3UOXA

Crystal structure of otemo (fad bound form 2)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
540
structure length
537
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSAPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Oxidoreductase
total genus 194
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uoxA01
3AE3A 1XPQA 1IJHA 2GB0A 3WE0A 4UDPA 3CNPA 4A65A 2OAMA 2RGJA 3CGEA 3NN6X 4Y4LA 1PBBA 1B5QA 4YTPA 1ZY8A 3I6DA 2JAEA 3FMWA 3CN8A 4CCRA 5GSNA 5U63A 2V6OA 1O5WA 3CNJA 4P9SA 1IUUA 1E7PA 4B66A 5CKUA 2YVGA 5GRTA 4U8OA 2OLNA 3NNEA 4AP3A 2YM1A 1N1PA 2WOIA 3P4SA 3AE7A 4TLZA 5IQ4A 2VRMA 4K8DA 3CPHG 1W4XA 1OJ9A 4IA6A 4I59A 1PHHA 3DK9A 3CIRA 4WCTA 1PN0A 1L0VA 3PVCA 2YLWA 3NHOX 1CJ4A 1KFYA 3VR8A 3LB8A 3B6DA 3AD8B 4ICYA 4N9XA 3IHMA 2WQYA 2BCGG 2EQ6A 1B4VA 1LQUA 1LQTA 3FPZA 3GD3A 3F8PA 3ZYXA 4X4JA 2RGHA 4YKFA 3NTAA 2GMHA 3G5QA 4AOSA 4EQWA 2W0HA 2GF3A 3D1CA 2UZZA 1CJ3A 3BI2A 2IVDA 4GCMA 4B68A 4APNA 4H4PA 2Q0LA 1TDEA 3G5RA 2WBAA 3BI5A 3DJGX 2X8GA 4U8PA 3UKHA 5M10A 1FCDA 3AEFA 1D4CA 3AE6A 1OJCA 5KVHA 5KRQA 3UCLA 2GQFA 2OA1A 4DNAA 3NTDA 4EMJA 3BI4A 5LV9A 1Q1WA 1S2YA 2A8XA 3ABVA 1OJDA 2V3BA 5IQ1A 4U8MA 1GREA 5EOWA 4EQXA 2AAQA 1LPFA 2X3NA 3AECA 4RG4A 4TM1A 3LZXA 3M12A 4U2LA 3V76A 2JB2A 4K7ZA 4DSHA 1CJCA 1NHQA 4BURA 3UOXA 1K0JA 2BC0A 3NG7X 1H7XA 5BUKA 3GWFA 2C76A 1CL0A 3C96A 4Z2RA 1V59A 1JRXA 4OVIA 4I58A 1MO9A 3GDNA 2XFUA 4NEWA 1YQZA 2R0GA 3GMCA 3P9UA 2H89A 3UTFA 3AEEA 1BZLA 2HQMA 4KX6A 2R0PA 1H86A 2XVIA 2I0ZA 1DNCA 4A6NA 1Q9IA 2BS2A 1BF3A 3LXDA 4GDPA 3GRTA 1NHRA 1N4WA 2BXRA 3VR9A 3RP8A 2A87A 1JU2A 2R0CA 2Y6RA 4AT2A 2BS4A 2R4EA 1GTEA 3NT6A 2DKHA 2YLXA 2GR1A 3UP5A 2VZ2A 1PJ6A 2GR2A 2YM2A 1ZDLA 1KDGA 2YAUA 2Z5YA 3NYCA 2XVEA 4IA5A 3DJEA 4OPUA 4RG3A 4B64A 3AXBA 1XDIA 4B69A 3UKPA 4IVMB 1F6MA 1GV4A 2BXSA 2WPEA 1Y56B 3GRSA 4EQRA 4YSHA 2R4JA 3BNUA 1KSSA 3Q9TA 4J34A 2WDQA 4M52A 4EMIA 3AD7B 2RGOA 3P4QA 2EQ7A 3VRAA 1YQ4A 3NIXA 2VRLA 4Z25A 1QO8A 1EL5A 4OPIA 2WETA 3AE9A 5BVAA 4CY8A 4XWRA 3QJ4A 3RP6A 3QVRA 1JRZA 3EANA 1GOSA 1NAAA 3GDPA 1TYPA 3QFBA 2QA2A 4J36A 5HHFA 3NGCX 3DMEA 2V60A 4K5SA 3UOVA 2YLTA 1H6VA 3PO7A 2VVLG 1GPEA 4JY3A 1CC4A 1DODA 4USRA 1K0LA 1E6EA 4J56A 3H8IA 2R46A 2V3AA 2WEUA 1BGJA 2YR6A 1IUXA 3HZLA 4FK1C 1H83A 3DH9A 4B67A 1F8SA 2YG7A 4OCGA 2BK3A 2WOVA 2XLPA 2VQBA 2EQ8A 2ZBWA 2YLRA 1CBOA 4UP3A 1E1NA 1PS9A 2GH5A 1MOKA 4NTDA 2VVMA 2XLTA 1VG0A 4GUVA 3V3OA 1FECA 5FS6A 3KVEA 1BKWA 1HYUA 4Z44A 3SFEA 3DK4A 4O5UA 3COXA 3I3LA 2XLSA 1GRHA 4FX9A 5C2TA 1LJ1A 3AE2A 5JCKA 2XCGA 4YSYA 2YG3A 5FS9A 2B7RA 4NTCA 5U1OA 1RSGA 1ZMDA 1ZK7A 2TMDA 3IHGA 3JSKA 2WOWA 2XVJA 3LADA 4IV9A 1OJTA 4YTMA 3CTYA 4YWOA 1MXTA 1D7LA 4H4TA 5KXJA 3RNMA 4UDQA 3AE5A 3GWDA 5HYMA 4EIPA 2GR0A 2JBVA 3L8KA 2OLOA 4H4YA 4U2TA 2J3NA 1IUVA 5L46A 4J33A 3FIMB 2WDRA 1Y56A 1PDHA 4X9NA 3SM8A 2BABA 2E4GA 3BHKA 1D5TA 1FL2A 1JOAA 1NEKA 4B65A 3NKSA 3BNMA 5JCLA 3ALJA 4UDRA 4Y4MA 3IF9A 2XDOA 4BK3A 3AD9B 4J31A 4JN9A 3AYLA 3IWAA 4HB9A 4YTNA 1P2EA 2C3DA 2XFNA 4Y4NA 1GXFA 4LIIA 2X99A 3AEBA 4KPRA 4TM3A 3DGZA 5FS7A 3UTEA 4JY2A 2PYXA 2C72A 2ACZA 4E0VA 4C74A 4IVOB 4K2XA 2GQWA 4B63A 3S5WA 2QCUA 1TDKA 3QFAA 1O95A 1ONFA 3CGBA 4C77A 2C66A 3ISHA 2GR3A 3KD9A 2FJEA 4JNAA 3DA1A 2O9ZA 2WP5A 3V3NA 1H82A 3AEGA 3URHA 4GDEA 4TM4A 1GT8A 1RYIA 3NH3X 1YY5A 4BJYA 4AOXA 2V61A 1TRBA 3NN0X 1PBEA 2WU2A 1GETA 3P4RA 4GRTA 3ALMA 4DSGA 4U8KA 4AP1A 2XVFA 3AE8A 2Z5XA 4Z24A 3KLJA 1D4DA 4PAAA 4U8JA 3GMBA 4YSZA 4ZCDA 2CVJA 1NPXA 1ZOVA 1DOCA 2GRTA 2WDVA 2YQUA 4YXDA 4A79A 4JQ9A 2X50A 1LVLA 2BC1A 4ADWA 1PXCA 2Q0KA 3CGCA 1Q1RA 1NHSA 2QAEA 3G5SA 1NG3A 1EL8A 2C67A 2AQJA 4OPTA 1VDCA 1M64A 2WPFA 4OPDA 2E1MA 4GF7A 4YKGA 2WS3A 1PJ7A 1PXBA 1ZOYA 3EAOA 1RP0A 2EQ9A 2XLRA 3L1RA 5BRTA 1GRBA 1JNRA 1P2HA 1ELIA 3NYFA 1GRAA 3P4PA 1N4VA 2WP9A 1M6IA 1DJQA 3F8DA 5ER0A 1GRGA 4H50A 5J7XA 2A89A 2JKCA 3O0HA 1JRYA 3AWIA 2BS3A 1EL7A 1K4QA 2Q6UA 1CJ2A 4CNKA 4H2NA 4MJWA 5C3JA 2FJAA 1DJNA 2BK4A 4ECHA 3UKFA 1S3EA 3FBSA 3UTGA 3DGHA 3AYJA 4U8IA 3AEAA 4H7UA 2C3CA 3R9UA 3CNDA 4A9WA 3OC4A 2XLUA 2YG4A 1YKJA 3ZDNA 2JB3A 1CC2A 2B7SA 2VQ7A 4EM4A 3DK8A 4OPGA 4LU6A 1QLBA 3QSMA 4H4VA 4H4SA 3LJPA 1D4EA 4D03A 4H2PA 1B37A 2JK6A 4EMWA 2ZZBA 2FJBA 4NEVA 1VG9A 2RABA 2XVHA 4CNJA 2NPXA 2F5ZA 2OALA 4X9MA 2YG6A 3DJJA 3M13A 5M0ZA 5HY5A 4H4XA 2DKIA 3K7QX 2Q7VA 4H2QA 2ZZ0A 4H4WA 4JNQA 4BK2A 4H4ZA 5JCNA 4ZN0A 3S61A 4CY6A 3REDA 4A7AA 5KOXA 2QA1A 2X8HA 4U8NA 2B9WA 2XFPA 1Z6LA 1LTXR 4J2WA 5FMHA 3VRDB 1NDAA 4K22A 1CC6A 3KU9A 3NK0X 3ATQA 5DBJA 1YQ3A 3EPTA 4BK1A 3LOVA 5HXIA 1TDOA 3C4AA 1CF3A 3GYJA 2WU5A 3VRBA 4A99A 4H4UA 3AEDA 3RHAA 4EM3A 2C73A 4HA6A 4REKA 4TLXA 3PS9A 1JNZA 2B9YA 3Q6JA 2FJDA 1EBDA 3QSSA 1N4UA 1BWCA 1F3PA 2H88A 4Z43A 4A6NB 2C64A 2B76A 4BV6A 3FG2P 3UKQA 2XFOA 1VQWA 5KVIA 1GRFA 1H84A 4FDCB 3E1TA 2XFQA 2YR4A 1SEZA 2PHHA 3EF6A 1ZX9A 1S3BA 2R45A 1FEBA 3NK2X 3C4NA 3GD4A 4XWZA 1E1MA 1GESA 2C65A 3AE1A 4H4QA 1NG4A 1KSUA 4XXGA 2C7GA 1GRTA 1JEHA 5BULA 3H8LA 1KNPA 3F8RA 4H4RA 1FOHA 1O94A 1PBFA 1E1LA 4Z2TA 3SGLA 2BYBA 1IUTA 4NZHA 2VOUA 4C5OA 2YLZA 1GEUA 3AB1A 5U25A 1NENA 3II4A 2AR8A 1Y0PA 1VRQB 1LV0A 1OJAA 4U2SA 2CFYA 4C3XA 5KWFA 1FEAA 1TDFA 2BK5A 1H7WA 2GMJA 2GAGB 1GALA 2IVEA 3K7MX 3K30A 4J57A 2BACA 2YR5A 4O5QA 2C75A 1REOA 1GTHA 1L9CA 2V5ZA 1D7YA 5IPYA 5EB5A 2E5VA 1X31B 3QSEA 1E1KA 4K5RA 3KA7A 1DXLA 3BHFA 3H4KA 2CDUA 1GERA 4OPCA 1IUSA 1QJDA 3NK1X 4USQA 2WP6A 4ZCCA 3SFDA 1ZP0A 1IUWA 4NTEA 3UKLA 4U8LA 3NRNA 3GSIA 1S2QA 2TPRA 3ALLA 2GEWA 5JCIA 2YVJA 3GYIA 4EQSA 3QVPA 4YT0A 2YVFA 1ZKQA 2R9ZA 4PABA 1BGNA 3OZ2A 1H81A 1PBCA 2NVKX 3UTHA 3M0OA 1L9DA 4C3YA 2GVCA 3NYEA 3B3RA 4WX1A 1XANA 1TDNA 4DGKA 3AE4A 4B1BA 1ZMCA 4JDRA 1DOEA 4RSLA 5J60A 1DOBA 3VQRA 4GR1A 1GSNA 3ITJA 1CHUA 1NHPA 3LZWA 3CPJG 4FK1A 4YSXA 1AOGA 4CRTA 4LA1A 2XYOA 3DJDA 2ZZCA 4A5LA 4CCQA 1KF6A 3D8XA 5CQFA 3IC9A 1PBDA 4H2RA 1PJ5A 1EL9A 2APGA 2YLSA 3CPIG 3ICRA 2BCPA 4BJZA 3ICSA 3NLCA 4Z26A 4TM0A 3P1WA 1L9EA 3K7TA 2WPCA 3KKJA 3UKKA 1F8RA 2WESA 2GAHB 2VVLA 3ATRA 3ICTA 5TR3A 4Z2UA 1B8SA 2BA9A 2B9XA 3CGDA 2FBWA 3RP7A 4CBQA 1UKVG 3UOZA 2YWLA 5EBKA 3KPFA 1KNRA 1PXAA 1XHCA 3ADAB 3UKAA 1K0IA 2CULA 3AYIA 1TYTA 2GV8A 2IIDA 2C70A 4OPLA 2JB1A 3T37A 3CNTA 2WHDA 5KOWA 5FS8A 4D04A 2Y6QA 5EB4A 3CNSA 4AT0A 1GNDA 1COYA 2YG5A 1E39A 1F8WA 4EIQA 2X8CA 3UOYA 3SQPA 5JCMA 2ARDA 3UP4A
chains in the Genus database with same CATH superfamily
3AE3A 1XPQA 1IJHA 2GB0A 3WE0A 4UDPA 3CNPA 4A65A 2OAMA 2RGJA 3CGEA 3NN6X 4Y4LA 1PBBA 1B5QA 4YTPA 1ZY8A 3I6DA 2JAEA 3FMWA 3CN8A 4CCRA 5GSNA 5U63A 2V6OA 1O5WA 3CNJA 4P9SA 1IUUA 1E7PA 4B66A 5CKUA 2YVGA 5GRTA 4U8OA 2OLNA 3NNEA 5KMQA 4AP3A 2YM1A 1N1PA 2WOIA 3P4SA 3SZWA 3AE7A 4TLZA 5IQ4A 2VRMA 4K8DA 3CPHG 1W4XA 1OJ9A 4IA6A 4I59A 1PHHA 3DK9A 3CIRA 4WCTA 1PN0A 1L0VA 3PVCA 2YLWA 3NHOX 1CJ4A 1KFYA 3VR8A 3LB8A 3B6DA 3AD8B 4ICYA 4N9XA 3IHMA 2WQYA 2BCGG 2EQ6A 1B4VA 1LQUA 1LQTA 3FPZA 3GYXA 3GD3A 3F8PA 3ZYXA 3HYVA 2RGHA 4X4JA 4YKFA 3NTAA 2GMHA 3G5QA 3T2KA 4AOSA 4EQWA 2W0HA 2GF3A 3D1CA 2UZZA 1CJ3A 3BI2A 2IVDA 4GCMA 4B68A 4APNA 4H4PA 2Q0LA 1TDEA 3G5RA 2WBAA 3BI5A 3DJGX 2X8GA 4U8PA 3UKHA 5M10A 1FCDA 3AEFA 1D4CA 3AE6A 1OJCA 5KMSA 5KVHA 5KRQA 3UCLA 2GQFA 2OA1A 4DNAA 3NTDA 4EMJA 3BI4A 5LV9A 1Q1WA 1S2YA 2A8XA 3ABVA 1OJDA 2V3BA 5IQ1A 4U8MA 1GREA 5EOWA 4EQXA 2AAQA 1LPFA 2X3NA 3AECA 4RG4A 4TM1A 3LZXA 3M12A 4U2LA 3V76A 3T2YA 2JB2A 4K7ZA 4DSHA 3SY4A 1CJCA 1NHQA 4BURA 3UOXA 1K0JA 2BC0A 3NG7X 1H7XA 5BUKA 3GWFA 4GAPA 2C76A 1CL0A 3C96A 4Z2RA 1V59A 1JRXA 4OVIA 4I58A 1MO9A 3GDNA 2XFUA 4NEWA 1YQZA 2R0GA 3GMCA 3P9UA 2H89A 3UTFA 3AEEA 4G6HA 1BZLA 2HQMA 4KX6A 2R0PA 1H86A 2XVIA 2I0ZA 1DNCA 4A6NA 1Q9IA 2BS2A 1BF3A 3LXDA 4GDPA 3GRTA 1NHRA 1N4WA 2BXRA 3VR9A 3RP8A 2A87A 1JU2A 2R0CA 2Y6RA 4AT2A 2BS4A 2R4EA 1GTEA 3NT6A 2DKHA 2YLXA 2GR1A 3UP5A 2VZ2A 1PJ6A 2GR2A 2YM2A 1ZDLA 1KDGA 2YAUA 2Z5YA 3NYCA 2XVEA 4IA5A 3DJEA 4OPUA 4RG3A 4B64A 3AXBA 1XDIA 4B69A 3UKPA 4IVMB 1F6MA 1GV4A 2BXSA 2WPEA 1Y56B 3GRSA 4EQRA 4YSHA 2R4JA 3BNUA 1KSSA 3Q9TA 4J34A 2WDQA 4M52A 4EMIA 3AD7B 2RGOA 4II2A 3P4QA 2EQ7A 3VRAA 1YQ4A 3NIXA 2VRLA 4Z25A 1QO8A 1EL5A 4OPIA 2WETA 3AE9A 5BVAA 4CY8A 3T31A 4XWRA 3QJ4A 3RP6A 3QVRA 1JRZA 3EANA 1GOSA 1NAAA 3GDPA 1TYPA 3QFBA 2QA2A 4J36A 5HHFA 3SZCA 3NGCX 3DMEA 2V60A 4K5SA 3UOVA 4NWZA 2YLTA 1H6VA 3PO7A 2VVLG 1GPEA 4JY3A 1CC4A 1DODA 4USRA 1K0LA 1E6EA 4J56A 2C4CA 3H8IA 2R46A 2V3AA 2WEUA 1BGJA 2YR6A 1IUXA 3HZLA 4FK1C 1H83A 3DH9A 4B67A 1F8SA 2YG7A 4OCGA 2BK3A 2WOVA 2XLPA 2VQBA 2EQ8A 2ZBWA 2YLRA 1CBOA 4UP3A 1E1NA 1PS9A 2GH5A 1MOKA 4NTDA 2VVMA 2XLTA 3T14A 1VG0A 4GUVA 3V3OA 1FECA 5FS6A 3KVEA 1BKWA 1HYUA 4Z44A 3SFEA 4G73A 3DK4A 4O5UA 3COXA 3I3LA 2XLSA 1GRHA 4FX9A 5C2TA 1LJ1A 3AE2A 5JCKA 2XCGA 4YSYA 2YG3A 5FS9A 2B7RA 2BRAA 4NTCA 5U1OA 1RSGA 1ZMDA 1ZK7A 2TMDA 3IHGA 3JSKA 2WOWA 2XVJA 3LADA 4IV9A 1OJTA 4YTMA 3CTYA 4YWOA 1MXTA 1D7LA 4H4TA 5KMRA 5KXJA 3RNMA 4UDQA 3AE5A 3GWDA 5HYMA 4EIPA 2GR0A 2JBVA 3L8KA 2OLOA 4H4YA 4U2TA 2J3NA 1IUVA 5L46A 4J33A 3FIMB 2WDRA 1Y56A 1PDHA 4G9KA 4X9NA 3SM8A 2BABA 2E4GA 3BHKA 1D5TA 1FL2A 1JOAA 1NEKA 4B65A 3NKSA 3BNMA 5JCLA 3ALJA 4NNJA 4UDRA 4Y4MA 3IF9A 2XDOA 4BK3A 3AD9B 4J31A 4JN9A 3AYLA 3IWAA 4HB9A 4YTNA 1P2EA 2C3DA 2XFNA 4Y4NA 1GXFA 4LIIA 2X99A 3AEBA 4KPRA 4TM3A 3DGZA 5FS7A 3UTEA 4JY2A 2PYXA 2C72A 2ACZA 3SX6A 4E0VA 4C74A 4IVOB 4K2XA 2GQWA 4B63A 3S5WA 2QCUA 1TDKA 3QFAA 1O95A 1ONFA 3CGBA 3CMMA 2C66A 3ISHA 2GR3A 3KD9A 2FJEA 4JNAA 4C77A 3DA1A 2O9ZA 2WP5A 3V3NA 1H82A 3AEGA 3URHA 4GDEA 4TM4A 1GT8A 1RYIA 3NH3X 1YY5A 4BJYA 4AOXA 3SYIA 2V61A 1TRBA 3NN0X 1PBEA 2WU2A 1GETA 3P4RA 4GRTA 5KNLA 3ALMA 4DSGA 4U8KA 4AP1A 2XVFA 3AE8A 2Z5XA 4Z24A 3KLJA 1D4DA 4PAAA 4U8JA 3GMBA 4YSZA 4ZCDA 2CVJA 1NPXA 1ZOVA 1DOCA 2GRTA 2WDVA 2YQUA 4YXDA 4A79A 4JQ9A 2X50A 1LVLA 2BC1A 4ADWA 1PXCA 2Q0KA 3CGCA 1Q1RA 1NHSA 2QAEA 3G5SA 1NG3A 1EL8A 2C67A 2AQJA 4OPTA 1VDCA 1M64A 2WPFA 4OPDA 2E1MA 4GF7A 4YKGA 2WS3A 1PJ7A 1PXBA 4G74A 1ZOYA 3EAOA 1RP0A 2EQ9A 2XLRA 3L1RA 5BRTA 1GRBA 1JNRA 1P2HA 1ELIA 3NYFA 1GRAA 3P4PA 1N4VA 2WP9A 1M6IA 1DJQA 3F8DA 5ER0A 1GRGA 4H50A 5J7XA 2A89A 2JKCA 3O0HA 1JRYA 3AWIA 2BS3A 1EL7A 1K4QA 2Q6UA 1CJ2A 4CNKA 4H2NA 4MJWA 5C3JA 2FJAA 1DJNA 2BK4A 4ECHA 3UKFA 1S3EA 3FBSA 3UTGA 3DGHA 3AYJA 4U8IA 3T2ZA 3AEAA 4H7UA 2C3CA 3R9UA 3CNDA 4A9WA 3OC4A 2XLUA 2YG4A 1YKJA 3ZDNA 2JB3A 1CC2A 2B7SA 2VQ7A 4EM4A 3DK8A 4OPGA 4LU6A 1QLBA 3QSMA 4H4VA 4H4SA 3LJPA 1D4EA 4D03A 4H2PA 1B37A 3SXIA 2JK6A 4EMWA 2ZZBA 2FJBA 4NEVA 1VG9A 2RABA 2XVHA 4CNJA 2NPXA 2F5ZA 2OALA 4X9MA 2YG6A 3DJJA 3M13A 5M0ZA 5HY5A 4H4XA 2DKIA 3K7QX 2Q7VA 4H2QA 2ZZ0A 4H4WA 4JNQA 4BK2A 4H4ZA 5JCNA 4ZN0A 3S61A 4CY6A 3REDA 4A7AA 5KOXA 2QA1A 2X8HA 4U8NA 2B9WA 2XFPA 1Z6LA 1LTXR 4J2WA 5FMHA 3SZFA 1NDAA 4K22A 3VRDB 1CC6A 3KU9A 3NK0X 3ATQA 5DBJA 1YQ3A 3EPTA 4BK1A 3LOVA 5HXIA 1TDOA 3C4AA 1CF3A 3GYJA 2WU5A 3VRBA 4A99A 4H4UA 3AEDA 3RHAA 4EM3A 2C73A 4HA6A 4REKA 4TLXA 3PS9A 1JNZA 2B9YA 3Q6JA 2FJDA 1EBDA 3QSSA 1N4UA 1BWCA 1F3PA 2H88A 4Z43A 4A6NB 2C64A 2B76A 4BV6A 3HYXA 3FG2P 3UKQA 2XFOA 1VQWA 5KVIA 1GRFA 1H84A 4II3A 4FDCB 3E1TA 2XFQA 2YR4A 1SEZA 2PHHA 3EF6A 1ZX9A 1S3BA 2R45A 3KPKA 1FEBA 3NK2X 3C4NA 3GD4A 4XWZA 1E1MA 1GESA 2C65A 3AE1A 4H4QA 1NG4A 1KSUA 4XXGA 2C7GA 1GRTA 1JEHA 5BULA 3H8LA 1KNPA 3F8RA 4H4RA 1FOHA 1O94A 1PBFA 1E1LA 4Z2TA 3SGLA 2BYBA 1IUTA 4NZHA 2VOUA 3SZ0A 2YLZA 1GEUA 3AB1A 5U25A 4C5OA 1NENA 3II4A 2AR8A 1Y0PA 1VRQB 1LV0A 1OJAA 4U2SA 2CFYA 4C3XA 5KWFA 1FEAA 1TDFA 2BK5A 1H7WA 2GMJA 2GAGB 1GALA 2IVEA 3K7MX 3K30A 4J57A 2BACA 2YR5A 4O5QA 2C75A 1REOA 1GTHA 1L9CA 2V5ZA 1D7YA 3HYWA 5EB5A 2E5VA 5IPYA 1X31B 3QSEA 1E1KA 4K5RA 3KA7A 1DXLA 3BHFA 3H4KA 2CDUA 1GERA 4OPCA 1IUSA 1QJDA 3NK1X 4USQA 2WP6A 4ZCCA 3SFDA 1ZP0A 1IUWA 4NTEA 3UKLA 4U8LA 3NRNA 3GSIA 1S2QA 2TPRA 3ALLA 2GEWA 5JCIA 2YVJA 3GYIA 4EQSA 3QVPA 4YT0A 2YVFA 2BRYA 1ZKQA 2R9ZA 4PABA 1BGNA 3OZ2A 1H81A 1PBCA 2NVKX 3UTHA 3M0OA 1L9DA 4C3YA 2GVCA 3NYEA 3B3RA 4WX1A 1XANA 1TDNA 4DGKA 3AE4A 4B1BA 1ZMCA 4JDRA 1DOEA 4RSLA 5J60A 1DOBA 3VQRA 4GR1A 4G6GA 1GSNA 3ITJA 1CHUA 1NHPA 3LZWA 3CPJG 4FK1A 4YSXA 1AOGA 4CRTA 4LA1A 2XYOA 3DJDA 2ZZCA 4A5LA 4CCQA 1KF6A 3D8XA 5CQFA 3IC9A 1PBDA 4H2RA 1PJ5A 1EL9A 2APGA 2YLSA 3CPIG 3ICRA 2BCPA 4BJZA 3ICSA 3NLCA 4Z26A 4TM0A 3P1WA 1L9EA 3K7TA 2WPCA 3KKJA 3UKKA 1F8RA 2WESA 2GAHB 2VVLA 3ATRA 3ICTA 5TR3A 4Z2UA 1B8SA 2BA9A 2B9XA 3CGDA 2FBWA 3RP7A 4CBQA 1UKVG 3UOZA 2YWLA 5EBKA 3T0KA 3KPFA 1KNRA 5KMPA 1PXAA 1XHCA 3ADAB 4GAVA 3UKAA 1K0IA 2CULA 3AYIA 1TYTA 2GV8A 2IIDA 2C70A 4OPLA 2JB1A 3T37A 3CNTA 2WHDA 5KOWA 5FS8A 4D04A 2Y6QA 5EB4A 3CNSA 4AT0A 1GNDA 1COYA 2YG5A 1E39A 1F8WA 4EIQA 2X8CA 3UOYA 3SQPA 5JCMA 2ARDA 3UP4A
chains in the Genus database with same CATH topology
3AE3A 1XPQA 1IJHA 2GB0A 3WE0A 4UDPA 3CNPA 4A65A 2OAMA 2RGJA 3CGEA 3NN6X 4Y4LA 1PBBA 1B5QA 4YTPA 1ZY8A 3I6DA 2JAEA 3FMWA 3CN8A 4CCRA 5GSNA 5U63A 2V6OA 1O5WA 3CNJA 4P9SA 1IUUA 1E7PA 4B66A 5CKUA 2YVGA 5GRTA 4U8OA 2OLNA 3NNEA 5KMQA 4AP3A 2YM1A 1N1PA 2WOIA 3P4SA 3SZWA 3AE7A 4TLZA 5IQ4A 2VRMA 4K8DA 3CPHG 1W4XA 1OJ9A 4IA6A 4I59A 1PHHA 3DK9A 3CIRA 4WCTA 1PN0A 1L0VA 3PVCA 2YLWA 3NHOX 1CJ4A 1KFYA 3VR8A 3LB8A 3B6DA 3AD8B 4ICYA 4N9XA 3IHMA 2WQYA 2BCGG 2EQ6A 1B4VA 1LQUA 1LQTA 3FPZA 3GYXA 3GD3A 3F8PA 3ZYXA 3HYVA 2RGHA 4X4JA 4YKFA 3NTAA 2GMHA 3G5QA 3T2KA 4AOSA 4EQWA 2W0HA 2GF3A 3D1CA 2UZZA 1CJ3A 3BI2A 2IVDA 4GCMA 4B68A 4APNA 4H4PA 2Q0LA 1TDEA 3G5RA 2WBAA 3BI5A 3DJGX 2X8GA 4U8PA 3UKHA 5M10A 1FCDA 3AEFA 1D4CA 3AE6A 1OJCA 5KMSA 5KVHA 5KRQA 3UCLA 2GQFA 2OA1A 4DNAA 3NTDA 4EMJA 3BI4A 5LV9A 1Q1WA 1S2YA 2A8XA 3ABVA 1OJDA 2V3BA 5IQ1A 4U8MA 1GREA 5EOWA 4EQXA 2AAQA 1LPFA 2X3NA 3AECA 4RG4A 4TM1A 3LZXA 3M12A 4U2LA 3V76A 3T2YA 2JB2A 4K7ZA 4DSHA 3SY4A 1CJCA 1NHQA 4BURA 3UOXA 1K0JA 2BC0A 3NG7X 1H7XA 5BUKA 3GWFA 4GAPA 2C76A 1CL0A 3C96A 4Z2RA 1V59A 1JRXA 4OVIA 4I58A 1MO9A 3GDNA 2XFUA 4NEWA 1YQZA 2R0GA 3GMCA 3P9UA 2H89A 3UTFA 3AEEA 4G6HA 1BZLA 2HQMA 4KX6A 2R0PA 1H86A 2XVIA 2I0ZA 1DNCA 4A6NA 1Q9IA 2BS2A 1BF3A 3LXDA 4GDPA 3GRTA 1NHRA 1N4WA 2BXRA 3VR9A 3RP8A 2A87A 1JU2A 2R0CA 2Y6RA 4AT2A 2BS4A 2R4EA 1GTEA 3NT6A 2DKHA 2YLXA 2GR1A 3UP5A 2VZ2A 1PJ6A 2GR2A 2YM2A 1ZDLA 1KDGA 2YAUA 2Z5YA 3NYCA 2XVEA 4IA5A 3DJEA 4OPUA 4RG3A 4B64A 3AXBA 1XDIA 4B69A 3UKPA 4IVMB 1F6MA 1GV4A 2BXSA 2WPEA 1Y56B 3GRSA 4EQRA 4YSHA 2R4JA 3BNUA 1KSSA 3Q9TA 4J34A 2WDQA 4M52A 4EMIA 3AD7B 2RGOA 4II2A 3P4QA 2EQ7A 3VRAA 1YQ4A 3NIXA 2VRLA 4Z25A 1QO8A 1EL5A 4OPIA 2WETA 3AE9A 5BVAA 4CY8A 3T31A 4XWRA 3QJ4A 3RP6A 3QVRA 1JRZA 3EANA 1GOSA 1NAAA 3GDPA 1TYPA 3QFBA 2QA2A 4J36A 5HHFA 3SZCA 3NGCX 3DMEA 2V60A 4K5SA 3UOVA 4NWZA 2YLTA 1H6VA 3PO7A 2VVLG 1GPEA 4JY3A 1CC4A 1DODA 4USRA 1K0LA 1E6EA 4J56A 2C4CA 3H8IA 2R46A 2V3AA 2WEUA 1BGJA 2YR6A 1IUXA 3HZLA 4FK1C 1H83A 3DH9A 4B67A 1F8SA 2YG7A 4OCGA 2BK3A 2WOVA 2XLPA 2VQBA 2EQ8A 2ZBWA 2YLRA 1CBOA 4UP3A 1E1NA 1PS9A 2GH5A 1MOKA 4NTDA 2VVMA 2XLTA 3T14A 1VG0A 4GUVA 3V3OA 1FECA 5FS6A 3KVEA 1BKWA 1HYUA 4Z44A 3SFEA 4G73A 3DK4A 4O5UA 3COXA 3I3LA 2XLSA 1GRHA 4FX9A 5C2TA 1LJ1A 3AE2A 5JCKA 2XCGA 4YSYA 2YG3A 5FS9A 2B7RA 2BRAA 4NTCA 5U1OA 1RSGA 1ZMDA 1ZK7A 2TMDA 3IHGA 3JSKA 2WOWA 2XVJA 3LADA 4IV9A 1OJTA 4YTMA 3CTYA 4YWOA 1MXTA 1D7LA 4H4TA 5KMRA 5KXJA 3RNMA 4UDQA 3AE5A 3GWDA 5HYMA 4EIPA 2GR0A 2JBVA 3L8KA 2OLOA 4H4YA 4U2TA 2J3NA 1IUVA 5L46A 4J33A 3FIMB 2WDRA 1Y56A 1PDHA 4G9KA 4X9NA 3SM8A 2BABA 2E4GA 3BHKA 1D5TA 1FL2A 1JOAA 1NEKA 4B65A 3NKSA 3BNMA 5JCLA 3ALJA 4NNJA 4UDRA 4Y4MA 3IF9A 2XDOA 4BK3A 3AD9B 4J31A 4JN9A 3AYLA 3IWAA 4HB9A 4YTNA 1P2EA 2C3DA 2XFNA 4Y4NA 1GXFA 4LIIA 2X99A 3AEBA 4KPRA 4TM3A 3DGZA 5FS7A 3UTEA 4JY2A 2PYXA 2C72A 2ACZA 3SX6A 4E0VA 4C74A 4IVOB 4K2XA 2GQWA 4B63A 3S5WA 2QCUA 1TDKA 3QFAA 1O95A 1ONFA 3CGBA 3CMMA 2C66A 3ISHA 2GR3A 3KD9A 2FJEA 4JNAA 4C77A 3DA1A 2O9ZA 2WP5A 3V3NA 1H82A 3AEGA 3URHA 4GDEA 4TM4A 1GT8A 1RYIA 3NH3X 1YY5A 4BJYA 4AOXA 3SYIA 2V61A 1TRBA 3NN0X 1PBEA 2WU2A 1GETA 3P4RA 4GRTA 5KNLA 3ALMA 4DSGA 4U8KA 4AP1A 2XVFA 3AE8A 2Z5XA 4Z24A 3KLJA 1D4DA 4PAAA 4U8JA 3GMBA 4YSZA 4ZCDA 2CVJA 1NPXA 1ZOVA 1DOCA 2GRTA 2WDVA 2YQUA 4YXDA 4A79A 4JQ9A 2X50A 1LVLA 2BC1A 4ADWA 1PXCA 2Q0KA 3CGCA 1Q1RA 1NHSA 2QAEA 3G5SA 1NG3A 1EL8A 2C67A 2AQJA 4OPTA 1VDCA 1M64A 2WPFA 4OPDA 2E1MA 4GF7A 4YKGA 2WS3A 1PJ7A 1PXBA 4G74A 1ZOYA 3EAOA 1RP0A 2EQ9A 2XLRA 3L1RA 5BRTA 1GRBA 1JNRA 1P2HA 1ELIA 3NYFA 1GRAA 3P4PA 1N4VA 2WP9A 1M6IA 1DJQA 3F8DA 5ER0A 1GRGA 4H50A 5J7XA 2A89A 2JKCA 3O0HA 1JRYA 3AWIA 2BS3A 1EL7A 1K4QA 2Q6UA 1CJ2A 4CNKA 4H2NA 4MJWA 5C3JA 2FJAA 1DJNA 2BK4A 4ECHA 3UKFA 1S3EA 3FBSA 3UTGA 3DGHA 3AYJA 4U8IA 3T2ZA 3AEAA 4H7UA 2C3CA 3R9UA 3CNDA 4A9WA 3OC4A 2XLUA 2YG4A 1YKJA 3ZDNA 2JB3A 1CC2A 2B7SA 2VQ7A 4EM4A 3DK8A 4OPGA 4LU6A 1QLBA 3QSMA 4H4VA 4H4SA 3LJPA 1D4EA 4D03A 4H2PA 1B37A 3SXIA 2JK6A 4EMWA 2ZZBA 2FJBA 4NEVA 1VG9A 2RABA 2XVHA 4CNJA 2NPXA 2F5ZA 2OALA 4X9MA 2YG6A 3DJJA 3M13A 5M0ZA 5HY5A 4H4XA 2DKIA 3K7QX 2Q7VA 4H2QA 2ZZ0A 4H4WA 4JNQA 4BK2A 4H4ZA 5JCNA 4ZN0A 3S61A 4CY6A 3REDA 4A7AA 5KOXA 2QA1A 2X8HA 4U8NA 2B9WA 2XFPA 1Z6LA 1LTXR 4J2WA 5FMHA 3SZFA 1NDAA 4K22A 3VRDB 1CC6A 3KU9A 3NK0X 3ATQA 5DBJA 1YQ3A 3EPTA 4BK1A 3LOVA 5HXIA 1TDOA 3C4AA 1CF3A 3GYJA 2WU5A 3VRBA 4A99A 4H4UA 3AEDA 3RHAA 4EM3A 2C73A 4HA6A 4REKA 4TLXA 3PS9A 1JNZA 2B9YA 3Q6JA 2FJDA 1EBDA 3QSSA 1N4UA 1BWCA 1F3PA 2H88A 4Z43A 4A6NB 2C64A 2B76A 4BV6A 3HYXA 3FG2P 3UKQA 2XFOA 1VQWA 5KVIA 1GRFA 1H84A 4II3A 4FDCB 3E1TA 2XFQA 2YR4A 1SEZA 2PHHA 3EF6A 1ZX9A 1S3BA 2R45A 3KPKA 1FEBA 3NK2X 3C4NA 3GD4A 4XWZA 1E1MA 1GESA 2C65A 3AE1A 4H4QA 1NG4A 1KSUA 4XXGA 2C7GA 1GRTA 1JEHA 5BULA 3H8LA 1KNPA 3F8RA 4H4RA 1FOHA 1O94A 1PBFA 1E1LA 4Z2TA 3SGLA 2BYBA 1IUTA 4NZHA 2VOUA 3SZ0A 2YLZA 1GEUA 3AB1A 5U25A 4C5OA 1NENA 3II4A 2AR8A 1Y0PA 1VRQB 1LV0A 1OJAA 4U2SA 2CFYA 4C3XA 5KWFA 1FEAA 1TDFA 2BK5A 1H7WA 2GMJA 2GAGB 1GALA 2IVEA 3K7MX 3K30A 4J57A 2BACA 2YR5A 4O5QA 2C75A 1REOA 1GTHA 1L9CA 2V5ZA 1D7YA 3HYWA 5EB5A 2E5VA 5IPYA 1X31B 3QSEA 1E1KA 4K5RA 3KA7A 1DXLA 3BHFA 3H4KA 2CDUA 1GERA 4OPCA 1IUSA 1QJDA 3NK1X 4USQA 2WP6A 4ZCCA 3SFDA 1ZP0A 1IUWA 4NTEA 3UKLA 4U8LA 3NRNA 3GSIA 1S2QA 2TPRA 3ALLA 2GEWA 5JCIA 2YVJA 3GYIA 4EQSA 3QVPA 4YT0A 2YVFA 2BRYA 1ZKQA 2R9ZA 4PABA 1BGNA 3OZ2A 1H81A 1PBCA 2NVKX 3UTHA 3M0OA 1L9DA 4C3YA 2GVCA 3NYEA 3B3RA 4WX1A 1XANA 1TDNA 4DGKA 3AE4A 4B1BA 1ZMCA 4JDRA 1DOEA 4RSLA 5J60A 1DOBA 3VQRA 4GR1A 4G6GA 1GSNA 3ITJA 1CHUA 1NHPA 3LZWA 3CPJG 4FK1A 4YSXA 1AOGA 4CRTA 4LA1A 2XYOA 3DJDA 2ZZCA 4A5LA 4CCQA 1KF6A 3D8XA 5CQFA 3IC9A 1PBDA 4H2RA 1PJ5A 1EL9A 2APGA 2YLSA 3CPIG 3ICRA 2BCPA 4BJZA 3ICSA 3NLCA 4Z26A 4TM0A 3P1WA 1L9EA 3K7TA 2WPCA 3KKJA 3UKKA 1F8RA 2WESA 2GAHB 2VVLA 3ATRA 3ICTA 5TR3A 4Z2UA 1B8SA 2BA9A 2B9XA 3CGDA 2FBWA 3RP7A 4CBQA 1UKVG 3UOZA 2YWLA 5EBKA 3T0KA 3KPFA 1KNRA 5KMPA 1PXAA 1XHCA 3ADAB 4GAVA 3UKAA 1K0IA 2CULA 3AYIA 1TYTA 2GV8A 2IIDA 2C70A 4OPLA 2JB1A 3T37A 3CNTA 2WHDA 5KOWA 5FS8A 4D04A 2Y6QA 5EB4A 3CNSA 4AT0A 1GNDA 1COYA 2YG5A 1E39A 1F8WA 4EIQA 2X8CA 3UOYA 3SQPA 5JCMA 2ARDA 3UP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE3 A;  1XPQ A;  1IJH A;  2GB0 A;  3WE0 A;  4UDP A;  3CNP A;  4A65 A;  2OAM A;  2RGJ A;  3CGE A;  3NN6 X;  4Y4L A;  1PBB A;  1B5Q A;  4YTP A;  1ZY8 A;  3I6D A;  2JAE A;  3FMW A;  3CN8 A;  4CCR A;  5GSN A;  5U63 A;  2V6O A;  1O5W A;  3CNJ A;  4P9S A;  1IUU A;  1E7P A;  4B66 A;  5CKU A;  2YVG A;  5GRT A;  4U8O A;  2OLN A;  3NNE A;  4AP3 A;  2YM1 A;  1N1P A;  2WOI A;  3P4S A;  3AE7 A;  4TLZ A;  5IQ4 A;  2VRM A;  4K8D A;  3CPH G;  1W4X A;  1OJ9 A;  4IA6 A;  4I59 A;  1PHH A;  3DK9 A;  3CIR A;  4WCT A;  1PN0 A;  1L0V A;  3PVC A;  2YLW A;  3NHO X;  1CJ4 A;  1KFY A;  3VR8 A;  3LB8 A;  3B6D A;  3AD8 B;  4ICY A;  4N9X A;  3IHM A;  2WQY A;  2BCG G;  2EQ6 A;  1B4V A;  1LQU A;  1LQT A;  3FPZ A;  3GD3 A;  3F8P A;  3ZYX A;  4X4J A;  2RGH A;  4YKF A;  3NTA A;  2GMH A;  3G5Q A;  4AOS A;  4EQW A;  2W0H A;  2GF3 A;  3D1C A;  2UZZ A;  1CJ3 A;  3BI2 A;  2IVD A;  4GCM A;  4B68 A;  4APN A;  4H4P A;  2Q0L A;  1TDE A;  3G5R A;  2WBA A;  3BI5 A;  3DJG X;  2X8G A;  4U8P A;  3UKH A;  5M10 A;  1FCD A;  3AEF A;  1D4C A;  3AE6 A;  1OJC A;  5KVH A;  5KRQ A;  3UCL A;  2GQF A;  2OA1 A;  4DNA A;  3NTD A;  4EMJ A;  3BI4 A;  5LV9 A;  1Q1W A;  1S2Y A;  2A8X A;  3ABV A;  1OJD A;  2V3B A;  5IQ1 A;  4U8M A;  1GRE A;  5EOW A;  4EQX A;  2AAQ A;  1LPF A;  2X3N A;  3AEC A;  4RG4 A;  4TM1 A;  3LZX A;  3M12 A;  4U2L A;  3V76 A;  2JB2 A;  4K7Z A;  4DSH A;  1CJC A;  1NHQ A;  4BUR A;  3UOX A;  1K0J A;  2BC0 A;  3NG7 X;  1H7X A;  5BUK A;  3GWF A;  2C76 A;  1CL0 A;  3C96 A;  4Z2R A;  1V59 A;  1JRX A;  4OVI A;  4I58 A;  1MO9 A;  3GDN A;  2XFU A;  4NEW A;  1YQZ A;  2R0G A;  3GMC A;  3P9U A;  2H89 A;  3UTF A;  3AEE A;  1BZL A;  2HQM A;  4KX6 A;  2R0P A;  1H86 A;  2XVI A;  2I0Z A;  1DNC A;  4A6N A;  1Q9I A;  2BS2 A;  1BF3 A;  3LXD A;  4GDP A;  3GRT A;  1NHR A;  1N4W A;  2BXR A;  3VR9 A;  3RP8 A;  2A87 A;  1JU2 A;  2R0C A;  2Y6R A;  4AT2 A;  2BS4 A;  2R4E A;  1GTE A;  3NT6 A;  2DKH A;  2YLX A;  2GR1 A;  3UP5 A;  2VZ2 A;  1PJ6 A;  2GR2 A;  2YM2 A;  1ZDL A;  1KDG A;  2YAU A;  2Z5Y A;  3NYC A;  2XVE A;  4IA5 A;  3DJE A;  4OPU A;  4RG3 A;  4B64 A;  3AXB A;  1XDI A;  4B69 A;  3UKP A;  4IVM B;  1F6M A;  1GV4 A;  2BXS A;  2WPE A;  1Y56 B;  3GRS A;  4EQR A;  4YSH A;  2R4J A;  3BNU A;  1KSS A;  3Q9T A;  4J34 A;  2WDQ A;  4M52 A;  4EMI A;  3AD7 B;  2RGO A;  3P4Q A;  2EQ7 A;  3VRA A;  1YQ4 A;  3NIX A;  2VRL A;  4Z25 A;  1QO8 A;  1EL5 A;  4OPI A;  2WET A;  3AE9 A;  5BVA A;  4CY8 A;  4XWR A;  3QJ4 A;  3RP6 A;  3QVR A;  1JRZ A;  3EAN A;  1GOS A;  1NAA A;  3GDP A;  1TYP A;  3QFB A;  2QA2 A;  4J36 A;  5HHF A;  3NGC X;  3DME A;  2V60 A;  4K5S A;  3UOV A;  2YLT A;  1H6V A;  3PO7 A;  2VVL G;  1GPE A;  4JY3 A;  1CC4 A;  1DOD A;  4USR A;  1K0L A;  1E6E A;  4J56 A;  3H8I A;  2R46 A;  2V3A A;  2WEU A;  1BGJ A;  2YR6 A;  1IUX A;  3HZL A;  4FK1 C;  1H83 A;  3DH9 A;  4B67 A;  1F8S A;  2YG7 A;  4OCG A;  2BK3 A;  2WOV A;  2XLP A;  2VQB A;  2EQ8 A;  2ZBW A;  2YLR A;  1CBO A;  4UP3 A;  1E1N A;  1PS9 A;  2GH5 A;  1MOK A;  4NTD A;  2VVM A;  2XLT A;  1VG0 A;  4GUV A;  3V3O A;  1FEC A;  5FS6 A;  3KVE A;  1BKW A;  1HYU A;  4Z44 A;  3SFE A;  3DK4 A;  4O5U A;  3COX A;  3I3L A;  2XLS A;  1GRH A;  4FX9 A;  5C2T A;  1LJ1 A;  3AE2 A;  5JCK A;  2XCG A;  4YSY A;  2YG3 A;  5FS9 A;  2B7R A;  4NTC A;  5U1O A;  1RSG A;  1ZMD A;  1ZK7 A;  2TMD A;  3IHG A;  3JSK A;  2WOW A;  2XVJ A;  3LAD A;  4IV9 A;  1OJT A;  4YTM A;  3CTY A;  4YWO A;  1MXT A;  1D7L A;  4H4T A;  5KXJ A;  3RNM A;  4UDQ A;  3AE5 A;  3GWD A;  5HYM A;  4EIP A;  2GR0 A;  2JBV A;  3L8K A;  2OLO A;  4H4Y A;  4U2T A;  2J3N A;  1IUV A;  5L46 A;  4J33 A;  3FIM B;  2WDR A;  1Y56 A;  1PDH A;  4X9N A;  3SM8 A;  2BAB A;  2E4G A;  3BHK A;  1D5T A;  1FL2 A;  1JOA A;  1NEK A;  4B65 A;  3NKS A;  3BNM A;  5JCL A;  3ALJ A;  4UDR A;  4Y4M A;  3IF9 A;  2XDO A;  4BK3 A;  3AD9 B;  4J31 A;  4JN9 A;  3AYL A;  3IWA A;  4HB9 A;  4YTN A;  1P2E A;  2C3D A;  2XFN A;  4Y4N A;  1GXF A;  4LII A;  2X99 A;  3AEB A;  4KPR A;  4TM3 A;  3DGZ A;  5FS7 A;  3UTE A;  4JY2 A;  2PYX A;  2C72 A;  2ACZ A;  4E0V A;  4C74 A;  4IVO B;  4K2X A;  2GQW A;  4B63 A;  3S5W A;  2QCU A;  1TDK A;  3QFA A;  1O95 A;  1ONF A;  3CGB A;  4C77 A;  2C66 A;  3ISH A;  2GR3 A;  3KD9 A;  2FJE A;  4JNA A;  3DA1 A;  2O9Z A;  2WP5 A;  3V3N A;  1H82 A;  3AEG A;  3URH A;  4GDE A;  4TM4 A;  1GT8 A;  1RYI A;  3NH3 X;  1YY5 A;  4BJY A;  4AOX A;  2V61 A;  1TRB A;  3NN0 X;  1PBE A;  2WU2 A;  1GET A;  3P4R A;  4GRT A;  3ALM A;  4DSG A;  4U8K A;  4AP1 A;  2XVF A;  3AE8 A;  2Z5X A;  4Z24 A;  3KLJ A;  1D4D A;  4PAA A;  4U8J A;  3GMB A;  4YSZ A;  4ZCD A;  2CVJ A;  1NPX A;  1ZOV A;  1DOC A;  2GRT A;  2WDV A;  2YQU A;  4YXD A;  4A79 A;  4JQ9 A;  2X50 A;  1LVL A;  2BC1 A;  4ADW A;  1PXC A;  2Q0K A;  3CGC A;  1Q1R A;  1NHS A;  2QAE A;  3G5S A;  1NG3 A;  1EL8 A;  2C67 A;  2AQJ A;  4OPT A;  1VDC A;  1M64 A;  2WPF A;  4OPD A;  2E1M A;  4GF7 A;  4YKG A;  2WS3 A;  1PJ7 A;  1PXB A;  1ZOY A;  3EAO A;  1RP0 A;  2EQ9 A;  2XLR A;  3L1R A;  5BRT A;  1GRB A;  1JNR A;  1P2H A;  1ELI A;  3NYF A;  1GRA A;  3P4P A;  1N4V A;  2WP9 A;  1M6I A;  1DJQ A;  3F8D A;  5ER0 A;  1GRG A;  4H50 A;  5J7X A;  2A89 A;  2JKC A;  3O0H A;  1JRY A;  3AWI A;  2BS3 A;  1EL7 A;  1K4Q A;  2Q6U A;  1CJ2 A;  4CNK A;  4H2N A;  4MJW A;  5C3J A;  2FJA A;  1DJN A;  2BK4 A;  4ECH A;  3UKF A;  1S3E A;  3FBS A;  3UTG A;  3DGH A;  3AYJ A;  4U8I A;  3AEA A;  4H7U A;  2C3C A;  3R9U A;  3CND A;  4A9W A;  3OC4 A;  2XLU A;  2YG4 A;  1YKJ A;  3ZDN A;  2JB3 A;  1CC2 A;  2B7S A;  2VQ7 A;  4EM4 A;  3DK8 A;  4OPG A;  4LU6 A;  1QLB A;  3QSM A;  4H4V A;  4H4S A;  3LJP A;  1D4E A;  4D03 A;  4H2P A;  1B37 A;  2JK6 A;  4EMW A;  2ZZB A;  2FJB A;  4NEV A;  1VG9 A;  2RAB A;  2XVH A;  4CNJ A;  2NPX A;  2F5Z A;  2OAL A;  4X9M A;  2YG6 A;  3DJJ A;  3M13 A;  5M0Z A;  5HY5 A;  4H4X A;  2DKI A;  3K7Q X;  2Q7V A;  4H2Q A;  2ZZ0 A;  4H4W A;  4JNQ A;  4BK2 A;  4H4Z A;  5JCN A;  4ZN0 A;  3S61 A;  4CY6 A;  3RED A;  4A7A A;  5KOX A;  2QA1 A;  2X8H A;  4U8N A;  2B9W A;  2XFP A;  1Z6L A;  1LTX R;  4J2W A;  5FMH A;  3VRD B;  1NDA A;  4K22 A;  1CC6 A;  3KU9 A;  3NK0 X;  3ATQ A;  5DBJ A;  1YQ3 A;  3EPT A;  4BK1 A;  3LOV A;  5HXI A;  1TDO A;  3C4A A;  1CF3 A;  3GYJ A;  2WU5 A;  3VRB A;  4A99 A;  4H4U A;  3AED A;  3RHA A;  4EM3 A;  2C73 A;  4HA6 A;  4REK A;  4TLX A;  3PS9 A;  1JNZ A;  2B9Y A;  3Q6J A;  2FJD A;  1EBD A;  3QSS A;  1N4U A;  1BWC A;  1F3P A;  2H88 A;  4Z43 A;  4A6N B;  2C64 A;  2B76 A;  4BV6 A;  3FG2 P;  3UKQ A;  2XFO A;  1VQW A;  5KVI A;  1GRF A;  1H84 A;  4FDC B;  3E1T A;  2XFQ A;  2YR4 A;  1SEZ A;  2PHH A;  3EF6 A;  1ZX9 A;  1S3B A;  2R45 A;  1FEB A;  3NK2 X;  3C4N A;  3GD4 A;  4XWZ A;  1E1M A;  1GES A;  2C65 A;  3AE1 A;  4H4Q A;  1NG4 A;  1KSU A;  4XXG A;  2C7G A;  1GRT A;  1JEH A;  5BUL A;  3H8L A;  1KNP A;  3F8R A;  4H4R A;  1FOH A;  1O94 A;  1PBF A;  1E1L A;  4Z2T A;  3SGL A;  2BYB A;  1IUT A;  4NZH A;  2VOU A;  4C5O A;  2YLZ A;  1GEU A;  3AB1 A;  5U25 A;  1NEN A;  3II4 A;  2AR8 A;  1Y0P A;  1VRQ B;  1LV0 A;  1OJA A;  4U2S A;  2CFY A;  4C3X A;  5KWF A;  1FEA A;  1TDF A;  2BK5 A;  1H7W A;  2GMJ A;  2GAG B;  1GAL A;  2IVE A;  3K7M X;  3K30 A;  4J57 A;  2BAC A;  2YR5 A;  4O5Q A;  2C75 A;  1REO A;  1GTH A;  1L9C A;  2V5Z A;  1D7Y A;  5IPY A;  5EB5 A;  2E5V A;  1X31 B;  3QSE A;  1E1K A;  4K5R A;  3KA7 A;  1DXL A;  3BHF A;  3H4K A;  2CDU A;  1GER A;  4OPC A;  1IUS A;  1QJD A;  3NK1 X;  4USQ A;  2WP6 A;  4ZCC A;  3SFD A;  1ZP0 A;  1IUW A;  4NTE A;  3UKL A;  4U8L A;  3NRN A;  3GSI A;  1S2Q A;  2TPR A;  3ALL A;  2GEW A;  5JCI A;  2YVJ A;  3GYI A;  4EQS A;  3QVP A;  4YT0 A;  2YVF A;  1ZKQ A;  2R9Z A;  4PAB A;  1BGN A;  3OZ2 A;  1H81 A;  1PBC A;  2NVK X;  3UTH A;  3M0O A;  1L9D A;  4C3Y A;  2GVC A;  3NYE A;  3B3R A;  4WX1 A;  1XAN A;  1TDN A;  4DGK A;  3AE4 A;  4B1B A;  1ZMC A;  4JDR A;  1DOE A;  4RSL A;  5J60 A;  1DOB A;  3VQR A;  4GR1 A;  1GSN A;  3ITJ A;  1CHU A;  1NHP A;  3LZW A;  3CPJ G;  4FK1 A;  4YSX A;  1AOG A;  4CRT A;  4LA1 A;  2XYO A;  3DJD A;  2ZZC A;  4A5L A;  4CCQ A;  1KF6 A;  3D8X A;  5CQF A;  3IC9 A;  1PBD A;  4H2R A;  1PJ5 A;  1EL9 A;  2APG A;  2YLS A;  3CPI G;  3ICR A;  2BCP A;  4BJZ A;  3ICS A;  3NLC A;  4Z26 A;  4TM0 A;  3P1W A;  1L9E A;  3K7T A;  2WPC A;  3KKJ A;  3UKK A;  1F8R A;  2WES A;  2GAH B;  2VVL A;  3ATR A;  3ICT A;  5TR3 A;  4Z2U A;  1B8S A;  2BA9 A;  2B9X A;  3CGD A;  2FBW A;  3RP7 A;  4CBQ A;  1UKV G;  3UOZ A;  2YWL A;  5EBK A;  3KPF A;  1KNR A;  1PXA A;  1XHC A;  3ADA B;  3UKA A;  1K0I A;  2CUL A;  3AYI A;  1TYT A;  2GV8 A;  2IID A;  2C70 A;  4OPL A;  2JB1 A;  3T37 A;  3CNT A;  2WHD A;  5KOW A;  5FS8 A;  4D04 A;  2Y6Q A;  5EB4 A;  3CNS A;  4AT0 A;  1GND A;  1COY A;  2YG5 A;  1E39 A;  1F8W A;  4EIQ A;  2X8C A;  3UOY A;  3SQP A;  5JCM A;  2ARD A;  3UP4 A; 
#chains in the Genus database with same CATH topology
 3AE3 A;  1XPQ A;  1IJH A;  2GB0 A;  3WE0 A;  4UDP A;  3CNP A;  4A65 A;  2OAM A;  2RGJ A;  3CGE A;  3NN6 X;  4Y4L A;  1PBB A;  1B5Q A;  4YTP A;  1ZY8 A;  3I6D A;  2JAE A;  3FMW A;  3CN8 A;  4CCR A;  5GSN A;  5U63 A;  2V6O A;  1O5W A;  3CNJ A;  4P9S A;  1IUU A;  1E7P A;  4B66 A;  5CKU A;  2YVG A;  5GRT A;  4U8O A;  2OLN A;  3NNE A;  5KMQ A;  4AP3 A;  2YM1 A;  1N1P A;  2WOI A;  3P4S A;  3SZW A;  3AE7 A;  4TLZ A;  5IQ4 A;  2VRM A;  4K8D A;  3CPH G;  1W4X A;  1OJ9 A;  4IA6 A;  4I59 A;  1PHH A;  3DK9 A;  3CIR A;  4WCT A;  1PN0 A;  1L0V A;  3PVC A;  2YLW A;  3NHO X;  1CJ4 A;  1KFY A;  3VR8 A;  3LB8 A;  3B6D A;  3AD8 B;  4ICY A;  4N9X A;  3IHM A;  2WQY A;  2BCG G;  2EQ6 A;  1B4V A;  1LQU A;  1LQT A;  3FPZ A;  3GYX A;  3GD3 A;  3F8P A;  3ZYX A;  3HYV A;  2RGH A;  4X4J A;  4YKF A;  3NTA A;  2GMH A;  3G5Q A;  3T2K A;  4AOS A;  4EQW A;  2W0H A;  2GF3 A;  3D1C A;  2UZZ A;  1CJ3 A;  3BI2 A;  2IVD A;  4GCM A;  4B68 A;  4APN A;  4H4P A;  2Q0L A;  1TDE A;  3G5R A;  2WBA A;  3BI5 A;  3DJG X;  2X8G A;  4U8P A;  3UKH A;  5M10 A;  1FCD A;  3AEF A;  1D4C A;  3AE6 A;  1OJC A;  5KMS A;  5KVH A;  5KRQ A;  3UCL A;  2GQF A;  2OA1 A;  4DNA A;  3NTD A;  4EMJ A;  3BI4 A;  5LV9 A;  1Q1W A;  1S2Y A;  2A8X A;  3ABV A;  1OJD A;  2V3B A;  5IQ1 A;  4U8M A;  1GRE A;  5EOW A;  4EQX A;  2AAQ A;  1LPF A;  2X3N A;  3AEC A;  4RG4 A;  4TM1 A;  3LZX A;  3M12 A;  4U2L A;  3V76 A;  3T2Y A;  2JB2 A;  4K7Z A;  4DSH A;  3SY4 A;  1CJC A;  1NHQ A;  4BUR A;  3UOX A;  1K0J A;  2BC0 A;  3NG7 X;  1H7X A;  5BUK A;  3GWF A;  4GAP A;  2C76 A;  1CL0 A;  3C96 A;  4Z2R A;  1V59 A;  1JRX A;  4OVI A;  4I58 A;  1MO9 A;  3GDN A;  2XFU A;  4NEW A;  1YQZ A;  2R0G A;  3GMC A;  3P9U A;  2H89 A;  3UTF A;  3AEE A;  4G6H A;  1BZL A;  2HQM A;  4KX6 A;  2R0P A;  1H86 A;  2XVI A;  2I0Z A;  1DNC A;  4A6N A;  1Q9I A;  2BS2 A;  1BF3 A;  3LXD A;  4GDP A;  3GRT A;  1NHR A;  1N4W A;  2BXR A;  3VR9 A;  3RP8 A;  2A87 A;  1JU2 A;  2R0C A;  2Y6R A;  4AT2 A;  2BS4 A;  2R4E A;  1GTE A;  3NT6 A;  2DKH A;  2YLX A;  2GR1 A;  3UP5 A;  2VZ2 A;  1PJ6 A;  2GR2 A;  2YM2 A;  1ZDL A;  1KDG A;  2YAU A;  2Z5Y A;  3NYC A;  2XVE A;  4IA5 A;  3DJE A;  4OPU A;  4RG3 A;  4B64 A;  3AXB A;  1XDI A;  4B69 A;  3UKP A;  4IVM B;  1F6M A;  1GV4 A;  2BXS A;  2WPE A;  1Y56 B;  3GRS A;  4EQR A;  4YSH A;  2R4J A;  3BNU A;  1KSS A;  3Q9T A;  4J34 A;  2WDQ A;  4M52 A;  4EMI A;  3AD7 B;  2RGO A;  4II2 A;  3P4Q A;  2EQ7 A;  3VRA A;  1YQ4 A;  3NIX A;  2VRL A;  4Z25 A;  1QO8 A;  1EL5 A;  4OPI A;  2WET A;  3AE9 A;  5BVA A;  4CY8 A;  3T31 A;  4XWR A;  3QJ4 A;  3RP6 A;  3QVR A;  1JRZ A;  3EAN A;  1GOS A;  1NAA A;  3GDP A;  1TYP A;  3QFB A;  2QA2 A;  4J36 A;  5HHF A;  3SZC A;  3NGC X;  3DME A;  2V60 A;  4K5S A;  3UOV A;  4NWZ A;  2YLT A;  1H6V A;  3PO7 A;  2VVL G;  1GPE A;  4JY3 A;  1CC4 A;  1DOD A;  4USR A;  1K0L A;  1E6E A;  4J56 A;  2C4C A;  3H8I A;  2R46 A;  2V3A A;  2WEU A;  1BGJ A;  2YR6 A;  1IUX A;  3HZL A;  4FK1 C;  1H83 A;  3DH9 A;  4B67 A;  1F8S A;  2YG7 A;  4OCG A;  2BK3 A;  2WOV A;  2XLP A;  2VQB A;  2EQ8 A;  2ZBW A;  2YLR A;  1CBO A;  4UP3 A;  1E1N A;  1PS9 A;  2GH5 A;  1MOK A;  4NTD A;  2VVM A;  2XLT A;  3T14 A;  1VG0 A;  4GUV A;  3V3O A;  1FEC A;  5FS6 A;  3KVE A;  1BKW A;  1HYU A;  4Z44 A;  3SFE A;  4G73 A;  3DK4 A;  4O5U A;  3COX A;  3I3L A;  2XLS A;  1GRH A;  4FX9 A;  5C2T A;  1LJ1 A;  3AE2 A;  5JCK A;  2XCG A;  4YSY A;  2YG3 A;  5FS9 A;  2B7R A;  2BRA A;  4NTC A;  5U1O A;  1RSG A;  1ZMD A;  1ZK7 A;  2TMD A;  3IHG A;  3JSK A;  2WOW A;  2XVJ A;  3LAD A;  4IV9 A;  1OJT A;  4YTM A;  3CTY A;  4YWO A;  1MXT A;  1D7L A;  4H4T A;  5KMR A;  5KXJ A;  3RNM A;  4UDQ A;  3AE5 A;  3GWD A;  5HYM A;  4EIP A;  2GR0 A;  2JBV A;  3L8K A;  2OLO A;  4H4Y A;  4U2T A;  2J3N A;  1IUV A;  5L46 A;  4J33 A;  3FIM B;  2WDR A;  1Y56 A;  1PDH A;  4G9K A;  4X9N A;  3SM8 A;  2BAB A;  2E4G A;  3BHK A;  1D5T A;  1FL2 A;  1JOA A;  1NEK A;  4B65 A;  3NKS A;  3BNM A;  5JCL A;  3ALJ A;  4NNJ A;  4UDR A;  4Y4M A;  3IF9 A;  2XDO A;  4BK3 A;  3AD9 B;  4J31 A;  4JN9 A;  3AYL A;  3IWA A;  4HB9 A;  4YTN A;  1P2E A;  2C3D A;  2XFN A;  4Y4N A;  1GXF A;  4LII A;  2X99 A;  3AEB A;  4KPR A;  4TM3 A;  3DGZ A;  5FS7 A;  3UTE A;  4JY2 A;  2PYX A;  2C72 A;  2ACZ A;  3SX6 A;  4E0V A;  4C74 A;  4IVO B;  4K2X A;  2GQW A;  4B63 A;  3S5W A;  2QCU A;  1TDK A;  3QFA A;  1O95 A;  1ONF A;  3CGB A;  3CMM A;  2C66 A;  3ISH A;  2GR3 A;  3KD9 A;  2FJE A;  4JNA A;  4C77 A;  3DA1 A;  2O9Z A;  2WP5 A;  3V3N A;  1H82 A;  3AEG A;  3URH A;  4GDE A;  4TM4 A;  1GT8 A;  1RYI A;  3NH3 X;  1YY5 A;  4BJY A;  4AOX A;  3SYI A;  2V61 A;  1TRB A;  3NN0 X;  1PBE A;  2WU2 A;  1GET A;  3P4R A;  4GRT A;  5KNL A;  3ALM A;  4DSG A;  4U8K A;  4AP1 A;  2XVF A;  3AE8 A;  2Z5X A;  4Z24 A;  3KLJ A;  1D4D A;  4PAA A;  4U8J A;  3GMB A;  4YSZ A;  4ZCD A;  2CVJ A;  1NPX A;  1ZOV A;  1DOC A;  2GRT A;  2WDV A;  2YQU A;  4YXD A;  4A79 A;  4JQ9 A;  2X50 A;  1LVL A;  2BC1 A;  4ADW A;  1PXC A;  2Q0K A;  3CGC A;  1Q1R A;  1NHS A;  2QAE A;  3G5S A;  1NG3 A;  1EL8 A;  2C67 A;  2AQJ A;  4OPT A;  1VDC A;  1M64 A;  2WPF A;  4OPD A;  2E1M A;  4GF7 A;  4YKG A;  2WS3 A;  1PJ7 A;  1PXB A;  4G74 A;  1ZOY A;  3EAO A;  1RP0 A;  2EQ9 A;  2XLR A;  3L1R A;  5BRT A;  1GRB A;  1JNR A;  1P2H A;  1ELI A;  3NYF A;  1GRA A;  3P4P A;  1N4V A;  2WP9 A;  1M6I A;  1DJQ A;  3F8D A;  5ER0 A;  1GRG A;  4H50 A;  5J7X A;  2A89 A;  2JKC A;  3O0H A;  1JRY A;  3AWI A;  2BS3 A;  1EL7 A;  1K4Q A;  2Q6U A;  1CJ2 A;  4CNK A;  4H2N A;  4MJW A;  5C3J A;  2FJA A;  1DJN A;  2BK4 A;  4ECH A;  3UKF A;  1S3E A;  3FBS A;  3UTG A;  3DGH A;  3AYJ A;  4U8I A;  3T2Z A;  3AEA A;  4H7U A;  2C3C A;  3R9U A;  3CND A;  4A9W A;  3OC4 A;  2XLU A;  2YG4 A;  1YKJ A;  3ZDN A;  2JB3 A;  1CC2 A;  2B7S A;  2VQ7 A;  4EM4 A;  3DK8 A;  4OPG A;  4LU6 A;  1QLB A;  3QSM A;  4H4V A;  4H4S A;  3LJP A;  1D4E A;  4D03 A;  4H2P A;  1B37 A;  3SXI A;  2JK6 A;  4EMW A;  2ZZB A;  2FJB A;  4NEV A;  1VG9 A;  2RAB A;  2XVH A;  4CNJ A;  2NPX A;  2F5Z A;  2OAL A;  4X9M A;  2YG6 A;  3DJJ A;  3M13 A;  5M0Z A;  5HY5 A;  4H4X A;  2DKI A;  3K7Q X;  2Q7V A;  4H2Q A;  2ZZ0 A;  4H4W A;  4JNQ A;  4BK2 A;  4H4Z A;  5JCN A;  4ZN0 A;  3S61 A;  4CY6 A;  3RED A;  4A7A A;  5KOX A;  2QA1 A;  2X8H A;  4U8N A;  2B9W A;  2XFP A;  1Z6L A;  1LTX R;  4J2W A;  5FMH A;  3SZF A;  1NDA A;  4K22 A;  3VRD B;  1CC6 A;  3KU9 A;  3NK0 X;  3ATQ A;  5DBJ A;  1YQ3 A;  3EPT A;  4BK1 A;  3LOV A;  5HXI A;  1TDO A;  3C4A A;  1CF3 A;  3GYJ A;  2WU5 A;  3VRB A;  4A99 A;  4H4U A;  3AED A;  3RHA A;  4EM3 A;  2C73 A;  4HA6 A;  4REK A;  4TLX A;  3PS9 A;  1JNZ A;  2B9Y A;  3Q6J A;  2FJD A;  1EBD A;  3QSS A;  1N4U A;  1BWC A;  1F3P A;  2H88 A;  4Z43 A;  4A6N B;  2C64 A;  2B76 A;  4BV6 A;  3HYX A;  3FG2 P;  3UKQ A;  2XFO A;  1VQW A;  5KVI A;  1GRF A;  1H84 A;  4II3 A;  4FDC B;  3E1T A;  2XFQ A;  2YR4 A;  1SEZ A;  2PHH A;  3EF6 A;  1ZX9 A;  1S3B A;  2R45 A;  3KPK A;  1FEB A;  3NK2 X;  3C4N A;  3GD4 A;  4XWZ A;  1E1M A;  1GES A;  2C65 A;  3AE1 A;  4H4Q A;  1NG4 A;  1KSU A;  4XXG A;  2C7G A;  1GRT A;  1JEH A;  5BUL A;  3H8L A;  1KNP A;  3F8R A;  4H4R A;  1FOH A;  1O94 A;  1PBF A;  1E1L A;  4Z2T A;  3SGL A;  2BYB A;  1IUT A;  4NZH A;  2VOU A;  3SZ0 A;  2YLZ A;  1GEU A;  3AB1 A;  5U25 A;  4C5O A;  1NEN A;  3II4 A;  2AR8 A;  1Y0P A;  1VRQ B;  1LV0 A;  1OJA A;  4U2S A;  2CFY A;  4C3X A;  5KWF A;  1FEA A;  1TDF A;  2BK5 A;  1H7W A;  2GMJ A;  2GAG B;  1GAL A;  2IVE A;  3K7M X;  3K30 A;  4J57 A;  2BAC A;  2YR5 A;  4O5Q A;  2C75 A;  1REO A;  1GTH A;  1L9C A;  2V5Z A;  1D7Y A;  3HYW A;  5EB5 A;  2E5V A;  5IPY A;  1X31 B;  3QSE A;  1E1K A;  4K5R A;  3KA7 A;  1DXL A;  3BHF A;  3H4K A;  2CDU A;  1GER A;  4OPC A;  1IUS A;  1QJD A;  3NK1 X;  4USQ A;  2WP6 A;  4ZCC A;  3SFD A;  1ZP0 A;  1IUW A;  4NTE A;  3UKL A;  4U8L A;  3NRN A;  3GSI A;  1S2Q A;  2TPR A;  3ALL A;  2GEW A;  5JCI A;  2YVJ A;  3GYI A;  4EQS A;  3QVP A;  4YT0 A;  2YVF A;  2BRY A;  1ZKQ A;  2R9Z A;  4PAB A;  1BGN A;  3OZ2 A;  1H81 A;  1PBC A;  2NVK X;  3UTH A;  3M0O A;  1L9D A;  4C3Y A;  2GVC A;  3NYE A;  3B3R A;  4WX1 A;  1XAN A;  1TDN A;  4DGK A;  3AE4 A;  4B1B A;  1ZMC A;  4JDR A;  1DOE A;  4RSL A;  5J60 A;  1DOB A;  3VQR A;  4GR1 A;  4G6G A;  1GSN A;  3ITJ A;  1CHU A;  1NHP A;  3LZW A;  3CPJ G;  4FK1 A;  4YSX A;  1AOG A;  4CRT A;  4LA1 A;  2XYO A;  3DJD A;  2ZZC A;  4A5L A;  4CCQ A;  1KF6 A;  3D8X A;  5CQF A;  3IC9 A;  1PBD A;  4H2R A;  1PJ5 A;  1EL9 A;  2APG A;  2YLS A;  3CPI G;  3ICR A;  2BCP A;  4BJZ A;  3ICS A;  3NLC A;  4Z26 A;  4TM0 A;  3P1W A;  1L9E A;  3K7T A;  2WPC A;  3KKJ A;  3UKK A;  1F8R A;  2WES A;  2GAH B;  2VVL A;  3ATR A;  3ICT A;  5TR3 A;  4Z2U A;  1B8S A;  2BA9 A;  2B9X A;  3CGD A;  2FBW A;  3RP7 A;  4CBQ A;  1UKV G;  3UOZ A;  2YWL A;  5EBK A;  3T0K A;  3KPF A;  1KNR A;  5KMP A;  1PXA A;  1XHC A;  3ADA B;  4GAV A;  3UKA A;  1K0I A;  2CUL A;  3AYI A;  1TYT A;  2GV8 A;  2IID A;  2C70 A;  4OPL A;  2JB1 A;  3T37 A;  3CNT A;  2WHD A;  5KOW A;  5FS8 A;  4D04 A;  2Y6Q A;  5EB4 A;  3CNS A;  4AT0 A;  1GND A;  1COY A;  2YG5 A;  1E39 A;  1F8W A;  4EIQ A;  2X8C A;  3UOY A;  3SQP A;  5JCM A;  2ARD A;  3UP4 A; 
#chains in the Genus database with same CATH homology
 3AE3 A;  1XPQ A;  1IJH A;  2GB0 A;  3WE0 A;  4UDP A;  3CNP A;  4A65 A;  2OAM A;  2RGJ A;  3CGE A;  3NN6 X;  4Y4L A;  1PBB A;  1B5Q A;  4YTP A;  1ZY8 A;  3I6D A;  2JAE A;  3FMW A;  3CN8 A;  4CCR A;  5GSN A;  5U63 A;  2V6O A;  1O5W A;  3CNJ A;  4P9S A;  1IUU A;  1E7P A;  4B66 A;  5CKU A;  2YVG A;  5GRT A;  4U8O A;  2OLN A;  3NNE A;  5KMQ A;  4AP3 A;  2YM1 A;  1N1P A;  2WOI A;  3P4S A;  3SZW A;  3AE7 A;  4TLZ A;  5IQ4 A;  2VRM A;  4K8D A;  3CPH G;  1W4X A;  1OJ9 A;  4IA6 A;  4I59 A;  1PHH A;  3DK9 A;  3CIR A;  4WCT A;  1PN0 A;  1L0V A;  3PVC A;  2YLW A;  3NHO X;  1CJ4 A;  1KFY A;  3VR8 A;  3LB8 A;  3B6D A;  3AD8 B;  4ICY A;  4N9X A;  3IHM A;  2WQY A;  2BCG G;  2EQ6 A;  1B4V A;  1LQU A;  1LQT A;  3FPZ A;  3GYX A;  3GD3 A;  3F8P A;  3ZYX A;  3HYV A;  2RGH A;  4X4J A;  4YKF A;  3NTA A;  2GMH A;  3G5Q A;  3T2K A;  4AOS A;  4EQW A;  2W0H A;  2GF3 A;  3D1C A;  2UZZ A;  1CJ3 A;  3BI2 A;  2IVD A;  4GCM A;  4B68 A;  4APN A;  4H4P A;  2Q0L A;  1TDE A;  3G5R A;  2WBA A;  3BI5 A;  3DJG X;  2X8G A;  4U8P A;  3UKH A;  5M10 A;  1FCD A;  3AEF A;  1D4C A;  3AE6 A;  1OJC A;  5KMS A;  5KVH A;  5KRQ A;  3UCL A;  2GQF A;  2OA1 A;  4DNA A;  3NTD A;  4EMJ A;  3BI4 A;  5LV9 A;  1Q1W A;  1S2Y A;  2A8X A;  3ABV A;  1OJD A;  2V3B A;  5IQ1 A;  4U8M A;  1GRE A;  5EOW A;  4EQX A;  2AAQ A;  1LPF A;  2X3N A;  3AEC A;  4RG4 A;  4TM1 A;  3LZX A;  3M12 A;  4U2L A;  3V76 A;  3T2Y A;  2JB2 A;  4K7Z A;  4DSH A;  3SY4 A;  1CJC A;  1NHQ A;  4BUR A;  3UOX A;  1K0J A;  2BC0 A;  3NG7 X;  1H7X A;  5BUK A;  3GWF A;  4GAP A;  2C76 A;  1CL0 A;  3C96 A;  4Z2R A;  1V59 A;  1JRX A;  4OVI A;  4I58 A;  1MO9 A;  3GDN A;  2XFU A;  4NEW A;  1YQZ A;  2R0G A;  3GMC A;  3P9U A;  2H89 A;  3UTF A;  3AEE A;  4G6H A;  1BZL A;  2HQM A;  4KX6 A;  2R0P A;  1H86 A;  2XVI A;  2I0Z A;  1DNC A;  4A6N A;  1Q9I A;  2BS2 A;  1BF3 A;  3LXD A;  4GDP A;  3GRT A;  1NHR A;  1N4W A;  2BXR A;  3VR9 A;  3RP8 A;  2A87 A;  1JU2 A;  2R0C A;  2Y6R A;  4AT2 A;  2BS4 A;  2R4E A;  1GTE A;  3NT6 A;  2DKH A;  2YLX A;  2GR1 A;  3UP5 A;  2VZ2 A;  1PJ6 A;  2GR2 A;  2YM2 A;  1ZDL A;  1KDG A;  2YAU A;  2Z5Y A;  3NYC A;  2XVE A;  4IA5 A;  3DJE A;  4OPU A;  4RG3 A;  4B64 A;  3AXB A;  1XDI A;  4B69 A;  3UKP A;  4IVM B;  1F6M A;  1GV4 A;  2BXS A;  2WPE A;  1Y56 B;  3GRS A;  4EQR A;  4YSH A;  2R4J A;  3BNU A;  1KSS A;  3Q9T A;  4J34 A;  2WDQ A;  4M52 A;  4EMI A;  3AD7 B;  2RGO A;  4II2 A;  3P4Q A;  2EQ7 A;  3VRA A;  1YQ4 A;  3NIX A;  2VRL A;  4Z25 A;  1QO8 A;  1EL5 A;  4OPI A;  2WET A;  3AE9 A;  5BVA A;  4CY8 A;  3T31 A;  4XWR A;  3QJ4 A;  3RP6 A;  3QVR A;  1JRZ A;  3EAN A;  1GOS A;  1NAA A;  3GDP A;  1TYP A;  3QFB A;  2QA2 A;  4J36 A;  5HHF A;  3SZC A;  3NGC X;  3DME A;  2V60 A;  4K5S A;  3UOV A;  4NWZ A;  2YLT A;  1H6V A;  3PO7 A;  2VVL G;  1GPE A;  4JY3 A;  1CC4 A;  1DOD A;  4USR A;  1K0L A;  1E6E A;  4J56 A;  2C4C A;  3H8I A;  2R46 A;  2V3A A;  2WEU A;  1BGJ A;  2YR6 A;  1IUX A;  3HZL A;  4FK1 C;  1H83 A;  3DH9 A;  4B67 A;  1F8S A;  2YG7 A;  4OCG A;  2BK3 A;  2WOV A;  2XLP A;  2VQB A;  2EQ8 A;  2ZBW A;  2YLR A;  1CBO A;  4UP3 A;  1E1N A;  1PS9 A;  2GH5 A;  1MOK A;  4NTD A;  2VVM A;  2XLT A;  3T14 A;  1VG0 A;  4GUV A;  3V3O A;  1FEC A;  5FS6 A;  3KVE A;  1BKW A;  1HYU A;  4Z44 A;  3SFE A;  4G73 A;  3DK4 A;  4O5U A;  3COX A;  3I3L A;  2XLS A;  1GRH A;  4FX9 A;  5C2T A;  1LJ1 A;  3AE2 A;  5JCK A;  2XCG A;  4YSY A;  2YG3 A;  5FS9 A;  2B7R A;  2BRA A;  4NTC A;  5U1O A;  1RSG A;  1ZMD A;  1ZK7 A;  2TMD A;  3IHG A;  3JSK A;  2WOW A;  2XVJ A;  3LAD A;  4IV9 A;  1OJT A;  4YTM A;  3CTY A;  4YWO A;  1MXT A;  1D7L A;  4H4T A;  5KMR A;  5KXJ A;  3RNM A;  4UDQ A;  3AE5 A;  3GWD A;  5HYM A;  4EIP A;  2GR0 A;  2JBV A;  3L8K A;  2OLO A;  4H4Y A;  4U2T A;  2J3N A;  1IUV A;  5L46 A;  4J33 A;  3FIM B;  2WDR A;  1Y56 A;  1PDH A;  4G9K A;  4X9N A;  3SM8 A;  2BAB A;  2E4G A;  3BHK A;  1D5T A;  1FL2 A;  1JOA A;  1NEK A;  4B65 A;  3NKS A;  3BNM A;  5JCL A;  3ALJ A;  4NNJ A;  4UDR A;  4Y4M A;  3IF9 A;  2XDO A;  4BK3 A;  3AD9 B;  4J31 A;  4JN9 A;  3AYL A;  3IWA A;  4HB9 A;  4YTN A;  1P2E A;  2C3D A;  2XFN A;  4Y4N A;  1GXF A;  4LII A;  2X99 A;  3AEB A;  4KPR A;  4TM3 A;  3DGZ A;  5FS7 A;  3UTE A;  4JY2 A;  2PYX A;  2C72 A;  2ACZ A;  3SX6 A;  4E0V A;  4C74 A;  4IVO B;  4K2X A;  2GQW A;  4B63 A;  3S5W A;  2QCU A;  1TDK A;  3QFA A;  1O95 A;  1ONF A;  3CGB A;  3CMM A;  2C66 A;  3ISH A;  2GR3 A;  3KD9 A;  2FJE A;  4JNA A;  4C77 A;  3DA1 A;  2O9Z A;  2WP5 A;  3V3N A;  1H82 A;  3AEG A;  3URH A;  4GDE A;  4TM4 A;  1GT8 A;  1RYI A;  3NH3 X;  1YY5 A;  4BJY A;  4AOX A;  3SYI A;  2V61 A;  1TRB A;  3NN0 X;  1PBE A;  2WU2 A;  1GET A;  3P4R A;  4GRT A;  5KNL A;  3ALM A;  4DSG A;  4U8K A;  4AP1 A;  2XVF A;  3AE8 A;  2Z5X A;  4Z24 A;  3KLJ A;  1D4D A;  4PAA A;  4U8J A;  3GMB A;  4YSZ A;  4ZCD A;  2CVJ A;  1NPX A;  1ZOV A;  1DOC A;  2GRT A;  2WDV A;  2YQU A;  4YXD A;  4A79 A;  4JQ9 A;  2X50 A;  1LVL A;  2BC1 A;  4ADW A;  1PXC A;  2Q0K A;  3CGC A;  1Q1R A;  1NHS A;  2QAE A;  3G5S A;  1NG3 A;  1EL8 A;  2C67 A;  2AQJ A;  4OPT A;  1VDC A;  1M64 A;  2WPF A;  4OPD A;  2E1M A;  4GF7 A;  4YKG A;  2WS3 A;  1PJ7 A;  1PXB A;  4G74 A;  1ZOY A;  3EAO A;  1RP0 A;  2EQ9 A;  2XLR A;  3L1R A;  5BRT A;  1GRB A;  1JNR A;  1P2H A;  1ELI A;  3NYF A;  1GRA A;  3P4P A;  1N4V A;  2WP9 A;  1M6I A;  1DJQ A;  3F8D A;  5ER0 A;  1GRG A;  4H50 A;  5J7X A;  2A89 A;  2JKC A;  3O0H A;  1JRY A;  3AWI A;  2BS3 A;  1EL7 A;  1K4Q A;  2Q6U A;  1CJ2 A;  4CNK A;  4H2N A;  4MJW A;  5C3J A;  2FJA A;  1DJN A;  2BK4 A;  4ECH A;  3UKF A;  1S3E A;  3FBS A;  3UTG A;  3DGH A;  3AYJ A;  4U8I A;  3T2Z A;  3AEA A;  4H7U A;  2C3C A;  3R9U A;  3CND A;  4A9W A;  3OC4 A;  2XLU A;  2YG4 A;  1YKJ A;  3ZDN A;  2JB3 A;  1CC2 A;  2B7S A;  2VQ7 A;  4EM4 A;  3DK8 A;  4OPG A;  4LU6 A;  1QLB A;  3QSM A;  4H4V A;  4H4S A;  3LJP A;  1D4E A;  4D03 A;  4H2P A;  1B37 A;  3SXI A;  2JK6 A;  4EMW A;  2ZZB A;  2FJB A;  4NEV A;  1VG9 A;  2RAB A;  2XVH A;  4CNJ A;  2NPX A;  2F5Z A;  2OAL A;  4X9M A;  2YG6 A;  3DJJ A;  3M13 A;  5M0Z A;  5HY5 A;  4H4X A;  2DKI A;  3K7Q X;  2Q7V A;  4H2Q A;  2ZZ0 A;  4H4W A;  4JNQ A;  4BK2 A;  4H4Z A;  5JCN A;  4ZN0 A;  3S61 A;  4CY6 A;  3RED A;  4A7A A;  5KOX A;  2QA1 A;  2X8H A;  4U8N A;  2B9W A;  2XFP A;  1Z6L A;  1LTX R;  4J2W A;  5FMH A;  3SZF A;  1NDA A;  4K22 A;  3VRD B;  1CC6 A;  3KU9 A;  3NK0 X;  3ATQ A;  5DBJ A;  1YQ3 A;  3EPT A;  4BK1 A;  3LOV A;  5HXI A;  1TDO A;  3C4A A;  1CF3 A;  3GYJ A;  2WU5 A;  3VRB A;  4A99 A;  4H4U A;  3AED A;  3RHA A;  4EM3 A;  2C73 A;  4HA6 A;  4REK A;  4TLX A;  3PS9 A;  1JNZ A;  2B9Y A;  3Q6J A;  2FJD A;  1EBD A;  3QSS A;  1N4U A;  1BWC A;  1F3P A;  2H88 A;  4Z43 A;  4A6N B;  2C64 A;  2B76 A;  4BV6 A;  3HYX A;  3FG2 P;  3UKQ A;  2XFO A;  1VQW A;  5KVI A;  1GRF A;  1H84 A;  4II3 A;  4FDC B;  3E1T A;  2XFQ A;  2YR4 A;  1SEZ A;  2PHH A;  3EF6 A;  1ZX9 A;  1S3B A;  2R45 A;  3KPK A;  1FEB A;  3NK2 X;  3C4N A;  3GD4 A;  4XWZ A;  1E1M A;  1GES A;  2C65 A;  3AE1 A;  4H4Q A;  1NG4 A;  1KSU A;  4XXG A;  2C7G A;  1GRT A;  1JEH A;  5BUL A;  3H8L A;  1KNP A;  3F8R A;  4H4R A;  1FOH A;  1O94 A;  1PBF A;  1E1L A;  4Z2T A;  3SGL A;  2BYB A;  1IUT A;  4NZH A;  2VOU A;  3SZ0 A;  2YLZ A;  1GEU A;  3AB1 A;  5U25 A;  4C5O A;  1NEN A;  3II4 A;  2AR8 A;  1Y0P A;  1VRQ B;  1LV0 A;  1OJA A;  4U2S A;  2CFY A;  4C3X A;  5KWF A;  1FEA A;  1TDF A;  2BK5 A;  1H7W A;  2GMJ A;  2GAG B;  1GAL A;  2IVE A;  3K7M X;  3K30 A;  4J57 A;  2BAC A;  2YR5 A;  4O5Q A;  2C75 A;  1REO A;  1GTH A;  1L9C A;  2V5Z A;  1D7Y A;  3HYW A;  5EB5 A;  2E5V A;  5IPY A;  1X31 B;  3QSE A;  1E1K A;  4K5R A;  3KA7 A;  1DXL A;  3BHF A;  3H4K A;  2CDU A;  1GER A;  4OPC A;  1IUS A;  1QJD A;  3NK1 X;  4USQ A;  2WP6 A;  4ZCC A;  3SFD A;  1ZP0 A;  1IUW A;  4NTE A;  3UKL A;  4U8L A;  3NRN A;  3GSI A;  1S2Q A;  2TPR A;  3ALL A;  2GEW A;  5JCI A;  2YVJ A;  3GYI A;  4EQS A;  3QVP A;  4YT0 A;  2YVF A;  2BRY A;  1ZKQ A;  2R9Z A;  4PAB A;  1BGN A;  3OZ2 A;  1H81 A;  1PBC A;  2NVK X;  3UTH A;  3M0O A;  1L9D A;  4C3Y A;  2GVC A;  3NYE A;  3B3R A;  4WX1 A;  1XAN A;  1TDN A;  4DGK A;  3AE4 A;  4B1B A;  1ZMC A;  4JDR A;  1DOE A;  4RSL A;  5J60 A;  1DOB A;  3VQR A;  4GR1 A;  4G6G A;  1GSN A;  3ITJ A;  1CHU A;  1NHP A;  3LZW A;  3CPJ G;  4FK1 A;  4YSX A;  1AOG A;  4CRT A;  4LA1 A;  2XYO A;  3DJD A;  2ZZC A;  4A5L A;  4CCQ A;  1KF6 A;  3D8X A;  5CQF A;  3IC9 A;  1PBD A;  4H2R A;  1PJ5 A;  1EL9 A;  2APG A;  2YLS A;  3CPI G;  3ICR A;  2BCP A;  4BJZ A;  3ICS A;  3NLC A;  4Z26 A;  4TM0 A;  3P1W A;  1L9E A;  3K7T A;  2WPC A;  3KKJ A;  3UKK A;  1F8R A;  2WES A;  2GAH B;  2VVL A;  3ATR A;  3ICT A;  5TR3 A;  4Z2U A;  1B8S A;  2BA9 A;  2B9X A;  3CGD A;  2FBW A;  3RP7 A;  4CBQ A;  1UKV G;  3UOZ A;  2YWL A;  5EBK A;  3T0K A;  3KPF A;  1KNR A;  5KMP A;  1PXA A;  1XHC A;  3ADA B;  4GAV A;  3UKA A;  1K0I A;  2CUL A;  3AYI A;  1TYT A;  2GV8 A;  2IID A;  2C70 A;  4OPL A;  2JB1 A;  3T37 A;  3CNT A;  2WHD A;  5KOW A;  5FS8 A;  4D04 A;  2Y6Q A;  5EB4 A;  3CNS A;  4AT0 A;  1GND A;  1COY A;  2YG5 A;  1E39 A;  1F8W A;  4EIQ A;  2X8C A;  3UOY A;  3SQP A;  5JCM A;  2ARD A;  3UP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...