5HXIA

2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, 5hn bound
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Role of the Tyr270 residue in 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase from Mesorhizobium loti
pubmed doi rcsb
source organism Rhizobium loti (strain maff303099)
total genus 129
structure length 369
sequence length 369
ec nomenclature
pdb deposition date 2016-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 5hxiA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5hxiA01
3T37A 1UKVG 3GRSA 4K5SA 3NLCA 2BS2A 3AE1A 2XFQA 4NEWA 3NGCX 2JB1A 4NTEA 1KDGA 3EPTA 1CC2A 1L9EA 3Q6JA 2JKCA 1TYTA 4K7ZA 2WOWA 2VVMA 2WPCA 2X8GA 4J56A 4LU6A 3RNMA 1ZX9A 2B9YA 2OLNA 1P2HA 2Y6RA 3B3RA 3NYCA 1MXTA 1BGJA 3M12A 2XCGA 2A8XA 2IVEA 2VVLA 3FIMB 3NNEA 1NHQA 4IA6A 4RSLA 1S2QA 4JDRA 3UTFA 2YVJA 3UTGA 2V60A 2IVDA 4H2PA 1KF6A 1YQZA 3IHGA 3P1WA 1GTHA 1GT8A 1CBOA 4Z26A 1IUSA 3AE9A 3IWAA 2GR3A 1PDHA 2BS4A 5FS9A 5J60A 1DODA 1Y56B 1K0IA 1D5TA 4FDCB 4YWOA 5FS8A 4EMIA 1FOHA 3UKKA 1GALA 1GRBA 3M13A 3H8LA 4PABA 4YT0A 1HYUA 1EL5A 2GAGB 4JNQA 3AE4A 3ITJA 2C76A 3AE5A 1ZMDA 3JSKA 3NN0X 2W0HA 4NEVA 3ICRA 3SM8A 3GD4A 3CPJG 1NPXA 3H4KA 3P4SA 4AT0A 3CTYA 2XLTA 1OJTA 4DSHA 4RG3A 1JRZA 4Z2TA 3NYFA 2YAUA 4YTPA 2FBWA 3UKHA 1H82A 4OPIA 1FCDA 1D7LA 2V5ZA 2X50A 4BK1A 1TDOA 4EQSA 2PHHA 4U8MA 4OCGA 3VRDB 2XVHA 3DGZA 1EBDA 1JNZA 2CFYA 4H4PA 4OPDA 2E4GA 3BNUA 4XXGA 4UDQA 1K0JA 3S5WA 2YG7A 3CPHG 2XFOA 1GTEA 2WETA 1NAAA 4O5UA 1H7XA 4JN9A 1PBCA 1H84A 5GRTA 4I59A 1Z6LA 2YR5A 4C5OA 2XFNA 4H4YA 2WESA 1GREA 2WU2A 5BRTA 1VQWA 2C66A 2R0GA 4BURA 2Q7VA 1BKWA 4ZCDA 1GETA 2BC1A 2H89A 1Q1RA 1NHRA 4AT2A 3DJEA 2GR1A 2WDVA 3AEEA 3CGDA 3NK0X 3CNSA 4H4WA 5KRQA 5KWFA 1ONFA 4APNA 1ZK7A 4B66A 5JCMA 1K4QA 1GOSA 1NEKA 3AE6A 3V3OA 3C4NA 4B65A 1LPFA 1ELIA 3C4AA 3ALMA 2A87A 4YSXA 2ZBWA 3AYJA 4GDPA 1NG3A 4Z43A 3SFEA 4E0VA 4D04A 2FJBA 1GRTA 2YLSA 1PJ7A 1TDFA 1TDKA 2YG3A 3BHFA 3QVPA 4OPTA 3DK9A 3VRAA 3K7TA 2C70A 4CNKA 3BI2A 4CBQA 5IQ1A 1BF3A 5EB4A 1GRGA 3CGEA 2QAEA 1F3PA 1V59A 2J3NA 2XYOA 5DBJA 3LOVA 4B63A 3GSIA 1JNRA 4C74A 2EQ9A 1IJHA 1CHUA 2GVCA 5BVAA 2WBAA 5JCIA 2C7GA 5KOXA 4TM1A 2CULA 2C73A 3CNDA 4C77A 2ZZCA 2FJDA 1FEBA 2ZZBA 1K0LA 1ZP0A 3GYJA 4MJWA 4YSHA 2XDOA 4EMWA 4HB9A 1IUUA 1NG4A 2BS3A 2E5VA 2V61A 1GRFA 2C67A 1LV0A 4FK1C 4Y4MA 3PS9A 2IIDA 3UKFA 5KOWA 1E1NA 2A89A 2YWLA 1ZDLA 5KVHA 1EL7A 2YLZA 4TM0A 1W4XA 5EBKA 4ZN0A 4CCRA 1YQ4A 2AQJA 5JCNA 3GMCA 3AYIA 5CQFA 4Z25A 2EQ8A 3CGCA 3EF6A 4H4UA 4K2XA 1DJNA 3GWDA 3UOVA 1TDEA 3OZ2A 4BJZA 1B37A 3NH3X 1VG0A 1MOKA 1Y0PA 2HQMA 4JNAA 1E6EA 4GDEA 3AXBA 2XVEA 4H4VA 4KX6A 2BABA 3CNJA 3BNMA 4N9XA 5FS6A 1AOGA 2WP6A 3BHKA 3UP4A 1N4VA 2GB0A 3CNPA 3NT6A 2VRLA 5M0ZA 1YQ3A 4IVOB 4CNJA 5IQ4A 1DOEA 3QVRA 4J2WA 4ICYA 1ZY8A 3VR8A 4EM4A 1N4WA 3KPFA 3P4QA 1SEZA 4YSYA 4A6NB 3REDA 3DH9A 4UP3A 3NIXA 2C64A 1L9DA 4TLZA 2YR6A 4AOXA 1RP0A 4U8PA 1IUTA 1P2EA 1OJDA 2JB2A 3LZWA 3V76A 3AB1A 3PVCA 1GXFA 1MO9A 1XHCA 1LQUA 2OALA 2YLWA 3FMWA 2R4EA 3KU9A 2DKIA 1CJ4A 1PXBA 3F8RA 3DJJA 3O0HA 4EM3A 2YM2A 2R0CA 5J7XA 2BK3A 2C75A 2YQUA 4XWZA 4OPGA 4P9SA 1CF3A 2GF3A 4U8LA 1B8SA 1D7YA 1S2YA 2V3AA 5KXJA 4M52A 3FG2P 2X8CA 4GF7A 1JOAA 1KSUA 3ATQA 3ICSA 3NK1X 4J57A 3SGLA 3IC9A 2OLOA 2R45A 3ADAB 3UTHA 1S3EA 3DK4A 2GMHA 2GEWA 3KLJA 4PAAA 4BV6A 4RG4A 2WPFA 2BA9A 4JQ9A 2JBVA 4Z24A 2WP9A 3P9UA 1QJDA 2WS3A 5U25A 2F5ZA 3GWFA 1PXCA 4H4RA 2Z5XA 1KNPA 4H4QA 4K22A 4DGKA 2OAMA 1CC6A 3AEFA 3S61A 2VOUA 4A7AA 2XFPA 3AD8B 5HXIA 3BI5A 5TR3A 2VVLG 2WHDA 2VZ2A 4EQRA 5U63A 1FECA 4Y4NA 4A79A 3AEBA 1XPQA 4U8IA 3UKPA 3AD9B 3AEAA 4EQWA 2WOVA 3GRTA 4GRTA 1CJCA 1LVLA 1QO8A 2Q0LA 3AEDA 3EANA 1H81A 1O94A 3E1TA 3II4A 4AP3A 1ZMCA 3G5RA 2YM1A 3IF9A 2B9XA 3ABVA 1L0VA 3SQPA 1DOCA 1E7PA 4FK1A 4B69A 1FL2A 4C3YA 2CDUA 4X9MA 2I0ZA 2Q6UA 1B5QA 3BI4A 3NG7X 2BYBA 3PO7A 4H4TA 2V3BA 1B4VA 3ALLA 4REKA 1E1KA 3VQRA 4H50A 4GUVA 4B1BA 1FEAA 3NYEA 1CJ3A 1DXLA 1YY5A 1IUXA 1EL8A 3NHOX 2BCGG 2AR8A 1CC4A 3AECA 5JCKA 2YG6A 3GYIA 4U8NA 1NHSA 1OJAA 4J36A 2WPEA 3NKSA 4YKGA 1VG9A 2XVFA 2YG4A 1E1MA 1PXAA 3GDNA 5EOWA 5ER0A 4H4XA 1CL0A 2C65A 2Y6QA 2RGJA 1F8RA 2GQFA 2VQBA 1PBEA 4OPCA 1GNDA 3GDPA 3G5QA 3NTDA 3AD7B 3CNTA 4USQA 1GERA 4HA6A 1E39A 2R0PA 3UOXA 2C3CA 1KNRA 1D4DA 2PYXA 3GMBA 5C3JA 3QSEA 3DJDA 3QSSA 2YLTA 1D4EA 2OA1A 3D8XA 5HHFA 1X31B 3AE3A 4BJYA 3ALJA 3D1CA 3LADA 2C3DA 2Z5YA 4USRA 4H2QA 3H8IA 3KA7A 1N1PA 3AE2A 1DJQA 3V3NA 3AE7A 1O95A 2BACA 3UOYA 3K30A 5JCLA 1M6IA 2VQ7A 2R9ZA 4NTDA 1ZOVA 2RGOA 2B7RA 1PBDA 2R4JA 1IUWA 2C72A 1GSNA 3ATRA 3L1RA 3DJGX 2YVFA 2BXRA 5KVIA 2R46A 1EL9A 1LQTA 1NDAA 5EB5A 3VR9A 1PBBA 1TDNA 2QA1A 1DOBA 1N4UA 2B76A 2X3NA 2XLPA 3NRNA 5M10A 1VRQB 2B9WA 3WE0A 3P4PA 4ECHA 2CVJA 2TMDA 1JRXA 2RABA 2WOIA 4OPLA 4B68A 1L9CA 1TRBA 2XLUA 3G5SA 4UDRA 3P4RA 3ICTA 4GCMA 1GESA 1JRYA 2WU5A 2B7SA 1JEHA 3QJ4A 2GAHB 5LV9A 3QFAA 3KD9A 4A5LA 4U8JA 1XANA 5CKUA 2EQ7A 2GRTA 1YKJA 3URHA 4D03A 1M64A 1KFYA 1Q1WA 2E1MA 4CCQA 1F8WA 2APGA 2WEUA 3FPZA 3KKJA 4A65A 2BXSA 3CGBA 4C3XA 1F6MA 4FX9A 3RHAA 5HY5A 1O5WA 2XVIA 3C96A 4NZHA 3GD3A 2WDRA 5C2TA 1GRAA 4IA5A 2GR0A 1BZLA 4BK3A 4EMJA 3SFDA 4ADWA 4OPUA 2QA2A 5BUKA 2ARDA 4J33A 4CRTA 4Z44A 2YVGA 5U1OA 1OJ9A 1NENA 4U2SA 3R9UA 2YG5A 4LA1A 3DK8A 3KVEA 1S3BA 1Y56A 1IUVA 2XLSA 1OJCA 1PJ5A 1JU2A 2VRMA 4H2RA 2YLXA 3UTEA 4A6NA 4DNAA 2XVJA 2BK5A 4YTMA 1Q9IA 4EQXA 2X8HA 3Q9TA 4K8DA 1H6VA 3FBSA 3COXA 4H7UA 1LTXR 2JAEA 5BULA 1CJ2A 1E1LA 3AE8A 3K7QX 4O5QA 2BK4A 3NTAA 1TYPA 4AP1A 2GQWA 2XLRA 4K5RA 1F8SA 3I6DA 2QCUA 4AOSA 3M0OA 2YR4A 2FJEA 2O9ZA 2Q0KA 2GMJA 3RP6A 3F8PA 3DMEA 1PHHA 4A99A 4H2NA 3CIRA 3UKLA 4B64A 2BC0A 2FJAA 4WX1A 4Z2UA 1RSGA 3AEGA 1GRHA 2ZZ0A 4IVMB 2DKHA 3AYLA 3RP7A 1H83A 4U8OA 5IPYA 2X99A 1H7WA 3L8KA 2GH5A 2NVKX 5FS7A 1GPEA 4XWRA 3I3LA 4YKFA 1BGNA 2BCPA 3UCLA 4J34A 2JK6A 3LXDA 4TLXA 5GSNA 3OC4A 3ZDNA 5L46A 4ZCCA 4JY3A 2H88A 3IHMA 3ZYXA 4Z2RA 3CN8A 2V6OA 2WQYA 3ISHA 2XFUA 4A9WA 4J31A 2AAQA 5FMHA 1QLBA 2NPXA 1D4CA 1ZOYA 1VDCA 3LZXA 4IV9A 3VRBA 4CY6A 1PJ6A 2ACZA 2EQ6A 2UZZA 3QFBA 3UP5A 1REOA 2WDQA 3AWIA 1RYIA 1PBFA 1PN0A 3NN6X 3QSMA 3CPIG 4TM4A 4YXDA 1KSSA 4BK2A 2GR2A 5HYMA 3HZLA 1BWCA 4EIQA 3LJPA 3UOZA 3K7MX 4KPRA 4H4SA 1DNCA 2RGHA 3EAOA 3UKQA 3B6DA 4UDPA 3DA1A 1NHPA 4I58A 4U2TA 4Y4LA 4TM3A 2TPRA 4X4JA 4YSZA 4OVIA 3DGHA 3F8DA 4LIIA 4X9NA 2WP5A 2JB3A 4B67A 4U2LA 4DSGA 2YLRA 4GR1A 3RP8A 4EIPA 1GV4A 1GEUA 4U8KA 3UKAA 4H4ZA 4YTNA 4NTCA 4JY2A 1LJ1A 1ZKQA 3NK2X 3LB8A 1H86A 2GV8A 4CY8A 4WCTA 1PS9A 1XDIA 1COYA
chains in the Genus database with same CATH superfamily
3T37A 1UKVG 3GRSA 4K5SA 3NLCA 2BS2A 3AE1A 2XFQA 4NEWA 3NGCX 2JB1A 4NTEA 1KDGA 3EPTA 1L9EA 1CC2A 3Q6JA 2JKCA 1TYTA 4K7ZA 2WOWA 2VVMA 2WPCA 2X8GA 4J56A 4LU6A 3RNMA 1ZX9A 2OLNA 2B9YA 1P2HA 2Y6RA 3B3RA 3NYCA 1MXTA 1BGJA 3M12A 2XCGA 2A8XA 2IVEA 4IA6A 4RSLA 2VVLA 1NHQA 3FIMB 3NNEA 1S2QA 4JDRA 3SZ0A 2YVJA 3T2ZA 3UTGA 2V60A 2IVDA 4H2PA 1KF6A 1YQZA 3IHGA 3P1WA 1GTHA 1GT8A 1CBOA 4Z26A 1IUSA 3AE9A 3IWAA 2GR3A 1PDHA 2BS4A 5FS9A 5J60A 1DODA 1Y56B 1K0IA 1D5TA 4FDCB 4YWOA 5FS8A 4EMIA 1FOHA 3UKKA 1GALA 3M13A 1GRBA 3H8LA 3T31A 4PABA 4YT0A 1HYUA 1EL5A 2GAGB 4JNQA 3AE4A 3ITJA 2C76A 3AE5A 1ZMDA 3JSKA 1AN9A 2W0HA 3NN0X 4II3A 4NEVA 3ICRA 3SM8A 3GD4A 3CPJG 1NPXA 5KMQA 2E82A 3H4KA 3P4SA 4AT0A 4QFCA 3CTYA 2XLTA 1OJTA 4DSHA 4RG3A 1JRZA 4Z2TA 3NYFA 2YAUA 4YTPA 2FBWA 3UKHA 1H82A 4OPIA 1FCDA 1D7LA 2V5ZA 2X50A 4BK1A 1TDOA 4EQSA 2PHHA 5KNLA 4U8MA 4OCGA 3VRDB 2XVHA 3DGZA 1EBDA 1JNZA 2CFYA 4H4PA 4OPDA 2E4GA 3BNUA 3HYVA 4XXGA 4UDQA 1K0JA 1C0KA 4GAVA 2YG7A 3S5WA 3CPHG 2XFOA 1GTEA 2WETA 1NAAA 4O5UA 1H7XA 4JN9A 1PBCA 3WGTA 1H84A 5GRTA 4I59A 1Z6LA 2YR5A 3ZNPA 4C5OA 2XFNA 4H4YA 2WESA 1GREA 2WU2A 5BRTA 1VQWA 2C66A 2R0GA 4BURA 2Q7VA 4G9KA 1BKWA 4ZCDA 1GETA 2BC1A 2H89A 1Q1RA 1NHRA 4AT2A 3DJEA 2GR1A 2WDVA 3AEEA 3CGDA 3NK0X 3CNSA 4H4WA 5KRQA 5KWFA 1ONFA 4APNA 1ZK7A 4B66A 5JCMA 1K4QA 1GOSA 1NEKA 3AE6A 3V3OA 3C4NA 4B65A 1LPFA 1ELIA 3C4AA 3ALMA 2A87A 4YSXA 2ZBWA 3KPKA 3AYJA 4GDPA 1NG3A 4Z43A 3SFEA 4E0VA 4D04A 2FJBA 4G73A 3W4IA 4YJFA 1GRTA 2YLSA 1PJ7A 1TDFA 1TDKA 2YG3A 3BHFA 3QVPA 4OPTA 3DK9A 3VRAA 3K7TA 2C70A 4CNKA 3BI2A 4CBQA 5IQ1A 1BF3A 5EB4A 1GRGA 3CGEA 2QAEA 3GYXA 1F3PA 1V59A 2J3NA 2XYOA 5DBJA 3LOVA 4B63A 3GSIA 1JNRA 4C74A 2EQ9A 1IJHA 1CHUA 2GVCA 5BVAA 2WBAA 5JCIA 2C7GA 5KOXA 4TM1A 1EVIA 2CULA 2C73A 3CNDA 5KMSA 4C77A 2ZZCA 2FJDA 4YJHB 1FEBA 2ZZBA 1K0LA 1ZP0A 3GYJA 4YSHA 4MJWA 2XDOA 4EMWA 4HB9A 1IUUA 1NG4A 2BS3A 2E5VA 2V61A 1GRFA 2C67A 1LV0A 4FK1C 4Y4MA 3PS9A 2IIDA 3UKFA 5KOWA 1E1NA 2A89A 2YWLA 1ZDLA 5KVHA 1EL7A 2YLZA 3ZNOA 4TM0A 1W4XA 5EBKA 3ZNQA 4CCRA 4ZN0A 1YQ4A 2AQJA 5JCNA 3GMCA 3AYIA 5CQFA 4Z25A 2EQ8A 3CGCA 3EF6A 4H4UA 4K2XA 1DJNA 3GWDA 3UOVA 3OZ2A 1TDEA 4BJZA 1B37A 3NH3X 1VG0A 1MOKA 1Y0PA 2HQMA 3SXIA 4JNAA 1E6EA 4GDEA 3AXBA 2XVEA 3ZNNA 4H4VA 4KX6A 2BABA 3CNJA 3BNMA 4N9XA 4NWZA 4YJDA 5FS6A 1AOGA 3BHKA 2WP6A 3UP4A 2GB0A 1N4VA 1DAOA 3CNPA 3NT6A 2VRLA 5M0ZA 1C0PA 1YQ3A 4IVOB 4CNJA 5IQ4A 1DOEA 3QVRA 4J2WA 4ICYA 1ZY8A 3VR8A 4EM4A 4YJGA 1N4WA 3KPFA 3P4QA 1SEZA 4YSYA 4A6NB 3REDA 3DH9A 4UP3A 3NIXA 2C64A 1L9DA 4TLZA 2YR6A 4AOXA 1RP0A 4U8PA 3SYIA 1IUTA 1P2EA 1OJDA 2JB2A 3LZWA 3V76A 3AB1A 3PVCA 1GXFA 1MO9A 1XHCA 1LQUA 2OALA 2YLWA 3FMWA 2R4EA 3KU9A 2DKIA 1CJ4A 1PXBA 3F8RA 2E49A 3DJJA 3O0HA 4EM3A 2YM2A 2R0CA 5J7XA 2BK3A 2C75A 4XWZA 2YQUA 4OPGA 4P9SA 4G6GA 1CF3A 2GF3A 4U8LA 1B8SA 1D7YA 1S2YA 2V3AA 5KXJA 4M52A 3FG2P 2X8CA 4GF7A 1JOAA 1KSUA 2DU8A 3ATQA 3ICSA 3NK1X 4J57A 3SGLA 3IC9A 4II2A 2OLOA 2R45A 3ADAB 4GAPA 3UTHA 1S3EA 3DK4A 2GMHA 2GEWA 3KLJA 4PAAA 4BV6A 4RG4A 2WPFA 2BA9A 4JQ9A 2JBVA 4Z24A 2WP9A 3P9UA 1QJDA 2WS3A 5U25A 2F5ZA 3GWFA 1PXCA 4H4RA 3SY4A 2Z5XA 3CUKA 1KNPA 4H4QA 4K22A 4DGKA 2OAMA 1CC6A 3AEFA 4G6HA 2VOUA 3S61A 4A7AA 2XFPA 3AD8B 5HXIA 3BI5A 5TR3A 2VVLG 2WHDA 2VZ2A 4EQRA 5U63A 1FECA 4Y4NA 4A79A 3AEBA 1XPQA 1C0LA 4U8IA 3UKPA 3AD9B 3AEAA 4EQWA 2WOVA 3GRTA 4GRTA 1CJCA 1LVLA 1QO8A 2Q0LA 3AEDA 3EANA 3E1TA 1H81A 1O94A 3II4A 3W4JA 4AP3A 1ZMCA 3G5RA 3IF9A 2YM1A 2B9XA 3ABVA 1L0VA 3SQPA 1DOCA 1E7PA 4FK1A 4B69A 1FL2A 4C3YA 4QFDA 2CDUA 4X9MA 3UTFA 2I0ZA 2Q6UA 1B5QA 3BI4A 3NG7X 2BYBA 3VQRA 3PO7A 2V3BA 1B4VA 3ALLA 4H4TA 1E1KA 4REKA 4H50A 4GUVA 1KIFA 4B1BA 1FEAA 3NYEA 1CJ3A 1C0IA 1DXLA 1IUXA 1YY5A 1EL8A 3NHOX 2BCGG 2AR8A 1CC4A 3AECA 5JCKA 2YG6A 3GYIA 4U8NA 1NHSA 1OJAA 4J36A 2WPEA 3NKSA 4YKGA 1VG9A 2XVFA 2YG4A 1E1MA 1PXAA 3GDNA 2BRYA 5EOWA 5ER0A 4H4XA 1CL0A 2C65A 2Y6QA 2RGJA 1F8RA 2GQFA 2VQBA 1PBEA 4OPCA 1GNDA 3GDPA 3G5QA 3NTDA 3AD7B 3CNTA 4USQA 1GERA 4HA6A 1E39A 2R0PA 3UOXA 2C3CA 1KNRA 1D4DA 2PYXA 1VE9A 3GMBA 5C3JA 3QSEA 3DJDA 3QSSA 2YLTA 1D4EA 2OA1A 3D8XA 5HHFA 1X31B 3AE3A 4BJYA 3ALJA 3D1CA 3LADA 2C3DA 2Z5YA 4USRA 4H2QA 3H8IA 3KA7A 1N1PA 3AE2A 1DJQA 3G3EA 3V3NA 3AE7A 1O95A 2BACA 3UOYA 3K30A 5JCLA 1M6IA 2VQ7A 2R9ZA 4NTDA 1ZOVA 2RGOA 3HYXA 2B7RA 1PBDA 2R4JA 1IUWA 2C72A 1GSNA 3ATRA 3L1RA 3DJGX 2YVFA 2BXRA 5KVIA 2R46A 1EL9A 1LQTA 1NDAA 5EB5A 3VR9A 1PBBA 1TDNA 2QA1A 1DOBA 1N4UA 2B76A 2X3NA 2XLPA 3NRNA 5M10A 1VRQB 2C4CA 2B9WA 3WE0A 3P4PA 4ECHA 2CVJA 4YJHA 2TMDA 1JRXA 3SX6A 2RABA 2WOIA 4OPLA 4B68A 1L9CA 1TRBA 2XLUA 3G5SA 4UDRA 3P4RA 3ICTA 4GCMA 3SZWA 1GESA 1JRYA 2WU5A 2B7SA 1JEHA 3QJ4A 1DDOA 2BRAA 5LV9A 3QFAA 3KD9A 4A5LA 4U8JA 1XANA 5CKUA 2EQ7A 2GRTA 1YKJA 3URHA 4D03A 1M64A 1KFYA 1Q1WA 2E1MA 4CCQA 1F8WA 2APGA 2WEUA 3FPZA 3KKJA 3SZCA 4A65A 2BXSA 3CGBA 4C3XA 1F6MA 4FX9A 3RHAA 5HY5A 1O5WA 2XVIA 3C96A 4NZHA 3GD3A 2WDRA 5C2TA 1GRAA 4IA5A 3W4KA 2GR0A 4BK3A 1BZLA 4EMJA 3SFDA 4ADWA 4OPUA 2QA2A 5BUKA 2ARDA 4J33A 3T0KA 4Z44A 2YVGA 5U1OA 1OJ9A 4CRTA 1NENA 4U2SA 3R9UA 2YG5A 1PS9A 4LA1A 3DK8A 3KVEA 1S3BA 1Y56A 1IUVA 2XLSA 1PJ5A 1OJCA 1JU2A 2VRMA 4H2RA 2YLXA 3UTEA 4A6NA 4DNAA 2XVJA 2BK5A 4YTMA 1Q9IA 4EQXA 2X8HA 3Q9TA 4YJFB 4K8DA 1H6VA 3FBSA 3COXA 4H7UA 1LTXR 2JAEA 5BULA 1CJ2A 1E1LA 3AE8A 3K7QX 4O5QA 2BK4A 3NTAA 1TYPA 4AP1A 2GQWA 2XLRA 4K5RA 1F8SA 3I6DA 2QCUA 4AOSA 5KMRA 3M0OA 2YR4A 2FJEA 2O9ZA 2Q0KA 2GMJA 3RP6A 3F8PA 3DMEA 1PHHA 4A99A 4H2NA 3CIRA 3UKLA 4B64A 2E4AA 2BC0A 2FJAA 2E48A 4WX1A 3CMMA 4Z2UA 1RSGA 3AEGA 1GRHA 2ZZ0A 4IVMB 2DKHA 3RP7A 3AYLA 1H83A 4U8OA 5IPYA 3SZFA 2X99A 1H7WA 3L8KA 2GH5A 2NVKX 5FS7A 3T14A 1GPEA 4XWRA 3I3LA 4YKFA 1BGNA 2BCPA 3UCLA 4J34A 2JK6A 5L46A 3LXDA 4G74A 3OC4A 4TLXA 5GSNA 3ZDNA 4ZCCA 4JY3A 2H88A 3IHMA 3ZYXA 4Z2RA 3CN8A 2V6OA 2WQYA 3ISHA 2XFUA 4A9WA 4J31A 2AAQA 5FMHA 1QLBA 2NPXA 1D4CA 1ZOYA 1VDCA 3LZXA 4IV9A 3VRBA 4CY6A 1PJ6A 2ACZA 2UZZA 2EQ6A 3QFBA 3UP5A 1REOA 2WDQA 3AWIA 1RYIA 1PBFA 1PN0A 3QSMA 3NN6X 3CPIG 4TM4A 4YXDA 1KSSA 4BK2A 5HYMA 2GR2A 3HZLA 3T2YA 1BWCA 4EIQA 3LJPA 3UOZA 3K7MX 4KPRA 4H4SA 1DNCA 2RGHA 3EAOA 5KMPA 3UKQA 3B6DA 4UDPA 3DA1A 1NHPA 4I58A 4U2TA 4YJGB 4Y4LA 4TM3A 2TPRA 4X4JA 4YSZA 4OVIA 3DGHA 3F8DA 4X9NA 4LIIA 2WP5A 2JB3A 4B67A 4U2LA 4DSGA 2YLRA 4GR1A 3RP8A 4EIPA 1GV4A 1GEUA 4U8KA 3UKAA 4H4ZA 4YTNA 4NTCA 3HYWA 4JY2A 1LJ1A 1ZKQA 3NK2X 3LB8A 1H86A 2GV8A 3T2KA 4CY8A 4WCTA 2GAHB 1XDIA 1COYA 4NNJA
chains in the Genus database with same CATH topology
3T37A 1UKVG 3GRSA 4K5SA 3NLCA 2BS2A 3AE1A 2XFQA 4NEWA 3NGCX 2JB1A 4NTEA 1KDGA 3EPTA 1CC2A 1L9EA 3Q6JA 2JKCA 1TYTA 4K7ZA 2WOWA 2VVMA 2WPCA 2X8GA 4J56A 4LU6A 3RNMA 1ZX9A 2B9YA 2OLNA 1P2HA 2Y6RA 3B3RA 3NYCA 1MXTA 1BGJA 3M12A 2XCGA 2A8XA 2IVEA 4IA6A 2VVLA 3FIMB 1NHQA 3NNEA 4RSLA 1S2QA 4JDRA 3SZ0A 2YVJA 3T2ZA 3UTGA 2V60A 2IVDA 4H2PA 1KF6A 1YQZA 3IHGA 3P1WA 1GTHA 1GT8A 1CBOA 4Z26A 1IUSA 3AE9A 3IWAA 2GR3A 1PDHA 2BS4A 5FS9A 5J60A 1DODA 1Y56B 1K0IA 1D5TA 4FDCB 4YWOA 5FS8A 4EMIA 1FOHA 3UKKA 1GALA 1GRBA 3M13A 3H8LA 3T31A 4PABA 4YT0A 1HYUA 1EL5A 2GAGB 4JNQA 3AE4A 3ITJA 2C76A 3AE5A 1ZMDA 3JSKA 3NN0X 2W0HA 4II3A 4NEVA 3ICRA 3SM8A 3GD4A 3CPJG 1NPXA 5KMQA 3H4KA 3P4SA 4AT0A 3CTYA 2XLTA 1OJTA 4DSHA 4RG3A 1JRZA 4Z2TA 3NYFA 2YAUA 4YTPA 2FBWA 3UKHA 1H82A 4OPIA 1FCDA 1D7LA 2V5ZA 2X50A 4BK1A 1TDOA 4EQSA 2PHHA 5KNLA 4U8MA 4OCGA 3VRDB 2XVHA 3DGZA 1EBDA 1JNZA 2CFYA 4H4PA 4OPDA 2E4GA 3BNUA 3HYVA 4XXGA 4UDQA 1K0JA 3S5WA 4GAVA 2YG7A 3CPHG 2XFOA 1GTEA 2WETA 1NAAA 4O5UA 1H7XA 4JN9A 1PBCA 1H84A 5GRTA 4I59A 1Z6LA 2YR5A 4C5OA 2XFNA 4H4YA 2WESA 1GREA 2WU2A 5BRTA 1VQWA 2C66A 2R0GA 4BURA 2Q7VA 4G9KA 1BKWA 4ZCDA 1GETA 2BC1A 2H89A 1Q1RA 1NHRA 4AT2A 3DJEA 2GR1A 2WDVA 3AEEA 3CGDA 3NK0X 3CNSA 4H4WA 5KRQA 5KWFA 1ONFA 4APNA 1ZK7A 4B66A 5JCMA 1K4QA 1GOSA 1NEKA 3AE6A 3V3OA 3C4NA 4B65A 1LPFA 1ELIA 3C4AA 3ALMA 2A87A 4YSXA 2ZBWA 3KPKA 3AYJA 4GDPA 1NG3A 4Z43A 3SFEA 4E0VA 4D04A 2FJBA 4G73A 1GRTA 2YLSA 1PJ7A 1TDFA 1TDKA 2YG3A 3BHFA 3QVPA 4OPTA 3DK9A 3VRAA 3K7TA 2C70A 4CNKA 3BI2A 4CBQA 5IQ1A 1BF3A 5EB4A 1GRGA 3CGEA 2QAEA 3GYXA 1F3PA 1V59A 2J3NA 2XYOA 5DBJA 3LOVA 4B63A 3GSIA 1JNRA 4C74A 2EQ9A 1IJHA 1CHUA 2GVCA 5BVAA 2WBAA 5JCIA 2C7GA 5KOXA 4TM1A 2CULA 2C73A 3CNDA 5KMSA 4C77A 2ZZCA 2FJDA 1FEBA 2ZZBA 1K0LA 1ZP0A 3GYJA 4MJWA 4YSHA 2XDOA 4EMWA 4HB9A 1IUUA 1NG4A 2BS3A 2E5VA 2V61A 1GRFA 2C67A 1LV0A 4FK1C 4Y4MA 3PS9A 2IIDA 3UKFA 5KOWA 1E1NA 2A89A 2YWLA 1ZDLA 5KVHA 1EL7A 2YLZA 4TM0A 1W4XA 5EBKA 4ZN0A 4CCRA 1YQ4A 2AQJA 5JCNA 3GMCA 3AYIA 5CQFA 4Z25A 2EQ8A 3CGCA 3EF6A 4H4UA 4K2XA 1DJNA 3GWDA 3UOVA 1TDEA 3OZ2A 4BJZA 1B37A 3NH3X 1VG0A 1MOKA 1Y0PA 2HQMA 3SXIA 4JNAA 1E6EA 4GDEA 3AXBA 2XVEA 4H4VA 4KX6A 2BABA 3CNJA 3BNMA 4N9XA 4NWZA 5FS6A 1AOGA 2WP6A 3BHKA 3UP4A 1N4VA 2GB0A 3CNPA 3NT6A 2VRLA 5M0ZA 1YQ3A 4IVOB 4CNJA 5IQ4A 1DOEA 3QVRA 4J2WA 4ICYA 1ZY8A 3VR8A 4EM4A 1N4WA 3KPFA 3P4QA 1SEZA 4YSYA 4A6NB 3REDA 3DH9A 4UP3A 3NIXA 2C64A 1L9DA 4TLZA 2YR6A 4AOXA 1RP0A 4U8PA 3SYIA 1IUTA 1P2EA 1OJDA 2JB2A 3LZWA 3V76A 3AB1A 3PVCA 1GXFA 1MO9A 1XHCA 1LQUA 2OALA 2YLWA 3FMWA 2R4EA 3KU9A 2DKIA 1CJ4A 1PXBA 3F8RA 3DJJA 3O0HA 4EM3A 2YM2A 2R0CA 5J7XA 2BK3A 2C75A 2YQUA 4XWZA 4OPGA 4P9SA 4G6GA 1CF3A 2GF3A 4U8LA 1B8SA 1D7YA 1S2YA 2V3AA 5KXJA 4M52A 3FG2P 2X8CA 4GF7A 1JOAA 1KSUA 3ATQA 3ICSA 3NK1X 4J57A 3SGLA 3IC9A 4II2A 2OLOA 2R45A 3ADAB 4GAPA 3UTHA 1S3EA 3DK4A 2GMHA 2GEWA 3KLJA 4PAAA 4BV6A 4RG4A 2WPFA 2BA9A 4JQ9A 2JBVA 4Z24A 2WP9A 3P9UA 1QJDA 2WS3A 5U25A 2F5ZA 3GWFA 1PXCA 4H4RA 3SY4A 2Z5XA 1KNPA 4H4QA 4K22A 4DGKA 2OAMA 1CC6A 3AEFA 4G6HA 2VOUA 3S61A 4A7AA 2XFPA 3AD8B 5HXIA 3BI5A 5TR3A 2VVLG 2WHDA 2VZ2A 4EQRA 5U63A 1FECA 4Y4NA 4A79A 3AEBA 1XPQA 4U8IA 3UKPA 3AD9B 3AEAA 4EQWA 2WOVA 3GRTA 4GRTA 1CJCA 1LVLA 1QO8A 2Q0LA 3AEDA 3EANA 3E1TA 1H81A 1O94A 3II4A 4AP3A 1ZMCA 3G5RA 2YM1A 3IF9A 2B9XA 3ABVA 1L0VA 3SQPA 1DOCA 1E7PA 4FK1A 4B69A 1FL2A 4C3YA 2CDUA 4X9MA 3UTFA 2I0ZA 2Q6UA 1B5QA 3BI4A 3NG7X 2BYBA 3PO7A 4H4TA 2V3BA 1B4VA 3ALLA 4REKA 1E1KA 3VQRA 4H50A 4GUVA 4B1BA 1FEAA 3NYEA 1CJ3A 1DXLA 1YY5A 1IUXA 1EL8A 3NHOX 2BCGG 2AR8A 1CC4A 3AECA 5JCKA 2YG6A 3GYIA 4U8NA 1NHSA 1OJAA 4J36A 2WPEA 3NKSA 4YKGA 1VG9A 2XVFA 2YG4A 1E1MA 1PXAA 3GDNA 2BRYA 5EOWA 5ER0A 4H4XA 1CL0A 2C65A 2Y6QA 2RGJA 1F8RA 2GQFA 2VQBA 1PBEA 4OPCA 1GNDA 3GDPA 3G5QA 3NTDA 3AD7B 3CNTA 4USQA 1GERA 4HA6A 1E39A 2R0PA 3UOXA 2C3CA 1KNRA 1D4DA 2PYXA 3GMBA 5C3JA 3QSEA 3DJDA 3QSSA 2YLTA 1D4EA 2OA1A 3D8XA 5HHFA 1X31B 3AE3A 4BJYA 3ALJA 3D1CA 3LADA 2C3DA 2Z5YA 4USRA 4H2QA 3H8IA 3KA7A 1N1PA 3AE2A 1DJQA 3V3NA 3AE7A 1O95A 2BACA 3UOYA 3K30A 5JCLA 1M6IA 2VQ7A 2R9ZA 4NTDA 1ZOVA 2RGOA 3HYXA 2B7RA 1PBDA 2R4JA 1IUWA 2C72A 1GSNA 3ATRA 3L1RA 3DJGX 2YVFA 2BXRA 5KVIA 2R46A 1EL9A 1LQTA 1NDAA 5EB5A 3VR9A 1PBBA 1TDNA 2QA1A 1DOBA 1N4UA 2B76A 2X3NA 2XLPA 3NRNA 5M10A 1VRQB 2C4CA 2B9WA 3WE0A 3P4PA 4ECHA 2CVJA 2TMDA 1JRXA 3SX6A 2RABA 2WOIA 4OPLA 4B68A 1L9CA 1TRBA 2XLUA 3G5SA 4UDRA 3P4RA 3ICTA 4GCMA 3SZWA 1GESA 1JRYA 2WU5A 2B7SA 1JEHA 3QJ4A 2GAHB 2BRAA 5LV9A 3QFAA 3KD9A 4A5LA 4U8JA 1XANA 5CKUA 2EQ7A 2GRTA 1YKJA 3URHA 4D03A 1M64A 1KFYA 1Q1WA 2E1MA 4CCQA 1F8WA 2APGA 2WEUA 3FPZA 3KKJA 3SZCA 4A65A 2BXSA 3CGBA 4C3XA 1F6MA 4FX9A 3RHAA 5HY5A 1O5WA 2XVIA 3C96A 4NZHA 3GD3A 2WDRA 5C2TA 1GRAA 4IA5A 2GR0A 4BK3A 1BZLA 4EMJA 3SFDA 4ADWA 4OPUA 2QA2A 5BUKA 2ARDA 4J33A 3T0KA 4Z44A 2YVGA 5U1OA 1OJ9A 4CRTA 1NENA 4U2SA 3R9UA 2YG5A 4LA1A 3DK8A 3KVEA 1S3BA 1Y56A 1IUVA 2XLSA 1OJCA 1PJ5A 1JU2A 2VRMA 4H2RA 2YLXA 3UTEA 4A6NA 4DNAA 2XVJA 2BK5A 4YTMA 1Q9IA 4EQXA 2X8HA 3Q9TA 4K8DA 1H6VA 3FBSA 3COXA 4H7UA 1LTXR 2JAEA 5BULA 1CJ2A 1E1LA 3AE8A 3K7QX 4O5QA 2BK4A 3NTAA 1TYPA 4AP1A 2GQWA 2XLRA 4K5RA 1F8SA 3I6DA 2QCUA 4AOSA 5KMRA 3M0OA 2YR4A 2FJEA 2O9ZA 2Q0KA 2GMJA 3RP6A 3F8PA 3DMEA 1PHHA 4A99A 4H2NA 3CIRA 3UKLA 4B64A 2BC0A 2FJAA 4WX1A 3CMMA 4Z2UA 1RSGA 3AEGA 1GRHA 2ZZ0A 4IVMB 2DKHA 3RP7A 3AYLA 1H83A 4U8OA 5IPYA 3SZFA 2X99A 1H7WA 3L8KA 2GH5A 2NVKX 5FS7A 3T14A 1GPEA 4XWRA 3I3LA 4YKFA 1BGNA 2BCPA 3UCLA 4J34A 2JK6A 3LXDA 4G74A 4TLXA 3OC4A 5GSNA 3ZDNA 5L46A 4ZCCA 4JY3A 2H88A 3IHMA 3ZYXA 4Z2RA 3CN8A 2V6OA 2WQYA 3ISHA 2XFUA 4A9WA 4J31A 2AAQA 5FMHA 1QLBA 2NPXA 1D4CA 1ZOYA 1VDCA 3LZXA 4IV9A 3VRBA 4CY6A 1PJ6A 2ACZA 2EQ6A 2UZZA 3QFBA 3UP5A 1REOA 2WDQA 3AWIA 1RYIA 1PBFA 1PN0A 3NN6X 3QSMA 3CPIG 4TM4A 4YXDA 1KSSA 4BK2A 5HYMA 2GR2A 3HZLA 3T2YA 1BWCA 4EIQA 3LJPA 3UOZA 3K7MX 4KPRA 4H4SA 1DNCA 2RGHA 3EAOA 5KMPA 3UKQA 3B6DA 4UDPA 3DA1A 1NHPA 4I58A 4U2TA 4Y4LA 4TM3A 2TPRA 4X4JA 4YSZA 4OVIA 3DGHA 3F8DA 4LIIA 4X9NA 2WP5A 2JB3A 4B67A 4U2LA 4DSGA 2YLRA 4GR1A 3RP8A 4EIPA 1GV4A 1GEUA 4U8KA 3UKAA 4H4ZA 4YTNA 4NTCA 3HYWA 4JY2A 1LJ1A 1ZKQA 3NK2X 3LB8A 1H86A 2GV8A 3T2KA 4CY8A 4WCTA 1PS9A 1XDIA 1COYA 4NNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T37 A;  1UKV G;  3GRS A;  4K5S A;  3NLC A;  2BS2 A;  3AE1 A;  2XFQ A;  4NEW A;  3NGC X;  2JB1 A;  4NTE A;  1KDG A;  3EPT A;  1CC2 A;  1L9E A;  3Q6J A;  2JKC A;  1TYT A;  4K7Z A;  2WOW A;  2VVM A;  2WPC A;  2X8G A;  4J56 A;  4LU6 A;  3RNM A;  1ZX9 A;  2B9Y A;  2OLN A;  1P2H A;  2Y6R A;  3B3R A;  3NYC A;  1MXT A;  1BGJ A;  3M12 A;  2XCG A;  2A8X A;  2IVE A;  2VVL A;  3FIM B;  3NNE A;  1NHQ A;  4IA6 A;  4RSL A;  1S2Q A;  4JDR A;  3UTF A;  2YVJ A;  3UTG A;  2V60 A;  2IVD A;  4H2P A;  1KF6 A;  1YQZ A;  3IHG A;  3P1W A;  1GTH A;  1GT8 A;  1CBO A;  4Z26 A;  1IUS A;  3AE9 A;  3IWA A;  2GR3 A;  1PDH A;  2BS4 A;  5FS9 A;  5J60 A;  1DOD A;  1Y56 B;  1K0I A;  1D5T A;  4FDC B;  4YWO A;  5FS8 A;  4EMI A;  1FOH A;  3UKK A;  1GAL A;  1GRB A;  3M13 A;  3H8L A;  4PAB A;  4YT0 A;  1HYU A;  1EL5 A;  2GAG B;  4JNQ A;  3AE4 A;  3ITJ A;  2C76 A;  3AE5 A;  1ZMD A;  3JSK A;  3NN0 X;  2W0H A;  4NEV A;  3ICR A;  3SM8 A;  3GD4 A;  3CPJ G;  1NPX A;  3H4K A;  3P4S A;  4AT0 A;  3CTY A;  2XLT A;  1OJT A;  4DSH A;  4RG3 A;  1JRZ A;  4Z2T A;  3NYF A;  2YAU A;  4YTP A;  2FBW A;  3UKH A;  1H82 A;  4OPI A;  1FCD A;  1D7L A;  2V5Z A;  2X50 A;  4BK1 A;  1TDO A;  4EQS A;  2PHH A;  4U8M A;  4OCG A;  3VRD B;  2XVH A;  3DGZ A;  1EBD A;  1JNZ A;  2CFY A;  4H4P A;  4OPD A;  2E4G A;  3BNU A;  4XXG A;  4UDQ A;  1K0J A;  3S5W A;  2YG7 A;  3CPH G;  2XFO A;  1GTE A;  2WET A;  1NAA A;  4O5U A;  1H7X A;  4JN9 A;  1PBC A;  1H84 A;  5GRT A;  4I59 A;  1Z6L A;  2YR5 A;  4C5O A;  2XFN A;  4H4Y A;  2WES A;  1GRE A;  2WU2 A;  5BRT A;  1VQW A;  2C66 A;  2R0G A;  4BUR A;  2Q7V A;  1BKW A;  4ZCD A;  1GET A;  2BC1 A;  2H89 A;  1Q1R A;  1NHR A;  4AT2 A;  3DJE A;  2GR1 A;  2WDV A;  3AEE A;  3CGD A;  3NK0 X;  3CNS A;  4H4W A;  5KRQ A;  5KWF A;  1ONF A;  4APN A;  1ZK7 A;  4B66 A;  5JCM A;  1K4Q A;  1GOS A;  1NEK A;  3AE6 A;  3V3O A;  3C4N A;  4B65 A;  1LPF A;  1ELI A;  3C4A A;  3ALM A;  2A87 A;  4YSX A;  2ZBW A;  3AYJ A;  4GDP A;  1NG3 A;  4Z43 A;  3SFE A;  4E0V A;  4D04 A;  2FJB A;  1GRT A;  2YLS A;  1PJ7 A;  1TDF A;  1TDK A;  2YG3 A;  3BHF A;  3QVP A;  4OPT A;  3DK9 A;  3VRA A;  3K7T A;  2C70 A;  4CNK A;  3BI2 A;  4CBQ A;  5IQ1 A;  1BF3 A;  5EB4 A;  1GRG A;  3CGE A;  2QAE A;  1F3P A;  1V59 A;  2J3N A;  2XYO A;  5DBJ A;  3LOV A;  4B63 A;  3GSI A;  1JNR A;  4C74 A;  2EQ9 A;  1IJH A;  1CHU A;  2GVC A;  5BVA A;  2WBA A;  5JCI A;  2C7G A;  5KOX A;  4TM1 A;  2CUL A;  2C73 A;  3CND A;  4C77 A;  2ZZC A;  2FJD A;  1FEB A;  2ZZB A;  1K0L A;  1ZP0 A;  3GYJ A;  4MJW A;  4YSH A;  2XDO A;  4EMW A;  4HB9 A;  1IUU A;  1NG4 A;  2BS3 A;  2E5V A;  2V61 A;  1GRF A;  2C67 A;  1LV0 A;  4FK1 C;  4Y4M A;  3PS9 A;  2IID A;  3UKF A;  5KOW A;  1E1N A;  2A89 A;  2YWL A;  1ZDL A;  5KVH A;  1EL7 A;  2YLZ A;  4TM0 A;  1W4X A;  5EBK A;  4ZN0 A;  4CCR A;  1YQ4 A;  2AQJ A;  5JCN A;  3GMC A;  3AYI A;  5CQF A;  4Z25 A;  2EQ8 A;  3CGC A;  3EF6 A;  4H4U A;  4K2X A;  1DJN A;  3GWD A;  3UOV A;  1TDE A;  3OZ2 A;  4BJZ A;  1B37 A;  3NH3 X;  1VG0 A;  1MOK A;  1Y0P A;  2HQM A;  4JNA A;  1E6E A;  4GDE A;  3AXB A;  2XVE A;  4H4V A;  4KX6 A;  2BAB A;  3CNJ A;  3BNM A;  4N9X A;  5FS6 A;  1AOG A;  2WP6 A;  3BHK A;  3UP4 A;  1N4V A;  2GB0 A;  3CNP A;  3NT6 A;  2VRL A;  5M0Z A;  1YQ3 A;  4IVO B;  4CNJ A;  5IQ4 A;  1DOE A;  3QVR A;  4J2W A;  4ICY A;  1ZY8 A;  3VR8 A;  4EM4 A;  1N4W A;  3KPF A;  3P4Q A;  1SEZ A;  4YSY A;  4A6N B;  3RED A;  3DH9 A;  4UP3 A;  3NIX A;  2C64 A;  1L9D A;  4TLZ A;  2YR6 A;  4AOX A;  1RP0 A;  4U8P A;  1IUT A;  1P2E A;  1OJD A;  2JB2 A;  3LZW A;  3V76 A;  3AB1 A;  3PVC A;  1GXF A;  1MO9 A;  1XHC A;  1LQU A;  2OAL A;  2YLW A;  3FMW A;  2R4E A;  3KU9 A;  2DKI A;  1CJ4 A;  1PXB A;  3F8R A;  3DJJ A;  3O0H A;  4EM3 A;  2YM2 A;  2R0C A;  5J7X A;  2BK3 A;  2C75 A;  2YQU A;  4XWZ A;  4OPG A;  4P9S A;  1CF3 A;  2GF3 A;  4U8L A;  1B8S A;  1D7Y A;  1S2Y A;  2V3A A;  5KXJ A;  4M52 A;  3FG2 P;  2X8C A;  4GF7 A;  1JOA A;  1KSU A;  3ATQ A;  3ICS A;  3NK1 X;  4J57 A;  3SGL A;  3IC9 A;  2OLO A;  2R45 A;  3ADA B;  3UTH A;  1S3E A;  3DK4 A;  2GMH A;  2GEW A;  3KLJ A;  4PAA A;  4BV6 A;  4RG4 A;  2WPF A;  2BA9 A;  4JQ9 A;  2JBV A;  4Z24 A;  2WP9 A;  3P9U A;  1QJD A;  2WS3 A;  5U25 A;  2F5Z A;  3GWF A;  1PXC A;  4H4R A;  2Z5X A;  1KNP A;  4H4Q A;  4K22 A;  4DGK A;  2OAM A;  1CC6 A;  3AEF A;  3S61 A;  2VOU A;  4A7A A;  2XFP A;  3AD8 B;  5HXI A;  3BI5 A;  5TR3 A;  2VVL G;  2WHD A;  2VZ2 A;  4EQR A;  5U63 A;  1FEC A;  4Y4N A;  4A79 A;  3AEB A;  1XPQ A;  4U8I A;  3UKP A;  3AD9 B;  3AEA A;  4EQW A;  2WOV A;  3GRT A;  4GRT A;  1CJC A;  1LVL A;  1QO8 A;  2Q0L A;  3AED A;  3EAN A;  1H81 A;  1O94 A;  3E1T A;  3II4 A;  4AP3 A;  1ZMC A;  3G5R A;  2YM1 A;  3IF9 A;  2B9X A;  3ABV A;  1L0V A;  3SQP A;  1DOC A;  1E7P A;  4FK1 A;  4B69 A;  1FL2 A;  4C3Y A;  2CDU A;  4X9M A;  2I0Z A;  2Q6U A;  1B5Q A;  3BI4 A;  3NG7 X;  2BYB A;  3PO7 A;  4H4T A;  2V3B A;  1B4V A;  3ALL A;  4REK A;  1E1K A;  3VQR A;  4H50 A;  4GUV A;  4B1B A;  1FEA A;  3NYE A;  1CJ3 A;  1DXL A;  1YY5 A;  1IUX A;  1EL8 A;  3NHO X;  2BCG G;  2AR8 A;  1CC4 A;  3AEC A;  5JCK A;  2YG6 A;  3GYI A;  4U8N A;  1NHS A;  1OJA A;  4J36 A;  2WPE A;  3NKS A;  4YKG A;  1VG9 A;  2XVF A;  2YG4 A;  1E1M A;  1PXA A;  3GDN A;  5EOW A;  5ER0 A;  4H4X A;  1CL0 A;  2C65 A;  2Y6Q A;  2RGJ A;  1F8R A;  2GQF A;  2VQB A;  1PBE A;  4OPC A;  1GND A;  3GDP A;  3G5Q A;  3NTD A;  3AD7 B;  3CNT A;  4USQ A;  1GER A;  4HA6 A;  1E39 A;  2R0P A;  3UOX A;  2C3C A;  1KNR A;  1D4D A;  2PYX A;  3GMB A;  5C3J A;  3QSE A;  3DJD A;  3QSS A;  2YLT A;  1D4E A;  2OA1 A;  3D8X A;  5HHF A;  1X31 B;  3AE3 A;  4BJY A;  3ALJ A;  3D1C A;  3LAD A;  2C3D A;  2Z5Y A;  4USR A;  4H2Q A;  3H8I A;  3KA7 A;  1N1P A;  3AE2 A;  1DJQ A;  3V3N A;  3AE7 A;  1O95 A;  2BAC A;  3UOY A;  3K30 A;  5JCL A;  1M6I A;  2VQ7 A;  2R9Z A;  4NTD A;  1ZOV A;  2RGO A;  2B7R A;  1PBD A;  2R4J A;  1IUW A;  2C72 A;  1GSN A;  3ATR A;  3L1R A;  3DJG X;  2YVF A;  2BXR A;  5KVI A;  2R46 A;  1EL9 A;  1LQT A;  1NDA A;  5EB5 A;  3VR9 A;  1PBB A;  1TDN A;  2QA1 A;  1DOB A;  1N4U A;  2B76 A;  2X3N A;  2XLP A;  3NRN A;  5M10 A;  1VRQ B;  2B9W A;  3WE0 A;  3P4P A;  4ECH A;  2CVJ A;  2TMD A;  1JRX A;  2RAB A;  2WOI A;  4OPL A;  4B68 A;  1L9C A;  1TRB A;  2XLU A;  3G5S A;  4UDR A;  3P4R A;  3ICT A;  4GCM A;  1GES A;  1JRY A;  2WU5 A;  2B7S A;  1JEH A;  3QJ4 A;  2GAH B;  5LV9 A;  3QFA A;  3KD9 A;  4A5L A;  4U8J A;  1XAN A;  5CKU A;  2EQ7 A;  2GRT A;  1YKJ A;  3URH A;  4D03 A;  1M64 A;  1KFY A;  1Q1W A;  2E1M A;  4CCQ A;  1F8W A;  2APG A;  2WEU A;  3FPZ A;  3KKJ A;  4A65 A;  2BXS A;  3CGB A;  4C3X A;  1F6M A;  4FX9 A;  3RHA A;  5HY5 A;  1O5W A;  2XVI A;  3C96 A;  4NZH A;  3GD3 A;  2WDR A;  5C2T A;  1GRA A;  4IA5 A;  2GR0 A;  1BZL A;  4BK3 A;  4EMJ A;  3SFD A;  4ADW A;  4OPU A;  2QA2 A;  5BUK A;  2ARD A;  4J33 A;  4CRT A;  4Z44 A;  2YVG A;  5U1O A;  1OJ9 A;  1NEN A;  4U2S A;  3R9U A;  2YG5 A;  4LA1 A;  3DK8 A;  3KVE A;  1S3B A;  1Y56 A;  1IUV A;  2XLS A;  1OJC A;  1PJ5 A;  1JU2 A;  2VRM A;  4H2R A;  2YLX A;  3UTE A;  4A6N A;  4DNA A;  2XVJ A;  2BK5 A;  4YTM A;  1Q9I A;  4EQX A;  2X8H A;  3Q9T A;  4K8D A;  1H6V A;  3FBS A;  3COX A;  4H7U A;  1LTX R;  2JAE A;  5BUL A;  1CJ2 A;  1E1L A;  3AE8 A;  3K7Q X;  4O5Q A;  2BK4 A;  3NTA A;  1TYP A;  4AP1 A;  2GQW A;  2XLR A;  4K5R A;  1F8S A;  3I6D A;  2QCU A;  4AOS A;  3M0O A;  2YR4 A;  2FJE A;  2O9Z A;  2Q0K A;  2GMJ A;  3RP6 A;  3F8P A;  3DME A;  1PHH A;  4A99 A;  4H2N A;  3CIR A;  3UKL A;  4B64 A;  2BC0 A;  2FJA A;  4WX1 A;  4Z2U A;  1RSG A;  3AEG A;  1GRH A;  2ZZ0 A;  4IVM B;  2DKH A;  3AYL A;  3RP7 A;  1H83 A;  4U8O A;  5IPY A;  2X99 A;  1H7W A;  3L8K A;  2GH5 A;  2NVK X;  5FS7 A;  1GPE A;  4XWR A;  3I3L A;  4YKF A;  1BGN A;  2BCP A;  3UCL A;  4J34 A;  2JK6 A;  3LXD A;  4TLX A;  5GSN A;  3OC4 A;  3ZDN A;  5L46 A;  4ZCC A;  4JY3 A;  2H88 A;  3IHM A;  3ZYX A;  4Z2R A;  3CN8 A;  2V6O A;  2WQY A;  3ISH A;  2XFU A;  4A9W A;  4J31 A;  2AAQ A;  5FMH A;  1QLB A;  2NPX A;  1D4C A;  1ZOY A;  1VDC A;  3LZX A;  4IV9 A;  3VRB A;  4CY6 A;  1PJ6 A;  2ACZ A;  2EQ6 A;  2UZZ A;  3QFB A;  3UP5 A;  1REO A;  2WDQ A;  3AWI A;  1RYI A;  1PBF A;  1PN0 A;  3NN6 X;  3QSM A;  3CPI G;  4TM4 A;  4YXD A;  1KSS A;  4BK2 A;  2GR2 A;  5HYM A;  3HZL A;  1BWC A;  4EIQ A;  3LJP A;  3UOZ A;  3K7M X;  4KPR A;  4H4S A;  1DNC A;  2RGH A;  3EAO A;  3UKQ A;  3B6D A;  4UDP A;  3DA1 A;  1NHP A;  4I58 A;  4U2T A;  4Y4L A;  4TM3 A;  2TPR A;  4X4J A;  4YSZ A;  4OVI A;  3DGH A;  3F8D A;  4LII A;  4X9N A;  2WP5 A;  2JB3 A;  4B67 A;  4U2L A;  4DSG A;  2YLR A;  4GR1 A;  3RP8 A;  4EIP A;  1GV4 A;  1GEU A;  4U8K A;  3UKA A;  4H4Z A;  4YTN A;  4NTC A;  4JY2 A;  1LJ1 A;  1ZKQ A;  3NK2 X;  3LB8 A;  1H86 A;  2GV8 A;  4CY8 A;  4WCT A;  1PS9 A;  1XDI A;  1COY A; 
#chains in the Genus database with same CATH topology
 3T37 A;  1UKV G;  3GRS A;  4K5S A;  3NLC A;  2BS2 A;  3AE1 A;  2XFQ A;  4NEW A;  3NGC X;  2JB1 A;  4NTE A;  1KDG A;  3EPT A;  1L9E A;  1CC2 A;  3Q6J A;  2JKC A;  1TYT A;  4K7Z A;  2WOW A;  2VVM A;  2WPC A;  2X8G A;  4J56 A;  4LU6 A;  3RNM A;  1ZX9 A;  2OLN A;  2B9Y A;  1P2H A;  2Y6R A;  3B3R A;  3NYC A;  1MXT A;  1BGJ A;  3M12 A;  2XCG A;  2A8X A;  2IVE A;  4IA6 A;  4RSL A;  2VVL A;  1NHQ A;  3FIM B;  3NNE A;  1S2Q A;  4JDR A;  3SZ0 A;  2YVJ A;  3T2Z A;  3UTG A;  2V60 A;  2IVD A;  4H2P A;  1KF6 A;  1YQZ A;  3IHG A;  3P1W A;  1GTH A;  1GT8 A;  1CBO A;  4Z26 A;  1IUS A;  3AE9 A;  3IWA A;  2GR3 A;  1PDH A;  2BS4 A;  5FS9 A;  5J60 A;  1DOD A;  1Y56 B;  1K0I A;  1D5T A;  4FDC B;  4YWO A;  5FS8 A;  4EMI A;  1FOH A;  3UKK A;  1GAL A;  3M13 A;  1GRB A;  3H8L A;  3T31 A;  4PAB A;  4YT0 A;  1HYU A;  1EL5 A;  2GAG B;  4JNQ A;  3AE4 A;  3ITJ A;  2C76 A;  3AE5 A;  1ZMD A;  3JSK A;  1AN9 A;  2W0H A;  3NN0 X;  4II3 A;  4NEV A;  3ICR A;  3SM8 A;  3GD4 A;  3CPJ G;  1NPX A;  5KMQ A;  2E82 A;  3H4K A;  3P4S A;  4AT0 A;  4QFC A;  3CTY A;  2XLT A;  1OJT A;  4DSH A;  4RG3 A;  1JRZ A;  4Z2T A;  3NYF A;  2YAU A;  4YTP A;  2FBW A;  3UKH A;  1H82 A;  4OPI A;  1FCD A;  1D7L A;  2V5Z A;  2X50 A;  4BK1 A;  1TDO A;  4EQS A;  2PHH A;  5KNL A;  4U8M A;  4OCG A;  3VRD B;  2XVH A;  3DGZ A;  1EBD A;  1JNZ A;  2CFY A;  4H4P A;  4OPD A;  2E4G A;  3BNU A;  3HYV A;  4XXG A;  4UDQ A;  1K0J A;  1C0K A;  4GAV A;  2YG7 A;  3S5W A;  3CPH G;  2XFO A;  1GTE A;  2WET A;  1NAA A;  4O5U A;  1H7X A;  4JN9 A;  1PBC A;  3WGT A;  1H84 A;  5GRT A;  4I59 A;  1Z6L A;  2YR5 A;  3ZNP A;  4C5O A;  2XFN A;  4H4Y A;  2WES A;  1GRE A;  2WU2 A;  5BRT A;  1VQW A;  2C66 A;  2R0G A;  4BUR A;  2Q7V A;  4G9K A;  1BKW A;  4ZCD A;  1GET A;  2BC1 A;  2H89 A;  1Q1R A;  1NHR A;  4AT2 A;  3DJE A;  2GR1 A;  2WDV A;  3AEE A;  3CGD A;  3NK0 X;  3CNS A;  4H4W A;  5KRQ A;  5KWF A;  1ONF A;  4APN A;  1ZK7 A;  4B66 A;  5JCM A;  1K4Q A;  1GOS A;  1NEK A;  3AE6 A;  3V3O A;  3C4N A;  4B65 A;  1LPF A;  1ELI A;  3C4A A;  3ALM A;  2A87 A;  4YSX A;  2ZBW A;  3KPK A;  3AYJ A;  4GDP A;  1NG3 A;  4Z43 A;  3SFE A;  4E0V A;  4D04 A;  2FJB A;  4G73 A;  3W4I A;  4YJF A;  1GRT A;  2YLS A;  1PJ7 A;  1TDF A;  1TDK A;  2YG3 A;  3BHF A;  3QVP A;  4OPT A;  3DK9 A;  3VRA A;  3K7T A;  2C70 A;  4CNK A;  3BI2 A;  4CBQ A;  5IQ1 A;  1BF3 A;  5EB4 A;  1GRG A;  3CGE A;  2QAE A;  3GYX A;  1F3P A;  1V59 A;  2J3N A;  2XYO A;  5DBJ A;  3LOV A;  4B63 A;  3GSI A;  1JNR A;  4C74 A;  2EQ9 A;  1IJH A;  1CHU A;  2GVC A;  5BVA A;  2WBA A;  5JCI A;  2C7G A;  5KOX A;  4TM1 A;  1EVI A;  2CUL A;  2C73 A;  3CND A;  5KMS A;  4C77 A;  2ZZC A;  2FJD A;  4YJH B;  1FEB A;  2ZZB A;  1K0L A;  1ZP0 A;  3GYJ A;  4YSH A;  4MJW A;  2XDO A;  4EMW A;  4HB9 A;  1IUU A;  1NG4 A;  2BS3 A;  2E5V A;  2V61 A;  1GRF A;  2C67 A;  1LV0 A;  4FK1 C;  4Y4M A;  3PS9 A;  2IID A;  3UKF A;  5KOW A;  1E1N A;  2A89 A;  2YWL A;  1ZDL A;  5KVH A;  1EL7 A;  2YLZ A;  3ZNO A;  4TM0 A;  1W4X A;  5EBK A;  3ZNQ A;  4CCR A;  4ZN0 A;  1YQ4 A;  2AQJ A;  5JCN A;  3GMC A;  3AYI A;  5CQF A;  4Z25 A;  2EQ8 A;  3CGC A;  3EF6 A;  4H4U A;  4K2X A;  1DJN A;  3GWD A;  3UOV A;  3OZ2 A;  1TDE A;  4BJZ A;  1B37 A;  3NH3 X;  1VG0 A;  1MOK A;  1Y0P A;  2HQM A;  3SXI A;  4JNA A;  1E6E A;  4GDE A;  3AXB A;  2XVE A;  3ZNN A;  4H4V A;  4KX6 A;  2BAB A;  3CNJ A;  3BNM A;  4N9X A;  4NWZ A;  4YJD A;  5FS6 A;  1AOG A;  3BHK A;  2WP6 A;  3UP4 A;  2GB0 A;  1N4V A;  1DAO A;  3CNP A;  3NT6 A;  2VRL A;  5M0Z A;  1C0P A;  1YQ3 A;  4IVO B;  4CNJ A;  5IQ4 A;  1DOE A;  3QVR A;  4J2W A;  4ICY A;  1ZY8 A;  3VR8 A;  4EM4 A;  4YJG A;  1N4W A;  3KPF A;  3P4Q A;  1SEZ A;  4YSY A;  4A6N B;  3RED A;  3DH9 A;  4UP3 A;  3NIX A;  2C64 A;  1L9D A;  4TLZ A;  2YR6 A;  4AOX A;  1RP0 A;  4U8P A;  3SYI A;  1IUT A;  1P2E A;  1OJD A;  2JB2 A;  3LZW A;  3V76 A;  3AB1 A;  3PVC A;  1GXF A;  1MO9 A;  1XHC A;  1LQU A;  2OAL A;  2YLW A;  3FMW A;  2R4E A;  3KU9 A;  2DKI A;  1CJ4 A;  1PXB A;  3F8R A;  2E49 A;  3DJJ A;  3O0H A;  4EM3 A;  2YM2 A;  2R0C A;  5J7X A;  2BK3 A;  2C75 A;  4XWZ A;  2YQU A;  4OPG A;  4P9S A;  4G6G A;  1CF3 A;  2GF3 A;  4U8L A;  1B8S A;  1D7Y A;  1S2Y A;  2V3A A;  5KXJ A;  4M52 A;  3FG2 P;  2X8C A;  4GF7 A;  1JOA A;  1KSU A;  2DU8 A;  3ATQ A;  3ICS A;  3NK1 X;  4J57 A;  3SGL A;  3IC9 A;  4II2 A;  2OLO A;  2R45 A;  3ADA B;  4GAP A;  3UTH A;  1S3E A;  3DK4 A;  2GMH A;  2GEW A;  3KLJ A;  4PAA A;  4BV6 A;  4RG4 A;  2WPF A;  2BA9 A;  4JQ9 A;  2JBV A;  4Z24 A;  2WP9 A;  3P9U A;  1QJD A;  2WS3 A;  5U25 A;  2F5Z A;  3GWF A;  1PXC A;  4H4R A;  3SY4 A;  2Z5X A;  3CUK A;  1KNP A;  4H4Q A;  4K22 A;  4DGK A;  2OAM A;  1CC6 A;  3AEF A;  4G6H A;  2VOU A;  3S61 A;  4A7A A;  2XFP A;  3AD8 B;  5HXI A;  3BI5 A;  5TR3 A;  2VVL G;  2WHD A;  2VZ2 A;  4EQR A;  5U63 A;  1FEC A;  4Y4N A;  4A79 A;  3AEB A;  1XPQ A;  1C0L A;  4U8I A;  3UKP A;  3AD9 B;  3AEA A;  4EQW A;  2WOV A;  3GRT A;  4GRT A;  1CJC A;  1LVL A;  1QO8 A;  2Q0L A;  3AED A;  3EAN A;  3E1T A;  1H81 A;  1O94 A;  3II4 A;  3W4J A;  4AP3 A;  1ZMC A;  3G5R A;  3IF9 A;  2YM1 A;  2B9X A;  3ABV A;  1L0V A;  3SQP A;  1DOC A;  1E7P A;  4FK1 A;  4B69 A;  1FL2 A;  4C3Y A;  4QFD A;  2CDU A;  4X9M A;  3UTF A;  2I0Z A;  2Q6U A;  1B5Q A;  3BI4 A;  3NG7 X;  2BYB A;  3VQR A;  3PO7 A;  2V3B A;  1B4V A;  3ALL A;  4H4T A;  1E1K A;  4REK A;  4H50 A;  4GUV A;  1KIF A;  4B1B A;  1FEA A;  3NYE A;  1CJ3 A;  1C0I A;  1DXL A;  1IUX A;  1YY5 A;  1EL8 A;  3NHO X;  2BCG G;  2AR8 A;  1CC4 A;  3AEC A;  5JCK A;  2YG6 A;  3GYI A;  4U8N A;  1NHS A;  1OJA A;  4J36 A;  2WPE A;  3NKS A;  4YKG A;  1VG9 A;  2XVF A;  2YG4 A;  1E1M A;  1PXA A;  3GDN A;  2BRY A;  5EOW A;  5ER0 A;  4H4X A;  1CL0 A;  2C65 A;  2Y6Q A;  2RGJ A;  1F8R A;  2GQF A;  2VQB A;  1PBE A;  4OPC A;  1GND A;  3GDP A;  3G5Q A;  3NTD A;  3AD7 B;  3CNT A;  4USQ A;  1GER A;  4HA6 A;  1E39 A;  2R0P A;  3UOX A;  2C3C A;  1KNR A;  1D4D A;  2PYX A;  1VE9 A;  3GMB A;  5C3J A;  3QSE A;  3DJD A;  3QSS A;  2YLT A;  1D4E A;  2OA1 A;  3D8X A;  5HHF A;  1X31 B;  3AE3 A;  4BJY A;  3ALJ A;  3D1C A;  3LAD A;  2C3D A;  2Z5Y A;  4USR A;  4H2Q A;  3H8I A;  3KA7 A;  1N1P A;  3AE2 A;  1DJQ A;  3G3E A;  3V3N A;  3AE7 A;  1O95 A;  2BAC A;  3UOY A;  3K30 A;  5JCL A;  1M6I A;  2VQ7 A;  2R9Z A;  4NTD A;  1ZOV A;  2RGO A;  3HYX A;  2B7R A;  1PBD A;  2R4J A;  1IUW A;  2C72 A;  1GSN A;  3ATR A;  3L1R A;  3DJG X;  2YVF A;  2BXR A;  5KVI A;  2R46 A;  1EL9 A;  1LQT A;  1NDA A;  5EB5 A;  3VR9 A;  1PBB A;  1TDN A;  2QA1 A;  1DOB A;  1N4U A;  2B76 A;  2X3N A;  2XLP A;  3NRN A;  5M10 A;  1VRQ B;  2C4C A;  2B9W A;  3WE0 A;  3P4P A;  4ECH A;  2CVJ A;  4YJH A;  2TMD A;  1JRX A;  3SX6 A;  2RAB A;  2WOI A;  4OPL A;  4B68 A;  1L9C A;  1TRB A;  2XLU A;  3G5S A;  4UDR A;  3P4R A;  3ICT A;  4GCM A;  3SZW A;  1GES A;  1JRY A;  2WU5 A;  2B7S A;  1JEH A;  3QJ4 A;  1DDO A;  2BRA A;  5LV9 A;  3QFA A;  3KD9 A;  4A5L A;  4U8J A;  1XAN A;  5CKU A;  2EQ7 A;  2GRT A;  1YKJ A;  3URH A;  4D03 A;  1M64 A;  1KFY A;  1Q1W A;  2E1M A;  4CCQ A;  1F8W A;  2APG A;  2WEU A;  3FPZ A;  3KKJ A;  3SZC A;  4A65 A;  2BXS A;  3CGB A;  4C3X A;  1F6M A;  4FX9 A;  3RHA A;  5HY5 A;  1O5W A;  2XVI A;  3C96 A;  4NZH A;  3GD3 A;  2WDR A;  5C2T A;  1GRA A;  4IA5 A;  3W4K A;  2GR0 A;  4BK3 A;  1BZL A;  4EMJ A;  3SFD A;  4ADW A;  4OPU A;  2QA2 A;  5BUK A;  2ARD A;  4J33 A;  3T0K A;  4Z44 A;  2YVG A;  5U1O A;  1OJ9 A;  4CRT A;  1NEN A;  4U2S A;  3R9U A;  2YG5 A;  1PS9 A;  4LA1 A;  3DK8 A;  3KVE A;  1S3B A;  1Y56 A;  1IUV A;  2XLS A;  1PJ5 A;  1OJC A;  1JU2 A;  2VRM A;  4H2R A;  2YLX A;  3UTE A;  4A6N A;  4DNA A;  2XVJ A;  2BK5 A;  4YTM A;  1Q9I A;  4EQX A;  2X8H A;  3Q9T A;  4YJF B;  4K8D A;  1H6V A;  3FBS A;  3COX A;  4H7U A;  1LTX R;  2JAE A;  5BUL A;  1CJ2 A;  1E1L A;  3AE8 A;  3K7Q X;  4O5Q A;  2BK4 A;  3NTA A;  1TYP A;  4AP1 A;  2GQW A;  2XLR A;  4K5R A;  1F8S A;  3I6D A;  2QCU A;  4AOS A;  5KMR A;  3M0O A;  2YR4 A;  2FJE A;  2O9Z A;  2Q0K A;  2GMJ A;  3RP6 A;  3F8P A;  3DME A;  1PHH A;  4A99 A;  4H2N A;  3CIR A;  3UKL A;  4B64 A;  2E4A A;  2BC0 A;  2FJA A;  2E48 A;  4WX1 A;  3CMM A;  4Z2U A;  1RSG A;  3AEG A;  1GRH A;  2ZZ0 A;  4IVM B;  2DKH A;  3RP7 A;  3AYL A;  1H83 A;  4U8O A;  5IPY A;  3SZF A;  2X99 A;  1H7W A;  3L8K A;  2GH5 A;  2NVK X;  5FS7 A;  3T14 A;  1GPE A;  4XWR A;  3I3L A;  4YKF A;  1BGN A;  2BCP A;  3UCL A;  4J34 A;  2JK6 A;  5L46 A;  3LXD A;  4G74 A;  3OC4 A;  4TLX A;  5GSN A;  3ZDN A;  4ZCC A;  4JY3 A;  2H88 A;  3IHM A;  3ZYX A;  4Z2R A;  3CN8 A;  2V6O A;  2WQY A;  3ISH A;  2XFU A;  4A9W A;  4J31 A;  2AAQ A;  5FMH A;  1QLB A;  2NPX A;  1D4C A;  1ZOY A;  1VDC A;  3LZX A;  4IV9 A;  3VRB A;  4CY6 A;  1PJ6 A;  2ACZ A;  2UZZ A;  2EQ6 A;  3QFB A;  3UP5 A;  1REO A;  2WDQ A;  3AWI A;  1RYI A;  1PBF A;  1PN0 A;  3QSM A;  3NN6 X;  3CPI G;  4TM4 A;  4YXD A;  1KSS A;  4BK2 A;  5HYM A;  2GR2 A;  3HZL A;  3T2Y A;  1BWC A;  4EIQ A;  3LJP A;  3UOZ A;  3K7M X;  4KPR A;  4H4S A;  1DNC A;  2RGH A;  3EAO A;  5KMP A;  3UKQ A;  3B6D A;  4UDP A;  3DA1 A;  1NHP A;  4I58 A;  4U2T A;  4YJG B;  4Y4L A;  4TM3 A;  2TPR A;  4X4J A;  4YSZ A;  4OVI A;  3DGH A;  3F8D A;  4X9N A;  4LII A;  2WP5 A;  2JB3 A;  4B67 A;  4U2L A;  4DSG A;  2YLR A;  4GR1 A;  3RP8 A;  4EIP A;  1GV4 A;  1GEU A;  4U8K A;  3UKA A;  4H4Z A;  4YTN A;  4NTC A;  3HYW A;  4JY2 A;  1LJ1 A;  1ZKQ A;  3NK2 X;  3LB8 A;  1H86 A;  2GV8 A;  3T2K A;  4CY8 A;  4WCT A;  2GAH B;  1XDI A;  1COY A;  4NNJ A; 
#chains in the Genus database with same CATH homology
 3T37 A;  1UKV G;  3GRS A;  4K5S A;  3NLC A;  2BS2 A;  3AE1 A;  2XFQ A;  4NEW A;  3NGC X;  2JB1 A;  4NTE A;  1KDG A;  3EPT A;  1CC2 A;  1L9E A;  3Q6J A;  2JKC A;  1TYT A;  4K7Z A;  2WOW A;  2VVM A;  2WPC A;  2X8G A;  4J56 A;  4LU6 A;  3RNM A;  1ZX9 A;  2B9Y A;  2OLN A;  1P2H A;  2Y6R A;  3B3R A;  3NYC A;  1MXT A;  1BGJ A;  3M12 A;  2XCG A;  2A8X A;  2IVE A;  4IA6 A;  2VVL A;  3FIM B;  1NHQ A;  3NNE A;  4RSL A;  1S2Q A;  4JDR A;  3SZ0 A;  2YVJ A;  3T2Z A;  3UTG A;  2V60 A;  2IVD A;  4H2P A;  1KF6 A;  1YQZ A;  3IHG A;  3P1W A;  1GTH A;  1GT8 A;  1CBO A;  4Z26 A;  1IUS A;  3AE9 A;  3IWA A;  2GR3 A;  1PDH A;  2BS4 A;  5FS9 A;  5J60 A;  1DOD A;  1Y56 B;  1K0I A;  1D5T A;  4FDC B;  4YWO A;  5FS8 A;  4EMI A;  1FOH A;  3UKK A;  1GAL A;  1GRB A;  3M13 A;  3H8L A;  3T31 A;  4PAB A;  4YT0 A;  1HYU A;  1EL5 A;  2GAG B;  4JNQ A;  3AE4 A;  3ITJ A;  2C76 A;  3AE5 A;  1ZMD A;  3JSK A;  3NN0 X;  2W0H A;  4II3 A;  4NEV A;  3ICR A;  3SM8 A;  3GD4 A;  3CPJ G;  1NPX A;  5KMQ A;  3H4K A;  3P4S A;  4AT0 A;  3CTY A;  2XLT A;  1OJT A;  4DSH A;  4RG3 A;  1JRZ A;  4Z2T A;  3NYF A;  2YAU A;  4YTP A;  2FBW A;  3UKH A;  1H82 A;  4OPI A;  1FCD A;  1D7L A;  2V5Z A;  2X50 A;  4BK1 A;  1TDO A;  4EQS A;  2PHH A;  5KNL A;  4U8M A;  4OCG A;  3VRD B;  2XVH A;  3DGZ A;  1EBD A;  1JNZ A;  2CFY A;  4H4P A;  4OPD A;  2E4G A;  3BNU A;  3HYV A;  4XXG A;  4UDQ A;  1K0J A;  3S5W A;  4GAV A;  2YG7 A;  3CPH G;  2XFO A;  1GTE A;  2WET A;  1NAA A;  4O5U A;  1H7X A;  4JN9 A;  1PBC A;  1H84 A;  5GRT A;  4I59 A;  1Z6L A;  2YR5 A;  4C5O A;  2XFN A;  4H4Y A;  2WES A;  1GRE A;  2WU2 A;  5BRT A;  1VQW A;  2C66 A;  2R0G A;  4BUR A;  2Q7V A;  4G9K A;  1BKW A;  4ZCD A;  1GET A;  2BC1 A;  2H89 A;  1Q1R A;  1NHR A;  4AT2 A;  3DJE A;  2GR1 A;  2WDV A;  3AEE A;  3CGD A;  3NK0 X;  3CNS A;  4H4W A;  5KRQ A;  5KWF A;  1ONF A;  4APN A;  1ZK7 A;  4B66 A;  5JCM A;  1K4Q A;  1GOS A;  1NEK A;  3AE6 A;  3V3O A;  3C4N A;  4B65 A;  1LPF A;  1ELI A;  3C4A A;  3ALM A;  2A87 A;  4YSX A;  2ZBW A;  3KPK A;  3AYJ A;  4GDP A;  1NG3 A;  4Z43 A;  3SFE A;  4E0V A;  4D04 A;  2FJB A;  4G73 A;  1GRT A;  2YLS A;  1PJ7 A;  1TDF A;  1TDK A;  2YG3 A;  3BHF A;  3QVP A;  4OPT A;  3DK9 A;  3VRA A;  3K7T A;  2C70 A;  4CNK A;  3BI2 A;  4CBQ A;  5IQ1 A;  1BF3 A;  5EB4 A;  1GRG A;  3CGE A;  2QAE A;  3GYX A;  1F3P A;  1V59 A;  2J3N A;  2XYO A;  5DBJ A;  3LOV A;  4B63 A;  3GSI A;  1JNR A;  4C74 A;  2EQ9 A;  1IJH A;  1CHU A;  2GVC A;  5BVA A;  2WBA A;  5JCI A;  2C7G A;  5KOX A;  4TM1 A;  2CUL A;  2C73 A;  3CND A;  5KMS A;  4C77 A;  2ZZC A;  2FJD A;  1FEB A;  2ZZB A;  1K0L A;  1ZP0 A;  3GYJ A;  4MJW A;  4YSH A;  2XDO A;  4EMW A;  4HB9 A;  1IUU A;  1NG4 A;  2BS3 A;  2E5V A;  2V61 A;  1GRF A;  2C67 A;  1LV0 A;  4FK1 C;  4Y4M A;  3PS9 A;  2IID A;  3UKF A;  5KOW A;  1E1N A;  2A89 A;  2YWL A;  1ZDL A;  5KVH A;  1EL7 A;  2YLZ A;  4TM0 A;  1W4X A;  5EBK A;  4ZN0 A;  4CCR A;  1YQ4 A;  2AQJ A;  5JCN A;  3GMC A;  3AYI A;  5CQF A;  4Z25 A;  2EQ8 A;  3CGC A;  3EF6 A;  4H4U A;  4K2X A;  1DJN A;  3GWD A;  3UOV A;  1TDE A;  3OZ2 A;  4BJZ A;  1B37 A;  3NH3 X;  1VG0 A;  1MOK A;  1Y0P A;  2HQM A;  3SXI A;  4JNA A;  1E6E A;  4GDE A;  3AXB A;  2XVE A;  4H4V A;  4KX6 A;  2BAB A;  3CNJ A;  3BNM A;  4N9X A;  4NWZ A;  5FS6 A;  1AOG A;  2WP6 A;  3BHK A;  3UP4 A;  1N4V A;  2GB0 A;  3CNP A;  3NT6 A;  2VRL A;  5M0Z A;  1YQ3 A;  4IVO B;  4CNJ A;  5IQ4 A;  1DOE A;  3QVR A;  4J2W A;  4ICY A;  1ZY8 A;  3VR8 A;  4EM4 A;  1N4W A;  3KPF A;  3P4Q A;  1SEZ A;  4YSY A;  4A6N B;  3RED A;  3DH9 A;  4UP3 A;  3NIX A;  2C64 A;  1L9D A;  4TLZ A;  2YR6 A;  4AOX A;  1RP0 A;  4U8P A;  3SYI A;  1IUT A;  1P2E A;  1OJD A;  2JB2 A;  3LZW A;  3V76 A;  3AB1 A;  3PVC A;  1GXF A;  1MO9 A;  1XHC A;  1LQU A;  2OAL A;  2YLW A;  3FMW A;  2R4E A;  3KU9 A;  2DKI A;  1CJ4 A;  1PXB A;  3F8R A;  3DJJ A;  3O0H A;  4EM3 A;  2YM2 A;  2R0C A;  5J7X A;  2BK3 A;  2C75 A;  2YQU A;  4XWZ A;  4OPG A;  4P9S A;  4G6G A;  1CF3 A;  2GF3 A;  4U8L A;  1B8S A;  1D7Y A;  1S2Y A;  2V3A A;  5KXJ A;  4M52 A;  3FG2 P;  2X8C A;  4GF7 A;  1JOA A;  1KSU A;  3ATQ A;  3ICS A;  3NK1 X;  4J57 A;  3SGL A;  3IC9 A;  4II2 A;  2OLO A;  2R45 A;  3ADA B;  4GAP A;  3UTH A;  1S3E A;  3DK4 A;  2GMH A;  2GEW A;  3KLJ A;  4PAA A;  4BV6 A;  4RG4 A;  2WPF A;  2BA9 A;  4JQ9 A;  2JBV A;  4Z24 A;  2WP9 A;  3P9U A;  1QJD A;  2WS3 A;  5U25 A;  2F5Z A;  3GWF A;  1PXC A;  4H4R A;  3SY4 A;  2Z5X A;  1KNP A;  4H4Q A;  4K22 A;  4DGK A;  2OAM A;  1CC6 A;  3AEF A;  4G6H A;  2VOU A;  3S61 A;  4A7A A;  2XFP A;  3AD8 B;  5HXI A;  3BI5 A;  5TR3 A;  2VVL G;  2WHD A;  2VZ2 A;  4EQR A;  5U63 A;  1FEC A;  4Y4N A;  4A79 A;  3AEB A;  1XPQ A;  4U8I A;  3UKP A;  3AD9 B;  3AEA A;  4EQW A;  2WOV A;  3GRT A;  4GRT A;  1CJC A;  1LVL A;  1QO8 A;  2Q0L A;  3AED A;  3EAN A;  3E1T A;  1H81 A;  1O94 A;  3II4 A;  4AP3 A;  1ZMC A;  3G5R A;  2YM1 A;  3IF9 A;  2B9X A;  3ABV A;  1L0V A;  3SQP A;  1DOC A;  1E7P A;  4FK1 A;  4B69 A;  1FL2 A;  4C3Y A;  2CDU A;  4X9M A;  3UTF A;  2I0Z A;  2Q6U A;  1B5Q A;  3BI4 A;  3NG7 X;  2BYB A;  3PO7 A;  4H4T A;  2V3B A;  1B4V A;  3ALL A;  4REK A;  1E1K A;  3VQR A;  4H50 A;  4GUV A;  4B1B A;  1FEA A;  3NYE A;  1CJ3 A;  1DXL A;  1YY5 A;  1IUX A;  1EL8 A;  3NHO X;  2BCG G;  2AR8 A;  1CC4 A;  3AEC A;  5JCK A;  2YG6 A;  3GYI A;  4U8N A;  1NHS A;  1OJA A;  4J36 A;  2WPE A;  3NKS A;  4YKG A;  1VG9 A;  2XVF A;  2YG4 A;  1E1M A;  1PXA A;  3GDN A;  2BRY A;  5EOW A;  5ER0 A;  4H4X A;  1CL0 A;  2C65 A;  2Y6Q A;  2RGJ A;  1F8R A;  2GQF A;  2VQB A;  1PBE A;  4OPC A;  1GND A;  3GDP A;  3G5Q A;  3NTD A;  3AD7 B;  3CNT A;  4USQ A;  1GER A;  4HA6 A;  1E39 A;  2R0P A;  3UOX A;  2C3C A;  1KNR A;  1D4D A;  2PYX A;  3GMB A;  5C3J A;  3QSE A;  3DJD A;  3QSS A;  2YLT A;  1D4E A;  2OA1 A;  3D8X A;  5HHF A;  1X31 B;  3AE3 A;  4BJY A;  3ALJ A;  3D1C A;  3LAD A;  2C3D A;  2Z5Y A;  4USR A;  4H2Q A;  3H8I A;  3KA7 A;  1N1P A;  3AE2 A;  1DJQ A;  3V3N A;  3AE7 A;  1O95 A;  2BAC A;  3UOY A;  3K30 A;  5JCL A;  1M6I A;  2VQ7 A;  2R9Z A;  4NTD A;  1ZOV A;  2RGO A;  3HYX A;  2B7R A;  1PBD A;  2R4J A;  1IUW A;  2C72 A;  1GSN A;  3ATR A;  3L1R A;  3DJG X;  2YVF A;  2BXR A;  5KVI A;  2R46 A;  1EL9 A;  1LQT A;  1NDA A;  5EB5 A;  3VR9 A;  1PBB A;  1TDN A;  2QA1 A;  1DOB A;  1N4U A;  2B76 A;  2X3N A;  2XLP A;  3NRN A;  5M10 A;  1VRQ B;  2C4C A;  2B9W A;  3WE0 A;  3P4P A;  4ECH A;  2CVJ A;  2TMD A;  1JRX A;  3SX6 A;  2RAB A;  2WOI A;  4OPL A;  4B68 A;  1L9C A;  1TRB A;  2XLU A;  3G5S A;  4UDR A;  3P4R A;  3ICT A;  4GCM A;  3SZW A;  1GES A;  1JRY A;  2WU5 A;  2B7S A;  1JEH A;  3QJ4 A;  2GAH B;  2BRA A;  5LV9 A;  3QFA A;  3KD9 A;  4A5L A;  4U8J A;  1XAN A;  5CKU A;  2EQ7 A;  2GRT A;  1YKJ A;  3URH A;  4D03 A;  1M64 A;  1KFY A;  1Q1W A;  2E1M A;  4CCQ A;  1F8W A;  2APG A;  2WEU A;  3FPZ A;  3KKJ A;  3SZC A;  4A65 A;  2BXS A;  3CGB A;  4C3X A;  1F6M A;  4FX9 A;  3RHA A;  5HY5 A;  1O5W A;  2XVI A;  3C96 A;  4NZH A;  3GD3 A;  2WDR A;  5C2T A;  1GRA A;  4IA5 A;  2GR0 A;  4BK3 A;  1BZL A;  4EMJ A;  3SFD A;  4ADW A;  4OPU A;  2QA2 A;  5BUK A;  2ARD A;  4J33 A;  3T0K A;  4Z44 A;  2YVG A;  5U1O A;  1OJ9 A;  4CRT A;  1NEN A;  4U2S A;  3R9U A;  2YG5 A;  4LA1 A;  3DK8 A;  3KVE A;  1S3B A;  1Y56 A;  1IUV A;  2XLS A;  1OJC A;  1PJ5 A;  1JU2 A;  2VRM A;  4H2R A;  2YLX A;  3UTE A;  4A6N A;  4DNA A;  2XVJ A;  2BK5 A;  4YTM A;  1Q9I A;  4EQX A;  2X8H A;  3Q9T A;  4K8D A;  1H6V A;  3FBS A;  3COX A;  4H7U A;  1LTX R;  2JAE A;  5BUL A;  1CJ2 A;  1E1L A;  3AE8 A;  3K7Q X;  4O5Q A;  2BK4 A;  3NTA A;  1TYP A;  4AP1 A;  2GQW A;  2XLR A;  4K5R A;  1F8S A;  3I6D A;  2QCU A;  4AOS A;  5KMR A;  3M0O A;  2YR4 A;  2FJE A;  2O9Z A;  2Q0K A;  2GMJ A;  3RP6 A;  3F8P A;  3DME A;  1PHH A;  4A99 A;  4H2N A;  3CIR A;  3UKL A;  4B64 A;  2BC0 A;  2FJA A;  4WX1 A;  3CMM A;  4Z2U A;  1RSG A;  3AEG A;  1GRH A;  2ZZ0 A;  4IVM B;  2DKH A;  3RP7 A;  3AYL A;  1H83 A;  4U8O A;  5IPY A;  3SZF A;  2X99 A;  1H7W A;  3L8K A;  2GH5 A;  2NVK X;  5FS7 A;  3T14 A;  1GPE A;  4XWR A;  3I3L A;  4YKF A;  1BGN A;  2BCP A;  3UCL A;  4J34 A;  2JK6 A;  3LXD A;  4G74 A;  4TLX A;  3OC4 A;  5GSN A;  3ZDN A;  5L46 A;  4ZCC A;  4JY3 A;  2H88 A;  3IHM A;  3ZYX A;  4Z2R A;  3CN8 A;  2V6O A;  2WQY A;  3ISH A;  2XFU A;  4A9W A;  4J31 A;  2AAQ A;  5FMH A;  1QLB A;  2NPX A;  1D4C A;  1ZOY A;  1VDC A;  3LZX A;  4IV9 A;  3VRB A;  4CY6 A;  1PJ6 A;  2ACZ A;  2EQ6 A;  2UZZ A;  3QFB A;  3UP5 A;  1REO A;  2WDQ A;  3AWI A;  1RYI A;  1PBF A;  1PN0 A;  3NN6 X;  3QSM A;  3CPI G;  4TM4 A;  4YXD A;  1KSS A;  4BK2 A;  5HYM A;  2GR2 A;  3HZL A;  3T2Y A;  1BWC A;  4EIQ A;  3LJP A;  3UOZ A;  3K7M X;  4KPR A;  4H4S A;  1DNC A;  2RGH A;  3EAO A;  5KMP A;  3UKQ A;  3B6D A;  4UDP A;  3DA1 A;  1NHP A;  4I58 A;  4U2T A;  4Y4L A;  4TM3 A;  2TPR A;  4X4J A;  4YSZ A;  4OVI A;  3DGH A;  3F8D A;  4LII A;  4X9N A;  2WP5 A;  2JB3 A;  4B67 A;  4U2L A;  4DSG A;  2YLR A;  4GR1 A;  3RP8 A;  4EIP A;  1GV4 A;  1GEU A;  4U8K A;  3UKA A;  4H4Z A;  4YTN A;  4NTC A;  3HYW A;  4JY2 A;  1LJ1 A;  1ZKQ A;  3NK2 X;  3LB8 A;  1H86 A;  2GV8 A;  3T2K A;  4CY8 A;  4WCT A;  1PS9 A;  1XDI A;  1COY A;  4NNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...