3NK2X 1IUSA 4CY6A 3AE9A 5EBKA 3PS9A 1H86A 3ZDNA 1E1LA 2B76A 2GEWA 4NEWA 3UOXA 4ZCCA 5J7XA 2CVJA 1ZY8A 3RP7A 4K8DA 4Z2RA 3IF9A 4AOSA 5GSNA 1MXTA 4A99A 3CGEA 1FEAA 1NAAA 1ZMDA 3AEDA 1KSUA 1RSGA 1OJCA 4D04A 1F8WA 3RHAA 5EOWA 4BJYA 2JB1A 3QFAA 4OPDA 1ONFA 3GWDA 3AB1A 4YTPA 1BGNA 4I58A 1JNZA 1NHSA 2UZZA 2WETA 4J34A 3OZ2A 1OJ9A 3ATQA 2CFYA 1GTEA 1JNRA 4EM4A 3AEAA 3SQPA 2C7GA 1E1MA 3DJJA 5JCKA 5IQ1A 3CNJA 1PBBA 3BI5A 4USQA 3DJGX 1VDCA 3QSEA 3AEBA 5HYMA 2EQ7A 1GTHA 3K7MX 4AOXA 2BS3A 2ARDA 3LADA 2R9ZA 4YKGA 1H81A 3V3NA 4FDCB 1LJ1A 5U1OA 4UDRA 1S2YA 2BABA 3UTEA 5LV9A 4YSXA 3SFEA 2V60A 1TDEA 2E1MA 2XVHA 3AE6A 4N9XA 3UTGA 4CCRA 3P4PA 1H7XA 2GF3A 1CJCA 3G5RA 2BK4A 2ZZBA 4H4RA 4YXDA 2GQWA 4NEVA 4E0VA 4B69A 1GRAA 3II4A 3P4QA 2FJDA 1IUUA 1PJ7A 2YR6A 4H2NA 4JNQA 1QJDA 3AEGA 2B7RA 1KFYA 2DKIA 4FX9A 1MOKA 1P2EA 1VRQB 4YTMA 1ELIA 2XFPA 4PABA 2ZBWA 4EQXA 3OC4A 4GCMA 1LVLA 3RP8A 3CN8A 4OPUA 1NDAA 1O94A 2H89A 1GXFA 2V6OA 3EPTA 3ATRA 1TYPA 4H4QA 1GREA 1PJ6A 1ZX9A 4JDRA 4X9MA 2GR1A 3KLJA 4H2QA 4H50A 2B9YA 4BV6A 2JK6A 4Y4MA 4BK2A 1EL7A 5M10A 1CC4A 3UTHA 1E1KA 3ALJA 3ZYXA 3L1RA 4BURA 4B68A 5U63A 4BJZA 4P9SA 1IUWA 3AD9B 4IVOB 4CRTA 3I3LA 4LIIA 1PDHA 4IVMB 1TDNA 3UP5A 2R4EA 3ABVA 4O5UA 1QO8A 3G5QA 4LA1A 1XANA 3DK8A 2XLSA 4ZCDA 3AE1A 1ZOYA 1JRYA 1JEHA 3CIRA 2GMHA 3CNTA 3KD9A 5FS7A 3UKFA 4BK3A 2VZ2A 1X31B 1M6IA 1D4DA 4UDQA 5FS9A 3NYCA 5KRQA 1F8RA 1JU2A 3HZLA 4DNAA 1FECA 2R46A 4EQWA 2R45A 1YQ3A 1PBEA 1S2QA 1ZOVA 2QA1A 2GAGB 1K0LA 2RGHA 2V61A 3NN6X 4IA6A 3AEFA 5KXJA 3CNDA 3UOYA 3NT6A 1GRGA 3UKAA 2JB2A 1NENA 2Q0KA 2X8HA 1GT8A 4J33A 3UOVA 2EQ6A 2WESA 2XYOA 3Q9TA 1GNDA 3F8DA 1N4VA 3NK1X 4H4VA 3VRDB 2C73A 4EMIA 1B5QA 4YT0A 2QA2A 3NGCX 1DJNA 1NHRA 1L9EA 1W4XA 1L0VA 1TDOA 1CC2A 2Q6UA 2IIDA 3BI4A 2BXSA 3VR8A 1REOA 2VVLG 3CPJG 3NRNA 2TMDA 1NHQA 3ICRA 3NH3X 4J2WA 2WDQA 3DA1A 2XFOA 3H8LA 1CBOA 2XVIA 2GVCA 3T37A 1L9CA 3KU9A 2C70A 3P4RA 4A79A 1K0JA 1XDIA 3FMWA 2AAQA 3D8XA 4GDPA 1VQWA 4UP3A 2YG6A 5BVAA 4U8OA 4BK1A 3M13A 3UP4A 4JY3A 4M52A 4DGKA 4YSHA 3UKKA 2BCPA 1DNCA 3FBSA 3NYEA 5DBJA 2RGJA 1GEUA 2WDRA 3AE3A 2R0PA 4RG4A 3GD4A 3VR9A 4GUVA 1O5WA 2FJAA 2E5VA 2VVMA 4DSHA 3VRAA 5U25A 1DJQA 2BK3A 2CULA 4EM3A 2H88A 3LZXA 3AE4A 1S3EA 1Q1WA 3ALMA 1HYUA 1PBDA 2C76A 4X9NA 2OALA 4CNKA 4H2PA 1P2HA 2BS2A 1GPEA 2XFUA 3LJPA 3GMBA 1VG9A 2Y6RA 4Z43A 1GRFA 4J36A 3BNUA 4KPRA 4CCQA 3F8PA 3LOVA 1PBCA 1N4WA 3RNMA 5BRTA 2X3NA 3KA7A 2BS4A 4CBQA 5M0ZA 3UKPA 1N4UA 1GRBA 3UCLA 1FL2A 1Z6LA 2XFNA 4U8PA 2V5ZA 1CHUA 2XVFA 3FG2P 5HY5A 3M12A 5C2TA 3C4NA 3G5SA 3S61A 5JCLA 1Y56B 1COYA 3M0OA 3NN0X 4ICYA 4RSLA 3AECA 4A7AA 4ECHA 4U8JA 4C77A 2QCUA 3AYIA 3GWFA 2VQ7A 1JRXA 2OAMA 2XLRA 1BKWA 2W0HA 2OLOA 2GH5A 5GRTA 1TYTA 4U8LA 4JY2A 5FMHA 5TR3A 1DXLA 2OA1A 2WP5A 4TLZA 4YSYA 3CNSA 3ICTA 3QSMA 4OPIA 4B63A 2JB3A 2TPRA 2C65A 2YG7A 3GYJA 3ITJA 3VQRA 1FCDA 2NVKX 2YM1A 4K22A 4OCGA 1ZKQA 4USRA 4H4YA 3V76A 2YG3A 4ADWA 1B8SA 4GDEA 4H4XA 3FIMB 1K0IA 3NK0X 4JN9A 4O5QA 1TRBA 3NYFA 2WPEA 4NTCA 2YVGA 3GDNA 1GRHA 1EL9A 2BA9A 1LQTA 3AEEA 4OPTA 2Q7VA 4K5SA 4TM3A 1H82A 5BUKA 4Z2UA 5KVHA 3UTFA 1DOCA 3QSSA 3IHGA 2BYBA 3SFDA 2AQJA 2PHHA 3NIXA 2BC0A 1RYIA 2GRTA 1JOAA 1XPQA 2WOVA 1PHHA 2ZZ0A 4JNAA 1BGJA 3Q6JA 4U8KA 4Y4NA 3NNEA 3DMEA 4B66A 2V3BA 1MO9A 2WPFA 5CKUA 3AXBA 2XDOA 3ISHA 3S5WA 3I6DA 5EB5A 1Q1RA 4AP1A 3EANA 4RG3A 3SGLA 4APNA 4Z2TA 1PXCA 1ZK7A 2PYXA 3AD7B 1ZMCA 2XLUA 2WU5A 2XCGA 4C3XA 4OPGA 2FBWA 5IQ4A 5L46A 1OJTA 4GF7A 3H4KA 3CPIG 1EL8A 3DK9A 5FS8A 1H83A 2VOUA 3ADAB 4TLXA 4B1BA 1F3PA 2FJBA 1B4VA 1RP0A 4IV9A 1PXAA 3KPFA 4Z26A 4FK1C 4EIQA 2C64A 3GD3A 2RGOA 1S3BA 4OPLA 1E39A 4K2XA 2GR3A 4CY8A 3CNPA 1NG3A 2WOWA 3L8KA 3VRBA 1EL5A 3UOZA 2X99A 3NLCA 4MJWA 1F6MA 1DOBA 1LTXR 2E4GA 2C3CA 2GAHB 1E7PA 4A6NB 1LPFA 4WCTA 3DK4A 4NZHA 2EQ8A 2XVEA 3ICSA 3DGZA 5KWFA 2A8XA 2JAEA 5J60A 4Z24A 1PJ5A 1CJ4A 3P9UA 3BHFA 1GALA 4HA6A 5CQFA 1B37A 1E1NA 2XLTA 3QVRA 4YKFA 4YTNA 2R0GA 4J31A 3BHKA 4Y4LA 1KDGA 1BZLA 1N1PA 4H4PA 4H4WA 4B67A 1BWCA 2C67A 4K7ZA 2HQMA 3CGDA 3AE7A 4NTEA 2WDVA 2X8CA 3KVEA 4H4SA 1LQUA 3UKLA 1F8SA 1Y56A 2DKHA 4TM1A 1ZDLA 1CL0A 4KX6A 2GMJA 2Q0LA 3NKSA 5JCNA 2GR0A 3PVCA 2VRLA 5C3JA 3C4AA 3AD8B 1GRTA 2ACZA 4GR1A 1CJ2A 2VQBA 1L9DA 2GQFA 2YLZA 3COXA 4XXGA 1CF3A 3CGBA 4H2RA 4A65A 3H8IA 2YR4A 1DODA 4EIPA 2WP6A 2BACA 4C3YA 1FEBA 3D1CA 4H4TA 1PBFA 1XHCA 3R9UA 3EAOA 4U2SA 4U2LA 4HB9A 2IVEA 3RP6A 4X4JA 3QFBA 3AE2A 3NTDA 2WHDA 4DSGA 2YR5A 2BC1A 3AE5A 3DGHA 1D5TA 4J57A 4YWOA 5KOXA 2F5ZA 4EQRA 3CGCA 3GRTA 1H84A 2X50A 3P4SA 1VG0A 2YG5A 1Y0PA 2C3DA 3AE8A 1ZP0A 2Y6QA 2BCGG 2B7SA 2GB0A 1M64A 1YQ4A 4K5RA 3UKQA 2B9XA 1IUXA 4PAAA 3IC9A 1UKVG 3C96A 1LV0A 1D4EA 2YG4A 3QJ4A 5ER0A 2VVLA 2BXRA 5HHFA 2JKCA 3GRSA 3IHMA 3KKJA 1KF6A 4U8NA 3O0HA 4Z25A 3AYJA 4UDPA 1GERA 4C5OA 2GR2A 3NG7X 1IUTA 2I0ZA 3DJEA 2XFQA 1NPXA 5KVIA 4EQSA 2NPXA 4I59A 1GETA 2WEUA 2WOIA 5KOWA 1YKJA 1IUVA 2WS3A 3K7QX 1FOHA 3GYIA 4GRTA 4XWRA 4OVIA 2YQUA 2X8GA 2YLTA 4LU6A 4NTDA 1BF3A 1QLBA 3K7TA 3LB8A 4JQ9A 2WBAA 2IVDA 4U2TA 5FS6A 1H6VA 2YLRA 5IPYA 1V59A 1GSNA 3NHOX 3UKHA 3DJDA 1EBDA 1K4QA 5JCMA 3E1TA 3BI2A 3GDPA 3DH9A 1Q9IA 2B9WA 2V3AA 3BNMA 1SEZA 1PN0A 3F8RA 4TM4A 4A5LA 4H4UA 3QVPA 3URHA 1YQZA 2YVFA 4B65A 2R0CA 4H7UA 4XWZA 3WE0A 2XVJA 4WX1A 3K30A 1DOEA 5BULA 4A9WA 2FJEA 4REKA 1JRZA 1KSSA 3IWAA 3FPZA 2JBVA 2Z5YA 3REDA 4A6NA 2A89A 2YAUA 1E6EA 1D7YA 2BK5A 4YSZA 2Z5XA 5JCIA 2CDUA 2J3NA 1O95A 1TDFA 4AT0A 1D4CA 2C75A 4AT2A 2QAEA 1NHPA 2ZZCA 1KNPA 2WQYA 2WU2A 2GV8A 2C72A 2RABA 1KNRA 5EB4A 2YVJA 4D03A 1NG4A 4Z44A 2A87A 4U8MA 3LZWA 1IJHA 1H7WA 2YWLA 3NTAA 4U8IA 1YY5A 3PO7A 3EF6A 3LXDA 3V3OA 1D7LA 4OPCA 3GSIA 1CJ3A 1GESA 1PXBA 2O9ZA 1OJDA 3ALLA 1OJAA 4J56A 4EMJA 1PS9A 2R4JA 3JSKA
chains in the Genus database with same CATH superfamily
1TDKA 2OLNA 4C74A 1NEKA 3CPHG 2C66A 4EMWA 2XLPA 2YM2A 1GOSA 3B6DA 4FK1A 3AYLA 4ZN0A 1CC6A 2YLWA 3B3RA 2YLSA 4IA5A 4CNJA 2WPCA 3CTYA 2YLXA 4AP3A 5HXIA 2VRMA 3GMCA 4H4ZA 4TM0A 2EQ9A 3SM8A 4B64A 1AOGA 3P1WA 3T14A 3AWIA 2APGA 1GV4A 2AR8A 2WP9A 3NK2X 1IUSA 4CY6A 3AE9A 5EBKA 3PS9A 1H86A 3ZDNA 1E1LA 2B76A 2GEWA 4NEWA 3UOXA 4ZCCA 5J7XA 2CVJA 1ZY8A 3RP7A 4K8DA 4Z2RA 3IF9A 4AOSA 5GSNA 1MXTA 4A99A 3CGEA 1FEAA 1NAAA 1ZMDA 3AEDA 1KSUA 1RSGA 1OJCA 4D04A 1F8WA 3RHAA 5EOWA 4BJYA 2JB1A 3QFAA 4OPDA 1ONFA 3GWDA 3AB1A 4YTPA 1BGNA 4I58A 1JNZA 1NHSA 2UZZA 2WETA 4J34A 3OZ2A 1OJ9A 3ATQA 2CFYA 1GTEA 1JNRA 4EM4A 3AEAA 3SQPA 2C7GA 1E1MA 3DJJA 5JCKA 5IQ1A 3CNJA 1PBBA 3BI5A 4USQA 3DJGX 1VDCA 3QSEA 3AEBA 5HYMA 2EQ7A 3SZFA 1GTHA 5KMRA 3K7MX 4AOXA 2BS3A 2ARDA 3LADA 2R9ZA 4YKGA 1H81A 3V3NA 4FDCB 1LJ1A 3HYVA 5U1OA 4UDRA 1S2YA 2BABA 3UTEA 5LV9A 4YSXA 3SFEA 2V60A 1TDEA 2E1MA 2XVHA 3AE6A 4N9XA 3UTGA 4CCRA 3P4PA 1H7XA 2GF3A 1CJCA 3G5RA 2BK4A 2ZZBA 4H4RA 5KMPA 4YXDA 2GQWA 4NEVA 4E0VA 4B69A 1GRAA 3II4A 3P4QA 2FJDA 1IUUA 1PJ7A 2YR6A 4H2NA 4JNQA 4NWZA 1QJDA 3AEGA 2B7RA 1KFYA 2DKIA 4FX9A 1MOKA 1P2EA 1VRQB 4YTMA 1ELIA 2XFPA 4PABA 2ZBWA 4EQXA 3OC4A 4GCMA 1LVLA 3RP8A 3CN8A 4OPUA 1NDAA 1O94A 2H89A 1GXFA 2V6OA 3EPTA 3ATRA 1TYPA 4H4QA 1GREA 1PJ6A 1ZX9A 4JDRA 4X9MA 2GR1A 3KLJA 4H2QA 4H50A 2B9YA 4BV6A 3SZ0A 4G73A 2JK6A 4Y4MA 4BK2A 1EL7A 5M10A 1CC4A 3UTHA 1E1KA 3ALJA 3ZYXA 3L1RA 4BURA 4B68A 5U63A 4BJZA 4P9SA 1IUWA 3AD9B 4IVOB 4CRTA 3I3LA 4LIIA 1PDHA 4IVMB 1TDNA 3UP5A 2R4EA 3ABVA 3KPKA 1QO8A 3G5QA 4O5UA 4LA1A 1XANA 3DK8A 2XLSA 4ZCDA 3AE1A 1ZOYA 1JRYA 1JEHA 3CIRA 2GMHA 3CNTA 3KD9A 5FS7A 3UKFA 4BK3A 2VZ2A 1X31B 1M6IA 1D4DA 4UDQA 5FS9A 3NYCA 5KRQA 1F8RA 1JU2A 3HZLA 4DNAA 1FECA 2R46A 4EQWA 2R45A 1YQ3A 1PBEA 1S2QA 1ZOVA 2QA1A 5KMSA 2GAGB 1K0LA 2RGHA 2V61A 3NN6X 4IA6A 3AEFA 5KXJA 3CNDA 3UOYA 3NT6A 1GRGA 3UKAA 2JB2A 1NENA 2Q0KA 2X8HA 1GT8A 4J33A 3SYIA 3UOVA 2EQ6A 2WESA 2XYOA 3Q9TA 1GNDA 3F8DA 1N4VA 3NK1X 4H4VA 3VRDB 2C73A 4EMIA 1B5QA 4YT0A 2QA2A 3NGCX 1DJNA 1NHRA 1L9EA 1W4XA 1L0VA 1TDOA 1CC2A 2Q6UA 2IIDA 3BI4A 2BXSA 3VR8A 1REOA 2VVLG 3CPJG 3NRNA 2TMDA 1NHQA 3ICRA 3NH3X 4J2WA 2WDQA 3DA1A 2XFOA 3H8LA 1CBOA 2XVIA 2GVCA 3T37A 1L9CA 3KU9A 2C70A 3P4RA 4A79A 1K0JA 4G6HA 1XDIA 3FMWA 2AAQA 3D8XA 4GDPA 1VQWA 4UP3A 2YG6A 5BVAA 4U8OA 4BK1A 3M13A 3UP4A 4JY3A 4M52A 4DGKA 4YSHA 3UKKA 2BCPA 1DNCA 3FBSA 3NYEA 5DBJA 2RGJA 1GEUA 2WDRA 3AE3A 2R0PA 2BRYA 4RG4A 3GD4A 3VR9A 4GUVA 1O5WA 2FJAA 2E5VA 2VVMA 4DSHA 3VRAA 5U25A 1DJQA 2BK3A 2CULA 4EM3A 2H88A 3LZXA 3AE4A 1S3EA 1Q1WA 3ALMA 1HYUA 1PBDA 4GAVA 2C76A 4X9NA 2OALA 4CNKA 4H2PA 1P2HA 2BS2A 1GPEA 2XFUA 3LJPA 3GMBA 1VG9A 2Y6RA 4Z43A 1GRFA 4J36A 3BNUA 4KPRA 4CCQA 4II3A 3F8PA 3LOVA 1PBCA 1N4WA 3RNMA 5KNLA 5BRTA 2X3NA 3KA7A 2BS4A 4CBQA 5M0ZA 3UKPA 4G74A 1N4UA 1GRBA 3UCLA 1FL2A 1Z6LA 2XFNA 4U8PA 2V5ZA 1CHUA 2XVFA 3FG2P 3SXIA 3M12A 5C2TA 5HY5A 3C4NA 3G5SA 3S61A 5JCLA 1Y56B 1COYA 3M0OA 3NN0X 4ICYA 4RSLA 3AECA 4A7AA 4ECHA 4U8JA 3SZWA 4C77A 2QCUA 3AYIA 3SY4A 3GWFA 2VQ7A 1JRXA 2OAMA 2XLRA 1BKWA 2W0HA 2OLOA 2GH5A 5GRTA 1TYTA 4U8LA 4JY2A 5FMHA 5TR3A 1DXLA 2OA1A 3GYXA 2WP5A 4TLZA 4YSYA 3CNSA 3ICTA 3QSMA 4OPIA 4B63A 2JB3A 2TPRA 2C65A 2YG7A 3GYJA 3ITJA 3VQRA 1FCDA 2NVKX 2YM1A 4K22A 4OCGA 1ZKQA 4USRA 4H4YA 3V76A 2YG3A 4ADWA 1B8SA 4GDEA 4H4XA 3FIMB 3SZCA 1K0IA 3NK0X 4JN9A 4O5QA 1TRBA 3NYFA 2WPEA 4NTCA 2YVGA 3GDNA 1GRHA 1EL9A 2BA9A 1LQTA 3AEEA 4OPTA 2Q7VA 4K5SA 4TM3A 1H82A 5BUKA 4Z2UA 5KVHA 3UTFA 1DOCA 3QSSA 3IHGA 2BYBA 3SFDA 2AQJA 2PHHA 3NIXA 2BC0A 1RYIA 2GRTA 1JOAA 1XPQA 2WOVA 1PHHA 2ZZ0A 4JNAA 1BGJA 3Q6JA 4U8KA 4Y4NA 3NNEA 3DMEA 4B66A 2V3BA 1MO9A 2WPFA 5CKUA 3AXBA 2XDOA 3ISHA 3S5WA 3I6DA 5EB5A 3HYWA 1Q1RA 4AP1A 3EANA 4RG3A 3SGLA 4APNA 4Z2TA 1PXCA 1ZK7A 2PYXA 3AD7B 1ZMCA 2XLUA 2WU5A 2XCGA 4C3XA 4OPGA 2FBWA 5IQ4A 5L46A 1OJTA 4GF7A 3H4KA 3CPIG 1EL8A 3DK9A 3CMMA 5FS8A 1H83A 2VOUA 3ADAB 4TLXA 4B1BA 1F3PA 2FJBA 1B4VA 1RP0A 4IV9A 1PXAA 3KPFA 4Z26A 4FK1C 3HYXA 4EIQA 2C64A 3GD3A 2RGOA 1S3BA 4OPLA 1E39A 4K2XA 2GR3A 4G6GA 4CY8A 3CNPA 1NG3A 2WOWA 3L8KA 3VRBA 1EL5A 3UOZA 2X99A 3NLCA 4MJWA 1F6MA 1DOBA 1LTXR 2E4GA 2C3CA 2GAHB 1E7PA 4A6NB 1LPFA 4WCTA 3DK4A 4NZHA 2EQ8A 2XVEA 3ICSA 3DGZA 5KWFA 2A8XA 2JAEA 5J60A 4Z24A 1PJ5A 1CJ4A 3P9UA 3BHFA 1GALA 4HA6A 5CQFA 1B37A 1E1NA 2XLTA 3QVRA 4YKFA 4YTNA 2R0GA 4J31A 3BHKA 4Y4LA 1KDGA 1BZLA 1N1PA 4H4PA 4H4WA 4B67A 1BWCA 2C67A 4K7ZA 2HQMA 5KMQA 3CGDA 3AE7A 4NTEA 2WDVA 2X8CA 3KVEA 4H4SA 1LQUA 3UKLA 1F8SA 1Y56A 2DKHA 4TM1A 1ZDLA 1CL0A 4KX6A 2GMJA 2Q0LA 3NKSA 5JCNA 2GR0A 3PVCA 2VRLA 3T2YA 5C3JA 3C4AA 3AD8B 1GRTA 2ACZA 4GR1A 1CJ2A 2BRAA 1L9DA 2VQBA 2GQFA 2YLZA 3COXA 4XXGA 1CF3A 3CGBA 4H2RA 4A65A 3H8IA 2YR4A 1DODA 4EIPA 3T2ZA 2WP6A 2BACA 4C3YA 1FEBA 3D1CA 4H4TA 1PBFA 1XHCA 3R9UA 3EAOA 2C4CA 4U2SA 4U2LA 4HB9A 2IVEA 3RP6A 4X4JA 3QFBA 3AE2A 3NTDA 2WHDA 4DSGA 2YR5A 2BC1A 3AE5A 3DGHA 1D5TA 4J57A 4YWOA 5KOXA 2F5ZA 4EQRA 3CGCA 3GRTA 1H84A 2X50A 3P4SA 1VG0A 2YG5A 1Y0PA 2C3DA 3AE8A 1ZP0A 2Y6QA 3T0KA 2BCGG 2B7SA 4G9KA 2GB0A 1M64A 1YQ4A 4K5RA 3UKQA 2B9XA 1IUXA 4PAAA 3IC9A 1UKVG 3C96A 1LV0A 1D4EA 2YG4A 3QJ4A 5ER0A 2VVLA 2BXRA 5HHFA 2JKCA 3GRSA 3IHMA 3KKJA 1KF6A 4U8NA 3O0HA 4Z25A 3AYJA 4UDPA 3T2KA 1GERA 4C5OA 2GR2A 3NG7X 1IUTA 2I0ZA 3DJEA 2XFQA 1NPXA 5KVIA 4EQSA 2NPXA 4I59A 1GETA 2WEUA 2WOIA 4GAPA 5KOWA 1YKJA 1IUVA 2WS3A 3K7QX 1FOHA 3GYIA 4GRTA 4XWRA 4OVIA 2YQUA 2X8GA 2YLTA 4LU6A 4NTDA 1BF3A 1QLBA 3K7TA 3LB8A 4JQ9A 2WBAA 2IVDA 4U2TA 5FS6A 1H6VA 2YLRA 5IPYA 1V59A 1GSNA 3NHOX 3UKHA 3DJDA 1EBDA 1K4QA 5JCMA 3E1TA 4II2A 3BI2A 3GDPA 3DH9A 1Q9IA 2B9WA 2V3AA 3BNMA 1SEZA 1PN0A 3F8RA 4TM4A 4A5LA 4H4UA 3QVPA 3URHA 1YQZA 2YVFA 4B65A 2R0CA 4H7UA 4XWZA 3WE0A 2XVJA 4WX1A 3K30A 1DOEA 5BULA 4A9WA 2FJEA 4REKA 1JRZA 1KSSA 3IWAA 3FPZA 2JBVA 2Z5YA 3REDA 4A6NA 2A89A 2YAUA 1E6EA 1D7YA 2BK5A 4YSZA 2Z5XA 5JCIA 2CDUA 2J3NA 1O95A 1TDFA 4AT0A 1D4CA 2C75A 4AT2A 3SX6A 2QAEA 1NHPA 2ZZCA 1KNPA 2WQYA 2WU2A 2GV8A 2C72A 2RABA 1KNRA 5EB4A 2YVJA 4D03A 1NG4A 4Z44A 2A87A 4U8MA 3LZWA 1IJHA 1H7WA 2YWLA 3NTAA 4U8IA 1YY5A 3PO7A 3EF6A 3LXDA 3V3OA 1D7LA 4OPCA 3T31A 4NNJA 3GSIA 1CJ3A 1GESA 1PXBA 2O9ZA 1OJDA 3ALLA 1OJAA 4J56A 4EMJA 1PS9A 2R4JA 3JSKA
chains in the Genus database with same CATH topology
1TDKA 2OLNA 4C74A 1NEKA 3CPHG 2C66A 4EMWA 2XLPA 2YM2A 1GOSA 3B6DA 4FK1A 3AYLA 4ZN0A 1CC6A 2YLWA 3B3RA 2YLSA 4IA5A 4CNJA 2WPCA 3CTYA 2YLXA 4AP3A 5HXIA 2VRMA 3GMCA 4H4ZA 4TM0A 2EQ9A 3SM8A 4B64A 1AOGA 3P1WA 3T14A 3AWIA 2APGA 1GV4A 2AR8A 2WP9A 3NK2X 1IUSA 4CY6A 3AE9A 5EBKA 3PS9A 1H86A 3ZDNA 1E1LA 2B76A 2GEWA 4NEWA 3UOXA 4ZCCA 5J7XA 2CVJA 1ZY8A 3RP7A 4K8DA 4Z2RA 3IF9A 4AOSA 5GSNA 1MXTA 4A99A 3CGEA 1FEAA 1NAAA 1ZMDA 3AEDA 1KSUA 1RSGA 1OJCA 4D04A 1F8WA 3RHAA 5EOWA 4BJYA 2JB1A 3QFAA 4OPDA 1ONFA 3GWDA 3AB1A 4YTPA 1BGNA 4I58A 1JNZA 1NHSA 2UZZA 2WETA 4J34A 3OZ2A 1OJ9A 3ATQA 2CFYA 1GTEA 1JNRA 4EM4A 3AEAA 3SQPA 2C7GA 1E1MA 3DJJA 5JCKA 5IQ1A 3CNJA 1PBBA 3BI5A 4USQA 3DJGX 1VDCA 3QSEA 3AEBA 5HYMA 2EQ7A 3SZFA 1GTHA 5KMRA 3K7MX 4AOXA 2BS3A 2ARDA 3LADA 2R9ZA 4YKGA 1H81A 3V3NA 4FDCB 1LJ1A 3HYVA 5U1OA 4UDRA 1S2YA 2BABA 3UTEA 5LV9A 4YSXA 3SFEA 2V60A 1TDEA 2E1MA 2XVHA 3AE6A 4N9XA 3UTGA 4CCRA 3P4PA 1H7XA 2GF3A 1CJCA 3G5RA 2BK4A 2ZZBA 4H4RA 5KMPA 4YXDA 2GQWA 4NEVA 4E0VA 4B69A 1GRAA 3II4A 3P4QA 2FJDA 1IUUA 1PJ7A 2YR6A 4H2NA 4JNQA 4NWZA 1QJDA 3AEGA 2B7RA 1KFYA 2DKIA 4FX9A 1MOKA 1P2EA 1VRQB 4YTMA 1ELIA 2XFPA 4PABA 2ZBWA 4EQXA 3OC4A 4GCMA 1LVLA 3RP8A 3CN8A 4OPUA 1NDAA 1O94A 2H89A 1GXFA 2V6OA 3EPTA 3ATRA 1TYPA 4H4QA 1GREA 1PJ6A 1ZX9A 4JDRA 4X9MA 2GR1A 3KLJA 4H2QA 4H50A 2B9YA 4BV6A 3SZ0A 4G73A 2JK6A 4Y4MA 4BK2A 1EL7A 5M10A 1CC4A 3UTHA 1E1KA 3ALJA 3ZYXA 3L1RA 4BURA 4B68A 5U63A 4BJZA 4P9SA 1IUWA 3AD9B 4IVOB 4CRTA 3I3LA 4LIIA 1PDHA 4IVMB 1TDNA 3UP5A 2R4EA 3ABVA 3KPKA 1QO8A 3G5QA 4O5UA 4LA1A 1XANA 3DK8A 2XLSA 4ZCDA 3AE1A 1ZOYA 1JRYA 1JEHA 3CIRA 2GMHA 3CNTA 3KD9A 5FS7A 3UKFA 4BK3A 2VZ2A 1X31B 1M6IA 1D4DA 4UDQA 5FS9A 3NYCA 5KRQA 1F8RA 1JU2A 3HZLA 4DNAA 1FECA 2R46A 4EQWA 2R45A 1YQ3A 1PBEA 1S2QA 1ZOVA 2QA1A 5KMSA 2GAGB 1K0LA 2RGHA 2V61A 3NN6X 4IA6A 3AEFA 5KXJA 3CNDA 3UOYA 3NT6A 1GRGA 3UKAA 2JB2A 1NENA 2Q0KA 2X8HA 1GT8A 4J33A 3SYIA 3UOVA 2EQ6A 2WESA 2XYOA 3Q9TA 1GNDA 3F8DA 1N4VA 3NK1X 4H4VA 3VRDB 2C73A 4EMIA 1B5QA 4YT0A 2QA2A 3NGCX 1DJNA 1NHRA 1L9EA 1W4XA 1L0VA 1TDOA 1CC2A 2Q6UA 2IIDA 3BI4A 2BXSA 3VR8A 1REOA 2VVLG 3CPJG 3NRNA 2TMDA 1NHQA 3ICRA 3NH3X 4J2WA 2WDQA 3DA1A 2XFOA 3H8LA 1CBOA 2XVIA 2GVCA 3T37A 1L9CA 3KU9A 2C70A 3P4RA 4A79A 1K0JA 4G6HA 1XDIA 3FMWA 2AAQA 3D8XA 4GDPA 1VQWA 4UP3A 2YG6A 5BVAA 4U8OA 4BK1A 3M13A 3UP4A 4JY3A 4M52A 4DGKA 4YSHA 3UKKA 2BCPA 1DNCA 3FBSA 3NYEA 5DBJA 2RGJA 1GEUA 2WDRA 3AE3A 2R0PA 2BRYA 4RG4A 3GD4A 3VR9A 4GUVA 1O5WA 2FJAA 2E5VA 2VVMA 4DSHA 3VRAA 5U25A 1DJQA 2BK3A 2CULA 4EM3A 2H88A 3LZXA 3AE4A 1S3EA 1Q1WA 3ALMA 1HYUA 1PBDA 4GAVA 2C76A 4X9NA 2OALA 4CNKA 4H2PA 1P2HA 2BS2A 1GPEA 2XFUA 3LJPA 3GMBA 1VG9A 2Y6RA 4Z43A 1GRFA 4J36A 3BNUA 4KPRA 4CCQA 4II3A 3F8PA 3LOVA 1PBCA 1N4WA 3RNMA 5KNLA 5BRTA 2X3NA 3KA7A 2BS4A 4CBQA 5M0ZA 3UKPA 4G74A 1N4UA 1GRBA 3UCLA 1FL2A 1Z6LA 2XFNA 4U8PA 2V5ZA 1CHUA 2XVFA 3FG2P 3SXIA 3M12A 5C2TA 5HY5A 3C4NA 3G5SA 3S61A 5JCLA 1Y56B 1COYA 3M0OA 3NN0X 4ICYA 4RSLA 3AECA 4A7AA 4ECHA 4U8JA 3SZWA 4C77A 2QCUA 3AYIA 3SY4A 3GWFA 2VQ7A 1JRXA 2OAMA 2XLRA 1BKWA 2W0HA 2OLOA 2GH5A 5GRTA 1TYTA 4U8LA 4JY2A 5FMHA 5TR3A 1DXLA 2OA1A 3GYXA 2WP5A 4TLZA 4YSYA 3CNSA 3ICTA 3QSMA 4OPIA 4B63A 2JB3A 2TPRA 2C65A 2YG7A 3GYJA 3ITJA 3VQRA 1FCDA 2NVKX 2YM1A 4K22A 4OCGA 1ZKQA 4USRA 4H4YA 3V76A 2YG3A 4ADWA 1B8SA 4GDEA 4H4XA 3FIMB 3SZCA 1K0IA 3NK0X 4JN9A 4O5QA 1TRBA 3NYFA 2WPEA 4NTCA 2YVGA 3GDNA 1GRHA 1EL9A 2BA9A 1LQTA 3AEEA 4OPTA 2Q7VA 4K5SA 4TM3A 1H82A 5BUKA 4Z2UA 5KVHA 3UTFA 1DOCA 3QSSA 3IHGA 2BYBA 3SFDA 2AQJA 2PHHA 3NIXA 2BC0A 1RYIA 2GRTA 1JOAA 1XPQA 2WOVA 1PHHA 2ZZ0A 4JNAA 1BGJA 3Q6JA 4U8KA 4Y4NA 3NNEA 3DMEA 4B66A 2V3BA 1MO9A 2WPFA 5CKUA 3AXBA 2XDOA 3ISHA 3S5WA 3I6DA 5EB5A 3HYWA 1Q1RA 4AP1A 3EANA 4RG3A 3SGLA 4APNA 4Z2TA 1PXCA 1ZK7A 2PYXA 3AD7B 1ZMCA 2XLUA 2WU5A 2XCGA 4C3XA 4OPGA 2FBWA 5IQ4A 5L46A 1OJTA 4GF7A 3H4KA 3CPIG 1EL8A 3DK9A 3CMMA 5FS8A 1H83A 2VOUA 3ADAB 4TLXA 4B1BA 1F3PA 2FJBA 1B4VA 1RP0A 4IV9A 1PXAA 3KPFA 4Z26A 4FK1C 3HYXA 4EIQA 2C64A 3GD3A 2RGOA 1S3BA 4OPLA 1E39A 4K2XA 2GR3A 4G6GA 4CY8A 3CNPA 1NG3A 2WOWA 3L8KA 3VRBA 1EL5A 3UOZA 2X99A 3NLCA 4MJWA 1F6MA 1DOBA 1LTXR 2E4GA 2C3CA 2GAHB 1E7PA 4A6NB 1LPFA 4WCTA 3DK4A 4NZHA 2EQ8A 2XVEA 3ICSA 3DGZA 5KWFA 2A8XA 2JAEA 5J60A 4Z24A 1PJ5A 1CJ4A 3P9UA 3BHFA 1GALA 4HA6A 5CQFA 1B37A 1E1NA 2XLTA 3QVRA 4YKFA 4YTNA 2R0GA 4J31A 3BHKA 4Y4LA 1KDGA 1BZLA 1N1PA 4H4PA 4H4WA 4B67A 1BWCA 2C67A 4K7ZA 2HQMA 5KMQA 3CGDA 3AE7A 4NTEA 2WDVA 2X8CA 3KVEA 4H4SA 1LQUA 3UKLA 1F8SA 1Y56A 2DKHA 4TM1A 1ZDLA 1CL0A 4KX6A 2GMJA 2Q0LA 3NKSA 5JCNA 2GR0A 3PVCA 2VRLA 3T2YA 5C3JA 3C4AA 3AD8B 1GRTA 2ACZA 4GR1A 1CJ2A 2BRAA 1L9DA 2VQBA 2GQFA 2YLZA 3COXA 4XXGA 1CF3A 3CGBA 4H2RA 4A65A 3H8IA 2YR4A 1DODA 4EIPA 3T2ZA 2WP6A 2BACA 4C3YA 1FEBA 3D1CA 4H4TA 1PBFA 1XHCA 3R9UA 3EAOA 2C4CA 4U2SA 4U2LA 4HB9A 2IVEA 3RP6A 4X4JA 3QFBA 3AE2A 3NTDA 2WHDA 4DSGA 2YR5A 2BC1A 3AE5A 3DGHA 1D5TA 4J57A 4YWOA 5KOXA 2F5ZA 4EQRA 3CGCA 3GRTA 1H84A 2X50A 3P4SA 1VG0A 2YG5A 1Y0PA 2C3DA 3AE8A 1ZP0A 2Y6QA 3T0KA 2BCGG 2B7SA 4G9KA 2GB0A 1M64A 1YQ4A 4K5RA 3UKQA 2B9XA 1IUXA 4PAAA 3IC9A 1UKVG 3C96A 1LV0A 1D4EA 2YG4A 3QJ4A 5ER0A 2VVLA 2BXRA 5HHFA 2JKCA 3GRSA 3IHMA 3KKJA 1KF6A 4U8NA 3O0HA 4Z25A 3AYJA 4UDPA 3T2KA 1GERA 4C5OA 2GR2A 3NG7X 1IUTA 2I0ZA 3DJEA 2XFQA 1NPXA 5KVIA 4EQSA 2NPXA 4I59A 1GETA 2WEUA 2WOIA 4GAPA 5KOWA 1YKJA 1IUVA 2WS3A 3K7QX 1FOHA 3GYIA 4GRTA 4XWRA 4OVIA 2YQUA 2X8GA 2YLTA 4LU6A 4NTDA 1BF3A 1QLBA 3K7TA 3LB8A 4JQ9A 2WBAA 2IVDA 4U2TA 5FS6A 1H6VA 2YLRA 5IPYA 1V59A 1GSNA 3NHOX 3UKHA 3DJDA 1EBDA 1K4QA 5JCMA 3E1TA 4II2A 3BI2A 3GDPA 3DH9A 1Q9IA 2B9WA 2V3AA 3BNMA 1SEZA 1PN0A 3F8RA 4TM4A 4A5LA 4H4UA 3QVPA 3URHA 1YQZA 2YVFA 4B65A 2R0CA 4H7UA 4XWZA 3WE0A 2XVJA 4WX1A 3K30A 1DOEA 5BULA 4A9WA 2FJEA 4REKA 1JRZA 1KSSA 3IWAA 3FPZA 2JBVA 2Z5YA 3REDA 4A6NA 2A89A 2YAUA 1E6EA 1D7YA 2BK5A 4YSZA 2Z5XA 5JCIA 2CDUA 2J3NA 1O95A 1TDFA 4AT0A 1D4CA 2C75A 4AT2A 3SX6A 2QAEA 1NHPA 2ZZCA 1KNPA 2WQYA 2WU2A 2GV8A 2C72A 2RABA 1KNRA 5EB4A 2YVJA 4D03A 1NG4A 4Z44A 2A87A 4U8MA 3LZWA 1IJHA 1H7WA 2YWLA 3NTAA 4U8IA 1YY5A 3PO7A 3EF6A 3LXDA 3V3OA 1D7LA 4OPCA 3T31A 4NNJA 3GSIA 1CJ3A 1GESA 1PXBA 2O9ZA 1OJDA 3ALLA 1OJAA 4J56A 4EMJA 1PS9A 2R4JA 3JSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDK A;  2OLN A;  4C74 A;  1NEK A;  3CPH G;  2C66 A;  4EMW A;  2XLP A;  2YM2 A;  1GOS A;  3B6D A;  4FK1 A;  3AYL A;  4ZN0 A;  1CC6 A;  2YLW A;  3B3R A;  2YLS A;  4IA5 A;  4CNJ A;  2WPC A;  3CTY A;  2YLX A;  4AP3 A;  5HXI A;  2VRM A;  3GMC A;  4H4Z A;  4TM0 A;  2EQ9 A;  3SM8 A;  4B64 A;  1AOG A;  3P1W A;  3AWI A;  2APG A;  1GV4 A;  2AR8 A;  2WP9 A;  3NK2 X;  1IUS A;  4CY6 A;  3AE9 A;  5EBK A;  3PS9 A;  1H86 A;  3ZDN A;  1E1L A;  2B76 A;  2GEW A;  4NEW A;  3UOX A;  4ZCC A;  5J7X A;  2CVJ A;  1ZY8 A;  3RP7 A;  4K8D A;  4Z2R A;  3IF9 A;  4AOS A;  5GSN A;  1MXT A;  4A99 A;  3CGE A;  1FEA A;  1NAA A;  1ZMD A;  3AED A;  1KSU A;  1RSG A;  1OJC A;  4D04 A;  1F8W A;  3RHA A;  5EOW A;  4BJY A;  2JB1 A;  3QFA A;  4OPD A;  1ONF A;  3GWD A;  3AB1 A;  4YTP A;  1BGN A;  4I58 A;  1JNZ A;  1NHS A;  2UZZ A;  2WET A;  4J34 A;  3OZ2 A;  1OJ9 A;  3ATQ A;  2CFY A;  1GTE A;  1JNR A;  4EM4 A;  3AEA A;  3SQP A;  2C7G A;  1E1M A;  3DJJ A;  5JCK A;  5IQ1 A;  3CNJ A;  1PBB A;  3BI5 A;  4USQ A;  3DJG X;  1VDC A;  3QSE A;  3AEB A;  5HYM A;  2EQ7 A;  1GTH A;  3K7M X;  4AOX A;  2BS3 A;  2ARD A;  3LAD A;  2R9Z A;  4YKG A;  1H81 A;  3V3N A;  4FDC B;  1LJ1 A;  5U1O A;  4UDR A;  1S2Y A;  2BAB A;  3UTE A;  5LV9 A;  4YSX A;  3SFE A;  2V60 A;  1TDE A;  2E1M A;  2XVH A;  3AE6 A;  4N9X A;  3UTG A;  4CCR A;  3P4P A;  1H7X A;  2GF3 A;  1CJC A;  3G5R A;  2BK4 A;  2ZZB A;  4H4R A;  4YXD A;  2GQW A;  4NEV A;  4E0V A;  4B69 A;  1GRA A;  3II4 A;  3P4Q A;  2FJD A;  1IUU A;  1PJ7 A;  2YR6 A;  4H2N A;  4JNQ A;  1QJD A;  3AEG A;  2B7R A;  1KFY A;  2DKI A;  4FX9 A;  1MOK A;  1P2E A;  1VRQ B;  4YTM A;  1ELI A;  2XFP A;  4PAB A;  2ZBW A;  4EQX A;  3OC4 A;  4GCM A;  1LVL A;  3RP8 A;  3CN8 A;  4OPU A;  1NDA A;  1O94 A;  2H89 A;  1GXF A;  2V6O A;  3EPT A;  3ATR A;  1TYP A;  4H4Q A;  1GRE A;  1PJ6 A;  1ZX9 A;  4JDR A;  4X9M A;  2GR1 A;  3KLJ A;  4H2Q A;  4H50 A;  2B9Y A;  4BV6 A;  2JK6 A;  4Y4M A;  4BK2 A;  1EL7 A;  5M10 A;  1CC4 A;  3UTH A;  1E1K A;  3ALJ A;  3ZYX A;  3L1R A;  4BUR A;  4B68 A;  5U63 A;  4BJZ A;  4P9S A;  1IUW A;  3AD9 B;  4IVO B;  4CRT A;  3I3L A;  4LII A;  1PDH A;  4IVM B;  1TDN A;  3UP5 A;  2R4E A;  3ABV A;  4O5U A;  1QO8 A;  3G5Q A;  4LA1 A;  1XAN A;  3DK8 A;  2XLS A;  4ZCD A;  3AE1 A;  1ZOY A;  1JRY A;  1JEH A;  3CIR A;  2GMH A;  3CNT A;  3KD9 A;  5FS7 A;  3UKF A;  4BK3 A;  2VZ2 A;  1X31 B;  1M6I A;  1D4D A;  4UDQ A;  5FS9 A;  3NYC A;  5KRQ A;  1F8R A;  1JU2 A;  3HZL A;  4DNA A;  1FEC A;  2R46 A;  4EQW A;  2R45 A;  1YQ3 A;  1PBE A;  1S2Q A;  1ZOV A;  2QA1 A;  2GAG B;  1K0L A;  2RGH A;  2V61 A;  3NN6 X;  4IA6 A;  3AEF A;  5KXJ A;  3CND A;  3UOY A;  3NT6 A;  1GRG A;  3UKA A;  2JB2 A;  1NEN A;  2Q0K A;  2X8H A;  1GT8 A;  4J33 A;  3UOV A;  2EQ6 A;  2WES A;  2XYO A;  3Q9T A;  1GND A;  3F8D A;  1N4V A;  3NK1 X;  4H4V A;  3VRD B;  2C73 A;  4EMI A;  1B5Q A;  4YT0 A;  2QA2 A;  3NGC X;  1DJN A;  1NHR A;  1L9E A;  1W4X A;  1L0V A;  1TDO A;  1CC2 A;  2Q6U A;  2IID A;  3BI4 A;  2BXS A;  3VR8 A;  1REO A;  2VVL G;  3CPJ G;  3NRN A;  2TMD A;  1NHQ A;  3ICR A;  3NH3 X;  4J2W A;  2WDQ A;  3DA1 A;  2XFO A;  3H8L A;  1CBO A;  2XVI A;  2GVC A;  3T37 A;  1L9C A;  3KU9 A;  2C70 A;  3P4R A;  4A79 A;  1K0J A;  1XDI A;  3FMW A;  2AAQ A;  3D8X A;  4GDP A;  1VQW A;  4UP3 A;  2YG6 A;  5BVA A;  4U8O A;  4BK1 A;  3M13 A;  3UP4 A;  4JY3 A;  4M52 A;  4DGK A;  4YSH A;  3UKK A;  2BCP A;  1DNC A;  3FBS A;  3NYE A;  5DBJ A;  2RGJ A;  1GEU A;  2WDR A;  3AE3 A;  2R0P A;  4RG4 A;  3GD4 A;  3VR9 A;  4GUV A;  1O5W A;  2FJA A;  2E5V A;  2VVM A;  4DSH A;  3VRA A;  5U25 A;  1DJQ A;  2BK3 A;  2CUL A;  4EM3 A;  2H88 A;  3LZX A;  3AE4 A;  1S3E A;  1Q1W A;  3ALM A;  1HYU A;  1PBD A;  2C76 A;  4X9N A;  2OAL A;  4CNK A;  4H2P A;  1P2H A;  2BS2 A;  1GPE A;  2XFU A;  3LJP A;  3GMB A;  1VG9 A;  2Y6R A;  4Z43 A;  1GRF A;  4J36 A;  3BNU A;  4KPR A;  4CCQ A;  3F8P A;  3LOV A;  1PBC A;  1N4W A;  3RNM A;  5BRT A;  2X3N A;  3KA7 A;  2BS4 A;  4CBQ A;  5M0Z A;  3UKP A;  1N4U A;  1GRB A;  3UCL A;  1FL2 A;  1Z6L A;  2XFN A;  4U8P A;  2V5Z A;  1CHU A;  2XVF A;  3FG2 P;  5HY5 A;  3M12 A;  5C2T A;  3C4N A;  3G5S A;  3S61 A;  5JCL A;  1Y56 B;  1COY A;  3M0O A;  3NN0 X;  4ICY A;  4RSL A;  3AEC A;  4A7A A;  4ECH A;  4U8J A;  4C77 A;  2QCU A;  3AYI A;  3GWF A;  2VQ7 A;  1JRX A;  2OAM A;  2XLR A;  1BKW A;  2W0H A;  2OLO A;  2GH5 A;  5GRT A;  1TYT A;  4U8L A;  4JY2 A;  5FMH A;  5TR3 A;  1DXL A;  2OA1 A;  2WP5 A;  4TLZ A;  4YSY A;  3CNS A;  3ICT A;  3QSM A;  4OPI A;  4B63 A;  2JB3 A;  2TPR A;  2C65 A;  2YG7 A;  3GYJ A;  3ITJ A;  3VQR A;  1FCD A;  2NVK X;  2YM1 A;  4K22 A;  4OCG A;  1ZKQ A;  4USR A;  4H4Y A;  3V76 A;  2YG3 A;  4ADW A;  1B8S A;  4GDE A;  4H4X A;  3FIM B;  1K0I A;  3NK0 X;  4JN9 A;  4O5Q A;  1TRB A;  3NYF A;  2WPE A;  4NTC A;  2YVG A;  3GDN A;  1GRH A;  1EL9 A;  2BA9 A;  1LQT A;  3AEE A;  4OPT A;  2Q7V A;  4K5S A;  4TM3 A;  1H82 A;  5BUK A;  4Z2U A;  5KVH A;  3UTF A;  1DOC A;  3QSS A;  3IHG A;  2BYB A;  3SFD A;  2AQJ A;  2PHH A;  3NIX A;  2BC0 A;  1RYI A;  2GRT A;  1JOA A;  1XPQ A;  2WOV A;  1PHH A;  2ZZ0 A;  4JNA A;  1BGJ A;  3Q6J A;  4U8K A;  4Y4N A;  3NNE A;  3DME A;  4B66 A;  2V3B A;  1MO9 A;  2WPF A;  5CKU A;  3AXB A;  2XDO A;  3ISH A;  3S5W A;  3I6D A;  5EB5 A;  1Q1R A;  4AP1 A;  3EAN A;  4RG3 A;  3SGL A;  4APN A;  4Z2T A;  1PXC A;  1ZK7 A;  2PYX A;  3AD7 B;  1ZMC A;  2XLU A;  2WU5 A;  2XCG A;  4C3X A;  4OPG A;  2FBW A;  5IQ4 A;  5L46 A;  1OJT A;  4GF7 A;  3H4K A;  3CPI G;  1EL8 A;  3DK9 A;  5FS8 A;  1H83 A;  2VOU A;  3ADA B;  4TLX A;  4B1B A;  1F3P A;  2FJB A;  1B4V A;  1RP0 A;  4IV9 A;  1PXA A;  3KPF A;  4Z26 A;  4FK1 C;  4EIQ A;  2C64 A;  3GD3 A;  2RGO A;  1S3B A;  4OPL A;  1E39 A;  4K2X A;  2GR3 A;  4CY8 A;  3CNP A;  1NG3 A;  2WOW A;  3L8K A;  3VRB A;  1EL5 A;  3UOZ A;  2X99 A;  3NLC A;  4MJW A;  1F6M A;  1DOB A;  1LTX R;  2E4G A;  2C3C A;  2GAH B;  1E7P A;  4A6N B;  1LPF A;  4WCT A;  3DK4 A;  4NZH A;  2EQ8 A;  2XVE A;  3ICS A;  3DGZ A;  5KWF A;  2A8X A;  2JAE A;  5J60 A;  4Z24 A;  1PJ5 A;  1CJ4 A;  3P9U A;  3BHF A;  1GAL A;  4HA6 A;  5CQF A;  1B37 A;  1E1N A;  2XLT A;  3QVR A;  4YKF A;  4YTN A;  2R0G A;  4J31 A;  3BHK A;  4Y4L A;  1KDG A;  1BZL A;  1N1P A;  4H4P A;  4H4W A;  4B67 A;  1BWC A;  2C67 A;  4K7Z A;  2HQM A;  3CGD A;  3AE7 A;  4NTE A;  2WDV A;  2X8C A;  3KVE A;  4H4S A;  1LQU A;  3UKL A;  1F8S A;  1Y56 A;  2DKH A;  4TM1 A;  1ZDL A;  1CL0 A;  4KX6 A;  2GMJ A;  2Q0L A;  3NKS A;  5JCN A;  2GR0 A;  3PVC A;  2VRL A;  5C3J A;  3C4A A;  3AD8 B;  1GRT A;  2ACZ A;  4GR1 A;  1CJ2 A;  2VQB A;  1L9D A;  2GQF A;  2YLZ A;  3COX A;  4XXG A;  1CF3 A;  3CGB A;  4H2R A;  4A65 A;  3H8I A;  2YR4 A;  1DOD A;  4EIP A;  2WP6 A;  2BAC A;  4C3Y A;  1FEB A;  3D1C A;  4H4T A;  1PBF A;  1XHC A;  3R9U A;  3EAO A;  4U2S A;  4U2L A;  4HB9 A;  2IVE A;  3RP6 A;  4X4J A;  3QFB A;  3AE2 A;  3NTD A;  2WHD A;  4DSG A;  2YR5 A;  2BC1 A;  3AE5 A;  3DGH A;  1D5T A;  4J57 A;  4YWO A;  5KOX A;  2F5Z A;  4EQR A;  3CGC A;  3GRT A;  1H84 A;  2X50 A;  3P4S A;  1VG0 A;  2YG5 A;  1Y0P A;  2C3D A;  3AE8 A;  1ZP0 A;  2Y6Q A;  2BCG G;  2B7S A;  2GB0 A;  1M64 A;  1YQ4 A;  4K5R A;  3UKQ A;  2B9X A;  1IUX A;  4PAA A;  3IC9 A;  1UKV G;  3C96 A;  1LV0 A;  1D4E A;  2YG4 A;  3QJ4 A;  5ER0 A;  2VVL A;  2BXR A;  5HHF A;  2JKC A;  3GRS A;  3IHM A;  3KKJ A;  1KF6 A;  4U8N A;  3O0H A;  4Z25 A;  3AYJ A;  4UDP A;  1GER A;  4C5O A;  2GR2 A;  3NG7 X;  1IUT A;  2I0Z A;  3DJE A;  2XFQ A;  1NPX A;  5KVI A;  4EQS A;  2NPX A;  4I59 A;  1GET A;  2WEU A;  2WOI A;  5KOW A;  1YKJ A;  1IUV A;  2WS3 A;  3K7Q X;  1FOH A;  3GYI A;  4GRT A;  4XWR A;  4OVI A;  2YQU A;  2X8G A;  2YLT A;  4LU6 A;  4NTD A;  1BF3 A;  1QLB A;  3K7T A;  3LB8 A;  4JQ9 A;  2WBA A;  2IVD A;  4U2T A;  5FS6 A;  1H6V A;  2YLR A;  5IPY A;  1V59 A;  1GSN A;  3NHO X;  3UKH A;  3DJD A;  1EBD A;  1K4Q A;  5JCM A;  3E1T A;  3BI2 A;  3GDP A;  3DH9 A;  1Q9I A;  2B9W A;  2V3A A;  3BNM A;  1SEZ A;  1PN0 A;  3F8R A;  4TM4 A;  4A5L A;  4H4U A;  3QVP A;  3URH A;  1YQZ A;  2YVF A;  4B65 A;  2R0C A;  4H7U A;  4XWZ A;  3WE0 A;  2XVJ A;  4WX1 A;  3K30 A;  1DOE A;  5BUL A;  4A9W A;  2FJE A;  4REK A;  1JRZ A;  1KSS A;  3IWA A;  3FPZ A;  2JBV A;  2Z5Y A;  3RED A;  4A6N A;  2A89 A;  2YAU A;  1E6E A;  1D7Y A;  2BK5 A;  4YSZ A;  2Z5X A;  5JCI A;  2CDU A;  2J3N A;  1O95 A;  1TDF A;  4AT0 A;  1D4C A;  2C75 A;  4AT2 A;  2QAE A;  1NHP A;  2ZZC A;  1KNP A;  2WQY A;  2WU2 A;  2GV8 A;  2C72 A;  2RAB A;  1KNR A;  5EB4 A;  2YVJ A;  4D03 A;  1NG4 A;  4Z44 A;  2A87 A;  4U8M A;  3LZW A;  1IJH A;  1H7W A;  2YWL A;  3NTA A;  4U8I A;  1YY5 A;  3PO7 A;  3EF6 A;  3LXD A;  3V3O A;  1D7L A;  4OPC A;  3GSI A;  1CJ3 A;  1GES A;  1PXB A;  2O9Z A;  1OJD A;  3ALL A;  1OJA A;  4J56 A;  4EMJ A;  1PS9 A;  2R4J A;  3JSK A; 
#chains in the Genus database with same CATH topology
 1TDK A;  2OLN A;  4C74 A;  1NEK A;  3CPH G;  2C66 A;  4EMW A;  2XLP A;  2YM2 A;  1GOS A;  3B6D A;  4FK1 A;  3AYL A;  4ZN0 A;  1CC6 A;  2YLW A;  3B3R A;  2YLS A;  4IA5 A;  4CNJ A;  2WPC A;  3CTY A;  2YLX A;  4AP3 A;  5HXI A;  2VRM A;  3GMC A;  4H4Z A;  4TM0 A;  2EQ9 A;  3SM8 A;  4B64 A;  1AOG A;  3P1W A;  3T14 A;  3AWI A;  2APG A;  1GV4 A;  2AR8 A;  2WP9 A;  3NK2 X;  1IUS A;  4CY6 A;  3AE9 A;  5EBK A;  3PS9 A;  1H86 A;  3ZDN A;  1E1L A;  2B76 A;  2GEW A;  4NEW A;  3UOX A;  4ZCC A;  5J7X A;  2CVJ A;  1ZY8 A;  3RP7 A;  4K8D A;  4Z2R A;  3IF9 A;  4AOS A;  5GSN A;  1MXT A;  4A99 A;  3CGE A;  1FEA A;  1NAA A;  1ZMD A;  3AED A;  1KSU A;  1RSG A;  1OJC A;  4D04 A;  1F8W A;  3RHA A;  5EOW A;  4BJY A;  2JB1 A;  3QFA A;  4OPD A;  1ONF A;  3GWD A;  3AB1 A;  4YTP A;  1BGN A;  4I58 A;  1JNZ A;  1NHS A;  2UZZ A;  2WET A;  4J34 A;  3OZ2 A;  1OJ9 A;  3ATQ A;  2CFY A;  1GTE A;  1JNR A;  4EM4 A;  3AEA A;  3SQP A;  2C7G A;  1E1M A;  3DJJ A;  5JCK A;  5IQ1 A;  3CNJ A;  1PBB A;  3BI5 A;  4USQ A;  3DJG X;  1VDC A;  3QSE A;  3AEB A;  5HYM A;  2EQ7 A;  3SZF A;  1GTH A;  5KMR A;  3K7M X;  4AOX A;  2BS3 A;  2ARD A;  3LAD A;  2R9Z A;  4YKG A;  1H81 A;  3V3N A;  4FDC B;  1LJ1 A;  3HYV A;  5U1O A;  4UDR A;  1S2Y A;  2BAB A;  3UTE A;  5LV9 A;  4YSX A;  3SFE A;  2V60 A;  1TDE A;  2E1M A;  2XVH A;  3AE6 A;  4N9X A;  3UTG A;  4CCR A;  3P4P A;  1H7X A;  2GF3 A;  1CJC A;  3G5R A;  2BK4 A;  2ZZB A;  4H4R A;  5KMP A;  4YXD A;  2GQW A;  4NEV A;  4E0V A;  4B69 A;  1GRA A;  3II4 A;  3P4Q A;  2FJD A;  1IUU A;  1PJ7 A;  2YR6 A;  4H2N A;  4JNQ A;  4NWZ A;  1QJD A;  3AEG A;  2B7R A;  1KFY A;  2DKI A;  4FX9 A;  1MOK A;  1P2E A;  1VRQ B;  4YTM A;  1ELI A;  2XFP A;  4PAB A;  2ZBW A;  4EQX A;  3OC4 A;  4GCM A;  1LVL A;  3RP8 A;  3CN8 A;  4OPU A;  1NDA A;  1O94 A;  2H89 A;  1GXF A;  2V6O A;  3EPT A;  3ATR A;  1TYP A;  4H4Q A;  1GRE A;  1PJ6 A;  1ZX9 A;  4JDR A;  4X9M A;  2GR1 A;  3KLJ A;  4H2Q A;  4H50 A;  2B9Y A;  4BV6 A;  3SZ0 A;  4G73 A;  2JK6 A;  4Y4M A;  4BK2 A;  1EL7 A;  5M10 A;  1CC4 A;  3UTH A;  1E1K A;  3ALJ A;  3ZYX A;  3L1R A;  4BUR A;  4B68 A;  5U63 A;  4BJZ A;  4P9S A;  1IUW A;  3AD9 B;  4IVO B;  4CRT A;  3I3L A;  4LII A;  1PDH A;  4IVM B;  1TDN A;  3UP5 A;  2R4E A;  3ABV A;  3KPK A;  1QO8 A;  3G5Q A;  4O5U A;  4LA1 A;  1XAN A;  3DK8 A;  2XLS A;  4ZCD A;  3AE1 A;  1ZOY A;  1JRY A;  1JEH A;  3CIR A;  2GMH A;  3CNT A;  3KD9 A;  5FS7 A;  3UKF A;  4BK3 A;  2VZ2 A;  1X31 B;  1M6I A;  1D4D A;  4UDQ A;  5FS9 A;  3NYC A;  5KRQ A;  1F8R A;  1JU2 A;  3HZL A;  4DNA A;  1FEC A;  2R46 A;  4EQW A;  2R45 A;  1YQ3 A;  1PBE A;  1S2Q A;  1ZOV A;  2QA1 A;  5KMS A;  2GAG B;  1K0L A;  2RGH A;  2V61 A;  3NN6 X;  4IA6 A;  3AEF A;  5KXJ A;  3CND A;  3UOY A;  3NT6 A;  1GRG A;  3UKA A;  2JB2 A;  1NEN A;  2Q0K A;  2X8H A;  1GT8 A;  4J33 A;  3SYI A;  3UOV A;  2EQ6 A;  2WES A;  2XYO A;  3Q9T A;  1GND A;  3F8D A;  1N4V A;  3NK1 X;  4H4V A;  3VRD B;  2C73 A;  4EMI A;  1B5Q A;  4YT0 A;  2QA2 A;  3NGC X;  1DJN A;  1NHR A;  1L9E A;  1W4X A;  1L0V A;  1TDO A;  1CC2 A;  2Q6U A;  2IID A;  3BI4 A;  2BXS A;  3VR8 A;  1REO A;  2VVL G;  3CPJ G;  3NRN A;  2TMD A;  1NHQ A;  3ICR A;  3NH3 X;  4J2W A;  2WDQ A;  3DA1 A;  2XFO A;  3H8L A;  1CBO A;  2XVI A;  2GVC A;  3T37 A;  1L9C A;  3KU9 A;  2C70 A;  3P4R A;  4A79 A;  1K0J A;  4G6H A;  1XDI A;  3FMW A;  2AAQ A;  3D8X A;  4GDP A;  1VQW A;  4UP3 A;  2YG6 A;  5BVA A;  4U8O A;  4BK1 A;  3M13 A;  3UP4 A;  4JY3 A;  4M52 A;  4DGK A;  4YSH A;  3UKK A;  2BCP A;  1DNC A;  3FBS A;  3NYE A;  5DBJ A;  2RGJ A;  1GEU A;  2WDR A;  3AE3 A;  2R0P A;  2BRY A;  4RG4 A;  3GD4 A;  3VR9 A;  4GUV A;  1O5W A;  2FJA A;  2E5V A;  2VVM A;  4DSH A;  3VRA A;  5U25 A;  1DJQ A;  2BK3 A;  2CUL A;  4EM3 A;  2H88 A;  3LZX A;  3AE4 A;  1S3E A;  1Q1W A;  3ALM A;  1HYU A;  1PBD A;  4GAV A;  2C76 A;  4X9N A;  2OAL A;  4CNK A;  4H2P A;  1P2H A;  2BS2 A;  1GPE A;  2XFU A;  3LJP A;  3GMB A;  1VG9 A;  2Y6R A;  4Z43 A;  1GRF A;  4J36 A;  3BNU A;  4KPR A;  4CCQ A;  4II3 A;  3F8P A;  3LOV A;  1PBC A;  1N4W A;  3RNM A;  5KNL A;  5BRT A;  2X3N A;  3KA7 A;  2BS4 A;  4CBQ A;  5M0Z A;  3UKP A;  4G74 A;  1N4U A;  1GRB A;  3UCL A;  1FL2 A;  1Z6L A;  2XFN A;  4U8P A;  2V5Z A;  1CHU A;  2XVF A;  3FG2 P;  3SXI A;  3M12 A;  5C2T A;  5HY5 A;  3C4N A;  3G5S A;  3S61 A;  5JCL A;  1Y56 B;  1COY A;  3M0O A;  3NN0 X;  4ICY A;  4RSL A;  3AEC A;  4A7A A;  4ECH A;  4U8J A;  3SZW A;  4C77 A;  2QCU A;  3AYI A;  3SY4 A;  3GWF A;  2VQ7 A;  1JRX A;  2OAM A;  2XLR A;  1BKW A;  2W0H A;  2OLO A;  2GH5 A;  5GRT A;  1TYT A;  4U8L A;  4JY2 A;  5FMH A;  5TR3 A;  1DXL A;  2OA1 A;  3GYX A;  2WP5 A;  4TLZ A;  4YSY A;  3CNS A;  3ICT A;  3QSM A;  4OPI A;  4B63 A;  2JB3 A;  2TPR A;  2C65 A;  2YG7 A;  3GYJ A;  3ITJ A;  3VQR A;  1FCD A;  2NVK X;  2YM1 A;  4K22 A;  4OCG A;  1ZKQ A;  4USR A;  4H4Y A;  3V76 A;  2YG3 A;  4ADW A;  1B8S A;  4GDE A;  4H4X A;  3FIM B;  3SZC A;  1K0I A;  3NK0 X;  4JN9 A;  4O5Q A;  1TRB A;  3NYF A;  2WPE A;  4NTC A;  2YVG A;  3GDN A;  1GRH A;  1EL9 A;  2BA9 A;  1LQT A;  3AEE A;  4OPT A;  2Q7V A;  4K5S A;  4TM3 A;  1H82 A;  5BUK A;  4Z2U A;  5KVH A;  3UTF A;  1DOC A;  3QSS A;  3IHG A;  2BYB A;  3SFD A;  2AQJ A;  2PHH A;  3NIX A;  2BC0 A;  1RYI A;  2GRT A;  1JOA A;  1XPQ A;  2WOV A;  1PHH A;  2ZZ0 A;  4JNA A;  1BGJ A;  3Q6J A;  4U8K A;  4Y4N A;  3NNE A;  3DME A;  4B66 A;  2V3B A;  1MO9 A;  2WPF A;  5CKU A;  3AXB A;  2XDO A;  3ISH A;  3S5W A;  3I6D A;  5EB5 A;  3HYW A;  1Q1R A;  4AP1 A;  3EAN A;  4RG3 A;  3SGL A;  4APN A;  4Z2T A;  1PXC A;  1ZK7 A;  2PYX A;  3AD7 B;  1ZMC A;  2XLU A;  2WU5 A;  2XCG A;  4C3X A;  4OPG A;  2FBW A;  5IQ4 A;  5L46 A;  1OJT A;  4GF7 A;  3H4K A;  3CPI G;  1EL8 A;  3DK9 A;  3CMM A;  5FS8 A;  1H83 A;  2VOU A;  3ADA B;  4TLX A;  4B1B A;  1F3P A;  2FJB A;  1B4V A;  1RP0 A;  4IV9 A;  1PXA A;  3KPF A;  4Z26 A;  4FK1 C;  3HYX A;  4EIQ A;  2C64 A;  3GD3 A;  2RGO A;  1S3B A;  4OPL A;  1E39 A;  4K2X A;  2GR3 A;  4G6G A;  4CY8 A;  3CNP A;  1NG3 A;  2WOW A;  3L8K A;  3VRB A;  1EL5 A;  3UOZ A;  2X99 A;  3NLC A;  4MJW A;  1F6M A;  1DOB A;  1LTX R;  2E4G A;  2C3C A;  2GAH B;  1E7P A;  4A6N B;  1LPF A;  4WCT A;  3DK4 A;  4NZH A;  2EQ8 A;  2XVE A;  3ICS A;  3DGZ A;  5KWF A;  2A8X A;  2JAE A;  5J60 A;  4Z24 A;  1PJ5 A;  1CJ4 A;  3P9U A;  3BHF A;  1GAL A;  4HA6 A;  5CQF A;  1B37 A;  1E1N A;  2XLT A;  3QVR A;  4YKF A;  4YTN A;  2R0G A;  4J31 A;  3BHK A;  4Y4L A;  1KDG A;  1BZL A;  1N1P A;  4H4P A;  4H4W A;  4B67 A;  1BWC A;  2C67 A;  4K7Z A;  2HQM A;  5KMQ A;  3CGD A;  3AE7 A;  4NTE A;  2WDV A;  2X8C A;  3KVE A;  4H4S A;  1LQU A;  3UKL A;  1F8S A;  1Y56 A;  2DKH A;  4TM1 A;  1ZDL A;  1CL0 A;  4KX6 A;  2GMJ A;  2Q0L A;  3NKS A;  5JCN A;  2GR0 A;  3PVC A;  2VRL A;  3T2Y A;  5C3J A;  3C4A A;  3AD8 B;  1GRT A;  2ACZ A;  4GR1 A;  1CJ2 A;  2BRA A;  1L9D A;  2VQB A;  2GQF A;  2YLZ A;  3COX A;  4XXG A;  1CF3 A;  3CGB A;  4H2R A;  4A65 A;  3H8I A;  2YR4 A;  1DOD A;  4EIP A;  3T2Z A;  2WP6 A;  2BAC A;  4C3Y A;  1FEB A;  3D1C A;  4H4T A;  1PBF A;  1XHC A;  3R9U A;  3EAO A;  2C4C A;  4U2S A;  4U2L A;  4HB9 A;  2IVE A;  3RP6 A;  4X4J A;  3QFB A;  3AE2 A;  3NTD A;  2WHD A;  4DSG A;  2YR5 A;  2BC1 A;  3AE5 A;  3DGH A;  1D5T A;  4J57 A;  4YWO A;  5KOX A;  2F5Z A;  4EQR A;  3CGC A;  3GRT A;  1H84 A;  2X50 A;  3P4S A;  1VG0 A;  2YG5 A;  1Y0P A;  2C3D A;  3AE8 A;  1ZP0 A;  2Y6Q A;  3T0K A;  2BCG G;  2B7S A;  4G9K A;  2GB0 A;  1M64 A;  1YQ4 A;  4K5R A;  3UKQ A;  2B9X A;  1IUX A;  4PAA A;  3IC9 A;  1UKV G;  3C96 A;  1LV0 A;  1D4E A;  2YG4 A;  3QJ4 A;  5ER0 A;  2VVL A;  2BXR A;  5HHF A;  2JKC A;  3GRS A;  3IHM A;  3KKJ A;  1KF6 A;  4U8N A;  3O0H A;  4Z25 A;  3AYJ A;  4UDP A;  3T2K A;  1GER A;  4C5O A;  2GR2 A;  3NG7 X;  1IUT A;  2I0Z A;  3DJE A;  2XFQ A;  1NPX A;  5KVI A;  4EQS A;  2NPX A;  4I59 A;  1GET A;  2WEU A;  2WOI A;  4GAP A;  5KOW A;  1YKJ A;  1IUV A;  2WS3 A;  3K7Q X;  1FOH A;  3GYI A;  4GRT A;  4XWR A;  4OVI A;  2YQU A;  2X8G A;  2YLT A;  4LU6 A;  4NTD A;  1BF3 A;  1QLB A;  3K7T A;  3LB8 A;  4JQ9 A;  2WBA A;  2IVD A;  4U2T A;  5FS6 A;  1H6V A;  2YLR A;  5IPY A;  1V59 A;  1GSN A;  3NHO X;  3UKH A;  3DJD A;  1EBD A;  1K4Q A;  5JCM A;  3E1T A;  4II2 A;  3BI2 A;  3GDP A;  3DH9 A;  1Q9I A;  2B9W A;  2V3A A;  3BNM A;  1SEZ A;  1PN0 A;  3F8R A;  4TM4 A;  4A5L A;  4H4U A;  3QVP A;  3URH A;  1YQZ A;  2YVF A;  4B65 A;  2R0C A;  4H7U A;  4XWZ A;  3WE0 A;  2XVJ A;  4WX1 A;  3K30 A;  1DOE A;  5BUL A;  4A9W A;  2FJE A;  4REK A;  1JRZ A;  1KSS A;  3IWA A;  3FPZ A;  2JBV A;  2Z5Y A;  3RED A;  4A6N A;  2A89 A;  2YAU A;  1E6E A;  1D7Y A;  2BK5 A;  4YSZ A;  2Z5X A;  5JCI A;  2CDU A;  2J3N A;  1O95 A;  1TDF A;  4AT0 A;  1D4C A;  2C75 A;  4AT2 A;  3SX6 A;  2QAE A;  1NHP A;  2ZZC A;  1KNP A;  2WQY A;  2WU2 A;  2GV8 A;  2C72 A;  2RAB A;  1KNR A;  5EB4 A;  2YVJ A;  4D03 A;  1NG4 A;  4Z44 A;  2A87 A;  4U8M A;  3LZW A;  1IJH A;  1H7W A;  2YWL A;  3NTA A;  4U8I A;  1YY5 A;  3PO7 A;  3EF6 A;  3LXD A;  3V3O A;  1D7L A;  4OPC A;  3T31 A;  4NNJ A;  3GSI A;  1CJ3 A;  1GES A;  1PXB A;  2O9Z A;  1OJD A;  3ALL A;  1OJA A;  4J56 A;  4EMJ A;  1PS9 A;  2R4J A;  3JSK A; 
#chains in the Genus database with same CATH homology
 1TDK A;  2OLN A;  4C74 A;  1NEK A;  3CPH G;  2C66 A;  4EMW A;  2XLP A;  2YM2 A;  1GOS A;  3B6D A;  4FK1 A;  3AYL A;  4ZN0 A;  1CC6 A;  2YLW A;  3B3R A;  2YLS A;  4IA5 A;  4CNJ A;  2WPC A;  3CTY A;  2YLX A;  4AP3 A;  5HXI A;  2VRM A;  3GMC A;  4H4Z A;  4TM0 A;  2EQ9 A;  3SM8 A;  4B64 A;  1AOG A;  3P1W A;  3T14 A;  3AWI A;  2APG A;  1GV4 A;  2AR8 A;  2WP9 A;  3NK2 X;  1IUS A;  4CY6 A;  3AE9 A;  5EBK A;  3PS9 A;  1H86 A;  3ZDN A;  1E1L A;  2B76 A;  2GEW A;  4NEW A;  3UOX A;  4ZCC A;  5J7X A;  2CVJ A;  1ZY8 A;  3RP7 A;  4K8D A;  4Z2R A;  3IF9 A;  4AOS A;  5GSN A;  1MXT A;  4A99 A;  3CGE A;  1FEA A;  1NAA A;  1ZMD A;  3AED A;  1KSU A;  1RSG A;  1OJC A;  4D04 A;  1F8W A;  3RHA A;  5EOW A;  4BJY A;  2JB1 A;  3QFA A;  4OPD A;  1ONF A;  3GWD A;  3AB1 A;  4YTP A;  1BGN A;  4I58 A;  1JNZ A;  1NHS A;  2UZZ A;  2WET A;  4J34 A;  3OZ2 A;  1OJ9 A;  3ATQ A;  2CFY A;  1GTE A;  1JNR A;  4EM4 A;  3AEA A;  3SQP A;  2C7G A;  1E1M A;  3DJJ A;  5JCK A;  5IQ1 A;  3CNJ A;  1PBB A;  3BI5 A;  4USQ A;  3DJG X;  1VDC A;  3QSE A;  3AEB A;  5HYM A;  2EQ7 A;  3SZF A;  1GTH A;  5KMR A;  3K7M X;  4AOX A;  2BS3 A;  2ARD A;  3LAD A;  2R9Z A;  4YKG A;  1H81 A;  3V3N A;  4FDC B;  1LJ1 A;  3HYV A;  5U1O A;  4UDR A;  1S2Y A;  2BAB A;  3UTE A;  5LV9 A;  4YSX A;  3SFE A;  2V60 A;  1TDE A;  2E1M A;  2XVH A;  3AE6 A;  4N9X A;  3UTG A;  4CCR A;  3P4P A;  1H7X A;  2GF3 A;  1CJC A;  3G5R A;  2BK4 A;  2ZZB A;  4H4R A;  5KMP A;  4YXD A;  2GQW A;  4NEV A;  4E0V A;  4B69 A;  1GRA A;  3II4 A;  3P4Q A;  2FJD A;  1IUU A;  1PJ7 A;  2YR6 A;  4H2N A;  4JNQ A;  4NWZ A;  1QJD A;  3AEG A;  2B7R A;  1KFY A;  2DKI A;  4FX9 A;  1MOK A;  1P2E A;  1VRQ B;  4YTM A;  1ELI A;  2XFP A;  4PAB A;  2ZBW A;  4EQX A;  3OC4 A;  4GCM A;  1LVL A;  3RP8 A;  3CN8 A;  4OPU A;  1NDA A;  1O94 A;  2H89 A;  1GXF A;  2V6O A;  3EPT A;  3ATR A;  1TYP A;  4H4Q A;  1GRE A;  1PJ6 A;  1ZX9 A;  4JDR A;  4X9M A;  2GR1 A;  3KLJ A;  4H2Q A;  4H50 A;  2B9Y A;  4BV6 A;  3SZ0 A;  4G73 A;  2JK6 A;  4Y4M A;  4BK2 A;  1EL7 A;  5M10 A;  1CC4 A;  3UTH A;  1E1K A;  3ALJ A;  3ZYX A;  3L1R A;  4BUR A;  4B68 A;  5U63 A;  4BJZ A;  4P9S A;  1IUW A;  3AD9 B;  4IVO B;  4CRT A;  3I3L A;  4LII A;  1PDH A;  4IVM B;  1TDN A;  3UP5 A;  2R4E A;  3ABV A;  3KPK A;  1QO8 A;  3G5Q A;  4O5U A;  4LA1 A;  1XAN A;  3DK8 A;  2XLS A;  4ZCD A;  3AE1 A;  1ZOY A;  1JRY A;  1JEH A;  3CIR A;  2GMH A;  3CNT A;  3KD9 A;  5FS7 A;  3UKF A;  4BK3 A;  2VZ2 A;  1X31 B;  1M6I A;  1D4D A;  4UDQ A;  5FS9 A;  3NYC A;  5KRQ A;  1F8R A;  1JU2 A;  3HZL A;  4DNA A;  1FEC A;  2R46 A;  4EQW A;  2R45 A;  1YQ3 A;  1PBE A;  1S2Q A;  1ZOV A;  2QA1 A;  5KMS A;  2GAG B;  1K0L A;  2RGH A;  2V61 A;  3NN6 X;  4IA6 A;  3AEF A;  5KXJ A;  3CND A;  3UOY A;  3NT6 A;  1GRG A;  3UKA A;  2JB2 A;  1NEN A;  2Q0K A;  2X8H A;  1GT8 A;  4J33 A;  3SYI A;  3UOV A;  2EQ6 A;  2WES A;  2XYO A;  3Q9T A;  1GND A;  3F8D A;  1N4V A;  3NK1 X;  4H4V A;  3VRD B;  2C73 A;  4EMI A;  1B5Q A;  4YT0 A;  2QA2 A;  3NGC X;  1DJN A;  1NHR A;  1L9E A;  1W4X A;  1L0V A;  1TDO A;  1CC2 A;  2Q6U A;  2IID A;  3BI4 A;  2BXS A;  3VR8 A;  1REO A;  2VVL G;  3CPJ G;  3NRN A;  2TMD A;  1NHQ A;  3ICR A;  3NH3 X;  4J2W A;  2WDQ A;  3DA1 A;  2XFO A;  3H8L A;  1CBO A;  2XVI A;  2GVC A;  3T37 A;  1L9C A;  3KU9 A;  2C70 A;  3P4R A;  4A79 A;  1K0J A;  4G6H A;  1XDI A;  3FMW A;  2AAQ A;  3D8X A;  4GDP A;  1VQW A;  4UP3 A;  2YG6 A;  5BVA A;  4U8O A;  4BK1 A;  3M13 A;  3UP4 A;  4JY3 A;  4M52 A;  4DGK A;  4YSH A;  3UKK A;  2BCP A;  1DNC A;  3FBS A;  3NYE A;  5DBJ A;  2RGJ A;  1GEU A;  2WDR A;  3AE3 A;  2R0P A;  2BRY A;  4RG4 A;  3GD4 A;  3VR9 A;  4GUV A;  1O5W A;  2FJA A;  2E5V A;  2VVM A;  4DSH A;  3VRA A;  5U25 A;  1DJQ A;  2BK3 A;  2CUL A;  4EM3 A;  2H88 A;  3LZX A;  3AE4 A;  1S3E A;  1Q1W A;  3ALM A;  1HYU A;  1PBD A;  4GAV A;  2C76 A;  4X9N A;  2OAL A;  4CNK A;  4H2P A;  1P2H A;  2BS2 A;  1GPE A;  2XFU A;  3LJP A;  3GMB A;  1VG9 A;  2Y6R A;  4Z43 A;  1GRF A;  4J36 A;  3BNU A;  4KPR A;  4CCQ A;  4II3 A;  3F8P A;  3LOV A;  1PBC A;  1N4W A;  3RNM A;  5KNL A;  5BRT A;  2X3N A;  3KA7 A;  2BS4 A;  4CBQ A;  5M0Z A;  3UKP A;  4G74 A;  1N4U A;  1GRB A;  3UCL A;  1FL2 A;  1Z6L A;  2XFN A;  4U8P A;  2V5Z A;  1CHU A;  2XVF A;  3FG2 P;  3SXI A;  3M12 A;  5C2T A;  5HY5 A;  3C4N A;  3G5S A;  3S61 A;  5JCL A;  1Y56 B;  1COY A;  3M0O A;  3NN0 X;  4ICY A;  4RSL A;  3AEC A;  4A7A A;  4ECH A;  4U8J A;  3SZW A;  4C77 A;  2QCU A;  3AYI A;  3SY4 A;  3GWF A;  2VQ7 A;  1JRX A;  2OAM A;  2XLR A;  1BKW A;  2W0H A;  2OLO A;  2GH5 A;  5GRT A;  1TYT A;  4U8L A;  4JY2 A;  5FMH A;  5TR3 A;  1DXL A;  2OA1 A;  3GYX A;  2WP5 A;  4TLZ A;  4YSY A;  3CNS A;  3ICT A;  3QSM A;  4OPI A;  4B63 A;  2JB3 A;  2TPR A;  2C65 A;  2YG7 A;  3GYJ A;  3ITJ A;  3VQR A;  1FCD A;  2NVK X;  2YM1 A;  4K22 A;  4OCG A;  1ZKQ A;  4USR A;  4H4Y A;  3V76 A;  2YG3 A;  4ADW A;  1B8S A;  4GDE A;  4H4X A;  3FIM B;  3SZC A;  1K0I A;  3NK0 X;  4JN9 A;  4O5Q A;  1TRB A;  3NYF A;  2WPE A;  4NTC A;  2YVG A;  3GDN A;  1GRH A;  1EL9 A;  2BA9 A;  1LQT A;  3AEE A;  4OPT A;  2Q7V A;  4K5S A;  4TM3 A;  1H82 A;  5BUK A;  4Z2U A;  5KVH A;  3UTF A;  1DOC A;  3QSS A;  3IHG A;  2BYB A;  3SFD A;  2AQJ A;  2PHH A;  3NIX A;  2BC0 A;  1RYI A;  2GRT A;  1JOA A;  1XPQ A;  2WOV A;  1PHH A;  2ZZ0 A;  4JNA A;  1BGJ A;  3Q6J A;  4U8K A;  4Y4N A;  3NNE A;  3DME A;  4B66 A;  2V3B A;  1MO9 A;  2WPF A;  5CKU A;  3AXB A;  2XDO A;  3ISH A;  3S5W A;  3I6D A;  5EB5 A;  3HYW A;  1Q1R A;  4AP1 A;  3EAN A;  4RG3 A;  3SGL A;  4APN A;  4Z2T A;  1PXC A;  1ZK7 A;  2PYX A;  3AD7 B;  1ZMC A;  2XLU A;  2WU5 A;  2XCG A;  4C3X A;  4OPG A;  2FBW A;  5IQ4 A;  5L46 A;  1OJT A;  4GF7 A;  3H4K A;  3CPI G;  1EL8 A;  3DK9 A;  3CMM A;  5FS8 A;  1H83 A;  2VOU A;  3ADA B;  4TLX A;  4B1B A;  1F3P A;  2FJB A;  1B4V A;  1RP0 A;  4IV9 A;  1PXA A;  3KPF A;  4Z26 A;  4FK1 C;  3HYX A;  4EIQ A;  2C64 A;  3GD3 A;  2RGO A;  1S3B A;  4OPL A;  1E39 A;  4K2X A;  2GR3 A;  4G6G A;  4CY8 A;  3CNP A;  1NG3 A;  2WOW A;  3L8K A;  3VRB A;  1EL5 A;  3UOZ A;  2X99 A;  3NLC A;  4MJW A;  1F6M A;  1DOB A;  1LTX R;  2E4G A;  2C3C A;  2GAH B;  1E7P A;  4A6N B;  1LPF A;  4WCT A;  3DK4 A;  4NZH A;  2EQ8 A;  2XVE A;  3ICS A;  3DGZ A;  5KWF A;  2A8X A;  2JAE A;  5J60 A;  4Z24 A;  1PJ5 A;  1CJ4 A;  3P9U A;  3BHF A;  1GAL A;  4HA6 A;  5CQF A;  1B37 A;  1E1N A;  2XLT A;  3QVR A;  4YKF A;  4YTN A;  2R0G A;  4J31 A;  3BHK A;  4Y4L A;  1KDG A;  1BZL A;  1N1P A;  4H4P A;  4H4W A;  4B67 A;  1BWC A;  2C67 A;  4K7Z A;  2HQM A;  5KMQ A;  3CGD A;  3AE7 A;  4NTE A;  2WDV A;  2X8C A;  3KVE A;  4H4S A;  1LQU A;  3UKL A;  1F8S A;  1Y56 A;  2DKH A;  4TM1 A;  1ZDL A;  1CL0 A;  4KX6 A;  2GMJ A;  2Q0L A;  3NKS A;  5JCN A;  2GR0 A;  3PVC A;  2VRL A;  3T2Y A;  5C3J A;  3C4A A;  3AD8 B;  1GRT A;  2ACZ A;  4GR1 A;  1CJ2 A;  2BRA A;  1L9D A;  2VQB A;  2GQF A;  2YLZ A;  3COX A;  4XXG A;  1CF3 A;  3CGB A;  4H2R A;  4A65 A;  3H8I A;  2YR4 A;  1DOD A;  4EIP A;  3T2Z A;  2WP6 A;  2BAC A;  4C3Y A;  1FEB A;  3D1C A;  4H4T A;  1PBF A;  1XHC A;  3R9U A;  3EAO A;  2C4C A;  4U2S A;  4U2L A;  4HB9 A;  2IVE A;  3RP6 A;  4X4J A;  3QFB A;  3AE2 A;  3NTD A;  2WHD A;  4DSG A;  2YR5 A;  2BC1 A;  3AE5 A;  3DGH A;  1D5T A;  4J57 A;  4YWO A;  5KOX A;  2F5Z A;  4EQR A;  3CGC A;  3GRT A;  1H84 A;  2X50 A;  3P4S A;  1VG0 A;  2YG5 A;  1Y0P A;  2C3D A;  3AE8 A;  1ZP0 A;  2Y6Q A;  3T0K A;  2BCG G;  2B7S A;  4G9K A;  2GB0 A;  1M64 A;  1YQ4 A;  4K5R A;  3UKQ A;  2B9X A;  1IUX A;  4PAA A;  3IC9 A;  1UKV G;  3C96 A;  1LV0 A;  1D4E A;  2YG4 A;  3QJ4 A;  5ER0 A;  2VVL A;  2BXR A;  5HHF A;  2JKC A;  3GRS A;  3IHM A;  3KKJ A;  1KF6 A;  4U8N A;  3O0H A;  4Z25 A;  3AYJ A;  4UDP A;  3T2K A;  1GER A;  4C5O A;  2GR2 A;  3NG7 X;  1IUT A;  2I0Z A;  3DJE A;  2XFQ A;  1NPX A;  5KVI A;  4EQS A;  2NPX A;  4I59 A;  1GET A;  2WEU A;  2WOI A;  4GAP A;  5KOW A;  1YKJ A;  1IUV A;  2WS3 A;  3K7Q X;  1FOH A;  3GYI A;  4GRT A;  4XWR A;  4OVI A;  2YQU A;  2X8G A;  2YLT A;  4LU6 A;  4NTD A;  1BF3 A;  1QLB A;  3K7T A;  3LB8 A;  4JQ9 A;  2WBA A;  2IVD A;  4U2T A;  5FS6 A;  1H6V A;  2YLR A;  5IPY A;  1V59 A;  1GSN A;  3NHO X;  3UKH A;  3DJD A;  1EBD A;  1K4Q A;  5JCM A;  3E1T A;  4II2 A;  3BI2 A;  3GDP A;  3DH9 A;  1Q9I A;  2B9W A;  2V3A A;  3BNM A;  1SEZ A;  1PN0 A;  3F8R A;  4TM4 A;  4A5L A;  4H4U A;  3QVP A;  3URH A;  1YQZ A;  2YVF A;  4B65 A;  2R0C A;  4H7U A;  4XWZ A;  3WE0 A;  2XVJ A;  4WX1 A;  3K30 A;  1DOE A;  5BUL A;  4A9W A;  2FJE A;  4REK A;  1JRZ A;  1KSS A;  3IWA A;  3FPZ A;  2JBV A;  2Z5Y A;  3RED A;  4A6N A;  2A89 A;  2YAU A;  1E6E A;  1D7Y A;  2BK5 A;  4YSZ A;  2Z5X A;  5JCI A;  2CDU A;  2J3N A;  1O95 A;  1TDF A;  4AT0 A;  1D4C A;  2C75 A;  4AT2 A;  3SX6 A;  2QAE A;  1NHP A;  2ZZC A;  1KNP A;  2WQY A;  2WU2 A;  2GV8 A;  2C72 A;  2RAB A;  1KNR A;  5EB4 A;  2YVJ A;  4D03 A;  1NG4 A;  4Z44 A;  2A87 A;  4U8M A;  3LZW A;  1IJH A;  1H7W A;  2YWL A;  3NTA A;  4U8I A;  1YY5 A;  3PO7 A;  3EF6 A;  3LXD A;  3V3O A;  1D7L A;  4OPC A;  3T31 A;  4NNJ A;  3GSI A;  1CJ3 A;  1GES A;  1PXB A;  2O9Z A;  1OJD A;  3ALL A;  1OJA A;  4J56 A;  4EMJ A;  1PS9 A;  2R4J A;  3JSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...