4DGKA

Crystal structure of phytoene desaturase crti from pantoea ananatis
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
492
structure length
405
Chain Sequence
MKPTTVIGAGFGGLALAIRLQAAGIPVLLLEQRYVYEDQGFTFDAGPTVITDPSAIEELFALAGKQLKEYVELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLGTVPFLSFRDMLRAAPQLAKLQAWRSVYSKVASYIEDEHLRQAFSFHSLLVGGNPTSSIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVLNARVSHMETTGNKIEAVHLEDGRRFLTQAVASNADSNSLFVLYFGLNHHHDQLAHHTVCFGPRLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPHLGTANLDWTVEGPKLRDRIFAYLEQHYMPGLRSQLVTHRMFTPFDFRTITNLYLVGAGIPGVIGSAKATAGLMLEDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title On the structure and function of the phytoene desaturase CRTI from Pantoea ananatis, a membrane-peripheral and FAD-dependent oxidase/isomerase.
pubmed doi rcsb
source organism Pantoea ananatis
molecule tags Oxidoreductase
molecule keywords Phytoene dehydrogenase
total genus 130
structure length 405
sequence length 492
ec nomenclature ec 1.3.99.31: Phytoene desaturase (lycopene-forming).
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dgkA01
3LJPA 1GTEA 2X8GA 4YT0A 2OALA 3CGCA 1B37A 1F6MA 4REKA 1ZMDA 3NYEA 3P9UA 1EL8A 1VG9A 4YKFA 2XFQA 1PDHA 3AEDA 4EIPA 2BK4A 1S3BA 3UKAA 2XVFA 1S3EA 4YSHA 1FCDA 2GB0A 4UP3A 4EMJA 4BJZA 5C3JA 5ER0A 3ALMA 1OJCA 2XVHA 3C4AA 4A5LA 4U2SA 3NN0X 5KWFA 1TYPA 1KNRA 1H82A 1SEZA 2JB3A 3NHOX 3GRTA 1LTXR 4EQSA 3GYIA 2JB2A 1O95A 5BVAA 1DNCA 1RYIA 2BCGG 4GF7A 1DODA 2VRLA 4HB9A 2V61A 2V3AA 4TLXA 4B66A 2YAUA 3DK4A 1EL5A 4CBQA 2X99A 1TDEA 3GMBA 1XPQA 4NEVA 2ZZCA 1PHHA 1XDIA 1E6EA 1VG0A 2Y6RA 4OPIA 4NTEA 3FIMB 2GAGB 2WETA 1M64A 2R0GA 1K0JA 3AXBA 3CNJA 2C3DA 3G5RA 2YLWA 2R46A 1GNDA 3NIXA 4YKGA 2B7RA 3AEEA 4H7UA 4YTNA 1GOSA 2C64A 3H4KA 4OPTA 4A6NB 2GVCA 3PO7A 3QSSA 2FJDA 3K7QX 4XXGA 1GESA 3KA7A 1E1MA 2WP9A 4AOSA 2VQBA 1L9DA 1JEHA 3EAOA 1JRXA 2YLXA 2C72A 2GF3A 3AYLA 3GWFA 4J31A 4J57A 5FS9A 4C3YA 1FEAA 1M6IA 1RSGA 1MO9A 3COXA 4BURA 4FDCB 3H8LA 2XLSA 4OPCA 3D1CA 5LV9A 3BNMA 2OAMA 5JCKA 2GQWA 1VQWA 1BGJA 1GRHA 1Q9IA 2ZBWA 4K22A 1ZOYA 3CNTA 2CDUA 3CGBA 4TM3A 5IQ1A 1ELIA 1H6VA 2VOUA 4ZCDA 4B68A 5KOXA 1LVLA 2Y6QA 2B9WA 3GYJA 3NN6X 4GDEA 2GRTA 3C4NA 3F8DA 4FK1C 2IVDA 4EQRA 2XFOA 3ATQA 2JBVA 4ECHA 1E1NA 3AWIA 2C75A 2XVJA 2I0ZA 3FMWA 2Z5XA 3AE7A 1DOBA 1TDFA 4U8LA 4ZCCA 2E4GA 2Q0KA 1TDNA 2WOIA 3CIRA 4H4WA 4K5SA 1JU2A 2BYBA 1GRBA 4B63A 4JNAA 2JK6A 2C76A 2XLPA 1E39A 2F5ZA 3NTAA 2NVKX 4J34A 4AT2A 4H4UA 1KF6A 2GH5A 2XVEA 3GRSA 2A8XA 2C3CA 4Z43A 1N4UA 2WOVA 2XLTA 3M12A 1EL7A 1NENA 1NEKA 2FJBA 2H88A 1E1LA 3SFEA 2YLTA 4H4TA 3O0HA 2XCGA 2R0PA 4LU6A 1UKVG 2WEUA 2IIDA 1E1KA 3KPFA 4A9WA 1H83A 2GR0A 3V3NA 4Z24A 1DOCA 1Y0PA 2QAEA 4K8DA 3CPIG 4LA1A 1PBBA 1PBFA 1OJ9A 1XANA 3DK9A 1CC6A 2YM2A 3DK8A 4WX1A 1LQTA 1N1PA 1N4VA 3DJEA 4IVMB 1CC2A 4P9SA 2RGJA 4CRTA 3UKQA 3UP4A 1CJ4A 3AEBA 3LZXA 3NK2X 2XFPA 4K2XA 2Q6UA 3F8RA 4USRA 4IA6A 1FOHA 4K7ZA 1BGNA 2X50A 3BI5A 3CGDA 2YR5A 3KD9A 4A7AA 1NPXA 2VVLG 2X8HA 3VRBA 3I6DA 4JNQA 1PBCA 2R0CA 1B8SA 2WHDA 2XFNA 3NNEA 2BC1A 5TR3A 2RABA 3WE0A 3PVCA 4PAAA 4B1BA 1PN0A 3AD8B 4XWRA 4EMIA 1L9EA 4YSZA 1MXTA 2BACA 4IV9A 2BS4A 3IF9A 4H4SA 4UDPA 3AE2A 1DJNA 3QFBA 4N9XA 4B67A 3AEGA 3FG2P 4H4ZA 2B9XA 1N4WA 4K5RA 4U2TA 4U8PA 5KRQA 3OC4A 3P1WA 4NTDA 3ZDNA 3DGHA 1NHSA 2BA9A 1K0IA 2QA2A 2B9YA 4U2LA 4BK2A 1NG4A 3LXDA 4D04A 5CKUA 2ZZ0A 2C66A 2C7GA 3Q6JA 3SM8A 3UTHA 5J60A 1OJAA 4NTCA 3SFDA 5BRTA 3CNDA 1COYA 1GPEA 3DMEA 2B76A 4PABA 3NTDA 1EBDA 2GV8A 4O5QA 2EQ8A 3GDNA 2PHHA 3II4A 3CNSA 5DBJA 4H2PA 4U8OA 3UCLA 1NDAA 2Z5YA 1GEUA 3K7TA 3M0OA 2WP5A 3QSEA 2JKCA 4EMWA 1F8RA 1YKJA 3JSKA 4NEWA 3UOXA 3BHKA 5U1OA 3R9UA 3AB1A 2WPCA 1CJCA 4H4VA 4A65A 3VR8A 3UKFA 5HXIA 2TMDA 1CJ2A 1GTHA 4Y4MA 4DGKA 4ZN0A 4EQXA 3H8IA 2V6OA 3OZ2A 1D4EA 1ZDLA 4A6NA 3UOVA 2R9ZA 3P4RA 4H50A 3DA1A 5HY5A 3AECA 1Q1RA 3NG7X 4OPGA 2VRMA 2WP6A 4BV6A 2R45A 3BI2A 2RGHA 2WPFA 1GV4A 3V3OA 2BC0A 4RSLA 4APNA 1BWCA 1D4CA 3L8KA 1PS9A 3UP5A 1D4DA 2WDQA 3K7MX 4H4PA 2BS3A 1NHPA 2JAEA 1IUVA 5FS7A 4A99A 1YQ4A 1IJHA 3S5WA 1GERA 3DH9A 3CGEA 5BUKA 2Q7VA 1H86A 1LQUA 3D8XA 3IHGA 3ISHA 5EBKA 1LJ1A 2YG6A 1KFYA 1NG3A 2GAHB 1OJTA 2A87A 2Q0LA 3FPZA 4H4XA 1GRAA 4CCRA 5JCNA 3GSIA 5KOWA 2ZZBA 2GQFA 3DJJA 4OPUA 1YQZA 3NYCA 4TM0A 2AAQA 4C5OA 5FS8A 3AYJA 4JN9A 3LADA 5EOWA 1GRTA 3AEFA 3P4PA 1LV0A 2WBAA 5KVHA 2EQ6A 3ADAB 4RG3A 3EANA 3REDA 3KKJA 2BABA 2BXSA 1DXLA 4TM4A 2YVGA 1H81A 3ABVA 1B5QA 2YG4A 3KU9A 4AP1A 4H2RA 4Z2UA 3SGLA 1JOAA 4U8NA 2BCPA 3AE9A 4Y4LA 3CN8A 1D7LA 1FEBA 4O5UA 5EB4A 3HZLA 2XLRA 3EPTA 2GR3A 1ZY8A 1F8WA 4XWZA 4ADWA 4IVOB 3K30A 4J33A 3QJ4A 3UOYA 3ZYXA 3AYIA 3VQRA 4EM3A 1GETA 1LPFA 3KVEA 1V59A 3BNUA 4YXDA 5M10A 2B7SA 2YQUA 1IUUA 1DJQA 4ICYA 3UKLA 2E1MA 4GRTA 3FBSA 4OPDA 2GMHA 4H2QA 1X31B 3UTEA 3G5QA 3ICTA 2CULA 4CNKA 4Z25A 1AOGA 1L9CA 1D5TA 2VVLA 5U25A 2FJEA 2WDRA 2WU5A 4X9NA 1K4QA 1TRBA 3AE1A 1PJ5A 4JDRA 1ONFA 4KX6A 2JB1A 3E1TA 1ZX9A 3UTFA 3IWAA 1PJ7A 2YLSA 5J7XA 5U63A 1TDOA 4X9MA 1IUSA 1H84A 1ZMCA 2WS3A 2YM1A 1CL0A 3UKPA 3VR9A 3RP8A 3AE6A 2OLNA 1Y56A 5GSNA 1L0VA 3Q9TA 2CFYA 3RP7A 1JRYA 1KSSA 1PBDA 2YLRA 3LOVA 3SQPA 2OLOA 1H7WA 2C73A 4H4QA 4YWOA 2V60A 3LB8A 3CPHG 5IQ4A 3G5SA 1EL9A 1FL2A 2UZZA 2WQYA 4Y4NA 1B4VA 4YSXA 2XVIA 2YLZA 4J2WA 4Z2TA 3DJDA 2PYXA 2XFUA 5HYMA 3EF6A 3NYFA 2VVMA 2BK5A 4Z44A 1IUWA 3ALLA 3BI4A 1IUTA 2XLUA 4OCGA 4CY6A 3NRNA 4YTMA 2A89A 1JNZA 1P2EA 2VZ2A 2YG5A 3UTGA 1Z6LA 5CQFA 1F8SA 1QLBA 1YQ3A 4H4YA 2OA1A 3QVPA 3IC9A 4DSGA 3ATRA 2RGOA 4EIQA 3GD4A 1YY5A 2NPXA 3ALJA 4LIIA 1IUXA 1NHQA 1JRZA 2BK3A 3B3RA 4U8MA 4I59A 3AE8A 1O94A 3I3LA 4U8IA 1GT8A 2BXRA 3NK0X 4DNAA 2VQ7A 2APGA 2YG7A 3NK1X 3QSMA 3UKHA 4DSHA 4Z26A 4WCTA 1CHUA 3GDPA 3RHAA 2GEWA 4CY8A 2BS2A 4C77A 3QFAA 5JCLA 2R4JA 1BKWA 2X3NA 5FMHA 3NH3X 4J56A 3P4QA 2R4EA 4FK1A 4GCMA 1GSNA 2GR1A 3GMCA 4E0VA 5KXJA 1K0LA 2WESA 4NZHA 4AT0A 5FS6A 3AE3A 2YR4A 4BK1A 3NT6A 3RP6A 2W0HA 3NLCA 4CCQA 3VRAA 1CC4A 1MOKA 4D03A 4U8KA 5EB5A 1DOEA 1TDKA 3QVRA 2O9ZA 3URHA 2WDVA 1PXBA 4YTPA 2GMJA 4GDPA 1XHCA 5C2TA 4GUVA 1QJDA 4H4RA 1P2HA 1S2QA 3IHMA 2DKIA 2AR8A 1CBOA 3C96A 3ICSA 1PXAA 4USQA 5M0ZA 4IA5A 2FBWA 3GD3A 4H2NA 4B64A 3AE4A 1ZP0A 3AE5A 2E5VA 2TPRA 3AD7B 3PS9A 1BF3A 1JNRA 1KNPA 1KDGA 1ZOVA 1GRGA 1RP0A 3VRDB 3UKKA 2ARDA 5L46A 4J36A 1TYTA 1NHRA 2EQ9A 3LZWA 3NGCX 4BJYA 4FX9A 4YSYA 2WU2A 5JCMA 1VRQB 3ITJA 1QO8A 4TLZA 4MJWA 1ZK7A 2HQMA 3T37A 1D7YA 2YVJA 4AOXA 1HYUA 5GRTA 3CPJG 3ICRA 4C74A 4EQWA 1Q1WA 4TM1A 1FECA 3V76A 4A79A 4GR1A 2FJAA 4Z2RA 1H7XA 1BZLA 1GRFA 2YVFA 3F8PA 2YR6A 3S61A 4C3XA 3GWDA 1CF3A 3CTYA 1O5WA 2H89A 3M13A 3DJGX 1ZKQA 1GALA 2X8CA 4OVIA 5KVIA 3P4SA 3RNMA 2J3NA 1VDCA 2WOWA 2AQJA 2QCUA 1GREA 4AP3A 2C70A 3NKSA 2YWLA 2CVJA 5IPYA 4UDQA 4UDRA 3UOZA 2XDOA 4I58A 2V5ZA 1OJDA 2XYOA 4KPRA 5JCIA 4RG4A 1CJ3A 5HHFA 2ACZA 4CNJA 3KLJA 4U8JA 3AD9B 1PBEA 3B6DA 2C67A 2EQ7A 4HA6A 2GR2A 2WPEA 2V3BA 4BK3A 3L1RA 4JQ9A 1REOA 4EM4A 1S2YA 5BULA 4M52A 4OPLA 4B65A 3BHFA 3AEAA 4B69A 1PJ6A 2YG3A 4JY3A 1GXFA 4JY2A 2IVEA 1Y56B 1W4XA 1NAAA 1PXCA 2C65A 4X4JA 1E7PA 3DGZA 1F3PA 1KSUA 2QA1A 2DKHA 3CNPA
chains in the Genus database with same CATH superfamily
3LJPA 1GTEA 2X8GA 4YT0A 2OALA 3CGCA 1B37A 1F6MA 4REKA 1ZMDA 3NYEA 3P9UA 5KMSA 1EL8A 1VG9A 4YKFA 2XFQA 1PDHA 3AEDA 4EIPA 2BK4A 1S3BA 3UKAA 5KNLA 2XVFA 1S3EA 4YSHA 1FCDA 2GB0A 4UP3A 4EMJA 4BJZA 5C3JA 5ER0A 3ALMA 1OJCA 2XVHA 3C4AA 4A5LA 4U2SA 3NN0X 5KWFA 1TYPA 1KNRA 1H82A 1SEZA 2JB3A 3NHOX 3GRTA 1LTXR 4EQSA 3GYIA 3HYXA 2JB2A 1O95A 5BVAA 1DNCA 1RYIA 2BCGG 4GF7A 1DODA 2VRLA 4HB9A 2V61A 2V3AA 4TLXA 4B66A 2YAUA 3DK4A 1EL5A 4CBQA 2X99A 1TDEA 3GMBA 1XPQA 4NEVA 2ZZCA 1PHHA 1XDIA 1E6EA 1VG0A 2Y6RA 4OPIA 4NTEA 3FIMB 2GAGB 2WETA 1M64A 2R0GA 1K0JA 3AXBA 3CNJA 2C3DA 3G5RA 2YLWA 2R46A 1GNDA 3NIXA 4YKGA 2B7RA 3AEEA 3T2KA 4H7UA 4YTNA 1GOSA 2C64A 3H4KA 4OPTA 4A6NB 2GVCA 3PO7A 3QSSA 2FJDA 3K7QX 4XXGA 1GESA 3KA7A 1E1MA 2WP9A 4AOSA 2VQBA 1L9DA 1JEHA 3EAOA 1JRXA 2YLXA 2C72A 2GF3A 3AYLA 3GWFA 4J31A 4J57A 5FS9A 4C3YA 1FEAA 1M6IA 1RSGA 1MO9A 3COXA 4BURA 4FDCB 3H8LA 2XLSA 4OPCA 3D1CA 5LV9A 3BNMA 2OAMA 5JCKA 2GQWA 1VQWA 1BGJA 1GRHA 1Q9IA 2ZBWA 4K22A 1ZOYA 3CNTA 2CDUA 3CGBA 4TM3A 5IQ1A 1ELIA 1H6VA 2VOUA 4ZCDA 4B68A 5KOXA 1LVLA 2Y6QA 2B9WA 3GYJA 3NN6X 4GDEA 2GRTA 3C4NA 3F8DA 4FK1C 2IVDA 4EQRA 4G73A 2XFOA 3ATQA 2JBVA 4ECHA 1E1NA 3AWIA 2C75A 2XVJA 2I0ZA 3FMWA 2Z5XA 3AE7A 1DOBA 1TDFA 4U8LA 4ZCCA 2E4GA 2Q0KA 1TDNA 2WOIA 3CIRA 4H4WA 4K5SA 1JU2A 2BYBA 1GRBA 4B63A 4JNAA 2JK6A 2C76A 2XLPA 1E39A 2F5ZA 3NTAA 2NVKX 4J34A 4AT2A 4H4UA 1KF6A 2GH5A 2XVEA 3GRSA 2A8XA 2C3CA 4Z43A 1N4UA 2WOVA 2XLTA 3M12A 1EL7A 1NENA 1NEKA 2FJBA 3SYIA 2H88A 1E1LA 3SFEA 2YLTA 4H4TA 3O0HA 2XCGA 2R0PA 4LU6A 1UKVG 2WEUA 2IIDA 1E1KA 3KPFA 4A9WA 1H83A 2GR0A 5KMRA 4GAPA 3V3NA 4Z24A 1DOCA 1Y0PA 2QAEA 4K8DA 3CPIG 4LA1A 1PBBA 1PBFA 1OJ9A 1XANA 3DK9A 1CC6A 2YM2A 3DK8A 4WX1A 1LQTA 1N1PA 1N4VA 3DJEA 4IVMB 1CC2A 4P9SA 2RGJA 3T2YA 4CRTA 3UKQA 3UP4A 1CJ4A 3AEBA 3LZXA 3NK2X 2XFPA 4G6GA 4G6HA 2Q6UA 3F8RA 4K2XA 4USRA 4IA6A 1FOHA 4K7ZA 1BGNA 2X50A 3BI5A 3CGDA 2YR5A 3KD9A 4A7AA 1NPXA 2VVLG 2X8HA 3VRBA 3I6DA 4JNQA 1PBCA 2R0CA 1B8SA 2WHDA 2XFNA 3NNEA 2BC1A 5TR3A 2RABA 3SZ0A 3PVCA 4PAAA 3WE0A 4B1BA 1PN0A 3AD8B 4XWRA 4EMIA 1L9EA 4YSZA 1MXTA 2BACA 4IV9A 2BS4A 3IF9A 4H4SA 4UDPA 3AE2A 1DJNA 3QFBA 4II2A 4N9XA 4B67A 3AEGA 3FG2P 4H4ZA 2B9XA 1N4WA 4K5RA 4U2TA 4U8PA 3SZFA 5KRQA 3OC4A 3P1WA 4NTDA 3ZDNA 3DGHA 1NHSA 2BA9A 1K0IA 2QA2A 2B9YA 4U2LA 4BK2A 1NG4A 3LXDA 4D04A 5CKUA 2ZZ0A 2C66A 2C7GA 3Q6JA 3SM8A 3UTHA 5J60A 1OJAA 4NTCA 3SFDA 5BRTA 3CNDA 1COYA 1GPEA 3DMEA 2B76A 4PABA 3NTDA 3T2ZA 1EBDA 2GV8A 4O5QA 2EQ8A 3GDNA 2PHHA 3II4A 3CNSA 3KPKA 5DBJA 4H2PA 4U8OA 3GYXA 3UCLA 1NDAA 2Z5YA 1GEUA 3K7TA 3M0OA 2WP5A 3QSEA 2JKCA 4EMWA 1F8RA 1YKJA 3JSKA 4NEWA 3UOXA 3BHKA 5U1OA 3R9UA 3AB1A 2WPCA 1CJCA 4H4VA 4A65A 3VR8A 3UKFA 5HXIA 2TMDA 1CJ2A 1GTHA 4Y4MA 4DGKA 4ZN0A 4EQXA 3H8IA 2V6OA 3OZ2A 1D4EA 1ZDLA 4A6NA 3UOVA 2R9ZA 3P4RA 4H50A 3DA1A 5HY5A 3AECA 1Q1RA 3NG7X 4OPGA 2VRMA 2WP6A 4BV6A 3T31A 2R45A 3BI2A 2RGHA 3SY4A 2WPFA 1GV4A 3V3OA 2BC0A 4RSLA 4APNA 1BWCA 1D4CA 3L8KA 1PS9A 3UP5A 1D4DA 2WDQA 3K7MX 4H4PA 2BS3A 1NHPA 3SXIA 2JAEA 1IUVA 5FS7A 4A99A 1YQ4A 1IJHA 3S5WA 1GERA 3DH9A 3CGEA 5BUKA 2Q7VA 1H86A 1LQUA 3D8XA 3IHGA 3SX6A 4NWZA 3ISHA 5EBKA 5KMPA 1LJ1A 2YG6A 1KFYA 1NG3A 2GAHB 1OJTA 2A87A 2Q0LA 3FPZA 4H4XA 1GRAA 4CCRA 5JCNA 3GSIA 5KOWA 2ZZBA 2GQFA 3DJJA 4OPUA 1YQZA 3NYCA 4TM0A 2AAQA 4C5OA 5FS8A 3AYJA 4JN9A 3LADA 5EOWA 1GRTA 3AEFA 3P4PA 1LV0A 2WBAA 5KVHA 2EQ6A 3ADAB 4RG3A 3EANA 3REDA 3KKJA 2BABA 2BXSA 1DXLA 4TM4A 2YVGA 1H81A 3ABVA 1B5QA 2YG4A 3KU9A 4AP1A 4H2RA 4Z2UA 3SGLA 1JOAA 4U8NA 2BCPA 3AE9A 4Y4LA 3CN8A 1D7LA 1FEBA 4O5UA 5EB4A 3HZLA 2XLRA 3EPTA 2GR3A 1ZY8A 1F8WA 4XWZA 3SZCA 4IVOB 3K30A 4ADWA 4J33A 3QJ4A 3UOYA 3ZYXA 3AYIA 3VQRA 4EM3A 1GETA 1LPFA 3KVEA 1V59A 3BNUA 4YXDA 5M10A 2B7SA 2YQUA 1IUUA 1DJQA 4ICYA 3UKLA 2E1MA 4GRTA 4II3A 2C4CA 3FBSA 4OPDA 2GMHA 4H2QA 1X31B 3UTEA 3G5QA 3ICTA 2CULA 4CNKA 4Z25A 1AOGA 1L9CA 1D5TA 2VVLA 5U25A 2FJEA 2WDRA 2WU5A 4X9NA 1K4QA 1TRBA 3AE1A 1PJ5A 4JDRA 1ONFA 4KX6A 2JB1A 3E1TA 1ZX9A 3UTFA 3IWAA 1PJ7A 2YLSA 3HYVA 5J7XA 1TDOA 5U63A 4X9MA 1IUSA 1H84A 1ZMCA 2WS3A 2YM1A 1CL0A 3UKPA 3VR9A 3RP8A 3AE6A 2OLNA 1Y56A 5GSNA 1L0VA 3Q9TA 4GAVA 2CFYA 3RP7A 1JRYA 1KSSA 1PBDA 2YLRA 3LOVA 3SQPA 2OLOA 1H7WA 2C73A 4H4QA 4YWOA 2V60A 3LB8A 3CPHG 5IQ4A 3G5SA 1EL9A 1FL2A 2UZZA 2WQYA 4Y4NA 1B4VA 4YSXA 2BRAA 3CMMA 2XVIA 2YLZA 4J2WA 4Z2TA 3DJDA 2PYXA 2XFUA 5HYMA 3EF6A 3NYFA 2VVMA 2BK5A 4Z44A 1IUWA 3ALLA 3BI4A 1IUTA 2XLUA 4OCGA 4CY6A 3NRNA 4YTMA 2A89A 1JNZA 1P2EA 2VZ2A 2YG5A 3UTGA 1Z6LA 3HYWA 5CQFA 1F8SA 1QLBA 1YQ3A 4H4YA 2OA1A 3QVPA 3IC9A 4DSGA 3ATRA 2RGOA 4EIQA 3GD4A 1YY5A 2NPXA 3ALJA 4LIIA 1IUXA 1NHQA 1JRZA 2BK3A 3B3RA 4U8MA 4I59A 3AE8A 1O94A 3I3LA 4U8IA 1GT8A 2BXRA 3NK0X 4DNAA 2VQ7A 2APGA 2YG7A 3NK1X 3QSMA 3UKHA 4DSHA 4Z26A 4WCTA 1CHUA 3GDPA 3RHAA 2GEWA 4CY8A 2BS2A 4C77A 3QFAA 5JCLA 2R4JA 1BKWA 2X3NA 5FMHA 3NH3X 4J56A 3P4QA 2R4EA 4FK1A 4GCMA 1GSNA 2GR1A 3GMCA 4E0VA 5KXJA 1K0LA 2WESA 4NZHA 4AT0A 5FS6A 3AE3A 2YR4A 4BK1A 3NT6A 3RP6A 2W0HA 3NLCA 3SZWA 4CCQA 3VRAA 1CC4A 1MOKA 4D03A 4U8KA 5EB5A 1DOEA 1TDKA 3QVRA 2O9ZA 3URHA 2WDVA 1PXBA 4YTPA 2GMJA 4GDPA 1XHCA 5C2TA 4GUVA 1QJDA 4H4RA 1P2HA 1S2QA 3IHMA 2DKIA 2AR8A 1CBOA 3C96A 3ICSA 1PXAA 4USQA 5M0ZA 4IA5A 2FBWA 3GD3A 4H2NA 4B64A 3AE4A 4NNJA 1ZP0A 3AE5A 2E5VA 2TPRA 3AD7B 3PS9A 1BF3A 1JNRA 1KNPA 1KDGA 1ZOVA 1GRGA 1RP0A 3VRDB 3UKKA 2ARDA 5L46A 4J36A 1TYTA 1NHRA 2EQ9A 3LZWA 3NGCX 4BJYA 4FX9A 4YSYA 2WU2A 5JCMA 1VRQB 3ITJA 1QO8A 4TLZA 4MJWA 1ZK7A 2HQMA 3T37A 1D7YA 2YVJA 4AOXA 1HYUA 5GRTA 3CPJG 3ICRA 4C74A 4EQWA 1Q1WA 4TM1A 1FECA 3V76A 4A79A 4GR1A 2FJAA 4Z2RA 1H7XA 1BZLA 1GRFA 2YVFA 3F8PA 2YR6A 3S61A 4C3XA 3GWDA 1CF3A 3CTYA 1O5WA 2H89A 3M13A 3DJGX 1ZKQA 1GALA 2X8CA 4OVIA 5KVIA 3P4SA 3RNMA 2J3NA 1VDCA 3T14A 2WOWA 4G74A 2AQJA 2QCUA 1GREA 4AP3A 2C70A 3NKSA 2YWLA 2CVJA 5IPYA 4UDQA 4UDRA 3UOZA 2XDOA 4I58A 2V5ZA 4G9KA 1OJDA 2XYOA 4KPRA 5JCIA 4RG4A 1CJ3A 5HHFA 2ACZA 5KMQA 4CNJA 3KLJA 4U8JA 3AD9B 1PBEA 3B6DA 2C67A 2EQ7A 4HA6A 2GR2A 2WPEA 2V3BA 4BK3A 3L1RA 4JQ9A 1REOA 4EM4A 1S2YA 5BULA 4M52A 4OPLA 4B65A 3BHFA 3AEAA 4B69A 1PJ6A 2YG3A 4JY3A 1GXFA 4JY2A 2IVEA 1Y56B 1W4XA 1NAAA 1PXCA 2BRYA 2C65A 4X4JA 1E7PA 3DGZA 1F3PA 1KSUA 2QA1A 2DKHA 3T0KA 3CNPA
chains in the Genus database with same CATH topology
3LJPA 1GTEA 2X8GA 4YT0A 2OALA 3CGCA 1B37A 1F6MA 4REKA 1ZMDA 3NYEA 3P9UA 5KMSA 1EL8A 1VG9A 4YKFA 2XFQA 1PDHA 3AEDA 4EIPA 2BK4A 1S3BA 3UKAA 5KNLA 2XVFA 1S3EA 4YSHA 1FCDA 2GB0A 4UP3A 4EMJA 4BJZA 5C3JA 5ER0A 3ALMA 1OJCA 2XVHA 3C4AA 4A5LA 4U2SA 3NN0X 5KWFA 1TYPA 1KNRA 1H82A 1SEZA 2JB3A 3NHOX 3GRTA 1LTXR 4EQSA 3GYIA 3HYXA 2JB2A 1O95A 5BVAA 1DNCA 1RYIA 2BCGG 4GF7A 1DODA 2VRLA 4HB9A 2V61A 2V3AA 4TLXA 4B66A 2YAUA 3DK4A 1EL5A 4CBQA 2X99A 1TDEA 3GMBA 1XPQA 4NEVA 2ZZCA 1PHHA 1XDIA 1E6EA 1VG0A 2Y6RA 4OPIA 4NTEA 3FIMB 2GAGB 2WETA 1M64A 2R0GA 1K0JA 3AXBA 3CNJA 2C3DA 3G5RA 2YLWA 2R46A 1GNDA 3NIXA 4YKGA 2B7RA 3AEEA 3T2KA 4H7UA 4YTNA 1GOSA 2C64A 3H4KA 4OPTA 4A6NB 2GVCA 3PO7A 3QSSA 2FJDA 3K7QX 4XXGA 1GESA 3KA7A 1E1MA 2WP9A 4AOSA 2VQBA 1L9DA 1JEHA 3EAOA 1JRXA 2YLXA 2C72A 2GF3A 3AYLA 3GWFA 4J31A 4J57A 5FS9A 4C3YA 1FEAA 1M6IA 1RSGA 1MO9A 3COXA 4BURA 4FDCB 3H8LA 2XLSA 4OPCA 3D1CA 5LV9A 3BNMA 2OAMA 5JCKA 2GQWA 1VQWA 1BGJA 1GRHA 1Q9IA 2ZBWA 4K22A 1ZOYA 3CNTA 2CDUA 3CGBA 4TM3A 5IQ1A 1ELIA 1H6VA 2VOUA 4ZCDA 4B68A 5KOXA 1LVLA 2Y6QA 2B9WA 3GYJA 3NN6X 4GDEA 2GRTA 3C4NA 3F8DA 4FK1C 2IVDA 4EQRA 4G73A 2XFOA 3ATQA 2JBVA 4ECHA 1E1NA 3AWIA 2C75A 2XVJA 2I0ZA 3FMWA 2Z5XA 3AE7A 1DOBA 1TDFA 4U8LA 4ZCCA 2E4GA 2Q0KA 1TDNA 2WOIA 3CIRA 4H4WA 4K5SA 1JU2A 2BYBA 1GRBA 4B63A 4JNAA 2JK6A 2C76A 2XLPA 1E39A 2F5ZA 3NTAA 2NVKX 4J34A 4AT2A 4H4UA 1KF6A 2GH5A 2XVEA 3GRSA 2A8XA 2C3CA 4Z43A 1N4UA 2WOVA 2XLTA 3M12A 1EL7A 1NENA 1NEKA 2FJBA 3SYIA 2H88A 1E1LA 3SFEA 2YLTA 4H4TA 3O0HA 2XCGA 2R0PA 4LU6A 1UKVG 2WEUA 2IIDA 1E1KA 3KPFA 4A9WA 1H83A 2GR0A 5KMRA 4GAPA 3V3NA 4Z24A 1DOCA 1Y0PA 2QAEA 4K8DA 3CPIG 4LA1A 1PBBA 1PBFA 1OJ9A 1XANA 3DK9A 1CC6A 2YM2A 3DK8A 4WX1A 1LQTA 1N1PA 1N4VA 3DJEA 4IVMB 1CC2A 4P9SA 2RGJA 3T2YA 4CRTA 3UKQA 3UP4A 1CJ4A 3AEBA 3LZXA 3NK2X 2XFPA 4G6GA 4G6HA 2Q6UA 3F8RA 4K2XA 4USRA 4IA6A 1FOHA 4K7ZA 1BGNA 2X50A 3BI5A 3CGDA 2YR5A 3KD9A 4A7AA 1NPXA 2VVLG 2X8HA 3VRBA 3I6DA 4JNQA 1PBCA 2R0CA 1B8SA 2WHDA 2XFNA 3NNEA 2BC1A 5TR3A 2RABA 3SZ0A 3PVCA 4PAAA 3WE0A 4B1BA 1PN0A 3AD8B 4XWRA 4EMIA 1L9EA 4YSZA 1MXTA 2BACA 4IV9A 2BS4A 3IF9A 4H4SA 4UDPA 3AE2A 1DJNA 3QFBA 4II2A 4N9XA 4B67A 3AEGA 3FG2P 4H4ZA 2B9XA 1N4WA 4K5RA 4U2TA 4U8PA 3SZFA 5KRQA 3OC4A 3P1WA 4NTDA 3ZDNA 3DGHA 1NHSA 2BA9A 1K0IA 2QA2A 2B9YA 4U2LA 4BK2A 1NG4A 3LXDA 4D04A 5CKUA 2ZZ0A 2C66A 2C7GA 3Q6JA 3SM8A 3UTHA 5J60A 1OJAA 4NTCA 3SFDA 5BRTA 3CNDA 1COYA 1GPEA 3DMEA 2B76A 4PABA 3NTDA 3T2ZA 1EBDA 2GV8A 4O5QA 2EQ8A 3GDNA 2PHHA 3II4A 3CNSA 3KPKA 5DBJA 4H2PA 4U8OA 3GYXA 3UCLA 1NDAA 2Z5YA 1GEUA 3K7TA 3M0OA 2WP5A 3QSEA 2JKCA 4EMWA 1F8RA 1YKJA 3JSKA 4NEWA 3UOXA 3BHKA 5U1OA 3R9UA 3AB1A 2WPCA 1CJCA 4H4VA 4A65A 3VR8A 3UKFA 5HXIA 2TMDA 1CJ2A 1GTHA 4Y4MA 4DGKA 4ZN0A 4EQXA 3H8IA 2V6OA 3OZ2A 1D4EA 1ZDLA 4A6NA 3UOVA 2R9ZA 3P4RA 4H50A 3DA1A 5HY5A 3AECA 1Q1RA 3NG7X 4OPGA 2VRMA 2WP6A 4BV6A 3T31A 2R45A 3BI2A 2RGHA 3SY4A 2WPFA 1GV4A 3V3OA 2BC0A 4RSLA 4APNA 1BWCA 1D4CA 3L8KA 1PS9A 3UP5A 1D4DA 2WDQA 3K7MX 4H4PA 2BS3A 1NHPA 3SXIA 2JAEA 1IUVA 5FS7A 4A99A 1YQ4A 1IJHA 3S5WA 1GERA 3DH9A 3CGEA 5BUKA 2Q7VA 1H86A 1LQUA 3D8XA 3IHGA 3SX6A 4NWZA 3ISHA 5EBKA 5KMPA 1LJ1A 2YG6A 1KFYA 1NG3A 2GAHB 1OJTA 2A87A 2Q0LA 3FPZA 4H4XA 1GRAA 4CCRA 5JCNA 3GSIA 5KOWA 2ZZBA 2GQFA 3DJJA 4OPUA 1YQZA 3NYCA 4TM0A 2AAQA 4C5OA 5FS8A 3AYJA 4JN9A 3LADA 5EOWA 1GRTA 3AEFA 3P4PA 1LV0A 2WBAA 5KVHA 2EQ6A 3ADAB 4RG3A 3EANA 3REDA 3KKJA 2BABA 2BXSA 1DXLA 4TM4A 2YVGA 1H81A 3ABVA 1B5QA 2YG4A 3KU9A 4AP1A 4H2RA 4Z2UA 3SGLA 1JOAA 4U8NA 2BCPA 3AE9A 4Y4LA 3CN8A 1D7LA 1FEBA 4O5UA 5EB4A 3HZLA 2XLRA 3EPTA 2GR3A 1ZY8A 1F8WA 4XWZA 3SZCA 4IVOB 3K30A 4ADWA 4J33A 3QJ4A 3UOYA 3ZYXA 3AYIA 3VQRA 4EM3A 1GETA 1LPFA 3KVEA 1V59A 3BNUA 4YXDA 5M10A 2B7SA 2YQUA 1IUUA 1DJQA 4ICYA 3UKLA 2E1MA 4GRTA 4II3A 2C4CA 3FBSA 4OPDA 2GMHA 4H2QA 1X31B 3UTEA 3G5QA 3ICTA 2CULA 4CNKA 4Z25A 1AOGA 1L9CA 1D5TA 2VVLA 5U25A 2FJEA 2WDRA 2WU5A 4X9NA 1K4QA 1TRBA 3AE1A 1PJ5A 4JDRA 1ONFA 4KX6A 2JB1A 3E1TA 1ZX9A 3UTFA 3IWAA 1PJ7A 2YLSA 3HYVA 5J7XA 1TDOA 5U63A 4X9MA 1IUSA 1H84A 1ZMCA 2WS3A 2YM1A 1CL0A 3UKPA 3VR9A 3RP8A 3AE6A 2OLNA 1Y56A 5GSNA 1L0VA 3Q9TA 4GAVA 2CFYA 3RP7A 1JRYA 1KSSA 1PBDA 2YLRA 3LOVA 3SQPA 2OLOA 1H7WA 2C73A 4H4QA 4YWOA 2V60A 3LB8A 3CPHG 5IQ4A 3G5SA 1EL9A 1FL2A 2UZZA 2WQYA 4Y4NA 1B4VA 4YSXA 2BRAA 3CMMA 2XVIA 2YLZA 4J2WA 4Z2TA 3DJDA 2PYXA 2XFUA 5HYMA 3EF6A 3NYFA 2VVMA 2BK5A 4Z44A 1IUWA 3ALLA 3BI4A 1IUTA 2XLUA 4OCGA 4CY6A 3NRNA 4YTMA 2A89A 1JNZA 1P2EA 2VZ2A 2YG5A 3UTGA 1Z6LA 3HYWA 5CQFA 1F8SA 1QLBA 1YQ3A 4H4YA 2OA1A 3QVPA 3IC9A 4DSGA 3ATRA 2RGOA 4EIQA 3GD4A 1YY5A 2NPXA 3ALJA 4LIIA 1IUXA 1NHQA 1JRZA 2BK3A 3B3RA 4U8MA 4I59A 3AE8A 1O94A 3I3LA 4U8IA 1GT8A 2BXRA 3NK0X 4DNAA 2VQ7A 2APGA 2YG7A 3NK1X 3QSMA 3UKHA 4DSHA 4Z26A 4WCTA 1CHUA 3GDPA 3RHAA 2GEWA 4CY8A 2BS2A 4C77A 3QFAA 5JCLA 2R4JA 1BKWA 2X3NA 5FMHA 3NH3X 4J56A 3P4QA 2R4EA 4FK1A 4GCMA 1GSNA 2GR1A 3GMCA 4E0VA 5KXJA 1K0LA 2WESA 4NZHA 4AT0A 5FS6A 3AE3A 2YR4A 4BK1A 3NT6A 3RP6A 2W0HA 3NLCA 3SZWA 4CCQA 3VRAA 1CC4A 1MOKA 4D03A 4U8KA 5EB5A 1DOEA 1TDKA 3QVRA 2O9ZA 3URHA 2WDVA 1PXBA 4YTPA 2GMJA 4GDPA 1XHCA 5C2TA 4GUVA 1QJDA 4H4RA 1P2HA 1S2QA 3IHMA 2DKIA 2AR8A 1CBOA 3C96A 3ICSA 1PXAA 4USQA 5M0ZA 4IA5A 2FBWA 3GD3A 4H2NA 4B64A 3AE4A 4NNJA 1ZP0A 3AE5A 2E5VA 2TPRA 3AD7B 3PS9A 1BF3A 1JNRA 1KNPA 1KDGA 1ZOVA 1GRGA 1RP0A 3VRDB 3UKKA 2ARDA 5L46A 4J36A 1TYTA 1NHRA 2EQ9A 3LZWA 3NGCX 4BJYA 4FX9A 4YSYA 2WU2A 5JCMA 1VRQB 3ITJA 1QO8A 4TLZA 4MJWA 1ZK7A 2HQMA 3T37A 1D7YA 2YVJA 4AOXA 1HYUA 5GRTA 3CPJG 3ICRA 4C74A 4EQWA 1Q1WA 4TM1A 1FECA 3V76A 4A79A 4GR1A 2FJAA 4Z2RA 1H7XA 1BZLA 1GRFA 2YVFA 3F8PA 2YR6A 3S61A 4C3XA 3GWDA 1CF3A 3CTYA 1O5WA 2H89A 3M13A 3DJGX 1ZKQA 1GALA 2X8CA 4OVIA 5KVIA 3P4SA 3RNMA 2J3NA 1VDCA 3T14A 2WOWA 4G74A 2AQJA 2QCUA 1GREA 4AP3A 2C70A 3NKSA 2YWLA 2CVJA 5IPYA 4UDQA 4UDRA 3UOZA 2XDOA 4I58A 2V5ZA 4G9KA 1OJDA 2XYOA 4KPRA 5JCIA 4RG4A 1CJ3A 5HHFA 2ACZA 5KMQA 4CNJA 3KLJA 4U8JA 3AD9B 1PBEA 3B6DA 2C67A 2EQ7A 4HA6A 2GR2A 2WPEA 2V3BA 4BK3A 3L1RA 4JQ9A 1REOA 4EM4A 1S2YA 5BULA 4M52A 4OPLA 4B65A 3BHFA 3AEAA 4B69A 1PJ6A 2YG3A 4JY3A 1GXFA 4JY2A 2IVEA 1Y56B 1W4XA 1NAAA 1PXCA 2BRYA 2C65A 4X4JA 1E7PA 3DGZA 1F3PA 1KSUA 2QA1A 2DKHA 3T0KA 3CNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LJP A;  1GTE A;  2X8G A;  4YT0 A;  2OAL A;  3CGC A;  1B37 A;  1F6M A;  4REK A;  1ZMD A;  3NYE A;  3P9U A;  1EL8 A;  1VG9 A;  4YKF A;  2XFQ A;  1PDH A;  3AED A;  4EIP A;  2BK4 A;  1S3B A;  3UKA A;  2XVF A;  1S3E A;  4YSH A;  1FCD A;  2GB0 A;  4UP3 A;  4EMJ A;  4BJZ A;  5C3J A;  5ER0 A;  3ALM A;  1OJC A;  2XVH A;  3C4A A;  4A5L A;  4U2S A;  3NN0 X;  5KWF A;  1TYP A;  1KNR A;  1H82 A;  1SEZ A;  2JB3 A;  3NHO X;  3GRT A;  1LTX R;  4EQS A;  3GYI A;  2JB2 A;  1O95 A;  5BVA A;  1DNC A;  1RYI A;  2BCG G;  4GF7 A;  1DOD A;  2VRL A;  4HB9 A;  2V61 A;  2V3A A;  4TLX A;  4B66 A;  2YAU A;  3DK4 A;  1EL5 A;  4CBQ A;  2X99 A;  1TDE A;  3GMB A;  1XPQ A;  4NEV A;  2ZZC A;  1PHH A;  1XDI A;  1E6E A;  1VG0 A;  2Y6R A;  4OPI A;  4NTE A;  3FIM B;  2GAG B;  2WET A;  1M64 A;  2R0G A;  1K0J A;  3AXB A;  3CNJ A;  2C3D A;  3G5R A;  2YLW A;  2R46 A;  1GND A;  3NIX A;  4YKG A;  2B7R A;  3AEE A;  4H7U A;  4YTN A;  1GOS A;  2C64 A;  3H4K A;  4OPT A;  4A6N B;  2GVC A;  3PO7 A;  3QSS A;  2FJD A;  3K7Q X;  4XXG A;  1GES A;  3KA7 A;  1E1M A;  2WP9 A;  4AOS A;  2VQB A;  1L9D A;  1JEH A;  3EAO A;  1JRX A;  2YLX A;  2C72 A;  2GF3 A;  3AYL A;  3GWF A;  4J31 A;  4J57 A;  5FS9 A;  4C3Y A;  1FEA A;  1M6I A;  1RSG A;  1MO9 A;  3COX A;  4BUR A;  4FDC B;  3H8L A;  2XLS A;  4OPC A;  3D1C A;  5LV9 A;  3BNM A;  2OAM A;  5JCK A;  2GQW A;  1VQW A;  1BGJ A;  1GRH A;  1Q9I A;  2ZBW A;  4K22 A;  1ZOY A;  3CNT A;  2CDU A;  3CGB A;  4TM3 A;  5IQ1 A;  1ELI A;  1H6V A;  2VOU A;  4ZCD A;  4B68 A;  5KOX A;  1LVL A;  2Y6Q A;  2B9W A;  3GYJ A;  3NN6 X;  4GDE A;  2GRT A;  3C4N A;  3F8D A;  4FK1 C;  2IVD A;  4EQR A;  2XFO A;  3ATQ A;  2JBV A;  4ECH A;  1E1N A;  3AWI A;  2C75 A;  2XVJ A;  2I0Z A;  3FMW A;  2Z5X A;  3AE7 A;  1DOB A;  1TDF A;  4U8L A;  4ZCC A;  2E4G A;  2Q0K A;  1TDN A;  2WOI A;  3CIR A;  4H4W A;  4K5S A;  1JU2 A;  2BYB A;  1GRB A;  4B63 A;  4JNA A;  2JK6 A;  2C76 A;  2XLP A;  1E39 A;  2F5Z A;  3NTA A;  2NVK X;  4J34 A;  4AT2 A;  4H4U A;  1KF6 A;  2GH5 A;  2XVE A;  3GRS A;  2A8X A;  2C3C A;  4Z43 A;  1N4U A;  2WOV A;  2XLT A;  3M12 A;  1EL7 A;  1NEN A;  1NEK A;  2FJB A;  2H88 A;  1E1L A;  3SFE A;  2YLT A;  4H4T A;  3O0H A;  2XCG A;  2R0P A;  4LU6 A;  1UKV G;  2WEU A;  2IID A;  1E1K A;  3KPF A;  4A9W A;  1H83 A;  2GR0 A;  3V3N A;  4Z24 A;  1DOC A;  1Y0P A;  2QAE A;  4K8D A;  3CPI G;  4LA1 A;  1PBB A;  1PBF A;  1OJ9 A;  1XAN A;  3DK9 A;  1CC6 A;  2YM2 A;  3DK8 A;  4WX1 A;  1LQT A;  1N1P A;  1N4V A;  3DJE A;  4IVM B;  1CC2 A;  4P9S A;  2RGJ A;  4CRT A;  3UKQ A;  3UP4 A;  1CJ4 A;  3AEB A;  3LZX A;  3NK2 X;  2XFP A;  4K2X A;  2Q6U A;  3F8R A;  4USR A;  4IA6 A;  1FOH A;  4K7Z A;  1BGN A;  2X50 A;  3BI5 A;  3CGD A;  2YR5 A;  3KD9 A;  4A7A A;  1NPX A;  2VVL G;  2X8H A;  3VRB A;  3I6D A;  4JNQ A;  1PBC A;  2R0C A;  1B8S A;  2WHD A;  2XFN A;  3NNE A;  2BC1 A;  5TR3 A;  2RAB A;  3WE0 A;  3PVC A;  4PAA A;  4B1B A;  1PN0 A;  3AD8 B;  4XWR A;  4EMI A;  1L9E A;  4YSZ A;  1MXT A;  2BAC A;  4IV9 A;  2BS4 A;  3IF9 A;  4H4S A;  4UDP A;  3AE2 A;  1DJN A;  3QFB A;  4N9X A;  4B67 A;  3AEG A;  3FG2 P;  4H4Z A;  2B9X A;  1N4W A;  4K5R A;  4U2T A;  4U8P A;  5KRQ A;  3OC4 A;  3P1W A;  4NTD A;  3ZDN A;  3DGH A;  1NHS A;  2BA9 A;  1K0I A;  2QA2 A;  2B9Y A;  4U2L A;  4BK2 A;  1NG4 A;  3LXD A;  4D04 A;  5CKU A;  2ZZ0 A;  2C66 A;  2C7G A;  3Q6J A;  3SM8 A;  3UTH A;  5J60 A;  1OJA A;  4NTC A;  3SFD A;  5BRT A;  3CND A;  1COY A;  1GPE A;  3DME A;  2B76 A;  4PAB A;  3NTD A;  1EBD A;  2GV8 A;  4O5Q A;  2EQ8 A;  3GDN A;  2PHH A;  3II4 A;  3CNS A;  5DBJ A;  4H2P A;  4U8O A;  3UCL A;  1NDA A;  2Z5Y A;  1GEU A;  3K7T A;  3M0O A;  2WP5 A;  3QSE A;  2JKC A;  4EMW A;  1F8R A;  1YKJ A;  3JSK A;  4NEW A;  3UOX A;  3BHK A;  5U1O A;  3R9U A;  3AB1 A;  2WPC A;  1CJC A;  4H4V A;  4A65 A;  3VR8 A;  3UKF A;  5HXI A;  2TMD A;  1CJ2 A;  1GTH A;  4Y4M A;  4DGK A;  4ZN0 A;  4EQX A;  3H8I A;  2V6O A;  3OZ2 A;  1D4E A;  1ZDL A;  4A6N A;  3UOV A;  2R9Z A;  3P4R A;  4H50 A;  3DA1 A;  5HY5 A;  3AEC A;  1Q1R A;  3NG7 X;  4OPG A;  2VRM A;  2WP6 A;  4BV6 A;  2R45 A;  3BI2 A;  2RGH A;  2WPF A;  1GV4 A;  3V3O A;  2BC0 A;  4RSL A;  4APN A;  1BWC A;  1D4C A;  3L8K A;  1PS9 A;  3UP5 A;  1D4D A;  2WDQ A;  3K7M X;  4H4P A;  2BS3 A;  1NHP A;  2JAE A;  1IUV A;  5FS7 A;  4A99 A;  1YQ4 A;  1IJH A;  3S5W A;  1GER A;  3DH9 A;  3CGE A;  5BUK A;  2Q7V A;  1H86 A;  1LQU A;  3D8X A;  3IHG A;  3ISH A;  5EBK A;  1LJ1 A;  2YG6 A;  1KFY A;  1NG3 A;  2GAH B;  1OJT A;  2A87 A;  2Q0L A;  3FPZ A;  4H4X A;  1GRA A;  4CCR A;  5JCN A;  3GSI A;  5KOW A;  2ZZB A;  2GQF A;  3DJJ A;  4OPU A;  1YQZ A;  3NYC A;  4TM0 A;  2AAQ A;  4C5O A;  5FS8 A;  3AYJ A;  4JN9 A;  3LAD A;  5EOW A;  1GRT A;  3AEF A;  3P4P A;  1LV0 A;  2WBA A;  5KVH A;  2EQ6 A;  3ADA B;  4RG3 A;  3EAN A;  3RED A;  3KKJ A;  2BAB A;  2BXS A;  1DXL A;  4TM4 A;  2YVG A;  1H81 A;  3ABV A;  1B5Q A;  2YG4 A;  3KU9 A;  4AP1 A;  4H2R A;  4Z2U A;  3SGL A;  1JOA A;  4U8N A;  2BCP A;  3AE9 A;  4Y4L A;  3CN8 A;  1D7L A;  1FEB A;  4O5U A;  5EB4 A;  3HZL A;  2XLR A;  3EPT A;  2GR3 A;  1ZY8 A;  1F8W A;  4XWZ A;  4ADW A;  4IVO B;  3K30 A;  4J33 A;  3QJ4 A;  3UOY A;  3ZYX A;  3AYI A;  3VQR A;  4EM3 A;  1GET A;  1LPF A;  3KVE A;  1V59 A;  3BNU A;  4YXD A;  5M10 A;  2B7S A;  2YQU A;  1IUU A;  1DJQ A;  4ICY A;  3UKL A;  2E1M A;  4GRT A;  3FBS A;  4OPD A;  2GMH A;  4H2Q A;  1X31 B;  3UTE A;  3G5Q A;  3ICT A;  2CUL A;  4CNK A;  4Z25 A;  1AOG A;  1L9C A;  1D5T A;  2VVL A;  5U25 A;  2FJE A;  2WDR A;  2WU5 A;  4X9N A;  1K4Q A;  1TRB A;  3AE1 A;  1PJ5 A;  4JDR A;  1ONF A;  4KX6 A;  2JB1 A;  3E1T A;  1ZX9 A;  3UTF A;  3IWA A;  1PJ7 A;  2YLS A;  5J7X A;  5U63 A;  1TDO A;  4X9M A;  1IUS A;  1H84 A;  1ZMC A;  2WS3 A;  2YM1 A;  1CL0 A;  3UKP A;  3VR9 A;  3RP8 A;  3AE6 A;  2OLN A;  1Y56 A;  5GSN A;  1L0V A;  3Q9T A;  2CFY A;  3RP7 A;  1JRY A;  1KSS A;  1PBD A;  2YLR A;  3LOV A;  3SQP A;  2OLO A;  1H7W A;  2C73 A;  4H4Q A;  4YWO A;  2V60 A;  3LB8 A;  3CPH G;  5IQ4 A;  3G5S A;  1EL9 A;  1FL2 A;  2UZZ A;  2WQY A;  4Y4N A;  1B4V A;  4YSX A;  2XVI A;  2YLZ A;  4J2W A;  4Z2T A;  3DJD A;  2PYX A;  2XFU A;  5HYM A;  3EF6 A;  3NYF A;  2VVM A;  2BK5 A;  4Z44 A;  1IUW A;  3ALL A;  3BI4 A;  1IUT A;  2XLU A;  4OCG A;  4CY6 A;  3NRN A;  4YTM A;  2A89 A;  1JNZ A;  1P2E A;  2VZ2 A;  2YG5 A;  3UTG A;  1Z6L A;  5CQF A;  1F8S A;  1QLB A;  1YQ3 A;  4H4Y A;  2OA1 A;  3QVP A;  3IC9 A;  4DSG A;  3ATR A;  2RGO A;  4EIQ A;  3GD4 A;  1YY5 A;  2NPX A;  3ALJ A;  4LII A;  1IUX A;  1NHQ A;  1JRZ A;  2BK3 A;  3B3R A;  4U8M A;  4I59 A;  3AE8 A;  1O94 A;  3I3L A;  4U8I A;  1GT8 A;  2BXR A;  3NK0 X;  4DNA A;  2VQ7 A;  2APG A;  2YG7 A;  3NK1 X;  3QSM A;  3UKH A;  4DSH A;  4Z26 A;  4WCT A;  1CHU A;  3GDP A;  3RHA A;  2GEW A;  4CY8 A;  2BS2 A;  4C77 A;  3QFA A;  5JCL A;  2R4J A;  1BKW A;  2X3N A;  5FMH A;  3NH3 X;  4J56 A;  3P4Q A;  2R4E A;  4FK1 A;  4GCM A;  1GSN A;  2GR1 A;  3GMC A;  4E0V A;  5KXJ A;  1K0L A;  2WES A;  4NZH A;  4AT0 A;  5FS6 A;  3AE3 A;  2YR4 A;  4BK1 A;  3NT6 A;  3RP6 A;  2W0H A;  3NLC A;  4CCQ A;  3VRA A;  1CC4 A;  1MOK A;  4D03 A;  4U8K A;  5EB5 A;  1DOE A;  1TDK A;  3QVR A;  2O9Z A;  3URH A;  2WDV A;  1PXB A;  4YTP A;  2GMJ A;  4GDP A;  1XHC A;  5C2T A;  4GUV A;  1QJD A;  4H4R A;  1P2H A;  1S2Q A;  3IHM A;  2DKI A;  2AR8 A;  1CBO A;  3C96 A;  3ICS A;  1PXA A;  4USQ A;  5M0Z A;  4IA5 A;  2FBW A;  3GD3 A;  4H2N A;  4B64 A;  3AE4 A;  1ZP0 A;  3AE5 A;  2E5V A;  2TPR A;  3AD7 B;  3PS9 A;  1BF3 A;  1JNR A;  1KNP A;  1KDG A;  1ZOV A;  1GRG A;  1RP0 A;  3VRD B;  3UKK A;  2ARD A;  5L46 A;  4J36 A;  1TYT A;  1NHR A;  2EQ9 A;  3LZW A;  3NGC X;  4BJY A;  4FX9 A;  4YSY A;  2WU2 A;  5JCM A;  1VRQ B;  3ITJ A;  1QO8 A;  4TLZ A;  4MJW A;  1ZK7 A;  2HQM A;  3T37 A;  1D7Y A;  2YVJ A;  4AOX A;  1HYU A;  5GRT A;  3CPJ G;  3ICR A;  4C74 A;  4EQW A;  1Q1W A;  4TM1 A;  1FEC A;  3V76 A;  4A79 A;  4GR1 A;  2FJA A;  4Z2R A;  1H7X A;  1BZL A;  1GRF A;  2YVF A;  3F8P A;  2YR6 A;  3S61 A;  4C3X A;  3GWD A;  1CF3 A;  3CTY A;  1O5W A;  2H89 A;  3M13 A;  3DJG X;  1ZKQ A;  1GAL A;  2X8C A;  4OVI A;  5KVI A;  3P4S A;  3RNM A;  2J3N A;  1VDC A;  2WOW A;  2AQJ A;  2QCU A;  1GRE A;  4AP3 A;  2C70 A;  3NKS A;  2YWL A;  2CVJ A;  5IPY A;  4UDQ A;  4UDR A;  3UOZ A;  2XDO A;  4I58 A;  2V5Z A;  1OJD A;  2XYO A;  4KPR A;  5JCI A;  4RG4 A;  1CJ3 A;  5HHF A;  2ACZ A;  4CNJ A;  3KLJ A;  4U8J A;  3AD9 B;  1PBE A;  3B6D A;  2C67 A;  2EQ7 A;  4HA6 A;  2GR2 A;  2WPE A;  2V3B A;  4BK3 A;  3L1R A;  4JQ9 A;  1REO A;  4EM4 A;  1S2Y A;  5BUL A;  4M52 A;  4OPL A;  4B65 A;  3BHF A;  3AEA A;  4B69 A;  1PJ6 A;  2YG3 A;  4JY3 A;  1GXF A;  4JY2 A;  2IVE A;  1Y56 B;  1W4X A;  1NAA A;  1PXC A;  2C65 A;  4X4J A;  1E7P A;  3DGZ A;  1F3P A;  1KSU A;  2QA1 A;  2DKH A;  3CNP A; 
#chains in the Genus database with same CATH topology
 3LJP A;  1GTE A;  2X8G A;  4YT0 A;  2OAL A;  3CGC A;  1B37 A;  1F6M A;  4REK A;  1ZMD A;  3NYE A;  3P9U A;  5KMS A;  1EL8 A;  1VG9 A;  4YKF A;  2XFQ A;  1PDH A;  3AED A;  4EIP A;  2BK4 A;  1S3B A;  3UKA A;  5KNL A;  2XVF A;  1S3E A;  4YSH A;  1FCD A;  2GB0 A;  4UP3 A;  4EMJ A;  4BJZ A;  5C3J A;  5ER0 A;  3ALM A;  1OJC A;  2XVH A;  3C4A A;  4A5L A;  4U2S A;  3NN0 X;  5KWF A;  1TYP A;  1KNR A;  1H82 A;  1SEZ A;  2JB3 A;  3NHO X;  3GRT A;  1LTX R;  4EQS A;  3GYI A;  3HYX A;  2JB2 A;  1O95 A;  5BVA A;  1DNC A;  1RYI A;  2BCG G;  4GF7 A;  1DOD A;  2VRL A;  4HB9 A;  2V61 A;  2V3A A;  4TLX A;  4B66 A;  2YAU A;  3DK4 A;  1EL5 A;  4CBQ A;  2X99 A;  1TDE A;  3GMB A;  1XPQ A;  4NEV A;  2ZZC A;  1PHH A;  1XDI A;  1E6E A;  1VG0 A;  2Y6R A;  4OPI A;  4NTE A;  3FIM B;  2GAG B;  2WET A;  1M64 A;  2R0G A;  1K0J A;  3AXB A;  3CNJ A;  2C3D A;  3G5R A;  2YLW A;  2R46 A;  1GND A;  3NIX A;  4YKG A;  2B7R A;  3AEE A;  3T2K A;  4H7U A;  4YTN A;  1GOS A;  2C64 A;  3H4K A;  4OPT A;  4A6N B;  2GVC A;  3PO7 A;  3QSS A;  2FJD A;  3K7Q X;  4XXG A;  1GES A;  3KA7 A;  1E1M A;  2WP9 A;  4AOS A;  2VQB A;  1L9D A;  1JEH A;  3EAO A;  1JRX A;  2YLX A;  2C72 A;  2GF3 A;  3AYL A;  3GWF A;  4J31 A;  4J57 A;  5FS9 A;  4C3Y A;  1FEA A;  1M6I A;  1RSG A;  1MO9 A;  3COX A;  4BUR A;  4FDC B;  3H8L A;  2XLS A;  4OPC A;  3D1C A;  5LV9 A;  3BNM A;  2OAM A;  5JCK A;  2GQW A;  1VQW A;  1BGJ A;  1GRH A;  1Q9I A;  2ZBW A;  4K22 A;  1ZOY A;  3CNT A;  2CDU A;  3CGB A;  4TM3 A;  5IQ1 A;  1ELI A;  1H6V A;  2VOU A;  4ZCD A;  4B68 A;  5KOX A;  1LVL A;  2Y6Q A;  2B9W A;  3GYJ A;  3NN6 X;  4GDE A;  2GRT A;  3C4N A;  3F8D A;  4FK1 C;  2IVD A;  4EQR A;  4G73 A;  2XFO A;  3ATQ A;  2JBV A;  4ECH A;  1E1N A;  3AWI A;  2C75 A;  2XVJ A;  2I0Z A;  3FMW A;  2Z5X A;  3AE7 A;  1DOB A;  1TDF A;  4U8L A;  4ZCC A;  2E4G A;  2Q0K A;  1TDN A;  2WOI A;  3CIR A;  4H4W A;  4K5S A;  1JU2 A;  2BYB A;  1GRB A;  4B63 A;  4JNA A;  2JK6 A;  2C76 A;  2XLP A;  1E39 A;  2F5Z A;  3NTA A;  2NVK X;  4J34 A;  4AT2 A;  4H4U A;  1KF6 A;  2GH5 A;  2XVE A;  3GRS A;  2A8X A;  2C3C A;  4Z43 A;  1N4U A;  2WOV A;  2XLT A;  3M12 A;  1EL7 A;  1NEN A;  1NEK A;  2FJB A;  3SYI A;  2H88 A;  1E1L A;  3SFE A;  2YLT A;  4H4T A;  3O0H A;  2XCG A;  2R0P A;  4LU6 A;  1UKV G;  2WEU A;  2IID A;  1E1K A;  3KPF A;  4A9W A;  1H83 A;  2GR0 A;  5KMR A;  4GAP A;  3V3N A;  4Z24 A;  1DOC A;  1Y0P A;  2QAE A;  4K8D A;  3CPI G;  4LA1 A;  1PBB A;  1PBF A;  1OJ9 A;  1XAN A;  3DK9 A;  1CC6 A;  2YM2 A;  3DK8 A;  4WX1 A;  1LQT A;  1N1P A;  1N4V A;  3DJE A;  4IVM B;  1CC2 A;  4P9S A;  2RGJ A;  3T2Y A;  4CRT A;  3UKQ A;  3UP4 A;  1CJ4 A;  3AEB A;  3LZX A;  3NK2 X;  2XFP A;  4G6G A;  4G6H A;  2Q6U A;  3F8R A;  4K2X A;  4USR A;  4IA6 A;  1FOH A;  4K7Z A;  1BGN A;  2X50 A;  3BI5 A;  3CGD A;  2YR5 A;  3KD9 A;  4A7A A;  1NPX A;  2VVL G;  2X8H A;  3VRB A;  3I6D A;  4JNQ A;  1PBC A;  2R0C A;  1B8S A;  2WHD A;  2XFN A;  3NNE A;  2BC1 A;  5TR3 A;  2RAB A;  3SZ0 A;  3PVC A;  4PAA A;  3WE0 A;  4B1B A;  1PN0 A;  3AD8 B;  4XWR A;  4EMI A;  1L9E A;  4YSZ A;  1MXT A;  2BAC A;  4IV9 A;  2BS4 A;  3IF9 A;  4H4S A;  4UDP A;  3AE2 A;  1DJN A;  3QFB A;  4II2 A;  4N9X A;  4B67 A;  3AEG A;  3FG2 P;  4H4Z A;  2B9X A;  1N4W A;  4K5R A;  4U2T A;  4U8P A;  3SZF A;  5KRQ A;  3OC4 A;  3P1W A;  4NTD A;  3ZDN A;  3DGH A;  1NHS A;  2BA9 A;  1K0I A;  2QA2 A;  2B9Y A;  4U2L A;  4BK2 A;  1NG4 A;  3LXD A;  4D04 A;  5CKU A;  2ZZ0 A;  2C66 A;  2C7G A;  3Q6J A;  3SM8 A;  3UTH A;  5J60 A;  1OJA A;  4NTC A;  3SFD A;  5BRT A;  3CND A;  1COY A;  1GPE A;  3DME A;  2B76 A;  4PAB A;  3NTD A;  3T2Z A;  1EBD A;  2GV8 A;  4O5Q A;  2EQ8 A;  3GDN A;  2PHH A;  3II4 A;  3CNS A;  3KPK A;  5DBJ A;  4H2P A;  4U8O A;  3GYX A;  3UCL A;  1NDA A;  2Z5Y A;  1GEU A;  3K7T A;  3M0O A;  2WP5 A;  3QSE A;  2JKC A;  4EMW A;  1F8R A;  1YKJ A;  3JSK A;  4NEW A;  3UOX A;  3BHK A;  5U1O A;  3R9U A;  3AB1 A;  2WPC A;  1CJC A;  4H4V A;  4A65 A;  3VR8 A;  3UKF A;  5HXI A;  2TMD A;  1CJ2 A;  1GTH A;  4Y4M A;  4DGK A;  4ZN0 A;  4EQX A;  3H8I A;  2V6O A;  3OZ2 A;  1D4E A;  1ZDL A;  4A6N A;  3UOV A;  2R9Z A;  3P4R A;  4H50 A;  3DA1 A;  5HY5 A;  3AEC A;  1Q1R A;  3NG7 X;  4OPG A;  2VRM A;  2WP6 A;  4BV6 A;  3T31 A;  2R45 A;  3BI2 A;  2RGH A;  3SY4 A;  2WPF A;  1GV4 A;  3V3O A;  2BC0 A;  4RSL A;  4APN A;  1BWC A;  1D4C A;  3L8K A;  1PS9 A;  3UP5 A;  1D4D A;  2WDQ A;  3K7M X;  4H4P A;  2BS3 A;  1NHP A;  3SXI A;  2JAE A;  1IUV A;  5FS7 A;  4A99 A;  1YQ4 A;  1IJH A;  3S5W A;  1GER A;  3DH9 A;  3CGE A;  5BUK A;  2Q7V A;  1H86 A;  1LQU A;  3D8X A;  3IHG A;  3SX6 A;  4NWZ A;  3ISH A;  5EBK A;  5KMP A;  1LJ1 A;  2YG6 A;  1KFY A;  1NG3 A;  2GAH B;  1OJT A;  2A87 A;  2Q0L A;  3FPZ A;  4H4X A;  1GRA A;  4CCR A;  5JCN A;  3GSI A;  5KOW A;  2ZZB A;  2GQF A;  3DJJ A;  4OPU A;  1YQZ A;  3NYC A;  4TM0 A;  2AAQ A;  4C5O A;  5FS8 A;  3AYJ A;  4JN9 A;  3LAD A;  5EOW A;  1GRT A;  3AEF A;  3P4P A;  1LV0 A;  2WBA A;  5KVH A;  2EQ6 A;  3ADA B;  4RG3 A;  3EAN A;  3RED A;  3KKJ A;  2BAB A;  2BXS A;  1DXL A;  4TM4 A;  2YVG A;  1H81 A;  3ABV A;  1B5Q A;  2YG4 A;  3KU9 A;  4AP1 A;  4H2R A;  4Z2U A;  3SGL A;  1JOA A;  4U8N A;  2BCP A;  3AE9 A;  4Y4L A;  3CN8 A;  1D7L A;  1FEB A;  4O5U A;  5EB4 A;  3HZL A;  2XLR A;  3EPT A;  2GR3 A;  1ZY8 A;  1F8W A;  4XWZ A;  3SZC A;  4IVO B;  3K30 A;  4ADW A;  4J33 A;  3QJ4 A;  3UOY A;  3ZYX A;  3AYI A;  3VQR A;  4EM3 A;  1GET A;  1LPF A;  3KVE A;  1V59 A;  3BNU A;  4YXD A;  5M10 A;  2B7S A;  2YQU A;  1IUU A;  1DJQ A;  4ICY A;  3UKL A;  2E1M A;  4GRT A;  4II3 A;  2C4C A;  3FBS A;  4OPD A;  2GMH A;  4H2Q A;  1X31 B;  3UTE A;  3G5Q A;  3ICT A;  2CUL A;  4CNK A;  4Z25 A;  1AOG A;  1L9C A;  1D5T A;  2VVL A;  5U25 A;  2FJE A;  2WDR A;  2WU5 A;  4X9N A;  1K4Q A;  1TRB A;  3AE1 A;  1PJ5 A;  4JDR A;  1ONF A;  4KX6 A;  2JB1 A;  3E1T A;  1ZX9 A;  3UTF A;  3IWA A;  1PJ7 A;  2YLS A;  3HYV A;  5J7X A;  1TDO A;  5U63 A;  4X9M A;  1IUS A;  1H84 A;  1ZMC A;  2WS3 A;  2YM1 A;  1CL0 A;  3UKP A;  3VR9 A;  3RP8 A;  3AE6 A;  2OLN A;  1Y56 A;  5GSN A;  1L0V A;  3Q9T A;  4GAV A;  2CFY A;  3RP7 A;  1JRY A;  1KSS A;  1PBD A;  2YLR A;  3LOV A;  3SQP A;  2OLO A;  1H7W A;  2C73 A;  4H4Q A;  4YWO A;  2V60 A;  3LB8 A;  3CPH G;  5IQ4 A;  3G5S A;  1EL9 A;  1FL2 A;  2UZZ A;  2WQY A;  4Y4N A;  1B4V A;  4YSX A;  2BRA A;  3CMM A;  2XVI A;  2YLZ A;  4J2W A;  4Z2T A;  3DJD A;  2PYX A;  2XFU A;  5HYM A;  3EF6 A;  3NYF A;  2VVM A;  2BK5 A;  4Z44 A;  1IUW A;  3ALL A;  3BI4 A;  1IUT A;  2XLU A;  4OCG A;  4CY6 A;  3NRN A;  4YTM A;  2A89 A;  1JNZ A;  1P2E A;  2VZ2 A;  2YG5 A;  3UTG A;  1Z6L A;  3HYW A;  5CQF A;  1F8S A;  1QLB A;  1YQ3 A;  4H4Y A;  2OA1 A;  3QVP A;  3IC9 A;  4DSG A;  3ATR A;  2RGO A;  4EIQ A;  3GD4 A;  1YY5 A;  2NPX A;  3ALJ A;  4LII A;  1IUX A;  1NHQ A;  1JRZ A;  2BK3 A;  3B3R A;  4U8M A;  4I59 A;  3AE8 A;  1O94 A;  3I3L A;  4U8I A;  1GT8 A;  2BXR A;  3NK0 X;  4DNA A;  2VQ7 A;  2APG A;  2YG7 A;  3NK1 X;  3QSM A;  3UKH A;  4DSH A;  4Z26 A;  4WCT A;  1CHU A;  3GDP A;  3RHA A;  2GEW A;  4CY8 A;  2BS2 A;  4C77 A;  3QFA A;  5JCL A;  2R4J A;  1BKW A;  2X3N A;  5FMH A;  3NH3 X;  4J56 A;  3P4Q A;  2R4E A;  4FK1 A;  4GCM A;  1GSN A;  2GR1 A;  3GMC A;  4E0V A;  5KXJ A;  1K0L A;  2WES A;  4NZH A;  4AT0 A;  5FS6 A;  3AE3 A;  2YR4 A;  4BK1 A;  3NT6 A;  3RP6 A;  2W0H A;  3NLC A;  3SZW A;  4CCQ A;  3VRA A;  1CC4 A;  1MOK A;  4D03 A;  4U8K A;  5EB5 A;  1DOE A;  1TDK A;  3QVR A;  2O9Z A;  3URH A;  2WDV A;  1PXB A;  4YTP A;  2GMJ A;  4GDP A;  1XHC A;  5C2T A;  4GUV A;  1QJD A;  4H4R A;  1P2H A;  1S2Q A;  3IHM A;  2DKI A;  2AR8 A;  1CBO A;  3C96 A;  3ICS A;  1PXA A;  4USQ A;  5M0Z A;  4IA5 A;  2FBW A;  3GD3 A;  4H2N A;  4B64 A;  3AE4 A;  4NNJ A;  1ZP0 A;  3AE5 A;  2E5V A;  2TPR A;  3AD7 B;  3PS9 A;  1BF3 A;  1JNR A;  1KNP A;  1KDG A;  1ZOV A;  1GRG A;  1RP0 A;  3VRD B;  3UKK A;  2ARD A;  5L46 A;  4J36 A;  1TYT A;  1NHR A;  2EQ9 A;  3LZW A;  3NGC X;  4BJY A;  4FX9 A;  4YSY A;  2WU2 A;  5JCM A;  1VRQ B;  3ITJ A;  1QO8 A;  4TLZ A;  4MJW A;  1ZK7 A;  2HQM A;  3T37 A;  1D7Y A;  2YVJ A;  4AOX A;  1HYU A;  5GRT A;  3CPJ G;  3ICR A;  4C74 A;  4EQW A;  1Q1W A;  4TM1 A;  1FEC A;  3V76 A;  4A79 A;  4GR1 A;  2FJA A;  4Z2R A;  1H7X A;  1BZL A;  1GRF A;  2YVF A;  3F8P A;  2YR6 A;  3S61 A;  4C3X A;  3GWD A;  1CF3 A;  3CTY A;  1O5W A;  2H89 A;  3M13 A;  3DJG X;  1ZKQ A;  1GAL A;  2X8C A;  4OVI A;  5KVI A;  3P4S A;  3RNM A;  2J3N A;  1VDC A;  3T14 A;  2WOW A;  4G74 A;  2AQJ A;  2QCU A;  1GRE A;  4AP3 A;  2C70 A;  3NKS A;  2YWL A;  2CVJ A;  5IPY A;  4UDQ A;  4UDR A;  3UOZ A;  2XDO A;  4I58 A;  2V5Z A;  4G9K A;  1OJD A;  2XYO A;  4KPR A;  5JCI A;  4RG4 A;  1CJ3 A;  5HHF A;  2ACZ A;  5KMQ A;  4CNJ A;  3KLJ A;  4U8J A;  3AD9 B;  1PBE A;  3B6D A;  2C67 A;  2EQ7 A;  4HA6 A;  2GR2 A;  2WPE A;  2V3B A;  4BK3 A;  3L1R A;  4JQ9 A;  1REO A;  4EM4 A;  1S2Y A;  5BUL A;  4M52 A;  4OPL A;  4B65 A;  3BHF A;  3AEA A;  4B69 A;  1PJ6 A;  2YG3 A;  4JY3 A;  1GXF A;  4JY2 A;  2IVE A;  1Y56 B;  1W4X A;  1NAA A;  1PXC A;  2BRY A;  2C65 A;  4X4J A;  1E7P A;  3DGZ A;  1F3P A;  1KSU A;  2QA1 A;  2DKH A;  3T0K A;  3CNP A; 
#chains in the Genus database with same CATH homology
 3LJP A;  1GTE A;  2X8G A;  4YT0 A;  2OAL A;  3CGC A;  1B37 A;  1F6M A;  4REK A;  1ZMD A;  3NYE A;  3P9U A;  5KMS A;  1EL8 A;  1VG9 A;  4YKF A;  2XFQ A;  1PDH A;  3AED A;  4EIP A;  2BK4 A;  1S3B A;  3UKA A;  5KNL A;  2XVF A;  1S3E A;  4YSH A;  1FCD A;  2GB0 A;  4UP3 A;  4EMJ A;  4BJZ A;  5C3J A;  5ER0 A;  3ALM A;  1OJC A;  2XVH A;  3C4A A;  4A5L A;  4U2S A;  3NN0 X;  5KWF A;  1TYP A;  1KNR A;  1H82 A;  1SEZ A;  2JB3 A;  3NHO X;  3GRT A;  1LTX R;  4EQS A;  3GYI A;  3HYX A;  2JB2 A;  1O95 A;  5BVA A;  1DNC A;  1RYI A;  2BCG G;  4GF7 A;  1DOD A;  2VRL A;  4HB9 A;  2V61 A;  2V3A A;  4TLX A;  4B66 A;  2YAU A;  3DK4 A;  1EL5 A;  4CBQ A;  2X99 A;  1TDE A;  3GMB A;  1XPQ A;  4NEV A;  2ZZC A;  1PHH A;  1XDI A;  1E6E A;  1VG0 A;  2Y6R A;  4OPI A;  4NTE A;  3FIM B;  2GAG B;  2WET A;  1M64 A;  2R0G A;  1K0J A;  3AXB A;  3CNJ A;  2C3D A;  3G5R A;  2YLW A;  2R46 A;  1GND A;  3NIX A;  4YKG A;  2B7R A;  3AEE A;  3T2K A;  4H7U A;  4YTN A;  1GOS A;  2C64 A;  3H4K A;  4OPT A;  4A6N B;  2GVC A;  3PO7 A;  3QSS A;  2FJD A;  3K7Q X;  4XXG A;  1GES A;  3KA7 A;  1E1M A;  2WP9 A;  4AOS A;  2VQB A;  1L9D A;  1JEH A;  3EAO A;  1JRX A;  2YLX A;  2C72 A;  2GF3 A;  3AYL A;  3GWF A;  4J31 A;  4J57 A;  5FS9 A;  4C3Y A;  1FEA A;  1M6I A;  1RSG A;  1MO9 A;  3COX A;  4BUR A;  4FDC B;  3H8L A;  2XLS A;  4OPC A;  3D1C A;  5LV9 A;  3BNM A;  2OAM A;  5JCK A;  2GQW A;  1VQW A;  1BGJ A;  1GRH A;  1Q9I A;  2ZBW A;  4K22 A;  1ZOY A;  3CNT A;  2CDU A;  3CGB A;  4TM3 A;  5IQ1 A;  1ELI A;  1H6V A;  2VOU A;  4ZCD A;  4B68 A;  5KOX A;  1LVL A;  2Y6Q A;  2B9W A;  3GYJ A;  3NN6 X;  4GDE A;  2GRT A;  3C4N A;  3F8D A;  4FK1 C;  2IVD A;  4EQR A;  4G73 A;  2XFO A;  3ATQ A;  2JBV A;  4ECH A;  1E1N A;  3AWI A;  2C75 A;  2XVJ A;  2I0Z A;  3FMW A;  2Z5X A;  3AE7 A;  1DOB A;  1TDF A;  4U8L A;  4ZCC A;  2E4G A;  2Q0K A;  1TDN A;  2WOI A;  3CIR A;  4H4W A;  4K5S A;  1JU2 A;  2BYB A;  1GRB A;  4B63 A;  4JNA A;  2JK6 A;  2C76 A;  2XLP A;  1E39 A;  2F5Z A;  3NTA A;  2NVK X;  4J34 A;  4AT2 A;  4H4U A;  1KF6 A;  2GH5 A;  2XVE A;  3GRS A;  2A8X A;  2C3C A;  4Z43 A;  1N4U A;  2WOV A;  2XLT A;  3M12 A;  1EL7 A;  1NEN A;  1NEK A;  2FJB A;  3SYI A;  2H88 A;  1E1L A;  3SFE A;  2YLT A;  4H4T A;  3O0H A;  2XCG A;  2R0P A;  4LU6 A;  1UKV G;  2WEU A;  2IID A;  1E1K A;  3KPF A;  4A9W A;  1H83 A;  2GR0 A;  5KMR A;  4GAP A;  3V3N A;  4Z24 A;  1DOC A;  1Y0P A;  2QAE A;  4K8D A;  3CPI G;  4LA1 A;  1PBB A;  1PBF A;  1OJ9 A;  1XAN A;  3DK9 A;  1CC6 A;  2YM2 A;  3DK8 A;  4WX1 A;  1LQT A;  1N1P A;  1N4V A;  3DJE A;  4IVM B;  1CC2 A;  4P9S A;  2RGJ A;  3T2Y A;  4CRT A;  3UKQ A;  3UP4 A;  1CJ4 A;  3AEB A;  3LZX A;  3NK2 X;  2XFP A;  4G6G A;  4G6H A;  2Q6U A;  3F8R A;  4K2X A;  4USR A;  4IA6 A;  1FOH A;  4K7Z A;  1BGN A;  2X50 A;  3BI5 A;  3CGD A;  2YR5 A;  3KD9 A;  4A7A A;  1NPX A;  2VVL G;  2X8H A;  3VRB A;  3I6D A;  4JNQ A;  1PBC A;  2R0C A;  1B8S A;  2WHD A;  2XFN A;  3NNE A;  2BC1 A;  5TR3 A;  2RAB A;  3SZ0 A;  3PVC A;  4PAA A;  3WE0 A;  4B1B A;  1PN0 A;  3AD8 B;  4XWR A;  4EMI A;  1L9E A;  4YSZ A;  1MXT A;  2BAC A;  4IV9 A;  2BS4 A;  3IF9 A;  4H4S A;  4UDP A;  3AE2 A;  1DJN A;  3QFB A;  4II2 A;  4N9X A;  4B67 A;  3AEG A;  3FG2 P;  4H4Z A;  2B9X A;  1N4W A;  4K5R A;  4U2T A;  4U8P A;  3SZF A;  5KRQ A;  3OC4 A;  3P1W A;  4NTD A;  3ZDN A;  3DGH A;  1NHS A;  2BA9 A;  1K0I A;  2QA2 A;  2B9Y A;  4U2L A;  4BK2 A;  1NG4 A;  3LXD A;  4D04 A;  5CKU A;  2ZZ0 A;  2C66 A;  2C7G A;  3Q6J A;  3SM8 A;  3UTH A;  5J60 A;  1OJA A;  4NTC A;  3SFD A;  5BRT A;  3CND A;  1COY A;  1GPE A;  3DME A;  2B76 A;  4PAB A;  3NTD A;  3T2Z A;  1EBD A;  2GV8 A;  4O5Q A;  2EQ8 A;  3GDN A;  2PHH A;  3II4 A;  3CNS A;  3KPK A;  5DBJ A;  4H2P A;  4U8O A;  3GYX A;  3UCL A;  1NDA A;  2Z5Y A;  1GEU A;  3K7T A;  3M0O A;  2WP5 A;  3QSE A;  2JKC A;  4EMW A;  1F8R A;  1YKJ A;  3JSK A;  4NEW A;  3UOX A;  3BHK A;  5U1O A;  3R9U A;  3AB1 A;  2WPC A;  1CJC A;  4H4V A;  4A65 A;  3VR8 A;  3UKF A;  5HXI A;  2TMD A;  1CJ2 A;  1GTH A;  4Y4M A;  4DGK A;  4ZN0 A;  4EQX A;  3H8I A;  2V6O A;  3OZ2 A;  1D4E A;  1ZDL A;  4A6N A;  3UOV A;  2R9Z A;  3P4R A;  4H50 A;  3DA1 A;  5HY5 A;  3AEC A;  1Q1R A;  3NG7 X;  4OPG A;  2VRM A;  2WP6 A;  4BV6 A;  3T31 A;  2R45 A;  3BI2 A;  2RGH A;  3SY4 A;  2WPF A;  1GV4 A;  3V3O A;  2BC0 A;  4RSL A;  4APN A;  1BWC A;  1D4C A;  3L8K A;  1PS9 A;  3UP5 A;  1D4D A;  2WDQ A;  3K7M X;  4H4P A;  2BS3 A;  1NHP A;  3SXI A;  2JAE A;  1IUV A;  5FS7 A;  4A99 A;  1YQ4 A;  1IJH A;  3S5W A;  1GER A;  3DH9 A;  3CGE A;  5BUK A;  2Q7V A;  1H86 A;  1LQU A;  3D8X A;  3IHG A;  3SX6 A;  4NWZ A;  3ISH A;  5EBK A;  5KMP A;  1LJ1 A;  2YG6 A;  1KFY A;  1NG3 A;  2GAH B;  1OJT A;  2A87 A;  2Q0L A;  3FPZ A;  4H4X A;  1GRA A;  4CCR A;  5JCN A;  3GSI A;  5KOW A;  2ZZB A;  2GQF A;  3DJJ A;  4OPU A;  1YQZ A;  3NYC A;  4TM0 A;  2AAQ A;  4C5O A;  5FS8 A;  3AYJ A;  4JN9 A;  3LAD A;  5EOW A;  1GRT A;  3AEF A;  3P4P A;  1LV0 A;  2WBA A;  5KVH A;  2EQ6 A;  3ADA B;  4RG3 A;  3EAN A;  3RED A;  3KKJ A;  2BAB A;  2BXS A;  1DXL A;  4TM4 A;  2YVG A;  1H81 A;  3ABV A;  1B5Q A;  2YG4 A;  3KU9 A;  4AP1 A;  4H2R A;  4Z2U A;  3SGL A;  1JOA A;  4U8N A;  2BCP A;  3AE9 A;  4Y4L A;  3CN8 A;  1D7L A;  1FEB A;  4O5U A;  5EB4 A;  3HZL A;  2XLR A;  3EPT A;  2GR3 A;  1ZY8 A;  1F8W A;  4XWZ A;  3SZC A;  4IVO B;  3K30 A;  4ADW A;  4J33 A;  3QJ4 A;  3UOY A;  3ZYX A;  3AYI A;  3VQR A;  4EM3 A;  1GET A;  1LPF A;  3KVE A;  1V59 A;  3BNU A;  4YXD A;  5M10 A;  2B7S A;  2YQU A;  1IUU A;  1DJQ A;  4ICY A;  3UKL A;  2E1M A;  4GRT A;  4II3 A;  2C4C A;  3FBS A;  4OPD A;  2GMH A;  4H2Q A;  1X31 B;  3UTE A;  3G5Q A;  3ICT A;  2CUL A;  4CNK A;  4Z25 A;  1AOG A;  1L9C A;  1D5T A;  2VVL A;  5U25 A;  2FJE A;  2WDR A;  2WU5 A;  4X9N A;  1K4Q A;  1TRB A;  3AE1 A;  1PJ5 A;  4JDR A;  1ONF A;  4KX6 A;  2JB1 A;  3E1T A;  1ZX9 A;  3UTF A;  3IWA A;  1PJ7 A;  2YLS A;  3HYV A;  5J7X A;  1TDO A;  5U63 A;  4X9M A;  1IUS A;  1H84 A;  1ZMC A;  2WS3 A;  2YM1 A;  1CL0 A;  3UKP A;  3VR9 A;  3RP8 A;  3AE6 A;  2OLN A;  1Y56 A;  5GSN A;  1L0V A;  3Q9T A;  4GAV A;  2CFY A;  3RP7 A;  1JRY A;  1KSS A;  1PBD A;  2YLR A;  3LOV A;  3SQP A;  2OLO A;  1H7W A;  2C73 A;  4H4Q A;  4YWO A;  2V60 A;  3LB8 A;  3CPH G;  5IQ4 A;  3G5S A;  1EL9 A;  1FL2 A;  2UZZ A;  2WQY A;  4Y4N A;  1B4V A;  4YSX A;  2BRA A;  3CMM A;  2XVI A;  2YLZ A;  4J2W A;  4Z2T A;  3DJD A;  2PYX A;  2XFU A;  5HYM A;  3EF6 A;  3NYF A;  2VVM A;  2BK5 A;  4Z44 A;  1IUW A;  3ALL A;  3BI4 A;  1IUT A;  2XLU A;  4OCG A;  4CY6 A;  3NRN A;  4YTM A;  2A89 A;  1JNZ A;  1P2E A;  2VZ2 A;  2YG5 A;  3UTG A;  1Z6L A;  3HYW A;  5CQF A;  1F8S A;  1QLB A;  1YQ3 A;  4H4Y A;  2OA1 A;  3QVP A;  3IC9 A;  4DSG A;  3ATR A;  2RGO A;  4EIQ A;  3GD4 A;  1YY5 A;  2NPX A;  3ALJ A;  4LII A;  1IUX A;  1NHQ A;  1JRZ A;  2BK3 A;  3B3R A;  4U8M A;  4I59 A;  3AE8 A;  1O94 A;  3I3L A;  4U8I A;  1GT8 A;  2BXR A;  3NK0 X;  4DNA A;  2VQ7 A;  2APG A;  2YG7 A;  3NK1 X;  3QSM A;  3UKH A;  4DSH A;  4Z26 A;  4WCT A;  1CHU A;  3GDP A;  3RHA A;  2GEW A;  4CY8 A;  2BS2 A;  4C77 A;  3QFA A;  5JCL A;  2R4J A;  1BKW A;  2X3N A;  5FMH A;  3NH3 X;  4J56 A;  3P4Q A;  2R4E A;  4FK1 A;  4GCM A;  1GSN A;  2GR1 A;  3GMC A;  4E0V A;  5KXJ A;  1K0L A;  2WES A;  4NZH A;  4AT0 A;  5FS6 A;  3AE3 A;  2YR4 A;  4BK1 A;  3NT6 A;  3RP6 A;  2W0H A;  3NLC A;  3SZW A;  4CCQ A;  3VRA A;  1CC4 A;  1MOK A;  4D03 A;  4U8K A;  5EB5 A;  1DOE A;  1TDK A;  3QVR A;  2O9Z A;  3URH A;  2WDV A;  1PXB A;  4YTP A;  2GMJ A;  4GDP A;  1XHC A;  5C2T A;  4GUV A;  1QJD A;  4H4R A;  1P2H A;  1S2Q A;  3IHM A;  2DKI A;  2AR8 A;  1CBO A;  3C96 A;  3ICS A;  1PXA A;  4USQ A;  5M0Z A;  4IA5 A;  2FBW A;  3GD3 A;  4H2N A;  4B64 A;  3AE4 A;  4NNJ A;  1ZP0 A;  3AE5 A;  2E5V A;  2TPR A;  3AD7 B;  3PS9 A;  1BF3 A;  1JNR A;  1KNP A;  1KDG A;  1ZOV A;  1GRG A;  1RP0 A;  3VRD B;  3UKK A;  2ARD A;  5L46 A;  4J36 A;  1TYT A;  1NHR A;  2EQ9 A;  3LZW A;  3NGC X;  4BJY A;  4FX9 A;  4YSY A;  2WU2 A;  5JCM A;  1VRQ B;  3ITJ A;  1QO8 A;  4TLZ A;  4MJW A;  1ZK7 A;  2HQM A;  3T37 A;  1D7Y A;  2YVJ A;  4AOX A;  1HYU A;  5GRT A;  3CPJ G;  3ICR A;  4C74 A;  4EQW A;  1Q1W A;  4TM1 A;  1FEC A;  3V76 A;  4A79 A;  4GR1 A;  2FJA A;  4Z2R A;  1H7X A;  1BZL A;  1GRF A;  2YVF A;  3F8P A;  2YR6 A;  3S61 A;  4C3X A;  3GWD A;  1CF3 A;  3CTY A;  1O5W A;  2H89 A;  3M13 A;  3DJG X;  1ZKQ A;  1GAL A;  2X8C A;  4OVI A;  5KVI A;  3P4S A;  3RNM A;  2J3N A;  1VDC A;  3T14 A;  2WOW A;  4G74 A;  2AQJ A;  2QCU A;  1GRE A;  4AP3 A;  2C70 A;  3NKS A;  2YWL A;  2CVJ A;  5IPY A;  4UDQ A;  4UDR A;  3UOZ A;  2XDO A;  4I58 A;  2V5Z A;  4G9K A;  1OJD A;  2XYO A;  4KPR A;  5JCI A;  4RG4 A;  1CJ3 A;  5HHF A;  2ACZ A;  5KMQ A;  4CNJ A;  3KLJ A;  4U8J A;  3AD9 B;  1PBE A;  3B6D A;  2C67 A;  2EQ7 A;  4HA6 A;  2GR2 A;  2WPE A;  2V3B A;  4BK3 A;  3L1R A;  4JQ9 A;  1REO A;  4EM4 A;  1S2Y A;  5BUL A;  4M52 A;  4OPL A;  4B65 A;  3BHF A;  3AEA A;  4B69 A;  1PJ6 A;  2YG3 A;  4JY3 A;  1GXF A;  4JY2 A;  2IVE A;  1Y56 B;  1W4X A;  1NAA A;  1PXC A;  2BRY A;  2C65 A;  4X4J A;  1E7P A;  3DGZ A;  1F3P A;  1KSU A;  2QA1 A;  2DKH A;  3T0K A;  3CNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...