4DGKA

Crystal structure of phytoene desaturase crti from pantoea ananatis
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
492
structure length
405
Chain Sequence
MKPTTVIGAGFGGLALAIRLQAAGIPVLLLEQRYVYEDQGFTFDAGPTVITDPSAIEELFALAGKQLKEYVELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLGTVPFLSFRDMLRAAPQLAKLQAWRSVYSKVASYIEDEHLRQAFSFHSLLVGGNPTSSIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVLNARVSHMETTGNKIEAVHLEDGRRFLTQAVASNADSNSLFVLYFGLNHHHDQLAHHTVCFGPRLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPHLGTANLDWTVEGPKLRDRIFAYLEQHYMPGLRSQLVTHRMFTPFDFRTITNLYLVGAGIPGVIGSAKATAGLMLEDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Phytoene dehydrogenase
publication title On the structure and function of the phytoene desaturase CRTI from Pantoea ananatis, a membrane-peripheral and FAD-dependent oxidase/isomerase.
pubmed doi rcsb
source organism Pantoea ananatis
total genus 130
structure length 405
sequence length 492
ec nomenclature ec 1.3.99.31: Phytoene desaturase (lycopene-forming).
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dgkA01
3UOVA 3AXBA 1RSGA 1LJ1A 1S3EA 3ADAB 2OLNA 3UKLA 3UOXA 4CNJA 5KXJA 2YLSA 1L9DA 1PS9A 2WP5A 4YT0A 1JEHA 3REDA 4B68A 3G5QA 2VOUA 2CDUA 2GH5A 4U8LA 5KOXA 4PAAA 2GMJA 1E39A 4FK1C 1L9CA 3AE1A 5EBKA 1YY5A 3M0OA 1BGNA 2WETA 1BF3A 1N4UA 2WDQA 3ICRA 3ZDNA 3V3OA 2HQMA 3NT6A 5GRTA 2VVLA 3CTYA 4H4UA 4ZCCA 1CJ4A 4KPRA 4TLXA 3UKKA 1EBDA 1DJNA 3C4NA 2GAGB 3DGZA 3ICTA 3NTAA 1GETA 2JBVA 3H4KA 4U8NA 3UKPA 4ECHA 1DOCA 2V61A 4Z2RA 3V3NA 4JQ9A 3RHAA 3UOYA 5C3JA 1FEAA 4U2SA 1O95A 2XCGA 4U8IA 4OPUA 3AEGA 1NDAA 2DKHA 2C7GA 2TPRA 4YKFA 1D7YA 2TMDA 1MO9A 3K30A 2ZBWA 2VVLG 4EIPA 3K7MX 3CNPA 3NHOX 4ADWA 4A99A 1BGJA 1PBCA 2RGOA 4N9XA 4EIQA 1GESA 1PN0A 1OJDA 3II4A 1O5WA 2OLOA 4K5SA 2C73A 2V3AA 3G5RA 3LZXA 4OPDA 4B1BA 4HA6A 5LV9A 1YQZA 2XDOA 2R4EA 3UCLA 4EQRA 1LQTA 4P9SA 4A6NA 2BCPA 1KFYA 2YVGA 3F8DA 4IA5A 2GR1A 2XLUA 1ZY8A 1EL7A 1COYA 1CF3A 1PHHA 2CVJA 3QSSA 4X4JA 5M0ZA 1XPQA 3EPTA 3KU9A 4E0VA 3DK8A 4O5UA 1PBBA 3ALMA 5KVIA 1FEBA 1W4XA 1ZDLA 5FS8A 5FS6A 1B5QA 4DSGA 2YR6A 4Z2UA 2WDRA 5FS7A 5EB4A 4YWOA 4J36A 2Q0LA 1GV4A 4J2WA 1KSSA 2YQUA 1H6VA 3Q6JA 2WDVA 1JRXA 2GQWA 3C96A 1PXBA 3R9UA 2BC0A 1GRBA 1E1NA 2A8XA 3DJDA 2YLRA 2JKCA 2YWLA 4JNQA 2GAHB 3QSMA 2JB2A 4UDQA 3LJPA 3NIXA 3PVCA 4YTPA 1NPXA 4CCRA 1F8WA 4Z26A 3GD4A 1GOSA 2YM2A 3GWFA 1EL5A 2XVJA 3NG7X 4X9NA 3NN0X 5IQ1A 1QO8A 3AB1A 2VVMA 3BHKA 1CJ2A 3UTFA 4OPCA 4GUVA 2ZZ0A 1PXCA 2QA1A 5J7XA 2OA1A 5CKUA 2ZZCA 4OVIA 1CHUA 3WE0A 1TDNA 5BULA 1SEZA 1H83A 4GDPA 3CGDA 5U25A 1IUUA 2XFOA 3DK4A 4TM1A 3AEEA 4C3XA 2FJAA 3KVEA 4RG4A 2BS2A 2XLPA 5DBJA 4OPIA 3AD7B 3S5WA 4AP1A 1Y0PA 4Z25A 4I59A 3ABVA 2VRMA 3KA7A 3EAOA 2BS3A 4APNA 1DXLA 4OPLA 4UDRA 5TR3A 5IPYA 3GSIA 3AE8A 2X99A 2WU2A 1E1KA 1GTEA 1XHCA 3KLJA 2BXRA 1GRAA 4WCTA 4YSXA 1TDFA 1TDOA 1VG9A 1JRYA 1XANA 3GD3A 4J57A 1VDCA 2WOVA 1DOBA 3BI4A 3GMBA 3QVPA 4MJWA 2JB1A 4CRTA 1OJ9A 3P4PA 2YR4A 4K22A 3NK1X 4AP3A 1RYIA 1Q9IA 3IHGA 2B7SA 4H2RA 2YLTA 4XWRA 4H4RA 3GYIA 3DH9A 1NHQA 4BJYA 1BKWA 2B76A 1UKVG 1GTHA 1PJ7A 3UKHA 5ER0A 3AE4A 4H2QA 4LA1A 4J34A 4JNAA 2GRTA 2X3NA 3AE2A 3QJ4A 2BABA 2GEWA 2IIDA 4A7AA 5KWFA 3CGBA 4REKA 2XFNA 3P1WA 1D4DA 4XXGA 4EMWA 3AD9B 3CIRA 3COXA 2B9YA 4H4TA 1NHSA 1EL8A 5HYMA 2V3BA 4EQSA 3BI5A 1F3PA 2WESA 3SFEA 2B9WA 4B65A 4B67A 2WOWA 4YTMA 1KNPA 2XFUA 1FOHA 3CNTA 3LZWA 2Y6QA 2YLXA 4K8DA 4B64A 3SGLA 4JY2A 4EQXA 3ATQA 1K0LA 2A87A 4FK1A 3B3RA 4AT0A 4ZN0A 5JCMA 1IUXA 1ZMCA 3AEBA 4TLZA 2GMHA 4GF7A 1GRTA 3ITJA 3UKQA 4TM3A 3AD8B 3GDNA 1GNDA 4Y4MA 4A5LA 3H8IA 4NEVA 2F5ZA 4YSZA 4YSYA 3CNJA 3VRDB 2A89A 3B6DA 1DNCA 4NTCA 3VR9A 5BVAA 3Q9TA 3NYFA 1YQ3A 2V60A 3GWDA 3I6DA 1CC2A 1YQ4A 4J56A 3T37A 4DGKA 1GRFA 4Y4NA 3UTGA 3PO7A 4H4XA 4AT2A 5JCLA 2VQ7A 1Q1WA 4O5QA 4A79A 1VQWA 1H7XA 1Z6LA 2R0PA 2RGHA 3K7QX 4LIIA 3AE9A 2XVFA 2BK5A 3LXDA 3AYIA 1FECA 5JCIA 1Y56B 2O9ZA 2WEUA 2Q7VA 4U2LA 2GR3A 3RP8A 2ARDA 3D1CA 2C3CA 2GR0A 4DNAA 4H4YA 3UTEA 4K7ZA 1BWCA 2GQFA 4GCMA 1F8RA 1HYUA 2C75A 1S3BA 3PS9A 4CY8A 1NG3A 1REOA 4USQA 3AECA 2JB3A 4U8KA 3UP4A 2C66A 5C2TA 5FS9A 3FBSA 1PJ6A 4CBQA 3UOZA 4AOXA 3DK9A 4A9WA 3NLCA 1N1PA 2QA2A 3FIMB 3ZYXA 4U8JA 1LPFA 4NTEA 3FG2P 2GV8A 1XDIA 2R45A 1MOKA 1S2YA 2NVKX 1GRHA 4BURA 4Z2TA 3BNMA 1DJQA 1Q1RA 2Q0KA 5U63A 2XVIA 3UTHA 3LOVA 5FMHA 1TDKA 2ACZA 2BCGG 1NHPA 1YKJA 2V6OA 4BK2A 3IHMA 1FL2A 4EMJA 2FJEA 3ALLA 3QVRA 4B66A 1LQUA 2J3NA 5IQ4A 1VRQB 1ZMDA 3H8LA 4M52A 3NTDA 4C77A 3AYJA 2QCUA 4K5RA 2WU5A 1TYTA 1GALA 3RP6A 2NPXA 2BK3A 1BZLA 5BRTA 4I58A 2YLZA 1P2EA 4D03A 4BV6A 1JRZA 3ATRA 4PABA 1TDEA 1JNRA 2BC1A 3UKFA 3O0HA 2EQ6A 4UDPA 4RG3A 2X8GA 4C74A 4D04A 4WX1A 4EQWA 1GSNA 1AOGA 5M10A 2W0HA 3AE3A 2PYXA 1CC4A 4YTNA 2YG4A 1ZP0A 1H81A 2R0GA 1VG0A 1NEKA 5JCNA 3P4SA 2YG5A 3CN8A 1DOEA 2VZ2A 3UKAA 3GYJA 3GDPA 4USRA 1PBEA 1N4WA 2WP6A 2XLRA 4LU6A 4EMIA 2X8HA 3AEDA 2CULA 3KPFA 2BACA 3EF6A 3GRTA 4H4ZA 3AWIA 2R0CA 2YG3A 3DJEA 4Z43A 3DA1A 1B37A 4NEWA 1EL9A 2RABA 1X31B 2EQ8A 2GB0A 2VQBA 1GRGA 4H4WA 5EB5A 2YR5A 2WP9A 2Y6RA 5U1OA 1CBOA 1S2QA 3M12A 1IJHA 2XVHA 1KDGA 1NENA 2PHHA 3KD9A 3VQRA 4YSHA 2X8CA 1RP0A 2DKIA 4IA6A 1E1MA 1NAAA 1K0IA 2WQYA 3HZLA 4H2NA 3AE6A 2FBWA 3CPHG 4GR1A 2IVEA 3VRAA 3BNUA 3NYEA 4EM4A 4JDRA 1IUVA 4XWZA 1CC6A 2GR2A 2UZZA 2RGJA 3NGCX 3M13A 2EQ9A 4BJZA 4YKGA 3SQPA 1ONFA 1O94A 1NG4A 1PXAA 2WPCA 2XFQA 3GRSA 4TM0A 4Z44A 5HY5A 4B63A 3D8XA 1P2HA 2CFYA 4JY3A 4U8MA 4X9MA 3NNEA 4TM4A 2XVEA 2JAEA 4B69A 4H7UA 3L8KA 1LTXR 1H86A 1ZK7A 1PBFA 3P4QA 3C4AA 2QAEA 1ZKQA 4EM3A 1TRBA 2BXSA 2Z5XA 5KVHA 1PDHA 3NKSA 1D7LA 4RSLA 3RNMA 2C64A 3I3LA 1GREA 4IVMB 1GT8A 1QLBA 1N4VA 2YG6A 4IVOB 2YAUA 4U8PA 2XLSA 5KRQA 4OCGA 4FX9A 3RP7A 1JNZA 4GRTA 4Z24A 1H7WA 2C70A 1D5TA 3VR8A 4K2XA 2FJDA 2E4GA 2WPFA 3AEFA 3F8PA 5GSNA 1KSUA 4U2TA 3ISHA 3NH3X 3CNDA 3KKJA 4AOSA 5EOWA 1OJTA 4C3YA 2B7RA 1DODA 1H84A 4HB9A 3AYLA 3FMWA 4UP3A 3EANA 3SFDA 3GMCA 1E1LA 3CPIG 5HXIA 4H4PA 1KNRA 1V59A 4A65A 3DJJA 3CPJG 4J31A 4OPTA 2E1MA 2YM1A 3JSKA 4H4QA 2C67A 1CJCA 1GXFA 4OPGA 4C5OA 2C3DA 3NK2X 3QSEA 1M64A 4H4SA 2R46A 1F6MA 1E7PA 1GEUA 1JU2A 4H4VA 3FPZA 2Q6UA 2R9ZA 2YVFA 2WOIA 3OC4A 3QFAA 1GPEA 2FJBA 2WPEA 1ZOVA 2H89A 1LVLA 4H2PA 4KX6A 3CGEA 4Y4LA 4ICYA 4ZCDA 3P9UA 3OZ2A 2WS3A 2BS4A 3BHFA 3NRNA 4IV9A 4NZHA 1MXTA 3DGHA 3CNSA 2GF3A 5CQFA 2YLWA 2AR8A 5KOWA 2XLTA 3QFBA 4BK3A 4YXDA 1OJAA 2BK4A 1IUTA 1IUSA 1ELIA 2C72A 2C65A 2OAMA 4FDCB 2WBAA 1ZX9A 2YG7A 3IF9A 5JCKA 4H50A 2BA9A 3AE7A 1LV0A 1PBDA 2B9XA 4NTDA 4DSHA 4J33A 1JOAA 2I0ZA 2AAQA 2JK6A 3CGCA 3VRBA 2YVJA 1E6EA 2BYBA 3NK0X 3IC9A 2IVDA 2OALA 2VRLA 1PJ5A 3P4RA 1B8SA 1D4CA 1F8SA 3URHA 4A6NB 2H88A 2E5VA 1M6IA 2XFPA 1L0VA 1FCDA 2WHDA 1CL0A 1QJDA 2AQJA 2APGA 3ALJA 1NHRA 2R4JA 2X50A 3AEAA 3AE5A 1TYPA 2GVCA 3DMEA 5J60A 3SM8A 3LB8A 2ZZBA 1CJ3A 1OJCA 1K4QA 1B4VA 5BUKA 3LADA 3E1TA 3G5SA 3S61A 1KF6A 1H82A 4U8OA 2C76A 1D4EA 3ICSA 3BI2A 3V76A 3UP5A 3DJGX 3NN6X 2EQ7A 1K0JA 3K7TA 3F8RA 2XYOA 4JN9A 1Y56A 3NYCA 4GDEA 1ZOYA 5L46A 1IUWA 2Z5YA 1GERA 5HHFA 2V5ZA 4BK1A 3L1RA 4CCQA 1L9EA 4CNKA 4CY6A 3IWAA
chains in the Genus database with same CATH superfamily
3UOVA 3AXBA 1RSGA 1LJ1A 1S3EA 3ADAB 2OLNA 3UKLA 3UOXA 4CNJA 5KXJA 2YLSA 1L9DA 1PS9A 2WP5A 4YT0A 1JEHA 3REDA 4B68A 3G5QA 2VOUA 2CDUA 2GH5A 4U8LA 5KOXA 4PAAA 2GMJA 1E39A 4FK1C 1L9CA 3AE1A 5EBKA 1YY5A 3M0OA 1BGNA 2WETA 1BF3A 1N4UA 3T2YA 2WDQA 3ICRA 3ZDNA 3V3OA 2HQMA 3NT6A 5GRTA 2VVLA 3CTYA 4H4UA 4ZCCA 1CJ4A 4KPRA 4TLXA 3UKKA 1EBDA 1DJNA 3C4NA 2GAGB 3DGZA 3ICTA 3NTAA 1GETA 2JBVA 3H4KA 4U8NA 3UKPA 4ECHA 1DOCA 2V61A 2C4CA 4Z2RA 3V3NA 4JQ9A 3RHAA 3UOYA 5C3JA 1FEAA 4U2SA 1O95A 2XCGA 4U8IA 4OPUA 3AEGA 1NDAA 2DKHA 2C7GA 3KPKA 2TPRA 4YKFA 1D7YA 2TMDA 1MO9A 3K30A 2ZBWA 2VVLG 4EIPA 3K7MX 3CNPA 3NHOX 4ADWA 4A99A 1BGJA 1PBCA 2RGOA 4N9XA 4EIQA 1GESA 3CMMA 1PN0A 1OJDA 3II4A 1O5WA 2OLOA 4K5SA 2C73A 2V3AA 3G5RA 3LZXA 4OPDA 4B1BA 4HA6A 5LV9A 1YQZA 2XDOA 2R4EA 3UCLA 4EQRA 1LQTA 4P9SA 4A6NA 2BCPA 1KFYA 2YVGA 3F8DA 4IA5A 2GR1A 2XLUA 1ZY8A 1EL7A 5KMPA 1COYA 1CF3A 1PHHA 2CVJA 3QSSA 4X4JA 5M0ZA 1XPQA 3EPTA 3KU9A 4E0VA 3DK8A 4O5UA 1PBBA 3ALMA 5KVIA 1FEBA 1W4XA 1ZDLA 5FS8A 5FS6A 1B5QA 4DSGA 2YR6A 4Z2UA 2WDRA 5FS7A 5EB4A 4YWOA 4J36A 2Q0LA 1GV4A 4J2WA 1KSSA 4II3A 2YQUA 1H6VA 3Q6JA 2WDVA 1JRXA 2GQWA 3C96A 1PXBA 3R9UA 2BC0A 1GRBA 1E1NA 2A8XA 3DJDA 2YLRA 2JKCA 2YWLA 4G74A 4JNQA 2GAHB 3QSMA 2JB2A 4UDQA 3LJPA 3SZWA 3NIXA 3PVCA 4YTPA 1NPXA 4CCRA 1F8WA 4Z26A 3GD4A 1GOSA 4GAPA 2YM2A 3GWFA 1EL5A 2XVJA 3NG7X 4X9NA 3NN0X 5IQ1A 1QO8A 3AB1A 2VVMA 3BHKA 1CJ2A 3UTFA 4OPCA 4GUVA 2ZZ0A 1PXCA 2QA1A 5J7XA 2OA1A 5CKUA 2ZZCA 4OVIA 1CHUA 3WE0A 1TDNA 5BULA 1SEZA 1H83A 4GDPA 3CGDA 5U25A 1IUUA 2XFOA 3DK4A 4TM1A 3AEEA 4C3XA 2FJAA 3KVEA 4RG4A 2BS2A 2XLPA 5DBJA 4OPIA 3AD7B 3S5WA 4AP1A 1Y0PA 4Z25A 4I59A 3ABVA 2VRMA 3KA7A 3EAOA 2BS3A 4APNA 1DXLA 4OPLA 4UDRA 5TR3A 5IPYA 3GSIA 3AE8A 4II2A 2X99A 2WU2A 1E1KA 1GTEA 1XHCA 3KLJA 2BXRA 1GRAA 4WCTA 4YSXA 1TDFA 1TDOA 1VG9A 1JRYA 1XANA 3GD3A 4J57A 1VDCA 2WOVA 1DOBA 3BI4A 3GMBA 3QVPA 3SXIA 4MJWA 2JB1A 4CRTA 1OJ9A 3P4PA 2YR4A 4K22A 3NK1X 4AP3A 1RYIA 1Q9IA 3IHGA 2B7SA 4H2RA 2YLTA 4XWRA 4H4RA 3GYIA 3DH9A 1NHQA 4BJYA 1BKWA 2B76A 1UKVG 1GTHA 1PJ7A 3UKHA 5ER0A 3AE4A 4H2QA 4LA1A 4J34A 4JNAA 2GRTA 2X3NA 3AE2A 3QJ4A 2BABA 2GEWA 2IIDA 4A7AA 5KWFA 3CGBA 4REKA 2XFNA 3P1WA 1D4DA 4XXGA 3T31A 4EMWA 3AD9B 3CIRA 3COXA 2B9YA 4H4TA 1NHSA 1EL8A 5HYMA 2V3BA 4EQSA 3BI5A 1F3PA 4G73A 2WESA 3SFEA 2B9WA 4B65A 4B67A 5KNLA 2WOWA 4YTMA 1KNPA 2XFUA 1FOHA 3CNTA 3LZWA 2Y6QA 2YLXA 4K8DA 4B64A 3SGLA 4JY2A 4EQXA 3ATQA 1K0LA 2A87A 4FK1A 3B3RA 4AT0A 4ZN0A 5JCMA 3HYWA 1IUXA 1ZMCA 3AEBA 4TLZA 2GMHA 3SX6A 4GF7A 1GRTA 3ITJA 3UKQA 4TM3A 3AD8B 3GDNA 1GNDA 4Y4MA 4A5LA 3H8IA 4NEVA 2F5ZA 4YSZA 4YSYA 3CNJA 3VRDB 2A89A 3B6DA 1DNCA 4NTCA 3VR9A 5BVAA 3Q9TA 3NYFA 1YQ3A 2V60A 3GWDA 3I6DA 1CC2A 1YQ4A 3HYXA 4J56A 3T37A 1GRFA 4Y4NA 4DGKA 3UTGA 2BRAA 3PO7A 4H4XA 4AT2A 5JCLA 2VQ7A 1Q1WA 4O5QA 4A79A 1VQWA 1H7XA 1Z6LA 2R0PA 2RGHA 3K7QX 4LIIA 3AE9A 2XVFA 2BK5A 3LXDA 3AYIA 1FECA 5JCIA 1Y56B 2O9ZA 2WEUA 2Q7VA 4U2LA 2GR3A 3RP8A 2ARDA 3D1CA 2C3CA 2GR0A 3SY4A 4DNAA 4H4YA 3UTEA 4K7ZA 1BWCA 2GQFA 4GCMA 1F8RA 1HYUA 2C75A 1S3BA 3PS9A 3GYXA 4CY8A 1NG3A 1REOA 4USQA 3AECA 2JB3A 4U8KA 3UP4A 3T14A 2C66A 5C2TA 5FS9A 3FBSA 1PJ6A 4CBQA 3UOZA 4AOXA 3DK9A 4A9WA 3NLCA 1N1PA 2QA2A 3FIMB 5KMRA 4G6GA 3ZYXA 4U8JA 1LPFA 4NTEA 3FG2P 2GV8A 1XDIA 2R45A 1MOKA 1S2YA 2NVKX 1GRHA 3SZ0A 4BURA 3BNMA 4Z2TA 1DJQA 1Q1RA 2Q0KA 5U63A 5KMSA 2XVIA 3UTHA 3LOVA 5FMHA 1TDKA 2ACZA 2BCGG 1NHPA 4G6HA 1YKJA 2V6OA 4BK2A 3IHMA 1FL2A 4EMJA 2FJEA 3ALLA 3QVRA 4B66A 1LQUA 2J3NA 5IQ4A 1VRQB 1ZMDA 3H8LA 4M52A 3NTDA 4C77A 3AYJA 2QCUA 4K5RA 2WU5A 1TYTA 1GALA 3RP6A 2NPXA 2BK3A 1BZLA 5BRTA 4I58A 2YLZA 1P2EA 4D03A 4BV6A 1JRZA 3ATRA 4PABA 1TDEA 1JNRA 2BC1A 3UKFA 3O0HA 2EQ6A 4UDPA 4RG3A 2X8GA 4C74A 4D04A 4WX1A 4EQWA 1GSNA 1AOGA 5M10A 2W0HA 3AE3A 2PYXA 1CC4A 4YTNA 2YG4A 1ZP0A 1H81A 2R0GA 1VG0A 1NEKA 5JCNA 3P4SA 2YG5A 3CN8A 1DOEA 2VZ2A 3UKAA 3GYJA 3GDPA 4USRA 1PBEA 1N4WA 2WP6A 2XLRA 4LU6A 5KMQA 4EMIA 2X8HA 3AEDA 2CULA 3KPFA 2BACA 3EF6A 3GRTA 4H4ZA 3AWIA 2R0CA 2YG3A 3DJEA 4Z43A 3DA1A 1B37A 4NEWA 1EL9A 2RABA 1X31B 2EQ8A 2GB0A 2VQBA 1GRGA 4H4WA 5EB5A 2YR5A 2WP9A 2Y6RA 5U1OA 1CBOA 1S2QA 3M12A 1IJHA 2XVHA 1KDGA 1NENA 2PHHA 3KD9A 3VQRA 4YSHA 2X8CA 1RP0A 2DKIA 4IA6A 1E1MA 1NAAA 1K0IA 2WQYA 3HZLA 4H2NA 3AE6A 2FBWA 3CPHG 4GR1A 2IVEA 3VRAA 3BNUA 3NYEA 4EM4A 4JDRA 1IUVA 4XWZA 1CC6A 2GR2A 2UZZA 2RGJA 3NGCX 3M13A 2EQ9A 4BJZA 4YKGA 3SQPA 1ONFA 1O94A 1NG4A 3SZCA 1PXAA 2WPCA 2XFQA 3GRSA 4TM0A 4Z44A 5HY5A 3T2KA 4B63A 3D8XA 1P2HA 2CFYA 4JY3A 4U8MA 4X9MA 3NNEA 4TM4A 2XVEA 2JAEA 4B69A 4H7UA 3L8KA 1LTXR 1H86A 1ZK7A 1PBFA 3P4QA 3C4AA 2QAEA 1ZKQA 4EM3A 1TRBA 2BXSA 2Z5XA 5KVHA 1PDHA 3NKSA 1D7LA 4RSLA 3RNMA 2C64A 3I3LA 1GREA 4IVMB 1GT8A 1QLBA 1N4VA 2YG6A 4IVOB 2YAUA 4U8PA 2XLSA 5KRQA 4OCGA 4FX9A 3RP7A 1JNZA 4GAVA 4GRTA 1H7WA 2C70A 1D5TA 4Z24A 4K2XA 3VR8A 2FJDA 2E4GA 2WPFA 3AEFA 3F8PA 5GSNA 1KSUA 4U2TA 3ISHA 3SZFA 3NH3X 3CNDA 3KKJA 4AOSA 5EOWA 1OJTA 3SYIA 4C3YA 2B7RA 1DODA 1H84A 4HB9A 3AYLA 3FMWA 4UP3A 3EANA 3SFDA 3GMCA 1E1LA 3CPIG 5HXIA 4H4PA 1KNRA 1V59A 4A65A 3DJJA 3CPJG 4J31A 4NNJA 4OPTA 2E1MA 2YM1A 3JSKA 4H4QA 2C67A 1CJCA 1GXFA 4OPGA 4C5OA 2C3DA 3NK2X 3QSEA 1M64A 4H4SA 2R46A 1F6MA 1E7PA 1GEUA 1JU2A 3HYVA 4H4VA 3FPZA 2Q6UA 2R9ZA 2YVFA 2WOIA 3OC4A 3QFAA 1GPEA 2FJBA 2WPEA 1ZOVA 2H89A 1LVLA 4H2PA 4KX6A 3CGEA 4Y4LA 4ICYA 4ZCDA 3P9UA 3OZ2A 2WS3A 2BS4A 3BHFA 3NRNA 4IV9A 4NZHA 1MXTA 3DGHA 3CNSA 2GF3A 5CQFA 2YLWA 2AR8A 5KOWA 2XLTA 3QFBA 4BK3A 4YXDA 1OJAA 2BK4A 1IUTA 1IUSA 1ELIA 2C72A 2C65A 2OAMA 4FDCB 2WBAA 1ZX9A 2YG7A 3IF9A 5JCKA 4H50A 2BA9A 3AE7A 1LV0A 1PBDA 2B9XA 4NTDA 4DSHA 4J33A 1JOAA 2I0ZA 2AAQA 2JK6A 3CGCA 3VRBA 2YVJA 1E6EA 2BYBA 3NK0X 3IC9A 2IVDA 2OALA 3T2ZA 2VRLA 1PJ5A 3P4RA 1B8SA 1D4CA 1F8SA 3URHA 4A6NB 2H88A 2E5VA 1M6IA 2XFPA 1L0VA 1FCDA 2WHDA 1CL0A 1QJDA 2AQJA 2APGA 3ALJA 1NHRA 2R4JA 2X50A 3AEAA 3AE5A 1TYPA 2GVCA 3DMEA 5J60A 3SM8A 4G9KA 4NWZA 3LB8A 2ZZBA 1CJ3A 1OJCA 1K4QA 1B4VA 5BUKA 3LADA 3E1TA 3G5SA 3S61A 1KF6A 1H82A 4U8OA 2C76A 1D4EA 3ICSA 3BI2A 3V76A 3T0KA 3UP5A 3DJGX 3NN6X 2EQ7A 1K0JA 3K7TA 3F8RA 2XYOA 4JN9A 1Y56A 2BRYA 3NYCA 1ZOYA 4GDEA 5L46A 1IUWA 2Z5YA 1GERA 5HHFA 2V5ZA 4BK1A 3L1RA 4CCQA 1L9EA 4CNKA 4CY6A 3IWAA
chains in the Genus database with same CATH topology
3UOVA 3AXBA 1RSGA 1LJ1A 1S3EA 3ADAB 2OLNA 3UKLA 3UOXA 4CNJA 5KXJA 2YLSA 1L9DA 1PS9A 2WP5A 4YT0A 1JEHA 3REDA 4B68A 3G5QA 2VOUA 2CDUA 2GH5A 4U8LA 5KOXA 4PAAA 2GMJA 1E39A 4FK1C 1L9CA 3AE1A 5EBKA 1YY5A 3M0OA 1BGNA 2WETA 1BF3A 1N4UA 3T2YA 2WDQA 3ICRA 3ZDNA 3V3OA 2HQMA 3NT6A 5GRTA 2VVLA 3CTYA 4H4UA 4ZCCA 1CJ4A 4KPRA 4TLXA 3UKKA 1EBDA 1DJNA 3C4NA 2GAGB 3DGZA 3ICTA 3NTAA 1GETA 2JBVA 3H4KA 4U8NA 3UKPA 4ECHA 1DOCA 2V61A 2C4CA 4Z2RA 3V3NA 4JQ9A 3RHAA 3UOYA 5C3JA 1FEAA 4U2SA 1O95A 2XCGA 4U8IA 4OPUA 3AEGA 1NDAA 2DKHA 2C7GA 3KPKA 2TPRA 4YKFA 1D7YA 2TMDA 1MO9A 3K30A 2ZBWA 2VVLG 4EIPA 3K7MX 3CNPA 3NHOX 4ADWA 4A99A 1BGJA 1PBCA 2RGOA 4N9XA 4EIQA 1GESA 3CMMA 1PN0A 1OJDA 3II4A 1O5WA 2OLOA 4K5SA 2C73A 2V3AA 3G5RA 3LZXA 4OPDA 4B1BA 4HA6A 5LV9A 1YQZA 2XDOA 2R4EA 3UCLA 4EQRA 1LQTA 4P9SA 4A6NA 2BCPA 1KFYA 2YVGA 3F8DA 4IA5A 2GR1A 2XLUA 1ZY8A 1EL7A 5KMPA 1COYA 1CF3A 1PHHA 2CVJA 3QSSA 4X4JA 5M0ZA 1XPQA 3EPTA 3KU9A 4E0VA 3DK8A 4O5UA 1PBBA 3ALMA 5KVIA 1FEBA 1W4XA 1ZDLA 5FS8A 5FS6A 1B5QA 4DSGA 2YR6A 4Z2UA 2WDRA 5FS7A 5EB4A 4YWOA 4J36A 2Q0LA 1GV4A 4J2WA 1KSSA 4II3A 2YQUA 1H6VA 3Q6JA 2WDVA 1JRXA 2GQWA 3C96A 1PXBA 3R9UA 2BC0A 1GRBA 1E1NA 2A8XA 3DJDA 2YLRA 2JKCA 2YWLA 4G74A 4JNQA 2GAHB 3QSMA 2JB2A 4UDQA 3LJPA 3SZWA 3NIXA 3PVCA 4YTPA 1NPXA 4CCRA 1F8WA 4Z26A 3GD4A 1GOSA 4GAPA 2YM2A 3GWFA 1EL5A 2XVJA 3NG7X 4X9NA 3NN0X 5IQ1A 1QO8A 3AB1A 2VVMA 3BHKA 1CJ2A 3UTFA 4OPCA 4GUVA 2ZZ0A 1PXCA 2QA1A 5J7XA 2OA1A 5CKUA 2ZZCA 4OVIA 1CHUA 3WE0A 1TDNA 5BULA 1SEZA 1H83A 4GDPA 3CGDA 5U25A 1IUUA 2XFOA 3DK4A 4TM1A 3AEEA 4C3XA 2FJAA 3KVEA 4RG4A 2BS2A 2XLPA 5DBJA 4OPIA 3AD7B 3S5WA 4AP1A 1Y0PA 4Z25A 4I59A 3ABVA 2VRMA 3KA7A 3EAOA 2BS3A 4APNA 1DXLA 4OPLA 4UDRA 5TR3A 5IPYA 3GSIA 3AE8A 4II2A 2X99A 2WU2A 1E1KA 1GTEA 1XHCA 3KLJA 2BXRA 1GRAA 4WCTA 4YSXA 1TDFA 1TDOA 1VG9A 1JRYA 1XANA 3GD3A 4J57A 1VDCA 2WOVA 1DOBA 3BI4A 3GMBA 3QVPA 3SXIA 4MJWA 2JB1A 4CRTA 1OJ9A 3P4PA 2YR4A 4K22A 3NK1X 4AP3A 1RYIA 1Q9IA 3IHGA 2B7SA 4H2RA 2YLTA 4XWRA 4H4RA 3GYIA 3DH9A 1NHQA 4BJYA 1BKWA 2B76A 1UKVG 1GTHA 1PJ7A 3UKHA 5ER0A 3AE4A 4H2QA 4LA1A 4J34A 4JNAA 2GRTA 2X3NA 3AE2A 3QJ4A 2BABA 2GEWA 2IIDA 4A7AA 5KWFA 3CGBA 4REKA 2XFNA 3P1WA 1D4DA 4XXGA 3T31A 4EMWA 3AD9B 3CIRA 3COXA 2B9YA 4H4TA 1NHSA 1EL8A 5HYMA 2V3BA 4EQSA 3BI5A 1F3PA 4G73A 2WESA 3SFEA 2B9WA 4B65A 4B67A 5KNLA 2WOWA 4YTMA 1KNPA 2XFUA 1FOHA 3CNTA 3LZWA 2Y6QA 2YLXA 4K8DA 4B64A 3SGLA 4JY2A 4EQXA 3ATQA 1K0LA 2A87A 4FK1A 3B3RA 4AT0A 4ZN0A 5JCMA 3HYWA 1IUXA 1ZMCA 3AEBA 4TLZA 2GMHA 3SX6A 4GF7A 1GRTA 3ITJA 3UKQA 4TM3A 3AD8B 3GDNA 1GNDA 4Y4MA 4A5LA 3H8IA 4NEVA 2F5ZA 4YSZA 4YSYA 3CNJA 3VRDB 2A89A 3B6DA 1DNCA 4NTCA 3VR9A 5BVAA 3Q9TA 3NYFA 1YQ3A 2V60A 3GWDA 3I6DA 1CC2A 1YQ4A 3HYXA 4J56A 3T37A 1GRFA 4Y4NA 4DGKA 3UTGA 2BRAA 3PO7A 4H4XA 4AT2A 5JCLA 2VQ7A 1Q1WA 4O5QA 4A79A 1VQWA 1H7XA 1Z6LA 2R0PA 2RGHA 3K7QX 4LIIA 3AE9A 2XVFA 2BK5A 3LXDA 3AYIA 1FECA 5JCIA 1Y56B 2O9ZA 2WEUA 2Q7VA 4U2LA 2GR3A 3RP8A 2ARDA 3D1CA 2C3CA 2GR0A 3SY4A 4DNAA 4H4YA 3UTEA 4K7ZA 1BWCA 2GQFA 4GCMA 1F8RA 1HYUA 2C75A 1S3BA 3PS9A 3GYXA 4CY8A 1NG3A 1REOA 4USQA 3AECA 2JB3A 4U8KA 3UP4A 3T14A 2C66A 5C2TA 5FS9A 3FBSA 1PJ6A 4CBQA 3UOZA 4AOXA 3DK9A 4A9WA 3NLCA 1N1PA 2QA2A 3FIMB 5KMRA 4G6GA 3ZYXA 4U8JA 1LPFA 4NTEA 3FG2P 2GV8A 1XDIA 2R45A 1MOKA 1S2YA 2NVKX 1GRHA 3SZ0A 4BURA 3BNMA 4Z2TA 1DJQA 1Q1RA 2Q0KA 5U63A 5KMSA 2XVIA 3UTHA 3LOVA 5FMHA 1TDKA 2ACZA 2BCGG 1NHPA 4G6HA 1YKJA 2V6OA 4BK2A 3IHMA 1FL2A 4EMJA 2FJEA 3ALLA 3QVRA 4B66A 1LQUA 2J3NA 5IQ4A 1VRQB 1ZMDA 3H8LA 4M52A 3NTDA 4C77A 3AYJA 2QCUA 4K5RA 2WU5A 1TYTA 1GALA 3RP6A 2NPXA 2BK3A 1BZLA 5BRTA 4I58A 2YLZA 1P2EA 4D03A 4BV6A 1JRZA 3ATRA 4PABA 1TDEA 1JNRA 2BC1A 3UKFA 3O0HA 2EQ6A 4UDPA 4RG3A 2X8GA 4C74A 4D04A 4WX1A 4EQWA 1GSNA 1AOGA 5M10A 2W0HA 3AE3A 2PYXA 1CC4A 4YTNA 2YG4A 1ZP0A 1H81A 2R0GA 1VG0A 1NEKA 5JCNA 3P4SA 2YG5A 3CN8A 1DOEA 2VZ2A 3UKAA 3GYJA 3GDPA 4USRA 1PBEA 1N4WA 2WP6A 2XLRA 4LU6A 5KMQA 4EMIA 2X8HA 3AEDA 2CULA 3KPFA 2BACA 3EF6A 3GRTA 4H4ZA 3AWIA 2R0CA 2YG3A 3DJEA 4Z43A 3DA1A 1B37A 4NEWA 1EL9A 2RABA 1X31B 2EQ8A 2GB0A 2VQBA 1GRGA 4H4WA 5EB5A 2YR5A 2WP9A 2Y6RA 5U1OA 1CBOA 1S2QA 3M12A 1IJHA 2XVHA 1KDGA 1NENA 2PHHA 3KD9A 3VQRA 4YSHA 2X8CA 1RP0A 2DKIA 4IA6A 1E1MA 1NAAA 1K0IA 2WQYA 3HZLA 4H2NA 3AE6A 2FBWA 3CPHG 4GR1A 2IVEA 3VRAA 3BNUA 3NYEA 4EM4A 4JDRA 1IUVA 4XWZA 1CC6A 2GR2A 2UZZA 2RGJA 3NGCX 3M13A 2EQ9A 4BJZA 4YKGA 3SQPA 1ONFA 1O94A 1NG4A 3SZCA 1PXAA 2WPCA 2XFQA 3GRSA 4TM0A 4Z44A 5HY5A 3T2KA 4B63A 3D8XA 1P2HA 2CFYA 4JY3A 4U8MA 4X9MA 3NNEA 4TM4A 2XVEA 2JAEA 4B69A 4H7UA 3L8KA 1LTXR 1H86A 1ZK7A 1PBFA 3P4QA 3C4AA 2QAEA 1ZKQA 4EM3A 1TRBA 2BXSA 2Z5XA 5KVHA 1PDHA 3NKSA 1D7LA 4RSLA 3RNMA 2C64A 3I3LA 1GREA 4IVMB 1GT8A 1QLBA 1N4VA 2YG6A 4IVOB 2YAUA 4U8PA 2XLSA 5KRQA 4OCGA 4FX9A 3RP7A 1JNZA 4GAVA 4GRTA 1H7WA 2C70A 1D5TA 4Z24A 4K2XA 3VR8A 2FJDA 2E4GA 2WPFA 3AEFA 3F8PA 5GSNA 1KSUA 4U2TA 3ISHA 3SZFA 3NH3X 3CNDA 3KKJA 4AOSA 5EOWA 1OJTA 3SYIA 4C3YA 2B7RA 1DODA 1H84A 4HB9A 3AYLA 3FMWA 4UP3A 3EANA 3SFDA 3GMCA 1E1LA 3CPIG 5HXIA 4H4PA 1KNRA 1V59A 4A65A 3DJJA 3CPJG 4J31A 4NNJA 4OPTA 2E1MA 2YM1A 3JSKA 4H4QA 2C67A 1CJCA 1GXFA 4OPGA 4C5OA 2C3DA 3NK2X 3QSEA 1M64A 4H4SA 2R46A 1F6MA 1E7PA 1GEUA 1JU2A 3HYVA 4H4VA 3FPZA 2Q6UA 2R9ZA 2YVFA 2WOIA 3OC4A 3QFAA 1GPEA 2FJBA 2WPEA 1ZOVA 2H89A 1LVLA 4H2PA 4KX6A 3CGEA 4Y4LA 4ICYA 4ZCDA 3P9UA 3OZ2A 2WS3A 2BS4A 3BHFA 3NRNA 4IV9A 4NZHA 1MXTA 3DGHA 3CNSA 2GF3A 5CQFA 2YLWA 2AR8A 5KOWA 2XLTA 3QFBA 4BK3A 4YXDA 1OJAA 2BK4A 1IUTA 1IUSA 1ELIA 2C72A 2C65A 2OAMA 4FDCB 2WBAA 1ZX9A 2YG7A 3IF9A 5JCKA 4H50A 2BA9A 3AE7A 1LV0A 1PBDA 2B9XA 4NTDA 4DSHA 4J33A 1JOAA 2I0ZA 2AAQA 2JK6A 3CGCA 3VRBA 2YVJA 1E6EA 2BYBA 3NK0X 3IC9A 2IVDA 2OALA 3T2ZA 2VRLA 1PJ5A 3P4RA 1B8SA 1D4CA 1F8SA 3URHA 4A6NB 2H88A 2E5VA 1M6IA 2XFPA 1L0VA 1FCDA 2WHDA 1CL0A 1QJDA 2AQJA 2APGA 3ALJA 1NHRA 2R4JA 2X50A 3AEAA 3AE5A 1TYPA 2GVCA 3DMEA 5J60A 3SM8A 4G9KA 4NWZA 3LB8A 2ZZBA 1CJ3A 1OJCA 1K4QA 1B4VA 5BUKA 3LADA 3E1TA 3G5SA 3S61A 1KF6A 1H82A 4U8OA 2C76A 1D4EA 3ICSA 3BI2A 3V76A 3T0KA 3UP5A 3DJGX 3NN6X 2EQ7A 1K0JA 3K7TA 3F8RA 2XYOA 4JN9A 1Y56A 2BRYA 3NYCA 1ZOYA 4GDEA 5L46A 1IUWA 2Z5YA 1GERA 5HHFA 2V5ZA 4BK1A 3L1RA 4CCQA 1L9EA 4CNKA 4CY6A 3IWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UOV A;  3AXB A;  1RSG A;  1LJ1 A;  1S3E A;  3ADA B;  2OLN A;  3UKL A;  3UOX A;  4CNJ A;  5KXJ A;  2YLS A;  1L9D A;  1PS9 A;  2WP5 A;  4YT0 A;  1JEH A;  3RED A;  4B68 A;  3G5Q A;  2VOU A;  2CDU A;  2GH5 A;  4U8L A;  5KOX A;  4PAA A;  2GMJ A;  1E39 A;  4FK1 C;  1L9C A;  3AE1 A;  5EBK A;  1YY5 A;  3M0O A;  1BGN A;  2WET A;  1BF3 A;  1N4U A;  2WDQ A;  3ICR A;  3ZDN A;  3V3O A;  2HQM A;  3NT6 A;  5GRT A;  2VVL A;  3CTY A;  4H4U A;  4ZCC A;  1CJ4 A;  4KPR A;  4TLX A;  3UKK A;  1EBD A;  1DJN A;  3C4N A;  2GAG B;  3DGZ A;  3ICT A;  3NTA A;  1GET A;  2JBV A;  3H4K A;  4U8N A;  3UKP A;  4ECH A;  1DOC A;  2V61 A;  4Z2R A;  3V3N A;  4JQ9 A;  3RHA A;  3UOY A;  5C3J A;  1FEA A;  4U2S A;  1O95 A;  2XCG A;  4U8I A;  4OPU A;  3AEG A;  1NDA A;  2DKH A;  2C7G A;  2TPR A;  4YKF A;  1D7Y A;  2TMD A;  1MO9 A;  3K30 A;  2ZBW A;  2VVL G;  4EIP A;  3K7M X;  3CNP A;  3NHO X;  4ADW A;  4A99 A;  1BGJ A;  1PBC A;  2RGO A;  4N9X A;  4EIQ A;  1GES A;  1PN0 A;  1OJD A;  3II4 A;  1O5W A;  2OLO A;  4K5S A;  2C73 A;  2V3A A;  3G5R A;  3LZX A;  4OPD A;  4B1B A;  4HA6 A;  5LV9 A;  1YQZ A;  2XDO A;  2R4E A;  3UCL A;  4EQR A;  1LQT A;  4P9S A;  4A6N A;  2BCP A;  1KFY A;  2YVG A;  3F8D A;  4IA5 A;  2GR1 A;  2XLU A;  1ZY8 A;  1EL7 A;  1COY A;  1CF3 A;  1PHH A;  2CVJ A;  3QSS A;  4X4J A;  5M0Z A;  1XPQ A;  3EPT A;  3KU9 A;  4E0V A;  3DK8 A;  4O5U A;  1PBB A;  3ALM A;  5KVI A;  1FEB A;  1W4X A;  1ZDL A;  5FS8 A;  5FS6 A;  1B5Q A;  4DSG A;  2YR6 A;  4Z2U A;  2WDR A;  5FS7 A;  5EB4 A;  4YWO A;  4J36 A;  2Q0L A;  1GV4 A;  4J2W A;  1KSS A;  2YQU A;  1H6V A;  3Q6J A;  2WDV A;  1JRX A;  2GQW A;  3C96 A;  1PXB A;  3R9U A;  2BC0 A;  1GRB A;  1E1N A;  2A8X A;  3DJD A;  2YLR A;  2JKC A;  2YWL A;  4JNQ A;  2GAH B;  3QSM A;  2JB2 A;  4UDQ A;  3LJP A;  3NIX A;  3PVC A;  4YTP A;  1NPX A;  4CCR A;  1F8W A;  4Z26 A;  3GD4 A;  1GOS A;  2YM2 A;  3GWF A;  1EL5 A;  2XVJ A;  3NG7 X;  4X9N A;  3NN0 X;  5IQ1 A;  1QO8 A;  3AB1 A;  2VVM A;  3BHK A;  1CJ2 A;  3UTF A;  4OPC A;  4GUV A;  2ZZ0 A;  1PXC A;  2QA1 A;  5J7X A;  2OA1 A;  5CKU A;  2ZZC A;  4OVI A;  1CHU A;  3WE0 A;  1TDN A;  5BUL A;  1SEZ A;  1H83 A;  4GDP A;  3CGD A;  5U25 A;  1IUU A;  2XFO A;  3DK4 A;  4TM1 A;  3AEE A;  4C3X A;  2FJA A;  3KVE A;  4RG4 A;  2BS2 A;  2XLP A;  5DBJ A;  4OPI A;  3AD7 B;  3S5W A;  4AP1 A;  1Y0P A;  4Z25 A;  4I59 A;  3ABV A;  2VRM A;  3KA7 A;  3EAO A;  2BS3 A;  4APN A;  1DXL A;  4OPL A;  4UDR A;  5TR3 A;  5IPY A;  3GSI A;  3AE8 A;  2X99 A;  2WU2 A;  1E1K A;  1GTE A;  1XHC A;  3KLJ A;  2BXR A;  1GRA A;  4WCT A;  4YSX A;  1TDF A;  1TDO A;  1VG9 A;  1JRY A;  1XAN A;  3GD3 A;  4J57 A;  1VDC A;  2WOV A;  1DOB A;  3BI4 A;  3GMB A;  3QVP A;  4MJW A;  2JB1 A;  4CRT A;  1OJ9 A;  3P4P A;  2YR4 A;  4K22 A;  3NK1 X;  4AP3 A;  1RYI A;  1Q9I A;  3IHG A;  2B7S A;  4H2R A;  2YLT A;  4XWR A;  4H4R A;  3GYI A;  3DH9 A;  1NHQ A;  4BJY A;  1BKW A;  2B76 A;  1UKV G;  1GTH A;  1PJ7 A;  3UKH A;  5ER0 A;  3AE4 A;  4H2Q A;  4LA1 A;  4J34 A;  4JNA A;  2GRT A;  2X3N A;  3AE2 A;  3QJ4 A;  2BAB A;  2GEW A;  2IID A;  4A7A A;  5KWF A;  3CGB A;  4REK A;  2XFN A;  3P1W A;  1D4D A;  4XXG A;  4EMW A;  3AD9 B;  3CIR A;  3COX A;  2B9Y A;  4H4T A;  1NHS A;  1EL8 A;  5HYM A;  2V3B A;  4EQS A;  3BI5 A;  1F3P A;  2WES A;  3SFE A;  2B9W A;  4B65 A;  4B67 A;  2WOW A;  4YTM A;  1KNP A;  2XFU A;  1FOH A;  3CNT A;  3LZW A;  2Y6Q A;  2YLX A;  4K8D A;  4B64 A;  3SGL A;  4JY2 A;  4EQX A;  3ATQ A;  1K0L A;  2A87 A;  4FK1 A;  3B3R A;  4AT0 A;  4ZN0 A;  5JCM A;  1IUX A;  1ZMC A;  3AEB A;  4TLZ A;  2GMH A;  4GF7 A;  1GRT A;  3ITJ A;  3UKQ A;  4TM3 A;  3AD8 B;  3GDN A;  1GND A;  4Y4M A;  4A5L A;  3H8I A;  4NEV A;  2F5Z A;  4YSZ A;  4YSY A;  3CNJ A;  3VRD B;  2A89 A;  3B6D A;  1DNC A;  4NTC A;  3VR9 A;  5BVA A;  3Q9T A;  3NYF A;  1YQ3 A;  2V60 A;  3GWD A;  3I6D A;  1CC2 A;  1YQ4 A;  4J56 A;  3T37 A;  4DGK A;  1GRF A;  4Y4N A;  3UTG A;  3PO7 A;  4H4X A;  4AT2 A;  5JCL A;  2VQ7 A;  1Q1W A;  4O5Q A;  4A79 A;  1VQW A;  1H7X A;  1Z6L A;  2R0P A;  2RGH A;  3K7Q X;  4LII A;  3AE9 A;  2XVF A;  2BK5 A;  3LXD A;  3AYI A;  1FEC A;  5JCI A;  1Y56 B;  2O9Z A;  2WEU A;  2Q7V A;  4U2L A;  2GR3 A;  3RP8 A;  2ARD A;  3D1C A;  2C3C A;  2GR0 A;  4DNA A;  4H4Y A;  3UTE A;  4K7Z A;  1BWC A;  2GQF A;  4GCM A;  1F8R A;  1HYU A;  2C75 A;  1S3B A;  3PS9 A;  4CY8 A;  1NG3 A;  1REO A;  4USQ A;  3AEC A;  2JB3 A;  4U8K A;  3UP4 A;  2C66 A;  5C2T A;  5FS9 A;  3FBS A;  1PJ6 A;  4CBQ A;  3UOZ A;  4AOX A;  3DK9 A;  4A9W A;  3NLC A;  1N1P A;  2QA2 A;  3FIM B;  3ZYX A;  4U8J A;  1LPF A;  4NTE A;  3FG2 P;  2GV8 A;  1XDI A;  2R45 A;  1MOK A;  1S2Y A;  2NVK X;  1GRH A;  4BUR A;  4Z2T A;  3BNM A;  1DJQ A;  1Q1R A;  2Q0K A;  5U63 A;  2XVI A;  3UTH A;  3LOV A;  5FMH A;  1TDK A;  2ACZ A;  2BCG G;  1NHP A;  1YKJ A;  2V6O A;  4BK2 A;  3IHM A;  1FL2 A;  4EMJ A;  2FJE A;  3ALL A;  3QVR A;  4B66 A;  1LQU A;  2J3N A;  5IQ4 A;  1VRQ B;  1ZMD A;  3H8L A;  4M52 A;  3NTD A;  4C77 A;  3AYJ A;  2QCU A;  4K5R A;  2WU5 A;  1TYT A;  1GAL A;  3RP6 A;  2NPX A;  2BK3 A;  1BZL A;  5BRT A;  4I58 A;  2YLZ A;  1P2E A;  4D03 A;  4BV6 A;  1JRZ A;  3ATR A;  4PAB A;  1TDE A;  1JNR A;  2BC1 A;  3UKF A;  3O0H A;  2EQ6 A;  4UDP A;  4RG3 A;  2X8G A;  4C74 A;  4D04 A;  4WX1 A;  4EQW A;  1GSN A;  1AOG A;  5M10 A;  2W0H A;  3AE3 A;  2PYX A;  1CC4 A;  4YTN A;  2YG4 A;  1ZP0 A;  1H81 A;  2R0G A;  1VG0 A;  1NEK A;  5JCN A;  3P4S A;  2YG5 A;  3CN8 A;  1DOE A;  2VZ2 A;  3UKA A;  3GYJ A;  3GDP A;  4USR A;  1PBE A;  1N4W A;  2WP6 A;  2XLR A;  4LU6 A;  4EMI A;  2X8H A;  3AED A;  2CUL A;  3KPF A;  2BAC A;  3EF6 A;  3GRT A;  4H4Z A;  3AWI A;  2R0C A;  2YG3 A;  3DJE A;  4Z43 A;  3DA1 A;  1B37 A;  4NEW A;  1EL9 A;  2RAB A;  1X31 B;  2EQ8 A;  2GB0 A;  2VQB A;  1GRG A;  4H4W A;  5EB5 A;  2YR5 A;  2WP9 A;  2Y6R A;  5U1O A;  1CBO A;  1S2Q A;  3M12 A;  1IJH A;  2XVH A;  1KDG A;  1NEN A;  2PHH A;  3KD9 A;  3VQR A;  4YSH A;  2X8C A;  1RP0 A;  2DKI A;  4IA6 A;  1E1M A;  1NAA A;  1K0I A;  2WQY A;  3HZL A;  4H2N A;  3AE6 A;  2FBW A;  3CPH G;  4GR1 A;  2IVE A;  3VRA A;  3BNU A;  3NYE A;  4EM4 A;  4JDR A;  1IUV A;  4XWZ A;  1CC6 A;  2GR2 A;  2UZZ A;  2RGJ A;  3NGC X;  3M13 A;  2EQ9 A;  4BJZ A;  4YKG A;  3SQP A;  1ONF A;  1O94 A;  1NG4 A;  1PXA A;  2WPC A;  2XFQ A;  3GRS A;  4TM0 A;  4Z44 A;  5HY5 A;  4B63 A;  3D8X A;  1P2H A;  2CFY A;  4JY3 A;  4U8M A;  4X9M A;  3NNE A;  4TM4 A;  2XVE A;  2JAE A;  4B69 A;  4H7U A;  3L8K A;  1LTX R;  1H86 A;  1ZK7 A;  1PBF A;  3P4Q A;  3C4A A;  2QAE A;  1ZKQ A;  4EM3 A;  1TRB A;  2BXS A;  2Z5X A;  5KVH A;  1PDH A;  3NKS A;  1D7L A;  4RSL A;  3RNM A;  2C64 A;  3I3L A;  1GRE A;  4IVM B;  1GT8 A;  1QLB A;  1N4V A;  2YG6 A;  4IVO B;  2YAU A;  4U8P A;  2XLS A;  5KRQ A;  4OCG A;  4FX9 A;  3RP7 A;  1JNZ A;  4GRT A;  4Z24 A;  1H7W A;  2C70 A;  1D5T A;  3VR8 A;  4K2X A;  2FJD A;  2E4G A;  2WPF A;  3AEF A;  3F8P A;  5GSN A;  1KSU A;  4U2T A;  3ISH A;  3NH3 X;  3CND A;  3KKJ A;  4AOS A;  5EOW A;  1OJT A;  4C3Y A;  2B7R A;  1DOD A;  1H84 A;  4HB9 A;  3AYL A;  3FMW A;  4UP3 A;  3EAN A;  3SFD A;  3GMC A;  1E1L A;  3CPI G;  5HXI A;  4H4P A;  1KNR A;  1V59 A;  4A65 A;  3DJJ A;  3CPJ G;  4J31 A;  4OPT A;  2E1M A;  2YM1 A;  3JSK A;  4H4Q A;  2C67 A;  1CJC A;  1GXF A;  4OPG A;  4C5O A;  2C3D A;  3NK2 X;  3QSE A;  1M64 A;  4H4S A;  2R46 A;  1F6M A;  1E7P A;  1GEU A;  1JU2 A;  4H4V A;  3FPZ A;  2Q6U A;  2R9Z A;  2YVF A;  2WOI A;  3OC4 A;  3QFA A;  1GPE A;  2FJB A;  2WPE A;  1ZOV A;  2H89 A;  1LVL A;  4H2P A;  4KX6 A;  3CGE A;  4Y4L A;  4ICY A;  4ZCD A;  3P9U A;  3OZ2 A;  2WS3 A;  2BS4 A;  3BHF A;  3NRN A;  4IV9 A;  4NZH A;  1MXT A;  3DGH A;  3CNS A;  2GF3 A;  5CQF A;  2YLW A;  2AR8 A;  5KOW A;  2XLT A;  3QFB A;  4BK3 A;  4YXD A;  1OJA A;  2BK4 A;  1IUT A;  1IUS A;  1ELI A;  2C72 A;  2C65 A;  2OAM A;  4FDC B;  2WBA A;  1ZX9 A;  2YG7 A;  3IF9 A;  5JCK A;  4H50 A;  2BA9 A;  3AE7 A;  1LV0 A;  1PBD A;  2B9X A;  4NTD A;  4DSH A;  4J33 A;  1JOA A;  2I0Z A;  2AAQ A;  2JK6 A;  3CGC A;  3VRB A;  2YVJ A;  1E6E A;  2BYB A;  3NK0 X;  3IC9 A;  2IVD A;  2OAL A;  2VRL A;  1PJ5 A;  3P4R A;  1B8S A;  1D4C A;  1F8S A;  3URH A;  4A6N B;  2H88 A;  2E5V A;  1M6I A;  2XFP A;  1L0V A;  1FCD A;  2WHD A;  1CL0 A;  1QJD A;  2AQJ A;  2APG A;  3ALJ A;  1NHR A;  2R4J A;  2X50 A;  3AEA A;  3AE5 A;  1TYP A;  2GVC A;  3DME A;  5J60 A;  3SM8 A;  3LB8 A;  2ZZB A;  1CJ3 A;  1OJC A;  1K4Q A;  1B4V A;  5BUK A;  3LAD A;  3E1T A;  3G5S A;  3S61 A;  1KF6 A;  1H82 A;  4U8O A;  2C76 A;  1D4E A;  3ICS A;  3BI2 A;  3V76 A;  3UP5 A;  3DJG X;  3NN6 X;  2EQ7 A;  1K0J A;  3K7T A;  3F8R A;  2XYO A;  4JN9 A;  1Y56 A;  3NYC A;  4GDE A;  1ZOY A;  5L46 A;  1IUW A;  2Z5Y A;  1GER A;  5HHF A;  2V5Z A;  4BK1 A;  3L1R A;  4CCQ A;  1L9E A;  4CNK A;  4CY6 A;  3IWA A; 
#chains in the Genus database with same CATH topology
 3UOV A;  3AXB A;  1RSG A;  1LJ1 A;  1S3E A;  3ADA B;  2OLN A;  3UKL A;  3UOX A;  4CNJ A;  5KXJ A;  2YLS A;  1L9D A;  1PS9 A;  2WP5 A;  4YT0 A;  1JEH A;  3RED A;  4B68 A;  3G5Q A;  2VOU A;  2CDU A;  2GH5 A;  4U8L A;  5KOX A;  4PAA A;  2GMJ A;  1E39 A;  4FK1 C;  1L9C A;  3AE1 A;  5EBK A;  1YY5 A;  3M0O A;  1BGN A;  2WET A;  1BF3 A;  1N4U A;  3T2Y A;  2WDQ A;  3ICR A;  3ZDN A;  3V3O A;  2HQM A;  3NT6 A;  5GRT A;  2VVL A;  3CTY A;  4H4U A;  4ZCC A;  1CJ4 A;  4KPR A;  4TLX A;  3UKK A;  1EBD A;  1DJN A;  3C4N A;  2GAG B;  3DGZ A;  3ICT A;  3NTA A;  1GET A;  2JBV A;  3H4K A;  4U8N A;  3UKP A;  4ECH A;  1DOC A;  2V61 A;  2C4C A;  4Z2R A;  3V3N A;  4JQ9 A;  3RHA A;  3UOY A;  5C3J A;  1FEA A;  4U2S A;  1O95 A;  2XCG A;  4U8I A;  4OPU A;  3AEG A;  1NDA A;  2DKH A;  2C7G A;  3KPK A;  2TPR A;  4YKF A;  1D7Y A;  2TMD A;  1MO9 A;  3K30 A;  2ZBW A;  2VVL G;  4EIP A;  3K7M X;  3CNP A;  3NHO X;  4ADW A;  4A99 A;  1BGJ A;  1PBC A;  2RGO A;  4N9X A;  4EIQ A;  1GES A;  3CMM A;  1PN0 A;  1OJD A;  3II4 A;  1O5W A;  2OLO A;  4K5S A;  2C73 A;  2V3A A;  3G5R A;  3LZX A;  4OPD A;  4B1B A;  4HA6 A;  5LV9 A;  1YQZ A;  2XDO A;  2R4E A;  3UCL A;  4EQR A;  1LQT A;  4P9S A;  4A6N A;  2BCP A;  1KFY A;  2YVG A;  3F8D A;  4IA5 A;  2GR1 A;  2XLU A;  1ZY8 A;  1EL7 A;  5KMP A;  1COY A;  1CF3 A;  1PHH A;  2CVJ A;  3QSS A;  4X4J A;  5M0Z A;  1XPQ A;  3EPT A;  3KU9 A;  4E0V A;  3DK8 A;  4O5U A;  1PBB A;  3ALM A;  5KVI A;  1FEB A;  1W4X A;  1ZDL A;  5FS8 A;  5FS6 A;  1B5Q A;  4DSG A;  2YR6 A;  4Z2U A;  2WDR A;  5FS7 A;  5EB4 A;  4YWO A;  4J36 A;  2Q0L A;  1GV4 A;  4J2W A;  1KSS A;  4II3 A;  2YQU A;  1H6V A;  3Q6J A;  2WDV A;  1JRX A;  2GQW A;  3C96 A;  1PXB A;  3R9U A;  2BC0 A;  1GRB A;  1E1N A;  2A8X A;  3DJD A;  2YLR A;  2JKC A;  2YWL A;  4G74 A;  4JNQ A;  2GAH B;  3QSM A;  2JB2 A;  4UDQ A;  3LJP A;  3SZW A;  3NIX A;  3PVC A;  4YTP A;  1NPX A;  4CCR A;  1F8W A;  4Z26 A;  3GD4 A;  1GOS A;  4GAP A;  2YM2 A;  3GWF A;  1EL5 A;  2XVJ A;  3NG7 X;  4X9N A;  3NN0 X;  5IQ1 A;  1QO8 A;  3AB1 A;  2VVM A;  3BHK A;  1CJ2 A;  3UTF A;  4OPC A;  4GUV A;  2ZZ0 A;  1PXC A;  2QA1 A;  5J7X A;  2OA1 A;  5CKU A;  2ZZC A;  4OVI A;  1CHU A;  3WE0 A;  1TDN A;  5BUL A;  1SEZ A;  1H83 A;  4GDP A;  3CGD A;  5U25 A;  1IUU A;  2XFO A;  3DK4 A;  4TM1 A;  3AEE A;  4C3X A;  2FJA A;  3KVE A;  4RG4 A;  2BS2 A;  2XLP A;  5DBJ A;  4OPI A;  3AD7 B;  3S5W A;  4AP1 A;  1Y0P A;  4Z25 A;  4I59 A;  3ABV A;  2VRM A;  3KA7 A;  3EAO A;  2BS3 A;  4APN A;  1DXL A;  4OPL A;  4UDR A;  5TR3 A;  5IPY A;  3GSI A;  3AE8 A;  4II2 A;  2X99 A;  2WU2 A;  1E1K A;  1GTE A;  1XHC A;  3KLJ A;  2BXR A;  1GRA A;  4WCT A;  4YSX A;  1TDF A;  1TDO A;  1VG9 A;  1JRY A;  1XAN A;  3GD3 A;  4J57 A;  1VDC A;  2WOV A;  1DOB A;  3BI4 A;  3GMB A;  3QVP A;  3SXI A;  4MJW A;  2JB1 A;  4CRT A;  1OJ9 A;  3P4P A;  2YR4 A;  4K22 A;  3NK1 X;  4AP3 A;  1RYI A;  1Q9I A;  3IHG A;  2B7S A;  4H2R A;  2YLT A;  4XWR A;  4H4R A;  3GYI A;  3DH9 A;  1NHQ A;  4BJY A;  1BKW A;  2B76 A;  1UKV G;  1GTH A;  1PJ7 A;  3UKH A;  5ER0 A;  3AE4 A;  4H2Q A;  4LA1 A;  4J34 A;  4JNA A;  2GRT A;  2X3N A;  3AE2 A;  3QJ4 A;  2BAB A;  2GEW A;  2IID A;  4A7A A;  5KWF A;  3CGB A;  4REK A;  2XFN A;  3P1W A;  1D4D A;  4XXG A;  3T31 A;  4EMW A;  3AD9 B;  3CIR A;  3COX A;  2B9Y A;  4H4T A;  1NHS A;  1EL8 A;  5HYM A;  2V3B A;  4EQS A;  3BI5 A;  1F3P A;  4G73 A;  2WES A;  3SFE A;  2B9W A;  4B65 A;  4B67 A;  5KNL A;  2WOW A;  4YTM A;  1KNP A;  2XFU A;  1FOH A;  3CNT A;  3LZW A;  2Y6Q A;  2YLX A;  4K8D A;  4B64 A;  3SGL A;  4JY2 A;  4EQX A;  3ATQ A;  1K0L A;  2A87 A;  4FK1 A;  3B3R A;  4AT0 A;  4ZN0 A;  5JCM A;  3HYW A;  1IUX A;  1ZMC A;  3AEB A;  4TLZ A;  2GMH A;  3SX6 A;  4GF7 A;  1GRT A;  3ITJ A;  3UKQ A;  4TM3 A;  3AD8 B;  3GDN A;  1GND A;  4Y4M A;  4A5L A;  3H8I A;  4NEV A;  2F5Z A;  4YSZ A;  4YSY A;  3CNJ A;  3VRD B;  2A89 A;  3B6D A;  1DNC A;  4NTC A;  3VR9 A;  5BVA A;  3Q9T A;  3NYF A;  1YQ3 A;  2V60 A;  3GWD A;  3I6D A;  1CC2 A;  1YQ4 A;  3HYX A;  4J56 A;  3T37 A;  1GRF A;  4Y4N A;  4DGK A;  3UTG A;  2BRA A;  3PO7 A;  4H4X A;  4AT2 A;  5JCL A;  2VQ7 A;  1Q1W A;  4O5Q A;  4A79 A;  1VQW A;  1H7X A;  1Z6L A;  2R0P A;  2RGH A;  3K7Q X;  4LII A;  3AE9 A;  2XVF A;  2BK5 A;  3LXD A;  3AYI A;  1FEC A;  5JCI A;  1Y56 B;  2O9Z A;  2WEU A;  2Q7V A;  4U2L A;  2GR3 A;  3RP8 A;  2ARD A;  3D1C A;  2C3C A;  2GR0 A;  3SY4 A;  4DNA A;  4H4Y A;  3UTE A;  4K7Z A;  1BWC A;  2GQF A;  4GCM A;  1F8R A;  1HYU A;  2C75 A;  1S3B A;  3PS9 A;  3GYX A;  4CY8 A;  1NG3 A;  1REO A;  4USQ A;  3AEC A;  2JB3 A;  4U8K A;  3UP4 A;  3T14 A;  2C66 A;  5C2T A;  5FS9 A;  3FBS A;  1PJ6 A;  4CBQ A;  3UOZ A;  4AOX A;  3DK9 A;  4A9W A;  3NLC A;  1N1P A;  2QA2 A;  3FIM B;  5KMR A;  4G6G A;  3ZYX A;  4U8J A;  1LPF A;  4NTE A;  3FG2 P;  2GV8 A;  1XDI A;  2R45 A;  1MOK A;  1S2Y A;  2NVK X;  1GRH A;  3SZ0 A;  4BUR A;  3BNM A;  4Z2T A;  1DJQ A;  1Q1R A;  2Q0K A;  5U63 A;  5KMS A;  2XVI A;  3UTH A;  3LOV A;  5FMH A;  1TDK A;  2ACZ A;  2BCG G;  1NHP A;  4G6H A;  1YKJ A;  2V6O A;  4BK2 A;  3IHM A;  1FL2 A;  4EMJ A;  2FJE A;  3ALL A;  3QVR A;  4B66 A;  1LQU A;  2J3N A;  5IQ4 A;  1VRQ B;  1ZMD A;  3H8L A;  4M52 A;  3NTD A;  4C77 A;  3AYJ A;  2QCU A;  4K5R A;  2WU5 A;  1TYT A;  1GAL A;  3RP6 A;  2NPX A;  2BK3 A;  1BZL A;  5BRT A;  4I58 A;  2YLZ A;  1P2E A;  4D03 A;  4BV6 A;  1JRZ A;  3ATR A;  4PAB A;  1TDE A;  1JNR A;  2BC1 A;  3UKF A;  3O0H A;  2EQ6 A;  4UDP A;  4RG3 A;  2X8G A;  4C74 A;  4D04 A;  4WX1 A;  4EQW A;  1GSN A;  1AOG A;  5M10 A;  2W0H A;  3AE3 A;  2PYX A;  1CC4 A;  4YTN A;  2YG4 A;  1ZP0 A;  1H81 A;  2R0G A;  1VG0 A;  1NEK A;  5JCN A;  3P4S A;  2YG5 A;  3CN8 A;  1DOE A;  2VZ2 A;  3UKA A;  3GYJ A;  3GDP A;  4USR A;  1PBE A;  1N4W A;  2WP6 A;  2XLR A;  4LU6 A;  5KMQ A;  4EMI A;  2X8H A;  3AED A;  2CUL A;  3KPF A;  2BAC A;  3EF6 A;  3GRT A;  4H4Z A;  3AWI A;  2R0C A;  2YG3 A;  3DJE A;  4Z43 A;  3DA1 A;  1B37 A;  4NEW A;  1EL9 A;  2RAB A;  1X31 B;  2EQ8 A;  2GB0 A;  2VQB A;  1GRG A;  4H4W A;  5EB5 A;  2YR5 A;  2WP9 A;  2Y6R A;  5U1O A;  1CBO A;  1S2Q A;  3M12 A;  1IJH A;  2XVH A;  1KDG A;  1NEN A;  2PHH A;  3KD9 A;  3VQR A;  4YSH A;  2X8C A;  1RP0 A;  2DKI A;  4IA6 A;  1E1M A;  1NAA A;  1K0I A;  2WQY A;  3HZL A;  4H2N A;  3AE6 A;  2FBW A;  3CPH G;  4GR1 A;  2IVE A;  3VRA A;  3BNU A;  3NYE A;  4EM4 A;  4JDR A;  1IUV A;  4XWZ A;  1CC6 A;  2GR2 A;  2UZZ A;  2RGJ A;  3NGC X;  3M13 A;  2EQ9 A;  4BJZ A;  4YKG A;  3SQP A;  1ONF A;  1O94 A;  1NG4 A;  3SZC A;  1PXA A;  2WPC A;  2XFQ A;  3GRS A;  4TM0 A;  4Z44 A;  5HY5 A;  3T2K A;  4B63 A;  3D8X A;  1P2H A;  2CFY A;  4JY3 A;  4U8M A;  4X9M A;  3NNE A;  4TM4 A;  2XVE A;  2JAE A;  4B69 A;  4H7U A;  3L8K A;  1LTX R;  1H86 A;  1ZK7 A;  1PBF A;  3P4Q A;  3C4A A;  2QAE A;  1ZKQ A;  4EM3 A;  1TRB A;  2BXS A;  2Z5X A;  5KVH A;  1PDH A;  3NKS A;  1D7L A;  4RSL A;  3RNM A;  2C64 A;  3I3L A;  1GRE A;  4IVM B;  1GT8 A;  1QLB A;  1N4V A;  2YG6 A;  4IVO B;  2YAU A;  4U8P A;  2XLS A;  5KRQ A;  4OCG A;  4FX9 A;  3RP7 A;  1JNZ A;  4GAV A;  4GRT A;  1H7W A;  2C70 A;  1D5T A;  4Z24 A;  4K2X A;  3VR8 A;  2FJD A;  2E4G A;  2WPF A;  3AEF A;  3F8P A;  5GSN A;  1KSU A;  4U2T A;  3ISH A;  3SZF A;  3NH3 X;  3CND A;  3KKJ A;  4AOS A;  5EOW A;  1OJT A;  3SYI A;  4C3Y A;  2B7R A;  1DOD A;  1H84 A;  4HB9 A;  3AYL A;  3FMW A;  4UP3 A;  3EAN A;  3SFD A;  3GMC A;  1E1L A;  3CPI G;  5HXI A;  4H4P A;  1KNR A;  1V59 A;  4A65 A;  3DJJ A;  3CPJ G;  4J31 A;  4NNJ A;  4OPT A;  2E1M A;  2YM1 A;  3JSK A;  4H4Q A;  2C67 A;  1CJC A;  1GXF A;  4OPG A;  4C5O A;  2C3D A;  3NK2 X;  3QSE A;  1M64 A;  4H4S A;  2R46 A;  1F6M A;  1E7P A;  1GEU A;  1JU2 A;  3HYV A;  4H4V A;  3FPZ A;  2Q6U A;  2R9Z A;  2YVF A;  2WOI A;  3OC4 A;  3QFA A;  1GPE A;  2FJB A;  2WPE A;  1ZOV A;  2H89 A;  1LVL A;  4H2P A;  4KX6 A;  3CGE A;  4Y4L A;  4ICY A;  4ZCD A;  3P9U A;  3OZ2 A;  2WS3 A;  2BS4 A;  3BHF A;  3NRN A;  4IV9 A;  4NZH A;  1MXT A;  3DGH A;  3CNS A;  2GF3 A;  5CQF A;  2YLW A;  2AR8 A;  5KOW A;  2XLT A;  3QFB A;  4BK3 A;  4YXD A;  1OJA A;  2BK4 A;  1IUT A;  1IUS A;  1ELI A;  2C72 A;  2C65 A;  2OAM A;  4FDC B;  2WBA A;  1ZX9 A;  2YG7 A;  3IF9 A;  5JCK A;  4H50 A;  2BA9 A;  3AE7 A;  1LV0 A;  1PBD A;  2B9X A;  4NTD A;  4DSH A;  4J33 A;  1JOA A;  2I0Z A;  2AAQ A;  2JK6 A;  3CGC A;  3VRB A;  2YVJ A;  1E6E A;  2BYB A;  3NK0 X;  3IC9 A;  2IVD A;  2OAL A;  3T2Z A;  2VRL A;  1PJ5 A;  3P4R A;  1B8S A;  1D4C A;  1F8S A;  3URH A;  4A6N B;  2H88 A;  2E5V A;  1M6I A;  2XFP A;  1L0V A;  1FCD A;  2WHD A;  1CL0 A;  1QJD A;  2AQJ A;  2APG A;  3ALJ A;  1NHR A;  2R4J A;  2X50 A;  3AEA A;  3AE5 A;  1TYP A;  2GVC A;  3DME A;  5J60 A;  3SM8 A;  4G9K A;  4NWZ A;  3LB8 A;  2ZZB A;  1CJ3 A;  1OJC A;  1K4Q A;  1B4V A;  5BUK A;  3LAD A;  3E1T A;  3G5S A;  3S61 A;  1KF6 A;  1H82 A;  4U8O A;  2C76 A;  1D4E A;  3ICS A;  3BI2 A;  3V76 A;  3T0K A;  3UP5 A;  3DJG X;  3NN6 X;  2EQ7 A;  1K0J A;  3K7T A;  3F8R A;  2XYO A;  4JN9 A;  1Y56 A;  2BRY A;  3NYC A;  1ZOY A;  4GDE A;  5L46 A;  1IUW A;  2Z5Y A;  1GER A;  5HHF A;  2V5Z A;  4BK1 A;  3L1R A;  4CCQ A;  1L9E A;  4CNK A;  4CY6 A;  3IWA A; 
#chains in the Genus database with same CATH homology
 3UOV A;  3AXB A;  1RSG A;  1LJ1 A;  1S3E A;  3ADA B;  2OLN A;  3UKL A;  3UOX A;  4CNJ A;  5KXJ A;  2YLS A;  1L9D A;  1PS9 A;  2WP5 A;  4YT0 A;  1JEH A;  3RED A;  4B68 A;  3G5Q A;  2VOU A;  2CDU A;  2GH5 A;  4U8L A;  5KOX A;  4PAA A;  2GMJ A;  1E39 A;  4FK1 C;  1L9C A;  3AE1 A;  5EBK A;  1YY5 A;  3M0O A;  1BGN A;  2WET A;  1BF3 A;  1N4U A;  3T2Y A;  2WDQ A;  3ICR A;  3ZDN A;  3V3O A;  2HQM A;  3NT6 A;  5GRT A;  2VVL A;  3CTY A;  4H4U A;  4ZCC A;  1CJ4 A;  4KPR A;  4TLX A;  3UKK A;  1EBD A;  1DJN A;  3C4N A;  2GAG B;  3DGZ A;  3ICT A;  3NTA A;  1GET A;  2JBV A;  3H4K A;  4U8N A;  3UKP A;  4ECH A;  1DOC A;  2V61 A;  2C4C A;  4Z2R A;  3V3N A;  4JQ9 A;  3RHA A;  3UOY A;  5C3J A;  1FEA A;  4U2S A;  1O95 A;  2XCG A;  4U8I A;  4OPU A;  3AEG A;  1NDA A;  2DKH A;  2C7G A;  3KPK A;  2TPR A;  4YKF A;  1D7Y A;  2TMD A;  1MO9 A;  3K30 A;  2ZBW A;  2VVL G;  4EIP A;  3K7M X;  3CNP A;  3NHO X;  4ADW A;  4A99 A;  1BGJ A;  1PBC A;  2RGO A;  4N9X A;  4EIQ A;  1GES A;  3CMM A;  1PN0 A;  1OJD A;  3II4 A;  1O5W A;  2OLO A;  4K5S A;  2C73 A;  2V3A A;  3G5R A;  3LZX A;  4OPD A;  4B1B A;  4HA6 A;  5LV9 A;  1YQZ A;  2XDO A;  2R4E A;  3UCL A;  4EQR A;  1LQT A;  4P9S A;  4A6N A;  2BCP A;  1KFY A;  2YVG A;  3F8D A;  4IA5 A;  2GR1 A;  2XLU A;  1ZY8 A;  1EL7 A;  5KMP A;  1COY A;  1CF3 A;  1PHH A;  2CVJ A;  3QSS A;  4X4J A;  5M0Z A;  1XPQ A;  3EPT A;  3KU9 A;  4E0V A;  3DK8 A;  4O5U A;  1PBB A;  3ALM A;  5KVI A;  1FEB A;  1W4X A;  1ZDL A;  5FS8 A;  5FS6 A;  1B5Q A;  4DSG A;  2YR6 A;  4Z2U A;  2WDR A;  5FS7 A;  5EB4 A;  4YWO A;  4J36 A;  2Q0L A;  1GV4 A;  4J2W A;  1KSS A;  4II3 A;  2YQU A;  1H6V A;  3Q6J A;  2WDV A;  1JRX A;  2GQW A;  3C96 A;  1PXB A;  3R9U A;  2BC0 A;  1GRB A;  1E1N A;  2A8X A;  3DJD A;  2YLR A;  2JKC A;  2YWL A;  4G74 A;  4JNQ A;  2GAH B;  3QSM A;  2JB2 A;  4UDQ A;  3LJP A;  3SZW A;  3NIX A;  3PVC A;  4YTP A;  1NPX A;  4CCR A;  1F8W A;  4Z26 A;  3GD4 A;  1GOS A;  4GAP A;  2YM2 A;  3GWF A;  1EL5 A;  2XVJ A;  3NG7 X;  4X9N A;  3NN0 X;  5IQ1 A;  1QO8 A;  3AB1 A;  2VVM A;  3BHK A;  1CJ2 A;  3UTF A;  4OPC A;  4GUV A;  2ZZ0 A;  1PXC A;  2QA1 A;  5J7X A;  2OA1 A;  5CKU A;  2ZZC A;  4OVI A;  1CHU A;  3WE0 A;  1TDN A;  5BUL A;  1SEZ A;  1H83 A;  4GDP A;  3CGD A;  5U25 A;  1IUU A;  2XFO A;  3DK4 A;  4TM1 A;  3AEE A;  4C3X A;  2FJA A;  3KVE A;  4RG4 A;  2BS2 A;  2XLP A;  5DBJ A;  4OPI A;  3AD7 B;  3S5W A;  4AP1 A;  1Y0P A;  4Z25 A;  4I59 A;  3ABV A;  2VRM A;  3KA7 A;  3EAO A;  2BS3 A;  4APN A;  1DXL A;  4OPL A;  4UDR A;  5TR3 A;  5IPY A;  3GSI A;  3AE8 A;  4II2 A;  2X99 A;  2WU2 A;  1E1K A;  1GTE A;  1XHC A;  3KLJ A;  2BXR A;  1GRA A;  4WCT A;  4YSX A;  1TDF A;  1TDO A;  1VG9 A;  1JRY A;  1XAN A;  3GD3 A;  4J57 A;  1VDC A;  2WOV A;  1DOB A;  3BI4 A;  3GMB A;  3QVP A;  3SXI A;  4MJW A;  2JB1 A;  4CRT A;  1OJ9 A;  3P4P A;  2YR4 A;  4K22 A;  3NK1 X;  4AP3 A;  1RYI A;  1Q9I A;  3IHG A;  2B7S A;  4H2R A;  2YLT A;  4XWR A;  4H4R A;  3GYI A;  3DH9 A;  1NHQ A;  4BJY A;  1BKW A;  2B76 A;  1UKV G;  1GTH A;  1PJ7 A;  3UKH A;  5ER0 A;  3AE4 A;  4H2Q A;  4LA1 A;  4J34 A;  4JNA A;  2GRT A;  2X3N A;  3AE2 A;  3QJ4 A;  2BAB A;  2GEW A;  2IID A;  4A7A A;  5KWF A;  3CGB A;  4REK A;  2XFN A;  3P1W A;  1D4D A;  4XXG A;  3T31 A;  4EMW A;  3AD9 B;  3CIR A;  3COX A;  2B9Y A;  4H4T A;  1NHS A;  1EL8 A;  5HYM A;  2V3B A;  4EQS A;  3BI5 A;  1F3P A;  4G73 A;  2WES A;  3SFE A;  2B9W A;  4B65 A;  4B67 A;  5KNL A;  2WOW A;  4YTM A;  1KNP A;  2XFU A;  1FOH A;  3CNT A;  3LZW A;  2Y6Q A;  2YLX A;  4K8D A;  4B64 A;  3SGL A;  4JY2 A;  4EQX A;  3ATQ A;  1K0L A;  2A87 A;  4FK1 A;  3B3R A;  4AT0 A;  4ZN0 A;  5JCM A;  3HYW A;  1IUX A;  1ZMC A;  3AEB A;  4TLZ A;  2GMH A;  3SX6 A;  4GF7 A;  1GRT A;  3ITJ A;  3UKQ A;  4TM3 A;  3AD8 B;  3GDN A;  1GND A;  4Y4M A;  4A5L A;  3H8I A;  4NEV A;  2F5Z A;  4YSZ A;  4YSY A;  3CNJ A;  3VRD B;  2A89 A;  3B6D A;  1DNC A;  4NTC A;  3VR9 A;  5BVA A;  3Q9T A;  3NYF A;  1YQ3 A;  2V60 A;  3GWD A;  3I6D A;  1CC2 A;  1YQ4 A;  3HYX A;  4J56 A;  3T37 A;  1GRF A;  4Y4N A;  4DGK A;  3UTG A;  2BRA A;  3PO7 A;  4H4X A;  4AT2 A;  5JCL A;  2VQ7 A;  1Q1W A;  4O5Q A;  4A79 A;  1VQW A;  1H7X A;  1Z6L A;  2R0P A;  2RGH A;  3K7Q X;  4LII A;  3AE9 A;  2XVF A;  2BK5 A;  3LXD A;  3AYI A;  1FEC A;  5JCI A;  1Y56 B;  2O9Z A;  2WEU A;  2Q7V A;  4U2L A;  2GR3 A;  3RP8 A;  2ARD A;  3D1C A;  2C3C A;  2GR0 A;  3SY4 A;  4DNA A;  4H4Y A;  3UTE A;  4K7Z A;  1BWC A;  2GQF A;  4GCM A;  1F8R A;  1HYU A;  2C75 A;  1S3B A;  3PS9 A;  3GYX A;  4CY8 A;  1NG3 A;  1REO A;  4USQ A;  3AEC A;  2JB3 A;  4U8K A;  3UP4 A;  3T14 A;  2C66 A;  5C2T A;  5FS9 A;  3FBS A;  1PJ6 A;  4CBQ A;  3UOZ A;  4AOX A;  3DK9 A;  4A9W A;  3NLC A;  1N1P A;  2QA2 A;  3FIM B;  5KMR A;  4G6G A;  3ZYX A;  4U8J A;  1LPF A;  4NTE A;  3FG2 P;  2GV8 A;  1XDI A;  2R45 A;  1MOK A;  1S2Y A;  2NVK X;  1GRH A;  3SZ0 A;  4BUR A;  3BNM A;  4Z2T A;  1DJQ A;  1Q1R A;  2Q0K A;  5U63 A;  5KMS A;  2XVI A;  3UTH A;  3LOV A;  5FMH A;  1TDK A;  2ACZ A;  2BCG G;  1NHP A;  4G6H A;  1YKJ A;  2V6O A;  4BK2 A;  3IHM A;  1FL2 A;  4EMJ A;  2FJE A;  3ALL A;  3QVR A;  4B66 A;  1LQU A;  2J3N A;  5IQ4 A;  1VRQ B;  1ZMD A;  3H8L A;  4M52 A;  3NTD A;  4C77 A;  3AYJ A;  2QCU A;  4K5R A;  2WU5 A;  1TYT A;  1GAL A;  3RP6 A;  2NPX A;  2BK3 A;  1BZL A;  5BRT A;  4I58 A;  2YLZ A;  1P2E A;  4D03 A;  4BV6 A;  1JRZ A;  3ATR A;  4PAB A;  1TDE A;  1JNR A;  2BC1 A;  3UKF A;  3O0H A;  2EQ6 A;  4UDP A;  4RG3 A;  2X8G A;  4C74 A;  4D04 A;  4WX1 A;  4EQW A;  1GSN A;  1AOG A;  5M10 A;  2W0H A;  3AE3 A;  2PYX A;  1CC4 A;  4YTN A;  2YG4 A;  1ZP0 A;  1H81 A;  2R0G A;  1VG0 A;  1NEK A;  5JCN A;  3P4S A;  2YG5 A;  3CN8 A;  1DOE A;  2VZ2 A;  3UKA A;  3GYJ A;  3GDP A;  4USR A;  1PBE A;  1N4W A;  2WP6 A;  2XLR A;  4LU6 A;  5KMQ A;  4EMI A;  2X8H A;  3AED A;  2CUL A;  3KPF A;  2BAC A;  3EF6 A;  3GRT A;  4H4Z A;  3AWI A;  2R0C A;  2YG3 A;  3DJE A;  4Z43 A;  3DA1 A;  1B37 A;  4NEW A;  1EL9 A;  2RAB A;  1X31 B;  2EQ8 A;  2GB0 A;  2VQB A;  1GRG A;  4H4W A;  5EB5 A;  2YR5 A;  2WP9 A;  2Y6R A;  5U1O A;  1CBO A;  1S2Q A;  3M12 A;  1IJH A;  2XVH A;  1KDG A;  1NEN A;  2PHH A;  3KD9 A;  3VQR A;  4YSH A;  2X8C A;  1RP0 A;  2DKI A;  4IA6 A;  1E1M A;  1NAA A;  1K0I A;  2WQY A;  3HZL A;  4H2N A;  3AE6 A;  2FBW A;  3CPH G;  4GR1 A;  2IVE A;  3VRA A;  3BNU A;  3NYE A;  4EM4 A;  4JDR A;  1IUV A;  4XWZ A;  1CC6 A;  2GR2 A;  2UZZ A;  2RGJ A;  3NGC X;  3M13 A;  2EQ9 A;  4BJZ A;  4YKG A;  3SQP A;  1ONF A;  1O94 A;  1NG4 A;  3SZC A;  1PXA A;  2WPC A;  2XFQ A;  3GRS A;  4TM0 A;  4Z44 A;  5HY5 A;  3T2K A;  4B63 A;  3D8X A;  1P2H A;  2CFY A;  4JY3 A;  4U8M A;  4X9M A;  3NNE A;  4TM4 A;  2XVE A;  2JAE A;  4B69 A;  4H7U A;  3L8K A;  1LTX R;  1H86 A;  1ZK7 A;  1PBF A;  3P4Q A;  3C4A A;  2QAE A;  1ZKQ A;  4EM3 A;  1TRB A;  2BXS A;  2Z5X A;  5KVH A;  1PDH A;  3NKS A;  1D7L A;  4RSL A;  3RNM A;  2C64 A;  3I3L A;  1GRE A;  4IVM B;  1GT8 A;  1QLB A;  1N4V A;  2YG6 A;  4IVO B;  2YAU A;  4U8P A;  2XLS A;  5KRQ A;  4OCG A;  4FX9 A;  3RP7 A;  1JNZ A;  4GAV A;  4GRT A;  1H7W A;  2C70 A;  1D5T A;  4Z24 A;  4K2X A;  3VR8 A;  2FJD A;  2E4G A;  2WPF A;  3AEF A;  3F8P A;  5GSN A;  1KSU A;  4U2T A;  3ISH A;  3SZF A;  3NH3 X;  3CND A;  3KKJ A;  4AOS A;  5EOW A;  1OJT A;  3SYI A;  4C3Y A;  2B7R A;  1DOD A;  1H84 A;  4HB9 A;  3AYL A;  3FMW A;  4UP3 A;  3EAN A;  3SFD A;  3GMC A;  1E1L A;  3CPI G;  5HXI A;  4H4P A;  1KNR A;  1V59 A;  4A65 A;  3DJJ A;  3CPJ G;  4J31 A;  4NNJ A;  4OPT A;  2E1M A;  2YM1 A;  3JSK A;  4H4Q A;  2C67 A;  1CJC A;  1GXF A;  4OPG A;  4C5O A;  2C3D A;  3NK2 X;  3QSE A;  1M64 A;  4H4S A;  2R46 A;  1F6M A;  1E7P A;  1GEU A;  1JU2 A;  3HYV A;  4H4V A;  3FPZ A;  2Q6U A;  2R9Z A;  2YVF A;  2WOI A;  3OC4 A;  3QFA A;  1GPE A;  2FJB A;  2WPE A;  1ZOV A;  2H89 A;  1LVL A;  4H2P A;  4KX6 A;  3CGE A;  4Y4L A;  4ICY A;  4ZCD A;  3P9U A;  3OZ2 A;  2WS3 A;  2BS4 A;  3BHF A;  3NRN A;  4IV9 A;  4NZH A;  1MXT A;  3DGH A;  3CNS A;  2GF3 A;  5CQF A;  2YLW A;  2AR8 A;  5KOW A;  2XLT A;  3QFB A;  4BK3 A;  4YXD A;  1OJA A;  2BK4 A;  1IUT A;  1IUS A;  1ELI A;  2C72 A;  2C65 A;  2OAM A;  4FDC B;  2WBA A;  1ZX9 A;  2YG7 A;  3IF9 A;  5JCK A;  4H50 A;  2BA9 A;  3AE7 A;  1LV0 A;  1PBD A;  2B9X A;  4NTD A;  4DSH A;  4J33 A;  1JOA A;  2I0Z A;  2AAQ A;  2JK6 A;  3CGC A;  3VRB A;  2YVJ A;  1E6E A;  2BYB A;  3NK0 X;  3IC9 A;  2IVD A;  2OAL A;  3T2Z A;  2VRL A;  1PJ5 A;  3P4R A;  1B8S A;  1D4C A;  1F8S A;  3URH A;  4A6N B;  2H88 A;  2E5V A;  1M6I A;  2XFP A;  1L0V A;  1FCD A;  2WHD A;  1CL0 A;  1QJD A;  2AQJ A;  2APG A;  3ALJ A;  1NHR A;  2R4J A;  2X50 A;  3AEA A;  3AE5 A;  1TYP A;  2GVC A;  3DME A;  5J60 A;  3SM8 A;  4G9K A;  4NWZ A;  3LB8 A;  2ZZB A;  1CJ3 A;  1OJC A;  1K4Q A;  1B4V A;  5BUK A;  3LAD A;  3E1T A;  3G5S A;  3S61 A;  1KF6 A;  1H82 A;  4U8O A;  2C76 A;  1D4E A;  3ICS A;  3BI2 A;  3V76 A;  3T0K A;  3UP5 A;  3DJG X;  3NN6 X;  2EQ7 A;  1K0J A;  3K7T A;  3F8R A;  2XYO A;  4JN9 A;  1Y56 A;  2BRY A;  3NYC A;  1ZOY A;  4GDE A;  5L46 A;  1IUW A;  2Z5Y A;  1GER A;  5HHF A;  2V5Z A;  4BK1 A;  3L1R A;  4CCQ A;  1L9E A;  4CNK A;  4CY6 A;  3IWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...