4E0VA

Structure of l-amino acid oxidase from the b. jararacussu venom
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
479
structure length
474
Chain Sequence
NPLEECFRETDYEEFLEIAKNGLPKRVVIVGAGMSGLSAAYVLANAGHQVTVLEASERAGGQVKTYRNEKEGWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENENAWYFIKNIRKRVGEVNKDPGVLDYPVKPSEVGKSAGQLYEESLQKAVEELRRTNCSYMLNKYDTYSTKEYLLKEGNLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVGGMDKLPTSMYQAIQEKVHLNARVIKIQQDVKEVTVTYQTSEKETLSVTADYVIVCTTSRAARRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDDGIHGGKSTTDLPSRFIYYPNHNFPNGVGVIIAYGIGDDANYFEALDFEDCGDIVINDLSLIHQLPKEEIQAICRPSMIQRWSLDKYAMGGITTFTPYQFQHFSEALTAPVDRIYFAGEYTAQAHGWIASTIKSGPEGLDVNRAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-amino-acid oxidase
publication title Structural insights into selectivity and cofactor binding in snake venom L-amino acid oxidases.
pubmed doi rcsb
total genus 122
structure length 474
sequence length 479
chains with identical sequence B
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2012-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 4e0vA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4e0vA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 4e0vA01
1ZK7A 2Q0LA 2YVFA 3AYLA 5FS8A 1DJQA 4U8KA 3FMWA 1YKJA 3C4NA 4Z2TA 3AWIA 3P4RA 2JAEA 4YT0A 5KXJA 2AAQA 4E0VA 2WBAA 1VG9A 2JK6A 3ATRA 3FBSA 2CFYA 3P1WA 3IC9A 4UDPA 2OALA 3VRDB 2BK3A 2B9XA 2C3CA 2XLUA 2H89A 5FMHA 1S3BA 4O5QA 2VQ7A 4EM3A 1GRGA 2GMHA 3CGCA 4Z44A 1TDOA 3BNUA 1H7XA 1DODA 1PXAA 2YM2A 4K8DA 1ZKQA 2XLPA 3RP8A 1N4WA 3B3RA 3NTDA 2DKHA 3S5WA 3VR8A 2J3NA 2I0ZA 4H4PA 1PJ6A 2RGHA 4A65A 4CRTA 3V76A 3AEDA 3SFDA 1HYUA 3DJJA 4GDPA 1JRYA 4KPRA 4APNA 1VQWA 3KPFA 2IVDA 1IUWA 4EQRA 3L8KA 4Z25A 1GT8A 1IUTA 1NPXA 2FJEA 4J36A 1JU2A 2X99A 2X8CA 1DOCA 1CBOA 1ZOYA 2BCPA 3ZDNA 2C65A 1RP0A 4CNJA 2WP9A 4U8NA 4LU6A 5U25A 4CCQA 1FCDA 1ZX9A 3AE1A 2EQ6A 3NT6A 3NG7X 1E1KA 4C3XA 1MXTA 4GR1A 4K7ZA 4Z43A 2AR8A 2BK4A 3IHGA 2GMJA 3AYIA 5LV9A 2YG4A 4J2WA 4EIPA 3P4QA 3NIXA 1LVLA 5BVAA 2YR4A 4H4VA 2YVJA 3GRTA 4M52A 4NEWA 1E1NA 1GRTA 3ZYXA 3BHKA 2R45A 1FECA 2R46A 3ADAB 1BZLA 3CNDA 3P4SA 2OAMA 1F8WA 2C70A 3P9UA 3QSSA 2C66A 3GYJA 2GR1A 4U2SA 4YSZA 2GF3A 2RGOA 5DBJA 2BYBA 2C67A 1E39A 4Y4LA 4BJZA 5EB4A 5BRTA 4H2RA 3REDA 4B64A 2VVLA 4K5SA 2GV8A 4JNQA 3GMCA 4JNAA 4H2NA 3ABVA 1SEZA 4NTCA 3UKAA 3NN0X 5HHFA 1VRQB 1DNCA 1W4XA 2WS3A 5EOWA 4U8IA 5JCNA 3LZWA 3KU9A 3AEAA 1ELIA 1FL2A 4JDRA 2BS4A 4CY8A 1F8RA 3UKLA 2YR5A 1KNRA 3UOXA 3QSEA 1ZDLA 1GOSA 1D7YA 3T37A 5U1OA 2WPFA 2YLTA 1KDGA 3LOVA 4EMJA 4N9XA 4AT2A 2GRTA 3NN6X 3UP4A 3QVPA 4YXDA 2GQFA 3NYCA 2XFNA 1OJAA 3QSMA 4AP3A 3CNPA 1S2YA 3UTFA 4IA6A 3BI2A 1E1MA 3RP7A 2RGJA 2GAHB 1QLBA 2BABA 4EM4A 1NG3A 4H50A 2WPEA 4J33A 3DGHA 4TM1A 2WESA 2WU5A 3LB8A 4U2LA 4H4WA 2YG7A 1PBDA 1NHRA 2E5VA 4YWOA 2GR2A 4A99A 3NRNA 2BC1A 3RHAA 5KVHA 2C72A 1CJ2A 3AEEA 3DH9A 4H4TA 3IF9A 2C64A 1CC2A 4TLXA 1XANA 2XFUA 1OJ9A 4EQWA 1H86A 5IQ4A 1FOHA 1CL0A 1QO8A 1DOBA 1D4DA 4OPTA 1JRZA 1IUXA 4U8MA 3AE3A 3UCLA 3UOYA 1PDHA 4BK1A 3V3OA 1GRHA 3AECA 4H4XA 1D5TA 2GEWA 3H8LA 2XLTA 1CJ3A 3VRBA 4H4RA 2QA2A 2V60A 2H88A 2VOUA 3UKHA 1EL7A 2XLSA 3BI4A 5JCLA 1B37A 1LJ1A 1TRBA 2R4JA 1B8SA 3H8IA 2XVHA 1EL9A 1GTEA 5BUKA 2NPXA 2WOVA 5L46A 1NHSA 3BI5A 1TDFA 3CNSA 4OCGA 5JCIA 2APGA 4I58A 2GH5A 2YVGA 3D8XA 4NZHA 4C74A 3L1RA 2YLRA 3C4AA 2XFOA 3UKKA 2BC0A 2VVLG 2GR3A 2YLXA 5FS7A 2Q0KA 4Z24A 3F8DA 4O5UA 1CC6A 1GRAA 1FEAA 4B68A 2BXRA 4K22A 2PHHA 5KWFA 3M13A 1N4VA 2BXSA 4Y4NA 4YTPA 1GESA 4NTEA 3K30A 5IQ1A 1PXBA 4DGKA 2Z5YA 2QA1A 2GB0A 3K7TA 3LXDA 3RNMA 4J31A 4XXGA 3II4A 1EBDA 4YTMA 3SGLA 4FDCB 2XVJA 3AE7A 1X31B 1Y0PA 3V3NA 4BJYA 4EMIA 1COYA 1TDNA 4REKA 3IHMA 2XDOA 4X4JA 4TM3A 2X8HA 4YTNA 3AE5A 4XWZA 4DNAA 1H7WA 2B76A 2ACZA 1NG4A 3DJDA 2BCGG 4OPLA 3NYEA 4PAAA 1OJCA 4J57A 2XVIA 2UZZA 2V3AA 4EMWA 5BULA 3AB1A 3C96A 3EF6A 1PBCA 2VQBA 4C77A 2OLOA 3DMEA 2ZZ0A 2VVMA 2O9ZA 4IVOB 1BWCA 1CHUA 1K0IA 2ZZCA 4B69A 4ZCCA 2XVEA 3GWFA 3KKJA 1YQ3A 2WETA 3ITJA 3UTHA 3F8RA 1ZP0A 2JB3A 3AXBA 4K5RA 2WOWA 3PVCA 2QAEA 3R9UA 3AD7B 1D4EA 3DJGX 2FBWA 4U8LA 2XFQA 1DJNA 3CN8A 1O94A 4X9NA 1D7LA 1H83A 2YR6A 3QFBA 4GUVA 1S3EA 3VQRA 3FIMB 4C5OA 1OJDA 4ADWA 4P9SA 4YSXA 1Y56B 2V3BA 2WP6A 5CQFA 1IUSA 3SFEA 1KNPA 1VDCA 3NK1X 1GETA 3UKQA 3O0HA 4Y4MA 1GREA 1K0LA 3CTYA 3AYJA 1PBFA 2XLRA 3GD4A 1AOGA 4J34A 4IVMB 1CJCA 3UOZA 1L9CA 5HXIA 2CULA 3GDNA 3LJPA 2V6OA 3ICRA 1F6MA 2R4EA 4H4UA 1OJTA 2WEUA 1JOAA 2RABA 1NAAA 3G5QA 1GXFA 3CGEA 3GRSA 4HB9A 3ALMA 2R9ZA 4JY2A 2C76A 3ICTA 4I59A 1E7PA 3QJ4A 1YY5A 4OPGA 4A79A 5FS6A 1GNDA 2YWLA 1BKWA 3E1TA 3M0OA 2B9WA 2B9YA 4FK1A 3KD9A 3UOVA 3NK2X 1CJ4A 1P2HA 3NGCX 4AOXA 1H84A 2A89A 3NKSA 4MJWA 1L0VA 4RG3A 2R0GA 3AEGA 3DK9A 3CGBA 1ZMCA 1GSNA 4H4SA 2WOIA 1LQUA 2FJBA 3AE4A 1LV0A 1E1LA 2PYXA 2W0HA 4ICYA 3WE0A 5C2TA 1REOA 3IWAA 2GR0A 1L9DA 3AE9A 3GYIA 4D04A 4U8OA 4GF7A 4ZN0A 4CBQA 2WHDA 3NYFA 4YKFA 5EB5A 4USRA 2JKCA 4YSYA 1PS9A 2WDRA 2E4GA 4H4ZA 4RG4A 4DSGA 1PBBA 1NHPA 4DSHA 1ZY8A 1B4VA 2BACA 1NDAA 1GTHA 3GDPA 2TMDA 4HA6A 3AEBA 4CY6A 2OLNA 4ZCDA 2ZBWA 2CDUA 1DXLA 4GDEA 2BA9A 2VZ2A 2IVEA 1GALA 1CC4A 1UKVG 2YG3A 1P2EA 2WU2A 3LADA 3NH3X 4NEVA 4GRTA 4A6NB 4EQXA 5HY5A 5HYMA 1RSGA 4TM0A 1Y56A 3DA1A 3EANA 1S2QA 1BF3A 1YQZA 5ER0A 2EQ7A 3KLJA 1H81A 1V59A 5J7XA 1GERA 3D1CA 3AE8A 2XVFA 3CPIG 2CVJA 1L9EA 4BURA 2WP5A 1JRXA 3AD8B 3UKPA 5JCMA 2FJDA 2NVKX 4B1BA 2BK5A 4OPDA 2XCGA 1CF3A 1PN0A 2JB2A 3NTAA 2ZZBA 3EPTA 4RSLA 5GSNA 4EIQA 3QVRA 1XHCA 4B63A 2C75A 2YAUA 1PJ7A 3Q9TA 3KA7A 1KSUA 3G5RA 4BK3A 1Q9IA 3NHOX 1D4CA 3ALJA 3EAOA 4UDRA 1N1PA 2BS2A 1XDIA 2YG6A 3G5SA 1BGJA 2A8XA 5KOWA 3AEFA 3LZXA 1NHQA 4GCMA 3DK4A 5TR3A 1PHHA 3COXA 2WPCA 2WDQA 4U8JA 2BS3A 3URHA 2XFPA 1H82A 2EQ8A 2C7GA 3B6DA 5EBKA 4A9WA 1YQ4A 2E1MA 1Q1WA 5M0ZA 5IPYA 2F5ZA 5C3JA 3VR9A 4AT0A 4XWRA 4H4QA 1N4UA 1TDEA 2V5ZA 3JSKA 4U8PA 4PABA 1ZOVA 5KRQA 4Z2RA 2YLZA 4OPUA 4EQSA 1JNRA 4JN9A 3KVEA 2YQUA 3HZLA 1O95A 4WX1A 3SM8A 3UTGA 3FPZA 2B7RA 1K0JA 1TYPA 2Y6QA 3BHFA 2FJAA 4H4YA 3OZ2A 1M6IA 4A5LA 4AP1A 2IIDA 1JNZA 1KFYA 3K7QX 3AE2A 3VRAA 1GRBA 4A6NA 2V61A 2GQWA 4K2XA 4OPCA 2DKIA 2WQYA 3CPHG 4Z2UA 1ONFA 1VG0A 2Y6RA 3CPJG 4B65A 4YSHA 1E6EA 2YM1A 4TM4A 3UTEA 3S61A 2XYOA 3H4KA 2WDVA 4USQA 3SQPA 3PO7A 1QJDA 1ZMDA 2Q7VA 2JB1A 3AE6A 1LPFA 2QCUA 1F8SA 3DJEA 2YLWA 4OPIA 3M12A 4YKGA 2YLSA 4H7UA 3K7MX 4UDQA 4JQ9A 1IUVA 3GD3A 2Q6UA 4A7AA 1PBEA 2ARDA 3UP5A 2X8GA 2R0PA 3GWDA 5U63A 1GV4A 4LIIA 4OVIA 4CNKA 1XPQA 4IA5A 2C3DA 2A87A 3CNJA 2TPRA 2X50A 2VRMA 3ATQA 3F8PA 4WCTA 4ECHA 2GAGB 4B67A 3BNMA 3FG2P 3GMBA 4BV6A 5JCKA 5KOXA 3Q6JA 2HQMA 4CCRA 1MO9A 1FEBA 1IUUA 3NNEA 3ISHA 1JEHA 2YG5A 2AQJA 1B5QA 1TYTA 1Z6LA 3I6DA 1DOEA 1GRFA 1EL5A 2EQ9A 2JBVA 2Z5XA 3I3LA 3UKFA 2C73A 3RP6A 4B66A 1KSSA 3ALLA 3NK0X 4NTDA 4AOSA 4KX6A 1LTXR 3QFAA 4X9MA 1F3PA 5CKUA 3P4PA 3DK8A 5FS9A 1O5WA 2GVCA 1MOKA 2OA1A 1IJHA 4U2TA 4BK2A 2VRLA 4FX9A 5M10A 1M64A 2X3NA 4TLZA 1LQTA 3CIRA 1TDKA 1K4QA 4C3YA 5GRTA 4IV9A 1Q1RA 3ICSA 1H6VA 1KF6A 3NLCA 4Z26A 1GPEA 3PS9A 1BGNA 1PXCA 1EL8A 1PJ5A 1RYIA 3GSIA 3OC4A 3CGDA 4FK1C 4JY3A 3DGZA 4H2QA 4D03A 1NEKA 3AD9B 4H2PA 5J60A 4UP3A 4LA1A 5KVIA 1GEUA 3CNTA 4J56A 1NENA 2R0CA 2B7SA
chains in the Genus database with same CATH superfamily
1ZK7A 2Q0LA 2YVFA 3AYLA 3HYXA 5FS8A 1DJQA 4U8KA 3FMWA 1YKJA 3C4NA 4Z2TA 3AWIA 3P4RA 2JAEA 4YT0A 5KXJA 2AAQA 4E0VA 2WBAA 1VG9A 2JK6A 3ATRA 3FBSA 3SZCA 2CFYA 3P1WA 3IC9A 4UDPA 2OALA 3VRDB 2B9XA 2BK3A 2C3CA 2XLUA 2H89A 5FMHA 1S3BA 4O5QA 2VQ7A 4EM3A 1GRGA 2GMHA 3CGCA 4Z44A 1TDOA 3BNUA 1H7XA 1DODA 1PXAA 2YM2A 3GYXA 1ZKQA 2BRAA 2XLPA 4K8DA 3RP8A 1N4WA 3B3RA 3NTDA 2DKHA 3S5WA 3VR8A 2J3NA 2I0ZA 4H4PA 1PJ6A 2RGHA 4A65A 4CRTA 3V76A 3AEDA 3SFDA 1HYUA 3DJJA 4GDPA 1JRYA 4KPRA 4APNA 1VQWA 3KPFA 2IVDA 1IUWA 4EQRA 3L8KA 4Z25A 1GT8A 1IUTA 1NPXA 2FJEA 4J36A 1JU2A 2X99A 2X8CA 1DOCA 1CBOA 1ZOYA 2BCPA 3ZDNA 2C65A 1RP0A 4CNJA 2WP9A 4U8NA 4LU6A 5U25A 4CCQA 1FCDA 1ZX9A 3SZWA 3AE1A 2EQ6A 3NT6A 3NG7X 1E1KA 4C3XA 1MXTA 4GR1A 4K7ZA 4Z43A 2AR8A 2BK4A 4G9KA 3IHGA 2GMJA 3AYIA 5LV9A 2YG4A 4J2WA 4EIPA 3P4QA 3NIXA 1LVLA 5BVAA 2YR4A 4H4VA 2YVJA 3GRTA 4M52A 4NEWA 1E1NA 1GRTA 3ZYXA 3BHKA 2R45A 1FECA 2R46A 3ADAB 1BZLA 3CNDA 3P4SA 2OAMA 1F8WA 2C70A 3P9UA 3QSSA 4II3A 2C66A 3GYJA 2GR1A 4U2SA 4YSZA 2GF3A 2RGOA 5DBJA 2BYBA 2C67A 1E39A 4Y4LA 4BJZA 5EB4A 5BRTA 4H2RA 3REDA 4B64A 2VVLA 4K5SA 2GV8A 4JNQA 3GMCA 4JNAA 4H2NA 3ABVA 1SEZA 4NTCA 3UKAA 3NN0X 5HHFA 1VRQB 1DNCA 1W4XA 2WS3A 5EOWA 4U8IA 5JCNA 3LZWA 3SZFA 3KU9A 3AEAA 1ELIA 1FL2A 4JDRA 2BS4A 4CY8A 1F8RA 3UKLA 2YR5A 1KNRA 3UOXA 3QSEA 1ZDLA 1GOSA 3CMMA 1D7YA 3T37A 5U1OA 2WPFA 2YLTA 1KDGA 3LOVA 4EMJA 4N9XA 4AT2A 2GRTA 3NN6X 3UP4A 3QVPA 4YXDA 2GQFA 3NYCA 2XFNA 1OJAA 3QSMA 4AP3A 3CNPA 1S2YA 3UTFA 4IA6A 3BI2A 1E1MA 3RP7A 2RGJA 2GAHB 1QLBA 2BABA 4EM4A 1NG3A 4H50A 2WPEA 3HYVA 4J33A 3DGHA 4TM1A 2WESA 2WU5A 3LB8A 4G74A 4U2LA 4H4WA 2YG7A 1PBDA 1NHRA 2E5VA 4YWOA 2GR2A 4A99A 3NRNA 2BC1A 3RHAA 5KVHA 2C72A 1CJ2A 3AEEA 3DH9A 4H4TA 3IF9A 2C64A 1CC2A 4TLXA 1XANA 2XFUA 1OJ9A 4EQWA 1H86A 5IQ4A 5KMRA 1FOHA 1CL0A 1QO8A 1DOBA 3SYIA 1D4DA 4OPTA 1JRZA 1IUXA 4U8MA 3AE3A 3UCLA 3UOYA 1PDHA 4BK1A 3V3OA 1GRHA 3AECA 4H4XA 4G6HA 1D5TA 2GEWA 3H8LA 2XLTA 1CJ3A 3VRBA 4H4RA 2QA2A 2V60A 2H88A 2VOUA 3UKHA 1EL7A 2XLSA 3BI4A 3T2KA 5JCLA 5KNLA 1B37A 1LJ1A 1TRBA 2R4JA 1B8SA 3H8IA 2XVHA 1EL9A 1GTEA 5BUKA 2NPXA 2WOVA 5L46A 1NHSA 3BI5A 4G73A 1TDFA 3CNSA 4OCGA 5JCIA 2APGA 4I58A 2GH5A 2YVGA 3D8XA 4NZHA 4C74A 3L1RA 2YLRA 3C4AA 2XFOA 3UKKA 2BC0A 2VVLG 2GR3A 2YLXA 2C4CA 5FS7A 2Q0KA 4Z24A 3F8DA 4O5UA 1CC6A 1GRAA 1FEAA 4B68A 2BXRA 4K22A 2PHHA 5KWFA 5KMQA 3M13A 1N4VA 2BXSA 4Y4NA 4YTPA 1GESA 4NTEA 3K30A 5IQ1A 1PXBA 4DGKA 2Z5YA 2QA1A 2GB0A 3K7TA 3LXDA 3RNMA 4GAVA 4J31A 4XXGA 3II4A 1EBDA 3T14A 4YTMA 3SGLA 4FDCB 2XVJA 3AE7A 1X31B 1Y0PA 3V3NA 4BJYA 4EMIA 1COYA 1TDNA 4REKA 3IHMA 2XDOA 4X4JA 4TM3A 2X8HA 4YTNA 3AE5A 4XWZA 4DNAA 1H7WA 2B76A 2ACZA 5KMPA 1NG4A 3DJDA 2BCGG 4OPLA 3NYEA 4PAAA 1OJCA 4J57A 2XVIA 2UZZA 2V3AA 4EMWA 5BULA 3AB1A 3C96A 3EF6A 1PBCA 2VQBA 4C77A 2OLOA 3DMEA 2ZZ0A 2VVMA 2O9ZA 4IVOB 1BWCA 1CHUA 1K0IA 2ZZCA 4B69A 4ZCCA 2XVEA 3GWFA 3KKJA 1YQ3A 2WETA 3ITJA 3UTHA 3F8RA 1ZP0A 2JB3A 3AXBA 4K5RA 2WOWA 3PVCA 2QAEA 3R9UA 3AD7B 1D4EA 3DJGX 2FBWA 4U8LA 2XFQA 1DJNA 3CN8A 1O94A 4X9NA 1D7LA 1H83A 2YR6A 3QFBA 4GUVA 1S3EA 3VQRA 3FIMB 4C5OA 1OJDA 4ADWA 4P9SA 4YSXA 1Y56B 2V3BA 2WP6A 5CQFA 1IUSA 3SFEA 1KNPA 1VDCA 3NK1X 1GETA 3UKQA 3O0HA 4Y4MA 1GREA 5KMSA 1K0LA 3CTYA 3AYJA 1PBFA 2XLRA 3GD4A 1AOGA 4J34A 4IVMB 1CJCA 3UOZA 3SXIA 1L9CA 5HXIA 2CULA 3GDNA 3LJPA 2V6OA 3ICRA 1F6MA 2R4EA 4NWZA 4H4UA 1OJTA 2WEUA 1JOAA 2RABA 1NAAA 3G5QA 1GXFA 3CGEA 3GRSA 4HB9A 3ALMA 2R9ZA 4JY2A 2C76A 3ICTA 4I59A 1E7PA 3QJ4A 1YY5A 4OPGA 4A79A 5FS6A 1GNDA 2YWLA 1BKWA 3E1TA 3M0OA 2B9WA 2B9YA 4FK1A 3KD9A 3UOVA 3NK2X 1CJ4A 1P2HA 3NGCX 2BRYA 4AOXA 1H84A 2A89A 3NKSA 4MJWA 1L0VA 4RG3A 2R0GA 3AEGA 3DK9A 3CGBA 1ZMCA 1GSNA 4H4SA 2WOIA 1LQUA 2FJBA 3AE4A 1LV0A 1E1LA 2PYXA 2W0HA 4ICYA 3WE0A 5C2TA 1REOA 3IWAA 2GR0A 1L9DA 3AE9A 3GYIA 4D04A 4U8OA 4GF7A 4ZN0A 4CBQA 3SY4A 2WHDA 3NYFA 4YKFA 5EB5A 4USRA 2JKCA 4YSYA 1PS9A 2WDRA 2E4GA 4H4ZA 4RG4A 4DSGA 1PBBA 1NHPA 4DSHA 2BACA 1B4VA 1ZY8A 1NDAA 1GTHA 3GDPA 2TMDA 4HA6A 3AEBA 4CY6A 2OLNA 4ZCDA 2ZBWA 2CDUA 1DXLA 4GDEA 2BA9A 2VZ2A 2IVEA 1GALA 1CC4A 1UKVG 2YG3A 1P2EA 2WU2A 3LADA 3NH3X 4NEVA 4GRTA 4A6NB 4EQXA 5HY5A 5HYMA 1RSGA 4TM0A 1Y56A 3T31A 3DA1A 3EANA 1S2QA 1BF3A 1YQZA 5ER0A 2EQ7A 3KLJA 1H81A 1V59A 5J7XA 1GERA 3D1CA 3AE8A 2XVFA 3T2ZA 3CPIG 2CVJA 1L9EA 4BURA 2WP5A 1JRXA 3AD8B 3UKPA 5JCMA 2FJDA 2NVKX 4B1BA 2BK5A 4OPDA 2XCGA 1CF3A 1PN0A 2JB2A 3NTAA 2ZZBA 3EPTA 4RSLA 5GSNA 4EIQA 3QVRA 1XHCA 4B63A 2C75A 2YAUA 1PJ7A 3Q9TA 3KA7A 1KSUA 3G5RA 4BK3A 1Q9IA 3NHOX 1D4CA 3ALJA 3EAOA 4UDRA 1N1PA 2BS2A 4GAPA 1XDIA 2YG6A 3G5SA 1BGJA 2A8XA 5KOWA 3AEFA 3LZXA 1NHQA 4GCMA 3DK4A 5TR3A 1PHHA 3COXA 3SX6A 2WPCA 2WDQA 4U8JA 3SZ0A 2BS3A 3URHA 2XFPA 1H82A 2EQ8A 2C7GA 3B6DA 5EBKA 4A9WA 1YQ4A 2E1MA 1Q1WA 5M0ZA 5IPYA 2F5ZA 5C3JA 3VR9A 4AT0A 4XWRA 3T2YA 4H4QA 1N4UA 1TDEA 2V5ZA 3JSKA 4U8PA 4PABA 1ZOVA 5KRQA 4Z2RA 2YLZA 4OPUA 4EQSA 1JNRA 4JN9A 3KVEA 2YQUA 3HZLA 1O95A 4G6GA 4WX1A 3SM8A 3FPZA 2B7RA 1K0JA 1TYPA 2Y6QA 3BHFA 2FJAA 4H4YA 3OZ2A 1M6IA 4A5LA 4AP1A 2IIDA 1JNZA 1KFYA 3K7QX 3AE2A 3VRAA 1GRBA 4A6NA 2V61A 2GQWA 4K2XA 4OPCA 2DKIA 2WQYA 3CPHG 4Z2UA 1ONFA 1VG0A 2Y6RA 3CPJG 4B65A 4YSHA 1E6EA 2YM1A 4TM4A 3UTEA 3S61A 2XYOA 3H4KA 2WDVA 4USQA 3SQPA 3KPKA 3PO7A 1QJDA 1ZMDA 2Q7VA 2JB1A 3AE6A 1LPFA 2QCUA 1F8SA 3DJEA 2YLWA 4OPIA 3M12A 4YKGA 2YLSA 4H7UA 3K7MX 4UDQA 4JQ9A 1IUVA 3GD3A 2Q6UA 4A7AA 1PBEA 2ARDA 3UP5A 2X8GA 2R0PA 4II2A 3GWDA 5U63A 1GV4A 4LIIA 4OVIA 4CNKA 1XPQA 4IA5A 2C3DA 2A87A 3CNJA 2TPRA 2X50A 2VRMA 3ATQA 3F8PA 4WCTA 4ECHA 2GAGB 4B67A 3BNMA 3FG2P 3GMBA 3T0KA 4BV6A 5JCKA 5KOXA 3Q6JA 2HQMA 4CCRA 1MO9A 1FEBA 1IUUA 3NNEA 3ISHA 1JEHA 2YG5A 2AQJA 1B5QA 1TYTA 1Z6LA 3I6DA 1DOEA 1GRFA 1EL5A 2EQ9A 2JBVA 2Z5XA 3I3LA 3UKFA 2C73A 3RP6A 4B66A 1KSSA 3ALLA 3NK0X 4NTDA 4AOSA 4NNJA 4KX6A 1LTXR 3QFAA 4X9MA 1F3PA 5CKUA 3P4PA 3DK8A 5FS9A 1O5WA 2GVCA 1MOKA 2OA1A 3UTGA 1IJHA 4U2TA 4BK2A 2VRLA 4FX9A 5M10A 1M64A 2X3NA 4TLZA 1LQTA 3CIRA 1TDKA 1K4QA 4C3YA 5GRTA 4IV9A 1Q1RA 3ICSA 1H6VA 1KF6A 3NLCA 4Z26A 1GPEA 3PS9A 1BGNA 1PXCA 1EL8A 1PJ5A 1RYIA 3GSIA 3OC4A 3CGDA 4FK1C 4JY3A 3DGZA 3HYWA 4H2QA 4D03A 1NEKA 3AD9B 4H2PA 5J60A 4UP3A 4LA1A 5KVIA 1GEUA 3CNTA 4J56A 1NENA 2R0CA 2B7SA
chains in the Genus database with same CATH topology
1ZK7A 2Q0LA 2YVFA 3AYLA 3HYXA 5FS8A 1DJQA 4U8KA 3FMWA 1YKJA 3C4NA 4Z2TA 3AWIA 3P4RA 2JAEA 4YT0A 5KXJA 2AAQA 4E0VA 2WBAA 1VG9A 2JK6A 3ATRA 3FBSA 3SZCA 2CFYA 3P1WA 3IC9A 4UDPA 2OALA 3VRDB 2BK3A 2B9XA 2C3CA 2XLUA 2H89A 5FMHA 1S3BA 4O5QA 2VQ7A 4EM3A 1GRGA 2GMHA 3CGCA 4Z44A 1TDOA 3BNUA 1H7XA 1DODA 1PXAA 2YM2A 3GYXA 1ZKQA 2BRAA 2XLPA 4K8DA 3RP8A 1N4WA 3B3RA 3NTDA 2DKHA 3S5WA 3VR8A 2J3NA 2I0ZA 4H4PA 1PJ6A 2RGHA 4A65A 4CRTA 3V76A 3AEDA 3SFDA 1HYUA 3DJJA 4GDPA 1JRYA 4KPRA 4APNA 1VQWA 3KPFA 2IVDA 1IUWA 4EQRA 3L8KA 4Z25A 1GT8A 1IUTA 1NPXA 2FJEA 4J36A 1JU2A 2X99A 2X8CA 1DOCA 1CBOA 1ZOYA 2BCPA 3ZDNA 2C65A 1RP0A 4CNJA 2WP9A 4U8NA 4LU6A 5U25A 4CCQA 1FCDA 1ZX9A 3SZWA 3AE1A 2EQ6A 3NT6A 3NG7X 1E1KA 4C3XA 1MXTA 4GR1A 4K7ZA 4Z43A 2AR8A 2BK4A 4G9KA 3IHGA 2GMJA 3AYIA 5LV9A 2YG4A 4J2WA 4EIPA 3P4QA 3NIXA 1LVLA 5BVAA 2YR4A 4H4VA 2YVJA 3GRTA 4M52A 4NEWA 1E1NA 1GRTA 3ZYXA 3BHKA 2R45A 1FECA 2R46A 3ADAB 1BZLA 3CNDA 3P4SA 2OAMA 1F8WA 2C70A 3P9UA 3QSSA 4II3A 2C66A 3GYJA 2GR1A 4U2SA 4YSZA 2GF3A 2RGOA 5DBJA 2BYBA 2C67A 1E39A 4Y4LA 4BJZA 5EB4A 5BRTA 4H2RA 3REDA 4B64A 2VVLA 4K5SA 2GV8A 4JNQA 3GMCA 4JNAA 4H2NA 3ABVA 1SEZA 4NTCA 3UKAA 3NN0X 5HHFA 1VRQB 1DNCA 1W4XA 2WS3A 5EOWA 4U8IA 5JCNA 3LZWA 3SZFA 3KU9A 3AEAA 1ELIA 1FL2A 4JDRA 2BS4A 4CY8A 1F8RA 3UKLA 2YR5A 1KNRA 3UOXA 3QSEA 1ZDLA 1GOSA 3CMMA 1D7YA 3T37A 5U1OA 2WPFA 2YLTA 1KDGA 3LOVA 4EMJA 4N9XA 4AT2A 2GRTA 3NN6X 3UP4A 3QVPA 4YXDA 2GQFA 3NYCA 2XFNA 1OJAA 3QSMA 4AP3A 3CNPA 1S2YA 3UTFA 4IA6A 3BI2A 1E1MA 3RP7A 2RGJA 2GAHB 1QLBA 2BABA 4EM4A 1NG3A 4H50A 2WPEA 3HYVA 4J33A 3DGHA 4TM1A 2WESA 2WU5A 3LB8A 4G74A 4U2LA 4H4WA 2YG7A 1PBDA 1NHRA 2E5VA 4YWOA 2GR2A 4A99A 3NRNA 2BC1A 3RHAA 5KVHA 2C72A 1CJ2A 3AEEA 3DH9A 4H4TA 3IF9A 2C64A 1CC2A 4TLXA 1XANA 2XFUA 1OJ9A 4EQWA 1H86A 5IQ4A 5KMRA 1FOHA 1CL0A 1QO8A 1DOBA 3SYIA 1D4DA 4OPTA 1JRZA 1IUXA 4U8MA 3AE3A 3UCLA 3UOYA 1PDHA 4BK1A 3V3OA 1GRHA 3AECA 4H4XA 4G6HA 1D5TA 2GEWA 3H8LA 2XLTA 1CJ3A 3VRBA 4H4RA 2QA2A 2V60A 2H88A 2VOUA 3UKHA 1EL7A 2XLSA 3BI4A 3T2KA 5JCLA 5KNLA 1B37A 1LJ1A 1TRBA 2R4JA 1B8SA 3H8IA 2XVHA 1EL9A 1GTEA 5BUKA 2NPXA 2WOVA 5L46A 1NHSA 3BI5A 4G73A 1TDFA 3CNSA 4OCGA 5JCIA 2APGA 4I58A 2GH5A 2YVGA 3D8XA 4NZHA 4C74A 3L1RA 2YLRA 3C4AA 2XFOA 3UKKA 2BC0A 2VVLG 2GR3A 2YLXA 2C4CA 5FS7A 2Q0KA 4Z24A 3F8DA 4O5UA 1CC6A 1GRAA 1FEAA 4B68A 2BXRA 4K22A 2PHHA 5KWFA 5KMQA 3M13A 1N4VA 2BXSA 4Y4NA 4YTPA 1GESA 4NTEA 3K30A 5IQ1A 1PXBA 4DGKA 2Z5YA 2QA1A 2GB0A 3K7TA 3LXDA 3RNMA 4GAVA 4J31A 4XXGA 3II4A 1EBDA 3T14A 4YTMA 3SGLA 4FDCB 2XVJA 3AE7A 1X31B 1Y0PA 3V3NA 4BJYA 4EMIA 1COYA 1TDNA 4REKA 3IHMA 2XDOA 4X4JA 4TM3A 2X8HA 4YTNA 3AE5A 4XWZA 4DNAA 1H7WA 2B76A 2ACZA 5KMPA 1NG4A 3DJDA 2BCGG 4OPLA 3NYEA 4PAAA 1OJCA 4J57A 2XVIA 2UZZA 2V3AA 4EMWA 5BULA 3AB1A 3C96A 3EF6A 1PBCA 2VQBA 4C77A 2OLOA 3DMEA 2ZZ0A 2VVMA 2O9ZA 4IVOB 1BWCA 1CHUA 1K0IA 2ZZCA 4B69A 4ZCCA 2XVEA 3GWFA 3KKJA 1YQ3A 2WETA 3ITJA 3UTHA 3F8RA 1ZP0A 2JB3A 3AXBA 4K5RA 2WOWA 3PVCA 2QAEA 3R9UA 3AD7B 1D4EA 3DJGX 2FBWA 4U8LA 2XFQA 1DJNA 3CN8A 1O94A 4X9NA 1D7LA 1H83A 2YR6A 3QFBA 4GUVA 1S3EA 3VQRA 3FIMB 4C5OA 1OJDA 4ADWA 4P9SA 4YSXA 1Y56B 2V3BA 2WP6A 5CQFA 1IUSA 3SFEA 1KNPA 1VDCA 3NK1X 1GETA 3UKQA 3O0HA 4Y4MA 1GREA 5KMSA 1K0LA 3CTYA 3AYJA 1PBFA 2XLRA 3GD4A 1AOGA 4J34A 4IVMB 1CJCA 3UOZA 3SXIA 1L9CA 5HXIA 2CULA 3GDNA 3LJPA 2V6OA 3ICRA 1F6MA 2R4EA 4NWZA 4H4UA 1OJTA 2WEUA 1JOAA 2RABA 1NAAA 3G5QA 1GXFA 3CGEA 3GRSA 4HB9A 3ALMA 2R9ZA 4JY2A 2C76A 3ICTA 4I59A 1E7PA 3QJ4A 1YY5A 4OPGA 4A79A 5FS6A 1GNDA 2YWLA 1BKWA 3E1TA 3M0OA 2B9WA 2B9YA 4FK1A 3KD9A 3UOVA 3NK2X 1CJ4A 1P2HA 3NGCX 2BRYA 4AOXA 1H84A 2A89A 3NKSA 4MJWA 1L0VA 4RG3A 2R0GA 3AEGA 3DK9A 3CGBA 1ZMCA 1GSNA 4H4SA 2WOIA 1LQUA 2FJBA 3AE4A 1LV0A 1E1LA 2PYXA 2W0HA 4ICYA 3WE0A 5C2TA 1REOA 3IWAA 2GR0A 1L9DA 3AE9A 3GYIA 4D04A 4U8OA 4GF7A 4ZN0A 4CBQA 3SY4A 2WHDA 3NYFA 4YKFA 5EB5A 4USRA 2JKCA 4YSYA 1PS9A 2WDRA 2E4GA 4H4ZA 4RG4A 4DSGA 1PBBA 1NHPA 4DSHA 1ZY8A 1B4VA 2BACA 1NDAA 1GTHA 3GDPA 2TMDA 4HA6A 3AEBA 4CY6A 2OLNA 4ZCDA 2ZBWA 2CDUA 1DXLA 4GDEA 2BA9A 2VZ2A 2IVEA 1GALA 1CC4A 1UKVG 2YG3A 1P2EA 2WU2A 3LADA 3NH3X 4NEVA 4GRTA 4A6NB 4EQXA 5HY5A 5HYMA 1RSGA 4TM0A 1Y56A 3T31A 3DA1A 3EANA 1S2QA 1BF3A 1YQZA 5ER0A 2EQ7A 3KLJA 1H81A 1V59A 5J7XA 1GERA 3D1CA 3AE8A 2XVFA 3T2ZA 3CPIG 2CVJA 1L9EA 4BURA 2WP5A 1JRXA 3AD8B 3UKPA 5JCMA 2FJDA 2NVKX 4B1BA 2BK5A 4OPDA 2XCGA 1CF3A 1PN0A 2JB2A 3NTAA 2ZZBA 3EPTA 4RSLA 5GSNA 4EIQA 3QVRA 1XHCA 4B63A 2C75A 2YAUA 1PJ7A 3Q9TA 3KA7A 1KSUA 3G5RA 4BK3A 1Q9IA 3NHOX 1D4CA 3ALJA 3EAOA 4UDRA 1N1PA 2BS2A 4GAPA 1XDIA 2YG6A 3G5SA 1BGJA 2A8XA 5KOWA 3AEFA 3LZXA 1NHQA 4GCMA 3DK4A 5TR3A 1PHHA 3COXA 3SX6A 2WPCA 2WDQA 4U8JA 3SZ0A 2BS3A 3URHA 2XFPA 1H82A 2EQ8A 2C7GA 3B6DA 5EBKA 4A9WA 1YQ4A 2E1MA 1Q1WA 5M0ZA 5IPYA 2F5ZA 5C3JA 3VR9A 4AT0A 4XWRA 3T2YA 4H4QA 1N4UA 1TDEA 2V5ZA 3JSKA 4U8PA 4PABA 1ZOVA 5KRQA 4Z2RA 2YLZA 4OPUA 4EQSA 1JNRA 4JN9A 3KVEA 2YQUA 3HZLA 1O95A 4G6GA 4WX1A 3SM8A 3FPZA 2B7RA 1K0JA 1TYPA 2Y6QA 3BHFA 2FJAA 4H4YA 3OZ2A 1M6IA 4A5LA 4AP1A 2IIDA 1JNZA 1KFYA 3K7QX 3AE2A 3VRAA 1GRBA 4A6NA 2V61A 2GQWA 4K2XA 4OPCA 2DKIA 2WQYA 3CPHG 4Z2UA 1ONFA 1VG0A 2Y6RA 3CPJG 4B65A 4YSHA 1E6EA 2YM1A 4TM4A 3UTEA 3S61A 2XYOA 3H4KA 2WDVA 4USQA 3SQPA 3KPKA 3PO7A 1QJDA 1ZMDA 2Q7VA 2JB1A 3AE6A 1LPFA 2QCUA 1F8SA 3DJEA 2YLWA 4OPIA 3M12A 4YKGA 2YLSA 4H7UA 3K7MX 4UDQA 4JQ9A 1IUVA 3GD3A 2Q6UA 4A7AA 1PBEA 2ARDA 3UP5A 2X8GA 2R0PA 4II2A 3GWDA 5U63A 1GV4A 4LIIA 4OVIA 4CNKA 1XPQA 4IA5A 2C3DA 2A87A 3CNJA 2TPRA 2X50A 2VRMA 3ATQA 3F8PA 4WCTA 4ECHA 2GAGB 4B67A 3BNMA 3FG2P 3GMBA 3T0KA 4BV6A 5JCKA 5KOXA 3Q6JA 2HQMA 4CCRA 1MO9A 1FEBA 1IUUA 3NNEA 3ISHA 1JEHA 2YG5A 2AQJA 1B5QA 1TYTA 1Z6LA 3I6DA 1DOEA 1GRFA 1EL5A 2EQ9A 2JBVA 2Z5XA 3I3LA 3UKFA 2C73A 3RP6A 4B66A 1KSSA 3ALLA 3NK0X 4NTDA 4AOSA 4NNJA 4KX6A 1LTXR 3QFAA 4X9MA 1F3PA 5CKUA 3P4PA 3DK8A 5FS9A 1O5WA 2GVCA 1MOKA 2OA1A 3UTGA 1IJHA 4U2TA 4BK2A 2VRLA 4FX9A 5M10A 1M64A 2X3NA 4TLZA 1LQTA 3CIRA 1TDKA 1K4QA 4C3YA 5GRTA 4IV9A 1Q1RA 3ICSA 1H6VA 1KF6A 3NLCA 4Z26A 1GPEA 3PS9A 1BGNA 1PXCA 1EL8A 1PJ5A 1RYIA 3GSIA 3OC4A 3CGDA 4FK1C 4JY3A 3DGZA 3HYWA 4H2QA 4D03A 1NEKA 3AD9B 4H2PA 5J60A 4UP3A 4LA1A 5KVIA 1GEUA 3CNTA 4J56A 1NENA 2R0CA 2B7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK7 A;  2Q0L A;  2YVF A;  3AYL A;  5FS8 A;  1DJQ A;  4U8K A;  3FMW A;  1YKJ A;  3C4N A;  4Z2T A;  3AWI A;  3P4R A;  2JAE A;  4YT0 A;  5KXJ A;  2AAQ A;  4E0V A;  2WBA A;  1VG9 A;  2JK6 A;  3ATR A;  3FBS A;  2CFY A;  3P1W A;  3IC9 A;  4UDP A;  2OAL A;  3VRD B;  2BK3 A;  2B9X A;  2C3C A;  2XLU A;  2H89 A;  5FMH A;  1S3B A;  4O5Q A;  2VQ7 A;  4EM3 A;  1GRG A;  2GMH A;  3CGC A;  4Z44 A;  1TDO A;  3BNU A;  1H7X A;  1DOD A;  1PXA A;  2YM2 A;  4K8D A;  1ZKQ A;  2XLP A;  3RP8 A;  1N4W A;  3B3R A;  3NTD A;  2DKH A;  3S5W A;  3VR8 A;  2J3N A;  2I0Z A;  4H4P A;  1PJ6 A;  2RGH A;  4A65 A;  4CRT A;  3V76 A;  3AED A;  3SFD A;  1HYU A;  3DJJ A;  4GDP A;  1JRY A;  4KPR A;  4APN A;  1VQW A;  3KPF A;  2IVD A;  1IUW A;  4EQR A;  3L8K A;  4Z25 A;  1GT8 A;  1IUT A;  1NPX A;  2FJE A;  4J36 A;  1JU2 A;  2X99 A;  2X8C A;  1DOC A;  1CBO A;  1ZOY A;  2BCP A;  3ZDN A;  2C65 A;  1RP0 A;  4CNJ A;  2WP9 A;  4U8N A;  4LU6 A;  5U25 A;  4CCQ A;  1FCD A;  1ZX9 A;  3AE1 A;  2EQ6 A;  3NT6 A;  3NG7 X;  1E1K A;  4C3X A;  1MXT A;  4GR1 A;  4K7Z A;  4Z43 A;  2AR8 A;  2BK4 A;  3IHG A;  2GMJ A;  3AYI A;  5LV9 A;  2YG4 A;  4J2W A;  4EIP A;  3P4Q A;  3NIX A;  1LVL A;  5BVA A;  2YR4 A;  4H4V A;  2YVJ A;  3GRT A;  4M52 A;  4NEW A;  1E1N A;  1GRT A;  3ZYX A;  3BHK A;  2R45 A;  1FEC A;  2R46 A;  3ADA B;  1BZL A;  3CND A;  3P4S A;  2OAM A;  1F8W A;  2C70 A;  3P9U A;  3QSS A;  2C66 A;  3GYJ A;  2GR1 A;  4U2S A;  4YSZ A;  2GF3 A;  2RGO A;  5DBJ A;  2BYB A;  2C67 A;  1E39 A;  4Y4L A;  4BJZ A;  5EB4 A;  5BRT A;  4H2R A;  3RED A;  4B64 A;  2VVL A;  4K5S A;  2GV8 A;  4JNQ A;  3GMC A;  4JNA A;  4H2N A;  3ABV A;  1SEZ A;  4NTC A;  3UKA A;  3NN0 X;  5HHF A;  1VRQ B;  1DNC A;  1W4X A;  2WS3 A;  5EOW A;  4U8I A;  5JCN A;  3LZW A;  3KU9 A;  3AEA A;  1ELI A;  1FL2 A;  4JDR A;  2BS4 A;  4CY8 A;  1F8R A;  3UKL A;  2YR5 A;  1KNR A;  3UOX A;  3QSE A;  1ZDL A;  1GOS A;  1D7Y A;  3T37 A;  5U1O A;  2WPF A;  2YLT A;  1KDG A;  3LOV A;  4EMJ A;  4N9X A;  4AT2 A;  2GRT A;  3NN6 X;  3UP4 A;  3QVP A;  4YXD A;  2GQF A;  3NYC A;  2XFN A;  1OJA A;  3QSM A;  4AP3 A;  3CNP A;  1S2Y A;  3UTF A;  4IA6 A;  3BI2 A;  1E1M A;  3RP7 A;  2RGJ A;  2GAH B;  1QLB A;  2BAB A;  4EM4 A;  1NG3 A;  4H50 A;  2WPE A;  4J33 A;  3DGH A;  4TM1 A;  2WES A;  2WU5 A;  3LB8 A;  4U2L A;  4H4W A;  2YG7 A;  1PBD A;  1NHR A;  2E5V A;  4YWO A;  2GR2 A;  4A99 A;  3NRN A;  2BC1 A;  3RHA A;  5KVH A;  2C72 A;  1CJ2 A;  3AEE A;  3DH9 A;  4H4T A;  3IF9 A;  2C64 A;  1CC2 A;  4TLX A;  1XAN A;  2XFU A;  1OJ9 A;  4EQW A;  1H86 A;  5IQ4 A;  1FOH A;  1CL0 A;  1QO8 A;  1DOB A;  1D4D A;  4OPT A;  1JRZ A;  1IUX A;  4U8M A;  3AE3 A;  3UCL A;  3UOY A;  1PDH A;  4BK1 A;  3V3O A;  1GRH A;  3AEC A;  4H4X A;  1D5T A;  2GEW A;  3H8L A;  2XLT A;  1CJ3 A;  3VRB A;  4H4R A;  2QA2 A;  2V60 A;  2H88 A;  2VOU A;  3UKH A;  1EL7 A;  2XLS A;  3BI4 A;  5JCL A;  1B37 A;  1LJ1 A;  1TRB A;  2R4J A;  1B8S A;  3H8I A;  2XVH A;  1EL9 A;  1GTE A;  5BUK A;  2NPX A;  2WOV A;  5L46 A;  1NHS A;  3BI5 A;  1TDF A;  3CNS A;  4OCG A;  5JCI A;  2APG A;  4I58 A;  2GH5 A;  2YVG A;  3D8X A;  4NZH A;  4C74 A;  3L1R A;  2YLR A;  3C4A A;  2XFO A;  3UKK A;  2BC0 A;  2VVL G;  2GR3 A;  2YLX A;  5FS7 A;  2Q0K A;  4Z24 A;  3F8D A;  4O5U A;  1CC6 A;  1GRA A;  1FEA A;  4B68 A;  2BXR A;  4K22 A;  2PHH A;  5KWF A;  3M13 A;  1N4V A;  2BXS A;  4Y4N A;  4YTP A;  1GES A;  4NTE A;  3K30 A;  5IQ1 A;  1PXB A;  4DGK A;  2Z5Y A;  2QA1 A;  2GB0 A;  3K7T A;  3LXD A;  3RNM A;  4J31 A;  4XXG A;  3II4 A;  1EBD A;  4YTM A;  3SGL A;  4FDC B;  2XVJ A;  3AE7 A;  1X31 B;  1Y0P A;  3V3N A;  4BJY A;  4EMI A;  1COY A;  1TDN A;  4REK A;  3IHM A;  2XDO A;  4X4J A;  4TM3 A;  2X8H A;  4YTN A;  3AE5 A;  4XWZ A;  4DNA A;  1H7W A;  2B76 A;  2ACZ A;  1NG4 A;  3DJD A;  2BCG G;  4OPL A;  3NYE A;  4PAA A;  1OJC A;  4J57 A;  2XVI A;  2UZZ A;  2V3A A;  4EMW A;  5BUL A;  3AB1 A;  3C96 A;  3EF6 A;  1PBC A;  2VQB A;  4C77 A;  2OLO A;  3DME A;  2ZZ0 A;  2VVM A;  2O9Z A;  4IVO B;  1BWC A;  1CHU A;  1K0I A;  2ZZC A;  4B69 A;  4ZCC A;  2XVE A;  3GWF A;  3KKJ A;  1YQ3 A;  2WET A;  3ITJ A;  3UTH A;  3F8R A;  1ZP0 A;  2JB3 A;  3AXB A;  4K5R A;  2WOW A;  3PVC A;  2QAE A;  3R9U A;  3AD7 B;  1D4E A;  3DJG X;  2FBW A;  4U8L A;  2XFQ A;  1DJN A;  3CN8 A;  1O94 A;  4X9N A;  1D7L A;  1H83 A;  2YR6 A;  3QFB A;  4GUV A;  1S3E A;  3VQR A;  3FIM B;  4C5O A;  1OJD A;  4ADW A;  4P9S A;  4YSX A;  1Y56 B;  2V3B A;  2WP6 A;  5CQF A;  1IUS A;  3SFE A;  1KNP A;  1VDC A;  3NK1 X;  1GET A;  3UKQ A;  3O0H A;  4Y4M A;  1GRE A;  1K0L A;  3CTY A;  3AYJ A;  1PBF A;  2XLR A;  3GD4 A;  1AOG A;  4J34 A;  4IVM B;  1CJC A;  3UOZ A;  1L9C A;  5HXI A;  2CUL A;  3GDN A;  3LJP A;  2V6O A;  3ICR A;  1F6M A;  2R4E A;  4H4U A;  1OJT A;  2WEU A;  1JOA A;  2RAB A;  1NAA A;  3G5Q A;  1GXF A;  3CGE A;  3GRS A;  4HB9 A;  3ALM A;  2R9Z A;  4JY2 A;  2C76 A;  3ICT A;  4I59 A;  1E7P A;  3QJ4 A;  1YY5 A;  4OPG A;  4A79 A;  5FS6 A;  1GND A;  2YWL A;  1BKW A;  3E1T A;  3M0O A;  2B9W A;  2B9Y A;  4FK1 A;  3KD9 A;  3UOV A;  3NK2 X;  1CJ4 A;  1P2H A;  3NGC X;  4AOX A;  1H84 A;  2A89 A;  3NKS A;  4MJW A;  1L0V A;  4RG3 A;  2R0G A;  3AEG A;  3DK9 A;  3CGB A;  1ZMC A;  1GSN A;  4H4S A;  2WOI A;  1LQU A;  2FJB A;  3AE4 A;  1LV0 A;  1E1L A;  2PYX A;  2W0H A;  4ICY A;  3WE0 A;  5C2T A;  1REO A;  3IWA A;  2GR0 A;  1L9D A;  3AE9 A;  3GYI A;  4D04 A;  4U8O A;  4GF7 A;  4ZN0 A;  4CBQ A;  2WHD A;  3NYF A;  4YKF A;  5EB5 A;  4USR A;  2JKC A;  4YSY A;  1PS9 A;  2WDR A;  2E4G A;  4H4Z A;  4RG4 A;  4DSG A;  1PBB A;  1NHP A;  4DSH A;  1ZY8 A;  1B4V A;  2BAC A;  1NDA A;  1GTH A;  3GDP A;  2TMD A;  4HA6 A;  3AEB A;  4CY6 A;  2OLN A;  4ZCD A;  2ZBW A;  2CDU A;  1DXL A;  4GDE A;  2BA9 A;  2VZ2 A;  2IVE A;  1GAL A;  1CC4 A;  1UKV G;  2YG3 A;  1P2E A;  2WU2 A;  3LAD A;  3NH3 X;  4NEV A;  4GRT A;  4A6N B;  4EQX A;  5HY5 A;  5HYM A;  1RSG A;  4TM0 A;  1Y56 A;  3DA1 A;  3EAN A;  1S2Q A;  1BF3 A;  1YQZ A;  5ER0 A;  2EQ7 A;  3KLJ A;  1H81 A;  1V59 A;  5J7X A;  1GER A;  3D1C A;  3AE8 A;  2XVF A;  3CPI G;  2CVJ A;  1L9E A;  4BUR A;  2WP5 A;  1JRX A;  3AD8 B;  3UKP A;  5JCM A;  2FJD A;  2NVK X;  4B1B A;  2BK5 A;  4OPD A;  2XCG A;  1CF3 A;  1PN0 A;  2JB2 A;  3NTA A;  2ZZB A;  3EPT A;  4RSL A;  5GSN A;  4EIQ A;  3QVR A;  1XHC A;  4B63 A;  2C75 A;  2YAU A;  1PJ7 A;  3Q9T A;  3KA7 A;  1KSU A;  3G5R A;  4BK3 A;  1Q9I A;  3NHO X;  1D4C A;  3ALJ A;  3EAO A;  4UDR A;  1N1P A;  2BS2 A;  1XDI A;  2YG6 A;  3G5S A;  1BGJ A;  2A8X A;  5KOW A;  3AEF A;  3LZX A;  1NHQ A;  4GCM A;  3DK4 A;  5TR3 A;  1PHH A;  3COX A;  2WPC A;  2WDQ A;  4U8J A;  2BS3 A;  3URH A;  2XFP A;  1H82 A;  2EQ8 A;  2C7G A;  3B6D A;  5EBK A;  4A9W A;  1YQ4 A;  2E1M A;  1Q1W A;  5M0Z A;  5IPY A;  2F5Z A;  5C3J A;  3VR9 A;  4AT0 A;  4XWR A;  4H4Q A;  1N4U A;  1TDE A;  2V5Z A;  3JSK A;  4U8P A;  4PAB A;  1ZOV A;  5KRQ A;  4Z2R A;  2YLZ A;  4OPU A;  4EQS A;  1JNR A;  4JN9 A;  3KVE A;  2YQU A;  3HZL A;  1O95 A;  4WX1 A;  3SM8 A;  3UTG A;  3FPZ A;  2B7R A;  1K0J A;  1TYP A;  2Y6Q A;  3BHF A;  2FJA A;  4H4Y A;  3OZ2 A;  1M6I A;  4A5L A;  4AP1 A;  2IID A;  1JNZ A;  1KFY A;  3K7Q X;  3AE2 A;  3VRA A;  1GRB A;  4A6N A;  2V61 A;  2GQW A;  4K2X A;  4OPC A;  2DKI A;  2WQY A;  3CPH G;  4Z2U A;  1ONF A;  1VG0 A;  2Y6R A;  3CPJ G;  4B65 A;  4YSH A;  1E6E A;  2YM1 A;  4TM4 A;  3UTE A;  3S61 A;  2XYO A;  3H4K A;  2WDV A;  4USQ A;  3SQP A;  3PO7 A;  1QJD A;  1ZMD A;  2Q7V A;  2JB1 A;  3AE6 A;  1LPF A;  2QCU A;  1F8S A;  3DJE A;  2YLW A;  4OPI A;  3M12 A;  4YKG A;  2YLS A;  4H7U A;  3K7M X;  4UDQ A;  4JQ9 A;  1IUV A;  3GD3 A;  2Q6U A;  4A7A A;  1PBE A;  2ARD A;  3UP5 A;  2X8G A;  2R0P A;  3GWD A;  5U63 A;  1GV4 A;  4LII A;  4OVI A;  4CNK A;  1XPQ A;  4IA5 A;  2C3D A;  2A87 A;  3CNJ A;  2TPR A;  2X50 A;  2VRM A;  3ATQ A;  3F8P A;  4WCT A;  4ECH A;  2GAG B;  4B67 A;  3BNM A;  3FG2 P;  3GMB A;  4BV6 A;  5JCK A;  5KOX A;  3Q6J A;  2HQM A;  4CCR A;  1MO9 A;  1FEB A;  1IUU A;  3NNE A;  3ISH A;  1JEH A;  2YG5 A;  2AQJ A;  1B5Q A;  1TYT A;  1Z6L A;  3I6D A;  1DOE A;  1GRF A;  1EL5 A;  2EQ9 A;  2JBV A;  2Z5X A;  3I3L A;  3UKF A;  2C73 A;  3RP6 A;  4B66 A;  1KSS A;  3ALL A;  3NK0 X;  4NTD A;  4AOS A;  4KX6 A;  1LTX R;  3QFA A;  4X9M A;  1F3P A;  5CKU A;  3P4P A;  3DK8 A;  5FS9 A;  1O5W A;  2GVC A;  1MOK A;  2OA1 A;  1IJH A;  4U2T A;  4BK2 A;  2VRL A;  4FX9 A;  5M10 A;  1M64 A;  2X3N A;  4TLZ A;  1LQT A;  3CIR A;  1TDK A;  1K4Q A;  4C3Y A;  5GRT A;  4IV9 A;  1Q1R A;  3ICS A;  1H6V A;  1KF6 A;  3NLC A;  4Z26 A;  1GPE A;  3PS9 A;  1BGN A;  1PXC A;  1EL8 A;  1PJ5 A;  1RYI A;  3GSI A;  3OC4 A;  3CGD A;  4FK1 C;  4JY3 A;  3DGZ A;  4H2Q A;  4D03 A;  1NEK A;  3AD9 B;  4H2P A;  5J60 A;  4UP3 A;  4LA1 A;  5KVI A;  1GEU A;  3CNT A;  4J56 A;  1NEN A;  2R0C A;  2B7S A; 
#chains in the Genus database with same CATH topology
 1ZK7 A;  2Q0L A;  2YVF A;  3AYL A;  3HYX A;  5FS8 A;  1DJQ A;  4U8K A;  3FMW A;  1YKJ A;  3C4N A;  4Z2T A;  3AWI A;  3P4R A;  2JAE A;  4YT0 A;  5KXJ A;  2AAQ A;  4E0V A;  2WBA A;  1VG9 A;  2JK6 A;  3ATR A;  3FBS A;  3SZC A;  2CFY A;  3P1W A;  3IC9 A;  4UDP A;  2OAL A;  3VRD B;  2B9X A;  2BK3 A;  2C3C A;  2XLU A;  2H89 A;  5FMH A;  1S3B A;  4O5Q A;  2VQ7 A;  4EM3 A;  1GRG A;  2GMH A;  3CGC A;  4Z44 A;  1TDO A;  3BNU A;  1H7X A;  1DOD A;  1PXA A;  2YM2 A;  3GYX A;  1ZKQ A;  2BRA A;  2XLP A;  4K8D A;  3RP8 A;  1N4W A;  3B3R A;  3NTD A;  2DKH A;  3S5W A;  3VR8 A;  2J3N A;  2I0Z A;  4H4P A;  1PJ6 A;  2RGH A;  4A65 A;  4CRT A;  3V76 A;  3AED A;  3SFD A;  1HYU A;  3DJJ A;  4GDP A;  1JRY A;  4KPR A;  4APN A;  1VQW A;  3KPF A;  2IVD A;  1IUW A;  4EQR A;  3L8K A;  4Z25 A;  1GT8 A;  1IUT A;  1NPX A;  2FJE A;  4J36 A;  1JU2 A;  2X99 A;  2X8C A;  1DOC A;  1CBO A;  1ZOY A;  2BCP A;  3ZDN A;  2C65 A;  1RP0 A;  4CNJ A;  2WP9 A;  4U8N A;  4LU6 A;  5U25 A;  4CCQ A;  1FCD A;  1ZX9 A;  3SZW A;  3AE1 A;  2EQ6 A;  3NT6 A;  3NG7 X;  1E1K A;  4C3X A;  1MXT A;  4GR1 A;  4K7Z A;  4Z43 A;  2AR8 A;  2BK4 A;  4G9K A;  3IHG A;  2GMJ A;  3AYI A;  5LV9 A;  2YG4 A;  4J2W A;  4EIP A;  3P4Q A;  3NIX A;  1LVL A;  5BVA A;  2YR4 A;  4H4V A;  2YVJ A;  3GRT A;  4M52 A;  4NEW A;  1E1N A;  1GRT A;  3ZYX A;  3BHK A;  2R45 A;  1FEC A;  2R46 A;  3ADA B;  1BZL A;  3CND A;  3P4S A;  2OAM A;  1F8W A;  2C70 A;  3P9U A;  3QSS A;  4II3 A;  2C66 A;  3GYJ A;  2GR1 A;  4U2S A;  4YSZ A;  2GF3 A;  2RGO A;  5DBJ A;  2BYB A;  2C67 A;  1E39 A;  4Y4L A;  4BJZ A;  5EB4 A;  5BRT A;  4H2R A;  3RED A;  4B64 A;  2VVL A;  4K5S A;  2GV8 A;  4JNQ A;  3GMC A;  4JNA A;  4H2N A;  3ABV A;  1SEZ A;  4NTC A;  3UKA A;  3NN0 X;  5HHF A;  1VRQ B;  1DNC A;  1W4X A;  2WS3 A;  5EOW A;  4U8I A;  5JCN A;  3LZW A;  3SZF A;  3KU9 A;  3AEA A;  1ELI A;  1FL2 A;  4JDR A;  2BS4 A;  4CY8 A;  1F8R A;  3UKL A;  2YR5 A;  1KNR A;  3UOX A;  3QSE A;  1ZDL A;  1GOS A;  3CMM A;  1D7Y A;  3T37 A;  5U1O A;  2WPF A;  2YLT A;  1KDG A;  3LOV A;  4EMJ A;  4N9X A;  4AT2 A;  2GRT A;  3NN6 X;  3UP4 A;  3QVP A;  4YXD A;  2GQF A;  3NYC A;  2XFN A;  1OJA A;  3QSM A;  4AP3 A;  3CNP A;  1S2Y A;  3UTF A;  4IA6 A;  3BI2 A;  1E1M A;  3RP7 A;  2RGJ A;  2GAH B;  1QLB A;  2BAB A;  4EM4 A;  1NG3 A;  4H50 A;  2WPE A;  3HYV A;  4J33 A;  3DGH A;  4TM1 A;  2WES A;  2WU5 A;  3LB8 A;  4G74 A;  4U2L A;  4H4W A;  2YG7 A;  1PBD A;  1NHR A;  2E5V A;  4YWO A;  2GR2 A;  4A99 A;  3NRN A;  2BC1 A;  3RHA A;  5KVH A;  2C72 A;  1CJ2 A;  3AEE A;  3DH9 A;  4H4T A;  3IF9 A;  2C64 A;  1CC2 A;  4TLX A;  1XAN A;  2XFU A;  1OJ9 A;  4EQW A;  1H86 A;  5IQ4 A;  5KMR A;  1FOH A;  1CL0 A;  1QO8 A;  1DOB A;  3SYI A;  1D4D A;  4OPT A;  1JRZ A;  1IUX A;  4U8M A;  3AE3 A;  3UCL A;  3UOY A;  1PDH A;  4BK1 A;  3V3O A;  1GRH A;  3AEC A;  4H4X A;  4G6H A;  1D5T A;  2GEW A;  3H8L A;  2XLT A;  1CJ3 A;  3VRB A;  4H4R A;  2QA2 A;  2V60 A;  2H88 A;  2VOU A;  3UKH A;  1EL7 A;  2XLS A;  3BI4 A;  3T2K A;  5JCL A;  5KNL A;  1B37 A;  1LJ1 A;  1TRB A;  2R4J A;  1B8S A;  3H8I A;  2XVH A;  1EL9 A;  1GTE A;  5BUK A;  2NPX A;  2WOV A;  5L46 A;  1NHS A;  3BI5 A;  4G73 A;  1TDF A;  3CNS A;  4OCG A;  5JCI A;  2APG A;  4I58 A;  2GH5 A;  2YVG A;  3D8X A;  4NZH A;  4C74 A;  3L1R A;  2YLR A;  3C4A A;  2XFO A;  3UKK A;  2BC0 A;  2VVL G;  2GR3 A;  2YLX A;  2C4C A;  5FS7 A;  2Q0K A;  4Z24 A;  3F8D A;  4O5U A;  1CC6 A;  1GRA A;  1FEA A;  4B68 A;  2BXR A;  4K22 A;  2PHH A;  5KWF A;  5KMQ A;  3M13 A;  1N4V A;  2BXS A;  4Y4N A;  4YTP A;  1GES A;  4NTE A;  3K30 A;  5IQ1 A;  1PXB A;  4DGK A;  2Z5Y A;  2QA1 A;  2GB0 A;  3K7T A;  3LXD A;  3RNM A;  4GAV A;  4J31 A;  4XXG A;  3II4 A;  1EBD A;  3T14 A;  4YTM A;  3SGL A;  4FDC B;  2XVJ A;  3AE7 A;  1X31 B;  1Y0P A;  3V3N A;  4BJY A;  4EMI A;  1COY A;  1TDN A;  4REK A;  3IHM A;  2XDO A;  4X4J A;  4TM3 A;  2X8H A;  4YTN A;  3AE5 A;  4XWZ A;  4DNA A;  1H7W A;  2B76 A;  2ACZ A;  5KMP A;  1NG4 A;  3DJD A;  2BCG G;  4OPL A;  3NYE A;  4PAA A;  1OJC A;  4J57 A;  2XVI A;  2UZZ A;  2V3A A;  4EMW A;  5BUL A;  3AB1 A;  3C96 A;  3EF6 A;  1PBC A;  2VQB A;  4C77 A;  2OLO A;  3DME A;  2ZZ0 A;  2VVM A;  2O9Z A;  4IVO B;  1BWC A;  1CHU A;  1K0I A;  2ZZC A;  4B69 A;  4ZCC A;  2XVE A;  3GWF A;  3KKJ A;  1YQ3 A;  2WET A;  3ITJ A;  3UTH A;  3F8R A;  1ZP0 A;  2JB3 A;  3AXB A;  4K5R A;  2WOW A;  3PVC A;  2QAE A;  3R9U A;  3AD7 B;  1D4E A;  3DJG X;  2FBW A;  4U8L A;  2XFQ A;  1DJN A;  3CN8 A;  1O94 A;  4X9N A;  1D7L A;  1H83 A;  2YR6 A;  3QFB A;  4GUV A;  1S3E A;  3VQR A;  3FIM B;  4C5O A;  1OJD A;  4ADW A;  4P9S A;  4YSX A;  1Y56 B;  2V3B A;  2WP6 A;  5CQF A;  1IUS A;  3SFE A;  1KNP A;  1VDC A;  3NK1 X;  1GET A;  3UKQ A;  3O0H A;  4Y4M A;  1GRE A;  5KMS A;  1K0L A;  3CTY A;  3AYJ A;  1PBF A;  2XLR A;  3GD4 A;  1AOG A;  4J34 A;  4IVM B;  1CJC A;  3UOZ A;  3SXI A;  1L9C A;  5HXI A;  2CUL A;  3GDN A;  3LJP A;  2V6O A;  3ICR A;  1F6M A;  2R4E A;  4NWZ A;  4H4U A;  1OJT A;  2WEU A;  1JOA A;  2RAB A;  1NAA A;  3G5Q A;  1GXF A;  3CGE A;  3GRS A;  4HB9 A;  3ALM A;  2R9Z A;  4JY2 A;  2C76 A;  3ICT A;  4I59 A;  1E7P A;  3QJ4 A;  1YY5 A;  4OPG A;  4A79 A;  5FS6 A;  1GND A;  2YWL A;  1BKW A;  3E1T A;  3M0O A;  2B9W A;  2B9Y A;  4FK1 A;  3KD9 A;  3UOV A;  3NK2 X;  1CJ4 A;  1P2H A;  3NGC X;  2BRY A;  4AOX A;  1H84 A;  2A89 A;  3NKS A;  4MJW A;  1L0V A;  4RG3 A;  2R0G A;  3AEG A;  3DK9 A;  3CGB A;  1ZMC A;  1GSN A;  4H4S A;  2WOI A;  1LQU A;  2FJB A;  3AE4 A;  1LV0 A;  1E1L A;  2PYX A;  2W0H A;  4ICY A;  3WE0 A;  5C2T A;  1REO A;  3IWA A;  2GR0 A;  1L9D A;  3AE9 A;  3GYI A;  4D04 A;  4U8O A;  4GF7 A;  4ZN0 A;  4CBQ A;  3SY4 A;  2WHD A;  3NYF A;  4YKF A;  5EB5 A;  4USR A;  2JKC A;  4YSY A;  1PS9 A;  2WDR A;  2E4G A;  4H4Z A;  4RG4 A;  4DSG A;  1PBB A;  1NHP A;  4DSH A;  2BAC A;  1B4V A;  1ZY8 A;  1NDA A;  1GTH A;  3GDP A;  2TMD A;  4HA6 A;  3AEB A;  4CY6 A;  2OLN A;  4ZCD A;  2ZBW A;  2CDU A;  1DXL A;  4GDE A;  2BA9 A;  2VZ2 A;  2IVE A;  1GAL A;  1CC4 A;  1UKV G;  2YG3 A;  1P2E A;  2WU2 A;  3LAD A;  3NH3 X;  4NEV A;  4GRT A;  4A6N B;  4EQX A;  5HY5 A;  5HYM A;  1RSG A;  4TM0 A;  1Y56 A;  3T31 A;  3DA1 A;  3EAN A;  1S2Q A;  1BF3 A;  1YQZ A;  5ER0 A;  2EQ7 A;  3KLJ A;  1H81 A;  1V59 A;  5J7X A;  1GER A;  3D1C A;  3AE8 A;  2XVF A;  3T2Z A;  3CPI G;  2CVJ A;  1L9E A;  4BUR A;  2WP5 A;  1JRX A;  3AD8 B;  3UKP A;  5JCM A;  2FJD A;  2NVK X;  4B1B A;  2BK5 A;  4OPD A;  2XCG A;  1CF3 A;  1PN0 A;  2JB2 A;  3NTA A;  2ZZB A;  3EPT A;  4RSL A;  5GSN A;  4EIQ A;  3QVR A;  1XHC A;  4B63 A;  2C75 A;  2YAU A;  1PJ7 A;  3Q9T A;  3KA7 A;  1KSU A;  3G5R A;  4BK3 A;  1Q9I A;  3NHO X;  1D4C A;  3ALJ A;  3EAO A;  4UDR A;  1N1P A;  2BS2 A;  4GAP A;  1XDI A;  2YG6 A;  3G5S A;  1BGJ A;  2A8X A;  5KOW A;  3AEF A;  3LZX A;  1NHQ A;  4GCM A;  3DK4 A;  5TR3 A;  1PHH A;  3COX A;  3SX6 A;  2WPC A;  2WDQ A;  4U8J A;  3SZ0 A;  2BS3 A;  3URH A;  2XFP A;  1H82 A;  2EQ8 A;  2C7G A;  3B6D A;  5EBK A;  4A9W A;  1YQ4 A;  2E1M A;  1Q1W A;  5M0Z A;  5IPY A;  2F5Z A;  5C3J A;  3VR9 A;  4AT0 A;  4XWR A;  3T2Y A;  4H4Q A;  1N4U A;  1TDE A;  2V5Z A;  3JSK A;  4U8P A;  4PAB A;  1ZOV A;  5KRQ A;  4Z2R A;  2YLZ A;  4OPU A;  4EQS A;  1JNR A;  4JN9 A;  3KVE A;  2YQU A;  3HZL A;  1O95 A;  4G6G A;  4WX1 A;  3SM8 A;  3FPZ A;  2B7R A;  1K0J A;  1TYP A;  2Y6Q A;  3BHF A;  2FJA A;  4H4Y A;  3OZ2 A;  1M6I A;  4A5L A;  4AP1 A;  2IID A;  1JNZ A;  1KFY A;  3K7Q X;  3AE2 A;  3VRA A;  1GRB A;  4A6N A;  2V61 A;  2GQW A;  4K2X A;  4OPC A;  2DKI A;  2WQY A;  3CPH G;  4Z2U A;  1ONF A;  1VG0 A;  2Y6R A;  3CPJ G;  4B65 A;  4YSH A;  1E6E A;  2YM1 A;  4TM4 A;  3UTE A;  3S61 A;  2XYO A;  3H4K A;  2WDV A;  4USQ A;  3SQP A;  3KPK A;  3PO7 A;  1QJD A;  1ZMD A;  2Q7V A;  2JB1 A;  3AE6 A;  1LPF A;  2QCU A;  1F8S A;  3DJE A;  2YLW A;  4OPI A;  3M12 A;  4YKG A;  2YLS A;  4H7U A;  3K7M X;  4UDQ A;  4JQ9 A;  1IUV A;  3GD3 A;  2Q6U A;  4A7A A;  1PBE A;  2ARD A;  3UP5 A;  2X8G A;  2R0P A;  4II2 A;  3GWD A;  5U63 A;  1GV4 A;  4LII A;  4OVI A;  4CNK A;  1XPQ A;  4IA5 A;  2C3D A;  2A87 A;  3CNJ A;  2TPR A;  2X50 A;  2VRM A;  3ATQ A;  3F8P A;  4WCT A;  4ECH A;  2GAG B;  4B67 A;  3BNM A;  3FG2 P;  3GMB A;  3T0K A;  4BV6 A;  5JCK A;  5KOX A;  3Q6J A;  2HQM A;  4CCR A;  1MO9 A;  1FEB A;  1IUU A;  3NNE A;  3ISH A;  1JEH A;  2YG5 A;  2AQJ A;  1B5Q A;  1TYT A;  1Z6L A;  3I6D A;  1DOE A;  1GRF A;  1EL5 A;  2EQ9 A;  2JBV A;  2Z5X A;  3I3L A;  3UKF A;  2C73 A;  3RP6 A;  4B66 A;  1KSS A;  3ALL A;  3NK0 X;  4NTD A;  4AOS A;  4NNJ A;  4KX6 A;  1LTX R;  3QFA A;  4X9M A;  1F3P A;  5CKU A;  3P4P A;  3DK8 A;  5FS9 A;  1O5W A;  2GVC A;  1MOK A;  2OA1 A;  3UTG A;  1IJH A;  4U2T A;  4BK2 A;  2VRL A;  4FX9 A;  5M10 A;  1M64 A;  2X3N A;  4TLZ A;  1LQT A;  3CIR A;  1TDK A;  1K4Q A;  4C3Y A;  5GRT A;  4IV9 A;  1Q1R A;  3ICS A;  1H6V A;  1KF6 A;  3NLC A;  4Z26 A;  1GPE A;  3PS9 A;  1BGN A;  1PXC A;  1EL8 A;  1PJ5 A;  1RYI A;  3GSI A;  3OC4 A;  3CGD A;  4FK1 C;  4JY3 A;  3DGZ A;  3HYW A;  4H2Q A;  4D03 A;  1NEK A;  3AD9 B;  4H2P A;  5J60 A;  4UP3 A;  4LA1 A;  5KVI A;  1GEU A;  3CNT A;  4J56 A;  1NEN A;  2R0C A;  2B7S A; 
#chains in the Genus database with same CATH homology
 1ZK7 A;  2Q0L A;  2YVF A;  3AYL A;  3HYX A;  5FS8 A;  1DJQ A;  4U8K A;  3FMW A;  1YKJ A;  3C4N A;  4Z2T A;  3AWI A;  3P4R A;  2JAE A;  4YT0 A;  5KXJ A;  2AAQ A;  4E0V A;  2WBA A;  1VG9 A;  2JK6 A;  3ATR A;  3FBS A;  3SZC A;  2CFY A;  3P1W A;  3IC9 A;  4UDP A;  2OAL A;  3VRD B;  2BK3 A;  2B9X A;  2C3C A;  2XLU A;  2H89 A;  5FMH A;  1S3B A;  4O5Q A;  2VQ7 A;  4EM3 A;  1GRG A;  2GMH A;  3CGC A;  4Z44 A;  1TDO A;  3BNU A;  1H7X A;  1DOD A;  1PXA A;  2YM2 A;  3GYX A;  1ZKQ A;  2BRA A;  2XLP A;  4K8D A;  3RP8 A;  1N4W A;  3B3R A;  3NTD A;  2DKH A;  3S5W A;  3VR8 A;  2J3N A;  2I0Z A;  4H4P A;  1PJ6 A;  2RGH A;  4A65 A;  4CRT A;  3V76 A;  3AED A;  3SFD A;  1HYU A;  3DJJ A;  4GDP A;  1JRY A;  4KPR A;  4APN A;  1VQW A;  3KPF A;  2IVD A;  1IUW A;  4EQR A;  3L8K A;  4Z25 A;  1GT8 A;  1IUT A;  1NPX A;  2FJE A;  4J36 A;  1JU2 A;  2X99 A;  2X8C A;  1DOC A;  1CBO A;  1ZOY A;  2BCP A;  3ZDN A;  2C65 A;  1RP0 A;  4CNJ A;  2WP9 A;  4U8N A;  4LU6 A;  5U25 A;  4CCQ A;  1FCD A;  1ZX9 A;  3SZW A;  3AE1 A;  2EQ6 A;  3NT6 A;  3NG7 X;  1E1K A;  4C3X A;  1MXT A;  4GR1 A;  4K7Z A;  4Z43 A;  2AR8 A;  2BK4 A;  4G9K A;  3IHG A;  2GMJ A;  3AYI A;  5LV9 A;  2YG4 A;  4J2W A;  4EIP A;  3P4Q A;  3NIX A;  1LVL A;  5BVA A;  2YR4 A;  4H4V A;  2YVJ A;  3GRT A;  4M52 A;  4NEW A;  1E1N A;  1GRT A;  3ZYX A;  3BHK A;  2R45 A;  1FEC A;  2R46 A;  3ADA B;  1BZL A;  3CND A;  3P4S A;  2OAM A;  1F8W A;  2C70 A;  3P9U A;  3QSS A;  4II3 A;  2C66 A;  3GYJ A;  2GR1 A;  4U2S A;  4YSZ A;  2GF3 A;  2RGO A;  5DBJ A;  2BYB A;  2C67 A;  1E39 A;  4Y4L A;  4BJZ A;  5EB4 A;  5BRT A;  4H2R A;  3RED A;  4B64 A;  2VVL A;  4K5S A;  2GV8 A;  4JNQ A;  3GMC A;  4JNA A;  4H2N A;  3ABV A;  1SEZ A;  4NTC A;  3UKA A;  3NN0 X;  5HHF A;  1VRQ B;  1DNC A;  1W4X A;  2WS3 A;  5EOW A;  4U8I A;  5JCN A;  3LZW A;  3SZF A;  3KU9 A;  3AEA A;  1ELI A;  1FL2 A;  4JDR A;  2BS4 A;  4CY8 A;  1F8R A;  3UKL A;  2YR5 A;  1KNR A;  3UOX A;  3QSE A;  1ZDL A;  1GOS A;  3CMM A;  1D7Y A;  3T37 A;  5U1O A;  2WPF A;  2YLT A;  1KDG A;  3LOV A;  4EMJ A;  4N9X A;  4AT2 A;  2GRT A;  3NN6 X;  3UP4 A;  3QVP A;  4YXD A;  2GQF A;  3NYC A;  2XFN A;  1OJA A;  3QSM A;  4AP3 A;  3CNP A;  1S2Y A;  3UTF A;  4IA6 A;  3BI2 A;  1E1M A;  3RP7 A;  2RGJ A;  2GAH B;  1QLB A;  2BAB A;  4EM4 A;  1NG3 A;  4H50 A;  2WPE A;  3HYV A;  4J33 A;  3DGH A;  4TM1 A;  2WES A;  2WU5 A;  3LB8 A;  4G74 A;  4U2L A;  4H4W A;  2YG7 A;  1PBD A;  1NHR A;  2E5V A;  4YWO A;  2GR2 A;  4A99 A;  3NRN A;  2BC1 A;  3RHA A;  5KVH A;  2C72 A;  1CJ2 A;  3AEE A;  3DH9 A;  4H4T A;  3IF9 A;  2C64 A;  1CC2 A;  4TLX A;  1XAN A;  2XFU A;  1OJ9 A;  4EQW A;  1H86 A;  5IQ4 A;  5KMR A;  1FOH A;  1CL0 A;  1QO8 A;  1DOB A;  3SYI A;  1D4D A;  4OPT A;  1JRZ A;  1IUX A;  4U8M A;  3AE3 A;  3UCL A;  3UOY A;  1PDH A;  4BK1 A;  3V3O A;  1GRH A;  3AEC A;  4H4X A;  4G6H A;  1D5T A;  2GEW A;  3H8L A;  2XLT A;  1CJ3 A;  3VRB A;  4H4R A;  2QA2 A;  2V60 A;  2H88 A;  2VOU A;  3UKH A;  1EL7 A;  2XLS A;  3BI4 A;  3T2K A;  5JCL A;  5KNL A;  1B37 A;  1LJ1 A;  1TRB A;  2R4J A;  1B8S A;  3H8I A;  2XVH A;  1EL9 A;  1GTE A;  5BUK A;  2NPX A;  2WOV A;  5L46 A;  1NHS A;  3BI5 A;  4G73 A;  1TDF A;  3CNS A;  4OCG A;  5JCI A;  2APG A;  4I58 A;  2GH5 A;  2YVG A;  3D8X A;  4NZH A;  4C74 A;  3L1R A;  2YLR A;  3C4A A;  2XFO A;  3UKK A;  2BC0 A;  2VVL G;  2GR3 A;  2YLX A;  2C4C A;  5FS7 A;  2Q0K A;  4Z24 A;  3F8D A;  4O5U A;  1CC6 A;  1GRA A;  1FEA A;  4B68 A;  2BXR A;  4K22 A;  2PHH A;  5KWF A;  5KMQ A;  3M13 A;  1N4V A;  2BXS A;  4Y4N A;  4YTP A;  1GES A;  4NTE A;  3K30 A;  5IQ1 A;  1PXB A;  4DGK A;  2Z5Y A;  2QA1 A;  2GB0 A;  3K7T A;  3LXD A;  3RNM A;  4GAV A;  4J31 A;  4XXG A;  3II4 A;  1EBD A;  3T14 A;  4YTM A;  3SGL A;  4FDC B;  2XVJ A;  3AE7 A;  1X31 B;  1Y0P A;  3V3N A;  4BJY A;  4EMI A;  1COY A;  1TDN A;  4REK A;  3IHM A;  2XDO A;  4X4J A;  4TM3 A;  2X8H A;  4YTN A;  3AE5 A;  4XWZ A;  4DNA A;  1H7W A;  2B76 A;  2ACZ A;  5KMP A;  1NG4 A;  3DJD A;  2BCG G;  4OPL A;  3NYE A;  4PAA A;  1OJC A;  4J57 A;  2XVI A;  2UZZ A;  2V3A A;  4EMW A;  5BUL A;  3AB1 A;  3C96 A;  3EF6 A;  1PBC A;  2VQB A;  4C77 A;  2OLO A;  3DME A;  2ZZ0 A;  2VVM A;  2O9Z A;  4IVO B;  1BWC A;  1CHU A;  1K0I A;  2ZZC A;  4B69 A;  4ZCC A;  2XVE A;  3GWF A;  3KKJ A;  1YQ3 A;  2WET A;  3ITJ A;  3UTH A;  3F8R A;  1ZP0 A;  2JB3 A;  3AXB A;  4K5R A;  2WOW A;  3PVC A;  2QAE A;  3R9U A;  3AD7 B;  1D4E A;  3DJG X;  2FBW A;  4U8L A;  2XFQ A;  1DJN A;  3CN8 A;  1O94 A;  4X9N A;  1D7L A;  1H83 A;  2YR6 A;  3QFB A;  4GUV A;  1S3E A;  3VQR A;  3FIM B;  4C5O A;  1OJD A;  4ADW A;  4P9S A;  4YSX A;  1Y56 B;  2V3B A;  2WP6 A;  5CQF A;  1IUS A;  3SFE A;  1KNP A;  1VDC A;  3NK1 X;  1GET A;  3UKQ A;  3O0H A;  4Y4M A;  1GRE A;  5KMS A;  1K0L A;  3CTY A;  3AYJ A;  1PBF A;  2XLR A;  3GD4 A;  1AOG A;  4J34 A;  4IVM B;  1CJC A;  3UOZ A;  3SXI A;  1L9C A;  5HXI A;  2CUL A;  3GDN A;  3LJP A;  2V6O A;  3ICR A;  1F6M A;  2R4E A;  4NWZ A;  4H4U A;  1OJT A;  2WEU A;  1JOA A;  2RAB A;  1NAA A;  3G5Q A;  1GXF A;  3CGE A;  3GRS A;  4HB9 A;  3ALM A;  2R9Z A;  4JY2 A;  2C76 A;  3ICT A;  4I59 A;  1E7P A;  3QJ4 A;  1YY5 A;  4OPG A;  4A79 A;  5FS6 A;  1GND A;  2YWL A;  1BKW A;  3E1T A;  3M0O A;  2B9W A;  2B9Y A;  4FK1 A;  3KD9 A;  3UOV A;  3NK2 X;  1CJ4 A;  1P2H A;  3NGC X;  2BRY A;  4AOX A;  1H84 A;  2A89 A;  3NKS A;  4MJW A;  1L0V A;  4RG3 A;  2R0G A;  3AEG A;  3DK9 A;  3CGB A;  1ZMC A;  1GSN A;  4H4S A;  2WOI A;  1LQU A;  2FJB A;  3AE4 A;  1LV0 A;  1E1L A;  2PYX A;  2W0H A;  4ICY A;  3WE0 A;  5C2T A;  1REO A;  3IWA A;  2GR0 A;  1L9D A;  3AE9 A;  3GYI A;  4D04 A;  4U8O A;  4GF7 A;  4ZN0 A;  4CBQ A;  3SY4 A;  2WHD A;  3NYF A;  4YKF A;  5EB5 A;  4USR A;  2JKC A;  4YSY A;  1PS9 A;  2WDR A;  2E4G A;  4H4Z A;  4RG4 A;  4DSG A;  1PBB A;  1NHP A;  4DSH A;  1ZY8 A;  1B4V A;  2BAC A;  1NDA A;  1GTH A;  3GDP A;  2TMD A;  4HA6 A;  3AEB A;  4CY6 A;  2OLN A;  4ZCD A;  2ZBW A;  2CDU A;  1DXL A;  4GDE A;  2BA9 A;  2VZ2 A;  2IVE A;  1GAL A;  1CC4 A;  1UKV G;  2YG3 A;  1P2E A;  2WU2 A;  3LAD A;  3NH3 X;  4NEV A;  4GRT A;  4A6N B;  4EQX A;  5HY5 A;  5HYM A;  1RSG A;  4TM0 A;  1Y56 A;  3T31 A;  3DA1 A;  3EAN A;  1S2Q A;  1BF3 A;  1YQZ A;  5ER0 A;  2EQ7 A;  3KLJ A;  1H81 A;  1V59 A;  5J7X A;  1GER A;  3D1C A;  3AE8 A;  2XVF A;  3T2Z A;  3CPI G;  2CVJ A;  1L9E A;  4BUR A;  2WP5 A;  1JRX A;  3AD8 B;  3UKP A;  5JCM A;  2FJD A;  2NVK X;  4B1B A;  2BK5 A;  4OPD A;  2XCG A;  1CF3 A;  1PN0 A;  2JB2 A;  3NTA A;  2ZZB A;  3EPT A;  4RSL A;  5GSN A;  4EIQ A;  3QVR A;  1XHC A;  4B63 A;  2C75 A;  2YAU A;  1PJ7 A;  3Q9T A;  3KA7 A;  1KSU A;  3G5R A;  4BK3 A;  1Q9I A;  3NHO X;  1D4C A;  3ALJ A;  3EAO A;  4UDR A;  1N1P A;  2BS2 A;  4GAP A;  1XDI A;  2YG6 A;  3G5S A;  1BGJ A;  2A8X A;  5KOW A;  3AEF A;  3LZX A;  1NHQ A;  4GCM A;  3DK4 A;  5TR3 A;  1PHH A;  3COX A;  3SX6 A;  2WPC A;  2WDQ A;  4U8J A;  3SZ0 A;  2BS3 A;  3URH A;  2XFP A;  1H82 A;  2EQ8 A;  2C7G A;  3B6D A;  5EBK A;  4A9W A;  1YQ4 A;  2E1M A;  1Q1W A;  5M0Z A;  5IPY A;  2F5Z A;  5C3J A;  3VR9 A;  4AT0 A;  4XWR A;  3T2Y A;  4H4Q A;  1N4U A;  1TDE A;  2V5Z A;  3JSK A;  4U8P A;  4PAB A;  1ZOV A;  5KRQ A;  4Z2R A;  2YLZ A;  4OPU A;  4EQS A;  1JNR A;  4JN9 A;  3KVE A;  2YQU A;  3HZL A;  1O95 A;  4G6G A;  4WX1 A;  3SM8 A;  3FPZ A;  2B7R A;  1K0J A;  1TYP A;  2Y6Q A;  3BHF A;  2FJA A;  4H4Y A;  3OZ2 A;  1M6I A;  4A5L A;  4AP1 A;  2IID A;  1JNZ A;  1KFY A;  3K7Q X;  3AE2 A;  3VRA A;  1GRB A;  4A6N A;  2V61 A;  2GQW A;  4K2X A;  4OPC A;  2DKI A;  2WQY A;  3CPH G;  4Z2U A;  1ONF A;  1VG0 A;  2Y6R A;  3CPJ G;  4B65 A;  4YSH A;  1E6E A;  2YM1 A;  4TM4 A;  3UTE A;  3S61 A;  2XYO A;  3H4K A;  2WDV A;  4USQ A;  3SQP A;  3KPK A;  3PO7 A;  1QJD A;  1ZMD A;  2Q7V A;  2JB1 A;  3AE6 A;  1LPF A;  2QCU A;  1F8S A;  3DJE A;  2YLW A;  4OPI A;  3M12 A;  4YKG A;  2YLS A;  4H7U A;  3K7M X;  4UDQ A;  4JQ9 A;  1IUV A;  3GD3 A;  2Q6U A;  4A7A A;  1PBE A;  2ARD A;  3UP5 A;  2X8G A;  2R0P A;  4II2 A;  3GWD A;  5U63 A;  1GV4 A;  4LII A;  4OVI A;  4CNK A;  1XPQ A;  4IA5 A;  2C3D A;  2A87 A;  3CNJ A;  2TPR A;  2X50 A;  2VRM A;  3ATQ A;  3F8P A;  4WCT A;  4ECH A;  2GAG B;  4B67 A;  3BNM A;  3FG2 P;  3GMB A;  3T0K A;  4BV6 A;  5JCK A;  5KOX A;  3Q6J A;  2HQM A;  4CCR A;  1MO9 A;  1FEB A;  1IUU A;  3NNE A;  3ISH A;  1JEH A;  2YG5 A;  2AQJ A;  1B5Q A;  1TYT A;  1Z6L A;  3I6D A;  1DOE A;  1GRF A;  1EL5 A;  2EQ9 A;  2JBV A;  2Z5X A;  3I3L A;  3UKF A;  2C73 A;  3RP6 A;  4B66 A;  1KSS A;  3ALL A;  3NK0 X;  4NTD A;  4AOS A;  4NNJ A;  4KX6 A;  1LTX R;  3QFA A;  4X9M A;  1F3P A;  5CKU A;  3P4P A;  3DK8 A;  5FS9 A;  1O5W A;  2GVC A;  1MOK A;  2OA1 A;  3UTG A;  1IJH A;  4U2T A;  4BK2 A;  2VRL A;  4FX9 A;  5M10 A;  1M64 A;  2X3N A;  4TLZ A;  1LQT A;  3CIR A;  1TDK A;  1K4Q A;  4C3Y A;  5GRT A;  4IV9 A;  1Q1R A;  3ICS A;  1H6V A;  1KF6 A;  3NLC A;  4Z26 A;  1GPE A;  3PS9 A;  1BGN A;  1PXC A;  1EL8 A;  1PJ5 A;  1RYI A;  3GSI A;  3OC4 A;  3CGD A;  4FK1 C;  4JY3 A;  3DGZ A;  3HYW A;  4H2Q A;  4D03 A;  1NEK A;  3AD9 B;  4H2P A;  5J60 A;  4UP3 A;  4LA1 A;  5KVI A;  1GEU A;  3CNT A;  4J56 A;  1NEN A;  2R0C A;  2B7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...