4N9XA

Crystal structure of the octaprenyl-methyl-methoxy-benzq molecule from erwina carotovora subsp. atroseptica strain scri 1043 / atcc baa-672, northeast structural genomics consortium (nesg) target ewr161
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
398
structure length
371
Chain Sequence
MQSFDVVIAGGGMVGLALACGLQGSGLRIAVLEKQGKGHALRVSAINAASECLLRHIGVWENLVAQRVSPYNDMQVWDKDSFGKISFSGEEFGFSHLGHIIENPVIQQVLWQRASQLSDITLLSPTSLKQVAWGENEAFITLQDDSMLTARLVVGADGADYGHHALVANIRTEHPHQSVARQAFHGDGILAFLPLDDPHLCSIVWSLSPEQALVMQSLPVEEFNRQVAMAFDMRLGLCELESERQTFPLMGRYARSFAAHRLVLVGDAAHTIHPLAGQGVNLGFMDVAELIAELKRKDIGQHLYLRRYERRRKHSAAVMLASMQGFRELFDGDNPAKKLLRDVGLVLADKLPGIKPTLVRQAMGLHDLPDW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative monooxygenase
publication title Crystal Structure of the OCTAPRENYL-METHYL-METHOXY-BENZQ MOLECULE from Erwina carotovora subsp. atroseptica strain SCRI 1043 / ATCC BAA-672, Northeast Structural Genomics Consortium (NESG) Target EwR161
rcsb
source organism Pectobacterium atrosepticum
total genus 99
structure length 371
sequence length 398
ec nomenclature ec 1.-.-.-:
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4n9xA01
2BA9A 1CJ2A 2GR3A 3VRBA 2V5ZA 3QJ4A 4DGKA 5CQFA 3AD9B 4YKFA 4H4VA 3ATRA 2ZBWA 2OLNA 1FL2A 2XVFA 3SFDA 4B66A 3BHFA 3ICRA 1CC6A 1Y0PA 3GRTA 3P9UA 3CNDA 1E1KA 3FG2P 2WOVA 2C67A 2Y6RA 3G5QA 3L1RA 2VVLG 2GQFA 1XHCA 3RP7A 1JOAA 2X8CA 1F8SA 2XDOA 3NYCA 1DODA 2RGOA 3LB8A 2I0ZA 3M13A 3UKHA 4AT0A 2ZZ0A 1JNZA 1GEUA 3BI4A 1GRFA 5FS7A 3Q9TA 3AYIA 1FEAA 1BF3A 2EQ8A 2Q0KA 3D8XA 2BXSA 1NENA 3UP4A 2XVIA 4NEVA 1KSSA 5HXIA 1H84A 1D4DA 2AQJA 2B7RA 2YM1A 3AE1A 1K0JA 4BK3A 4JN9A 3VRDB 1FECA 1E1MA 2EQ9A 3CPJG 3EAOA 2XYOA 4AOXA 3EF6A 4FDCB 1PBEA 4OPCA 2YLTA 1MXTA 2JB1A 4O5UA 4OPTA 3HZLA 4NTCA 3CNJA 1GERA 1V59A 2CDUA 2YLXA 1TYTA 3BNUA 3JSKA 4OPIA 1F6MA 3GYJA 2CVJA 3DGZA 3ALJA 4UDPA 2XFUA 2BS2A 1KDGA 2XVHA 2YG6A 1IUXA 4A7AA 4H2NA 3NN0X 2XLSA 4BK2A 1DOEA 3P1WA 4EMJA 3AEBA 2YR6A 4OVIA 3UOYA 3GYIA 2YLRA 4ZCDA 4BV6A 5IQ1A 3LOVA 2JK6A 3GDNA 2GAHB 5CKUA 4DSHA 3H8LA 1PXAA 3S5WA 1LQUA 4NTEA 1N1PA 3NLCA 4E0VA 2BS3A 1GOSA 1D7YA 4EMIA 1H86A 1K0LA 3QVPA 5KOXA 5U63A 2CULA 3FMWA 4Z2UA 4OPGA 5BUKA 3EANA 3GSIA 2YM2A 4H4ZA 1N4UA 4GRTA 2R0GA 1XDIA 2WPEA 1E1LA 4J31A 4EMWA 1B37A 2VVLA 1RYIA 1BZLA 2B76A 5GSNA 3DK9A 4CCRA 2B9YA 4GDEA 4A65A 4Z43A 4OCGA 1F8WA 1S3EA 2A87A 2C64A 3AXBA 1LVLA 2GRTA 2GR2A 4GUVA 4IA6A 4JY3A 2OLOA 2QAEA 3AD8B 1VQWA 2B7SA 2WU2A 2YVGA 3QSSA 1LQTA 4H4XA 2ACZA 4EQXA 1PJ7A 3FBSA 1TRBA 3K30A 4OPLA 4PAAA 3NN6X 4H50A 4U8OA 1CJ4A 2VZ2A 1PBDA 3DJEA 2BABA 3I3LA 3QVRA 4U8KA 1DOCA 1K4QA 2GQWA 3CNTA 5EBKA 1CHUA 3SM8A 3GD4A 5C3JA 1E6EA 5FS8A 3LXDA 4TLXA 3AEGA 4JNAA 4A79A 4P9SA 2GAGB 1LPFA 2C66A 3AEDA 1E1NA 2VQ7A 3UKLA 3H4KA 3LJPA 4CY6A 1DOBA 3GWDA 2GH5A 4K8DA 1GT8A 2XFNA 2E5VA 4YSXA 1PJ6A 3C4NA 3ALMA 3EPTA 3GRSA 3P4SA 4H7UA 4BURA 4H4TA 3ABVA 3UTFA 3NK1X 2WBAA 5IPYA 3AEEA 1REOA 1ZP0A 2WOIA 2VOUA 1AOGA 4U8NA 2VVMA 3R9UA 3UKPA 1JRXA 2YAUA 4MJWA 1DXLA 2NPXA 1GTEA 3VQRA 2YG5A 4GF7A 2WQYA 3CTYA 1GETA 4U2LA 4LU6A 4X9NA 1VRQB 4FK1C 3K7MX 4J34A 5BVAA 3CGCA 1P2HA 4C3YA 2E4GA 2YLWA 4GDPA 4B68A 2FJDA 1E39A 2WP5A 3G5RA 4B64A 4JY2A 3AEAA 3OC4A 4HA6A 1IUWA 3P4QA 2UZZA 3GMCA 1ZKQA 4H4UA 1SEZA 2HQMA 3BI2A 4Y4MA 1CJ3A 4B1BA 4C77A 4AP3A 2WESA 2YWLA 1PBCA 3D1CA 3NTAA 4Z24A 3GD3A 2JB3A 2AAQA 4Z2RA 1KSUA 1NDAA 2WS3A 3B3RA 2H88A 4IVOB 4LIIA 1EL5A 1S3BA 1DJNA 3AE5A 3ICSA 4AT2A 5BULA 1ZOVA 1L9EA 1NAAA 2A89A 1Q9IA 2B9XA 2WEUA 1B5QA 3E1TA 1OJCA 4NZHA 3NK2X 2R45A 4IA5A 1GRHA 2APGA 3CIRA 3UTGA 4A99A 2GVCA 4YT0A 1KNPA 1VDCA 3NGCX 3NTDA 4PABA 4LA1A 2XLUA 3I6DA 3BHKA 4I59A 1HYUA 4O5QA 1OJDA 2X8GA 2IVDA 5KRQA 3UKQA 1IUUA 1LTXR 3IHGA 5FS6A 5DBJA 3NKSA 5KVIA 2FJAA 3DA1A 3FIMB 4JDRA 4X4JA 1BKWA 1YQ3A 2YG4A 2WPFA 3KLJA 1X31B 1NHQA 2C70A 5EB4A 1B8SA 1FEBA 1M64A 1OJAA 1E7PA 1NG3A 4TM3A 2GR1A 4XXGA 4CNKA 2YQUA 3KKJA 1ZK7A 3NHOX 2GMHA 4A5LA 1GRGA 3F8PA 2IIDA 3RP6A 2C65A 1TDNA 2W0HA 3AB1A 3C96A 1GRAA 2IVEA 3IWAA 3K7QX 3UP5A 2BXRA 4RG3A 4N9XA 4EM4A 3RNMA 2QA1A 4BJZA 1JU2A 1O94A 2X99A 2YR4A 3S61A 4CBQA 3PS9A 3AYJA 3VR9A 4UP3A 1Q1WA 1GXFA 1IUSA 1GREA 1YKJA 4M52A 2TMDA 4B63A 3LADA 4B65A 4FX9A 2EQ6A 5HY5A 1O5WA 1GTHA 3B6DA 1BGJA 1PN0A 1QO8A 2XVEA 1IUTA 1RSGA 4CCQA 5FMHA 1ZMCA 4D04A 1XPQA 2OALA 2QCUA 4ICYA 5JCNA 1H6VA 3AE7A 3SGLA 3L8KA 2R0PA 3WE0A 4ECHA 4K22A 1IJHA 2ARDA 3P4RA 4RG4A 3AWIA 1MO9A 3PO7A 4U8LA 4YXDA 5KWFA 1NEKA 3BNMA 5GRTA 2VRMA 4JQ9A 2FJEA 1TYPA 1EL8A 2V6OA 2GB0A 4TM1A 2C3CA 5JCIA 4OPDA 1JRZA 2JAEA 3F8RA 1GESA 4EIPA 5J7XA 3ZYXA 2RABA 2PHHA 1JEHA 1PBFA 4DSGA 1GALA 2BK5A 1S2QA 3DK8A 2VRLA 3NG7X 2X3NA 1DJQA 2V3BA 2R46A 3CNPA 1PXBA 3NNEA 2WP6A 3V3OA 4JNQA 4YTNA 1LJ1A 4H2RA 1TDEA 1CBOA 3CGDA 4U8PA 5HHFA 3SFEA 4IV9A 3DJJA 5LV9A 1H7WA 4NTDA 3REDA 1KF6A 4D03A 4USQA 5HYMA 4J56A 2H89A 2GMJA 1P2EA 1N4WA 1Z6LA 4BK1A 1KFYA 2WOWA 3IHMA 1ZDLA 3P4PA 4FK1A 1GRTA 3M0OA 4J2WA 2R9ZA 5M0ZA 3UCLA 3AE9A 3M12A 4H4RA 2YG7A 4TLZA 4YWOA 3ISHA 2XFPA 3UOXA 5BRTA 4UDQA 5FS9A 4C3XA 4YSZA 3DJGX 1VG9A 4EIQA 4OPUA 1QLBA 2QA2A 3VR8A 2BK4A 3QFAA 3AYLA 3DGHA 1B4VA 2RGHA 3SQPA 2OA1A 4U8IA 4WX1A 1OJTA 4H4WA 1D7LA 2YVJA 3II4A 2BACA 2C75A 2O9ZA 3IF9A 4B67A 2Q6UA 1NG4A 4J36A 3G5SA 2GR0A 1K0IA 4Y4NA 4H2QA 1F8RA 1CC2A 2Z5XA 2Z5YA 2C72A 4ADWA 4YKGA 4GR1A 1ZOYA 1UKVG 2F5ZA 1YY5A 1ZX9A 3QFBA 3C4AA 1PHHA 3KD9A 4K5RA 3UTEA 4Y4LA 1QJDA 1PJ5A 2WHDA 1CL0A 4H4SA 2JKCA 2YR5A 1H7XA 3ALLA 1N4VA 3NYFA 2WETA 4I58A 2XLTA 1DNCA 2A8XA 2WU5A 2YVFA 1ONFA 3AE8A 2BCPA 3KA7A 2XCGA 3O0HA 4H2PA 3RP8A 2CFYA 5TR3A 3KU9A 2BK3A 4YSHA 2OAMA 4H4QA 4Z26A 3ADAB 1NHPA 3CPHG 1JNRA 4AOSA 1S2YA 2Q7VA 3CPIG 4K5SA 3QSMA 2Q0LA 2VQBA 4ZCCA 5C2TA 2R4JA 2YG3A 5KVHA 3F8DA 3Q6JA 1EBDA 3NRNA 2WDVA 4XWRA 3LZWA 2BCGG 2GV8A 2RGJA 1Y56A 1ELIA 1PBBA 4EM3A 3BI5A 5JCMA 1Y56B 4RSLA 1GNDA 1FCDA 2BS4A 1TDFA 5IQ4A 3UKKA 2V60A 4TM0A 2WDQA 3COXA 3QSEA 1PS9A 1W4XA 4UDRA 1LV0A 5M10A 1L9CA 5ER0A 3UKAA 3ICTA 1MOKA 1O95A 1OJ9A 3DJDA 1YQ4A 1NPXA 4DNAA 1H83A 3AE3A 2EQ7A 2WPCA 3AE4A 4TM4A 2NVKX 3IC9A 4X9MA 2AR8A 3ATQA 4REKA 3RHAA 1EL9A 2V61A 2WP9A 2ZZCA 5EOWA 4EQWA 3GWFA 4HB9A 5EB5A 4USRA 2YLSA 4Z25A 3ZDNA 3ITJA 4XWZA 4U8JA 2C7GA 4Z44A 1RP0A 4IVMB 3UTHA 5JCKA 4K2XA 5U1OA 1TDOA 2YLZA 2C76A 3GMBA 4CNJA 2V3AA 1BWCA 2XVJA 2ZZBA 4EQSA 2BC0A 3KVEA 4GCMA 2JBVA 4Z2TA 3PVCA 4C74A 2C3DA 1PXCA 1VG0A 3AD7B 1H81A 4KPRA 3K7TA 4WCTA 3T37A 4A6NA 3GDPA 4J57A 1D4CA 4EQRA 1IUVA 2R0CA 4A6NB 4A9WA 1NHSA 1GV4A 1KNRA 4AP1A 5J60A 1ZMDA 2PYXA 1NHRA 1L0VA 2FJBA 1JRYA 2X8HA 1FOHA 3UKFA 3AECA 1CC4A 2X50A 4B69A 3V76A 5JCLA 2B9WA 1GRBA 1BGNA 2TPRA 3OZ2A 4U2SA 3UOVA 4ZN0A 4C5OA 4CY8A 3FPZA 4YSYA 4YTPA 1D4EA 3NK0X 3CN8A 3NYEA 4H4YA 3V3NA 2XFOA 1D5TA 3DMEA 4U2TA 1L9DA 1H82A 1XANA 4CRTA 2GF3A 3AE2A 1M6IA 2BC1A 2JB2A 3CNSA 3AE6A 3CGEA 4NEWA 3VRAA 3NT6A 1Q1RA 1TDKA 4U8MA 5KXJA 3H8IA 3KPFA 2DKIA 2XLRA 3DK4A 1CJCA 1GPEA 2J3NA 4K7ZA 5KOWA 2C73A 3DH9A 1COYA 3URHA 2FBWA 3CGBA 2WDRA 3NIXA 5U25A 4KX6A 4BJYA 1YQZA 2BYBA 3UOZA 5L46A 1CF3A 2XFQA 3NH3X 4H4PA 1PDHA 2GEWA 3LZXA 4J33A 3AEFA 1EL7A 1F3PA 4APNA 2R4EA 1GSNA 1ZY8A 2E1MA 2XLPA 2DKHA 2Y6QA 4YTMA
chains in the Genus database with same CATH superfamily
2BA9A 1CJ2A 2GR3A 3VRBA 2V5ZA 3QJ4A 4DGKA 5CQFA 3AD9B 4YKFA 4H4VA 3ATRA 2ZBWA 2OLNA 1FL2A 2XVFA 3SFDA 4B66A 3BHFA 3ICRA 1CC6A 1Y0PA 3GRTA 3P9UA 3CNDA 1E1KA 3FG2P 2WOVA 2C67A 2Y6RA 3G5QA 3L1RA 4GAPA 2VVLG 2GQFA 1XHCA 3RP7A 1JOAA 2X8CA 1F8SA 2XDOA 3NYCA 1DODA 2RGOA 3LB8A 2I0ZA 3M13A 3UKHA 3SYIA 4AT0A 2ZZ0A 1JNZA 1GEUA 3BI4A 1GRFA 5FS7A 3Q9TA 3AYIA 1FEAA 1BF3A 2EQ8A 2Q0KA 3D8XA 2BXSA 1NENA 3UP4A 2XVIA 4NEVA 1KSSA 3SXIA 5HXIA 1H84A 1D4DA 2AQJA 2B7RA 2YM1A 3AE1A 1K0JA 4BK3A 4JN9A 3VRDB 1FECA 1E1MA 2EQ9A 3CPJG 3EAOA 5KMPA 2XYOA 4AOXA 3EF6A 4FDCB 1PBEA 4OPCA 2YLTA 1MXTA 2JB1A 4O5UA 4OPTA 3HZLA 4NTCA 3CNJA 1GERA 1V59A 2CDUA 2YLXA 1TYTA 3BNUA 3JSKA 4OPIA 1F6MA 3GYJA 5KNLA 2CVJA 3DGZA 3ALJA 4UDPA 2XFUA 2BS2A 1KDGA 2XVHA 2YG6A 1IUXA 4A7AA 4H2NA 3NN0X 2XLSA 4BK2A 1DOEA 3P1WA 4EMJA 3AEBA 2YR6A 4OVIA 3UOYA 3GYIA 2YLRA 4ZCDA 4BV6A 5IQ1A 3LOVA 2JK6A 3GDNA 2GAHB 5CKUA 4DSHA 3H8LA 1PXAA 3S5WA 1LQUA 4NTEA 1N1PA 3NLCA 4E0VA 2BS3A 1GOSA 1D7YA 4EMIA 1H86A 1K0LA 3QVPA 5KOXA 5U63A 2CULA 3FMWA 4Z2UA 4OPGA 5BUKA 3EANA 3GSIA 2YM2A 4H4ZA 1N4UA 4GRTA 2R0GA 1XDIA 2WPEA 1E1LA 4J31A 4EMWA 1B37A 2VVLA 1RYIA 1BZLA 2B76A 5GSNA 3DK9A 4CCRA 2B9YA 3HYVA 4GDEA 4A65A 4Z43A 4OCGA 1F8WA 1S3EA 2A87A 2C64A 3AXBA 1LVLA 2GRTA 2GR2A 4GUVA 4IA6A 4JY3A 2OLOA 2QAEA 3AD8B 1VQWA 2B7SA 2WU2A 2YVGA 3QSSA 1LQTA 4H4XA 2ACZA 4EQXA 1PJ7A 3FBSA 3SZ0A 1TRBA 3K30A 4OPLA 4PAAA 3NN6X 4H50A 4U8OA 1CJ4A 2VZ2A 1PBDA 3DJEA 2BABA 3I3LA 3QVRA 4U8KA 1DOCA 1K4QA 2GQWA 3CNTA 5EBKA 1CHUA 3SM8A 3GD4A 5C3JA 1E6EA 5FS8A 3LXDA 4TLXA 3AEGA 4JNAA 4A79A 4P9SA 2GAGB 1LPFA 2C66A 3AEDA 1E1NA 2VQ7A 3UKLA 3H4KA 3LJPA 4CY6A 1DOBA 3GWDA 2GH5A 4K8DA 1GT8A 2XFNA 2E5VA 4YSXA 1PJ6A 3C4NA 3ALMA 3EPTA 3GRSA 3P4SA 4H7UA 4BURA 4H4TA 3ABVA 3T2YA 3UTFA 3NK1X 2WBAA 5IPYA 3AEEA 1REOA 1ZP0A 2WOIA 2VOUA 1AOGA 4U8NA 2VVMA 3R9UA 3UKPA 1JRXA 2YAUA 4MJWA 1DXLA 2NPXA 1GTEA 3VQRA 2YG5A 4GF7A 2WQYA 3CTYA 1GETA 4U2LA 4LU6A 4X9NA 1VRQB 4FK1C 3K7MX 4J34A 5BVAA 3CGCA 1P2HA 4C3YA 2E4GA 2YLWA 4GDPA 4B68A 2FJDA 1E39A 3KPKA 2WP5A 3G5RA 4B64A 4JY2A 3AEAA 3OC4A 4HA6A 4NWZA 1IUWA 3P4QA 2UZZA 3GMCA 1ZKQA 4H4UA 1SEZA 2HQMA 3BI2A 4Y4MA 1CJ3A 4B1BA 4C77A 4AP3A 2WESA 2YWLA 1PBCA 3D1CA 3NTAA 4Z24A 3GD3A 2JB3A 2AAQA 4Z2RA 1KSUA 1NDAA 2WS3A 3B3RA 2H88A 4IVOB 4LIIA 1EL5A 1S3BA 1DJNA 3AE5A 3ICSA 4AT2A 5BULA 1ZOVA 1L9EA 1NAAA 2A89A 1Q9IA 2B9XA 2WEUA 1B5QA 3E1TA 1OJCA 4NZHA 3NK2X 2R45A 4IA5A 1GRHA 2APGA 3CIRA 3UTGA 4A99A 2GVCA 4YT0A 1KNPA 1VDCA 3NGCX 3NTDA 4PABA 3T14A 4LA1A 2XLUA 3I6DA 3BHKA 4I59A 1HYUA 4GAVA 4O5QA 1OJDA 2X8GA 3HYWA 2IVDA 5KRQA 3UKQA 1IUUA 1LTXR 3IHGA 5FS6A 5DBJA 3NKSA 5KVIA 2FJAA 3DA1A 3FIMB 4JDRA 4X4JA 1BKWA 1YQ3A 2YG4A 2WPFA 3KLJA 1X31B 1NHQA 2C70A 5EB4A 1B8SA 1FEBA 1M64A 1OJAA 1E7PA 1NG3A 4TM3A 2GR1A 4XXGA 4CNKA 2YQUA 3KKJA 4G73A 1ZK7A 3NHOX 2GMHA 4A5LA 1GRGA 3F8PA 2IIDA 3RP6A 2C65A 1TDNA 2W0HA 3AB1A 3C96A 1GRAA 2IVEA 3IWAA 3K7QX 3UP5A 2BXRA 4RG3A 4N9XA 4NNJA 4EM4A 3RNMA 2QA1A 4BJZA 1JU2A 1O94A 2X99A 2YR4A 3S61A 4CBQA 3PS9A 3AYJA 3VR9A 4UP3A 1Q1WA 1GXFA 1IUSA 1GREA 1YKJA 4M52A 2TMDA 4B63A 3GYXA 3LADA 4B65A 4FX9A 2EQ6A 5HY5A 1O5WA 1GTHA 3B6DA 1BGJA 1PN0A 1QO8A 2XVEA 1IUTA 1RSGA 4CCQA 5FMHA 1ZMCA 4D04A 1XPQA 2OALA 2QCUA 4ICYA 2BRYA 3T2KA 5JCNA 1H6VA 3AE7A 3SGLA 3L8KA 2R0PA 3WE0A 4ECHA 4K22A 5KMQA 1IJHA 2ARDA 3P4RA 4RG4A 3AWIA 1MO9A 3PO7A 4U8LA 4YXDA 5KWFA 1NEKA 3BNMA 5GRTA 2VRMA 4JQ9A 2FJEA 1TYPA 1EL8A 2V6OA 2GB0A 4TM1A 2C3CA 5JCIA 4OPDA 1JRZA 2JAEA 3F8RA 1GESA 3CMMA 4EIPA 5J7XA 3ZYXA 2RABA 2PHHA 1JEHA 1PBFA 3SZCA 4DSGA 1GALA 2BK5A 1S2QA 3DK8A 2VRLA 3NG7X 2X3NA 1DJQA 2V3BA 2R46A 3CNPA 1PXBA 3NNEA 2WP6A 3V3OA 4JNQA 4YTNA 4II2A 1LJ1A 4H2RA 1TDEA 1CBOA 3CGDA 4U8PA 5HHFA 3SFEA 4IV9A 3DJJA 5LV9A 1H7WA 4NTDA 3REDA 1KF6A 4D03A 4USQA 5HYMA 4J56A 2H89A 2GMJA 1P2EA 1N4WA 1Z6LA 3SZFA 4BK1A 1KFYA 2WOWA 3IHMA 1ZDLA 3P4PA 4FK1A 1GRTA 3M0OA 4J2WA 2R9ZA 5M0ZA 3UCLA 3AE9A 3M12A 4H4RA 2YG7A 4TLZA 4YWOA 3ISHA 2XFPA 3UOXA 5BRTA 4UDQA 5FS9A 4C3XA 4YSZA 3DJGX 1VG9A 4EIQA 4OPUA 1QLBA 2QA2A 3VR8A 2BK4A 3QFAA 3AYLA 3DGHA 1B4VA 2RGHA 3SQPA 2OA1A 4U8IA 4WX1A 1OJTA 4H4WA 1D7LA 2YVJA 3II4A 2BACA 2C75A 2O9ZA 3IF9A 4B67A 2Q6UA 1NG4A 4J36A 3G5SA 2GR0A 1K0IA 4Y4NA 4H2QA 4G9KA 1F8RA 1CC2A 2Z5XA 2Z5YA 2C72A 4ADWA 4YKGA 4GR1A 1ZOYA 1UKVG 2F5ZA 1YY5A 1ZX9A 3QFBA 3C4AA 1PHHA 3KD9A 4K5RA 3UTEA 4Y4LA 1QJDA 1PJ5A 2WHDA 1CL0A 4H4SA 2JKCA 2YR5A 1H7XA 3ALLA 1N4VA 3NYFA 2WETA 4I58A 2XLTA 1DNCA 2A8XA 2WU5A 2YVFA 1ONFA 3AE8A 2BCPA 3KA7A 2XCGA 3O0HA 4H2PA 3RP8A 2CFYA 3HYXA 5TR3A 3KU9A 2BK3A 4YSHA 2OAMA 4H4QA 4Z26A 3ADAB 1NHPA 3CPHG 1JNRA 4AOSA 1S2YA 2Q7VA 3CPIG 4G6HA 3QSMA 2Q0LA 2VQBA 4K5SA 4ZCCA 5C2TA 2R4JA 2BRAA 2YG3A 3T0KA 5KVHA 3F8DA 3Q6JA 1EBDA 3NRNA 2WDVA 4XWRA 3T2ZA 3SZWA 3LZWA 2BCGG 2GV8A 2RGJA 1Y56A 1ELIA 1PBBA 4EM3A 3BI5A 5JCMA 1Y56B 4RSLA 1GNDA 1FCDA 2BS4A 1TDFA 5IQ4A 3UKKA 2V60A 4TM0A 2WDQA 3COXA 3QSEA 1PS9A 1W4XA 4UDRA 1LV0A 5M10A 1L9CA 5ER0A 3UKAA 3ICTA 1MOKA 1O95A 1OJ9A 3DJDA 1YQ4A 1NPXA 4G6GA 4DNAA 1H83A 3AE3A 2EQ7A 2WPCA 3AE4A 2C4CA 4TM4A 2NVKX 3IC9A 4X9MA 2AR8A 3ATQA 4REKA 3RHAA 1EL9A 2V61A 2WP9A 2ZZCA 5EOWA 4EQWA 3GWFA 4HB9A 5EB5A 4USRA 2YLSA 4Z25A 3ZDNA 3ITJA 4XWZA 4U8JA 2C7GA 4Z44A 1RP0A 4IVMB 3UTHA 5JCKA 4K2XA 4G74A 5U1OA 1TDOA 2YLZA 2C76A 3GMBA 4CNJA 2V3AA 1BWCA 2XVJA 2ZZBA 4EQSA 2BC0A 3KVEA 4GCMA 2JBVA 4Z2TA 4II3A 3PVCA 4C74A 2C3DA 1PXCA 1VG0A 3AD7B 1H81A 4KPRA 3K7TA 4WCTA 3T37A 4A6NA 3GDPA 4J57A 1D4CA 4EQRA 1IUVA 2R0CA 4A6NB 4A9WA 1NHSA 1GV4A 1KNRA 4AP1A 5J60A 1ZMDA 2PYXA 1NHRA 1L0VA 2FJBA 3SX6A 3SY4A 1JRYA 2X8HA 1FOHA 3UKFA 3AECA 1CC4A 2X50A 4B69A 3V76A 5JCLA 2B9WA 1GRBA 1BGNA 2TPRA 3OZ2A 4U2SA 3UOVA 4ZN0A 5KMSA 4C5OA 4CY8A 3FPZA 4YSYA 4YTPA 1D4EA 3NK0X 3CN8A 3NYEA 4H4YA 3V3NA 2XFOA 1D5TA 3DMEA 4U2TA 1L9DA 1H82A 1XANA 4CRTA 2GF3A 3AE2A 1M6IA 3T31A 5KMRA 2BC1A 2JB2A 3CNSA 3AE6A 3CGEA 4NEWA 3VRAA 3NT6A 1Q1RA 1TDKA 4U8MA 5KXJA 3H8IA 3KPFA 2DKIA 2XLRA 3DK4A 1CJCA 1GPEA 2J3NA 4K7ZA 5KOWA 2C73A 3DH9A 1COYA 3URHA 2FBWA 3CGBA 2WDRA 3NIXA 5U25A 4KX6A 4BJYA 1YQZA 2BYBA 3UOZA 5L46A 1CF3A 2XFQA 3NH3X 4H4PA 1PDHA 2GEWA 3LZXA 4J33A 3AEFA 1EL7A 1F3PA 4APNA 2R4EA 1GSNA 1ZY8A 2E1MA 2XLPA 2DKHA 2Y6QA 4YTMA
chains in the Genus database with same CATH topology
2BA9A 1CJ2A 2GR3A 3VRBA 2V5ZA 3QJ4A 4DGKA 5CQFA 3AD9B 4YKFA 4H4VA 3ATRA 2ZBWA 2OLNA 1FL2A 2XVFA 3SFDA 4B66A 3BHFA 3ICRA 1CC6A 1Y0PA 3GRTA 3P9UA 3CNDA 1E1KA 3FG2P 2WOVA 2C67A 2Y6RA 3G5QA 3L1RA 4GAPA 2VVLG 2GQFA 1XHCA 3RP7A 1JOAA 2X8CA 1F8SA 2XDOA 3NYCA 1DODA 2RGOA 3LB8A 2I0ZA 3M13A 3UKHA 3SYIA 4AT0A 2ZZ0A 1JNZA 1GEUA 3BI4A 1GRFA 5FS7A 3Q9TA 3AYIA 1FEAA 1BF3A 2EQ8A 2Q0KA 3D8XA 2BXSA 1NENA 3UP4A 2XVIA 4NEVA 1KSSA 3SXIA 5HXIA 1H84A 1D4DA 2AQJA 2B7RA 2YM1A 3AE1A 1K0JA 4BK3A 4JN9A 3VRDB 1FECA 1E1MA 2EQ9A 3CPJG 3EAOA 5KMPA 2XYOA 4AOXA 3EF6A 4FDCB 1PBEA 4OPCA 2YLTA 1MXTA 2JB1A 4O5UA 4OPTA 3HZLA 4NTCA 3CNJA 1GERA 1V59A 2CDUA 2YLXA 1TYTA 3BNUA 3JSKA 4OPIA 1F6MA 3GYJA 5KNLA 2CVJA 3DGZA 3ALJA 4UDPA 2XFUA 2BS2A 1KDGA 2XVHA 2YG6A 1IUXA 4A7AA 4H2NA 3NN0X 2XLSA 4BK2A 1DOEA 3P1WA 4EMJA 3AEBA 2YR6A 4OVIA 3UOYA 3GYIA 2YLRA 4ZCDA 4BV6A 5IQ1A 3LOVA 2JK6A 3GDNA 2GAHB 5CKUA 4DSHA 3H8LA 1PXAA 3S5WA 1LQUA 4NTEA 1N1PA 3NLCA 4E0VA 2BS3A 1GOSA 1D7YA 4EMIA 1H86A 1K0LA 3QVPA 5KOXA 5U63A 2CULA 3FMWA 4Z2UA 4OPGA 5BUKA 3EANA 3GSIA 2YM2A 4H4ZA 1N4UA 4GRTA 2R0GA 1XDIA 2WPEA 1E1LA 4J31A 4EMWA 1B37A 2VVLA 1RYIA 1BZLA 2B76A 5GSNA 3DK9A 4CCRA 2B9YA 3HYVA 4GDEA 4A65A 4Z43A 4OCGA 1F8WA 1S3EA 2A87A 2C64A 3AXBA 1LVLA 2GRTA 2GR2A 4GUVA 4IA6A 4JY3A 2OLOA 2QAEA 3AD8B 1VQWA 2B7SA 2WU2A 2YVGA 3QSSA 1LQTA 4H4XA 2ACZA 4EQXA 1PJ7A 3FBSA 3SZ0A 1TRBA 3K30A 4OPLA 4PAAA 3NN6X 4H50A 4U8OA 1CJ4A 2VZ2A 1PBDA 3DJEA 2BABA 3I3LA 3QVRA 4U8KA 1DOCA 1K4QA 2GQWA 3CNTA 5EBKA 1CHUA 3SM8A 3GD4A 5C3JA 1E6EA 5FS8A 3LXDA 4TLXA 3AEGA 4JNAA 4A79A 4P9SA 2GAGB 1LPFA 2C66A 3AEDA 1E1NA 2VQ7A 3UKLA 3H4KA 3LJPA 4CY6A 1DOBA 3GWDA 2GH5A 4K8DA 1GT8A 2XFNA 2E5VA 4YSXA 1PJ6A 3C4NA 3ALMA 3EPTA 3GRSA 3P4SA 4H7UA 4BURA 4H4TA 3ABVA 3T2YA 3UTFA 3NK1X 2WBAA 5IPYA 3AEEA 1REOA 1ZP0A 2WOIA 2VOUA 1AOGA 4U8NA 2VVMA 3R9UA 3UKPA 1JRXA 2YAUA 4MJWA 1DXLA 2NPXA 1GTEA 3VQRA 2YG5A 4GF7A 2WQYA 3CTYA 1GETA 4U2LA 4LU6A 4X9NA 1VRQB 4FK1C 3K7MX 4J34A 5BVAA 3CGCA 1P2HA 4C3YA 2E4GA 2YLWA 4GDPA 4B68A 2FJDA 1E39A 3KPKA 2WP5A 3G5RA 4B64A 4JY2A 3AEAA 3OC4A 4HA6A 4NWZA 1IUWA 3P4QA 2UZZA 3GMCA 1ZKQA 4H4UA 1SEZA 2HQMA 3BI2A 4Y4MA 1CJ3A 4B1BA 4C77A 4AP3A 2WESA 2YWLA 1PBCA 3D1CA 3NTAA 4Z24A 3GD3A 2JB3A 2AAQA 4Z2RA 1KSUA 1NDAA 2WS3A 3B3RA 2H88A 4IVOB 4LIIA 1EL5A 1S3BA 1DJNA 3AE5A 3ICSA 4AT2A 5BULA 1ZOVA 1L9EA 1NAAA 2A89A 1Q9IA 2B9XA 2WEUA 1B5QA 3E1TA 1OJCA 4NZHA 3NK2X 2R45A 4IA5A 1GRHA 2APGA 3CIRA 3UTGA 4A99A 2GVCA 4YT0A 1KNPA 1VDCA 3NGCX 3NTDA 4PABA 3T14A 4LA1A 2XLUA 3I6DA 3BHKA 4I59A 1HYUA 4GAVA 4O5QA 1OJDA 2X8GA 3HYWA 2IVDA 5KRQA 3UKQA 1IUUA 1LTXR 3IHGA 5FS6A 5DBJA 3NKSA 5KVIA 2FJAA 3DA1A 3FIMB 4JDRA 4X4JA 1BKWA 1YQ3A 2YG4A 2WPFA 3KLJA 1X31B 1NHQA 2C70A 5EB4A 1B8SA 1FEBA 1M64A 1OJAA 1E7PA 1NG3A 4TM3A 2GR1A 4XXGA 4CNKA 2YQUA 3KKJA 4G73A 1ZK7A 3NHOX 2GMHA 4A5LA 1GRGA 3F8PA 2IIDA 3RP6A 2C65A 1TDNA 2W0HA 3AB1A 3C96A 1GRAA 2IVEA 3IWAA 3K7QX 3UP5A 2BXRA 4RG3A 4N9XA 4NNJA 4EM4A 3RNMA 2QA1A 4BJZA 1JU2A 1O94A 2X99A 2YR4A 3S61A 4CBQA 3PS9A 3AYJA 3VR9A 4UP3A 1Q1WA 1GXFA 1IUSA 1GREA 1YKJA 4M52A 2TMDA 4B63A 3GYXA 3LADA 4B65A 4FX9A 2EQ6A 5HY5A 1O5WA 1GTHA 3B6DA 1BGJA 1PN0A 1QO8A 2XVEA 1IUTA 1RSGA 4CCQA 5FMHA 1ZMCA 4D04A 1XPQA 2OALA 2QCUA 4ICYA 2BRYA 3T2KA 5JCNA 1H6VA 3AE7A 3SGLA 3L8KA 2R0PA 3WE0A 4ECHA 4K22A 5KMQA 1IJHA 2ARDA 3P4RA 4RG4A 3AWIA 1MO9A 3PO7A 4U8LA 4YXDA 5KWFA 1NEKA 3BNMA 5GRTA 2VRMA 4JQ9A 2FJEA 1TYPA 1EL8A 2V6OA 2GB0A 4TM1A 2C3CA 5JCIA 4OPDA 1JRZA 2JAEA 3F8RA 1GESA 3CMMA 4EIPA 5J7XA 3ZYXA 2RABA 2PHHA 1JEHA 1PBFA 3SZCA 4DSGA 1GALA 2BK5A 1S2QA 3DK8A 2VRLA 3NG7X 2X3NA 1DJQA 2V3BA 2R46A 3CNPA 1PXBA 3NNEA 2WP6A 3V3OA 4JNQA 4YTNA 4II2A 1LJ1A 4H2RA 1TDEA 1CBOA 3CGDA 4U8PA 5HHFA 3SFEA 4IV9A 3DJJA 5LV9A 1H7WA 4NTDA 3REDA 1KF6A 4D03A 4USQA 5HYMA 4J56A 2H89A 2GMJA 1P2EA 1N4WA 1Z6LA 3SZFA 4BK1A 1KFYA 2WOWA 3IHMA 1ZDLA 3P4PA 4FK1A 1GRTA 3M0OA 4J2WA 2R9ZA 5M0ZA 3UCLA 3AE9A 3M12A 4H4RA 2YG7A 4TLZA 4YWOA 3ISHA 2XFPA 3UOXA 5BRTA 4UDQA 5FS9A 4C3XA 4YSZA 3DJGX 1VG9A 4EIQA 4OPUA 1QLBA 2QA2A 3VR8A 2BK4A 3QFAA 3AYLA 3DGHA 1B4VA 2RGHA 3SQPA 2OA1A 4U8IA 4WX1A 1OJTA 4H4WA 1D7LA 2YVJA 3II4A 2BACA 2C75A 2O9ZA 3IF9A 4B67A 2Q6UA 1NG4A 4J36A 3G5SA 2GR0A 1K0IA 4Y4NA 4H2QA 4G9KA 1F8RA 1CC2A 2Z5XA 2Z5YA 2C72A 4ADWA 4YKGA 4GR1A 1ZOYA 1UKVG 2F5ZA 1YY5A 1ZX9A 3QFBA 3C4AA 1PHHA 3KD9A 4K5RA 3UTEA 4Y4LA 1QJDA 1PJ5A 2WHDA 1CL0A 4H4SA 2JKCA 2YR5A 1H7XA 3ALLA 1N4VA 3NYFA 2WETA 4I58A 2XLTA 1DNCA 2A8XA 2WU5A 2YVFA 1ONFA 3AE8A 2BCPA 3KA7A 2XCGA 3O0HA 4H2PA 3RP8A 2CFYA 3HYXA 5TR3A 3KU9A 2BK3A 4YSHA 2OAMA 4H4QA 4Z26A 3ADAB 1NHPA 3CPHG 1JNRA 4AOSA 1S2YA 2Q7VA 3CPIG 4G6HA 3QSMA 2Q0LA 2VQBA 4K5SA 4ZCCA 5C2TA 2R4JA 2BRAA 2YG3A 3T0KA 5KVHA 3F8DA 3Q6JA 1EBDA 3NRNA 2WDVA 4XWRA 3T2ZA 3SZWA 3LZWA 2BCGG 2GV8A 2RGJA 1Y56A 1ELIA 1PBBA 4EM3A 3BI5A 5JCMA 1Y56B 4RSLA 1GNDA 1FCDA 2BS4A 1TDFA 5IQ4A 3UKKA 2V60A 4TM0A 2WDQA 3COXA 3QSEA 1PS9A 1W4XA 4UDRA 1LV0A 5M10A 1L9CA 5ER0A 3UKAA 3ICTA 1MOKA 1O95A 1OJ9A 3DJDA 1YQ4A 1NPXA 4G6GA 4DNAA 1H83A 3AE3A 2EQ7A 2WPCA 3AE4A 2C4CA 4TM4A 2NVKX 3IC9A 4X9MA 2AR8A 3ATQA 4REKA 3RHAA 1EL9A 2V61A 2WP9A 2ZZCA 5EOWA 4EQWA 3GWFA 4HB9A 5EB5A 4USRA 2YLSA 4Z25A 3ZDNA 3ITJA 4XWZA 4U8JA 2C7GA 4Z44A 1RP0A 4IVMB 3UTHA 5JCKA 4K2XA 4G74A 5U1OA 1TDOA 2YLZA 2C76A 3GMBA 4CNJA 2V3AA 1BWCA 2XVJA 2ZZBA 4EQSA 2BC0A 3KVEA 4GCMA 2JBVA 4Z2TA 4II3A 3PVCA 4C74A 2C3DA 1PXCA 1VG0A 3AD7B 1H81A 4KPRA 3K7TA 4WCTA 3T37A 4A6NA 3GDPA 4J57A 1D4CA 4EQRA 1IUVA 2R0CA 4A6NB 4A9WA 1NHSA 1GV4A 1KNRA 4AP1A 5J60A 1ZMDA 2PYXA 1NHRA 1L0VA 2FJBA 3SX6A 3SY4A 1JRYA 2X8HA 1FOHA 3UKFA 3AECA 1CC4A 2X50A 4B69A 3V76A 5JCLA 2B9WA 1GRBA 1BGNA 2TPRA 3OZ2A 4U2SA 3UOVA 4ZN0A 5KMSA 4C5OA 4CY8A 3FPZA 4YSYA 4YTPA 1D4EA 3NK0X 3CN8A 3NYEA 4H4YA 3V3NA 2XFOA 1D5TA 3DMEA 4U2TA 1L9DA 1H82A 1XANA 4CRTA 2GF3A 3AE2A 1M6IA 3T31A 5KMRA 2BC1A 2JB2A 3CNSA 3AE6A 3CGEA 4NEWA 3VRAA 3NT6A 1Q1RA 1TDKA 4U8MA 5KXJA 3H8IA 3KPFA 2DKIA 2XLRA 3DK4A 1CJCA 1GPEA 2J3NA 4K7ZA 5KOWA 2C73A 3DH9A 1COYA 3URHA 2FBWA 3CGBA 2WDRA 3NIXA 5U25A 4KX6A 4BJYA 1YQZA 2BYBA 3UOZA 5L46A 1CF3A 2XFQA 3NH3X 4H4PA 1PDHA 2GEWA 3LZXA 4J33A 3AEFA 1EL7A 1F3PA 4APNA 2R4EA 1GSNA 1ZY8A 2E1MA 2XLPA 2DKHA 2Y6QA 4YTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA9 A;  1CJ2 A;  2GR3 A;  3VRB A;  2V5Z A;  3QJ4 A;  4DGK A;  5CQF A;  3AD9 B;  4YKF A;  4H4V A;  3ATR A;  2ZBW A;  2OLN A;  1FL2 A;  2XVF A;  3SFD A;  4B66 A;  3BHF A;  3ICR A;  1CC6 A;  1Y0P A;  3GRT A;  3P9U A;  3CND A;  1E1K A;  3FG2 P;  2WOV A;  2C67 A;  2Y6R A;  3G5Q A;  3L1R A;  2VVL G;  2GQF A;  1XHC A;  3RP7 A;  1JOA A;  2X8C A;  1F8S A;  2XDO A;  3NYC A;  1DOD A;  2RGO A;  3LB8 A;  2I0Z A;  3M13 A;  3UKH A;  4AT0 A;  2ZZ0 A;  1JNZ A;  1GEU A;  3BI4 A;  1GRF A;  5FS7 A;  3Q9T A;  3AYI A;  1FEA A;  1BF3 A;  2EQ8 A;  2Q0K A;  3D8X A;  2BXS A;  1NEN A;  3UP4 A;  2XVI A;  4NEV A;  1KSS A;  5HXI A;  1H84 A;  1D4D A;  2AQJ A;  2B7R A;  2YM1 A;  3AE1 A;  1K0J A;  4BK3 A;  4JN9 A;  3VRD B;  1FEC A;  1E1M A;  2EQ9 A;  3CPJ G;  3EAO A;  2XYO A;  4AOX A;  3EF6 A;  4FDC B;  1PBE A;  4OPC A;  2YLT A;  1MXT A;  2JB1 A;  4O5U A;  4OPT A;  3HZL A;  4NTC A;  3CNJ A;  1GER A;  1V59 A;  2CDU A;  2YLX A;  1TYT A;  3BNU A;  3JSK A;  4OPI A;  1F6M A;  3GYJ A;  2CVJ A;  3DGZ A;  3ALJ A;  4UDP A;  2XFU A;  2BS2 A;  1KDG A;  2XVH A;  2YG6 A;  1IUX A;  4A7A A;  4H2N A;  3NN0 X;  2XLS A;  4BK2 A;  1DOE A;  3P1W A;  4EMJ A;  3AEB A;  2YR6 A;  4OVI A;  3UOY A;  3GYI A;  2YLR A;  4ZCD A;  4BV6 A;  5IQ1 A;  3LOV A;  2JK6 A;  3GDN A;  2GAH B;  5CKU A;  4DSH A;  3H8L A;  1PXA A;  3S5W A;  1LQU A;  4NTE A;  1N1P A;  3NLC A;  4E0V A;  2BS3 A;  1GOS A;  1D7Y A;  4EMI A;  1H86 A;  1K0L A;  3QVP A;  5KOX A;  5U63 A;  2CUL A;  3FMW A;  4Z2U A;  4OPG A;  5BUK A;  3EAN A;  3GSI A;  2YM2 A;  4H4Z A;  1N4U A;  4GRT A;  2R0G A;  1XDI A;  2WPE A;  1E1L A;  4J31 A;  4EMW A;  1B37 A;  2VVL A;  1RYI A;  1BZL A;  2B76 A;  5GSN A;  3DK9 A;  4CCR A;  2B9Y A;  4GDE A;  4A65 A;  4Z43 A;  4OCG A;  1F8W A;  1S3E A;  2A87 A;  2C64 A;  3AXB A;  1LVL A;  2GRT A;  2GR2 A;  4GUV A;  4IA6 A;  4JY3 A;  2OLO A;  2QAE A;  3AD8 B;  1VQW A;  2B7S A;  2WU2 A;  2YVG A;  3QSS A;  1LQT A;  4H4X A;  2ACZ A;  4EQX A;  1PJ7 A;  3FBS A;  1TRB A;  3K30 A;  4OPL A;  4PAA A;  3NN6 X;  4H50 A;  4U8O A;  1CJ4 A;  2VZ2 A;  1PBD A;  3DJE A;  2BAB A;  3I3L A;  3QVR A;  4U8K A;  1DOC A;  1K4Q A;  2GQW A;  3CNT A;  5EBK A;  1CHU A;  3SM8 A;  3GD4 A;  5C3J A;  1E6E A;  5FS8 A;  3LXD A;  4TLX A;  3AEG A;  4JNA A;  4A79 A;  4P9S A;  2GAG B;  1LPF A;  2C66 A;  3AED A;  1E1N A;  2VQ7 A;  3UKL A;  3H4K A;  3LJP A;  4CY6 A;  1DOB A;  3GWD A;  2GH5 A;  4K8D A;  1GT8 A;  2XFN A;  2E5V A;  4YSX A;  1PJ6 A;  3C4N A;  3ALM A;  3EPT A;  3GRS A;  3P4S A;  4H7U A;  4BUR A;  4H4T A;  3ABV A;  3UTF A;  3NK1 X;  2WBA A;  5IPY A;  3AEE A;  1REO A;  1ZP0 A;  2WOI A;  2VOU A;  1AOG A;  4U8N A;  2VVM A;  3R9U A;  3UKP A;  1JRX A;  2YAU A;  4MJW A;  1DXL A;  2NPX A;  1GTE A;  3VQR A;  2YG5 A;  4GF7 A;  2WQY A;  3CTY A;  1GET A;  4U2L A;  4LU6 A;  4X9N A;  1VRQ B;  4FK1 C;  3K7M X;  4J34 A;  5BVA A;  3CGC A;  1P2H A;  4C3Y A;  2E4G A;  2YLW A;  4GDP A;  4B68 A;  2FJD A;  1E39 A;  2WP5 A;  3G5R A;  4B64 A;  4JY2 A;  3AEA A;  3OC4 A;  4HA6 A;  1IUW A;  3P4Q A;  2UZZ A;  3GMC A;  1ZKQ A;  4H4U A;  1SEZ A;  2HQM A;  3BI2 A;  4Y4M A;  1CJ3 A;  4B1B A;  4C77 A;  4AP3 A;  2WES A;  2YWL A;  1PBC A;  3D1C A;  3NTA A;  4Z24 A;  3GD3 A;  2JB3 A;  2AAQ A;  4Z2R A;  1KSU A;  1NDA A;  2WS3 A;  3B3R A;  2H88 A;  4IVO B;  4LII A;  1EL5 A;  1S3B A;  1DJN A;  3AE5 A;  3ICS A;  4AT2 A;  5BUL A;  1ZOV A;  1L9E A;  1NAA A;  2A89 A;  1Q9I A;  2B9X A;  2WEU A;  1B5Q A;  3E1T A;  1OJC A;  4NZH A;  3NK2 X;  2R45 A;  4IA5 A;  1GRH A;  2APG A;  3CIR A;  3UTG A;  4A99 A;  2GVC A;  4YT0 A;  1KNP A;  1VDC A;  3NGC X;  3NTD A;  4PAB A;  4LA1 A;  2XLU A;  3I6D A;  3BHK A;  4I59 A;  1HYU A;  4O5Q A;  1OJD A;  2X8G A;  2IVD A;  5KRQ A;  3UKQ A;  1IUU A;  1LTX R;  3IHG A;  5FS6 A;  5DBJ A;  3NKS A;  5KVI A;  2FJA A;  3DA1 A;  3FIM B;  4JDR A;  4X4J A;  1BKW A;  1YQ3 A;  2YG4 A;  2WPF A;  3KLJ A;  1X31 B;  1NHQ A;  2C70 A;  5EB4 A;  1B8S A;  1FEB A;  1M64 A;  1OJA A;  1E7P A;  1NG3 A;  4TM3 A;  2GR1 A;  4XXG A;  4CNK A;  2YQU A;  3KKJ A;  1ZK7 A;  3NHO X;  2GMH A;  4A5L A;  1GRG A;  3F8P A;  2IID A;  3RP6 A;  2C65 A;  1TDN A;  2W0H A;  3AB1 A;  3C96 A;  1GRA A;  2IVE A;  3IWA A;  3K7Q X;  3UP5 A;  2BXR A;  4RG3 A;  4N9X A;  4EM4 A;  3RNM A;  2QA1 A;  4BJZ A;  1JU2 A;  1O94 A;  2X99 A;  2YR4 A;  3S61 A;  4CBQ A;  3PS9 A;  3AYJ A;  3VR9 A;  4UP3 A;  1Q1W A;  1GXF A;  1IUS A;  1GRE A;  1YKJ A;  4M52 A;  2TMD A;  4B63 A;  3LAD A;  4B65 A;  4FX9 A;  2EQ6 A;  5HY5 A;  1O5W A;  1GTH A;  3B6D A;  1BGJ A;  1PN0 A;  1QO8 A;  2XVE A;  1IUT A;  1RSG A;  4CCQ A;  5FMH A;  1ZMC A;  4D04 A;  1XPQ A;  2OAL A;  2QCU A;  4ICY A;  5JCN A;  1H6V A;  3AE7 A;  3SGL A;  3L8K A;  2R0P A;  3WE0 A;  4ECH A;  4K22 A;  1IJH A;  2ARD A;  3P4R A;  4RG4 A;  3AWI A;  1MO9 A;  3PO7 A;  4U8L A;  4YXD A;  5KWF A;  1NEK A;  3BNM A;  5GRT A;  2VRM A;  4JQ9 A;  2FJE A;  1TYP A;  1EL8 A;  2V6O A;  2GB0 A;  4TM1 A;  2C3C A;  5JCI A;  4OPD A;  1JRZ A;  2JAE A;  3F8R A;  1GES A;  4EIP A;  5J7X A;  3ZYX A;  2RAB A;  2PHH A;  1JEH A;  1PBF A;  4DSG A;  1GAL A;  2BK5 A;  1S2Q A;  3DK8 A;  2VRL A;  3NG7 X;  2X3N A;  1DJQ A;  2V3B A;  2R46 A;  3CNP A;  1PXB A;  3NNE A;  2WP6 A;  3V3O A;  4JNQ A;  4YTN A;  1LJ1 A;  4H2R A;  1TDE A;  1CBO A;  3CGD A;  4U8P A;  5HHF A;  3SFE A;  4IV9 A;  3DJJ A;  5LV9 A;  1H7W A;  4NTD A;  3RED A;  1KF6 A;  4D03 A;  4USQ A;  5HYM A;  4J56 A;  2H89 A;  2GMJ A;  1P2E A;  1N4W A;  1Z6L A;  4BK1 A;  1KFY A;  2WOW A;  3IHM A;  1ZDL A;  3P4P A;  4FK1 A;  1GRT A;  3M0O A;  4J2W A;  2R9Z A;  5M0Z A;  3UCL A;  3AE9 A;  3M12 A;  4H4R A;  2YG7 A;  4TLZ A;  4YWO A;  3ISH A;  2XFP A;  3UOX A;  5BRT A;  4UDQ A;  5FS9 A;  4C3X A;  4YSZ A;  3DJG X;  1VG9 A;  4EIQ A;  4OPU A;  1QLB A;  2QA2 A;  3VR8 A;  2BK4 A;  3QFA A;  3AYL A;  3DGH A;  1B4V A;  2RGH A;  3SQP A;  2OA1 A;  4U8I A;  4WX1 A;  1OJT A;  4H4W A;  1D7L A;  2YVJ A;  3II4 A;  2BAC A;  2C75 A;  2O9Z A;  3IF9 A;  4B67 A;  2Q6U A;  1NG4 A;  4J36 A;  3G5S A;  2GR0 A;  1K0I A;  4Y4N A;  4H2Q A;  1F8R A;  1CC2 A;  2Z5X A;  2Z5Y A;  2C72 A;  4ADW A;  4YKG A;  4GR1 A;  1ZOY A;  1UKV G;  2F5Z A;  1YY5 A;  1ZX9 A;  3QFB A;  3C4A A;  1PHH A;  3KD9 A;  4K5R A;  3UTE A;  4Y4L A;  1QJD A;  1PJ5 A;  2WHD A;  1CL0 A;  4H4S A;  2JKC A;  2YR5 A;  1H7X A;  3ALL A;  1N4V A;  3NYF A;  2WET A;  4I58 A;  2XLT A;  1DNC A;  2A8X A;  2WU5 A;  2YVF A;  1ONF A;  3AE8 A;  2BCP A;  3KA7 A;  2XCG A;  3O0H A;  4H2P A;  3RP8 A;  2CFY A;  5TR3 A;  3KU9 A;  2BK3 A;  4YSH A;  2OAM A;  4H4Q A;  4Z26 A;  3ADA B;  1NHP A;  3CPH G;  1JNR A;  4AOS A;  1S2Y A;  2Q7V A;  3CPI G;  4K5S A;  3QSM A;  2Q0L A;  2VQB A;  4ZCC A;  5C2T A;  2R4J A;  2YG3 A;  5KVH A;  3F8D A;  3Q6J A;  1EBD A;  3NRN A;  2WDV A;  4XWR A;  3LZW A;  2BCG G;  2GV8 A;  2RGJ A;  1Y56 A;  1ELI A;  1PBB A;  4EM3 A;  3BI5 A;  5JCM A;  1Y56 B;  4RSL A;  1GND A;  1FCD A;  2BS4 A;  1TDF A;  5IQ4 A;  3UKK A;  2V60 A;  4TM0 A;  2WDQ A;  3COX A;  3QSE A;  1PS9 A;  1W4X A;  4UDR A;  1LV0 A;  5M10 A;  1L9C A;  5ER0 A;  3UKA A;  3ICT A;  1MOK A;  1O95 A;  1OJ9 A;  3DJD A;  1YQ4 A;  1NPX A;  4DNA A;  1H83 A;  3AE3 A;  2EQ7 A;  2WPC A;  3AE4 A;  4TM4 A;  2NVK X;  3IC9 A;  4X9M A;  2AR8 A;  3ATQ A;  4REK A;  3RHA A;  1EL9 A;  2V61 A;  2WP9 A;  2ZZC A;  5EOW A;  4EQW A;  3GWF A;  4HB9 A;  5EB5 A;  4USR A;  2YLS A;  4Z25 A;  3ZDN A;  3ITJ A;  4XWZ A;  4U8J A;  2C7G A;  4Z44 A;  1RP0 A;  4IVM B;  3UTH A;  5JCK A;  4K2X A;  5U1O A;  1TDO A;  2YLZ A;  2C76 A;  3GMB A;  4CNJ A;  2V3A A;  1BWC A;  2XVJ A;  2ZZB A;  4EQS A;  2BC0 A;  3KVE A;  4GCM A;  2JBV A;  4Z2T A;  3PVC A;  4C74 A;  2C3D A;  1PXC A;  1VG0 A;  3AD7 B;  1H81 A;  4KPR A;  3K7T A;  4WCT A;  3T37 A;  4A6N A;  3GDP A;  4J57 A;  1D4C A;  4EQR A;  1IUV A;  2R0C A;  4A6N B;  4A9W A;  1NHS A;  1GV4 A;  1KNR A;  4AP1 A;  5J60 A;  1ZMD A;  2PYX A;  1NHR A;  1L0V A;  2FJB A;  1JRY A;  2X8H A;  1FOH A;  3UKF A;  3AEC A;  1CC4 A;  2X50 A;  4B69 A;  3V76 A;  5JCL A;  2B9W A;  1GRB A;  1BGN A;  2TPR A;  3OZ2 A;  4U2S A;  3UOV A;  4ZN0 A;  4C5O A;  4CY8 A;  3FPZ A;  4YSY A;  4YTP A;  1D4E A;  3NK0 X;  3CN8 A;  3NYE A;  4H4Y A;  3V3N A;  2XFO A;  1D5T A;  3DME A;  4U2T A;  1L9D A;  1H82 A;  1XAN A;  4CRT A;  2GF3 A;  3AE2 A;  1M6I A;  2BC1 A;  2JB2 A;  3CNS A;  3AE6 A;  3CGE A;  4NEW A;  3VRA A;  3NT6 A;  1Q1R A;  1TDK A;  4U8M A;  5KXJ A;  3H8I A;  3KPF A;  2DKI A;  2XLR A;  3DK4 A;  1CJC A;  1GPE A;  2J3N A;  4K7Z A;  5KOW A;  2C73 A;  3DH9 A;  1COY A;  3URH A;  2FBW A;  3CGB A;  2WDR A;  3NIX A;  5U25 A;  4KX6 A;  4BJY A;  1YQZ A;  2BYB A;  3UOZ A;  5L46 A;  1CF3 A;  2XFQ A;  3NH3 X;  4H4P A;  1PDH A;  2GEW A;  3LZX A;  4J33 A;  3AEF A;  1EL7 A;  1F3P A;  4APN A;  2R4E A;  1GSN A;  1ZY8 A;  2E1M A;  2XLP A;  2DKH A;  2Y6Q A;  4YTM A; 
#chains in the Genus database with same CATH topology
 2BA9 A;  1CJ2 A;  2GR3 A;  3VRB A;  2V5Z A;  3QJ4 A;  4DGK A;  5CQF A;  3AD9 B;  4YKF A;  4H4V A;  3ATR A;  2ZBW A;  2OLN A;  1FL2 A;  2XVF A;  3SFD A;  4B66 A;  3BHF A;  3ICR A;  1CC6 A;  1Y0P A;  3GRT A;  3P9U A;  3CND A;  1E1K A;  3FG2 P;  2WOV A;  2C67 A;  2Y6R A;  3G5Q A;  3L1R A;  4GAP A;  2VVL G;  2GQF A;  1XHC A;  3RP7 A;  1JOA A;  2X8C A;  1F8S A;  2XDO A;  3NYC A;  1DOD A;  2RGO A;  3LB8 A;  2I0Z A;  3M13 A;  3UKH A;  3SYI A;  4AT0 A;  2ZZ0 A;  1JNZ A;  1GEU A;  3BI4 A;  1GRF A;  5FS7 A;  3Q9T A;  3AYI A;  1FEA A;  1BF3 A;  2EQ8 A;  2Q0K A;  3D8X A;  2BXS A;  1NEN A;  3UP4 A;  2XVI A;  4NEV A;  1KSS A;  3SXI A;  5HXI A;  1H84 A;  1D4D A;  2AQJ A;  2B7R A;  2YM1 A;  3AE1 A;  1K0J A;  4BK3 A;  4JN9 A;  3VRD B;  1FEC A;  1E1M A;  2EQ9 A;  3CPJ G;  3EAO A;  5KMP A;  2XYO A;  4AOX A;  3EF6 A;  4FDC B;  1PBE A;  4OPC A;  2YLT A;  1MXT A;  2JB1 A;  4O5U A;  4OPT A;  3HZL A;  4NTC A;  3CNJ A;  1GER A;  1V59 A;  2CDU A;  2YLX A;  1TYT A;  3BNU A;  3JSK A;  4OPI A;  1F6M A;  3GYJ A;  5KNL A;  2CVJ A;  3DGZ A;  3ALJ A;  4UDP A;  2XFU A;  2BS2 A;  1KDG A;  2XVH A;  2YG6 A;  1IUX A;  4A7A A;  4H2N A;  3NN0 X;  2XLS A;  4BK2 A;  1DOE A;  3P1W A;  4EMJ A;  3AEB A;  2YR6 A;  4OVI A;  3UOY A;  3GYI A;  2YLR A;  4ZCD A;  4BV6 A;  5IQ1 A;  3LOV A;  2JK6 A;  3GDN A;  2GAH B;  5CKU A;  4DSH A;  3H8L A;  1PXA A;  3S5W A;  1LQU A;  4NTE A;  1N1P A;  3NLC A;  4E0V A;  2BS3 A;  1GOS A;  1D7Y A;  4EMI A;  1H86 A;  1K0L A;  3QVP A;  5KOX A;  5U63 A;  2CUL A;  3FMW A;  4Z2U A;  4OPG A;  5BUK A;  3EAN A;  3GSI A;  2YM2 A;  4H4Z A;  1N4U A;  4GRT A;  2R0G A;  1XDI A;  2WPE A;  1E1L A;  4J31 A;  4EMW A;  1B37 A;  2VVL A;  1RYI A;  1BZL A;  2B76 A;  5GSN A;  3DK9 A;  4CCR A;  2B9Y A;  3HYV A;  4GDE A;  4A65 A;  4Z43 A;  4OCG A;  1F8W A;  1S3E A;  2A87 A;  2C64 A;  3AXB A;  1LVL A;  2GRT A;  2GR2 A;  4GUV A;  4IA6 A;  4JY3 A;  2OLO A;  2QAE A;  3AD8 B;  1VQW A;  2B7S A;  2WU2 A;  2YVG A;  3QSS A;  1LQT A;  4H4X A;  2ACZ A;  4EQX A;  1PJ7 A;  3FBS A;  3SZ0 A;  1TRB A;  3K30 A;  4OPL A;  4PAA A;  3NN6 X;  4H50 A;  4U8O A;  1CJ4 A;  2VZ2 A;  1PBD A;  3DJE A;  2BAB A;  3I3L A;  3QVR A;  4U8K A;  1DOC A;  1K4Q A;  2GQW A;  3CNT A;  5EBK A;  1CHU A;  3SM8 A;  3GD4 A;  5C3J A;  1E6E A;  5FS8 A;  3LXD A;  4TLX A;  3AEG A;  4JNA A;  4A79 A;  4P9S A;  2GAG B;  1LPF A;  2C66 A;  3AED A;  1E1N A;  2VQ7 A;  3UKL A;  3H4K A;  3LJP A;  4CY6 A;  1DOB A;  3GWD A;  2GH5 A;  4K8D A;  1GT8 A;  2XFN A;  2E5V A;  4YSX A;  1PJ6 A;  3C4N A;  3ALM A;  3EPT A;  3GRS A;  3P4S A;  4H7U A;  4BUR A;  4H4T A;  3ABV A;  3T2Y A;  3UTF A;  3NK1 X;  2WBA A;  5IPY A;  3AEE A;  1REO A;  1ZP0 A;  2WOI A;  2VOU A;  1AOG A;  4U8N A;  2VVM A;  3R9U A;  3UKP A;  1JRX A;  2YAU A;  4MJW A;  1DXL A;  2NPX A;  1GTE A;  3VQR A;  2YG5 A;  4GF7 A;  2WQY A;  3CTY A;  1GET A;  4U2L A;  4LU6 A;  4X9N A;  1VRQ B;  4FK1 C;  3K7M X;  4J34 A;  5BVA A;  3CGC A;  1P2H A;  4C3Y A;  2E4G A;  2YLW A;  4GDP A;  4B68 A;  2FJD A;  1E39 A;  3KPK A;  2WP5 A;  3G5R A;  4B64 A;  4JY2 A;  3AEA A;  3OC4 A;  4HA6 A;  4NWZ A;  1IUW A;  3P4Q A;  2UZZ A;  3GMC A;  1ZKQ A;  4H4U A;  1SEZ A;  2HQM A;  3BI2 A;  4Y4M A;  1CJ3 A;  4B1B A;  4C77 A;  4AP3 A;  2WES A;  2YWL A;  1PBC A;  3D1C A;  3NTA A;  4Z24 A;  3GD3 A;  2JB3 A;  2AAQ A;  4Z2R A;  1KSU A;  1NDA A;  2WS3 A;  3B3R A;  2H88 A;  4IVO B;  4LII A;  1EL5 A;  1S3B A;  1DJN A;  3AE5 A;  3ICS A;  4AT2 A;  5BUL A;  1ZOV A;  1L9E A;  1NAA A;  2A89 A;  1Q9I A;  2B9X A;  2WEU A;  1B5Q A;  3E1T A;  1OJC A;  4NZH A;  3NK2 X;  2R45 A;  4IA5 A;  1GRH A;  2APG A;  3CIR A;  3UTG A;  4A99 A;  2GVC A;  4YT0 A;  1KNP A;  1VDC A;  3NGC X;  3NTD A;  4PAB A;  3T14 A;  4LA1 A;  2XLU A;  3I6D A;  3BHK A;  4I59 A;  1HYU A;  4GAV A;  4O5Q A;  1OJD A;  2X8G A;  3HYW A;  2IVD A;  5KRQ A;  3UKQ A;  1IUU A;  1LTX R;  3IHG A;  5FS6 A;  5DBJ A;  3NKS A;  5KVI A;  2FJA A;  3DA1 A;  3FIM B;  4JDR A;  4X4J A;  1BKW A;  1YQ3 A;  2YG4 A;  2WPF A;  3KLJ A;  1X31 B;  1NHQ A;  2C70 A;  5EB4 A;  1B8S A;  1FEB A;  1M64 A;  1OJA A;  1E7P A;  1NG3 A;  4TM3 A;  2GR1 A;  4XXG A;  4CNK A;  2YQU A;  3KKJ A;  4G73 A;  1ZK7 A;  3NHO X;  2GMH A;  4A5L A;  1GRG A;  3F8P A;  2IID A;  3RP6 A;  2C65 A;  1TDN A;  2W0H A;  3AB1 A;  3C96 A;  1GRA A;  2IVE A;  3IWA A;  3K7Q X;  3UP5 A;  2BXR A;  4RG3 A;  4N9X A;  4NNJ A;  4EM4 A;  3RNM A;  2QA1 A;  4BJZ A;  1JU2 A;  1O94 A;  2X99 A;  2YR4 A;  3S61 A;  4CBQ A;  3PS9 A;  3AYJ A;  3VR9 A;  4UP3 A;  1Q1W A;  1GXF A;  1IUS A;  1GRE A;  1YKJ A;  4M52 A;  2TMD A;  4B63 A;  3GYX A;  3LAD A;  4B65 A;  4FX9 A;  2EQ6 A;  5HY5 A;  1O5W A;  1GTH A;  3B6D A;  1BGJ A;  1PN0 A;  1QO8 A;  2XVE A;  1IUT A;  1RSG A;  4CCQ A;  5FMH A;  1ZMC A;  4D04 A;  1XPQ A;  2OAL A;  2QCU A;  4ICY A;  2BRY A;  3T2K A;  5JCN A;  1H6V A;  3AE7 A;  3SGL A;  3L8K A;  2R0P A;  3WE0 A;  4ECH A;  4K22 A;  5KMQ A;  1IJH A;  2ARD A;  3P4R A;  4RG4 A;  3AWI A;  1MO9 A;  3PO7 A;  4U8L A;  4YXD A;  5KWF A;  1NEK A;  3BNM A;  5GRT A;  2VRM A;  4JQ9 A;  2FJE A;  1TYP A;  1EL8 A;  2V6O A;  2GB0 A;  4TM1 A;  2C3C A;  5JCI A;  4OPD A;  1JRZ A;  2JAE A;  3F8R A;  1GES A;  3CMM A;  4EIP A;  5J7X A;  3ZYX A;  2RAB A;  2PHH A;  1JEH A;  1PBF A;  3SZC A;  4DSG A;  1GAL A;  2BK5 A;  1S2Q A;  3DK8 A;  2VRL A;  3NG7 X;  2X3N A;  1DJQ A;  2V3B A;  2R46 A;  3CNP A;  1PXB A;  3NNE A;  2WP6 A;  3V3O A;  4JNQ A;  4YTN A;  4II2 A;  1LJ1 A;  4H2R A;  1TDE A;  1CBO A;  3CGD A;  4U8P A;  5HHF A;  3SFE A;  4IV9 A;  3DJJ A;  5LV9 A;  1H7W A;  4NTD A;  3RED A;  1KF6 A;  4D03 A;  4USQ A;  5HYM A;  4J56 A;  2H89 A;  2GMJ A;  1P2E A;  1N4W A;  1Z6L A;  3SZF A;  4BK1 A;  1KFY A;  2WOW A;  3IHM A;  1ZDL A;  3P4P A;  4FK1 A;  1GRT A;  3M0O A;  4J2W A;  2R9Z A;  5M0Z A;  3UCL A;  3AE9 A;  3M12 A;  4H4R A;  2YG7 A;  4TLZ A;  4YWO A;  3ISH A;  2XFP A;  3UOX A;  5BRT A;  4UDQ A;  5FS9 A;  4C3X A;  4YSZ A;  3DJG X;  1VG9 A;  4EIQ A;  4OPU A;  1QLB A;  2QA2 A;  3VR8 A;  2BK4 A;  3QFA A;  3AYL A;  3DGH A;  1B4V A;  2RGH A;  3SQP A;  2OA1 A;  4U8I A;  4WX1 A;  1OJT A;  4H4W A;  1D7L A;  2YVJ A;  3II4 A;  2BAC A;  2C75 A;  2O9Z A;  3IF9 A;  4B67 A;  2Q6U A;  1NG4 A;  4J36 A;  3G5S A;  2GR0 A;  1K0I A;  4Y4N A;  4H2Q A;  4G9K A;  1F8R A;  1CC2 A;  2Z5X A;  2Z5Y A;  2C72 A;  4ADW A;  4YKG A;  4GR1 A;  1ZOY A;  1UKV G;  2F5Z A;  1YY5 A;  1ZX9 A;  3QFB A;  3C4A A;  1PHH A;  3KD9 A;  4K5R A;  3UTE A;  4Y4L A;  1QJD A;  1PJ5 A;  2WHD A;  1CL0 A;  4H4S A;  2JKC A;  2YR5 A;  1H7X A;  3ALL A;  1N4V A;  3NYF A;  2WET A;  4I58 A;  2XLT A;  1DNC A;  2A8X A;  2WU5 A;  2YVF A;  1ONF A;  3AE8 A;  2BCP A;  3KA7 A;  2XCG A;  3O0H A;  4H2P A;  3RP8 A;  2CFY A;  3HYX A;  5TR3 A;  3KU9 A;  2BK3 A;  4YSH A;  2OAM A;  4H4Q A;  4Z26 A;  3ADA B;  1NHP A;  3CPH G;  1JNR A;  4AOS A;  1S2Y A;  2Q7V A;  3CPI G;  4G6H A;  3QSM A;  2Q0L A;  2VQB A;  4K5S A;  4ZCC A;  5C2T A;  2R4J A;  2BRA A;  2YG3 A;  3T0K A;  5KVH A;  3F8D A;  3Q6J A;  1EBD A;  3NRN A;  2WDV A;  4XWR A;  3T2Z A;  3SZW A;  3LZW A;  2BCG G;  2GV8 A;  2RGJ A;  1Y56 A;  1ELI A;  1PBB A;  4EM3 A;  3BI5 A;  5JCM A;  1Y56 B;  4RSL A;  1GND A;  1FCD A;  2BS4 A;  1TDF A;  5IQ4 A;  3UKK A;  2V60 A;  4TM0 A;  2WDQ A;  3COX A;  3QSE A;  1PS9 A;  1W4X A;  4UDR A;  1LV0 A;  5M10 A;  1L9C A;  5ER0 A;  3UKA A;  3ICT A;  1MOK A;  1O95 A;  1OJ9 A;  3DJD A;  1YQ4 A;  1NPX A;  4G6G A;  4DNA A;  1H83 A;  3AE3 A;  2EQ7 A;  2WPC A;  3AE4 A;  2C4C A;  4TM4 A;  2NVK X;  3IC9 A;  4X9M A;  2AR8 A;  3ATQ A;  4REK A;  3RHA A;  1EL9 A;  2V61 A;  2WP9 A;  2ZZC A;  5EOW A;  4EQW A;  3GWF A;  4HB9 A;  5EB5 A;  4USR A;  2YLS A;  4Z25 A;  3ZDN A;  3ITJ A;  4XWZ A;  4U8J A;  2C7G A;  4Z44 A;  1RP0 A;  4IVM B;  3UTH A;  5JCK A;  4K2X A;  4G74 A;  5U1O A;  1TDO A;  2YLZ A;  2C76 A;  3GMB A;  4CNJ A;  2V3A A;  1BWC A;  2XVJ A;  2ZZB A;  4EQS A;  2BC0 A;  3KVE A;  4GCM A;  2JBV A;  4Z2T A;  4II3 A;  3PVC A;  4C74 A;  2C3D A;  1PXC A;  1VG0 A;  3AD7 B;  1H81 A;  4KPR A;  3K7T A;  4WCT A;  3T37 A;  4A6N A;  3GDP A;  4J57 A;  1D4C A;  4EQR A;  1IUV A;  2R0C A;  4A6N B;  4A9W A;  1NHS A;  1GV4 A;  1KNR A;  4AP1 A;  5J60 A;  1ZMD A;  2PYX A;  1NHR A;  1L0V A;  2FJB A;  3SX6 A;  3SY4 A;  1JRY A;  2X8H A;  1FOH A;  3UKF A;  3AEC A;  1CC4 A;  2X50 A;  4B69 A;  3V76 A;  5JCL A;  2B9W A;  1GRB A;  1BGN A;  2TPR A;  3OZ2 A;  4U2S A;  3UOV A;  4ZN0 A;  5KMS A;  4C5O A;  4CY8 A;  3FPZ A;  4YSY A;  4YTP A;  1D4E A;  3NK0 X;  3CN8 A;  3NYE A;  4H4Y A;  3V3N A;  2XFO A;  1D5T A;  3DME A;  4U2T A;  1L9D A;  1H82 A;  1XAN A;  4CRT A;  2GF3 A;  3AE2 A;  1M6I A;  3T31 A;  5KMR A;  2BC1 A;  2JB2 A;  3CNS A;  3AE6 A;  3CGE A;  4NEW A;  3VRA A;  3NT6 A;  1Q1R A;  1TDK A;  4U8M A;  5KXJ A;  3H8I A;  3KPF A;  2DKI A;  2XLR A;  3DK4 A;  1CJC A;  1GPE A;  2J3N A;  4K7Z A;  5KOW A;  2C73 A;  3DH9 A;  1COY A;  3URH A;  2FBW A;  3CGB A;  2WDR A;  3NIX A;  5U25 A;  4KX6 A;  4BJY A;  1YQZ A;  2BYB A;  3UOZ A;  5L46 A;  1CF3 A;  2XFQ A;  3NH3 X;  4H4P A;  1PDH A;  2GEW A;  3LZX A;  4J33 A;  3AEF A;  1EL7 A;  1F3P A;  4APN A;  2R4E A;  1GSN A;  1ZY8 A;  2E1M A;  2XLP A;  2DKH A;  2Y6Q A;  4YTM A; 
#chains in the Genus database with same CATH homology
 2BA9 A;  1CJ2 A;  2GR3 A;  3VRB A;  2V5Z A;  3QJ4 A;  4DGK A;  5CQF A;  3AD9 B;  4YKF A;  4H4V A;  3ATR A;  2ZBW A;  2OLN A;  1FL2 A;  2XVF A;  3SFD A;  4B66 A;  3BHF A;  3ICR A;  1CC6 A;  1Y0P A;  3GRT A;  3P9U A;  3CND A;  1E1K A;  3FG2 P;  2WOV A;  2C67 A;  2Y6R A;  3G5Q A;  3L1R A;  4GAP A;  2VVL G;  2GQF A;  1XHC A;  3RP7 A;  1JOA A;  2X8C A;  1F8S A;  2XDO A;  3NYC A;  1DOD A;  2RGO A;  3LB8 A;  2I0Z A;  3M13 A;  3UKH A;  3SYI A;  4AT0 A;  2ZZ0 A;  1JNZ A;  1GEU A;  3BI4 A;  1GRF A;  5FS7 A;  3Q9T A;  3AYI A;  1FEA A;  1BF3 A;  2EQ8 A;  2Q0K A;  3D8X A;  2BXS A;  1NEN A;  3UP4 A;  2XVI A;  4NEV A;  1KSS A;  3SXI A;  5HXI A;  1H84 A;  1D4D A;  2AQJ A;  2B7R A;  2YM1 A;  3AE1 A;  1K0J A;  4BK3 A;  4JN9 A;  3VRD B;  1FEC A;  1E1M A;  2EQ9 A;  3CPJ G;  3EAO A;  5KMP A;  2XYO A;  4AOX A;  3EF6 A;  4FDC B;  1PBE A;  4OPC A;  2YLT A;  1MXT A;  2JB1 A;  4O5U A;  4OPT A;  3HZL A;  4NTC A;  3CNJ A;  1GER A;  1V59 A;  2CDU A;  2YLX A;  1TYT A;  3BNU A;  3JSK A;  4OPI A;  1F6M A;  3GYJ A;  5KNL A;  2CVJ A;  3DGZ A;  3ALJ A;  4UDP A;  2XFU A;  2BS2 A;  1KDG A;  2XVH A;  2YG6 A;  1IUX A;  4A7A A;  4H2N A;  3NN0 X;  2XLS A;  4BK2 A;  1DOE A;  3P1W A;  4EMJ A;  3AEB A;  2YR6 A;  4OVI A;  3UOY A;  3GYI A;  2YLR A;  4ZCD A;  4BV6 A;  5IQ1 A;  3LOV A;  2JK6 A;  3GDN A;  2GAH B;  5CKU A;  4DSH A;  3H8L A;  1PXA A;  3S5W A;  1LQU A;  4NTE A;  1N1P A;  3NLC A;  4E0V A;  2BS3 A;  1GOS A;  1D7Y A;  4EMI A;  1H86 A;  1K0L A;  3QVP A;  5KOX A;  5U63 A;  2CUL A;  3FMW A;  4Z2U A;  4OPG A;  5BUK A;  3EAN A;  3GSI A;  2YM2 A;  4H4Z A;  1N4U A;  4GRT A;  2R0G A;  1XDI A;  2WPE A;  1E1L A;  4J31 A;  4EMW A;  1B37 A;  2VVL A;  1RYI A;  1BZL A;  2B76 A;  5GSN A;  3DK9 A;  4CCR A;  2B9Y A;  3HYV A;  4GDE A;  4A65 A;  4Z43 A;  4OCG A;  1F8W A;  1S3E A;  2A87 A;  2C64 A;  3AXB A;  1LVL A;  2GRT A;  2GR2 A;  4GUV A;  4IA6 A;  4JY3 A;  2OLO A;  2QAE A;  3AD8 B;  1VQW A;  2B7S A;  2WU2 A;  2YVG A;  3QSS A;  1LQT A;  4H4X A;  2ACZ A;  4EQX A;  1PJ7 A;  3FBS A;  3SZ0 A;  1TRB A;  3K30 A;  4OPL A;  4PAA A;  3NN6 X;  4H50 A;  4U8O A;  1CJ4 A;  2VZ2 A;  1PBD A;  3DJE A;  2BAB A;  3I3L A;  3QVR A;  4U8K A;  1DOC A;  1K4Q A;  2GQW A;  3CNT A;  5EBK A;  1CHU A;  3SM8 A;  3GD4 A;  5C3J A;  1E6E A;  5FS8 A;  3LXD A;  4TLX A;  3AEG A;  4JNA A;  4A79 A;  4P9S A;  2GAG B;  1LPF A;  2C66 A;  3AED A;  1E1N A;  2VQ7 A;  3UKL A;  3H4K A;  3LJP A;  4CY6 A;  1DOB A;  3GWD A;  2GH5 A;  4K8D A;  1GT8 A;  2XFN A;  2E5V A;  4YSX A;  1PJ6 A;  3C4N A;  3ALM A;  3EPT A;  3GRS A;  3P4S A;  4H7U A;  4BUR A;  4H4T A;  3ABV A;  3T2Y A;  3UTF A;  3NK1 X;  2WBA A;  5IPY A;  3AEE A;  1REO A;  1ZP0 A;  2WOI A;  2VOU A;  1AOG A;  4U8N A;  2VVM A;  3R9U A;  3UKP A;  1JRX A;  2YAU A;  4MJW A;  1DXL A;  2NPX A;  1GTE A;  3VQR A;  2YG5 A;  4GF7 A;  2WQY A;  3CTY A;  1GET A;  4U2L A;  4LU6 A;  4X9N A;  1VRQ B;  4FK1 C;  3K7M X;  4J34 A;  5BVA A;  3CGC A;  1P2H A;  4C3Y A;  2E4G A;  2YLW A;  4GDP A;  4B68 A;  2FJD A;  1E39 A;  3KPK A;  2WP5 A;  3G5R A;  4B64 A;  4JY2 A;  3AEA A;  3OC4 A;  4HA6 A;  4NWZ A;  1IUW A;  3P4Q A;  2UZZ A;  3GMC A;  1ZKQ A;  4H4U A;  1SEZ A;  2HQM A;  3BI2 A;  4Y4M A;  1CJ3 A;  4B1B A;  4C77 A;  4AP3 A;  2WES A;  2YWL A;  1PBC A;  3D1C A;  3NTA A;  4Z24 A;  3GD3 A;  2JB3 A;  2AAQ A;  4Z2R A;  1KSU A;  1NDA A;  2WS3 A;  3B3R A;  2H88 A;  4IVO B;  4LII A;  1EL5 A;  1S3B A;  1DJN A;  3AE5 A;  3ICS A;  4AT2 A;  5BUL A;  1ZOV A;  1L9E A;  1NAA A;  2A89 A;  1Q9I A;  2B9X A;  2WEU A;  1B5Q A;  3E1T A;  1OJC A;  4NZH A;  3NK2 X;  2R45 A;  4IA5 A;  1GRH A;  2APG A;  3CIR A;  3UTG A;  4A99 A;  2GVC A;  4YT0 A;  1KNP A;  1VDC A;  3NGC X;  3NTD A;  4PAB A;  3T14 A;  4LA1 A;  2XLU A;  3I6D A;  3BHK A;  4I59 A;  1HYU A;  4GAV A;  4O5Q A;  1OJD A;  2X8G A;  3HYW A;  2IVD A;  5KRQ A;  3UKQ A;  1IUU A;  1LTX R;  3IHG A;  5FS6 A;  5DBJ A;  3NKS A;  5KVI A;  2FJA A;  3DA1 A;  3FIM B;  4JDR A;  4X4J A;  1BKW A;  1YQ3 A;  2YG4 A;  2WPF A;  3KLJ A;  1X31 B;  1NHQ A;  2C70 A;  5EB4 A;  1B8S A;  1FEB A;  1M64 A;  1OJA A;  1E7P A;  1NG3 A;  4TM3 A;  2GR1 A;  4XXG A;  4CNK A;  2YQU A;  3KKJ A;  4G73 A;  1ZK7 A;  3NHO X;  2GMH A;  4A5L A;  1GRG A;  3F8P A;  2IID A;  3RP6 A;  2C65 A;  1TDN A;  2W0H A;  3AB1 A;  3C96 A;  1GRA A;  2IVE A;  3IWA A;  3K7Q X;  3UP5 A;  2BXR A;  4RG3 A;  4N9X A;  4NNJ A;  4EM4 A;  3RNM A;  2QA1 A;  4BJZ A;  1JU2 A;  1O94 A;  2X99 A;  2YR4 A;  3S61 A;  4CBQ A;  3PS9 A;  3AYJ A;  3VR9 A;  4UP3 A;  1Q1W A;  1GXF A;  1IUS A;  1GRE A;  1YKJ A;  4M52 A;  2TMD A;  4B63 A;  3GYX A;  3LAD A;  4B65 A;  4FX9 A;  2EQ6 A;  5HY5 A;  1O5W A;  1GTH A;  3B6D A;  1BGJ A;  1PN0 A;  1QO8 A;  2XVE A;  1IUT A;  1RSG A;  4CCQ A;  5FMH A;  1ZMC A;  4D04 A;  1XPQ A;  2OAL A;  2QCU A;  4ICY A;  2BRY A;  3T2K A;  5JCN A;  1H6V A;  3AE7 A;  3SGL A;  3L8K A;  2R0P A;  3WE0 A;  4ECH A;  4K22 A;  5KMQ A;  1IJH A;  2ARD A;  3P4R A;  4RG4 A;  3AWI A;  1MO9 A;  3PO7 A;  4U8L A;  4YXD A;  5KWF A;  1NEK A;  3BNM A;  5GRT A;  2VRM A;  4JQ9 A;  2FJE A;  1TYP A;  1EL8 A;  2V6O A;  2GB0 A;  4TM1 A;  2C3C A;  5JCI A;  4OPD A;  1JRZ A;  2JAE A;  3F8R A;  1GES A;  3CMM A;  4EIP A;  5J7X A;  3ZYX A;  2RAB A;  2PHH A;  1JEH A;  1PBF A;  3SZC A;  4DSG A;  1GAL A;  2BK5 A;  1S2Q A;  3DK8 A;  2VRL A;  3NG7 X;  2X3N A;  1DJQ A;  2V3B A;  2R46 A;  3CNP A;  1PXB A;  3NNE A;  2WP6 A;  3V3O A;  4JNQ A;  4YTN A;  4II2 A;  1LJ1 A;  4H2R A;  1TDE A;  1CBO A;  3CGD A;  4U8P A;  5HHF A;  3SFE A;  4IV9 A;  3DJJ A;  5LV9 A;  1H7W A;  4NTD A;  3RED A;  1KF6 A;  4D03 A;  4USQ A;  5HYM A;  4J56 A;  2H89 A;  2GMJ A;  1P2E A;  1N4W A;  1Z6L A;  3SZF A;  4BK1 A;  1KFY A;  2WOW A;  3IHM A;  1ZDL A;  3P4P A;  4FK1 A;  1GRT A;  3M0O A;  4J2W A;  2R9Z A;  5M0Z A;  3UCL A;  3AE9 A;  3M12 A;  4H4R A;  2YG7 A;  4TLZ A;  4YWO A;  3ISH A;  2XFP A;  3UOX A;  5BRT A;  4UDQ A;  5FS9 A;  4C3X A;  4YSZ A;  3DJG X;  1VG9 A;  4EIQ A;  4OPU A;  1QLB A;  2QA2 A;  3VR8 A;  2BK4 A;  3QFA A;  3AYL A;  3DGH A;  1B4V A;  2RGH A;  3SQP A;  2OA1 A;  4U8I A;  4WX1 A;  1OJT A;  4H4W A;  1D7L A;  2YVJ A;  3II4 A;  2BAC A;  2C75 A;  2O9Z A;  3IF9 A;  4B67 A;  2Q6U A;  1NG4 A;  4J36 A;  3G5S A;  2GR0 A;  1K0I A;  4Y4N A;  4H2Q A;  4G9K A;  1F8R A;  1CC2 A;  2Z5X A;  2Z5Y A;  2C72 A;  4ADW A;  4YKG A;  4GR1 A;  1ZOY A;  1UKV G;  2F5Z A;  1YY5 A;  1ZX9 A;  3QFB A;  3C4A A;  1PHH A;  3KD9 A;  4K5R A;  3UTE A;  4Y4L A;  1QJD A;  1PJ5 A;  2WHD A;  1CL0 A;  4H4S A;  2JKC A;  2YR5 A;  1H7X A;  3ALL A;  1N4V A;  3NYF A;  2WET A;  4I58 A;  2XLT A;  1DNC A;  2A8X A;  2WU5 A;  2YVF A;  1ONF A;  3AE8 A;  2BCP A;  3KA7 A;  2XCG A;  3O0H A;  4H2P A;  3RP8 A;  2CFY A;  3HYX A;  5TR3 A;  3KU9 A;  2BK3 A;  4YSH A;  2OAM A;  4H4Q A;  4Z26 A;  3ADA B;  1NHP A;  3CPH G;  1JNR A;  4AOS A;  1S2Y A;  2Q7V A;  3CPI G;  4G6H A;  3QSM A;  2Q0L A;  2VQB A;  4K5S A;  4ZCC A;  5C2T A;  2R4J A;  2BRA A;  2YG3 A;  3T0K A;  5KVH A;  3F8D A;  3Q6J A;  1EBD A;  3NRN A;  2WDV A;  4XWR A;  3T2Z A;  3SZW A;  3LZW A;  2BCG G;  2GV8 A;  2RGJ A;  1Y56 A;  1ELI A;  1PBB A;  4EM3 A;  3BI5 A;  5JCM A;  1Y56 B;  4RSL A;  1GND A;  1FCD A;  2BS4 A;  1TDF A;  5IQ4 A;  3UKK A;  2V60 A;  4TM0 A;  2WDQ A;  3COX A;  3QSE A;  1PS9 A;  1W4X A;  4UDR A;  1LV0 A;  5M10 A;  1L9C A;  5ER0 A;  3UKA A;  3ICT A;  1MOK A;  1O95 A;  1OJ9 A;  3DJD A;  1YQ4 A;  1NPX A;  4G6G A;  4DNA A;  1H83 A;  3AE3 A;  2EQ7 A;  2WPC A;  3AE4 A;  2C4C A;  4TM4 A;  2NVK X;  3IC9 A;  4X9M A;  2AR8 A;  3ATQ A;  4REK A;  3RHA A;  1EL9 A;  2V61 A;  2WP9 A;  2ZZC A;  5EOW A;  4EQW A;  3GWF A;  4HB9 A;  5EB5 A;  4USR A;  2YLS A;  4Z25 A;  3ZDN A;  3ITJ A;  4XWZ A;  4U8J A;  2C7G A;  4Z44 A;  1RP0 A;  4IVM B;  3UTH A;  5JCK A;  4K2X A;  4G74 A;  5U1O A;  1TDO A;  2YLZ A;  2C76 A;  3GMB A;  4CNJ A;  2V3A A;  1BWC A;  2XVJ A;  2ZZB A;  4EQS A;  2BC0 A;  3KVE A;  4GCM A;  2JBV A;  4Z2T A;  4II3 A;  3PVC A;  4C74 A;  2C3D A;  1PXC A;  1VG0 A;  3AD7 B;  1H81 A;  4KPR A;  3K7T A;  4WCT A;  3T37 A;  4A6N A;  3GDP A;  4J57 A;  1D4C A;  4EQR A;  1IUV A;  2R0C A;  4A6N B;  4A9W A;  1NHS A;  1GV4 A;  1KNR A;  4AP1 A;  5J60 A;  1ZMD A;  2PYX A;  1NHR A;  1L0V A;  2FJB A;  3SX6 A;  3SY4 A;  1JRY A;  2X8H A;  1FOH A;  3UKF A;  3AEC A;  1CC4 A;  2X50 A;  4B69 A;  3V76 A;  5JCL A;  2B9W A;  1GRB A;  1BGN A;  2TPR A;  3OZ2 A;  4U2S A;  3UOV A;  4ZN0 A;  5KMS A;  4C5O A;  4CY8 A;  3FPZ A;  4YSY A;  4YTP A;  1D4E A;  3NK0 X;  3CN8 A;  3NYE A;  4H4Y A;  3V3N A;  2XFO A;  1D5T A;  3DME A;  4U2T A;  1L9D A;  1H82 A;  1XAN A;  4CRT A;  2GF3 A;  3AE2 A;  1M6I A;  3T31 A;  5KMR A;  2BC1 A;  2JB2 A;  3CNS A;  3AE6 A;  3CGE A;  4NEW A;  3VRA A;  3NT6 A;  1Q1R A;  1TDK A;  4U8M A;  5KXJ A;  3H8I A;  3KPF A;  2DKI A;  2XLR A;  3DK4 A;  1CJC A;  1GPE A;  2J3N A;  4K7Z A;  5KOW A;  2C73 A;  3DH9 A;  1COY A;  3URH A;  2FBW A;  3CGB A;  2WDR A;  3NIX A;  5U25 A;  4KX6 A;  4BJY A;  1YQZ A;  2BYB A;  3UOZ A;  5L46 A;  1CF3 A;  2XFQ A;  3NH3 X;  4H4P A;  1PDH A;  2GEW A;  3LZX A;  4J33 A;  3AEF A;  1EL7 A;  1F3P A;  4APN A;  2R4E A;  1GSN A;  1ZY8 A;  2E1M A;  2XLP A;  2DKH A;  2Y6Q A;  4YTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...