4DGKA

Crystal structure of phytoene desaturase crti from pantoea ananatis
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
492
structure length
405
Chain Sequence
MKPTTVIGAGFGGLALAIRLQAAGIPVLLLEQRYVYEDQGFTFDAGPTVITDPSAIEELFALAGKQLKEYVELLPVTPFYRLCWESGKVFNYDNDQTRLEAQIQQFNPRDVEGYRQFLDYSRAVFKEGYLGTVPFLSFRDMLRAAPQLAKLQAWRSVYSKVASYIEDEHLRQAFSFHSLLVGGNPTSSIYTLIHALEREWGVWFPRGGTGALVQGMIKLFQDLGGEVVLNARVSHMETTGNKIEAVHLEDGRRFLTQAVASNADSNSLFVLYFGLNHHHDQLAHHTVCFGPRLAEDFSLYLHAPCVTDSSLAPEGCGSYYVLAPVPHLGTANLDWTVEGPKLRDRIFAYLEQHYMPGLRSQLVTHRMFTPFDFRTITNLYLVGAGIPGVIGSAKATAGLMLEDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phytoene dehydrogenase
publication title On the structure and function of the phytoene desaturase CRTI from Pantoea ananatis, a membrane-peripheral and FAD-dependent oxidase/isomerase.
pubmed doi rcsb
source organism Pantoea ananatis
molecule tags Oxidoreductase
total genus 130
structure length 405
sequence length 492
ec nomenclature ec 1.3.99.31: Phytoene desaturase (lycopene-forming).
pdb deposition date 2012-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4dgkA01
4USQA 1X31B 2W0HA 3LOVA 4K22A 3ALMA 5GRTA 4WX1A 4U8OA 3ICTA 1IJHA 2YAUA 3CPJG 4IVMB 2O9ZA 4ZCDA 4B65A 1EL5A 3T37A 4TLXA 3IF9A 4H4XA 4BJZA 4IVOB 1S3BA 3QSEA 4LU6A 1HYUA 1NEKA 4JNQA 4B66A 3CNJA 3M0OA 1N4WA 1E1LA 1NG3A 4A65A 1K0LA 1OJ9A 4EQRA 1IUVA 3URHA 1GRTA 1GREA 3S5WA 1TDNA 3QSMA 5HHFA 2R4EA 3CGEA 2X8CA 2VOUA 2BCGG 4NTCA 1TDOA 4GF7A 3CGDA 1S3EA 2CDUA 4IA5A 1K4QA 4H2QA 4U8IA 1H6VA 1LV0A 1Y0PA 5M0ZA 3B3RA 1M64A 2YLZA 3L1RA 3AXBA 3DK4A 3DA1A 2WETA 4U8MA 3AEEA 1NPXA 1KDGA 2GMHA 4AT2A 1PBFA 4K8DA 3HZLA 3ZDNA 1NDAA 2FJAA 1FEAA 4NTEA 1JU2A 3FIMB 1EL7A 3OZ2A 2JB3A 3DJJA 1IUXA 1MXTA 1PJ6A 1TDKA 3NTAA 4JQ9A 4Z2TA 3II4A 3DK9A 1BGJA 3BI4A 3CNPA 4OPDA 3RHAA 3SQPA 5BUKA 3C96A 3NGCX 3SFEA 1QLBA 4B63A 1TDEA 1D4DA 3AE4A 3LJPA 1LQTA 2GQWA 3CGCA 4EIQA 2IIDA 4CRTA 3CTYA 2C3CA 1GXFA 3KU9A 4YWOA 5BULA 1PXAA 2I0ZA 5U25A 2WU5A 1RYIA 2GR1A 3AEBA 4K7ZA 2B9WA 4D04A 4H4ZA 5LV9A 3F8RA 2BCPA 2ZZCA 4J2WA 4A99A 3DH9A 2A89A 2Z5YA 1VG9A 2B9YA 3EAOA 3P1WA 3M12A 4NEWA 2WBAA 3DJDA 1DOCA 2VVMA 1JOAA 1NHSA 3H8LA 5C3JA 4H4SA 1KSUA 3NN6X 1NG4A 2BS4A 2YLRA 2ARDA 4FK1A 4YTMA 2RGJA 1LPFA 2JB1A 3UTFA 3EANA 1D4CA 4O5UA 4GUVA 1Z6LA 1NHRA 2J3NA 2C72A 3VRAA 2BS3A 1B37A 3KLJA 3KVEA 1ZP0A 2VQ7A 4IA6A 4AP3A 2XLRA 3GDNA 4CY8A 2GVCA 2FJEA 2RGHA 3AE1A 4OVIA 4UDPA 2WU2A 4YSZA 1RP0A 3UKHA 3L8KA 1FOHA 3UCLA 2YM2A 3O0HA 4BJYA 1BKWA 1GALA 3BI2A 4P9SA 1F8WA 4H2NA 2GV8A 2BXSA 1OJAA 3Q6JA 3GD4A 4X9MA 1O94A 3GDPA 1YQZA 3NK1X 4XXGA 1ZDLA 2Q0LA 2V61A 5IQ1A 3UTHA 4OPGA 2YR4A 3AE5A 4X9NA 1KSSA 4B69A 1DODA 3V3NA 2H89A 4GRTA 1PJ5A 4CCRA 1VG0A 1PBEA 2ZZ0A 3CPHG 4OPUA 3EPTA 5KWFA 1ZMCA 4EQXA 2WHDA 2BK3A 2E1MA 2XLSA 1BWCA 1IUWA 4H2PA 4H4TA 4PAAA 5KVIA 5HYMA 2WOWA 3COXA 1PJ7A 3ZYXA 1F8RA 3PO7A 4E0VA 2C65A 3P4SA 1BF3A 2JK6A 2BS2A 3P9UA 4Z25A 2XLPA 5IPYA 4YSYA 4ICYA 4LA1A 4TM0A 1H84A 2WESA 4JY2A 4JY3A 2ACZA 5JCNA 2A87A 4RSLA 4UP3A 2C66A 3BHFA 2Y6QA 2YLTA 3F8DA 3DGHA 5U63A 1GESA 3AB1A 4DNAA 5BRTA 4ECHA 1OJDA 1H82A 1GETA 2YM1A 2BK5A 2TPRA 3ABVA 2JKCA 3AEFA 2C70A 4JNAA 1Q1WA 4U2TA 4RG3A 3QJ4A 4K5SA 1FEBA 3BNUA 2PHHA 4EMJA 4USRA 3FPZA 4A79A 4CY6A 3EF6A 3UOYA 3ICSA 3GYIA 4GDEA 5C2TA 3G5SA 5EB4A 1B8SA 2X50A 3AD8B 5L46A 2JAEA 2YVGA 4U8JA 4XWRA 2C76A 1D5TA 4N9XA 1PDHA 5FS8A 5KXJA 2WOVA 4KPRA 4BURA 5HY5A 3DMEA 1JEHA 1JNRA 1GRAA 3V76A 4H4VA 3UKLA 4Z26A 1CF3A 1LVLA 4I59A 4YTNA 1ZX9A 1OJCA 2X99A 3AECA 1H81A 1L9CA 1ZOYA 3ALJA 3IHGA 1DOEA 3AE6A 5CKUA 1XANA 5J60A 2DKHA 1M6IA 3QVPA 1PBCA 2YG4A 4OPLA 2YVFA 4A7AA 1N1PA 1D4EA 1E6EA 4Y4LA 2GQFA 4CBQA 3ADAB 3KA7A 4U8LA 2WP5A 4RG4A 3UP5A 4H4YA 2EQ6A 4UDQA 3AE7A 4OPCA 5KOWA 3C4AA 5J7XA 3AEDA 1Q9IA 1JRZA 4NEVA 3UKQA 2XVIA 4U8NA 4H4PA 3DJGX 1EL9A 2XYOA 3UP4A 3D8XA 3K7TA 2YLSA 2GMJA 4C3XA 3IC9A 1XPQA 1H7XA 2BC1A 1JNZA 2R46A 2OLNA 1V59A 4B64A 1O5WA 1Y56A 1S2YA 2F5ZA 2QA2A 3UOVA 2GF3A 1IUUA 1KNRA 2JB2A 3CIRA 3KPFA 1L0VA 3NLCA 4A5LA 2B7SA 4YKFA 3LZWA 4IV9A 1ZKQA 3F8PA 1EBDA 1RSGA 1GPEA 1CC2A 1PBBA 2GAGB 4CCQA 5FS9A 1BZLA 1MOKA 1QJDA 4UDRA 4J34A 1TYTA 1UKVG 1JRYA 4FDCB 4H7UA 2VRLA 1YY5A 3NT6A 2GAHB 3H4KA 2QAEA 2R0CA 2V6OA 1GEUA 3NTDA 3AYLA 1GT8A 2GEWA 3FBSA 2YVJA 5EB5A 4JN9A 4YTPA 3ALLA 2WDRA 2X8HA 4FX9A 3SM8A 2X3NA 4U2SA 2YWLA 3P4RA 4BK3A 2R0GA 1GRFA 2C73A 3VR8A 3BNMA 5EOWA 1E1NA 1K0IA 2B7RA 2R0PA 2YQUA 1GRHA 3UKKA 5M10A 1EL8A 3GWFA 5KOXA 3NYFA 4Y4NA 4EQSA 5EBKA 1YKJA 1PN0A 3DK8A 4U8KA 4NZHA 3SGLA 4BV6A 4GDPA 3UKPA 1PBDA 3ATQA 1COYA 2XVFA 3PS9A 4OPTA 4K5RA 3UKAA 4J57A 2TMDA 2FBWA 3NYCA 1DXLA 1CJ4A 4GCMA 2GB0A 1GOSA 3GRTA 1F3PA 3RNMA 4AT0A 1NENA 2B9XA 2GR3A 3IWAA 1FECA 2YG6A 5U1OA 2WS3A 2GH5A 4OPIA 1ZOVA 1GTHA 2OA1A 4YKGA 2V3BA 3PVCA 3WE0A 3K30A 2HQMA 2BXRA 2EQ8A 2UZZA 3K7MX 3QFBA 4Y4MA 5FMHA 3BHKA 2Q7VA 2H88A 2Q6UA 1ZK7A 2XCGA 4LIIA 3REDA 4EQWA 3AE8A 3I6DA 2C75A 1PXCA 3GSIA 3AWIA 5IQ4A 2WDQA 1F8SA 2EQ7A 4PABA 2AAQA 4H4UA 1O95A 3VR9A 2YG5A 2OAMA 2XLTA 2YG3A 2YR5A 1LJ1A 4D03A 1DJQA 1OJTA 4C74A 2C7GA 1NAAA 1GNDA 2WEUA 5JCLA 4J56A 2XFPA 2B76A 4TLZA 1W4XA 4X4JA 1DOBA 2XFOA 2CVJA 3QSSA 3SFDA 3R9UA 3FMWA 4M52A 3G5RA 4Z2RA 1XHCA 1XDIA 2FJDA 4KX6A 4YSHA 1REOA 3P4PA 2WPFA 3NHOX 2NVKX 2GR0A 1JRXA 1S2QA 2XFQA 1TYPA 3AEGA 3M13A 2OALA 2ZZBA 5ER0A 4ZCCA 3UTEA 4APNA 3D1CA 3LB8A 3NNEA 1FL2A 1ELIA 1F6MA 2WP9A 2XFNA 3AEAA 3CNTA 4C3YA 1MO9A 2V60A 3GMBA 4TM1A 3RP6A 3UKFA 4EM4A 1SEZA 2Z5XA 2XVEA 4TM3A 1H86A 4XWZA 1PS9A 5JCKA 2R45A 1NHQA 1LTXR 1H83A 4A6NB 2BK4A 5TR3A 2OLOA 4TM4A 4C5OA 1P2EA 2XFUA 4GR1A 1D7LA 1D7YA 4MJWA 2WP6A 2WDVA 3NK0X 1GSNA 4I58A 2BABA 4Z24A 4AOXA 4HA6A 4BK1A 3CPIG 2WPCA 2CFYA 2YG7A 3KKJA 2BA9A 4J31A 4FK1C 2VQBA 5JCMA 3KD9A 1K0JA 3GD3A 3VRDB 4DSGA 4EM3A 3ISHA 5JCIA 1PHHA 2V5ZA 3AE3A 1KNPA 2EQ9A 3DGZA 5CQFA 4DSHA 3H8IA 1ZY8A 1DJNA 1YQ4A 1ONFA 2BC0A 2WPEA 2XDOA 2APGA 4AOSA 2C3DA 4H4QA 4U8PA 4EMIA 2Q0KA 3GWDA 3QVRA 4H4RA 1N4UA 1BGNA 1VQWA 2A8XA 1IUSA 3AYJA 2XVJA 4Z44A 4NTDA 3UOZA 3GYJA 1CJCA 1GRGA 2IVEA 4DGKA 3NRNA 4YXDA 3AD7B 4ADWA 2AQJA 2YLWA 1B5QA 2NPXA 3GRSA 2JBVA 3E1TA 4JDRA 1CBOA 1L9EA 2DKIA 1VDCA 2YLXA 5FS7A 1QO8A 4J36A 3GMCA 1AOGA 1GTEA 2YR6A 2RABA 2R9ZA 2CULA 3CNSA 2VZ2A 3NYEA 3P4QA 3RP7A 4B68A 4Z2UA 1PXBA 3CNDA 3NG7X 3OC4A 1TDFA 3UOXA 3NN0X 4OCGA 1CC4A 2WOIA 4O5QA 3G5QA 3CGBA 5GSNA 4B1BA 1YQ3A 1CJ2A 3IHMA 3Q9TA 2BYBA 5DBJA 4K2XA 3NH3X 2RGOA 3B6DA 2GRTA 3V3OA 2IVDA 3AYIA 4A9WA 3I3LA 4HB9A 4YT0A 3LXDA 3LADA 5BVAA 3BI5A 2QA1A 3NK2X 2QCUA 3ATRA 4J33A 2PYXA 1E1MA 1H7WA 4A6NA 2XVHA 4ZN0A 4BK2A 4WCTA 1L9DA 2X8GA 3C4NA 4REKA 3NKSA 2E4GA 4H50A 1FCDA 2BACA 2VVLG 3CN8A 1VRQB 3UTGA 1TRBA 1GRBA 5FS6A 4EMWA 1DNCA 2VVLA 4CNKA 4Z43A 3VQRA 1NHPA 3NIXA 4CNJA 1E7PA 1CHUA 3S61A 1N4VA 4YSXA 1Y56B 3FG2P 2VRMA 3ITJA 1LQUA 3K7QX 1E1KA 2XLUA 3LZXA 3QFAA 2ZBWA 4H2RA 3RP8A 2Y6RA 3DJEA 3JSKA 4AP1A 2C64A 4EIPA 2C67A 5KRQA 1P2HA 5KVHA 3VRBA 1ZMDA 2AR8A 1Q1RA 3AE2A 1CC6A 1CJ3A 1B4VA 2WQYA 2GR2A 2FJBA 1KFYA 1CL0A 1IUTA 1E39A 3AD9B 3AE9A 1KF6A 3ICRA 5HXIA 1GERA 1GV4A 2E5VA 4B67A 4H4WA 2V3AA 4C77A 4U2LA 2R4JA
chains in the Genus database with same CATH superfamily
4USQA 1X31B 2W0HA 3LOVA 4K22A 3ALMA 5GRTA 4WX1A 4U8OA 3ICTA 1IJHA 2YAUA 3CPJG 4IVMB 2O9ZA 4ZCDA 4B65A 1EL5A 3T37A 4TLXA 3IF9A 4H4XA 4BJZA 4IVOB 1S3BA 3QSEA 4LU6A 1HYUA 1NEKA 4JNQA 4B66A 3CNJA 3M0OA 1N4WA 1E1LA 1NG3A 4A65A 1K0LA 1OJ9A 4EQRA 1IUVA 4GAVA 3URHA 1GRTA 1GREA 3S5WA 1TDNA 3QSMA 5HHFA 2R4EA 3CGEA 2X8CA 2VOUA 2BCGG 4NTCA 1TDOA 4GF7A 3CGDA 1S3EA 2CDUA 4IA5A 1K4QA 4H2QA 4U8IA 1H6VA 1LV0A 1Y0PA 5M0ZA 3B3RA 1M64A 2YLZA 3L1RA 3AXBA 3DK4A 3DA1A 2WETA 4U8MA 3AEEA 1NPXA 2BRAA 1KDGA 2GMHA 4AT2A 1PBFA 4K8DA 3HZLA 3ZDNA 1NDAA 2FJAA 1FEAA 4NTEA 1JU2A 3FIMB 1EL7A 3OZ2A 2JB3A 3DJJA 1IUXA 1MXTA 5KMQA 1PJ6A 1TDKA 3NTAA 4JQ9A 4Z2TA 3II4A 3DK9A 1BGJA 3BI4A 3CNPA 4OPDA 3RHAA 3SQPA 5BUKA 3C96A 3NGCX 3SFEA 1QLBA 4B63A 1TDEA 1D4DA 3AE4A 3LJPA 1LQTA 2GQWA 3CGCA 4EIQA 5KNLA 2IIDA 4CRTA 3CTYA 2C3CA 1GXFA 3KU9A 4YWOA 5BULA 1PXAA 2I0ZA 5U25A 2WU5A 1RYIA 2GR1A 3AEBA 4K7ZA 2B9WA 4D04A 4H4ZA 5LV9A 3F8RA 2BCPA 2ZZCA 4J2WA 4A99A 3DH9A 2A89A 2Z5YA 1VG9A 2B9YA 3EAOA 3P1WA 3M12A 4NEWA 2WBAA 3DJDA 1DOCA 2VVMA 1JOAA 1NHSA 3H8LA 5C3JA 4H4SA 1KSUA 3NN6X 1NG4A 2BS4A 2YLRA 3GYXA 2ARDA 4FK1A 4YTMA 5KMPA 2RGJA 1LPFA 2JB1A 3UTFA 3EANA 1D4CA 4O5UA 4GUVA 1Z6LA 1NHRA 2J3NA 2C72A 3VRAA 2BS3A 1B37A 3KLJA 3KVEA 1ZP0A 2VQ7A 4IA6A 4AP3A 2XLRA 3GDNA 4CY8A 2GVCA 2FJEA 2RGHA 3AE1A 4OVIA 4UDPA 2WU2A 4YSZA 1RP0A 3HYVA 3L8KA 3UKHA 1FOHA 3UCLA 2YM2A 3CMMA 3O0HA 4GAPA 4BJYA 1BKWA 5KMRA 1GALA 3BI2A 4P9SA 1F8WA 4H2NA 2BXSA 1OJAA 2GV8A 3Q6JA 3GD4A 4X9MA 1O94A 3GDPA 1YQZA 3NK1X 4XXGA 1ZDLA 2Q0LA 2V61A 5IQ1A 3UTHA 4OPGA 2YR4A 3AE5A 4X9NA 1KSSA 4B69A 1DODA 3V3NA 2H89A 4GRTA 1PJ5A 4CCRA 1VG0A 1PBEA 2ZZ0A 3CPHG 4OPUA 3EPTA 5KWFA 1ZMCA 4EQXA 2WHDA 2BK3A 2E1MA 2XLSA 1BWCA 1IUWA 4H2PA 4H4TA 4PAAA 5KVIA 5HYMA 2WOWA 3COXA 1PJ7A 3ZYXA 1F8RA 3PO7A 4E0VA 2C65A 3P4SA 1BF3A 2JK6A 2BS2A 3P9UA 4Z25A 2XLPA 5IPYA 4YSYA 4ICYA 4LA1A 4TM0A 1H84A 2WESA 4JY2A 4JY3A 2ACZA 5JCNA 2A87A 4RSLA 4UP3A 2C66A 3BHFA 2Y6QA 2YLTA 3F8DA 3DGHA 5U63A 1GESA 3AB1A 4DNAA 5BRTA 4ECHA 1OJDA 1H82A 1GETA 2YM1A 2BK5A 2TPRA 3ABVA 2JKCA 3AEFA 2C70A 4JNAA 1Q1WA 4U2TA 4RG3A 3QJ4A 4K5SA 1FEBA 3BNUA 2PHHA 4EMJA 4USRA 3FPZA 4A79A 4CY6A 3EF6A 3UOYA 3ICSA 3GYIA 4GDEA 5C2TA 3G5SA 5EB4A 1B8SA 2X50A 3AD8B 5L46A 2JAEA 2YVGA 4U8JA 4XWRA 3T0KA 2C76A 1D5TA 4N9XA 1PDHA 5FS8A 5KXJA 2WOVA 4KPRA 4BURA 5HY5A 3DMEA 1JEHA 1JNRA 1GRAA 3V76A 4H4VA 3UKLA 4Z26A 1CF3A 1LVLA 4I59A 4YTNA 1ZX9A 1OJCA 2X99A 3AECA 1H81A 1L9CA 1ZOYA 3ALJA 3IHGA 1DOEA 3AE6A 5CKUA 1XANA 5J60A 2DKHA 1M6IA 3QVPA 1PBCA 2YG4A 4OPLA 2YVFA 4A7AA 1N1PA 1D4EA 1E6EA 3KPKA 2GQFA 4Y4LA 4CBQA 3ADAB 3KA7A 4NNJA 4U8LA 2WP5A 4RG4A 3UP5A 4H4YA 2EQ6A 4UDQA 3AE7A 4OPCA 5KOWA 3C4AA 5J7XA 3AEDA 1Q9IA 1JRZA 4NEVA 3UKQA 3SX6A 2XVIA 4U8NA 4H4PA 3DJGX 1EL9A 2XYOA 3UP4A 3D8XA 3K7TA 2YLSA 2GMJA 4C3XA 3T2KA 3IC9A 1XPQA 1H7XA 2BC1A 1JNZA 2R46A 2OLNA 1V59A 4B64A 1O5WA 1Y56A 1S2YA 2F5ZA 2QA2A 3UOVA 2GF3A 1IUUA 1KNRA 2JB2A 3CIRA 3KPFA 1L0VA 3NLCA 4A5LA 4II2A 2B7SA 4YKFA 3LZWA 4IV9A 1ZKQA 3F8PA 1EBDA 1RSGA 1GPEA 1CC2A 1PBBA 2GAGB 3HYWA 3SXIA 5FS9A 4CCQA 1BZLA 1MOKA 1QJDA 4UDRA 3T2YA 4J34A 1TYTA 1UKVG 1JRYA 4FDCB 4H7UA 2VRLA 1YY5A 3NT6A 2GAHB 3H4KA 2QAEA 2R0CA 2V6OA 1GEUA 3NTDA 3T14A 3T2ZA 3AYLA 1GT8A 2GEWA 3FBSA 2YVJA 5EB5A 4JN9A 4YTPA 3ALLA 2WDRA 2X8HA 4FX9A 3SM8A 2X3NA 4U2SA 2YWLA 3P4RA 4BK3A 2R0GA 1GRFA 2C73A 3VR8A 3BNMA 5EOWA 1E1NA 1K0IA 2B7RA 2R0PA 2YQUA 1GRHA 3SZCA 3UKKA 1EL8A 3GWFA 5KOXA 5M10A 3NYFA 4Y4NA 4EQSA 5EBKA 1YKJA 1PN0A 3DK8A 4U8KA 4NZHA 3SGLA 3SZ0A 4GDPA 3UKPA 4BV6A 1PBDA 3ATQA 1COYA 2XVFA 3PS9A 4OPTA 4K5RA 3UKAA 4J57A 2TMDA 2FBWA 3NYCA 1DXLA 1CJ4A 4GCMA 2GB0A 1GOSA 3GRTA 1F3PA 3RNMA 4AT0A 4G73A 1NENA 2B9XA 2GR3A 3IWAA 1FECA 2YG6A 5U1OA 2WS3A 2GH5A 4OPIA 1ZOVA 1GTHA 2OA1A 4YKGA 2V3BA 3PVCA 3WE0A 3K30A 2HQMA 2BXRA 2EQ8A 2UZZA 3K7MX 3QFBA 4Y4MA 5FMHA 3BHKA 2Q7VA 2H88A 2Q6UA 1ZK7A 2XCGA 4LIIA 3REDA 4EQWA 3AE8A 3I6DA 2C75A 1PXCA 3GSIA 3AWIA 5IQ4A 2WDQA 1F8SA 2EQ7A 4PABA 2AAQA 4H4UA 1O95A 3VR9A 2YG5A 2OAMA 2XLTA 2YG3A 2YR5A 1LJ1A 4D03A 1DJQA 1OJTA 4C74A 2C7GA 1NAAA 1GNDA 2WEUA 5JCLA 4J56A 2XFPA 2B76A 4TLZA 1W4XA 4X4JA 1DOBA 2XFOA 2CVJA 3QSSA 3SFDA 3R9UA 3FMWA 4M52A 3G5RA 4Z2RA 1XHCA 1XDIA 2FJDA 4KX6A 4YSHA 1REOA 3P4PA 2WPFA 5KMSA 3NHOX 2NVKX 2GR0A 1JRXA 1S2QA 2XFQA 1TYPA 3AEGA 3M13A 2OALA 2ZZBA 5ER0A 4ZCCA 3UTEA 4APNA 3D1CA 3LB8A 3NNEA 1FL2A 1ELIA 1F6MA 2WP9A 2XFNA 3AEAA 3HYXA 3CNTA 4C3YA 1MO9A 2V60A 3GMBA 4TM1A 3RP6A 3UKFA 4EM4A 1SEZA 2Z5XA 2XVEA 4TM3A 1H86A 4XWZA 1PS9A 5JCKA 2R45A 1NHQA 1LTXR 1H83A 2C4CA 4A6NB 2BK4A 3SZWA 5TR3A 2OLOA 4TM4A 4C5OA 1P2EA 2XFUA 4GR1A 1D7LA 1D7YA 4MJWA 2WP6A 2WDVA 3NK0X 1GSNA 4I58A 2BABA 4Z24A 4AOXA 4HA6A 4NWZA 4BK1A 3CPIG 2WPCA 2CFYA 2YG7A 3KKJA 2BA9A 4J31A 4FK1C 2VQBA 5JCMA 3KD9A 1K0JA 3GD3A 3VRDB 4DSGA 4EM3A 3ISHA 5JCIA 1PHHA 2V5ZA 3AE3A 1KNPA 2EQ9A 3DGZA 5CQFA 4DSHA 3H8IA 1ZY8A 1DJNA 1YQ4A 1ONFA 2BC0A 2WPEA 2XDOA 2APGA 4AOSA 2C3DA 4H4QA 4U8PA 4EMIA 2Q0KA 3GWDA 3QVRA 4H4RA 1N4UA 1BGNA 1VQWA 2A8XA 1IUSA 3AYJA 2XVJA 4Z44A 3SZFA 4NTDA 3UOZA 3GYJA 1CJCA 1GRGA 2IVEA 4DGKA 3NRNA 4YXDA 3AD7B 4ADWA 2AQJA 2YLWA 1B5QA 2NPXA 3GRSA 2JBVA 3E1TA 4JDRA 1CBOA 1L9EA 2DKIA 1VDCA 2YLXA 5FS7A 1QO8A 4J36A 3GMCA 1AOGA 1GTEA 2YR6A 2RABA 2R9ZA 2CULA 3CNSA 4G6GA 2VZ2A 3NYEA 3P4QA 3RP7A 4B68A 4Z2UA 1PXBA 3CNDA 3NG7X 3OC4A 1TDFA 3UOXA 3NN0X 3T31A 4G6HA 4OCGA 1CC4A 2WOIA 4O5QA 3G5QA 3CGBA 5GSNA 4B1BA 1YQ3A 1CJ2A 2BRYA 3IHMA 3Q9TA 2BYBA 5DBJA 4K2XA 3NH3X 2RGOA 3B6DA 2GRTA 3V3OA 2IVDA 3AYIA 4A9WA 3I3LA 4HB9A 4YT0A 3LXDA 3LADA 5BVAA 3BI5A 2QA1A 3SY4A 3NK2X 2QCUA 3ATRA 4J33A 2PYXA 1E1MA 1H7WA 3SYIA 2XVHA 4A6NA 4ZN0A 4G9KA 4WCTA 1L9DA 2X8GA 3C4NA 4BK2A 4REKA 3NKSA 2E4GA 4H50A 1FCDA 2BACA 2VVLG 3CN8A 1VRQB 3UTGA 1TRBA 1GRBA 5FS6A 4EMWA 1DNCA 2VVLA 4CNKA 4Z43A 3VQRA 1NHPA 3NIXA 4CNJA 1E7PA 1CHUA 4G74A 1N4VA 3S61A 4YSXA 1Y56B 3FG2P 2VRMA 3ITJA 1LQUA 3K7QX 1E1KA 2XLUA 3LZXA 3QFAA 2ZBWA 4H2RA 3RP8A 2Y6RA 3DJEA 3JSKA 4AP1A 2C64A 4EIPA 2C67A 4II3A 5KRQA 1P2HA 5KVHA 3VRBA 1ZMDA 2AR8A 1Q1RA 3AE2A 1CC6A 1CJ3A 1B4VA 2WQYA 2GR2A 2FJBA 1KFYA 1CL0A 1IUTA 1E39A 3AD9B 3AE9A 1KF6A 3ICRA 5HXIA 1GERA 1GV4A 2E5VA 4B67A 4H4WA 2V3AA 4C77A 4U2LA 2R4JA
chains in the Genus database with same CATH topology
4USQA 1X31B 2W0HA 3LOVA 4K22A 3ALMA 5GRTA 4WX1A 4U8OA 3ICTA 1IJHA 2YAUA 3CPJG 4IVMB 2O9ZA 4ZCDA 4B65A 1EL5A 3T37A 4TLXA 3IF9A 4H4XA 4BJZA 4IVOB 1S3BA 3QSEA 4LU6A 1HYUA 1NEKA 4JNQA 4B66A 3CNJA 3M0OA 1N4WA 1E1LA 1NG3A 4A65A 1K0LA 1OJ9A 4EQRA 1IUVA 4GAVA 3URHA 1GRTA 1GREA 3S5WA 1TDNA 3QSMA 5HHFA 2R4EA 3CGEA 2X8CA 2VOUA 2BCGG 4NTCA 1TDOA 4GF7A 3CGDA 1S3EA 2CDUA 4IA5A 1K4QA 4H2QA 4U8IA 1H6VA 1LV0A 1Y0PA 5M0ZA 3B3RA 1M64A 2YLZA 3L1RA 3AXBA 3DK4A 3DA1A 2WETA 4U8MA 3AEEA 1NPXA 2BRAA 1KDGA 2GMHA 4AT2A 1PBFA 4K8DA 3HZLA 3ZDNA 1NDAA 2FJAA 1FEAA 4NTEA 1JU2A 3FIMB 1EL7A 3OZ2A 2JB3A 3DJJA 1IUXA 1MXTA 5KMQA 1PJ6A 1TDKA 3NTAA 4JQ9A 4Z2TA 3II4A 3DK9A 1BGJA 3BI4A 3CNPA 4OPDA 3RHAA 3SQPA 5BUKA 3C96A 3NGCX 3SFEA 1QLBA 4B63A 1TDEA 1D4DA 3AE4A 3LJPA 1LQTA 2GQWA 3CGCA 4EIQA 5KNLA 2IIDA 4CRTA 3CTYA 2C3CA 1GXFA 3KU9A 4YWOA 5BULA 1PXAA 2I0ZA 5U25A 2WU5A 1RYIA 2GR1A 3AEBA 4K7ZA 2B9WA 4D04A 4H4ZA 5LV9A 3F8RA 2BCPA 2ZZCA 4J2WA 4A99A 3DH9A 2A89A 2Z5YA 1VG9A 2B9YA 3EAOA 3P1WA 3M12A 4NEWA 2WBAA 3DJDA 1DOCA 2VVMA 1JOAA 1NHSA 3H8LA 5C3JA 4H4SA 1KSUA 3NN6X 1NG4A 2BS4A 2YLRA 3GYXA 2ARDA 4FK1A 4YTMA 5KMPA 2RGJA 1LPFA 2JB1A 3UTFA 3EANA 1D4CA 4O5UA 4GUVA 1Z6LA 1NHRA 2J3NA 2C72A 3VRAA 2BS3A 1B37A 3KLJA 3KVEA 1ZP0A 2VQ7A 4IA6A 4AP3A 2XLRA 3GDNA 4CY8A 2GVCA 2FJEA 2RGHA 3AE1A 4OVIA 4UDPA 2WU2A 4YSZA 1RP0A 3HYVA 3L8KA 3UKHA 1FOHA 3UCLA 2YM2A 3CMMA 3O0HA 4GAPA 4BJYA 1BKWA 5KMRA 1GALA 3BI2A 4P9SA 1F8WA 4H2NA 2BXSA 1OJAA 2GV8A 3Q6JA 3GD4A 4X9MA 1O94A 3GDPA 1YQZA 3NK1X 4XXGA 1ZDLA 2Q0LA 2V61A 5IQ1A 3UTHA 4OPGA 2YR4A 3AE5A 4X9NA 1KSSA 4B69A 1DODA 3V3NA 2H89A 4GRTA 1PJ5A 4CCRA 1VG0A 1PBEA 2ZZ0A 3CPHG 4OPUA 3EPTA 5KWFA 1ZMCA 4EQXA 2WHDA 2BK3A 2E1MA 2XLSA 1BWCA 1IUWA 4H2PA 4H4TA 4PAAA 5KVIA 5HYMA 2WOWA 3COXA 1PJ7A 3ZYXA 1F8RA 3PO7A 4E0VA 2C65A 3P4SA 1BF3A 2JK6A 2BS2A 3P9UA 4Z25A 2XLPA 5IPYA 4YSYA 4ICYA 4LA1A 4TM0A 1H84A 2WESA 4JY2A 4JY3A 2ACZA 5JCNA 2A87A 4RSLA 4UP3A 2C66A 3BHFA 2Y6QA 2YLTA 3F8DA 3DGHA 5U63A 1GESA 3AB1A 4DNAA 5BRTA 4ECHA 1OJDA 1H82A 1GETA 2YM1A 2BK5A 2TPRA 3ABVA 2JKCA 3AEFA 2C70A 4JNAA 1Q1WA 4U2TA 4RG3A 3QJ4A 4K5SA 1FEBA 3BNUA 2PHHA 4EMJA 4USRA 3FPZA 4A79A 4CY6A 3EF6A 3UOYA 3ICSA 3GYIA 4GDEA 5C2TA 3G5SA 5EB4A 1B8SA 2X50A 3AD8B 5L46A 2JAEA 2YVGA 4U8JA 4XWRA 3T0KA 2C76A 1D5TA 4N9XA 1PDHA 5FS8A 5KXJA 2WOVA 4KPRA 4BURA 5HY5A 3DMEA 1JEHA 1JNRA 1GRAA 3V76A 4H4VA 3UKLA 4Z26A 1CF3A 1LVLA 4I59A 4YTNA 1ZX9A 1OJCA 2X99A 3AECA 1H81A 1L9CA 1ZOYA 3ALJA 3IHGA 1DOEA 3AE6A 5CKUA 1XANA 5J60A 2DKHA 1M6IA 3QVPA 1PBCA 2YG4A 4OPLA 2YVFA 4A7AA 1N1PA 1D4EA 1E6EA 3KPKA 2GQFA 4Y4LA 4CBQA 3ADAB 3KA7A 4NNJA 4U8LA 2WP5A 4RG4A 3UP5A 4H4YA 2EQ6A 4UDQA 3AE7A 4OPCA 5KOWA 3C4AA 5J7XA 3AEDA 1Q9IA 1JRZA 4NEVA 3UKQA 3SX6A 2XVIA 4U8NA 4H4PA 3DJGX 1EL9A 2XYOA 3UP4A 3D8XA 3K7TA 2YLSA 2GMJA 4C3XA 3T2KA 3IC9A 1XPQA 1H7XA 2BC1A 1JNZA 2R46A 2OLNA 1V59A 4B64A 1O5WA 1Y56A 1S2YA 2F5ZA 2QA2A 3UOVA 2GF3A 1IUUA 1KNRA 2JB2A 3CIRA 3KPFA 1L0VA 3NLCA 4A5LA 4II2A 2B7SA 4YKFA 3LZWA 4IV9A 1ZKQA 3F8PA 1EBDA 1RSGA 1GPEA 1CC2A 1PBBA 2GAGB 3HYWA 3SXIA 5FS9A 4CCQA 1BZLA 1MOKA 1QJDA 4UDRA 3T2YA 4J34A 1TYTA 1UKVG 1JRYA 4FDCB 4H7UA 2VRLA 1YY5A 3NT6A 2GAHB 3H4KA 2QAEA 2R0CA 2V6OA 1GEUA 3NTDA 3T14A 3T2ZA 3AYLA 1GT8A 2GEWA 3FBSA 2YVJA 5EB5A 4JN9A 4YTPA 3ALLA 2WDRA 2X8HA 4FX9A 3SM8A 2X3NA 4U2SA 2YWLA 3P4RA 4BK3A 2R0GA 1GRFA 2C73A 3VR8A 3BNMA 5EOWA 1E1NA 1K0IA 2B7RA 2R0PA 2YQUA 1GRHA 3SZCA 3UKKA 1EL8A 3GWFA 5KOXA 5M10A 3NYFA 4Y4NA 4EQSA 5EBKA 1YKJA 1PN0A 3DK8A 4U8KA 4NZHA 3SGLA 3SZ0A 4GDPA 3UKPA 4BV6A 1PBDA 3ATQA 1COYA 2XVFA 3PS9A 4OPTA 4K5RA 3UKAA 4J57A 2TMDA 2FBWA 3NYCA 1DXLA 1CJ4A 4GCMA 2GB0A 1GOSA 3GRTA 1F3PA 3RNMA 4AT0A 4G73A 1NENA 2B9XA 2GR3A 3IWAA 1FECA 2YG6A 5U1OA 2WS3A 2GH5A 4OPIA 1ZOVA 1GTHA 2OA1A 4YKGA 2V3BA 3PVCA 3WE0A 3K30A 2HQMA 2BXRA 2EQ8A 2UZZA 3K7MX 3QFBA 4Y4MA 5FMHA 3BHKA 2Q7VA 2H88A 2Q6UA 1ZK7A 2XCGA 4LIIA 3REDA 4EQWA 3AE8A 3I6DA 2C75A 1PXCA 3GSIA 3AWIA 5IQ4A 2WDQA 1F8SA 2EQ7A 4PABA 2AAQA 4H4UA 1O95A 3VR9A 2YG5A 2OAMA 2XLTA 2YG3A 2YR5A 1LJ1A 4D03A 1DJQA 1OJTA 4C74A 2C7GA 1NAAA 1GNDA 2WEUA 5JCLA 4J56A 2XFPA 2B76A 4TLZA 1W4XA 4X4JA 1DOBA 2XFOA 2CVJA 3QSSA 3SFDA 3R9UA 3FMWA 4M52A 3G5RA 4Z2RA 1XHCA 1XDIA 2FJDA 4KX6A 4YSHA 1REOA 3P4PA 2WPFA 5KMSA 3NHOX 2NVKX 2GR0A 1JRXA 1S2QA 2XFQA 1TYPA 3AEGA 3M13A 2OALA 2ZZBA 5ER0A 4ZCCA 3UTEA 4APNA 3D1CA 3LB8A 3NNEA 1FL2A 1ELIA 1F6MA 2WP9A 2XFNA 3AEAA 3HYXA 3CNTA 4C3YA 1MO9A 2V60A 3GMBA 4TM1A 3RP6A 3UKFA 4EM4A 1SEZA 2Z5XA 2XVEA 4TM3A 1H86A 4XWZA 1PS9A 5JCKA 2R45A 1NHQA 1LTXR 1H83A 2C4CA 4A6NB 2BK4A 3SZWA 5TR3A 2OLOA 4TM4A 4C5OA 1P2EA 2XFUA 4GR1A 1D7LA 1D7YA 4MJWA 2WP6A 2WDVA 3NK0X 1GSNA 4I58A 2BABA 4Z24A 4AOXA 4HA6A 4NWZA 4BK1A 3CPIG 2WPCA 2CFYA 2YG7A 3KKJA 2BA9A 4J31A 4FK1C 2VQBA 5JCMA 3KD9A 1K0JA 3GD3A 3VRDB 4DSGA 4EM3A 3ISHA 5JCIA 1PHHA 2V5ZA 3AE3A 1KNPA 2EQ9A 3DGZA 5CQFA 4DSHA 3H8IA 1ZY8A 1DJNA 1YQ4A 1ONFA 2BC0A 2WPEA 2XDOA 2APGA 4AOSA 2C3DA 4H4QA 4U8PA 4EMIA 2Q0KA 3GWDA 3QVRA 4H4RA 1N4UA 1BGNA 1VQWA 2A8XA 1IUSA 3AYJA 2XVJA 4Z44A 3SZFA 4NTDA 3UOZA 3GYJA 1CJCA 1GRGA 2IVEA 4DGKA 3NRNA 4YXDA 3AD7B 4ADWA 2AQJA 2YLWA 1B5QA 2NPXA 3GRSA 2JBVA 3E1TA 4JDRA 1CBOA 1L9EA 2DKIA 1VDCA 2YLXA 5FS7A 1QO8A 4J36A 3GMCA 1AOGA 1GTEA 2YR6A 2RABA 2R9ZA 2CULA 3CNSA 4G6GA 2VZ2A 3NYEA 3P4QA 3RP7A 4B68A 4Z2UA 1PXBA 3CNDA 3NG7X 3OC4A 1TDFA 3UOXA 3NN0X 3T31A 4G6HA 4OCGA 1CC4A 2WOIA 4O5QA 3G5QA 3CGBA 5GSNA 4B1BA 1YQ3A 1CJ2A 2BRYA 3IHMA 3Q9TA 2BYBA 5DBJA 4K2XA 3NH3X 2RGOA 3B6DA 2GRTA 3V3OA 2IVDA 3AYIA 4A9WA 3I3LA 4HB9A 4YT0A 3LXDA 3LADA 5BVAA 3BI5A 2QA1A 3SY4A 3NK2X 2QCUA 3ATRA 4J33A 2PYXA 1E1MA 1H7WA 3SYIA 2XVHA 4A6NA 4ZN0A 4G9KA 4WCTA 1L9DA 2X8GA 3C4NA 4BK2A 4REKA 3NKSA 2E4GA 4H50A 1FCDA 2BACA 2VVLG 3CN8A 1VRQB 3UTGA 1TRBA 1GRBA 5FS6A 4EMWA 1DNCA 2VVLA 4CNKA 4Z43A 3VQRA 1NHPA 3NIXA 4CNJA 1E7PA 1CHUA 4G74A 1N4VA 3S61A 4YSXA 1Y56B 3FG2P 2VRMA 3ITJA 1LQUA 3K7QX 1E1KA 2XLUA 3LZXA 3QFAA 2ZBWA 4H2RA 3RP8A 2Y6RA 3DJEA 3JSKA 4AP1A 2C64A 4EIPA 2C67A 4II3A 5KRQA 1P2HA 5KVHA 3VRBA 1ZMDA 2AR8A 1Q1RA 3AE2A 1CC6A 1CJ3A 1B4VA 2WQYA 2GR2A 2FJBA 1KFYA 1CL0A 1IUTA 1E39A 3AD9B 3AE9A 1KF6A 3ICRA 5HXIA 1GERA 1GV4A 2E5VA 4B67A 4H4WA 2V3AA 4C77A 4U2LA 2R4JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4USQ A;  1X31 B;  2W0H A;  3LOV A;  4K22 A;  3ALM A;  5GRT A;  4WX1 A;  4U8O A;  3ICT A;  1IJH A;  2YAU A;  3CPJ G;  4IVM B;  2O9Z A;  4ZCD A;  4B65 A;  1EL5 A;  3T37 A;  4TLX A;  3IF9 A;  4H4X A;  4BJZ A;  4IVO B;  1S3B A;  3QSE A;  4LU6 A;  1HYU A;  1NEK A;  4JNQ A;  4B66 A;  3CNJ A;  3M0O A;  1N4W A;  1E1L A;  1NG3 A;  4A65 A;  1K0L A;  1OJ9 A;  4EQR A;  1IUV A;  3URH A;  1GRT A;  1GRE A;  3S5W A;  1TDN A;  3QSM A;  5HHF A;  2R4E A;  3CGE A;  2X8C A;  2VOU A;  2BCG G;  4NTC A;  1TDO A;  4GF7 A;  3CGD A;  1S3E A;  2CDU A;  4IA5 A;  1K4Q A;  4H2Q A;  4U8I A;  1H6V A;  1LV0 A;  1Y0P A;  5M0Z A;  3B3R A;  1M64 A;  2YLZ A;  3L1R A;  3AXB A;  3DK4 A;  3DA1 A;  2WET A;  4U8M A;  3AEE A;  1NPX A;  1KDG A;  2GMH A;  4AT2 A;  1PBF A;  4K8D A;  3HZL A;  3ZDN A;  1NDA A;  2FJA A;  1FEA A;  4NTE A;  1JU2 A;  3FIM B;  1EL7 A;  3OZ2 A;  2JB3 A;  3DJJ A;  1IUX A;  1MXT A;  1PJ6 A;  1TDK A;  3NTA A;  4JQ9 A;  4Z2T A;  3II4 A;  3DK9 A;  1BGJ A;  3BI4 A;  3CNP A;  4OPD A;  3RHA A;  3SQP A;  5BUK A;  3C96 A;  3NGC X;  3SFE A;  1QLB A;  4B63 A;  1TDE A;  1D4D A;  3AE4 A;  3LJP A;  1LQT A;  2GQW A;  3CGC A;  4EIQ A;  2IID A;  4CRT A;  3CTY A;  2C3C A;  1GXF A;  3KU9 A;  4YWO A;  5BUL A;  1PXA A;  2I0Z A;  5U25 A;  2WU5 A;  1RYI A;  2GR1 A;  3AEB A;  4K7Z A;  2B9W A;  4D04 A;  4H4Z A;  5LV9 A;  3F8R A;  2BCP A;  2ZZC A;  4J2W A;  4A99 A;  3DH9 A;  2A89 A;  2Z5Y A;  1VG9 A;  2B9Y A;  3EAO A;  3P1W A;  3M12 A;  4NEW A;  2WBA A;  3DJD A;  1DOC A;  2VVM A;  1JOA A;  1NHS A;  3H8L A;  5C3J A;  4H4S A;  1KSU A;  3NN6 X;  1NG4 A;  2BS4 A;  2YLR A;  2ARD A;  4FK1 A;  4YTM A;  2RGJ A;  1LPF A;  2JB1 A;  3UTF A;  3EAN A;  1D4C A;  4O5U A;  4GUV A;  1Z6L A;  1NHR A;  2J3N A;  2C72 A;  3VRA A;  2BS3 A;  1B37 A;  3KLJ A;  3KVE A;  1ZP0 A;  2VQ7 A;  4IA6 A;  4AP3 A;  2XLR A;  3GDN A;  4CY8 A;  2GVC A;  2FJE A;  2RGH A;  3AE1 A;  4OVI A;  4UDP A;  2WU2 A;  4YSZ A;  1RP0 A;  3UKH A;  3L8K A;  1FOH A;  3UCL A;  2YM2 A;  3O0H A;  4BJY A;  1BKW A;  1GAL A;  3BI2 A;  4P9S A;  1F8W A;  4H2N A;  2GV8 A;  2BXS A;  1OJA A;  3Q6J A;  3GD4 A;  4X9M A;  1O94 A;  3GDP A;  1YQZ A;  3NK1 X;  4XXG A;  1ZDL A;  2Q0L A;  2V61 A;  5IQ1 A;  3UTH A;  4OPG A;  2YR4 A;  3AE5 A;  4X9N A;  1KSS A;  4B69 A;  1DOD A;  3V3N A;  2H89 A;  4GRT A;  1PJ5 A;  4CCR A;  1VG0 A;  1PBE A;  2ZZ0 A;  3CPH G;  4OPU A;  3EPT A;  5KWF A;  1ZMC A;  4EQX A;  2WHD A;  2BK3 A;  2E1M A;  2XLS A;  1BWC A;  1IUW A;  4H2P A;  4H4T A;  4PAA A;  5KVI A;  5HYM A;  2WOW A;  3COX A;  1PJ7 A;  3ZYX A;  1F8R A;  3PO7 A;  4E0V A;  2C65 A;  3P4S A;  1BF3 A;  2JK6 A;  2BS2 A;  3P9U A;  4Z25 A;  2XLP A;  5IPY A;  4YSY A;  4ICY A;  4LA1 A;  4TM0 A;  1H84 A;  2WES A;  4JY2 A;  4JY3 A;  2ACZ A;  5JCN A;  2A87 A;  4RSL A;  4UP3 A;  2C66 A;  3BHF A;  2Y6Q A;  2YLT A;  3F8D A;  3DGH A;  5U63 A;  1GES A;  3AB1 A;  4DNA A;  5BRT A;  4ECH A;  1OJD A;  1H82 A;  1GET A;  2YM1 A;  2BK5 A;  2TPR A;  3ABV A;  2JKC A;  3AEF A;  2C70 A;  4JNA A;  1Q1W A;  4U2T A;  4RG3 A;  3QJ4 A;  4K5S A;  1FEB A;  3BNU A;  2PHH A;  4EMJ A;  4USR A;  3FPZ A;  4A79 A;  4CY6 A;  3EF6 A;  3UOY A;  3ICS A;  3GYI A;  4GDE A;  5C2T A;  3G5S A;  5EB4 A;  1B8S A;  2X50 A;  3AD8 B;  5L46 A;  2JAE A;  2YVG A;  4U8J A;  4XWR A;  2C76 A;  1D5T A;  4N9X A;  1PDH A;  5FS8 A;  5KXJ A;  2WOV A;  4KPR A;  4BUR A;  5HY5 A;  3DME A;  1JEH A;  1JNR A;  1GRA A;  3V76 A;  4H4V A;  3UKL A;  4Z26 A;  1CF3 A;  1LVL A;  4I59 A;  4YTN A;  1ZX9 A;  1OJC A;  2X99 A;  3AEC A;  1H81 A;  1L9C A;  1ZOY A;  3ALJ A;  3IHG A;  1DOE A;  3AE6 A;  5CKU A;  1XAN A;  5J60 A;  2DKH A;  1M6I A;  3QVP A;  1PBC A;  2YG4 A;  4OPL A;  2YVF A;  4A7A A;  1N1P A;  1D4E A;  1E6E A;  4Y4L A;  2GQF A;  4CBQ A;  3ADA B;  3KA7 A;  4U8L A;  2WP5 A;  4RG4 A;  3UP5 A;  4H4Y A;  2EQ6 A;  4UDQ A;  3AE7 A;  4OPC A;  5KOW A;  3C4A A;  5J7X A;  3AED A;  1Q9I A;  1JRZ A;  4NEV A;  3UKQ A;  2XVI A;  4U8N A;  4H4P A;  3DJG X;  1EL9 A;  2XYO A;  3UP4 A;  3D8X A;  3K7T A;  2YLS A;  2GMJ A;  4C3X A;  3IC9 A;  1XPQ A;  1H7X A;  2BC1 A;  1JNZ A;  2R46 A;  2OLN A;  1V59 A;  4B64 A;  1O5W A;  1Y56 A;  1S2Y A;  2F5Z A;  2QA2 A;  3UOV A;  2GF3 A;  1IUU A;  1KNR A;  2JB2 A;  3CIR A;  3KPF A;  1L0V A;  3NLC A;  4A5L A;  2B7S A;  4YKF A;  3LZW A;  4IV9 A;  1ZKQ A;  3F8P A;  1EBD A;  1RSG A;  1GPE A;  1CC2 A;  1PBB A;  2GAG B;  4CCQ A;  5FS9 A;  1BZL A;  1MOK A;  1QJD A;  4UDR A;  4J34 A;  1TYT A;  1UKV G;  1JRY A;  4FDC B;  4H7U A;  2VRL A;  1YY5 A;  3NT6 A;  2GAH B;  3H4K A;  2QAE A;  2R0C A;  2V6O A;  1GEU A;  3NTD A;  3AYL A;  1GT8 A;  2GEW A;  3FBS A;  2YVJ A;  5EB5 A;  4JN9 A;  4YTP A;  3ALL A;  2WDR A;  2X8H A;  4FX9 A;  3SM8 A;  2X3N A;  4U2S A;  2YWL A;  3P4R A;  4BK3 A;  2R0G A;  1GRF A;  2C73 A;  3VR8 A;  3BNM A;  5EOW A;  1E1N A;  1K0I A;  2B7R A;  2R0P A;  2YQU A;  1GRH A;  3UKK A;  5M10 A;  1EL8 A;  3GWF A;  5KOX A;  3NYF A;  4Y4N A;  4EQS A;  5EBK A;  1YKJ A;  1PN0 A;  3DK8 A;  4U8K A;  4NZH A;  3SGL A;  4BV6 A;  4GDP A;  3UKP A;  1PBD A;  3ATQ A;  1COY A;  2XVF A;  3PS9 A;  4OPT A;  4K5R A;  3UKA A;  4J57 A;  2TMD A;  2FBW A;  3NYC A;  1DXL A;  1CJ4 A;  4GCM A;  2GB0 A;  1GOS A;  3GRT A;  1F3P A;  3RNM A;  4AT0 A;  1NEN A;  2B9X A;  2GR3 A;  3IWA A;  1FEC A;  2YG6 A;  5U1O A;  2WS3 A;  2GH5 A;  4OPI A;  1ZOV A;  1GTH A;  2OA1 A;  4YKG A;  2V3B A;  3PVC A;  3WE0 A;  3K30 A;  2HQM A;  2BXR A;  2EQ8 A;  2UZZ A;  3K7M X;  3QFB A;  4Y4M A;  5FMH A;  3BHK A;  2Q7V A;  2H88 A;  2Q6U A;  1ZK7 A;  2XCG A;  4LII A;  3RED A;  4EQW A;  3AE8 A;  3I6D A;  2C75 A;  1PXC A;  3GSI A;  3AWI A;  5IQ4 A;  2WDQ A;  1F8S A;  2EQ7 A;  4PAB A;  2AAQ A;  4H4U A;  1O95 A;  3VR9 A;  2YG5 A;  2OAM A;  2XLT A;  2YG3 A;  2YR5 A;  1LJ1 A;  4D03 A;  1DJQ A;  1OJT A;  4C74 A;  2C7G A;  1NAA A;  1GND A;  2WEU A;  5JCL A;  4J56 A;  2XFP A;  2B76 A;  4TLZ A;  1W4X A;  4X4J A;  1DOB A;  2XFO A;  2CVJ A;  3QSS A;  3SFD A;  3R9U A;  3FMW A;  4M52 A;  3G5R A;  4Z2R A;  1XHC A;  1XDI A;  2FJD A;  4KX6 A;  4YSH A;  1REO A;  3P4P A;  2WPF A;  3NHO X;  2NVK X;  2GR0 A;  1JRX A;  1S2Q A;  2XFQ A;  1TYP A;  3AEG A;  3M13 A;  2OAL A;  2ZZB A;  5ER0 A;  4ZCC A;  3UTE A;  4APN A;  3D1C A;  3LB8 A;  3NNE A;  1FL2 A;  1ELI A;  1F6M A;  2WP9 A;  2XFN A;  3AEA A;  3CNT A;  4C3Y A;  1MO9 A;  2V60 A;  3GMB A;  4TM1 A;  3RP6 A;  3UKF A;  4EM4 A;  1SEZ A;  2Z5X A;  2XVE A;  4TM3 A;  1H86 A;  4XWZ A;  1PS9 A;  5JCK A;  2R45 A;  1NHQ A;  1LTX R;  1H83 A;  4A6N B;  2BK4 A;  5TR3 A;  2OLO A;  4TM4 A;  4C5O A;  1P2E A;  2XFU A;  4GR1 A;  1D7L A;  1D7Y A;  4MJW A;  2WP6 A;  2WDV A;  3NK0 X;  1GSN A;  4I58 A;  2BAB A;  4Z24 A;  4AOX A;  4HA6 A;  4BK1 A;  3CPI G;  2WPC A;  2CFY A;  2YG7 A;  3KKJ A;  2BA9 A;  4J31 A;  4FK1 C;  2VQB A;  5JCM A;  3KD9 A;  1K0J A;  3GD3 A;  3VRD B;  4DSG A;  4EM3 A;  3ISH A;  5JCI A;  1PHH A;  2V5Z A;  3AE3 A;  1KNP A;  2EQ9 A;  3DGZ A;  5CQF A;  4DSH A;  3H8I A;  1ZY8 A;  1DJN A;  1YQ4 A;  1ONF A;  2BC0 A;  2WPE A;  2XDO A;  2APG A;  4AOS A;  2C3D A;  4H4Q A;  4U8P A;  4EMI A;  2Q0K A;  3GWD A;  3QVR A;  4H4R A;  1N4U A;  1BGN A;  1VQW A;  2A8X A;  1IUS A;  3AYJ A;  2XVJ A;  4Z44 A;  4NTD A;  3UOZ A;  3GYJ A;  1CJC A;  1GRG A;  2IVE A;  4DGK A;  3NRN A;  4YXD A;  3AD7 B;  4ADW A;  2AQJ A;  2YLW A;  1B5Q A;  2NPX A;  3GRS A;  2JBV A;  3E1T A;  4JDR A;  1CBO A;  1L9E A;  2DKI A;  1VDC A;  2YLX A;  5FS7 A;  1QO8 A;  4J36 A;  3GMC A;  1AOG A;  1GTE A;  2YR6 A;  2RAB A;  2R9Z A;  2CUL A;  3CNS A;  2VZ2 A;  3NYE A;  3P4Q A;  3RP7 A;  4B68 A;  4Z2U A;  1PXB A;  3CND A;  3NG7 X;  3OC4 A;  1TDF A;  3UOX A;  3NN0 X;  4OCG A;  1CC4 A;  2WOI A;  4O5Q A;  3G5Q A;  3CGB A;  5GSN A;  4B1B A;  1YQ3 A;  1CJ2 A;  3IHM A;  3Q9T A;  2BYB A;  5DBJ A;  4K2X A;  3NH3 X;  2RGO A;  3B6D A;  2GRT A;  3V3O A;  2IVD A;  3AYI A;  4A9W A;  3I3L A;  4HB9 A;  4YT0 A;  3LXD A;  3LAD A;  5BVA A;  3BI5 A;  2QA1 A;  3NK2 X;  2QCU A;  3ATR A;  4J33 A;  2PYX A;  1E1M A;  1H7W A;  4A6N A;  2XVH A;  4ZN0 A;  4BK2 A;  4WCT A;  1L9D A;  2X8G A;  3C4N A;  4REK A;  3NKS A;  2E4G A;  4H50 A;  1FCD A;  2BAC A;  2VVL G;  3CN8 A;  1VRQ B;  3UTG A;  1TRB A;  1GRB A;  5FS6 A;  4EMW A;  1DNC A;  2VVL A;  4CNK A;  4Z43 A;  3VQR A;  1NHP A;  3NIX A;  4CNJ A;  1E7P A;  1CHU A;  3S61 A;  1N4V A;  4YSX A;  1Y56 B;  3FG2 P;  2VRM A;  3ITJ A;  1LQU A;  3K7Q X;  1E1K A;  2XLU A;  3LZX A;  3QFA A;  2ZBW A;  4H2R A;  3RP8 A;  2Y6R A;  3DJE A;  3JSK A;  4AP1 A;  2C64 A;  4EIP A;  2C67 A;  5KRQ A;  1P2H A;  5KVH A;  3VRB A;  1ZMD A;  2AR8 A;  1Q1R A;  3AE2 A;  1CC6 A;  1CJ3 A;  1B4V A;  2WQY A;  2GR2 A;  2FJB A;  1KFY A;  1CL0 A;  1IUT A;  1E39 A;  3AD9 B;  3AE9 A;  1KF6 A;  3ICR A;  5HXI A;  1GER A;  1GV4 A;  2E5V A;  4B67 A;  4H4W A;  2V3A A;  4C77 A;  4U2L A;  2R4J A; 
#chains in the Genus database with same CATH topology
 4USQ A;  1X31 B;  2W0H A;  3LOV A;  4K22 A;  3ALM A;  5GRT A;  4WX1 A;  4U8O A;  3ICT A;  1IJH A;  2YAU A;  3CPJ G;  4IVM B;  2O9Z A;  4ZCD A;  4B65 A;  1EL5 A;  3T37 A;  4TLX A;  3IF9 A;  4H4X A;  4BJZ A;  4IVO B;  1S3B A;  3QSE A;  4LU6 A;  1HYU A;  1NEK A;  4JNQ A;  4B66 A;  3CNJ A;  3M0O A;  1N4W A;  1E1L A;  1NG3 A;  4A65 A;  1K0L A;  1OJ9 A;  4EQR A;  1IUV A;  4GAV A;  3URH A;  1GRT A;  1GRE A;  3S5W A;  1TDN A;  3QSM A;  5HHF A;  2R4E A;  3CGE A;  2X8C A;  2VOU A;  2BCG G;  4NTC A;  1TDO A;  4GF7 A;  3CGD A;  1S3E A;  2CDU A;  4IA5 A;  1K4Q A;  4H2Q A;  4U8I A;  1H6V A;  1LV0 A;  1Y0P A;  5M0Z A;  3B3R A;  1M64 A;  2YLZ A;  3L1R A;  3AXB A;  3DK4 A;  3DA1 A;  2WET A;  4U8M A;  3AEE A;  1NPX A;  2BRA A;  1KDG A;  2GMH A;  4AT2 A;  1PBF A;  4K8D A;  3HZL A;  3ZDN A;  1NDA A;  2FJA A;  1FEA A;  4NTE A;  1JU2 A;  3FIM B;  1EL7 A;  3OZ2 A;  2JB3 A;  3DJJ A;  1IUX A;  1MXT A;  5KMQ A;  1PJ6 A;  1TDK A;  3NTA A;  4JQ9 A;  4Z2T A;  3II4 A;  3DK9 A;  1BGJ A;  3BI4 A;  3CNP A;  4OPD A;  3RHA A;  3SQP A;  5BUK A;  3C96 A;  3NGC X;  3SFE A;  1QLB A;  4B63 A;  1TDE A;  1D4D A;  3AE4 A;  3LJP A;  1LQT A;  2GQW A;  3CGC A;  4EIQ A;  5KNL A;  2IID A;  4CRT A;  3CTY A;  2C3C A;  1GXF A;  3KU9 A;  4YWO A;  5BUL A;  1PXA A;  2I0Z A;  5U25 A;  2WU5 A;  1RYI A;  2GR1 A;  3AEB A;  4K7Z A;  2B9W A;  4D04 A;  4H4Z A;  5LV9 A;  3F8R A;  2BCP A;  2ZZC A;  4J2W A;  4A99 A;  3DH9 A;  2A89 A;  2Z5Y A;  1VG9 A;  2B9Y A;  3EAO A;  3P1W A;  3M12 A;  4NEW A;  2WBA A;  3DJD A;  1DOC A;  2VVM A;  1JOA A;  1NHS A;  3H8L A;  5C3J A;  4H4S A;  1KSU A;  3NN6 X;  1NG4 A;  2BS4 A;  2YLR A;  3GYX A;  2ARD A;  4FK1 A;  4YTM A;  5KMP A;  2RGJ A;  1LPF A;  2JB1 A;  3UTF A;  3EAN A;  1D4C A;  4O5U A;  4GUV A;  1Z6L A;  1NHR A;  2J3N A;  2C72 A;  3VRA A;  2BS3 A;  1B37 A;  3KLJ A;  3KVE A;  1ZP0 A;  2VQ7 A;  4IA6 A;  4AP3 A;  2XLR A;  3GDN A;  4CY8 A;  2GVC A;  2FJE A;  2RGH A;  3AE1 A;  4OVI A;  4UDP A;  2WU2 A;  4YSZ A;  1RP0 A;  3HYV A;  3L8K A;  3UKH A;  1FOH A;  3UCL A;  2YM2 A;  3CMM A;  3O0H A;  4GAP A;  4BJY A;  1BKW A;  5KMR A;  1GAL A;  3BI2 A;  4P9S A;  1F8W A;  4H2N A;  2BXS A;  1OJA A;  2GV8 A;  3Q6J A;  3GD4 A;  4X9M A;  1O94 A;  3GDP A;  1YQZ A;  3NK1 X;  4XXG A;  1ZDL A;  2Q0L A;  2V61 A;  5IQ1 A;  3UTH A;  4OPG A;  2YR4 A;  3AE5 A;  4X9N A;  1KSS A;  4B69 A;  1DOD A;  3V3N A;  2H89 A;  4GRT A;  1PJ5 A;  4CCR A;  1VG0 A;  1PBE A;  2ZZ0 A;  3CPH G;  4OPU A;  3EPT A;  5KWF A;  1ZMC A;  4EQX A;  2WHD A;  2BK3 A;  2E1M A;  2XLS A;  1BWC A;  1IUW A;  4H2P A;  4H4T A;  4PAA A;  5KVI A;  5HYM A;  2WOW A;  3COX A;  1PJ7 A;  3ZYX A;  1F8R A;  3PO7 A;  4E0V A;  2C65 A;  3P4S A;  1BF3 A;  2JK6 A;  2BS2 A;  3P9U A;  4Z25 A;  2XLP A;  5IPY A;  4YSY A;  4ICY A;  4LA1 A;  4TM0 A;  1H84 A;  2WES A;  4JY2 A;  4JY3 A;  2ACZ A;  5JCN A;  2A87 A;  4RSL A;  4UP3 A;  2C66 A;  3BHF A;  2Y6Q A;  2YLT A;  3F8D A;  3DGH A;  5U63 A;  1GES A;  3AB1 A;  4DNA A;  5BRT A;  4ECH A;  1OJD A;  1H82 A;  1GET A;  2YM1 A;  2BK5 A;  2TPR A;  3ABV A;  2JKC A;  3AEF A;  2C70 A;  4JNA A;  1Q1W A;  4U2T A;  4RG3 A;  3QJ4 A;  4K5S A;  1FEB A;  3BNU A;  2PHH A;  4EMJ A;  4USR A;  3FPZ A;  4A79 A;  4CY6 A;  3EF6 A;  3UOY A;  3ICS A;  3GYI A;  4GDE A;  5C2T A;  3G5S A;  5EB4 A;  1B8S A;  2X50 A;  3AD8 B;  5L46 A;  2JAE A;  2YVG A;  4U8J A;  4XWR A;  3T0K A;  2C76 A;  1D5T A;  4N9X A;  1PDH A;  5FS8 A;  5KXJ A;  2WOV A;  4KPR A;  4BUR A;  5HY5 A;  3DME A;  1JEH A;  1JNR A;  1GRA A;  3V76 A;  4H4V A;  3UKL A;  4Z26 A;  1CF3 A;  1LVL A;  4I59 A;  4YTN A;  1ZX9 A;  1OJC A;  2X99 A;  3AEC A;  1H81 A;  1L9C A;  1ZOY A;  3ALJ A;  3IHG A;  1DOE A;  3AE6 A;  5CKU A;  1XAN A;  5J60 A;  2DKH A;  1M6I A;  3QVP A;  1PBC A;  2YG4 A;  4OPL A;  2YVF A;  4A7A A;  1N1P A;  1D4E A;  1E6E A;  3KPK A;  2GQF A;  4Y4L A;  4CBQ A;  3ADA B;  3KA7 A;  4NNJ A;  4U8L A;  2WP5 A;  4RG4 A;  3UP5 A;  4H4Y A;  2EQ6 A;  4UDQ A;  3AE7 A;  4OPC A;  5KOW A;  3C4A A;  5J7X A;  3AED A;  1Q9I A;  1JRZ A;  4NEV A;  3UKQ A;  3SX6 A;  2XVI A;  4U8N A;  4H4P A;  3DJG X;  1EL9 A;  2XYO A;  3UP4 A;  3D8X A;  3K7T A;  2YLS A;  2GMJ A;  4C3X A;  3T2K A;  3IC9 A;  1XPQ A;  1H7X A;  2BC1 A;  1JNZ A;  2R46 A;  2OLN A;  1V59 A;  4B64 A;  1O5W A;  1Y56 A;  1S2Y A;  2F5Z A;  2QA2 A;  3UOV A;  2GF3 A;  1IUU A;  1KNR A;  2JB2 A;  3CIR A;  3KPF A;  1L0V A;  3NLC A;  4A5L A;  4II2 A;  2B7S A;  4YKF A;  3LZW A;  4IV9 A;  1ZKQ A;  3F8P A;  1EBD A;  1RSG A;  1GPE A;  1CC2 A;  1PBB A;  2GAG B;  3HYW A;  3SXI A;  5FS9 A;  4CCQ A;  1BZL A;  1MOK A;  1QJD A;  4UDR A;  3T2Y A;  4J34 A;  1TYT A;  1UKV G;  1JRY A;  4FDC B;  4H7U A;  2VRL A;  1YY5 A;  3NT6 A;  2GAH B;  3H4K A;  2QAE A;  2R0C A;  2V6O A;  1GEU A;  3NTD A;  3T14 A;  3T2Z A;  3AYL A;  1GT8 A;  2GEW A;  3FBS A;  2YVJ A;  5EB5 A;  4JN9 A;  4YTP A;  3ALL A;  2WDR A;  2X8H A;  4FX9 A;  3SM8 A;  2X3N A;  4U2S A;  2YWL A;  3P4R A;  4BK3 A;  2R0G A;  1GRF A;  2C73 A;  3VR8 A;  3BNM A;  5EOW A;  1E1N A;  1K0I A;  2B7R A;  2R0P A;  2YQU A;  1GRH A;  3SZC A;  3UKK A;  1EL8 A;  3GWF A;  5KOX A;  5M10 A;  3NYF A;  4Y4N A;  4EQS A;  5EBK A;  1YKJ A;  1PN0 A;  3DK8 A;  4U8K A;  4NZH A;  3SGL A;  3SZ0 A;  4GDP A;  3UKP A;  4BV6 A;  1PBD A;  3ATQ A;  1COY A;  2XVF A;  3PS9 A;  4OPT A;  4K5R A;  3UKA A;  4J57 A;  2TMD A;  2FBW A;  3NYC A;  1DXL A;  1CJ4 A;  4GCM A;  2GB0 A;  1GOS A;  3GRT A;  1F3P A;  3RNM A;  4AT0 A;  4G73 A;  1NEN A;  2B9X A;  2GR3 A;  3IWA A;  1FEC A;  2YG6 A;  5U1O A;  2WS3 A;  2GH5 A;  4OPI A;  1ZOV A;  1GTH A;  2OA1 A;  4YKG A;  2V3B A;  3PVC A;  3WE0 A;  3K30 A;  2HQM A;  2BXR A;  2EQ8 A;  2UZZ A;  3K7M X;  3QFB A;  4Y4M A;  5FMH A;  3BHK A;  2Q7V A;  2H88 A;  2Q6U A;  1ZK7 A;  2XCG A;  4LII A;  3RED A;  4EQW A;  3AE8 A;  3I6D A;  2C75 A;  1PXC A;  3GSI A;  3AWI A;  5IQ4 A;  2WDQ A;  1F8S A;  2EQ7 A;  4PAB A;  2AAQ A;  4H4U A;  1O95 A;  3VR9 A;  2YG5 A;  2OAM A;  2XLT A;  2YG3 A;  2YR5 A;  1LJ1 A;  4D03 A;  1DJQ A;  1OJT A;  4C74 A;  2C7G A;  1NAA A;  1GND A;  2WEU A;  5JCL A;  4J56 A;  2XFP A;  2B76 A;  4TLZ A;  1W4X A;  4X4J A;  1DOB A;  2XFO A;  2CVJ A;  3QSS A;  3SFD A;  3R9U A;  3FMW A;  4M52 A;  3G5R A;  4Z2R A;  1XHC A;  1XDI A;  2FJD A;  4KX6 A;  4YSH A;  1REO A;  3P4P A;  2WPF A;  5KMS A;  3NHO X;  2NVK X;  2GR0 A;  1JRX A;  1S2Q A;  2XFQ A;  1TYP A;  3AEG A;  3M13 A;  2OAL A;  2ZZB A;  5ER0 A;  4ZCC A;  3UTE A;  4APN A;  3D1C A;  3LB8 A;  3NNE A;  1FL2 A;  1ELI A;  1F6M A;  2WP9 A;  2XFN A;  3AEA A;  3HYX A;  3CNT A;  4C3Y A;  1MO9 A;  2V60 A;  3GMB A;  4TM1 A;  3RP6 A;  3UKF A;  4EM4 A;  1SEZ A;  2Z5X A;  2XVE A;  4TM3 A;  1H86 A;  4XWZ A;  1PS9 A;  5JCK A;  2R45 A;  1NHQ A;  1LTX R;  1H83 A;  2C4C A;  4A6N B;  2BK4 A;  3SZW A;  5TR3 A;  2OLO A;  4TM4 A;  4C5O A;  1P2E A;  2XFU A;  4GR1 A;  1D7L A;  1D7Y A;  4MJW A;  2WP6 A;  2WDV A;  3NK0 X;  1GSN A;  4I58 A;  2BAB A;  4Z24 A;  4AOX A;  4HA6 A;  4NWZ A;  4BK1 A;  3CPI G;  2WPC A;  2CFY A;  2YG7 A;  3KKJ A;  2BA9 A;  4J31 A;  4FK1 C;  2VQB A;  5JCM A;  3KD9 A;  1K0J A;  3GD3 A;  3VRD B;  4DSG A;  4EM3 A;  3ISH A;  5JCI A;  1PHH A;  2V5Z A;  3AE3 A;  1KNP A;  2EQ9 A;  3DGZ A;  5CQF A;  4DSH A;  3H8I A;  1ZY8 A;  1DJN A;  1YQ4 A;  1ONF A;  2BC0 A;  2WPE A;  2XDO A;  2APG A;  4AOS A;  2C3D A;  4H4Q A;  4U8P A;  4EMI A;  2Q0K A;  3GWD A;  3QVR A;  4H4R A;  1N4U A;  1BGN A;  1VQW A;  2A8X A;  1IUS A;  3AYJ A;  2XVJ A;  4Z44 A;  3SZF A;  4NTD A;  3UOZ A;  3GYJ A;  1CJC A;  1GRG A;  2IVE A;  4DGK A;  3NRN A;  4YXD A;  3AD7 B;  4ADW A;  2AQJ A;  2YLW A;  1B5Q A;  2NPX A;  3GRS A;  2JBV A;  3E1T A;  4JDR A;  1CBO A;  1L9E A;  2DKI A;  1VDC A;  2YLX A;  5FS7 A;  1QO8 A;  4J36 A;  3GMC A;  1AOG A;  1GTE A;  2YR6 A;  2RAB A;  2R9Z A;  2CUL A;  3CNS A;  4G6G A;  2VZ2 A;  3NYE A;  3P4Q A;  3RP7 A;  4B68 A;  4Z2U A;  1PXB A;  3CND A;  3NG7 X;  3OC4 A;  1TDF A;  3UOX A;  3NN0 X;  3T31 A;  4G6H A;  4OCG A;  1CC4 A;  2WOI A;  4O5Q A;  3G5Q A;  3CGB A;  5GSN A;  4B1B A;  1YQ3 A;  1CJ2 A;  2BRY A;  3IHM A;  3Q9T A;  2BYB A;  5DBJ A;  4K2X A;  3NH3 X;  2RGO A;  3B6D A;  2GRT A;  3V3O A;  2IVD A;  3AYI A;  4A9W A;  3I3L A;  4HB9 A;  4YT0 A;  3LXD A;  3LAD A;  5BVA A;  3BI5 A;  2QA1 A;  3SY4 A;  3NK2 X;  2QCU A;  3ATR A;  4J33 A;  2PYX A;  1E1M A;  1H7W A;  3SYI A;  2XVH A;  4A6N A;  4ZN0 A;  4G9K A;  4WCT A;  1L9D A;  2X8G A;  3C4N A;  4BK2 A;  4REK A;  3NKS A;  2E4G A;  4H50 A;  1FCD A;  2BAC A;  2VVL G;  3CN8 A;  1VRQ B;  3UTG A;  1TRB A;  1GRB A;  5FS6 A;  4EMW A;  1DNC A;  2VVL A;  4CNK A;  4Z43 A;  3VQR A;  1NHP A;  3NIX A;  4CNJ A;  1E7P A;  1CHU A;  4G74 A;  1N4V A;  3S61 A;  4YSX A;  1Y56 B;  3FG2 P;  2VRM A;  3ITJ A;  1LQU A;  3K7Q X;  1E1K A;  2XLU A;  3LZX A;  3QFA A;  2ZBW A;  4H2R A;  3RP8 A;  2Y6R A;  3DJE A;  3JSK A;  4AP1 A;  2C64 A;  4EIP A;  2C67 A;  4II3 A;  5KRQ A;  1P2H A;  5KVH A;  3VRB A;  1ZMD A;  2AR8 A;  1Q1R A;  3AE2 A;  1CC6 A;  1CJ3 A;  1B4V A;  2WQY A;  2GR2 A;  2FJB A;  1KFY A;  1CL0 A;  1IUT A;  1E39 A;  3AD9 B;  3AE9 A;  1KF6 A;  3ICR A;  5HXI A;  1GER A;  1GV4 A;  2E5V A;  4B67 A;  4H4W A;  2V3A A;  4C77 A;  4U2L A;  2R4J A; 
#chains in the Genus database with same CATH homology
 4USQ A;  1X31 B;  2W0H A;  3LOV A;  4K22 A;  3ALM A;  5GRT A;  4WX1 A;  4U8O A;  3ICT A;  1IJH A;  2YAU A;  3CPJ G;  4IVM B;  2O9Z A;  4ZCD A;  4B65 A;  1EL5 A;  3T37 A;  4TLX A;  3IF9 A;  4H4X A;  4BJZ A;  4IVO B;  1S3B A;  3QSE A;  4LU6 A;  1HYU A;  1NEK A;  4JNQ A;  4B66 A;  3CNJ A;  3M0O A;  1N4W A;  1E1L A;  1NG3 A;  4A65 A;  1K0L A;  1OJ9 A;  4EQR A;  1IUV A;  4GAV A;  3URH A;  1GRT A;  1GRE A;  3S5W A;  1TDN A;  3QSM A;  5HHF A;  2R4E A;  3CGE A;  2X8C A;  2VOU A;  2BCG G;  4NTC A;  1TDO A;  4GF7 A;  3CGD A;  1S3E A;  2CDU A;  4IA5 A;  1K4Q A;  4H2Q A;  4U8I A;  1H6V A;  1LV0 A;  1Y0P A;  5M0Z A;  3B3R A;  1M64 A;  2YLZ A;  3L1R A;  3AXB A;  3DK4 A;  3DA1 A;  2WET A;  4U8M A;  3AEE A;  1NPX A;  2BRA A;  1KDG A;  2GMH A;  4AT2 A;  1PBF A;  4K8D A;  3HZL A;  3ZDN A;  1NDA A;  2FJA A;  1FEA A;  4NTE A;  1JU2 A;  3FIM B;  1EL7 A;  3OZ2 A;  2JB3 A;  3DJJ A;  1IUX A;  1MXT A;  5KMQ A;  1PJ6 A;  1TDK A;  3NTA A;  4JQ9 A;  4Z2T A;  3II4 A;  3DK9 A;  1BGJ A;  3BI4 A;  3CNP A;  4OPD A;  3RHA A;  3SQP A;  5BUK A;  3C96 A;  3NGC X;  3SFE A;  1QLB A;  4B63 A;  1TDE A;  1D4D A;  3AE4 A;  3LJP A;  1LQT A;  2GQW A;  3CGC A;  4EIQ A;  5KNL A;  2IID A;  4CRT A;  3CTY A;  2C3C A;  1GXF A;  3KU9 A;  4YWO A;  5BUL A;  1PXA A;  2I0Z A;  5U25 A;  2WU5 A;  1RYI A;  2GR1 A;  3AEB A;  4K7Z A;  2B9W A;  4D04 A;  4H4Z A;  5LV9 A;  3F8R A;  2BCP A;  2ZZC A;  4J2W A;  4A99 A;  3DH9 A;  2A89 A;  2Z5Y A;  1VG9 A;  2B9Y A;  3EAO A;  3P1W A;  3M12 A;  4NEW A;  2WBA A;  3DJD A;  1DOC A;  2VVM A;  1JOA A;  1NHS A;  3H8L A;  5C3J A;  4H4S A;  1KSU A;  3NN6 X;  1NG4 A;  2BS4 A;  2YLR A;  3GYX A;  2ARD A;  4FK1 A;  4YTM A;  5KMP A;  2RGJ A;  1LPF A;  2JB1 A;  3UTF A;  3EAN A;  1D4C A;  4O5U A;  4GUV A;  1Z6L A;  1NHR A;  2J3N A;  2C72 A;  3VRA A;  2BS3 A;  1B37 A;  3KLJ A;  3KVE A;  1ZP0 A;  2VQ7 A;  4IA6 A;  4AP3 A;  2XLR A;  3GDN A;  4CY8 A;  2GVC A;  2FJE A;  2RGH A;  3AE1 A;  4OVI A;  4UDP A;  2WU2 A;  4YSZ A;  1RP0 A;  3HYV A;  3L8K A;  3UKH A;  1FOH A;  3UCL A;  2YM2 A;  3CMM A;  3O0H A;  4GAP A;  4BJY A;  1BKW A;  5KMR A;  1GAL A;  3BI2 A;  4P9S A;  1F8W A;  4H2N A;  2BXS A;  1OJA A;  2GV8 A;  3Q6J A;  3GD4 A;  4X9M A;  1O94 A;  3GDP A;  1YQZ A;  3NK1 X;  4XXG A;  1ZDL A;  2Q0L A;  2V61 A;  5IQ1 A;  3UTH A;  4OPG A;  2YR4 A;  3AE5 A;  4X9N A;  1KSS A;  4B69 A;  1DOD A;  3V3N A;  2H89 A;  4GRT A;  1PJ5 A;  4CCR A;  1VG0 A;  1PBE A;  2ZZ0 A;  3CPH G;  4OPU A;  3EPT A;  5KWF A;  1ZMC A;  4EQX A;  2WHD A;  2BK3 A;  2E1M A;  2XLS A;  1BWC A;  1IUW A;  4H2P A;  4H4T A;  4PAA A;  5KVI A;  5HYM A;  2WOW A;  3COX A;  1PJ7 A;  3ZYX A;  1F8R A;  3PO7 A;  4E0V A;  2C65 A;  3P4S A;  1BF3 A;  2JK6 A;  2BS2 A;  3P9U A;  4Z25 A;  2XLP A;  5IPY A;  4YSY A;  4ICY A;  4LA1 A;  4TM0 A;  1H84 A;  2WES A;  4JY2 A;  4JY3 A;  2ACZ A;  5JCN A;  2A87 A;  4RSL A;  4UP3 A;  2C66 A;  3BHF A;  2Y6Q A;  2YLT A;  3F8D A;  3DGH A;  5U63 A;  1GES A;  3AB1 A;  4DNA A;  5BRT A;  4ECH A;  1OJD A;  1H82 A;  1GET A;  2YM1 A;  2BK5 A;  2TPR A;  3ABV A;  2JKC A;  3AEF A;  2C70 A;  4JNA A;  1Q1W A;  4U2T A;  4RG3 A;  3QJ4 A;  4K5S A;  1FEB A;  3BNU A;  2PHH A;  4EMJ A;  4USR A;  3FPZ A;  4A79 A;  4CY6 A;  3EF6 A;  3UOY A;  3ICS A;  3GYI A;  4GDE A;  5C2T A;  3G5S A;  5EB4 A;  1B8S A;  2X50 A;  3AD8 B;  5L46 A;  2JAE A;  2YVG A;  4U8J A;  4XWR A;  3T0K A;  2C76 A;  1D5T A;  4N9X A;  1PDH A;  5FS8 A;  5KXJ A;  2WOV A;  4KPR A;  4BUR A;  5HY5 A;  3DME A;  1JEH A;  1JNR A;  1GRA A;  3V76 A;  4H4V A;  3UKL A;  4Z26 A;  1CF3 A;  1LVL A;  4I59 A;  4YTN A;  1ZX9 A;  1OJC A;  2X99 A;  3AEC A;  1H81 A;  1L9C A;  1ZOY A;  3ALJ A;  3IHG A;  1DOE A;  3AE6 A;  5CKU A;  1XAN A;  5J60 A;  2DKH A;  1M6I A;  3QVP A;  1PBC A;  2YG4 A;  4OPL A;  2YVF A;  4A7A A;  1N1P A;  1D4E A;  1E6E A;  3KPK A;  2GQF A;  4Y4L A;  4CBQ A;  3ADA B;  3KA7 A;  4NNJ A;  4U8L A;  2WP5 A;  4RG4 A;  3UP5 A;  4H4Y A;  2EQ6 A;  4UDQ A;  3AE7 A;  4OPC A;  5KOW A;  3C4A A;  5J7X A;  3AED A;  1Q9I A;  1JRZ A;  4NEV A;  3UKQ A;  3SX6 A;  2XVI A;  4U8N A;  4H4P A;  3DJG X;  1EL9 A;  2XYO A;  3UP4 A;  3D8X A;  3K7T A;  2YLS A;  2GMJ A;  4C3X A;  3T2K A;  3IC9 A;  1XPQ A;  1H7X A;  2BC1 A;  1JNZ A;  2R46 A;  2OLN A;  1V59 A;  4B64 A;  1O5W A;  1Y56 A;  1S2Y A;  2F5Z A;  2QA2 A;  3UOV A;  2GF3 A;  1IUU A;  1KNR A;  2JB2 A;  3CIR A;  3KPF A;  1L0V A;  3NLC A;  4A5L A;  4II2 A;  2B7S A;  4YKF A;  3LZW A;  4IV9 A;  1ZKQ A;  3F8P A;  1EBD A;  1RSG A;  1GPE A;  1CC2 A;  1PBB A;  2GAG B;  3HYW A;  3SXI A;  5FS9 A;  4CCQ A;  1BZL A;  1MOK A;  1QJD A;  4UDR A;  3T2Y A;  4J34 A;  1TYT A;  1UKV G;  1JRY A;  4FDC B;  4H7U A;  2VRL A;  1YY5 A;  3NT6 A;  2GAH B;  3H4K A;  2QAE A;  2R0C A;  2V6O A;  1GEU A;  3NTD A;  3T14 A;  3T2Z A;  3AYL A;  1GT8 A;  2GEW A;  3FBS A;  2YVJ A;  5EB5 A;  4JN9 A;  4YTP A;  3ALL A;  2WDR A;  2X8H A;  4FX9 A;  3SM8 A;  2X3N A;  4U2S A;  2YWL A;  3P4R A;  4BK3 A;  2R0G A;  1GRF A;  2C73 A;  3VR8 A;  3BNM A;  5EOW A;  1E1N A;  1K0I A;  2B7R A;  2R0P A;  2YQU A;  1GRH A;  3SZC A;  3UKK A;  1EL8 A;  3GWF A;  5KOX A;  5M10 A;  3NYF A;  4Y4N A;  4EQS A;  5EBK A;  1YKJ A;  1PN0 A;  3DK8 A;  4U8K A;  4NZH A;  3SGL A;  3SZ0 A;  4GDP A;  3UKP A;  4BV6 A;  1PBD A;  3ATQ A;  1COY A;  2XVF A;  3PS9 A;  4OPT A;  4K5R A;  3UKA A;  4J57 A;  2TMD A;  2FBW A;  3NYC A;  1DXL A;  1CJ4 A;  4GCM A;  2GB0 A;  1GOS A;  3GRT A;  1F3P A;  3RNM A;  4AT0 A;  4G73 A;  1NEN A;  2B9X A;  2GR3 A;  3IWA A;  1FEC A;  2YG6 A;  5U1O A;  2WS3 A;  2GH5 A;  4OPI A;  1ZOV A;  1GTH A;  2OA1 A;  4YKG A;  2V3B A;  3PVC A;  3WE0 A;  3K30 A;  2HQM A;  2BXR A;  2EQ8 A;  2UZZ A;  3K7M X;  3QFB A;  4Y4M A;  5FMH A;  3BHK A;  2Q7V A;  2H88 A;  2Q6U A;  1ZK7 A;  2XCG A;  4LII A;  3RED A;  4EQW A;  3AE8 A;  3I6D A;  2C75 A;  1PXC A;  3GSI A;  3AWI A;  5IQ4 A;  2WDQ A;  1F8S A;  2EQ7 A;  4PAB A;  2AAQ A;  4H4U A;  1O95 A;  3VR9 A;  2YG5 A;  2OAM A;  2XLT A;  2YG3 A;  2YR5 A;  1LJ1 A;  4D03 A;  1DJQ A;  1OJT A;  4C74 A;  2C7G A;  1NAA A;  1GND A;  2WEU A;  5JCL A;  4J56 A;  2XFP A;  2B76 A;  4TLZ A;  1W4X A;  4X4J A;  1DOB A;  2XFO A;  2CVJ A;  3QSS A;  3SFD A;  3R9U A;  3FMW A;  4M52 A;  3G5R A;  4Z2R A;  1XHC A;  1XDI A;  2FJD A;  4KX6 A;  4YSH A;  1REO A;  3P4P A;  2WPF A;  5KMS A;  3NHO X;  2NVK X;  2GR0 A;  1JRX A;  1S2Q A;  2XFQ A;  1TYP A;  3AEG A;  3M13 A;  2OAL A;  2ZZB A;  5ER0 A;  4ZCC A;  3UTE A;  4APN A;  3D1C A;  3LB8 A;  3NNE A;  1FL2 A;  1ELI A;  1F6M A;  2WP9 A;  2XFN A;  3AEA A;  3HYX A;  3CNT A;  4C3Y A;  1MO9 A;  2V60 A;  3GMB A;  4TM1 A;  3RP6 A;  3UKF A;  4EM4 A;  1SEZ A;  2Z5X A;  2XVE A;  4TM3 A;  1H86 A;  4XWZ A;  1PS9 A;  5JCK A;  2R45 A;  1NHQ A;  1LTX R;  1H83 A;  2C4C A;  4A6N B;  2BK4 A;  3SZW A;  5TR3 A;  2OLO A;  4TM4 A;  4C5O A;  1P2E A;  2XFU A;  4GR1 A;  1D7L A;  1D7Y A;  4MJW A;  2WP6 A;  2WDV A;  3NK0 X;  1GSN A;  4I58 A;  2BAB A;  4Z24 A;  4AOX A;  4HA6 A;  4NWZ A;  4BK1 A;  3CPI G;  2WPC A;  2CFY A;  2YG7 A;  3KKJ A;  2BA9 A;  4J31 A;  4FK1 C;  2VQB A;  5JCM A;  3KD9 A;  1K0J A;  3GD3 A;  3VRD B;  4DSG A;  4EM3 A;  3ISH A;  5JCI A;  1PHH A;  2V5Z A;  3AE3 A;  1KNP A;  2EQ9 A;  3DGZ A;  5CQF A;  4DSH A;  3H8I A;  1ZY8 A;  1DJN A;  1YQ4 A;  1ONF A;  2BC0 A;  2WPE A;  2XDO A;  2APG A;  4AOS A;  2C3D A;  4H4Q A;  4U8P A;  4EMI A;  2Q0K A;  3GWD A;  3QVR A;  4H4R A;  1N4U A;  1BGN A;  1VQW A;  2A8X A;  1IUS A;  3AYJ A;  2XVJ A;  4Z44 A;  3SZF A;  4NTD A;  3UOZ A;  3GYJ A;  1CJC A;  1GRG A;  2IVE A;  4DGK A;  3NRN A;  4YXD A;  3AD7 B;  4ADW A;  2AQJ A;  2YLW A;  1B5Q A;  2NPX A;  3GRS A;  2JBV A;  3E1T A;  4JDR A;  1CBO A;  1L9E A;  2DKI A;  1VDC A;  2YLX A;  5FS7 A;  1QO8 A;  4J36 A;  3GMC A;  1AOG A;  1GTE A;  2YR6 A;  2RAB A;  2R9Z A;  2CUL A;  3CNS A;  4G6G A;  2VZ2 A;  3NYE A;  3P4Q A;  3RP7 A;  4B68 A;  4Z2U A;  1PXB A;  3CND A;  3NG7 X;  3OC4 A;  1TDF A;  3UOX A;  3NN0 X;  3T31 A;  4G6H A;  4OCG A;  1CC4 A;  2WOI A;  4O5Q A;  3G5Q A;  3CGB A;  5GSN A;  4B1B A;  1YQ3 A;  1CJ2 A;  2BRY A;  3IHM A;  3Q9T A;  2BYB A;  5DBJ A;  4K2X A;  3NH3 X;  2RGO A;  3B6D A;  2GRT A;  3V3O A;  2IVD A;  3AYI A;  4A9W A;  3I3L A;  4HB9 A;  4YT0 A;  3LXD A;  3LAD A;  5BVA A;  3BI5 A;  2QA1 A;  3SY4 A;  3NK2 X;  2QCU A;  3ATR A;  4J33 A;  2PYX A;  1E1M A;  1H7W A;  3SYI A;  2XVH A;  4A6N A;  4ZN0 A;  4G9K A;  4WCT A;  1L9D A;  2X8G A;  3C4N A;  4BK2 A;  4REK A;  3NKS A;  2E4G A;  4H50 A;  1FCD A;  2BAC A;  2VVL G;  3CN8 A;  1VRQ B;  3UTG A;  1TRB A;  1GRB A;  5FS6 A;  4EMW A;  1DNC A;  2VVL A;  4CNK A;  4Z43 A;  3VQR A;  1NHP A;  3NIX A;  4CNJ A;  1E7P A;  1CHU A;  4G74 A;  1N4V A;  3S61 A;  4YSX A;  1Y56 B;  3FG2 P;  2VRM A;  3ITJ A;  1LQU A;  3K7Q X;  1E1K A;  2XLU A;  3LZX A;  3QFA A;  2ZBW A;  4H2R A;  3RP8 A;  2Y6R A;  3DJE A;  3JSK A;  4AP1 A;  2C64 A;  4EIP A;  2C67 A;  4II3 A;  5KRQ A;  1P2H A;  5KVH A;  3VRB A;  1ZMD A;  2AR8 A;  1Q1R A;  3AE2 A;  1CC6 A;  1CJ3 A;  1B4V A;  2WQY A;  2GR2 A;  2FJB A;  1KFY A;  1CL0 A;  1IUT A;  1E39 A;  3AD9 B;  3AE9 A;  1KF6 A;  3ICR A;  5HXI A;  1GER A;  1GV4 A;  2E5V A;  4B67 A;  4H4W A;  2V3A A;  4C77 A;  4U2L A;  2R4J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...