3UOXA

Crystal structure of otemo (fad bound form 2)
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
540
structure length
537
Chain Sequence
KSPALDAVVIGAGVTGIYQAFLINQAGMKVLGIEAGEDVGGTWYWNRYPGCRLDTESYAYGYFALKGIIPEWEWSENFASQPEMLRYVNRAADAMDVRKHYRFNTRVTAARYVENDRLWEVTLDNEEVVTCRFLISATGPLSAPDIKGIDSFKGESFHSSRWPTDAEGAPKGVDFTGKRVGVIGTGATGVQIIPIAAETAKELYVFQRTPNWCTPLGNSPMSKEKMDSLRNRYPTILEYVKSTDTAFPYHRDPRKGTDVSESERDAFFEELYRQPGYGIWLSGFRDLLLNKESNKFLADFVAKKIRQRVKDPVVAEKLIPKDHPFGAKRVPMETNYYETYNRDNVHLVDIREAPIQEVTPEGIKTADAAYDLDVIIYATGFDAVTGSLDRIDIRGKDNVRLIDAWAEGPSTYLGLQARGFPNFFTLVGPHNGSTFCNVGVCGGLQAEWVLRMISYMKDNGFTYSEPTQAAENRWTEEVYADFSRTLLAEANAWWVKTTTKPDGSVVRRTLVHVSGGPEYRKRCEQVAYNNYNGFELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords OTEMO
publication title Cloning, Baeyer-Villiger biooxidations, and structures of the camphor pathway 2-oxo-{Delta}(3)-4,5,5-trimethylcyclopentenylacetyl-coenzyme A monooxygenase of Pseudomonas putida ATCC 17453.
pubmed doi rcsb
source organism Pseudomonas putida
total genus 194
structure length 537
sequence length 540
chains with identical sequence B
ec nomenclature ec 1.14.13.160: (2,2,3-trimethyl-5-oxocyclopent-3-enyl)acetyl-CoA 1,5-monooxygenase.
pdb deposition date 2011-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3uoxA01
2APGA 1F8RA 3NKSA 2VQBA 1E1KA 3GMCA 3T37A 4EQWA 1XPQA 1XANA 3P4PA 2YLTA 3LOVA 4GR1A 1EL8A 2AAQA 5KOXA 3AE9A 1CJ2A 2R46A 2IIDA 4C3YA 1OJAA 1JOAA 4B66A 3OC4A 1LPFA 1CHUA 4NTDA 3URHA 4CNKA 4PABA 1PBFA 4H4XA 2Z5XA 3LJPA 3UOZA 4EMIA 2XLUA 2YG4A 3AYJA 3ABVA 3H8IA 3GDNA 2VVLA 2V60A 1GRGA 4C77A 5GRTA 2WP5A 1E7PA 2YG5A 4PAAA 4BK2A 4YTNA 3AEGA 5EB5A 4O5UA 2BCPA 1KNPA 1H83A 1GRFA 1KFYA 2FJBA 4X4JA 5HYMA 1NHPA 2C65A 4HA6A 1NENA 3DJDA 4JQ9A 1FL2A 3IHMA 3DK8A 1QO8A 3C4NA 3OZ2A 4X9NA 3UKHA 1ZY8A 1TYPA 1EL9A 3CNSA 3G5RA 3QVRA 4H4VA 4A5LA 5HXIA 3CNTA 2XVFA 3F8RA 4U8LA 2XDOA 3ZDNA 1VG0A 4TM1A 3BNMA 3BHKA 4Y4MA 5FS6A 2JB2A 4B69A 1UKVG 1GSNA 4CRTA 2C3CA 2HQMA 4UDQA 4B1BA 4BV6A 1CJ4A 1E1LA 2WETA 4IVOB 5KOWA 1ZX9A 3I6DA 4TLZA 3H8LA 4NEVA 1BGJA 4YKGA 2R4JA 1FECA 2OA1A 1L9EA 1O95A 3RNMA 1NPXA 1BF3A 3AE1A 3B6DA 2TPRA 4EIPA 2XCGA 4LU6A 1B37A 1PBCA 3NYCA 3VRBA 4OPDA 2H89A 2A8XA 2X50A 3NH3X 5KVIA 3GRTA 2CDUA 5BRTA 2QA2A 4B63A 3PVCA 1GOSA 2WPEA 3P1WA 1O5WA 2EQ6A 3NLCA 3BNUA 3QSEA 3P4QA 1ZMCA 4H2RA 3NYFA 5KVHA 3NRNA 1GNDA 3VR9A 2ZZCA 4U8JA 4NTCA 3QFAA 3C96A 2E1MA 2C64A 2XYOA 1KSUA 1PHHA 4CBQA 5FS7A 1IUUA 3VQRA 4YSXA 4XXGA 2YR4A 1CC4A 3AE8A 4TM3A 3M13A 2Q0KA 1PXAA 3DJJA 2Y6QA 3BI4A 2CFYA 4OCGA 2BK4A 3CPHG 3UP5A 3EPTA 1B8SA 1VG9A 1FEBA 4ICYA 4J36A 3UTEA 3SM8A 3WE0A 1CC6A 3DGHA 4Z24A 4D04A 1H82A 2XVIA 2YQUA 4FX9A 3KPFA 1QJDA 2YM2A 5KXJA 2V3BA 1VQWA 2C72A 3KD9A 3LADA 1JRZA 2BC1A 3E1TA 3BHFA 4USRA 5J7XA 1DODA 3I3LA 4AP3A 4EQSA 5KWFA 3COXA 5DBJA 2R4EA 2V3AA 2BXRA 2BS4A 1ONFA 2Y6RA 4JNQA 2WP6A 3QSSA 1MO9A 4YXDA 2X3NA 1S3BA 2BACA 2BS2A 4A6NB 5FS8A 1CC2A 3UTFA 3ADAB 4YWOA 3FG2P 2XLPA 2B9XA 4H4YA 3LZWA 3NN6X 1DNCA 1E1NA 3GWFA 4BJYA 3GSIA 3LZXA 4CCQA 1DOBA 2A87A 4LIIA 2XVEA 2CVJA 5FS9A 4K2XA 1YQ4A 2BC0A 4DSGA 2WPCA 4H50A 3AEDA 2VZ2A 2GB0A 3CGEA 4J31A 5ER0A 2B9WA 4EMJA 3CNPA 4EQRA 1FOHA 2YVJA 4U8PA 2IVEA 4H2NA 1GERA 1LQUA 1TDKA 2XLSA 3SGLA 3GRSA 2JB1A 4H4PA 1LJ1A 3CIRA 3S5WA 4NEWA 2XFOA 1S2YA 2C3DA 3UTGA 4FK1C 1LTXR 4USQA 3G5QA 1BKWA 2O9ZA 4OPTA 2X8HA 5EB4A 1PN0A 2X99A 2XFQA 2BYBA 3CN8A 2F5ZA 4OPGA 4B68A 2VQ7A 4IVMB 2V6OA 3EF6A 2WOVA 1S3EA 4FDCB 2XLTA 1NHQA 3QFBA 1GALA 2WS3A 2IVDA 4OPCA 4C74A 3VR8A 3AYIA 1IJHA 1CJCA 2WP9A 1NG3A 2GQWA 2GVCA 2V5ZA 4H4RA 4ZCDA 4Z2TA 5U1OA 2YR6A 2FJEA 2I0ZA 4A9WA 2J3NA 2C70A 2R0CA 2XFUA 3IF9A 2TMDA 3AECA 4REKA 2VRLA 5KRQA 2GR1A 1D4EA 3V3NA 1RYIA 1GRAA 2RGOA 1D5TA 1YQZA 3K7TA 4U8IA 2GH5A 2YM1A 4UDRA 4ECHA 1EL7A 2BCGG 2BXSA 1DXLA 2C66A 5EBKA 3DA1A 4H4QA 3UKFA 4YSZA 2YWLA 3NG7X 1GRTA 1YKJA 1Q9IA 2JBVA 2WHDA 1TDEA 3FMWA 3HZLA 3AYLA 2BA9A 3ATQA 4U8OA 3FPZA 5C3JA 1GESA 3ICRA 4UP3A 2NPXA 3H4KA 4AP1A 3FBSA 3UTHA 2GAHB 2WEUA 2V61A 4H4WA 3DGZA 4GCMA 1GRBA 4DNAA 2B9YA 1D7YA 1ELIA 2R9ZA 3GYIA 2VVLG 4C5OA 3UKAA 1H86A 3GD4A 3B3RA 1REOA 1AOGA 5J60A 1PJ6A 4X9MA 4ADWA 3SQPA 1JNZA 1PJ5A 4JDRA 2VVMA 1ZP0A 4RG3A 3DK4A 5HY5A 4H4UA 4J33A 1F6MA 2UZZA 2GQFA 1TRBA 3R9UA 1CF3A 3LXDA 3NT6A 3Q9TA 3CNDA 4Z2UA 3F8PA 2VRMA 1BWCA 1NHRA 2XVJA 3SFDA 1IUSA 3PO7A 3QVPA 1JU2A 1Y56B 1IUVA 4AT2A 1BZLA 1BGNA 3M0OA 4B65A 2EQ8A 2NVKX 3KA7A 2YR5A 2WBAA 4TM0A 4Y4NA 1LQTA 1E39A 1JRYA 2JK6A 4J56A 3ALLA 1EL5A 4Y4LA 5M10A 4GRTA 3K7MX 4KPRA 4WCTA 2EQ7A 4Z26A 3DJGX 1TDNA 3P4SA 4U8NA 3UOVA 1Q1RA 3UOYA 1D7LA 2C67A 3KLJA 1GEUA 1B4VA 1K0IA 3AEEA 4LA1A 3ICTA 3ZYXA 1YQ3A 4YSYA 4YTPA 1GV4A 1CL0A 1F8WA 1PBEA 4RSLA 1OJCA 1N1PA 4NTEA 2Q7VA 1X31B 2GR2A 3K30A 1GTEA 3NIXA 3ALMA 4AOXA 4EM3A 4I58A 1DOCA 1MOKA 3NK0X 1KNRA 2ZZBA 3BI2A 2YLXA 1K0LA 1KSSA 3ATRA 3KKJA 4U2SA 5GSNA 3NTDA 5U25A 4A99A 2ARDA 4GDEA 4OPIA 1E6EA 1Q1WA 2GF3A 1OJTA 1H84A 1D4DA 2C76A 1PBDA 2B7SA 3AE7A 1SEZA 1XHCA 4TM4A 5FMHA 1Y0PA 1GREA 2GR0A 1H6VA 2QA1A 3V76A 4YT0A 1TDFA 2GEWA 2WDQA 2OALA 3UKLA 3AB1A 4UDPA 1COYA 3ITJA 3CGCA 4U2TA 4HB9A 1M6IA 1PXCA 2FBWA 1QLBA 2C73A 3JSKA 4FK1A 3EAOA 1Z6LA 4M52A 4JNAA 2CULA 5U63A 2Q6UA 1GRHA 3AWIA 2YG6A 3UKPA 4JY2A 5JCIA 1GPEA 2YLSA 2OLOA 1LV0A 3KVEA 4C3XA 2FJDA 2JKCA 3AD7B 2R0PA 2OLNA 4OVIA 2A89A 2DKIA 3DH9A 3REDA 5BUKA 3P9UA 3DMEA 3AXBA 3KU9A 2GMHA 2GR3A 4H4TA 3CNJA 1P2EA 2YLZA 1VRQB 2E4GA 2GMJA 3AE6A 4BJZA 4CY6A 2YAUA 2WU2A 2XFNA 1XDIA 3UKQA 4ZCCA 1F3PA 1NEKA 4TLXA 4K8DA 1ZKQA 3AE3A 2DKHA 3AEBA 5LV9A 1OJDA 3NTAA 2OAMA 2EQ9A 3CGBA 4B64A 1M64A 3AE2A 4YKFA 2BABA 3GDPA 1W4XA 3DK9A 3GYJA 4BK3A 1LVLA 2B76A 3O0HA 4XWRA 5JCLA 1KF6A 1S2QA 1DJNA 1DJQA 2XVHA 2XLRA 1B5QA 2YVFA 1YY5A 3UKKA 4IA5A 5JCNA 4XWZA 1GTHA 3NN0X 3IC9A 3UOXA 1H81A 1L9CA 5JCMA 2YLWA 2BK5A 2C7GA 4H2QA 2WESA 1EBDA 4MJWA 4RG4A 1GETA 4ZN0A 5L46A 5TR3A 3S61A 3LB8A 2PHHA 2YG3A 2ZBWA 4GUVA 2XFPA 1D4CA 1H7XA 5JCKA 3ALJA 3NK1X 3RP7A 2H88A 4D03A 3V3OA 1FCDA 3P4RA 2WDRA 1HYUA 2GRTA 3AE5A 1K4QA 4EM4A 2QAEA 2WDVA 4J34A 3ICSA 1CJ3A 1NDAA 1DOEA 1NAAA 3D8XA 4H4ZA 2WOIA 5BVAA 2X8CA 1Y56A 3ISHA 3NGCX 2R45A 5IPYA 4YSHA 3PS9A 4A7AA 4EMWA 2W0HA 1OJ9A 3DJEA 4APNA 1FEAA 2RGJA 4BURA 3QSMA 3L1RA 1MXTA 4P9SA 2YG7A 5IQ1A 1L0VA 3VRAA 3GWDA 2B7RA 3NYEA 1N4VA 3CTYA 2JAEA 1ZOYA 4Z44A 1H7WA 2BS3A 4GDPA 4J2WA 1V59A 4U2LA 1N4UA 5M0ZA 4I59A 1ZDLA 2FJAA 4IA6A 1F8SA 3GMBA 4K5RA 2GV8A 2QCUA 1N4WA 1IUXA 1NG4A 1JNRA 3D1CA 3RP8A 4Z2RA 3AEAA 1K0JA 2ZZ0A 3FIMB 4YTMA 4EQXA 5EOWA 3Q6JA 1NHSA 1PBBA 2WU5A 4A6NA 4CNJA 1PDHA 2X8GA 4Z43A 2WPFA 3AEFA 3NK2X 2WOWA 5CKUA 2YVGA 4KX6A 1JRXA 4DSHA 1KDGA 4N9XA 2RGHA 5HHFA 2ACZA 4AT0A 4CY8A 3NNEA 1GT8A 1TDOA 3IWAA 3BI5A 4O5QA 1PXBA 4IV9A 1VDCA 4A65A 3QJ4A 1TYTA 1ZOVA 2RABA 1P2HA 3G5SA 1ZK7A 3C4AA 3M12A 2WQYA 1RP0A 4K22A 4A79A 4JY3A 3IHGA 4BK1A 1E1MA 2C75A 4H4SA 2Z5YA 4JN9A 2JB3A 4EIQA 2AQJA 3NHOX 1PJ7A 2GAGB 5C2TA 5BULA 3RP6A 1ZMDA 3SFEA 4K5SA 4E0VA 1IUTA 1L9DA 3F8DA 5CQFA 3RHAA 4K7ZA 3VRDB 3CGDA 4B67A 4DGKA 4AOSA 3GD3A 2R0GA 1O94A 4OPUA 4H7UA 2Q0LA 3K7QX 4H2PA 3EANA 3UP4A 5IQ4A 4U8MA 1PS9A 1RSGA 3UCLA 2BK3A 2PYXA 3AD9B 3CPJG 3AD8B 1GXFA 2VOUA 3AE4A 4OPLA 4J57A 3II4A 4CCRA 1JEHA 4GF7A 1IUWA 3CPIG 1CBOA 4NZHA 4WX1A 3L8KA 4U8KA 2E5VA 2YLRA 2AR8A 4Z25A
chains in the Genus database with same CATH superfamily
2APGA 1F8RA 3NKSA 2VQBA 1E1KA 3GMCA 3T37A 4EQWA 1XPQA 1XANA 3P4PA 2YLTA 3LOVA 4GR1A 1EL8A 2AAQA 5KOXA 3AE9A 1CJ2A 2R46A 2IIDA 4C3YA 1OJAA 1JOAA 4B66A 3OC4A 1LPFA 1CHUA 4NTDA 3URHA 3SXIA 3SZFA 4PABA 1PBFA 4CNKA 4H4XA 2Z5XA 3LJPA 3UOZA 4EMIA 2XLUA 2YG4A 3AYJA 3ABVA 3H8IA 3GDNA 2VVLA 2V60A 1GRGA 4C77A 2C4CA 5GRTA 2WP5A 1E7PA 2YG5A 4PAAA 4BK2A 4YTNA 3AEGA 5EB5A 4O5UA 2BCPA 1KNPA 1H83A 1GRFA 1KFYA 2FJBA 4X4JA 5HYMA 1NHPA 2C65A 4HA6A 1NENA 3T14A 3DJDA 4JQ9A 1FL2A 3IHMA 3DK8A 1QO8A 3C4NA 3OZ2A 4X9NA 3UKHA 1ZY8A 1TYPA 1EL9A 3CNSA 3G5RA 3QVRA 4H4VA 4A5LA 5HXIA 3CNTA 2XVFA 3F8RA 4U8LA 2XDOA 3ZDNA 1VG0A 4TM1A 3BNMA 3BHKA 4Y4MA 5FS6A 2JB2A 4B69A 1UKVG 1GSNA 4CRTA 2C3CA 2HQMA 4UDQA 4B1BA 4BV6A 1CJ4A 1E1LA 2WETA 4IVOB 5KOWA 1ZX9A 3I6DA 4TLZA 3H8LA 4NEVA 1BGJA 4YKGA 2R4JA 1FECA 2OA1A 1L9EA 1O95A 3RNMA 1NPXA 1BF3A 3AE1A 3B6DA 2TPRA 4EIPA 2XCGA 4LU6A 5KMSA 1B37A 3T2KA 1PBCA 3NYCA 3VRBA 4OPDA 2H89A 2A8XA 2X50A 3NH3X 5KVIA 3GRTA 2CDUA 5BRTA 2QA2A 4B63A 3PVCA 1GOSA 2WPEA 3P1WA 1O5WA 2EQ6A 3NLCA 3BNUA 3QSEA 3P4QA 3T0KA 1ZMCA 4H2RA 3NYFA 5KVHA 3NRNA 1GNDA 4G9KA 3VR9A 2ZZCA 4U8JA 4NTCA 3QFAA 3C96A 2E1MA 2C64A 2XYOA 1KSUA 1PHHA 4CBQA 5FS7A 1IUUA 3VQRA 4YSXA 4XXGA 2YR4A 1CC4A 3AE8A 4TM3A 3M13A 2Q0KA 1PXAA 3DJJA 2Y6QA 3BI4A 2CFYA 4OCGA 2BK4A 3CPHG 3UP5A 3EPTA 1B8SA 1VG9A 1FEBA 4ICYA 4J36A 3SZCA 3SM8A 3UTEA 3WE0A 1CC6A 3HYVA 3DGHA 4Z24A 4D04A 1H82A 2XVIA 2YQUA 4FX9A 3KPFA 1QJDA 2YM2A 5KXJA 2V3BA 1VQWA 2C72A 3KD9A 3LADA 1JRZA 2BC1A 3E1TA 3BHFA 4USRA 5J7XA 1DODA 3I3LA 4AP3A 4EQSA 5KWFA 3COXA 5DBJA 2R4EA 2V3AA 2BXRA 2BS4A 1ONFA 2Y6RA 4JNQA 2WP6A 3QSSA 1MO9A 4YXDA 2X3NA 1S3BA 2BACA 2BS2A 4A6NB 5FS8A 1CC2A 3UTFA 3ADAB 4YWOA 3FG2P 2XLPA 2B9XA 4H4YA 3LZWA 3NN6X 1DNCA 1E1NA 3GWFA 4BJYA 3GSIA 3LZXA 4CCQA 1DOBA 2A87A 4LIIA 2XVEA 2CVJA 5FS9A 4K2XA 1YQ4A 2BC0A 4DSGA 2WPCA 4H50A 2BRAA 3AEDA 2VZ2A 2GB0A 3CGEA 4J31A 5ER0A 2B9WA 4EMJA 3CNPA 4GAVA 4EQRA 1FOHA 2YVJA 4U8PA 2IVEA 4H2NA 1GERA 1LQUA 1TDKA 2XLSA 3SGLA 3GRSA 2JB1A 5KMQA 4H4PA 1LJ1A 3CIRA 3S5WA 4NEWA 2XFOA 1S2YA 4G6HA 3SZWA 2C3DA 3UTGA 4FK1C 1LTXR 4USQA 3G5QA 1BKWA 2O9ZA 4OPTA 2X8HA 5EB4A 1PN0A 2X99A 2XFQA 2BYBA 3CN8A 2F5ZA 4OPGA 4B68A 2VQ7A 4IVMB 4G74A 2V6OA 3EF6A 2WOVA 1S3EA 4FDCB 2XLTA 3T2YA 1NHQA 3QFBA 1GALA 2WS3A 2IVDA 4OPCA 4C74A 3VR8A 3AYIA 1IJHA 1CJCA 2WP9A 1NG3A 2GQWA 2GVCA 2V5ZA 4H4RA 4ZCDA 4Z2TA 5U1OA 2YR6A 2FJEA 2I0ZA 4A9WA 2J3NA 2C70A 2R0CA 2XFUA 3IF9A 2TMDA 3AECA 4REKA 2VRLA 5KRQA 2GR1A 1D4EA 3V3NA 1RYIA 1GRAA 2RGOA 1D5TA 1YQZA 3K7TA 4U8IA 2GH5A 2YM1A 4UDRA 4ECHA 1EL7A 2BCGG 2BXSA 1DXLA 2C66A 5EBKA 3DA1A 4H4QA 3UKFA 4YSZA 2YWLA 3NG7X 1GRTA 1YKJA 1Q9IA 2JBVA 2WHDA 1TDEA 3FMWA 3HZLA 3AYLA 2BA9A 3ATQA 4U8OA 3FPZA 5C3JA 1GESA 3ICRA 4UP3A 2NPXA 3H4KA 4AP1A 3FBSA 3UTHA 2GAHB 2WEUA 2V61A 4H4WA 3DGZA 4GCMA 1GRBA 4DNAA 2B9YA 1D7YA 1ELIA 2R9ZA 3GYIA 2VVLG 4C5OA 3UKAA 1H86A 3GD4A 4II2A 3B3RA 1REOA 1AOGA 5J60A 1PJ6A 4X9MA 4ADWA 3SQPA 1JNZA 1PJ5A 4JDRA 2VVMA 1ZP0A 4RG3A 3DK4A 5HY5A 4H4UA 4J33A 1F6MA 2UZZA 2GQFA 1TRBA 3R9UA 1CF3A 3LXDA 3NT6A 3Q9TA 3CNDA 4Z2UA 3F8PA 2VRMA 1BWCA 1NHRA 2XVJA 3SFDA 1IUSA 3PO7A 3QVPA 1JU2A 3T2ZA 1Y56B 1IUVA 4AT2A 5KMPA 1BZLA 1BGNA 3M0OA 4B65A 2EQ8A 2NVKX 3KA7A 2YR5A 2WBAA 4TM0A 4Y4NA 1LQTA 1E39A 1JRYA 2JK6A 4J56A 3ALLA 1EL5A 4Y4LA 5M10A 4GRTA 3K7MX 4KPRA 4WCTA 2EQ7A 4Z26A 3DJGX 1TDNA 3P4SA 4U8NA 3UOVA 1Q1RA 3UOYA 1D7LA 4NNJA 2C67A 3KLJA 1GEUA 1B4VA 1K0IA 3AEEA 4LA1A 3ICTA 3ZYXA 1YQ3A 4YSYA 4YTPA 1GV4A 1CL0A 1F8WA 1PBEA 4RSLA 1OJCA 1N1PA 4NTEA 2Q7VA 1X31B 2GR2A 3K30A 1GTEA 3NIXA 3ALMA 4AOXA 4EM3A 4I58A 1DOCA 1MOKA 3NK0X 1KNRA 2ZZBA 3BI2A 2YLXA 1K0LA 1KSSA 3ATRA 3KKJA 4U2SA 5GSNA 3NTDA 5U25A 4A99A 2ARDA 4GDEA 4OPIA 1E6EA 1Q1WA 2GF3A 1OJTA 1H84A 1D4DA 2C76A 1PBDA 2B7SA 3AE7A 1SEZA 1XHCA 4TM4A 4G73A 2BRYA 5FMHA 1Y0PA 1GREA 2GR0A 1H6VA 2QA1A 3V76A 4YT0A 1TDFA 2GEWA 2WDQA 2OALA 3UKLA 3AB1A 4UDPA 1COYA 4GAPA 3ITJA 3CGCA 4U2TA 4HB9A 1M6IA 1PXCA 2FBWA 1QLBA 2C73A 3JSKA 4FK1A 3EAOA 1Z6LA 4M52A 4JNAA 2CULA 5U63A 2Q6UA 1GRHA 3AWIA 2YG6A 3UKPA 4JY2A 5JCIA 1GPEA 2YLSA 2OLOA 1LV0A 3KVEA 4C3XA 2FJDA 2JKCA 3HYWA 3AD7B 2R0PA 2OLNA 4OVIA 2A89A 2DKIA 3DH9A 3REDA 5BUKA 3P9UA 3DMEA 3AXBA 3KU9A 2GMHA 2GR3A 4H4TA 3CNJA 1P2EA 2YLZA 1VRQB 2E4GA 2GMJA 3AE6A 4BJZA 4CY6A 2YAUA 2WU2A 2XFNA 1XDIA 3UKQA 4ZCCA 1F3PA 1NEKA 4TLXA 4K8DA 1ZKQA 3AE3A 2DKHA 3AEBA 3CMMA 5LV9A 4G6GA 3SYIA 1OJDA 3NTAA 2OAMA 2EQ9A 3CGBA 4B64A 1M64A 3AE2A 3SZ0A 4YKFA 2BABA 3GDPA 1W4XA 3DK9A 3GYJA 4BK3A 5KNLA 1LVLA 2B76A 3O0HA 4XWRA 5JCLA 1KF6A 1S2QA 1DJNA 1DJQA 2XVHA 2XLRA 1B5QA 2YVFA 1YY5A 3UKKA 4IA5A 5JCNA 4XWZA 1GTHA 3NN0X 3IC9A 3UOXA 1H81A 1L9CA 5JCMA 2YLWA 2BK5A 2C7GA 4H2QA 2WESA 1EBDA 4MJWA 4RG4A 1GETA 4ZN0A 5L46A 5TR3A 3S61A 3LB8A 2PHHA 2YG3A 2ZBWA 4GUVA 2XFPA 1D4CA 1H7XA 3HYXA 3ALJA 5JCKA 3NK1X 3RP7A 2H88A 4D03A 3V3OA 1FCDA 4NWZA 3P4RA 2WDRA 1HYUA 2GRTA 3T31A 3AE5A 1K4QA 4EM4A 2QAEA 2WDVA 4J34A 3ICSA 1CJ3A 1NDAA 1DOEA 1NAAA 3D8XA 4H4ZA 2WOIA 5BVAA 2X8CA 1Y56A 3ISHA 3NGCX 2R45A 5IPYA 4YSHA 3PS9A 4A7AA 4EMWA 2W0HA 1OJ9A 3DJEA 4APNA 1FEAA 2RGJA 4BURA 3QSMA 3L1RA 1MXTA 3SY4A 4P9SA 2YG7A 5IQ1A 1L0VA 3VRAA 3GWDA 2B7RA 3NYEA 1N4VA 5KMRA 3CTYA 2JAEA 1ZOYA 4Z44A 1H7WA 2BS3A 4GDPA 4J2WA 1V59A 4U2LA 1N4UA 5M0ZA 4I59A 1ZDLA 2FJAA 4IA6A 1F8SA 3GMBA 4K5RA 2GV8A 2QCUA 1N4WA 1IUXA 1NG4A 1JNRA 3D1CA 3RP8A 4Z2RA 3AEAA 1K0JA 2ZZ0A 3FIMB 4YTMA 4EQXA 5EOWA 3SX6A 3Q6JA 1NHSA 1PBBA 2WU5A 4A6NA 4CNJA 1PDHA 2X8GA 4Z43A 2WPFA 3AEFA 3NK2X 2WOWA 5CKUA 2YVGA 4KX6A 1JRXA 4DSHA 1KDGA 4N9XA 2RGHA 5HHFA 2ACZA 4AT0A 4CY8A 3NNEA 1GT8A 1TDOA 3IWAA 3BI5A 4O5QA 1PXBA 4IV9A 1VDCA 4A65A 3QJ4A 1TYTA 1ZOVA 2RABA 1P2HA 3G5SA 1ZK7A 3C4AA 3M12A 2WQYA 1RP0A 3KPKA 4K22A 4A79A 4JY3A 3GYXA 3IHGA 4BK1A 1E1MA 2C75A 4H4SA 2Z5YA 4JN9A 2JB3A 4EIQA 2AQJA 3NHOX 1PJ7A 2GAGB 5C2TA 5BULA 3RP6A 1ZMDA 3SFEA 4K5SA 4E0VA 1IUTA 1L9DA 3F8DA 5CQFA 3RHAA 4K7ZA 3VRDB 3CGDA 4B67A 4DGKA 4AOSA 3GD3A 2R0GA 1O94A 4OPUA 4H7UA 2Q0LA 3K7QX 4H2PA 3EANA 3UP4A 5IQ4A 4U8MA 1PS9A 1RSGA 3UCLA 2BK3A 4II3A 2PYXA 3AD9B 3CPJG 3AD8B 1GXFA 2VOUA 3AE4A 4OPLA 4J57A 3II4A 4CCRA 1JEHA 4GF7A 1IUWA 3CPIG 1CBOA 4NZHA 4WX1A 3L8KA 4U8KA 2E5VA 2YLRA 2AR8A 4Z25A
chains in the Genus database with same CATH topology
2APGA 1F8RA 3NKSA 2VQBA 1E1KA 3GMCA 3T37A 4EQWA 1XPQA 1XANA 3P4PA 2YLTA 3LOVA 4GR1A 1EL8A 2AAQA 5KOXA 3AE9A 1CJ2A 2R46A 2IIDA 4C3YA 1OJAA 1JOAA 4B66A 3OC4A 1LPFA 1CHUA 4NTDA 3URHA 3SXIA 3SZFA 4PABA 1PBFA 4CNKA 4H4XA 2Z5XA 3LJPA 3UOZA 4EMIA 2XLUA 2YG4A 3AYJA 3ABVA 3H8IA 3GDNA 2VVLA 2V60A 1GRGA 4C77A 2C4CA 5GRTA 2WP5A 1E7PA 2YG5A 4PAAA 4BK2A 4YTNA 3AEGA 5EB5A 4O5UA 2BCPA 1KNPA 1H83A 1GRFA 1KFYA 2FJBA 4X4JA 5HYMA 1NHPA 2C65A 4HA6A 1NENA 3T14A 3DJDA 4JQ9A 1FL2A 3IHMA 3DK8A 1QO8A 3C4NA 3OZ2A 4X9NA 3UKHA 1ZY8A 1TYPA 1EL9A 3CNSA 3G5RA 3QVRA 4H4VA 4A5LA 5HXIA 3CNTA 2XVFA 3F8RA 4U8LA 2XDOA 3ZDNA 1VG0A 4TM1A 3BNMA 3BHKA 4Y4MA 5FS6A 2JB2A 4B69A 1UKVG 1GSNA 4CRTA 2C3CA 2HQMA 4UDQA 4B1BA 4BV6A 1CJ4A 1E1LA 2WETA 4IVOB 5KOWA 1ZX9A 3I6DA 4TLZA 3H8LA 4NEVA 1BGJA 4YKGA 2R4JA 1FECA 2OA1A 1L9EA 1O95A 3RNMA 1NPXA 1BF3A 3AE1A 3B6DA 2TPRA 4EIPA 2XCGA 4LU6A 5KMSA 1B37A 3T2KA 1PBCA 3NYCA 3VRBA 4OPDA 2H89A 2A8XA 2X50A 3NH3X 5KVIA 3GRTA 2CDUA 5BRTA 2QA2A 4B63A 3PVCA 1GOSA 2WPEA 3P1WA 1O5WA 2EQ6A 3NLCA 3BNUA 3QSEA 3P4QA 3T0KA 1ZMCA 4H2RA 3NYFA 5KVHA 3NRNA 1GNDA 4G9KA 3VR9A 2ZZCA 4U8JA 4NTCA 3QFAA 3C96A 2E1MA 2C64A 2XYOA 1KSUA 1PHHA 4CBQA 5FS7A 1IUUA 3VQRA 4YSXA 4XXGA 2YR4A 1CC4A 3AE8A 4TM3A 3M13A 2Q0KA 1PXAA 3DJJA 2Y6QA 3BI4A 2CFYA 4OCGA 2BK4A 3CPHG 3UP5A 3EPTA 1B8SA 1VG9A 1FEBA 4ICYA 4J36A 3SZCA 3SM8A 3UTEA 3WE0A 1CC6A 3HYVA 3DGHA 4Z24A 4D04A 1H82A 2XVIA 2YQUA 4FX9A 3KPFA 1QJDA 2YM2A 5KXJA 2V3BA 1VQWA 2C72A 3KD9A 3LADA 1JRZA 2BC1A 3E1TA 3BHFA 4USRA 5J7XA 1DODA 3I3LA 4AP3A 4EQSA 5KWFA 3COXA 5DBJA 2R4EA 2V3AA 2BXRA 2BS4A 1ONFA 2Y6RA 4JNQA 2WP6A 3QSSA 1MO9A 4YXDA 2X3NA 1S3BA 2BACA 2BS2A 4A6NB 5FS8A 1CC2A 3UTFA 3ADAB 4YWOA 3FG2P 2XLPA 2B9XA 4H4YA 3LZWA 3NN6X 1DNCA 1E1NA 3GWFA 4BJYA 3GSIA 3LZXA 4CCQA 1DOBA 2A87A 4LIIA 2XVEA 2CVJA 5FS9A 4K2XA 1YQ4A 2BC0A 4DSGA 2WPCA 4H50A 2BRAA 3AEDA 2VZ2A 2GB0A 3CGEA 4J31A 5ER0A 2B9WA 4EMJA 3CNPA 4GAVA 4EQRA 1FOHA 2YVJA 4U8PA 2IVEA 4H2NA 1GERA 1LQUA 1TDKA 2XLSA 3SGLA 3GRSA 2JB1A 5KMQA 4H4PA 1LJ1A 3CIRA 3S5WA 4NEWA 2XFOA 1S2YA 4G6HA 3SZWA 2C3DA 3UTGA 4FK1C 1LTXR 4USQA 3G5QA 1BKWA 2O9ZA 4OPTA 2X8HA 5EB4A 1PN0A 2X99A 2XFQA 2BYBA 3CN8A 2F5ZA 4OPGA 4B68A 2VQ7A 4IVMB 4G74A 2V6OA 3EF6A 2WOVA 1S3EA 4FDCB 2XLTA 3T2YA 1NHQA 3QFBA 1GALA 2WS3A 2IVDA 4OPCA 4C74A 3VR8A 3AYIA 1IJHA 1CJCA 2WP9A 1NG3A 2GQWA 2GVCA 2V5ZA 4H4RA 4ZCDA 4Z2TA 5U1OA 2YR6A 2FJEA 2I0ZA 4A9WA 2J3NA 2C70A 2R0CA 2XFUA 3IF9A 2TMDA 3AECA 4REKA 2VRLA 5KRQA 2GR1A 1D4EA 3V3NA 1RYIA 1GRAA 2RGOA 1D5TA 1YQZA 3K7TA 4U8IA 2GH5A 2YM1A 4UDRA 4ECHA 1EL7A 2BCGG 2BXSA 1DXLA 2C66A 5EBKA 3DA1A 4H4QA 3UKFA 4YSZA 2YWLA 3NG7X 1GRTA 1YKJA 1Q9IA 2JBVA 2WHDA 1TDEA 3FMWA 3HZLA 3AYLA 2BA9A 3ATQA 4U8OA 3FPZA 5C3JA 1GESA 3ICRA 4UP3A 2NPXA 3H4KA 4AP1A 3FBSA 3UTHA 2GAHB 2WEUA 2V61A 4H4WA 3DGZA 4GCMA 1GRBA 4DNAA 2B9YA 1D7YA 1ELIA 2R9ZA 3GYIA 2VVLG 4C5OA 3UKAA 1H86A 3GD4A 4II2A 3B3RA 1REOA 1AOGA 5J60A 1PJ6A 4X9MA 4ADWA 3SQPA 1JNZA 1PJ5A 4JDRA 2VVMA 1ZP0A 4RG3A 3DK4A 5HY5A 4H4UA 4J33A 1F6MA 2UZZA 2GQFA 1TRBA 3R9UA 1CF3A 3LXDA 3NT6A 3Q9TA 3CNDA 4Z2UA 3F8PA 2VRMA 1BWCA 1NHRA 2XVJA 3SFDA 1IUSA 3PO7A 3QVPA 1JU2A 3T2ZA 1Y56B 1IUVA 4AT2A 5KMPA 1BZLA 1BGNA 3M0OA 4B65A 2EQ8A 2NVKX 3KA7A 2YR5A 2WBAA 4TM0A 4Y4NA 1LQTA 1E39A 1JRYA 2JK6A 4J56A 3ALLA 1EL5A 4Y4LA 5M10A 4GRTA 3K7MX 4KPRA 4WCTA 2EQ7A 4Z26A 3DJGX 1TDNA 3P4SA 4U8NA 3UOVA 1Q1RA 3UOYA 1D7LA 4NNJA 2C67A 3KLJA 1GEUA 1B4VA 1K0IA 3AEEA 4LA1A 3ICTA 3ZYXA 1YQ3A 4YSYA 4YTPA 1GV4A 1CL0A 1F8WA 1PBEA 4RSLA 1OJCA 1N1PA 4NTEA 2Q7VA 1X31B 2GR2A 3K30A 1GTEA 3NIXA 3ALMA 4AOXA 4EM3A 4I58A 1DOCA 1MOKA 3NK0X 1KNRA 2ZZBA 3BI2A 2YLXA 1K0LA 1KSSA 3ATRA 3KKJA 4U2SA 5GSNA 3NTDA 5U25A 4A99A 2ARDA 4GDEA 4OPIA 1E6EA 1Q1WA 2GF3A 1OJTA 1H84A 1D4DA 2C76A 1PBDA 2B7SA 3AE7A 1SEZA 1XHCA 4TM4A 4G73A 2BRYA 5FMHA 1Y0PA 1GREA 2GR0A 1H6VA 2QA1A 3V76A 4YT0A 1TDFA 2GEWA 2WDQA 2OALA 3UKLA 3AB1A 4UDPA 1COYA 4GAPA 3ITJA 3CGCA 4U2TA 4HB9A 1M6IA 1PXCA 2FBWA 1QLBA 2C73A 3JSKA 4FK1A 3EAOA 1Z6LA 4M52A 4JNAA 2CULA 5U63A 2Q6UA 1GRHA 3AWIA 2YG6A 3UKPA 4JY2A 5JCIA 1GPEA 2YLSA 2OLOA 1LV0A 3KVEA 4C3XA 2FJDA 2JKCA 3HYWA 3AD7B 2R0PA 2OLNA 4OVIA 2A89A 2DKIA 3DH9A 3REDA 5BUKA 3P9UA 3DMEA 3AXBA 3KU9A 2GMHA 2GR3A 4H4TA 3CNJA 1P2EA 2YLZA 1VRQB 2E4GA 2GMJA 3AE6A 4BJZA 4CY6A 2YAUA 2WU2A 2XFNA 1XDIA 3UKQA 4ZCCA 1F3PA 1NEKA 4TLXA 4K8DA 1ZKQA 3AE3A 2DKHA 3AEBA 3CMMA 5LV9A 4G6GA 3SYIA 1OJDA 3NTAA 2OAMA 2EQ9A 3CGBA 4B64A 1M64A 3AE2A 3SZ0A 4YKFA 2BABA 3GDPA 1W4XA 3DK9A 3GYJA 4BK3A 5KNLA 1LVLA 2B76A 3O0HA 4XWRA 5JCLA 1KF6A 1S2QA 1DJNA 1DJQA 2XVHA 2XLRA 1B5QA 2YVFA 1YY5A 3UKKA 4IA5A 5JCNA 4XWZA 1GTHA 3NN0X 3IC9A 3UOXA 1H81A 1L9CA 5JCMA 2YLWA 2BK5A 2C7GA 4H2QA 2WESA 1EBDA 4MJWA 4RG4A 1GETA 4ZN0A 5L46A 5TR3A 3S61A 3LB8A 2PHHA 2YG3A 2ZBWA 4GUVA 2XFPA 1D4CA 1H7XA 3HYXA 3ALJA 5JCKA 3NK1X 3RP7A 2H88A 4D03A 3V3OA 1FCDA 4NWZA 3P4RA 2WDRA 1HYUA 2GRTA 3T31A 3AE5A 1K4QA 4EM4A 2QAEA 2WDVA 4J34A 3ICSA 1CJ3A 1NDAA 1DOEA 1NAAA 3D8XA 4H4ZA 2WOIA 5BVAA 2X8CA 1Y56A 3ISHA 3NGCX 2R45A 5IPYA 4YSHA 3PS9A 4A7AA 4EMWA 2W0HA 1OJ9A 3DJEA 4APNA 1FEAA 2RGJA 4BURA 3QSMA 3L1RA 1MXTA 3SY4A 4P9SA 2YG7A 5IQ1A 1L0VA 3VRAA 3GWDA 2B7RA 3NYEA 1N4VA 5KMRA 3CTYA 2JAEA 1ZOYA 4Z44A 1H7WA 2BS3A 4GDPA 4J2WA 1V59A 4U2LA 1N4UA 5M0ZA 4I59A 1ZDLA 2FJAA 4IA6A 1F8SA 3GMBA 4K5RA 2GV8A 2QCUA 1N4WA 1IUXA 1NG4A 1JNRA 3D1CA 3RP8A 4Z2RA 3AEAA 1K0JA 2ZZ0A 3FIMB 4YTMA 4EQXA 5EOWA 3SX6A 3Q6JA 1NHSA 1PBBA 2WU5A 4A6NA 4CNJA 1PDHA 2X8GA 4Z43A 2WPFA 3AEFA 3NK2X 2WOWA 5CKUA 2YVGA 4KX6A 1JRXA 4DSHA 1KDGA 4N9XA 2RGHA 5HHFA 2ACZA 4AT0A 4CY8A 3NNEA 1GT8A 1TDOA 3IWAA 3BI5A 4O5QA 1PXBA 4IV9A 1VDCA 4A65A 3QJ4A 1TYTA 1ZOVA 2RABA 1P2HA 3G5SA 1ZK7A 3C4AA 3M12A 2WQYA 1RP0A 3KPKA 4K22A 4A79A 4JY3A 3GYXA 3IHGA 4BK1A 1E1MA 2C75A 4H4SA 2Z5YA 4JN9A 2JB3A 4EIQA 2AQJA 3NHOX 1PJ7A 2GAGB 5C2TA 5BULA 3RP6A 1ZMDA 3SFEA 4K5SA 4E0VA 1IUTA 1L9DA 3F8DA 5CQFA 3RHAA 4K7ZA 3VRDB 3CGDA 4B67A 4DGKA 4AOSA 3GD3A 2R0GA 1O94A 4OPUA 4H7UA 2Q0LA 3K7QX 4H2PA 3EANA 3UP4A 5IQ4A 4U8MA 1PS9A 1RSGA 3UCLA 2BK3A 4II3A 2PYXA 3AD9B 3CPJG 3AD8B 1GXFA 2VOUA 3AE4A 4OPLA 4J57A 3II4A 4CCRA 1JEHA 4GF7A 1IUWA 3CPIG 1CBOA 4NZHA 4WX1A 3L8KA 4U8KA 2E5VA 2YLRA 2AR8A 4Z25A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2APG A;  1F8R A;  3NKS A;  2VQB A;  1E1K A;  3GMC A;  3T37 A;  4EQW A;  1XPQ A;  1XAN A;  3P4P A;  2YLT A;  3LOV A;  4GR1 A;  1EL8 A;  2AAQ A;  5KOX A;  3AE9 A;  1CJ2 A;  2R46 A;  2IID A;  4C3Y A;  1OJA A;  1JOA A;  4B66 A;  3OC4 A;  1LPF A;  1CHU A;  4NTD A;  3URH A;  4CNK A;  4PAB A;  1PBF A;  4H4X A;  2Z5X A;  3LJP A;  3UOZ A;  4EMI A;  2XLU A;  2YG4 A;  3AYJ A;  3ABV A;  3H8I A;  3GDN A;  2VVL A;  2V60 A;  1GRG A;  4C77 A;  5GRT A;  2WP5 A;  1E7P A;  2YG5 A;  4PAA A;  4BK2 A;  4YTN A;  3AEG A;  5EB5 A;  4O5U A;  2BCP A;  1KNP A;  1H83 A;  1GRF A;  1KFY A;  2FJB A;  4X4J A;  5HYM A;  1NHP A;  2C65 A;  4HA6 A;  1NEN A;  3DJD A;  4JQ9 A;  1FL2 A;  3IHM A;  3DK8 A;  1QO8 A;  3C4N A;  3OZ2 A;  4X9N A;  3UKH A;  1ZY8 A;  1TYP A;  1EL9 A;  3CNS A;  3G5R A;  3QVR A;  4H4V A;  4A5L A;  5HXI A;  3CNT A;  2XVF A;  3F8R A;  4U8L A;  2XDO A;  3ZDN A;  1VG0 A;  4TM1 A;  3BNM A;  3BHK A;  4Y4M A;  5FS6 A;  2JB2 A;  4B69 A;  1UKV G;  1GSN A;  4CRT A;  2C3C A;  2HQM A;  4UDQ A;  4B1B A;  4BV6 A;  1CJ4 A;  1E1L A;  2WET A;  4IVO B;  5KOW A;  1ZX9 A;  3I6D A;  4TLZ A;  3H8L A;  4NEV A;  1BGJ A;  4YKG A;  2R4J A;  1FEC A;  2OA1 A;  1L9E A;  1O95 A;  3RNM A;  1NPX A;  1BF3 A;  3AE1 A;  3B6D A;  2TPR A;  4EIP A;  2XCG A;  4LU6 A;  1B37 A;  1PBC A;  3NYC A;  3VRB A;  4OPD A;  2H89 A;  2A8X A;  2X50 A;  3NH3 X;  5KVI A;  3GRT A;  2CDU A;  5BRT A;  2QA2 A;  4B63 A;  3PVC A;  1GOS A;  2WPE A;  3P1W A;  1O5W A;  2EQ6 A;  3NLC A;  3BNU A;  3QSE A;  3P4Q A;  1ZMC A;  4H2R A;  3NYF A;  5KVH A;  3NRN A;  1GND A;  3VR9 A;  2ZZC A;  4U8J A;  4NTC A;  3QFA A;  3C96 A;  2E1M A;  2C64 A;  2XYO A;  1KSU A;  1PHH A;  4CBQ A;  5FS7 A;  1IUU A;  3VQR A;  4YSX A;  4XXG A;  2YR4 A;  1CC4 A;  3AE8 A;  4TM3 A;  3M13 A;  2Q0K A;  1PXA A;  3DJJ A;  2Y6Q A;  3BI4 A;  2CFY A;  4OCG A;  2BK4 A;  3CPH G;  3UP5 A;  3EPT A;  1B8S A;  1VG9 A;  1FEB A;  4ICY A;  4J36 A;  3UTE A;  3SM8 A;  3WE0 A;  1CC6 A;  3DGH A;  4Z24 A;  4D04 A;  1H82 A;  2XVI A;  2YQU A;  4FX9 A;  3KPF A;  1QJD A;  2YM2 A;  5KXJ A;  2V3B A;  1VQW A;  2C72 A;  3KD9 A;  3LAD A;  1JRZ A;  2BC1 A;  3E1T A;  3BHF A;  4USR A;  5J7X A;  1DOD A;  3I3L A;  4AP3 A;  4EQS A;  5KWF A;  3COX A;  5DBJ A;  2R4E A;  2V3A A;  2BXR A;  2BS4 A;  1ONF A;  2Y6R A;  4JNQ A;  2WP6 A;  3QSS A;  1MO9 A;  4YXD A;  2X3N A;  1S3B A;  2BAC A;  2BS2 A;  4A6N B;  5FS8 A;  1CC2 A;  3UTF A;  3ADA B;  4YWO A;  3FG2 P;  2XLP A;  2B9X A;  4H4Y A;  3LZW A;  3NN6 X;  1DNC A;  1E1N A;  3GWF A;  4BJY A;  3GSI A;  3LZX A;  4CCQ A;  1DOB A;  2A87 A;  4LII A;  2XVE A;  2CVJ A;  5FS9 A;  4K2X A;  1YQ4 A;  2BC0 A;  4DSG A;  2WPC A;  4H50 A;  3AED A;  2VZ2 A;  2GB0 A;  3CGE A;  4J31 A;  5ER0 A;  2B9W A;  4EMJ A;  3CNP A;  4EQR A;  1FOH A;  2YVJ A;  4U8P A;  2IVE A;  4H2N A;  1GER A;  1LQU A;  1TDK A;  2XLS A;  3SGL A;  3GRS A;  2JB1 A;  4H4P A;  1LJ1 A;  3CIR A;  3S5W A;  4NEW A;  2XFO A;  1S2Y A;  2C3D A;  3UTG A;  4FK1 C;  1LTX R;  4USQ A;  3G5Q A;  1BKW A;  2O9Z A;  4OPT A;  2X8H A;  5EB4 A;  1PN0 A;  2X99 A;  2XFQ A;  2BYB A;  3CN8 A;  2F5Z A;  4OPG A;  4B68 A;  2VQ7 A;  4IVM B;  2V6O A;  3EF6 A;  2WOV A;  1S3E A;  4FDC B;  2XLT A;  1NHQ A;  3QFB A;  1GAL A;  2WS3 A;  2IVD A;  4OPC A;  4C74 A;  3VR8 A;  3AYI A;  1IJH A;  1CJC A;  2WP9 A;  1NG3 A;  2GQW A;  2GVC A;  2V5Z A;  4H4R A;  4ZCD A;  4Z2T A;  5U1O A;  2YR6 A;  2FJE A;  2I0Z A;  4A9W A;  2J3N A;  2C70 A;  2R0C A;  2XFU A;  3IF9 A;  2TMD A;  3AEC A;  4REK A;  2VRL A;  5KRQ A;  2GR1 A;  1D4E A;  3V3N A;  1RYI A;  1GRA A;  2RGO A;  1D5T A;  1YQZ A;  3K7T A;  4U8I A;  2GH5 A;  2YM1 A;  4UDR A;  4ECH A;  1EL7 A;  2BCG G;  2BXS A;  1DXL A;  2C66 A;  5EBK A;  3DA1 A;  4H4Q A;  3UKF A;  4YSZ A;  2YWL A;  3NG7 X;  1GRT A;  1YKJ A;  1Q9I A;  2JBV A;  2WHD A;  1TDE A;  3FMW A;  3HZL A;  3AYL A;  2BA9 A;  3ATQ A;  4U8O A;  3FPZ A;  5C3J A;  1GES A;  3ICR A;  4UP3 A;  2NPX A;  3H4K A;  4AP1 A;  3FBS A;  3UTH A;  2GAH B;  2WEU A;  2V61 A;  4H4W A;  3DGZ A;  4GCM A;  1GRB A;  4DNA A;  2B9Y A;  1D7Y A;  1ELI A;  2R9Z A;  3GYI A;  2VVL G;  4C5O A;  3UKA A;  1H86 A;  3GD4 A;  3B3R A;  1REO A;  1AOG A;  5J60 A;  1PJ6 A;  4X9M A;  4ADW A;  3SQP A;  1JNZ A;  1PJ5 A;  4JDR A;  2VVM A;  1ZP0 A;  4RG3 A;  3DK4 A;  5HY5 A;  4H4U A;  4J33 A;  1F6M A;  2UZZ A;  2GQF A;  1TRB A;  3R9U A;  1CF3 A;  3LXD A;  3NT6 A;  3Q9T A;  3CND A;  4Z2U A;  3F8P A;  2VRM A;  1BWC A;  1NHR A;  2XVJ A;  3SFD A;  1IUS A;  3PO7 A;  3QVP A;  1JU2 A;  1Y56 B;  1IUV A;  4AT2 A;  1BZL A;  1BGN A;  3M0O A;  4B65 A;  2EQ8 A;  2NVK X;  3KA7 A;  2YR5 A;  2WBA A;  4TM0 A;  4Y4N A;  1LQT A;  1E39 A;  1JRY A;  2JK6 A;  4J56 A;  3ALL A;  1EL5 A;  4Y4L A;  5M10 A;  4GRT A;  3K7M X;  4KPR A;  4WCT A;  2EQ7 A;  4Z26 A;  3DJG X;  1TDN A;  3P4S A;  4U8N A;  3UOV A;  1Q1R A;  3UOY A;  1D7L A;  2C67 A;  3KLJ A;  1GEU A;  1B4V A;  1K0I A;  3AEE A;  4LA1 A;  3ICT A;  3ZYX A;  1YQ3 A;  4YSY A;  4YTP A;  1GV4 A;  1CL0 A;  1F8W A;  1PBE A;  4RSL A;  1OJC A;  1N1P A;  4NTE A;  2Q7V A;  1X31 B;  2GR2 A;  3K30 A;  1GTE A;  3NIX A;  3ALM A;  4AOX A;  4EM3 A;  4I58 A;  1DOC A;  1MOK A;  3NK0 X;  1KNR A;  2ZZB A;  3BI2 A;  2YLX A;  1K0L A;  1KSS A;  3ATR A;  3KKJ A;  4U2S A;  5GSN A;  3NTD A;  5U25 A;  4A99 A;  2ARD A;  4GDE A;  4OPI A;  1E6E A;  1Q1W A;  2GF3 A;  1OJT A;  1H84 A;  1D4D A;  2C76 A;  1PBD A;  2B7S A;  3AE7 A;  1SEZ A;  1XHC A;  4TM4 A;  5FMH A;  1Y0P A;  1GRE A;  2GR0 A;  1H6V A;  2QA1 A;  3V76 A;  4YT0 A;  1TDF A;  2GEW A;  2WDQ A;  2OAL A;  3UKL A;  3AB1 A;  4UDP A;  1COY A;  3ITJ A;  3CGC A;  4U2T A;  4HB9 A;  1M6I A;  1PXC A;  2FBW A;  1QLB A;  2C73 A;  3JSK A;  4FK1 A;  3EAO A;  1Z6L A;  4M52 A;  4JNA A;  2CUL A;  5U63 A;  2Q6U A;  1GRH A;  3AWI A;  2YG6 A;  3UKP A;  4JY2 A;  5JCI A;  1GPE A;  2YLS A;  2OLO A;  1LV0 A;  3KVE A;  4C3X A;  2FJD A;  2JKC A;  3AD7 B;  2R0P A;  2OLN A;  4OVI A;  2A89 A;  2DKI A;  3DH9 A;  3RED A;  5BUK A;  3P9U A;  3DME A;  3AXB A;  3KU9 A;  2GMH A;  2GR3 A;  4H4T A;  3CNJ A;  1P2E A;  2YLZ A;  1VRQ B;  2E4G A;  2GMJ A;  3AE6 A;  4BJZ A;  4CY6 A;  2YAU A;  2WU2 A;  2XFN A;  1XDI A;  3UKQ A;  4ZCC A;  1F3P A;  1NEK A;  4TLX A;  4K8D A;  1ZKQ A;  3AE3 A;  2DKH A;  3AEB A;  5LV9 A;  1OJD A;  3NTA A;  2OAM A;  2EQ9 A;  3CGB A;  4B64 A;  1M64 A;  3AE2 A;  4YKF A;  2BAB A;  3GDP A;  1W4X A;  3DK9 A;  3GYJ A;  4BK3 A;  1LVL A;  2B76 A;  3O0H A;  4XWR A;  5JCL A;  1KF6 A;  1S2Q A;  1DJN A;  1DJQ A;  2XVH A;  2XLR A;  1B5Q A;  2YVF A;  1YY5 A;  3UKK A;  4IA5 A;  5JCN A;  4XWZ A;  1GTH A;  3NN0 X;  3IC9 A;  3UOX A;  1H81 A;  1L9C A;  5JCM A;  2YLW A;  2BK5 A;  2C7G A;  4H2Q A;  2WES A;  1EBD A;  4MJW A;  4RG4 A;  1GET A;  4ZN0 A;  5L46 A;  5TR3 A;  3S61 A;  3LB8 A;  2PHH A;  2YG3 A;  2ZBW A;  4GUV A;  2XFP A;  1D4C A;  1H7X A;  5JCK A;  3ALJ A;  3NK1 X;  3RP7 A;  2H88 A;  4D03 A;  3V3O A;  1FCD A;  3P4R A;  2WDR A;  1HYU A;  2GRT A;  3AE5 A;  1K4Q A;  4EM4 A;  2QAE A;  2WDV A;  4J34 A;  3ICS A;  1CJ3 A;  1NDA A;  1DOE A;  1NAA A;  3D8X A;  4H4Z A;  2WOI A;  5BVA A;  2X8C A;  1Y56 A;  3ISH A;  3NGC X;  2R45 A;  5IPY A;  4YSH A;  3PS9 A;  4A7A A;  4EMW A;  2W0H A;  1OJ9 A;  3DJE A;  4APN A;  1FEA A;  2RGJ A;  4BUR A;  3QSM A;  3L1R A;  1MXT A;  4P9S A;  2YG7 A;  5IQ1 A;  1L0V A;  3VRA A;  3GWD A;  2B7R A;  3NYE A;  1N4V A;  3CTY A;  2JAE A;  1ZOY A;  4Z44 A;  1H7W A;  2BS3 A;  4GDP A;  4J2W A;  1V59 A;  4U2L A;  1N4U A;  5M0Z A;  4I59 A;  1ZDL A;  2FJA A;  4IA6 A;  1F8S A;  3GMB A;  4K5R A;  2GV8 A;  2QCU A;  1N4W A;  1IUX A;  1NG4 A;  1JNR A;  3D1C A;  3RP8 A;  4Z2R A;  3AEA A;  1K0J A;  2ZZ0 A;  3FIM B;  4YTM A;  4EQX A;  5EOW A;  3Q6J A;  1NHS A;  1PBB A;  2WU5 A;  4A6N A;  4CNJ A;  1PDH A;  2X8G A;  4Z43 A;  2WPF A;  3AEF A;  3NK2 X;  2WOW A;  5CKU A;  2YVG A;  4KX6 A;  1JRX A;  4DSH A;  1KDG A;  4N9X A;  2RGH A;  5HHF A;  2ACZ A;  4AT0 A;  4CY8 A;  3NNE A;  1GT8 A;  1TDO A;  3IWA A;  3BI5 A;  4O5Q A;  1PXB A;  4IV9 A;  1VDC A;  4A65 A;  3QJ4 A;  1TYT A;  1ZOV A;  2RAB A;  1P2H A;  3G5S A;  1ZK7 A;  3C4A A;  3M12 A;  2WQY A;  1RP0 A;  4K22 A;  4A79 A;  4JY3 A;  3IHG A;  4BK1 A;  1E1M A;  2C75 A;  4H4S A;  2Z5Y A;  4JN9 A;  2JB3 A;  4EIQ A;  2AQJ A;  3NHO X;  1PJ7 A;  2GAG B;  5C2T A;  5BUL A;  3RP6 A;  1ZMD A;  3SFE A;  4K5S A;  4E0V A;  1IUT A;  1L9D A;  3F8D A;  5CQF A;  3RHA A;  4K7Z A;  3VRD B;  3CGD A;  4B67 A;  4DGK A;  4AOS A;  3GD3 A;  2R0G A;  1O94 A;  4OPU A;  4H7U A;  2Q0L A;  3K7Q X;  4H2P A;  3EAN A;  3UP4 A;  5IQ4 A;  4U8M A;  1PS9 A;  1RSG A;  3UCL A;  2BK3 A;  2PYX A;  3AD9 B;  3CPJ G;  3AD8 B;  1GXF A;  2VOU A;  3AE4 A;  4OPL A;  4J57 A;  3II4 A;  4CCR A;  1JEH A;  4GF7 A;  1IUW A;  3CPI G;  1CBO A;  4NZH A;  4WX1 A;  3L8K A;  4U8K A;  2E5V A;  2YLR A;  2AR8 A;  4Z25 A; 
#chains in the Genus database with same CATH topology
 2APG A;  1F8R A;  3NKS A;  2VQB A;  1E1K A;  3GMC A;  3T37 A;  4EQW A;  1XPQ A;  1XAN A;  3P4P A;  2YLT A;  3LOV A;  4GR1 A;  1EL8 A;  2AAQ A;  5KOX A;  3AE9 A;  1CJ2 A;  2R46 A;  2IID A;  4C3Y A;  1OJA A;  1JOA A;  4B66 A;  3OC4 A;  1LPF A;  1CHU A;  4NTD A;  3URH A;  3SXI A;  3SZF A;  4PAB A;  1PBF A;  4CNK A;  4H4X A;  2Z5X A;  3LJP A;  3UOZ A;  4EMI A;  2XLU A;  2YG4 A;  3AYJ A;  3ABV A;  3H8I A;  3GDN A;  2VVL A;  2V60 A;  1GRG A;  4C77 A;  2C4C A;  5GRT A;  2WP5 A;  1E7P A;  2YG5 A;  4PAA A;  4BK2 A;  4YTN A;  3AEG A;  5EB5 A;  4O5U A;  2BCP A;  1KNP A;  1H83 A;  1GRF A;  1KFY A;  2FJB A;  4X4J A;  5HYM A;  1NHP A;  2C65 A;  4HA6 A;  1NEN A;  3T14 A;  3DJD A;  4JQ9 A;  1FL2 A;  3IHM A;  3DK8 A;  1QO8 A;  3C4N A;  3OZ2 A;  4X9N A;  3UKH A;  1ZY8 A;  1TYP A;  1EL9 A;  3CNS A;  3G5R A;  3QVR A;  4H4V A;  4A5L A;  5HXI A;  3CNT A;  2XVF A;  3F8R A;  4U8L A;  2XDO A;  3ZDN A;  1VG0 A;  4TM1 A;  3BNM A;  3BHK A;  4Y4M A;  5FS6 A;  2JB2 A;  4B69 A;  1UKV G;  1GSN A;  4CRT A;  2C3C A;  2HQM A;  4UDQ A;  4B1B A;  4BV6 A;  1CJ4 A;  1E1L A;  2WET A;  4IVO B;  5KOW A;  1ZX9 A;  3I6D A;  4TLZ A;  3H8L A;  4NEV A;  1BGJ A;  4YKG A;  2R4J A;  1FEC A;  2OA1 A;  1L9E A;  1O95 A;  3RNM A;  1NPX A;  1BF3 A;  3AE1 A;  3B6D A;  2TPR A;  4EIP A;  2XCG A;  4LU6 A;  5KMS A;  1B37 A;  3T2K A;  1PBC A;  3NYC A;  3VRB A;  4OPD A;  2H89 A;  2A8X A;  2X50 A;  3NH3 X;  5KVI A;  3GRT A;  2CDU A;  5BRT A;  2QA2 A;  4B63 A;  3PVC A;  1GOS A;  2WPE A;  3P1W A;  1O5W A;  2EQ6 A;  3NLC A;  3BNU A;  3QSE A;  3P4Q A;  3T0K A;  1ZMC A;  4H2R A;  3NYF A;  5KVH A;  3NRN A;  1GND A;  4G9K A;  3VR9 A;  2ZZC A;  4U8J A;  4NTC A;  3QFA A;  3C96 A;  2E1M A;  2C64 A;  2XYO A;  1KSU A;  1PHH A;  4CBQ A;  5FS7 A;  1IUU A;  3VQR A;  4YSX A;  4XXG A;  2YR4 A;  1CC4 A;  3AE8 A;  4TM3 A;  3M13 A;  2Q0K A;  1PXA A;  3DJJ A;  2Y6Q A;  3BI4 A;  2CFY A;  4OCG A;  2BK4 A;  3CPH G;  3UP5 A;  3EPT A;  1B8S A;  1VG9 A;  1FEB A;  4ICY A;  4J36 A;  3SZC A;  3SM8 A;  3UTE A;  3WE0 A;  1CC6 A;  3HYV A;  3DGH A;  4Z24 A;  4D04 A;  1H82 A;  2XVI A;  2YQU A;  4FX9 A;  3KPF A;  1QJD A;  2YM2 A;  5KXJ A;  2V3B A;  1VQW A;  2C72 A;  3KD9 A;  3LAD A;  1JRZ A;  2BC1 A;  3E1T A;  3BHF A;  4USR A;  5J7X A;  1DOD A;  3I3L A;  4AP3 A;  4EQS A;  5KWF A;  3COX A;  5DBJ A;  2R4E A;  2V3A A;  2BXR A;  2BS4 A;  1ONF A;  2Y6R A;  4JNQ A;  2WP6 A;  3QSS A;  1MO9 A;  4YXD A;  2X3N A;  1S3B A;  2BAC A;  2BS2 A;  4A6N B;  5FS8 A;  1CC2 A;  3UTF A;  3ADA B;  4YWO A;  3FG2 P;  2XLP A;  2B9X A;  4H4Y A;  3LZW A;  3NN6 X;  1DNC A;  1E1N A;  3GWF A;  4BJY A;  3GSI A;  3LZX A;  4CCQ A;  1DOB A;  2A87 A;  4LII A;  2XVE A;  2CVJ A;  5FS9 A;  4K2X A;  1YQ4 A;  2BC0 A;  4DSG A;  2WPC A;  4H50 A;  2BRA A;  3AED A;  2VZ2 A;  2GB0 A;  3CGE A;  4J31 A;  5ER0 A;  2B9W A;  4EMJ A;  3CNP A;  4GAV A;  4EQR A;  1FOH A;  2YVJ A;  4U8P A;  2IVE A;  4H2N A;  1GER A;  1LQU A;  1TDK A;  2XLS A;  3SGL A;  3GRS A;  2JB1 A;  5KMQ A;  4H4P A;  1LJ1 A;  3CIR A;  3S5W A;  4NEW A;  2XFO A;  1S2Y A;  4G6H A;  3SZW A;  2C3D A;  3UTG A;  4FK1 C;  1LTX R;  4USQ A;  3G5Q A;  1BKW A;  2O9Z A;  4OPT A;  2X8H A;  5EB4 A;  1PN0 A;  2X99 A;  2XFQ A;  2BYB A;  3CN8 A;  2F5Z A;  4OPG A;  4B68 A;  2VQ7 A;  4IVM B;  4G74 A;  2V6O A;  3EF6 A;  2WOV A;  1S3E A;  4FDC B;  2XLT A;  3T2Y A;  1NHQ A;  3QFB A;  1GAL A;  2WS3 A;  2IVD A;  4OPC A;  4C74 A;  3VR8 A;  3AYI A;  1IJH A;  1CJC A;  2WP9 A;  1NG3 A;  2GQW A;  2GVC A;  2V5Z A;  4H4R A;  4ZCD A;  4Z2T A;  5U1O A;  2YR6 A;  2FJE A;  2I0Z A;  4A9W A;  2J3N A;  2C70 A;  2R0C A;  2XFU A;  3IF9 A;  2TMD A;  3AEC A;  4REK A;  2VRL A;  5KRQ A;  2GR1 A;  1D4E A;  3V3N A;  1RYI A;  1GRA A;  2RGO A;  1D5T A;  1YQZ A;  3K7T A;  4U8I A;  2GH5 A;  2YM1 A;  4UDR A;  4ECH A;  1EL7 A;  2BCG G;  2BXS A;  1DXL A;  2C66 A;  5EBK A;  3DA1 A;  4H4Q A;  3UKF A;  4YSZ A;  2YWL A;  3NG7 X;  1GRT A;  1YKJ A;  1Q9I A;  2JBV A;  2WHD A;  1TDE A;  3FMW A;  3HZL A;  3AYL A;  2BA9 A;  3ATQ A;  4U8O A;  3FPZ A;  5C3J A;  1GES A;  3ICR A;  4UP3 A;  2NPX A;  3H4K A;  4AP1 A;  3FBS A;  3UTH A;  2GAH B;  2WEU A;  2V61 A;  4H4W A;  3DGZ A;  4GCM A;  1GRB A;  4DNA A;  2B9Y A;  1D7Y A;  1ELI A;  2R9Z A;  3GYI A;  2VVL G;  4C5O A;  3UKA A;  1H86 A;  3GD4 A;  4II2 A;  3B3R A;  1REO A;  1AOG A;  5J60 A;  1PJ6 A;  4X9M A;  4ADW A;  3SQP A;  1JNZ A;  1PJ5 A;  4JDR A;  2VVM A;  1ZP0 A;  4RG3 A;  3DK4 A;  5HY5 A;  4H4U A;  4J33 A;  1F6M A;  2UZZ A;  2GQF A;  1TRB A;  3R9U A;  1CF3 A;  3LXD A;  3NT6 A;  3Q9T A;  3CND A;  4Z2U A;  3F8P A;  2VRM A;  1BWC A;  1NHR A;  2XVJ A;  3SFD A;  1IUS A;  3PO7 A;  3QVP A;  1JU2 A;  3T2Z A;  1Y56 B;  1IUV A;  4AT2 A;  5KMP A;  1BZL A;  1BGN A;  3M0O A;  4B65 A;  2EQ8 A;  2NVK X;  3KA7 A;  2YR5 A;  2WBA A;  4TM0 A;  4Y4N A;  1LQT A;  1E39 A;  1JRY A;  2JK6 A;  4J56 A;  3ALL A;  1EL5 A;  4Y4L A;  5M10 A;  4GRT A;  3K7M X;  4KPR A;  4WCT A;  2EQ7 A;  4Z26 A;  3DJG X;  1TDN A;  3P4S A;  4U8N A;  3UOV A;  1Q1R A;  3UOY A;  1D7L A;  4NNJ A;  2C67 A;  3KLJ A;  1GEU A;  1B4V A;  1K0I A;  3AEE A;  4LA1 A;  3ICT A;  3ZYX A;  1YQ3 A;  4YSY A;  4YTP A;  1GV4 A;  1CL0 A;  1F8W A;  1PBE A;  4RSL A;  1OJC A;  1N1P A;  4NTE A;  2Q7V A;  1X31 B;  2GR2 A;  3K30 A;  1GTE A;  3NIX A;  3ALM A;  4AOX A;  4EM3 A;  4I58 A;  1DOC A;  1MOK A;  3NK0 X;  1KNR A;  2ZZB A;  3BI2 A;  2YLX A;  1K0L A;  1KSS A;  3ATR A;  3KKJ A;  4U2S A;  5GSN A;  3NTD A;  5U25 A;  4A99 A;  2ARD A;  4GDE A;  4OPI A;  1E6E A;  1Q1W A;  2GF3 A;  1OJT A;  1H84 A;  1D4D A;  2C76 A;  1PBD A;  2B7S A;  3AE7 A;  1SEZ A;  1XHC A;  4TM4 A;  4G73 A;  2BRY A;  5FMH A;  1Y0P A;  1GRE A;  2GR0 A;  1H6V A;  2QA1 A;  3V76 A;  4YT0 A;  1TDF A;  2GEW A;  2WDQ A;  2OAL A;  3UKL A;  3AB1 A;  4UDP A;  1COY A;  4GAP A;  3ITJ A;  3CGC A;  4U2T A;  4HB9 A;  1M6I A;  1PXC A;  2FBW A;  1QLB A;  2C73 A;  3JSK A;  4FK1 A;  3EAO A;  1Z6L A;  4M52 A;  4JNA A;  2CUL A;  5U63 A;  2Q6U A;  1GRH A;  3AWI A;  2YG6 A;  3UKP A;  4JY2 A;  5JCI A;  1GPE A;  2YLS A;  2OLO A;  1LV0 A;  3KVE A;  4C3X A;  2FJD A;  2JKC A;  3HYW A;  3AD7 B;  2R0P A;  2OLN A;  4OVI A;  2A89 A;  2DKI A;  3DH9 A;  3RED A;  5BUK A;  3P9U A;  3DME A;  3AXB A;  3KU9 A;  2GMH A;  2GR3 A;  4H4T A;  3CNJ A;  1P2E A;  2YLZ A;  1VRQ B;  2E4G A;  2GMJ A;  3AE6 A;  4BJZ A;  4CY6 A;  2YAU A;  2WU2 A;  2XFN A;  1XDI A;  3UKQ A;  4ZCC A;  1F3P A;  1NEK A;  4TLX A;  4K8D A;  1ZKQ A;  3AE3 A;  2DKH A;  3AEB A;  3CMM A;  5LV9 A;  4G6G A;  3SYI A;  1OJD A;  3NTA A;  2OAM A;  2EQ9 A;  3CGB A;  4B64 A;  1M64 A;  3AE2 A;  3SZ0 A;  4YKF A;  2BAB A;  3GDP A;  1W4X A;  3DK9 A;  3GYJ A;  4BK3 A;  5KNL A;  1LVL A;  2B76 A;  3O0H A;  4XWR A;  5JCL A;  1KF6 A;  1S2Q A;  1DJN A;  1DJQ A;  2XVH A;  2XLR A;  1B5Q A;  2YVF A;  1YY5 A;  3UKK A;  4IA5 A;  5JCN A;  4XWZ A;  1GTH A;  3NN0 X;  3IC9 A;  3UOX A;  1H81 A;  1L9C A;  5JCM A;  2YLW A;  2BK5 A;  2C7G A;  4H2Q A;  2WES A;  1EBD A;  4MJW A;  4RG4 A;  1GET A;  4ZN0 A;  5L46 A;  5TR3 A;  3S61 A;  3LB8 A;  2PHH A;  2YG3 A;  2ZBW A;  4GUV A;  2XFP A;  1D4C A;  1H7X A;  3HYX A;  3ALJ A;  5JCK A;  3NK1 X;  3RP7 A;  2H88 A;  4D03 A;  3V3O A;  1FCD A;  4NWZ A;  3P4R A;  2WDR A;  1HYU A;  2GRT A;  3T31 A;  3AE5 A;  1K4Q A;  4EM4 A;  2QAE A;  2WDV A;  4J34 A;  3ICS A;  1CJ3 A;  1NDA A;  1DOE A;  1NAA A;  3D8X A;  4H4Z A;  2WOI A;  5BVA A;  2X8C A;  1Y56 A;  3ISH A;  3NGC X;  2R45 A;  5IPY A;  4YSH A;  3PS9 A;  4A7A A;  4EMW A;  2W0H A;  1OJ9 A;  3DJE A;  4APN A;  1FEA A;  2RGJ A;  4BUR A;  3QSM A;  3L1R A;  1MXT A;  3SY4 A;  4P9S A;  2YG7 A;  5IQ1 A;  1L0V A;  3VRA A;  3GWD A;  2B7R A;  3NYE A;  1N4V A;  5KMR A;  3CTY A;  2JAE A;  1ZOY A;  4Z44 A;  1H7W A;  2BS3 A;  4GDP A;  4J2W A;  1V59 A;  4U2L A;  1N4U A;  5M0Z A;  4I59 A;  1ZDL A;  2FJA A;  4IA6 A;  1F8S A;  3GMB A;  4K5R A;  2GV8 A;  2QCU A;  1N4W A;  1IUX A;  1NG4 A;  1JNR A;  3D1C A;  3RP8 A;  4Z2R A;  3AEA A;  1K0J A;  2ZZ0 A;  3FIM B;  4YTM A;  4EQX A;  5EOW A;  3SX6 A;  3Q6J A;  1NHS A;  1PBB A;  2WU5 A;  4A6N A;  4CNJ A;  1PDH A;  2X8G A;  4Z43 A;  2WPF A;  3AEF A;  3NK2 X;  2WOW A;  5CKU A;  2YVG A;  4KX6 A;  1JRX A;  4DSH A;  1KDG A;  4N9X A;  2RGH A;  5HHF A;  2ACZ A;  4AT0 A;  4CY8 A;  3NNE A;  1GT8 A;  1TDO A;  3IWA A;  3BI5 A;  4O5Q A;  1PXB A;  4IV9 A;  1VDC A;  4A65 A;  3QJ4 A;  1TYT A;  1ZOV A;  2RAB A;  1P2H A;  3G5S A;  1ZK7 A;  3C4A A;  3M12 A;  2WQY A;  1RP0 A;  3KPK A;  4K22 A;  4A79 A;  4JY3 A;  3GYX A;  3IHG A;  4BK1 A;  1E1M A;  2C75 A;  4H4S A;  2Z5Y A;  4JN9 A;  2JB3 A;  4EIQ A;  2AQJ A;  3NHO X;  1PJ7 A;  2GAG B;  5C2T A;  5BUL A;  3RP6 A;  1ZMD A;  3SFE A;  4K5S A;  4E0V A;  1IUT A;  1L9D A;  3F8D A;  5CQF A;  3RHA A;  4K7Z A;  3VRD B;  3CGD A;  4B67 A;  4DGK A;  4AOS A;  3GD3 A;  2R0G A;  1O94 A;  4OPU A;  4H7U A;  2Q0L A;  3K7Q X;  4H2P A;  3EAN A;  3UP4 A;  5IQ4 A;  4U8M A;  1PS9 A;  1RSG A;  3UCL A;  2BK3 A;  4II3 A;  2PYX A;  3AD9 B;  3CPJ G;  3AD8 B;  1GXF A;  2VOU A;  3AE4 A;  4OPL A;  4J57 A;  3II4 A;  4CCR A;  1JEH A;  4GF7 A;  1IUW A;  3CPI G;  1CBO A;  4NZH A;  4WX1 A;  3L8K A;  4U8K A;  2E5V A;  2YLR A;  2AR8 A;  4Z25 A; 
#chains in the Genus database with same CATH homology
 2APG A;  1F8R A;  3NKS A;  2VQB A;  1E1K A;  3GMC A;  3T37 A;  4EQW A;  1XPQ A;  1XAN A;  3P4P A;  2YLT A;  3LOV A;  4GR1 A;  1EL8 A;  2AAQ A;  5KOX A;  3AE9 A;  1CJ2 A;  2R46 A;  2IID A;  4C3Y A;  1OJA A;  1JOA A;  4B66 A;  3OC4 A;  1LPF A;  1CHU A;  4NTD A;  3URH A;  3SXI A;  3SZF A;  4PAB A;  1PBF A;  4CNK A;  4H4X A;  2Z5X A;  3LJP A;  3UOZ A;  4EMI A;  2XLU A;  2YG4 A;  3AYJ A;  3ABV A;  3H8I A;  3GDN A;  2VVL A;  2V60 A;  1GRG A;  4C77 A;  2C4C A;  5GRT A;  2WP5 A;  1E7P A;  2YG5 A;  4PAA A;  4BK2 A;  4YTN A;  3AEG A;  5EB5 A;  4O5U A;  2BCP A;  1KNP A;  1H83 A;  1GRF A;  1KFY A;  2FJB A;  4X4J A;  5HYM A;  1NHP A;  2C65 A;  4HA6 A;  1NEN A;  3T14 A;  3DJD A;  4JQ9 A;  1FL2 A;  3IHM A;  3DK8 A;  1QO8 A;  3C4N A;  3OZ2 A;  4X9N A;  3UKH A;  1ZY8 A;  1TYP A;  1EL9 A;  3CNS A;  3G5R A;  3QVR A;  4H4V A;  4A5L A;  5HXI A;  3CNT A;  2XVF A;  3F8R A;  4U8L A;  2XDO A;  3ZDN A;  1VG0 A;  4TM1 A;  3BNM A;  3BHK A;  4Y4M A;  5FS6 A;  2JB2 A;  4B69 A;  1UKV G;  1GSN A;  4CRT A;  2C3C A;  2HQM A;  4UDQ A;  4B1B A;  4BV6 A;  1CJ4 A;  1E1L A;  2WET A;  4IVO B;  5KOW A;  1ZX9 A;  3I6D A;  4TLZ A;  3H8L A;  4NEV A;  1BGJ A;  4YKG A;  2R4J A;  1FEC A;  2OA1 A;  1L9E A;  1O95 A;  3RNM A;  1NPX A;  1BF3 A;  3AE1 A;  3B6D A;  2TPR A;  4EIP A;  2XCG A;  4LU6 A;  5KMS A;  1B37 A;  3T2K A;  1PBC A;  3NYC A;  3VRB A;  4OPD A;  2H89 A;  2A8X A;  2X50 A;  3NH3 X;  5KVI A;  3GRT A;  2CDU A;  5BRT A;  2QA2 A;  4B63 A;  3PVC A;  1GOS A;  2WPE A;  3P1W A;  1O5W A;  2EQ6 A;  3NLC A;  3BNU A;  3QSE A;  3P4Q A;  3T0K A;  1ZMC A;  4H2R A;  3NYF A;  5KVH A;  3NRN A;  1GND A;  4G9K A;  3VR9 A;  2ZZC A;  4U8J A;  4NTC A;  3QFA A;  3C96 A;  2E1M A;  2C64 A;  2XYO A;  1KSU A;  1PHH A;  4CBQ A;  5FS7 A;  1IUU A;  3VQR A;  4YSX A;  4XXG A;  2YR4 A;  1CC4 A;  3AE8 A;  4TM3 A;  3M13 A;  2Q0K A;  1PXA A;  3DJJ A;  2Y6Q A;  3BI4 A;  2CFY A;  4OCG A;  2BK4 A;  3CPH G;  3UP5 A;  3EPT A;  1B8S A;  1VG9 A;  1FEB A;  4ICY A;  4J36 A;  3SZC A;  3SM8 A;  3UTE A;  3WE0 A;  1CC6 A;  3HYV A;  3DGH A;  4Z24 A;  4D04 A;  1H82 A;  2XVI A;  2YQU A;  4FX9 A;  3KPF A;  1QJD A;  2YM2 A;  5KXJ A;  2V3B A;  1VQW A;  2C72 A;  3KD9 A;  3LAD A;  1JRZ A;  2BC1 A;  3E1T A;  3BHF A;  4USR A;  5J7X A;  1DOD A;  3I3L A;  4AP3 A;  4EQS A;  5KWF A;  3COX A;  5DBJ A;  2R4E A;  2V3A A;  2BXR A;  2BS4 A;  1ONF A;  2Y6R A;  4JNQ A;  2WP6 A;  3QSS A;  1MO9 A;  4YXD A;  2X3N A;  1S3B A;  2BAC A;  2BS2 A;  4A6N B;  5FS8 A;  1CC2 A;  3UTF A;  3ADA B;  4YWO A;  3FG2 P;  2XLP A;  2B9X A;  4H4Y A;  3LZW A;  3NN6 X;  1DNC A;  1E1N A;  3GWF A;  4BJY A;  3GSI A;  3LZX A;  4CCQ A;  1DOB A;  2A87 A;  4LII A;  2XVE A;  2CVJ A;  5FS9 A;  4K2X A;  1YQ4 A;  2BC0 A;  4DSG A;  2WPC A;  4H50 A;  2BRA A;  3AED A;  2VZ2 A;  2GB0 A;  3CGE A;  4J31 A;  5ER0 A;  2B9W A;  4EMJ A;  3CNP A;  4GAV A;  4EQR A;  1FOH A;  2YVJ A;  4U8P A;  2IVE A;  4H2N A;  1GER A;  1LQU A;  1TDK A;  2XLS A;  3SGL A;  3GRS A;  2JB1 A;  5KMQ A;  4H4P A;  1LJ1 A;  3CIR A;  3S5W A;  4NEW A;  2XFO A;  1S2Y A;  4G6H A;  3SZW A;  2C3D A;  3UTG A;  4FK1 C;  1LTX R;  4USQ A;  3G5Q A;  1BKW A;  2O9Z A;  4OPT A;  2X8H A;  5EB4 A;  1PN0 A;  2X99 A;  2XFQ A;  2BYB A;  3CN8 A;  2F5Z A;  4OPG A;  4B68 A;  2VQ7 A;  4IVM B;  4G74 A;  2V6O A;  3EF6 A;  2WOV A;  1S3E A;  4FDC B;  2XLT A;  3T2Y A;  1NHQ A;  3QFB A;  1GAL A;  2WS3 A;  2IVD A;  4OPC A;  4C74 A;  3VR8 A;  3AYI A;  1IJH A;  1CJC A;  2WP9 A;  1NG3 A;  2GQW A;  2GVC A;  2V5Z A;  4H4R A;  4ZCD A;  4Z2T A;  5U1O A;  2YR6 A;  2FJE A;  2I0Z A;  4A9W A;  2J3N A;  2C70 A;  2R0C A;  2XFU A;  3IF9 A;  2TMD A;  3AEC A;  4REK A;  2VRL A;  5KRQ A;  2GR1 A;  1D4E A;  3V3N A;  1RYI A;  1GRA A;  2RGO A;  1D5T A;  1YQZ A;  3K7T A;  4U8I A;  2GH5 A;  2YM1 A;  4UDR A;  4ECH A;  1EL7 A;  2BCG G;  2BXS A;  1DXL A;  2C66 A;  5EBK A;  3DA1 A;  4H4Q A;  3UKF A;  4YSZ A;  2YWL A;  3NG7 X;  1GRT A;  1YKJ A;  1Q9I A;  2JBV A;  2WHD A;  1TDE A;  3FMW A;  3HZL A;  3AYL A;  2BA9 A;  3ATQ A;  4U8O A;  3FPZ A;  5C3J A;  1GES A;  3ICR A;  4UP3 A;  2NPX A;  3H4K A;  4AP1 A;  3FBS A;  3UTH A;  2GAH B;  2WEU A;  2V61 A;  4H4W A;  3DGZ A;  4GCM A;  1GRB A;  4DNA A;  2B9Y A;  1D7Y A;  1ELI A;  2R9Z A;  3GYI A;  2VVL G;  4C5O A;  3UKA A;  1H86 A;  3GD4 A;  4II2 A;  3B3R A;  1REO A;  1AOG A;  5J60 A;  1PJ6 A;  4X9M A;  4ADW A;  3SQP A;  1JNZ A;  1PJ5 A;  4JDR A;  2VVM A;  1ZP0 A;  4RG3 A;  3DK4 A;  5HY5 A;  4H4U A;  4J33 A;  1F6M A;  2UZZ A;  2GQF A;  1TRB A;  3R9U A;  1CF3 A;  3LXD A;  3NT6 A;  3Q9T A;  3CND A;  4Z2U A;  3F8P A;  2VRM A;  1BWC A;  1NHR A;  2XVJ A;  3SFD A;  1IUS A;  3PO7 A;  3QVP A;  1JU2 A;  3T2Z A;  1Y56 B;  1IUV A;  4AT2 A;  5KMP A;  1BZL A;  1BGN A;  3M0O A;  4B65 A;  2EQ8 A;  2NVK X;  3KA7 A;  2YR5 A;  2WBA A;  4TM0 A;  4Y4N A;  1LQT A;  1E39 A;  1JRY A;  2JK6 A;  4J56 A;  3ALL A;  1EL5 A;  4Y4L A;  5M10 A;  4GRT A;  3K7M X;  4KPR A;  4WCT A;  2EQ7 A;  4Z26 A;  3DJG X;  1TDN A;  3P4S A;  4U8N A;  3UOV A;  1Q1R A;  3UOY A;  1D7L A;  4NNJ A;  2C67 A;  3KLJ A;  1GEU A;  1B4V A;  1K0I A;  3AEE A;  4LA1 A;  3ICT A;  3ZYX A;  1YQ3 A;  4YSY A;  4YTP A;  1GV4 A;  1CL0 A;  1F8W A;  1PBE A;  4RSL A;  1OJC A;  1N1P A;  4NTE A;  2Q7V A;  1X31 B;  2GR2 A;  3K30 A;  1GTE A;  3NIX A;  3ALM A;  4AOX A;  4EM3 A;  4I58 A;  1DOC A;  1MOK A;  3NK0 X;  1KNR A;  2ZZB A;  3BI2 A;  2YLX A;  1K0L A;  1KSS A;  3ATR A;  3KKJ A;  4U2S A;  5GSN A;  3NTD A;  5U25 A;  4A99 A;  2ARD A;  4GDE A;  4OPI A;  1E6E A;  1Q1W A;  2GF3 A;  1OJT A;  1H84 A;  1D4D A;  2C76 A;  1PBD A;  2B7S A;  3AE7 A;  1SEZ A;  1XHC A;  4TM4 A;  4G73 A;  2BRY A;  5FMH A;  1Y0P A;  1GRE A;  2GR0 A;  1H6V A;  2QA1 A;  3V76 A;  4YT0 A;  1TDF A;  2GEW A;  2WDQ A;  2OAL A;  3UKL A;  3AB1 A;  4UDP A;  1COY A;  4GAP A;  3ITJ A;  3CGC A;  4U2T A;  4HB9 A;  1M6I A;  1PXC A;  2FBW A;  1QLB A;  2C73 A;  3JSK A;  4FK1 A;  3EAO A;  1Z6L A;  4M52 A;  4JNA A;  2CUL A;  5U63 A;  2Q6U A;  1GRH A;  3AWI A;  2YG6 A;  3UKP A;  4JY2 A;  5JCI A;  1GPE A;  2YLS A;  2OLO A;  1LV0 A;  3KVE A;  4C3X A;  2FJD A;  2JKC A;  3HYW A;  3AD7 B;  2R0P A;  2OLN A;  4OVI A;  2A89 A;  2DKI A;  3DH9 A;  3RED A;  5BUK A;  3P9U A;  3DME A;  3AXB A;  3KU9 A;  2GMH A;  2GR3 A;  4H4T A;  3CNJ A;  1P2E A;  2YLZ A;  1VRQ B;  2E4G A;  2GMJ A;  3AE6 A;  4BJZ A;  4CY6 A;  2YAU A;  2WU2 A;  2XFN A;  1XDI A;  3UKQ A;  4ZCC A;  1F3P A;  1NEK A;  4TLX A;  4K8D A;  1ZKQ A;  3AE3 A;  2DKH A;  3AEB A;  3CMM A;  5LV9 A;  4G6G A;  3SYI A;  1OJD A;  3NTA A;  2OAM A;  2EQ9 A;  3CGB A;  4B64 A;  1M64 A;  3AE2 A;  3SZ0 A;  4YKF A;  2BAB A;  3GDP A;  1W4X A;  3DK9 A;  3GYJ A;  4BK3 A;  5KNL A;  1LVL A;  2B76 A;  3O0H A;  4XWR A;  5JCL A;  1KF6 A;  1S2Q A;  1DJN A;  1DJQ A;  2XVH A;  2XLR A;  1B5Q A;  2YVF A;  1YY5 A;  3UKK A;  4IA5 A;  5JCN A;  4XWZ A;  1GTH A;  3NN0 X;  3IC9 A;  3UOX A;  1H81 A;  1L9C A;  5JCM A;  2YLW A;  2BK5 A;  2C7G A;  4H2Q A;  2WES A;  1EBD A;  4MJW A;  4RG4 A;  1GET A;  4ZN0 A;  5L46 A;  5TR3 A;  3S61 A;  3LB8 A;  2PHH A;  2YG3 A;  2ZBW A;  4GUV A;  2XFP A;  1D4C A;  1H7X A;  3HYX A;  3ALJ A;  5JCK A;  3NK1 X;  3RP7 A;  2H88 A;  4D03 A;  3V3O A;  1FCD A;  4NWZ A;  3P4R A;  2WDR A;  1HYU A;  2GRT A;  3T31 A;  3AE5 A;  1K4Q A;  4EM4 A;  2QAE A;  2WDV A;  4J34 A;  3ICS A;  1CJ3 A;  1NDA A;  1DOE A;  1NAA A;  3D8X A;  4H4Z A;  2WOI A;  5BVA A;  2X8C A;  1Y56 A;  3ISH A;  3NGC X;  2R45 A;  5IPY A;  4YSH A;  3PS9 A;  4A7A A;  4EMW A;  2W0H A;  1OJ9 A;  3DJE A;  4APN A;  1FEA A;  2RGJ A;  4BUR A;  3QSM A;  3L1R A;  1MXT A;  3SY4 A;  4P9S A;  2YG7 A;  5IQ1 A;  1L0V A;  3VRA A;  3GWD A;  2B7R A;  3NYE A;  1N4V A;  5KMR A;  3CTY A;  2JAE A;  1ZOY A;  4Z44 A;  1H7W A;  2BS3 A;  4GDP A;  4J2W A;  1V59 A;  4U2L A;  1N4U A;  5M0Z A;  4I59 A;  1ZDL A;  2FJA A;  4IA6 A;  1F8S A;  3GMB A;  4K5R A;  2GV8 A;  2QCU A;  1N4W A;  1IUX A;  1NG4 A;  1JNR A;  3D1C A;  3RP8 A;  4Z2R A;  3AEA A;  1K0J A;  2ZZ0 A;  3FIM B;  4YTM A;  4EQX A;  5EOW A;  3SX6 A;  3Q6J A;  1NHS A;  1PBB A;  2WU5 A;  4A6N A;  4CNJ A;  1PDH A;  2X8G A;  4Z43 A;  2WPF A;  3AEF A;  3NK2 X;  2WOW A;  5CKU A;  2YVG A;  4KX6 A;  1JRX A;  4DSH A;  1KDG A;  4N9X A;  2RGH A;  5HHF A;  2ACZ A;  4AT0 A;  4CY8 A;  3NNE A;  1GT8 A;  1TDO A;  3IWA A;  3BI5 A;  4O5Q A;  1PXB A;  4IV9 A;  1VDC A;  4A65 A;  3QJ4 A;  1TYT A;  1ZOV A;  2RAB A;  1P2H A;  3G5S A;  1ZK7 A;  3C4A A;  3M12 A;  2WQY A;  1RP0 A;  3KPK A;  4K22 A;  4A79 A;  4JY3 A;  3GYX A;  3IHG A;  4BK1 A;  1E1M A;  2C75 A;  4H4S A;  2Z5Y A;  4JN9 A;  2JB3 A;  4EIQ A;  2AQJ A;  3NHO X;  1PJ7 A;  2GAG B;  5C2T A;  5BUL A;  3RP6 A;  1ZMD A;  3SFE A;  4K5S A;  4E0V A;  1IUT A;  1L9D A;  3F8D A;  5CQF A;  3RHA A;  4K7Z A;  3VRD B;  3CGD A;  4B67 A;  4DGK A;  4AOS A;  3GD3 A;  2R0G A;  1O94 A;  4OPU A;  4H7U A;  2Q0L A;  3K7Q X;  4H2P A;  3EAN A;  3UP4 A;  5IQ4 A;  4U8M A;  1PS9 A;  1RSG A;  3UCL A;  2BK3 A;  4II3 A;  2PYX A;  3AD9 B;  3CPJ G;  3AD8 B;  1GXF A;  2VOU A;  3AE4 A;  4OPL A;  4J57 A;  3II4 A;  4CCR A;  1JEH A;  4GF7 A;  1IUW A;  3CPI G;  1CBO A;  4NZH A;  4WX1 A;  3L8K A;  4U8K A;  2E5V A;  2YLR A;  2AR8 A;  4Z25 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...