5U63A

Crystal structure of putative thioredoxin reductase from haemophilus influenzae
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
315
structure length
315
Chain Sequence
DIKHAKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTDEIENWPGDFEMTTGSGLMQRMLQHAEKFETEIVFDHINRVDLSSRPFKLFGDVQNFTCDALIIATGASARYIGLPSEENYKGRGVSACATCDGFFYRNKPVGVIGGGNTAVEEALYLANIASTVHLIHRRDSFRAEKILIDRLYKKVEEGKIVLHTDRTLDEVLGDNMGVTGLRLANTKTGEKEELKLDGLFVAIGHSPNTEIFQGQLELNNGYIVVKSGLDGNATATSVEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Thioredoxin reductase
publication title Crystal structure of putative thioredoxin reductase from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
total genus 99
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2016-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u63A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u63A02
1YQ3A 3KU9A 2B9WA 3UP4A 3AYLA 3V3NA 1D7YA 3H8LA 2EQ6A 3SQPA 1E1LA 2FBWA 2XLSA 2EQ8A 3VQRA 1MOKA 1Y0PA 4CNKA 3C4NA 1FECA 3P4SA 4KX6A 2XLPA 4J2WA 1JU2A 1H86A 2B7RA 1DNCA 4X9NA 3AE2A 4J34A 4A99A 2C66A 2V61A 4FK1C 1TDFA 1CF3A 1NENA 5M0ZA 2OALA 2WBAA 4HB9A 2OAMA 4PAAA 4I58A 2J3NA 4OPCA 1PBCA 3GDNA 5C3JA 1ZDLA 1ZMCA 3ITJA 3QSEA 2DKIA 3P4QA 4B67A 4IA5A 1RP0A 4PABA 2NPXA 1PXCA 2ZZCA 4RSLA 2WP5A 2BS2A 3AEDA 3CNJA 1K0JA 4MJWA 4U2TA 3QJ4A 4NTDA 4DNAA 2C67A 4H7UA 3ALMA 5EB4A 3VRDB 3VRBA 3FMWA 1GPEA 4E0VA 5BVAA 1GERA 1KNPA 4D03A 4XXGA 2FJEA 1VRQB 1JEHA 2IVDA 2RGJA 3G5SA 2EQ7A 3K7MX 4AT2A 1H83A 2VOUA 1S2YA 2IIDA 4H4WA 2R4JA 4UDPA 1BF3A 2BK3A 3G5QA 3KPFA 3UTGA 1CL0A 3T37A 2C75A 1YQ4A 2WHDA 3FBSA 1OJCA 3EANA 1EBDA 1GESA 3LADA 1DODA 1IUXA 1JRZA 3CGCA 1MXTA 3NN0X 3RNMA 4H4TA 4FK1A 3ZYXA 4GF7A 2C76A 2RGOA 1IUVA 1CBOA 4U8MA 2PHHA 4RG4A 4DGKA 3GDPA 1JRXA 2Z5YA 3AEEA 3BHKA 1NG3A 2YG6A 3DJDA 2R0CA 2DKHA 1GOSA 5GSNA 2VQBA 1GEUA 2VVLG 2FJAA 1EL5A 3NK1X 3IC9A 2XVEA 1ZKQA 1DOCA 3DK9A 4A65A 4FX9A 4C3YA 2Y6RA 4CCQA 2GB0A 3DJJA 3NK0X 1S3BA 4EQXA 1M64A 3QVPA 2XVHA 1GSNA 3LOVA 2YLSA 3BHFA 5KVIA 4JNAA 4AP1A 3M12A 4JNQA 2XVFA 4OPTA 4C77A 1E7PA 4LIIA 2XFOA 3LXDA 4EQWA 2AR8A 3UKFA 2RABA 1Q1WA 3KA7A 2F5ZA 1B5QA 1NHRA 1PN0A 2GV8A 5KRQA 4APNA 4H4YA 4CBQA 4U8NA 2C65A 2XVJA 4ECHA 1PJ6A 2B76A 2PYXA 3ALJA 3GYJA 1D5TA 2BC0A 2XFUA 2GVCA 1D4CA 1N1PA 2E4GA 3COXA 2YR5A 2Q6UA 4GRTA 2VRMA 2CDUA 2GF3A 1JRYA 3CIRA 1REOA 4J57A 1Q9IA 1GXFA 4Y4MA 4YTMA 3CNPA 5FMHA 5IQ1A 1TYPA 3BI5A 4B69A 2AQJA 1QO8A 3CGEA 3Q9TA 1EL7A 4TM4A 2APGA 3CTYA 3UCLA 2XLRA 2E5VA 2QCUA 4JN9A 1L9DA 3F8PA 3V76A 3S5WA 3GWFA 4YKGA 3NIXA 5FS8A 4Z2RA 1LPFA 3UTEA 1KSSA 5EOWA 2C3DA 3UOYA 1B8SA 3GMBA 5JCKA 3QVRA 1O94A 1ONFA 2GRTA 2WPCA 1GETA 3CGBA 5U25A 1L0VA 3RP8A 4H4VA 2YG5A 1L9EA 3DJEA 3GD3A 3GMCA 4BJZA 4BK1A 2GEWA 3UTFA 1ZY8A 4U2LA 2EQ9A 1MO9A 4M52A 1DOBA 4AT0A 4EIPA 3NNEA 4JDRA 4NEWA 2JKCA 3NG7X 4X4JA 1TDNA 4BURA 1IJHA 1S3EA 4AP3A 2ZBWA 3GYIA 2YAUA 4GDPA 4U8PA 4H4QA 4YSHA 4H50A 1N4WA 3AEFA 2Y6QA 1DXLA 2XLUA 2C7GA 3VR8A 1D4DA 1TDEA 5KWFA 3AD8B 2YLZA 2ZZBA 4GUVA 1E6EA 1PBDA 2YVGA 3IWAA 1BGNA 4Z2UA 4Z43A 4U8LA 2VVMA 1K0IA 2O9ZA 3NYFA 1ZMDA 4JY2A 4BK3A 2BS4A 1BZLA 2IVEA 3NRNA 5GRTA 2VRLA 1BWCA 3UOXA 2XFQA 2R46A 2YG4A 1F8RA 1Z6LA 2YLWA 4A6NB 2RGHA 4ZCDA 1NHPA 3AE5A 2JAEA 3D8XA 4N9XA 4REKA 3UKQA 2YQUA 4CRTA 1VQWA 3LZWA 4C3XA 3IF9A 4J36A 1BGJA 3AEAA 1M6IA 1OJAA 3AD7B 1PHHA 4NEVA 4EQRA 3OZ2A 4XWZA 3AD9B 5KOXA 4CNJA 2YM1A 5J60A 5JCIA 1QJDA 3KKJA 1VDCA 4BJYA 1W4XA 2OLNA 3SM8A 2E1MA 2C73A 3C96A 4TM1A 4EMJA 5ER0A 4ZN0A 3ICSA 5KVHA 3P4RA 4BV6A 2BYBA 1E1NA 4RG3A 2BCGG 3NHOX 2C3CA 3UKHA 1GRFA 3AE4A 3P1WA 4OPDA 1TRBA 3GRSA 1PXBA 2H88A 3K7TA 1JNRA 4B68A 1OJDA 4BK2A 2GQFA 1NG4A 2WS3A 1LJ1A 3DGHA 2BABA 5LV9A 4AOSA 4U8IA 1NHQA 2B7SA 5JCMA 3DMEA 1GT8A 4H2QA 1VG9A 1X31B 5U63A 3O0HA 2WU5A 4TLZA 4U8JA 3NT6A 4GDEA 3DK8A 2WEUA 3AB1A 3AEGA 4H2PA 1XHCA 4P9SA 1NPXA 5DBJA 3FPZA 3UTHA 4H4SA 4LA1A 2BCPA 1PJ5A 3K7QX 1F8SA 2YM2A 3UOZA 4Z24A 2WP6A 4IVMB 2YG3A 3B6DA 3F8DA 2X8HA 1GRTA 2V3BA 1PJ7A 4A6NA 1LTXR 2BXRA 3NGCX 2CFYA 4A79A 2JBVA 1H84A 1H82A 2WDRA 3L1RA 1F3PA 4K8DA 3LZXA 4TM3A 3CNTA 1PBBA 3H8IA 3QFBA 2BA9A 3ISHA 3AE6A 2GQWA 1D4EA 2YVJA 2YR6A 1GRBA 5M10A 4NTEA 4CY6A 3NTDA 4UDRA 4YSXA 1IUTA 4LU6A 2CULA 2FJDA 2YG7A 2B9XA 2XFPA 5KXJA 2BACA 2YWLA 1DJNA 1XPQA 2R4EA 3H4KA 4OPGA 1KFYA 1YQZA 2Z5XA 4U2SA 3BI2A 3K30A 3M13A 4B65A 3NH3X 4OPLA 2JB1A 4EM3A 2C70A 4A7AA 2AAQA 3AE1A 3UKPA 4J31A 3PVCA 1CC4A 1LVLA 4EMWA 1GTEA 1GREA 1IUSA 1IUWA 1DJQA 4J56A 3GSIA 1LV0A 2XLTA 3GD4A 4YTPA 4K22A 1DOEA 3QSSA 1H81A 5JCNA 2B9YA 2ACZA 1P2EA 2Q7VA 4Z26A 2WPFA 4YTNA 1F8WA 2QA2A 1JOAA 1GNDA 2GR2A 4A5LA 2VZ2A 1O5WA 2X50A 2WOWA 1OJ9A 2QAEA 4OVIA 4H4RA 4EM4A 2XYOA 4TLXA 1KDGA 1KF6A 2R0PA 4USRA 5HHFA 2YLTA 3SGLA 4YSYA 2GMHA 1PBEA 3VR9A 2GR3A 3RP6A 2A87A 3II4A 1GRHA 2ZZ0A 3PS9A 3QFAA 4CY8A 2X99A 2JK6A 5JCLA 2Q0LA 1TDKA 4U8KA 3REDA 4Z44A 3JSKA 4EIQA 1ZOVA 4ICYA 4GCMA 3CGDA 1N4UA 1SEZA 2BK5A 5EB5A 3CPJG 1F6MA 3P4PA 4TM0A 1K4QA 1CC6A 3AYJA 3FIMB 3L8KA 3DJGX 1Q1RA 2QA1A 3SFEA 4YSZA 1KSUA 3BNMA 3ICRA 1FL2A 2VQ7A 4OPIA 1H7WA 4H4ZA 5IPYA 4WX1A 4YKFA 3AWIA 4X9MA 3AYIA 1S2QA 4YWOA 1NAAA 3UP5A 3CN8A 3S61A 4K5RA 3UKLA 3AE7A 4B66A 3UOVA 4K5SA 4Z25A 3AE8A 2YVFA 4H2RA 4K2XA 4OPUA 2XDOA 4B64A 2XFNA 3IHMA 1ZP0A 3EAOA 1NEKA 3KVEA 3GRTA 4B1BA 3D1CA 3LJPA 1UKVG 2V5ZA 4J33A 1PXAA 5TR3A 1L9CA 4D04A 1AOGA 3NYEA 2R45A 3M0OA 3C4AA 3EPTA 5U1OA 5CQFA 1Y56B 4Y4NA 3R9UA 3KD9A 4JY3A 3URHA 1H6VA 2XVIA 3OC4A 2X3NA 3EF6A 1RYIA 3GWDA 4C5OA 3RHAA 1YKJA 5BUKA 2FJBA 3ABVA 3UKAA 2VVLA 3DA1A 1FEBA 2GAGB 1N4VA 1IUUA 2HQMA 2ARDA 2YLRA 1CJ4A 1RSGA 2V3AA 5J7XA 1CC2A 4DSHA 1FCDA 4O5QA 2GH5A 3DGZA 3CPHG 4H4XA 2R9ZA 2X8CA 3Q6JA 1O95A 1KNRA 4WCTA 2BXSA 4K7ZA 2R0GA 1LQUA 4A9WA 4AOXA 4YXDA 4FDCB 4XWRA 2CVJA 1XDIA 2WOVA 1K0LA 1GRGA 2YR4A 4DSGA 3AXBA 1TDOA 3ATQA 4IV9A 2OLOA 3ICTA 1GV4A 4YT0A 1FEAA 2WDQA 3VRAA 1CHUA 4EQSA 4U8OA 4H4PA 3AE3A 3ZDNA 4IA6A 3ADAB 3NN6X 2WPEA 3IHGA 1GALA 3BNUA 5EBKA 2X8GA 2H89A 2C72A 3NYCA 1OJTA 4HA6A 1ZX9A 4EMIA 1QLBA 1CJ3A 2WDVA 2V6OA 2Q0KA 1E39A 5FS7A 3NTAA 1GRAA 1NDAA 2WU2A 3ALLA 1H7XA 1LQTA 3NKSA 3CPIG 3P9UA 3HZLA 2WOIA 3I6DA 2WETA 5BRTA 3I3LA 4CCRA 3UKKA 2GR1A 1E1KA 3SFDA 5HYMA 2JB2A 4Y4LA 4IVOB 1P2HA 3ATRA 4UP3A 1B37A 3G5RA 5KOWA 3DK4A 1PS9A 2GAHB 4H4UA 1CJ2A 3NLCA 4H2NA 5HY5A 1B4VA 4USQA 5L46A 1Y56A 2A89A 3CNSA 4JQ9A 3PO7A 3AEBA 2C64A 2XCGA 5CKUA 2WP9A 4GR1A 4I59A 1NHSA 5C2TA 2WESA 3LB8A 1VG0A 3CNDA 3RP7A 5BULA 1E1MA 1D7LA 2WQYA 1GTHA 4B63A 4OCGA 5IQ4A 2TMDA 4KPRA 1EL9A 3DH9A 1XANA 3WE0A 1PBFA 5FS9A 1YY5A 1ZOYA 2JB3A 2I0ZA 1HYUA 2GR0A 1JNZA 1PDHA 2OA1A 3B3RA 3F8RA 3NK2X 2NVKX 3AE9A 1TYTA 1EL8A 2BK4A 2W0HA 2YLXA 3QSMA 1V59A 1ZK7A 4UDQA 3V3OA 4ADWA 3E1TA 3FG2P 4NZHA 2TPRA 1CJCA 2A8XA 1BKWA 3KLJA 1COYA 4NTCA 2BS3A 2BC1A 3BI4A 4C74A 3AECA 2UZZA 4O5UA 5HXIA 2V60A 5FS6A 4ZCCA 1ELIA 4Z2TA 2GMJA 1FOHA
chains in the Genus database with same CATH superfamily
1YQ3A 3KU9A 2B9WA 3UP4A 3AYLA 3V3NA 1D7YA 3H8LA 2EQ6A 3SQPA 1E1LA 2FBWA 2XLSA 2EQ8A 3T0KA 3VQRA 1MOKA 1Y0PA 3T2ZA 4CNKA 3C4NA 1FECA 3P4SA 4KX6A 2XLPA 4J2WA 1JU2A 1H86A 2B7RA 1DNCA 4X9NA 3AE2A 4J34A 4A99A 2C66A 2V61A 4FK1C 1TDFA 1CF3A 1NENA 5M0ZA 2OALA 2WBAA 4HB9A 2OAMA 4PAAA 4I58A 2J3NA 4OPCA 1PBCA 3GDNA 5C3JA 1ZDLA 1ZMCA 4G9KA 3ITJA 3QSEA 2DKIA 3P4QA 4B67A 4IA5A 1RP0A 4PABA 2NPXA 1PXCA 2ZZCA 4RSLA 2WP5A 2BS2A 3AEDA 3CNJA 1K0JA 4MJWA 4U2TA 3QJ4A 4NTDA 4DNAA 2C67A 4H7UA 3ALMA 5EB4A 3VRDB 3VRBA 3FMWA 1GPEA 4E0VA 5BVAA 1GERA 1KNPA 4D03A 4XXGA 2FJEA 1VRQB 1JEHA 2IVDA 2RGJA 3G5SA 2EQ7A 3K7MX 3T31A 4AT2A 1H83A 2VOUA 1S2YA 2IIDA 4H4WA 2R4JA 4UDPA 1BF3A 2BK3A 3G5QA 3KPFA 3UTGA 1CL0A 3T37A 2C75A 1YQ4A 2WHDA 3FBSA 1OJCA 3EANA 1EBDA 1GESA 3LADA 1DODA 1IUXA 1JRZA 3CGCA 1MXTA 3NN0X 3RNMA 4H4TA 4FK1A 3ZYXA 4GF7A 2C76A 2RGOA 1IUVA 1CBOA 4U8MA 2PHHA 4RG4A 4DGKA 3GDPA 1JRXA 2Z5YA 3AEEA 3BHKA 1NG3A 2YG6A 3HYVA 3DJDA 2R0CA 2DKHA 1GOSA 5GSNA 2VQBA 1GEUA 2VVLG 2FJAA 1EL5A 3NK1X 3IC9A 2XVEA 1ZKQA 1DOCA 3DK9A 4A65A 4FX9A 4C3YA 2Y6RA 4CCQA 2GB0A 3DJJA 3NK0X 1S3BA 4EQXA 1M64A 3QVPA 2XVHA 1GSNA 3LOVA 2YLSA 3BHFA 5KMQA 5KVIA 4JNAA 4AP1A 3M12A 4JNQA 2XVFA 4OPTA 4C77A 1E7PA 4LIIA 2XFOA 3LXDA 4EQWA 2AR8A 2C4CA 2RABA 1Q1WA 3KA7A 2F5ZA 1B5QA 1NHRA 1PN0A 2GV8A 3GYXA 5KMSA 4APNA 5KRQA 4H4YA 4NNJA 4CBQA 4U8NA 2C65A 2XVJA 4G6HA 1PJ6A 2B76A 4ECHA 2PYXA 3ALJA 3GYJA 1D5TA 2BC0A 2XFUA 2GVCA 1D4CA 1N1PA 2E4GA 3COXA 2YR5A 2Q6UA 4GRTA 2VRMA 2CDUA 2GF3A 1JRYA 3CIRA 1REOA 4J57A 1Q9IA 1GXFA 4Y4MA 4YTMA 3CNPA 5FMHA 5IQ1A 1TYPA 3BI5A 4B69A 2AQJA 1QO8A 3CGEA 3Q9TA 1EL7A 3HYWA 2APGA 4NWZA 3CTYA 4TM4A 3UCLA 2XLRA 2E5VA 2QCUA 4JN9A 1L9DA 3F8PA 3V76A 3S5WA 3GWFA 4YKGA 3NIXA 5FS8A 4Z2RA 3SZCA 1LPFA 3UTEA 1KSSA 5EOWA 2C3DA 3UOYA 1B8SA 3GMBA 5JCKA 3QVRA 1O94A 1ONFA 2GRTA 2WPCA 1GETA 3CGBA 5U25A 3SZWA 1L0VA 3RP8A 4H4VA 2YG5A 1L9EA 3DJEA 3GD3A 3GMCA 4BJZA 4BK1A 2GEWA 3UTFA 1ZY8A 4U2LA 2EQ9A 1MO9A 4M52A 1DOBA 4AT0A 4EIPA 3NNEA 4JDRA 4NEWA 2JKCA 3NG7X 4X4JA 1TDNA 4BURA 4G74A 1IJHA 1S3EA 4AP3A 2ZBWA 3GYIA 2YAUA 4GDPA 4U8PA 4H4QA 4G6GA 4YSHA 4H50A 1N4WA 3AEFA 2Y6QA 1DXLA 2XLUA 2C7GA 3VR8A 1D4DA 1TDEA 5KWFA 3AD8B 2YLZA 2ZZBA 4GUVA 1E6EA 1PBDA 2YVGA 3IWAA 1BGNA 4Z2UA 4Z43A 4U8LA 2VVMA 1K0IA 2O9ZA 3NYFA 1ZMDA 4JY2A 4BK3A 2BS4A 1BZLA 2IVEA 3NRNA 5GRTA 2VRLA 1BWCA 3UOXA 2XFQA 2R46A 2YG4A 1F8RA 3SZ0A 1Z6LA 2YLWA 4A6NB 2RGHA 4ZCDA 1NHPA 3AE5A 2JAEA 3D8XA 4N9XA 4REKA 3UKQA 2YQUA 4CRTA 1VQWA 3LZWA 4C3XA 3IF9A 4J36A 1BGJA 3AEAA 1M6IA 1OJAA 3AD7B 1PHHA 4NEVA 4EQRA 3OZ2A 4XWZA 3AD9B 5KOXA 4CNJA 2YM1A 5J60A 5JCIA 1QJDA 3KKJA 1VDCA 4BJYA 1W4XA 2OLNA 3SM8A 2E1MA 2C73A 3C96A 4TM1A 4EMJA 5ER0A 4ZN0A 3ICSA 5KVHA 3P4RA 4BV6A 2BYBA 1E1NA 4RG3A 2BCGG 3NHOX 2C3CA 3SX6A 1GRFA 3AE4A 3UKHA 3P1WA 4OPDA 1TRBA 3GRSA 1PXBA 2H88A 3K7TA 1JNRA 4B68A 1OJDA 4BK2A 2GQFA 1NG4A 2WS3A 1LJ1A 3DGHA 2BABA 5LV9A 4AOSA 4U8IA 1NHQA 2B7SA 3T14A 5JCMA 3DMEA 1GT8A 4H2QA 1VG9A 1X31B 5U63A 3O0HA 2WU5A 4TLZA 4U8JA 3NT6A 4GDEA 3DK8A 3SXIA 2WEUA 3AB1A 3AEGA 4H2PA 1XHCA 4P9SA 1NPXA 5DBJA 3FPZA 3UTHA 4H4SA 4LA1A 2BCPA 1PJ5A 3K7QX 1F8SA 2YM2A 3UOZA 4Z24A 5KMPA 2WP6A 4IVMB 2YG3A 3B6DA 3F8DA 2X8HA 1GRTA 2V3BA 1PJ7A 4A6NA 1LTXR 2BXRA 3NGCX 2CFYA 4A79A 2JBVA 1H84A 1H82A 2WDRA 3L1RA 1F3PA 4K8DA 3LZXA 4TM3A 3CNTA 1PBBA 3H8IA 3QFBA 2BA9A 3ISHA 3AE6A 2GQWA 1D4EA 2YVJA 2YR6A 1GRBA 5M10A 4NTEA 4CY6A 3NTDA 4UDRA 4YSXA 1IUTA 4LU6A 2CULA 2FJDA 2YG7A 2B9XA 2XFPA 5KXJA 2BACA 2YWLA 1DJNA 1XPQA 2R4EA 3H4KA 4OPGA 1KFYA 1YQZA 2Z5XA 4U2SA 3BI2A 3K30A 3M13A 4B65A 3NH3X 4OPLA 2JB1A 4EM3A 2C70A 4A7AA 2AAQA 3AE1A 3UKPA 4J31A 3PVCA 1CC4A 1LVLA 4EMWA 2BRAA 1GTEA 1GREA 1IUSA 1IUWA 1DJQA 4J56A 3GSIA 1LV0A 2XLTA 3GD4A 4YTPA 4K22A 1DOEA 5KMRA 3QSSA 1H81A 5JCNA 2B9YA 2ACZA 1P2EA 2Q7VA 3HYXA 2WPFA 4Z26A 4YTNA 1F8WA 2QA2A 1JOAA 1GNDA 2GR2A 4A5LA 2VZ2A 1O5WA 2X50A 2WOWA 1OJ9A 2QAEA 4OVIA 4H4RA 4EM4A 2XYOA 4TLXA 1KDGA 1KF6A 2R0PA 4USRA 5HHFA 2YLTA 3SGLA 4YSYA 2GMHA 1PBEA 3VR9A 2GR3A 3RP6A 2A87A 3II4A 1GRHA 2ZZ0A 3PS9A 3QFAA 4CY8A 2X99A 2JK6A 5JCLA 2Q0LA 1TDKA 4U8KA 3REDA 4Z44A 3JSKA 4EIQA 1ZOVA 4ICYA 4GCMA 3CGDA 1N4UA 1SEZA 2BK5A 5EB5A 3CPJG 1F6MA 3P4PA 4TM0A 1K4QA 1CC6A 3AYJA 3FIMB 3L8KA 3DJGX 1Q1RA 2QA1A 3SFEA 4YSZA 1KSUA 3BNMA 3ICRA 1FL2A 2VQ7A 4OPIA 1H7WA 4H4ZA 5IPYA 4WX1A 4YKFA 3AWIA 4X9MA 3AYIA 1S2QA 4YWOA 1NAAA 3UP5A 3CN8A 3S61A 4K5RA 3UKLA 3AE7A 4B66A 3UOVA 4K5SA 4Z25A 2BRYA 3AE8A 2YVFA 4H2RA 4K2XA 4OPUA 2XDOA 3CMMA 4B64A 2XFNA 3IHMA 1ZP0A 3EAOA 1NEKA 3KVEA 3GRTA 4B1BA 3D1CA 3LJPA 1UKVG 2V5ZA 4J33A 1PXAA 5TR3A 1L9CA 4D04A 1AOGA 3NYEA 2R45A 3M0OA 3C4AA 3EPTA 5U1OA 5CQFA 3T2KA 1Y56B 4Y4NA 3R9UA 3KD9A 4JY3A 3URHA 1H6VA 2XVIA 3OC4A 2X3NA 3EF6A 1RYIA 3GWDA 4C5OA 4GAVA 3RHAA 1YKJA 5BUKA 2FJBA 3ABVA 3UKAA 2VVLA 3DA1A 1FEBA 2GAGB 1N4VA 1IUUA 5KNLA 2HQMA 2ARDA 2YLRA 1CJ4A 4II2A 1RSGA 2V3AA 5J7XA 1CC2A 4DSHA 1FCDA 4O5QA 2GH5A 3DGZA 3CPHG 4H4XA 2R9ZA 2X8CA 3Q6JA 1O95A 1KNRA 4WCTA 2BXSA 4K7ZA 2R0GA 1LQUA 4A9WA 4AOXA 4YXDA 4FDCB 4XWRA 2CVJA 1XDIA 2WOVA 1K0LA 1GRGA 2YR4A 4DSGA 3AXBA 1TDOA 3ATQA 4IV9A 2OLOA 3ICTA 3SZFA 1GV4A 4II3A 4YT0A 1FEAA 2WDQA 3VRAA 1CHUA 4EQSA 4U8OA 4H4PA 3AE3A 3ZDNA 4IA6A 3ADAB 3NN6X 2WPEA 3IHGA 1GALA 3BNUA 5EBKA 2X8GA 3T2YA 2H89A 2C72A 3NYCA 1OJTA 4HA6A 1ZX9A 3KPKA 4EMIA 1QLBA 1CJ3A 3UKFA 2WDVA 2V6OA 2Q0KA 1E39A 5FS7A 3NTAA 1GRAA 4GAPA 1NDAA 2WU2A 3ALLA 1H7XA 1LQTA 3NKSA 3CPIG 3P9UA 3HZLA 2WOIA 3I6DA 2WETA 5BRTA 3I3LA 4G73A 4CCRA 3UKKA 2GR1A 1E1KA 3SFDA 5HYMA 2JB2A 4Y4LA 4IVOB 1P2HA 3ATRA 4UP3A 1B37A 3G5RA 5KOWA 3DK4A 1PS9A 2GAHB 4H4UA 1CJ2A 3NLCA 4H2NA 5HY5A 1B4VA 4USQA 5L46A 1Y56A 2A89A 3CNSA 4JQ9A 3PO7A 3AEBA 3SY4A 2C64A 2XCGA 5CKUA 2WP9A 4GR1A 4I59A 1NHSA 5C2TA 2WESA 3LB8A 1VG0A 3CNDA 3RP7A 5BULA 1E1MA 1D7LA 2WQYA 1GTHA 4B63A 4OCGA 5IQ4A 2TMDA 4KPRA 1EL9A 3DH9A 1XANA 3WE0A 1PBFA 5FS9A 1YY5A 1ZOYA 2JB3A 2I0ZA 1HYUA 2GR0A 1JNZA 1PDHA 2OA1A 3B3RA 3F8RA 3NK2X 2NVKX 3AE9A 1TYTA 1EL8A 2BK4A 2W0HA 2YLXA 3QSMA 1V59A 1ZK7A 4UDQA 3V3OA 4ADWA 3E1TA 3FG2P 4NZHA 2TPRA 1CJCA 2A8XA 1BKWA 3KLJA 1COYA 4NTCA 2BS3A 2BC1A 3BI4A 4C74A 3AECA 2UZZA 4O5UA 5HXIA 2V60A 3SYIA 5FS6A 4ZCCA 1ELIA 4Z2TA 2GMJA 1FOHA
chains in the Genus database with same CATH topology
1YQ3A 3KU9A 2B9WA 3UP4A 3AYLA 3V3NA 1D7YA 3H8LA 2EQ6A 3SQPA 1E1LA 2FBWA 2XLSA 2EQ8A 3T0KA 3VQRA 1MOKA 1Y0PA 3T2ZA 4CNKA 3C4NA 1FECA 3P4SA 4KX6A 2XLPA 4J2WA 1JU2A 1H86A 2B7RA 1DNCA 4X9NA 3AE2A 4J34A 4A99A 2C66A 2V61A 4FK1C 1TDFA 1CF3A 1NENA 5M0ZA 2OALA 2WBAA 4HB9A 2OAMA 4PAAA 4I58A 2J3NA 4OPCA 1PBCA 3GDNA 5C3JA 1ZDLA 1ZMCA 4G9KA 3ITJA 3QSEA 2DKIA 3P4QA 4B67A 4IA5A 1RP0A 4PABA 2NPXA 1PXCA 2ZZCA 4RSLA 2WP5A 2BS2A 3AEDA 3CNJA 1K0JA 4MJWA 4U2TA 3QJ4A 4NTDA 4DNAA 2C67A 4H7UA 3ALMA 5EB4A 3VRDB 3VRBA 3FMWA 1GPEA 4E0VA 5BVAA 1GERA 1KNPA 4D03A 4XXGA 2FJEA 1VRQB 1JEHA 2IVDA 2RGJA 3G5SA 2EQ7A 3K7MX 3T31A 4AT2A 1H83A 2VOUA 1S2YA 2IIDA 4H4WA 2R4JA 4UDPA 1BF3A 2BK3A 3G5QA 3KPFA 3UTGA 1CL0A 3T37A 2C75A 1YQ4A 2WHDA 3FBSA 1OJCA 3EANA 1EBDA 1GESA 3LADA 1DODA 1IUXA 1JRZA 3CGCA 1MXTA 3NN0X 3RNMA 4H4TA 4FK1A 3ZYXA 4GF7A 2C76A 2RGOA 1IUVA 1CBOA 4U8MA 2PHHA 4RG4A 4DGKA 3GDPA 1JRXA 2Z5YA 3AEEA 3BHKA 1NG3A 2YG6A 3HYVA 3DJDA 2R0CA 2DKHA 1GOSA 5GSNA 2VQBA 1GEUA 2VVLG 2FJAA 1EL5A 3NK1X 3IC9A 2XVEA 1ZKQA 1DOCA 3DK9A 4A65A 4FX9A 4C3YA 2Y6RA 4CCQA 2GB0A 3DJJA 3NK0X 1S3BA 4EQXA 1M64A 3QVPA 2XVHA 1GSNA 3LOVA 2YLSA 3BHFA 5KMQA 5KVIA 4JNAA 4AP1A 3M12A 4JNQA 2XVFA 4OPTA 4C77A 1E7PA 4LIIA 2XFOA 3LXDA 4EQWA 2AR8A 2C4CA 2RABA 1Q1WA 3KA7A 2F5ZA 1B5QA 1NHRA 1PN0A 2GV8A 3GYXA 5KMSA 4APNA 5KRQA 4H4YA 4NNJA 4CBQA 4U8NA 2C65A 2XVJA 4G6HA 1PJ6A 2B76A 4ECHA 2PYXA 3ALJA 3GYJA 1D5TA 2BC0A 2XFUA 2GVCA 1D4CA 1N1PA 2E4GA 3COXA 2YR5A 2Q6UA 4GRTA 2VRMA 2CDUA 2GF3A 1JRYA 3CIRA 1REOA 4J57A 1Q9IA 1GXFA 4Y4MA 4YTMA 3CNPA 5FMHA 5IQ1A 1TYPA 3BI5A 4B69A 2AQJA 1QO8A 3CGEA 3Q9TA 1EL7A 3HYWA 2APGA 4NWZA 3CTYA 4TM4A 3UCLA 2XLRA 2E5VA 2QCUA 4JN9A 1L9DA 3F8PA 3V76A 3S5WA 3GWFA 4YKGA 3NIXA 5FS8A 4Z2RA 3SZCA 1LPFA 3UTEA 1KSSA 5EOWA 2C3DA 3UOYA 1B8SA 3GMBA 5JCKA 3QVRA 1O94A 1ONFA 2GRTA 2WPCA 1GETA 3CGBA 5U25A 3SZWA 1L0VA 3RP8A 4H4VA 2YG5A 1L9EA 3DJEA 3GD3A 3GMCA 4BJZA 4BK1A 2GEWA 3UTFA 1ZY8A 4U2LA 2EQ9A 1MO9A 4M52A 1DOBA 4AT0A 4EIPA 3NNEA 4JDRA 4NEWA 2JKCA 3NG7X 4X4JA 1TDNA 4BURA 4G74A 1IJHA 1S3EA 4AP3A 2ZBWA 3GYIA 2YAUA 4GDPA 4U8PA 4H4QA 4G6GA 4YSHA 4H50A 1N4WA 3AEFA 2Y6QA 1DXLA 2XLUA 2C7GA 3VR8A 1D4DA 1TDEA 5KWFA 3AD8B 2YLZA 2ZZBA 4GUVA 1E6EA 1PBDA 2YVGA 3IWAA 1BGNA 4Z2UA 4Z43A 4U8LA 2VVMA 1K0IA 2O9ZA 3NYFA 1ZMDA 4JY2A 4BK3A 2BS4A 1BZLA 2IVEA 3NRNA 5GRTA 2VRLA 1BWCA 3UOXA 2XFQA 2R46A 2YG4A 1F8RA 3SZ0A 1Z6LA 2YLWA 4A6NB 2RGHA 4ZCDA 1NHPA 3AE5A 2JAEA 3D8XA 4N9XA 4REKA 3UKQA 2YQUA 4CRTA 1VQWA 3LZWA 4C3XA 3IF9A 4J36A 1BGJA 3AEAA 1M6IA 1OJAA 3AD7B 1PHHA 4NEVA 4EQRA 3OZ2A 4XWZA 3AD9B 5KOXA 4CNJA 2YM1A 5J60A 5JCIA 1QJDA 3KKJA 1VDCA 4BJYA 1W4XA 2OLNA 3SM8A 2E1MA 2C73A 3C96A 4TM1A 4EMJA 5ER0A 4ZN0A 3ICSA 5KVHA 3P4RA 4BV6A 2BYBA 1E1NA 4RG3A 2BCGG 3NHOX 2C3CA 3SX6A 1GRFA 3AE4A 3UKHA 3P1WA 4OPDA 1TRBA 3GRSA 1PXBA 2H88A 3K7TA 1JNRA 4B68A 1OJDA 4BK2A 2GQFA 1NG4A 2WS3A 1LJ1A 3DGHA 2BABA 5LV9A 4AOSA 4U8IA 1NHQA 2B7SA 3T14A 5JCMA 3DMEA 1GT8A 4H2QA 1VG9A 1X31B 5U63A 3O0HA 2WU5A 4TLZA 4U8JA 3NT6A 4GDEA 3DK8A 3SXIA 2WEUA 3AB1A 3AEGA 4H2PA 1XHCA 4P9SA 1NPXA 5DBJA 3FPZA 3UTHA 4H4SA 4LA1A 2BCPA 1PJ5A 3K7QX 1F8SA 2YM2A 3UOZA 4Z24A 5KMPA 2WP6A 4IVMB 2YG3A 3B6DA 3F8DA 2X8HA 1GRTA 2V3BA 1PJ7A 4A6NA 1LTXR 2BXRA 3NGCX 2CFYA 4A79A 2JBVA 1H84A 1H82A 2WDRA 3L1RA 1F3PA 4K8DA 3LZXA 4TM3A 3CNTA 1PBBA 3H8IA 3QFBA 2BA9A 3ISHA 3AE6A 2GQWA 1D4EA 2YVJA 2YR6A 1GRBA 5M10A 4NTEA 4CY6A 3NTDA 4UDRA 4YSXA 1IUTA 4LU6A 2CULA 2FJDA 2YG7A 2B9XA 2XFPA 5KXJA 2BACA 2YWLA 1DJNA 1XPQA 2R4EA 3H4KA 4OPGA 1KFYA 1YQZA 2Z5XA 4U2SA 3BI2A 3K30A 3M13A 4B65A 3NH3X 4OPLA 2JB1A 4EM3A 2C70A 4A7AA 2AAQA 3AE1A 3UKPA 4J31A 3PVCA 1CC4A 1LVLA 4EMWA 2BRAA 1GTEA 1GREA 1IUSA 1IUWA 1DJQA 4J56A 3GSIA 1LV0A 2XLTA 3GD4A 4YTPA 4K22A 1DOEA 5KMRA 3QSSA 1H81A 5JCNA 2B9YA 2ACZA 1P2EA 2Q7VA 3HYXA 2WPFA 4Z26A 4YTNA 1F8WA 2QA2A 1JOAA 1GNDA 2GR2A 4A5LA 2VZ2A 1O5WA 2X50A 2WOWA 1OJ9A 2QAEA 4OVIA 4H4RA 4EM4A 2XYOA 4TLXA 1KDGA 1KF6A 2R0PA 4USRA 5HHFA 2YLTA 3SGLA 4YSYA 2GMHA 1PBEA 3VR9A 2GR3A 3RP6A 2A87A 3II4A 1GRHA 2ZZ0A 3PS9A 3QFAA 4CY8A 2X99A 2JK6A 5JCLA 2Q0LA 1TDKA 4U8KA 3REDA 4Z44A 3JSKA 4EIQA 1ZOVA 4ICYA 4GCMA 3CGDA 1N4UA 1SEZA 2BK5A 5EB5A 3CPJG 1F6MA 3P4PA 4TM0A 1K4QA 1CC6A 3AYJA 3FIMB 3L8KA 3DJGX 1Q1RA 2QA1A 3SFEA 4YSZA 1KSUA 3BNMA 3ICRA 1FL2A 2VQ7A 4OPIA 1H7WA 4H4ZA 5IPYA 4WX1A 4YKFA 3AWIA 4X9MA 3AYIA 1S2QA 4YWOA 1NAAA 3UP5A 3CN8A 3S61A 4K5RA 3UKLA 3AE7A 4B66A 3UOVA 4K5SA 4Z25A 2BRYA 3AE8A 2YVFA 4H2RA 4K2XA 4OPUA 2XDOA 3CMMA 4B64A 2XFNA 3IHMA 1ZP0A 3EAOA 1NEKA 3KVEA 3GRTA 4B1BA 3D1CA 3LJPA 1UKVG 2V5ZA 4J33A 1PXAA 5TR3A 1L9CA 4D04A 1AOGA 3NYEA 2R45A 3M0OA 3C4AA 3EPTA 5U1OA 5CQFA 3T2KA 1Y56B 4Y4NA 3R9UA 3KD9A 4JY3A 3URHA 1H6VA 2XVIA 3OC4A 2X3NA 3EF6A 1RYIA 3GWDA 4C5OA 4GAVA 3RHAA 1YKJA 5BUKA 2FJBA 3ABVA 3UKAA 2VVLA 3DA1A 1FEBA 2GAGB 1N4VA 1IUUA 5KNLA 2HQMA 2ARDA 2YLRA 1CJ4A 4II2A 1RSGA 2V3AA 5J7XA 1CC2A 4DSHA 1FCDA 4O5QA 2GH5A 3DGZA 3CPHG 4H4XA 2R9ZA 2X8CA 3Q6JA 1O95A 1KNRA 4WCTA 2BXSA 4K7ZA 2R0GA 1LQUA 4A9WA 4AOXA 4YXDA 4FDCB 4XWRA 2CVJA 1XDIA 2WOVA 1K0LA 1GRGA 2YR4A 4DSGA 3AXBA 1TDOA 3ATQA 4IV9A 2OLOA 3ICTA 3SZFA 1GV4A 4II3A 4YT0A 1FEAA 2WDQA 3VRAA 1CHUA 4EQSA 4U8OA 4H4PA 3AE3A 3ZDNA 4IA6A 3ADAB 3NN6X 2WPEA 3IHGA 1GALA 3BNUA 5EBKA 2X8GA 3T2YA 2H89A 2C72A 3NYCA 1OJTA 4HA6A 1ZX9A 3KPKA 4EMIA 1QLBA 1CJ3A 3UKFA 2WDVA 2V6OA 2Q0KA 1E39A 5FS7A 3NTAA 1GRAA 4GAPA 1NDAA 2WU2A 3ALLA 1H7XA 1LQTA 3NKSA 3CPIG 3P9UA 3HZLA 2WOIA 3I6DA 2WETA 5BRTA 3I3LA 4G73A 4CCRA 3UKKA 2GR1A 1E1KA 3SFDA 5HYMA 2JB2A 4Y4LA 4IVOB 1P2HA 3ATRA 4UP3A 1B37A 3G5RA 5KOWA 3DK4A 1PS9A 2GAHB 4H4UA 1CJ2A 3NLCA 4H2NA 5HY5A 1B4VA 4USQA 5L46A 1Y56A 2A89A 3CNSA 4JQ9A 3PO7A 3AEBA 3SY4A 2C64A 2XCGA 5CKUA 2WP9A 4GR1A 4I59A 1NHSA 5C2TA 2WESA 3LB8A 1VG0A 3CNDA 3RP7A 5BULA 1E1MA 1D7LA 2WQYA 1GTHA 4B63A 4OCGA 5IQ4A 2TMDA 4KPRA 1EL9A 3DH9A 1XANA 3WE0A 1PBFA 5FS9A 1YY5A 1ZOYA 2JB3A 2I0ZA 1HYUA 2GR0A 1JNZA 1PDHA 2OA1A 3B3RA 3F8RA 3NK2X 2NVKX 3AE9A 1TYTA 1EL8A 2BK4A 2W0HA 2YLXA 3QSMA 1V59A 1ZK7A 4UDQA 3V3OA 4ADWA 3E1TA 3FG2P 4NZHA 2TPRA 1CJCA 2A8XA 1BKWA 3KLJA 1COYA 4NTCA 2BS3A 2BC1A 3BI4A 4C74A 3AECA 2UZZA 4O5UA 5HXIA 2V60A 3SYIA 5FS6A 4ZCCA 1ELIA 4Z2TA 2GMJA 1FOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ3 A;  3KU9 A;  2B9W A;  3UP4 A;  3AYL A;  3V3N A;  1D7Y A;  3H8L A;  2EQ6 A;  3SQP A;  1E1L A;  2FBW A;  2XLS A;  2EQ8 A;  3VQR A;  1MOK A;  1Y0P A;  4CNK A;  3C4N A;  1FEC A;  3P4S A;  4KX6 A;  2XLP A;  4J2W A;  1JU2 A;  1H86 A;  2B7R A;  1DNC A;  4X9N A;  3AE2 A;  4J34 A;  4A99 A;  2C66 A;  2V61 A;  4FK1 C;  1TDF A;  1CF3 A;  1NEN A;  5M0Z A;  2OAL A;  2WBA A;  4HB9 A;  2OAM A;  4PAA A;  4I58 A;  2J3N A;  4OPC A;  1PBC A;  3GDN A;  5C3J A;  1ZDL A;  1ZMC A;  3ITJ A;  3QSE A;  2DKI A;  3P4Q A;  4B67 A;  4IA5 A;  1RP0 A;  4PAB A;  2NPX A;  1PXC A;  2ZZC A;  4RSL A;  2WP5 A;  2BS2 A;  3AED A;  3CNJ A;  1K0J A;  4MJW A;  4U2T A;  3QJ4 A;  4NTD A;  4DNA A;  2C67 A;  4H7U A;  3ALM A;  5EB4 A;  3VRD B;  3VRB A;  3FMW A;  1GPE A;  4E0V A;  5BVA A;  1GER A;  1KNP A;  4D03 A;  4XXG A;  2FJE A;  1VRQ B;  1JEH A;  2IVD A;  2RGJ A;  3G5S A;  2EQ7 A;  3K7M X;  4AT2 A;  1H83 A;  2VOU A;  1S2Y A;  2IID A;  4H4W A;  2R4J A;  4UDP A;  1BF3 A;  2BK3 A;  3G5Q A;  3KPF A;  3UTG A;  1CL0 A;  3T37 A;  2C75 A;  1YQ4 A;  2WHD A;  3FBS A;  1OJC A;  3EAN A;  1EBD A;  1GES A;  3LAD A;  1DOD A;  1IUX A;  1JRZ A;  3CGC A;  1MXT A;  3NN0 X;  3RNM A;  4H4T A;  4FK1 A;  3ZYX A;  4GF7 A;  2C76 A;  2RGO A;  1IUV A;  1CBO A;  4U8M A;  2PHH A;  4RG4 A;  4DGK A;  3GDP A;  1JRX A;  2Z5Y A;  3AEE A;  3BHK A;  1NG3 A;  2YG6 A;  3DJD A;  2R0C A;  2DKH A;  1GOS A;  5GSN A;  2VQB A;  1GEU A;  2VVL G;  2FJA A;  1EL5 A;  3NK1 X;  3IC9 A;  2XVE A;  1ZKQ A;  1DOC A;  3DK9 A;  4A65 A;  4FX9 A;  4C3Y A;  2Y6R A;  4CCQ A;  2GB0 A;  3DJJ A;  3NK0 X;  1S3B A;  4EQX A;  1M64 A;  3QVP A;  2XVH A;  1GSN A;  3LOV A;  2YLS A;  3BHF A;  5KVI A;  4JNA A;  4AP1 A;  3M12 A;  4JNQ A;  2XVF A;  4OPT A;  4C77 A;  1E7P A;  4LII A;  2XFO A;  3LXD A;  4EQW A;  2AR8 A;  3UKF A;  2RAB A;  1Q1W A;  3KA7 A;  2F5Z A;  1B5Q A;  1NHR A;  1PN0 A;  2GV8 A;  5KRQ A;  4APN A;  4H4Y A;  4CBQ A;  4U8N A;  2C65 A;  2XVJ A;  4ECH A;  1PJ6 A;  2B76 A;  2PYX A;  3ALJ A;  3GYJ A;  1D5T A;  2BC0 A;  2XFU A;  2GVC A;  1D4C A;  1N1P A;  2E4G A;  3COX A;  2YR5 A;  2Q6U A;  4GRT A;  2VRM A;  2CDU A;  2GF3 A;  1JRY A;  3CIR A;  1REO A;  4J57 A;  1Q9I A;  1GXF A;  4Y4M A;  4YTM A;  3CNP A;  5FMH A;  5IQ1 A;  1TYP A;  3BI5 A;  4B69 A;  2AQJ A;  1QO8 A;  3CGE A;  3Q9T A;  1EL7 A;  4TM4 A;  2APG A;  3CTY A;  3UCL A;  2XLR A;  2E5V A;  2QCU A;  4JN9 A;  1L9D A;  3F8P A;  3V76 A;  3S5W A;  3GWF A;  4YKG A;  3NIX A;  5FS8 A;  4Z2R A;  1LPF A;  3UTE A;  1KSS A;  5EOW A;  2C3D A;  3UOY A;  1B8S A;  3GMB A;  5JCK A;  3QVR A;  1O94 A;  1ONF A;  2GRT A;  2WPC A;  1GET A;  3CGB A;  5U25 A;  1L0V A;  3RP8 A;  4H4V A;  2YG5 A;  1L9E A;  3DJE A;  3GD3 A;  3GMC A;  4BJZ A;  4BK1 A;  2GEW A;  3UTF A;  1ZY8 A;  4U2L A;  2EQ9 A;  1MO9 A;  4M52 A;  1DOB A;  4AT0 A;  4EIP A;  3NNE A;  4JDR A;  4NEW A;  2JKC A;  3NG7 X;  4X4J A;  1TDN A;  4BUR A;  1IJH A;  1S3E A;  4AP3 A;  2ZBW A;  3GYI A;  2YAU A;  4GDP A;  4U8P A;  4H4Q A;  4YSH A;  4H50 A;  1N4W A;  3AEF A;  2Y6Q A;  1DXL A;  2XLU A;  2C7G A;  3VR8 A;  1D4D A;  1TDE A;  5KWF A;  3AD8 B;  2YLZ A;  2ZZB A;  4GUV A;  1E6E A;  1PBD A;  2YVG A;  3IWA A;  1BGN A;  4Z2U A;  4Z43 A;  4U8L A;  2VVM A;  1K0I A;  2O9Z A;  3NYF A;  1ZMD A;  4JY2 A;  4BK3 A;  2BS4 A;  1BZL A;  2IVE A;  3NRN A;  5GRT A;  2VRL A;  1BWC A;  3UOX A;  2XFQ A;  2R46 A;  2YG4 A;  1F8R A;  1Z6L A;  2YLW A;  4A6N B;  2RGH A;  4ZCD A;  1NHP A;  3AE5 A;  2JAE A;  3D8X A;  4N9X A;  4REK A;  3UKQ A;  2YQU A;  4CRT A;  1VQW A;  3LZW A;  4C3X A;  3IF9 A;  4J36 A;  1BGJ A;  3AEA A;  1M6I A;  1OJA A;  3AD7 B;  1PHH A;  4NEV A;  4EQR A;  3OZ2 A;  4XWZ A;  3AD9 B;  5KOX A;  4CNJ A;  2YM1 A;  5J60 A;  5JCI A;  1QJD A;  3KKJ A;  1VDC A;  4BJY A;  1W4X A;  2OLN A;  3SM8 A;  2E1M A;  2C73 A;  3C96 A;  4TM1 A;  4EMJ A;  5ER0 A;  4ZN0 A;  3ICS A;  5KVH A;  3P4R A;  4BV6 A;  2BYB A;  1E1N A;  4RG3 A;  2BCG G;  3NHO X;  2C3C A;  3UKH A;  1GRF A;  3AE4 A;  3P1W A;  4OPD A;  1TRB A;  3GRS A;  1PXB A;  2H88 A;  3K7T A;  1JNR A;  4B68 A;  1OJD A;  4BK2 A;  2GQF A;  1NG4 A;  2WS3 A;  1LJ1 A;  3DGH A;  2BAB A;  5LV9 A;  4AOS A;  4U8I A;  1NHQ A;  2B7S A;  5JCM A;  3DME A;  1GT8 A;  4H2Q A;  1VG9 A;  1X31 B;  5U63 A;  3O0H A;  2WU5 A;  4TLZ A;  4U8J A;  3NT6 A;  4GDE A;  3DK8 A;  2WEU A;  3AB1 A;  3AEG A;  4H2P A;  1XHC A;  4P9S A;  1NPX A;  5DBJ A;  3FPZ A;  3UTH A;  4H4S A;  4LA1 A;  2BCP A;  1PJ5 A;  3K7Q X;  1F8S A;  2YM2 A;  3UOZ A;  4Z24 A;  2WP6 A;  4IVM B;  2YG3 A;  3B6D A;  3F8D A;  2X8H A;  1GRT A;  2V3B A;  1PJ7 A;  4A6N A;  1LTX R;  2BXR A;  3NGC X;  2CFY A;  4A79 A;  2JBV A;  1H84 A;  1H82 A;  2WDR A;  3L1R A;  1F3P A;  4K8D A;  3LZX A;  4TM3 A;  3CNT A;  1PBB A;  3H8I A;  3QFB A;  2BA9 A;  3ISH A;  3AE6 A;  2GQW A;  1D4E A;  2YVJ A;  2YR6 A;  1GRB A;  5M10 A;  4NTE A;  4CY6 A;  3NTD A;  4UDR A;  4YSX A;  1IUT A;  4LU6 A;  2CUL A;  2FJD A;  2YG7 A;  2B9X A;  2XFP A;  5KXJ A;  2BAC A;  2YWL A;  1DJN A;  1XPQ A;  2R4E A;  3H4K A;  4OPG A;  1KFY A;  1YQZ A;  2Z5X A;  4U2S A;  3BI2 A;  3K30 A;  3M13 A;  4B65 A;  3NH3 X;  4OPL A;  2JB1 A;  4EM3 A;  2C70 A;  4A7A A;  2AAQ A;  3AE1 A;  3UKP A;  4J31 A;  3PVC A;  1CC4 A;  1LVL A;  4EMW A;  1GTE A;  1GRE A;  1IUS A;  1IUW A;  1DJQ A;  4J56 A;  3GSI A;  1LV0 A;  2XLT A;  3GD4 A;  4YTP A;  4K22 A;  1DOE A;  3QSS A;  1H81 A;  5JCN A;  2B9Y A;  2ACZ A;  1P2E A;  2Q7V A;  4Z26 A;  2WPF A;  4YTN A;  1F8W A;  2QA2 A;  1JOA A;  1GND A;  2GR2 A;  4A5L A;  2VZ2 A;  1O5W A;  2X50 A;  2WOW A;  1OJ9 A;  2QAE A;  4OVI A;  4H4R A;  4EM4 A;  2XYO A;  4TLX A;  1KDG A;  1KF6 A;  2R0P A;  4USR A;  5HHF A;  2YLT A;  3SGL A;  4YSY A;  2GMH A;  1PBE A;  3VR9 A;  2GR3 A;  3RP6 A;  2A87 A;  3II4 A;  1GRH A;  2ZZ0 A;  3PS9 A;  3QFA A;  4CY8 A;  2X99 A;  2JK6 A;  5JCL A;  2Q0L A;  1TDK A;  4U8K A;  3RED A;  4Z44 A;  3JSK A;  4EIQ A;  1ZOV A;  4ICY A;  4GCM A;  3CGD A;  1N4U A;  1SEZ A;  2BK5 A;  5EB5 A;  3CPJ G;  1F6M A;  3P4P A;  4TM0 A;  1K4Q A;  1CC6 A;  3AYJ A;  3FIM B;  3L8K A;  3DJG X;  1Q1R A;  2QA1 A;  3SFE A;  4YSZ A;  1KSU A;  3BNM A;  3ICR A;  1FL2 A;  2VQ7 A;  4OPI A;  1H7W A;  4H4Z A;  5IPY A;  4WX1 A;  4YKF A;  3AWI A;  4X9M A;  3AYI A;  1S2Q A;  4YWO A;  1NAA A;  3UP5 A;  3CN8 A;  3S61 A;  4K5R A;  3UKL A;  3AE7 A;  4B66 A;  3UOV A;  4K5S A;  4Z25 A;  3AE8 A;  2YVF A;  4H2R A;  4K2X A;  4OPU A;  2XDO A;  4B64 A;  2XFN A;  3IHM A;  1ZP0 A;  3EAO A;  1NEK A;  3KVE A;  3GRT A;  4B1B A;  3D1C A;  3LJP A;  1UKV G;  2V5Z A;  4J33 A;  1PXA A;  5TR3 A;  1L9C A;  4D04 A;  1AOG A;  3NYE A;  2R45 A;  3M0O A;  3C4A A;  3EPT A;  5U1O A;  5CQF A;  1Y56 B;  4Y4N A;  3R9U A;  3KD9 A;  4JY3 A;  3URH A;  1H6V A;  2XVI A;  3OC4 A;  2X3N A;  3EF6 A;  1RYI A;  3GWD A;  4C5O A;  3RHA A;  1YKJ A;  5BUK A;  2FJB A;  3ABV A;  3UKA A;  2VVL A;  3DA1 A;  1FEB A;  2GAG B;  1N4V A;  1IUU A;  2HQM A;  2ARD A;  2YLR A;  1CJ4 A;  1RSG A;  2V3A A;  5J7X A;  1CC2 A;  4DSH A;  1FCD A;  4O5Q A;  2GH5 A;  3DGZ A;  3CPH G;  4H4X A;  2R9Z A;  2X8C A;  3Q6J A;  1O95 A;  1KNR A;  4WCT A;  2BXS A;  4K7Z A;  2R0G A;  1LQU A;  4A9W A;  4AOX A;  4YXD A;  4FDC B;  4XWR A;  2CVJ A;  1XDI A;  2WOV A;  1K0L A;  1GRG A;  2YR4 A;  4DSG A;  3AXB A;  1TDO A;  3ATQ A;  4IV9 A;  2OLO A;  3ICT A;  1GV4 A;  4YT0 A;  1FEA A;  2WDQ A;  3VRA A;  1CHU A;  4EQS A;  4U8O A;  4H4P A;  3AE3 A;  3ZDN A;  4IA6 A;  3ADA B;  3NN6 X;  2WPE A;  3IHG A;  1GAL A;  3BNU A;  5EBK A;  2X8G A;  2H89 A;  2C72 A;  3NYC A;  1OJT A;  4HA6 A;  1ZX9 A;  4EMI A;  1QLB A;  1CJ3 A;  2WDV A;  2V6O A;  2Q0K A;  1E39 A;  5FS7 A;  3NTA A;  1GRA A;  1NDA A;  2WU2 A;  3ALL A;  1H7X A;  1LQT A;  3NKS A;  3CPI G;  3P9U A;  3HZL A;  2WOI A;  3I6D A;  2WET A;  5BRT A;  3I3L A;  4CCR A;  3UKK A;  2GR1 A;  1E1K A;  3SFD A;  5HYM A;  2JB2 A;  4Y4L A;  4IVO B;  1P2H A;  3ATR A;  4UP3 A;  1B37 A;  3G5R A;  5KOW A;  3DK4 A;  1PS9 A;  2GAH B;  4H4U A;  1CJ2 A;  3NLC A;  4H2N A;  5HY5 A;  1B4V A;  4USQ A;  5L46 A;  1Y56 A;  2A89 A;  3CNS A;  4JQ9 A;  3PO7 A;  3AEB A;  2C64 A;  2XCG A;  5CKU A;  2WP9 A;  4GR1 A;  4I59 A;  1NHS A;  5C2T A;  2WES A;  3LB8 A;  1VG0 A;  3CND A;  3RP7 A;  5BUL A;  1E1M A;  1D7L A;  2WQY A;  1GTH A;  4B63 A;  4OCG A;  5IQ4 A;  2TMD A;  4KPR A;  1EL9 A;  3DH9 A;  1XAN A;  3WE0 A;  1PBF A;  5FS9 A;  1YY5 A;  1ZOY A;  2JB3 A;  2I0Z A;  1HYU A;  2GR0 A;  1JNZ A;  1PDH A;  2OA1 A;  3B3R A;  3F8R A;  3NK2 X;  2NVK X;  3AE9 A;  1TYT A;  1EL8 A;  2BK4 A;  2W0H A;  2YLX A;  3QSM A;  1V59 A;  1ZK7 A;  4UDQ A;  3V3O A;  4ADW A;  3E1T A;  3FG2 P;  4NZH A;  2TPR A;  1CJC A;  2A8X A;  1BKW A;  3KLJ A;  1COY A;  4NTC A;  2BS3 A;  2BC1 A;  3BI4 A;  4C74 A;  3AEC A;  2UZZ A;  4O5U A;  5HXI A;  2V60 A;  5FS6 A;  4ZCC A;  1ELI A;  4Z2T A;  2GMJ A;  1FOH A; 
#chains in the Genus database with same CATH topology
 1YQ3 A;  3KU9 A;  2B9W A;  3UP4 A;  3AYL A;  3V3N A;  1D7Y A;  3H8L A;  2EQ6 A;  3SQP A;  1E1L A;  2FBW A;  2XLS A;  2EQ8 A;  3T0K A;  3VQR A;  1MOK A;  1Y0P A;  3T2Z A;  4CNK A;  3C4N A;  1FEC A;  3P4S A;  4KX6 A;  2XLP A;  4J2W A;  1JU2 A;  1H86 A;  2B7R A;  1DNC A;  4X9N A;  3AE2 A;  4J34 A;  4A99 A;  2C66 A;  2V61 A;  4FK1 C;  1TDF A;  1CF3 A;  1NEN A;  5M0Z A;  2OAL A;  2WBA A;  4HB9 A;  2OAM A;  4PAA A;  4I58 A;  2J3N A;  4OPC A;  1PBC A;  3GDN A;  5C3J A;  1ZDL A;  1ZMC A;  4G9K A;  3ITJ A;  3QSE A;  2DKI A;  3P4Q A;  4B67 A;  4IA5 A;  1RP0 A;  4PAB A;  2NPX A;  1PXC A;  2ZZC A;  4RSL A;  2WP5 A;  2BS2 A;  3AED A;  3CNJ A;  1K0J A;  4MJW A;  4U2T A;  3QJ4 A;  4NTD A;  4DNA A;  2C67 A;  4H7U A;  3ALM A;  5EB4 A;  3VRD B;  3VRB A;  3FMW A;  1GPE A;  4E0V A;  5BVA A;  1GER A;  1KNP A;  4D03 A;  4XXG A;  2FJE A;  1VRQ B;  1JEH A;  2IVD A;  2RGJ A;  3G5S A;  2EQ7 A;  3K7M X;  3T31 A;  4AT2 A;  1H83 A;  2VOU A;  1S2Y A;  2IID A;  4H4W A;  2R4J A;  4UDP A;  1BF3 A;  2BK3 A;  3G5Q A;  3KPF A;  3UTG A;  1CL0 A;  3T37 A;  2C75 A;  1YQ4 A;  2WHD A;  3FBS A;  1OJC A;  3EAN A;  1EBD A;  1GES A;  3LAD A;  1DOD A;  1IUX A;  1JRZ A;  3CGC A;  1MXT A;  3NN0 X;  3RNM A;  4H4T A;  4FK1 A;  3ZYX A;  4GF7 A;  2C76 A;  2RGO A;  1IUV A;  1CBO A;  4U8M A;  2PHH A;  4RG4 A;  4DGK A;  3GDP A;  1JRX A;  2Z5Y A;  3AEE A;  3BHK A;  1NG3 A;  2YG6 A;  3HYV A;  3DJD A;  2R0C A;  2DKH A;  1GOS A;  5GSN A;  2VQB A;  1GEU A;  2VVL G;  2FJA A;  1EL5 A;  3NK1 X;  3IC9 A;  2XVE A;  1ZKQ A;  1DOC A;  3DK9 A;  4A65 A;  4FX9 A;  4C3Y A;  2Y6R A;  4CCQ A;  2GB0 A;  3DJJ A;  3NK0 X;  1S3B A;  4EQX A;  1M64 A;  3QVP A;  2XVH A;  1GSN A;  3LOV A;  2YLS A;  3BHF A;  5KMQ A;  5KVI A;  4JNA A;  4AP1 A;  3M12 A;  4JNQ A;  2XVF A;  4OPT A;  4C77 A;  1E7P A;  4LII A;  2XFO A;  3LXD A;  4EQW A;  2AR8 A;  2C4C A;  2RAB A;  1Q1W A;  3KA7 A;  2F5Z A;  1B5Q A;  1NHR A;  1PN0 A;  2GV8 A;  3GYX A;  5KMS A;  4APN A;  5KRQ A;  4H4Y A;  4NNJ A;  4CBQ A;  4U8N A;  2C65 A;  2XVJ A;  4G6H A;  1PJ6 A;  2B76 A;  4ECH A;  2PYX A;  3ALJ A;  3GYJ A;  1D5T A;  2BC0 A;  2XFU A;  2GVC A;  1D4C A;  1N1P A;  2E4G A;  3COX A;  2YR5 A;  2Q6U A;  4GRT A;  2VRM A;  2CDU A;  2GF3 A;  1JRY A;  3CIR A;  1REO A;  4J57 A;  1Q9I A;  1GXF A;  4Y4M A;  4YTM A;  3CNP A;  5FMH A;  5IQ1 A;  1TYP A;  3BI5 A;  4B69 A;  2AQJ A;  1QO8 A;  3CGE A;  3Q9T A;  1EL7 A;  3HYW A;  2APG A;  4NWZ A;  3CTY A;  4TM4 A;  3UCL A;  2XLR A;  2E5V A;  2QCU A;  4JN9 A;  1L9D A;  3F8P A;  3V76 A;  3S5W A;  3GWF A;  4YKG A;  3NIX A;  5FS8 A;  4Z2R A;  3SZC A;  1LPF A;  3UTE A;  1KSS A;  5EOW A;  2C3D A;  3UOY A;  1B8S A;  3GMB A;  5JCK A;  3QVR A;  1O94 A;  1ONF A;  2GRT A;  2WPC A;  1GET A;  3CGB A;  5U25 A;  3SZW A;  1L0V A;  3RP8 A;  4H4V A;  2YG5 A;  1L9E A;  3DJE A;  3GD3 A;  3GMC A;  4BJZ A;  4BK1 A;  2GEW A;  3UTF A;  1ZY8 A;  4U2L A;  2EQ9 A;  1MO9 A;  4M52 A;  1DOB A;  4AT0 A;  4EIP A;  3NNE A;  4JDR A;  4NEW A;  2JKC A;  3NG7 X;  4X4J A;  1TDN A;  4BUR A;  4G74 A;  1IJH A;  1S3E A;  4AP3 A;  2ZBW A;  3GYI A;  2YAU A;  4GDP A;  4U8P A;  4H4Q A;  4G6G A;  4YSH A;  4H50 A;  1N4W A;  3AEF A;  2Y6Q A;  1DXL A;  2XLU A;  2C7G A;  3VR8 A;  1D4D A;  1TDE A;  5KWF A;  3AD8 B;  2YLZ A;  2ZZB A;  4GUV A;  1E6E A;  1PBD A;  2YVG A;  3IWA A;  1BGN A;  4Z2U A;  4Z43 A;  4U8L A;  2VVM A;  1K0I A;  2O9Z A;  3NYF A;  1ZMD A;  4JY2 A;  4BK3 A;  2BS4 A;  1BZL A;  2IVE A;  3NRN A;  5GRT A;  2VRL A;  1BWC A;  3UOX A;  2XFQ A;  2R46 A;  2YG4 A;  1F8R A;  3SZ0 A;  1Z6L A;  2YLW A;  4A6N B;  2RGH A;  4ZCD A;  1NHP A;  3AE5 A;  2JAE A;  3D8X A;  4N9X A;  4REK A;  3UKQ A;  2YQU A;  4CRT A;  1VQW A;  3LZW A;  4C3X A;  3IF9 A;  4J36 A;  1BGJ A;  3AEA A;  1M6I A;  1OJA A;  3AD7 B;  1PHH A;  4NEV A;  4EQR A;  3OZ2 A;  4XWZ A;  3AD9 B;  5KOX A;  4CNJ A;  2YM1 A;  5J60 A;  5JCI A;  1QJD A;  3KKJ A;  1VDC A;  4BJY A;  1W4X A;  2OLN A;  3SM8 A;  2E1M A;  2C73 A;  3C96 A;  4TM1 A;  4EMJ A;  5ER0 A;  4ZN0 A;  3ICS A;  5KVH A;  3P4R A;  4BV6 A;  2BYB A;  1E1N A;  4RG3 A;  2BCG G;  3NHO X;  2C3C A;  3SX6 A;  1GRF A;  3AE4 A;  3UKH A;  3P1W A;  4OPD A;  1TRB A;  3GRS A;  1PXB A;  2H88 A;  3K7T A;  1JNR A;  4B68 A;  1OJD A;  4BK2 A;  2GQF A;  1NG4 A;  2WS3 A;  1LJ1 A;  3DGH A;  2BAB A;  5LV9 A;  4AOS A;  4U8I A;  1NHQ A;  2B7S A;  3T14 A;  5JCM A;  3DME A;  1GT8 A;  4H2Q A;  1VG9 A;  1X31 B;  5U63 A;  3O0H A;  2WU5 A;  4TLZ A;  4U8J A;  3NT6 A;  4GDE A;  3DK8 A;  3SXI A;  2WEU A;  3AB1 A;  3AEG A;  4H2P A;  1XHC A;  4P9S A;  1NPX A;  5DBJ A;  3FPZ A;  3UTH A;  4H4S A;  4LA1 A;  2BCP A;  1PJ5 A;  3K7Q X;  1F8S A;  2YM2 A;  3UOZ A;  4Z24 A;  5KMP A;  2WP6 A;  4IVM B;  2YG3 A;  3B6D A;  3F8D A;  2X8H A;  1GRT A;  2V3B A;  1PJ7 A;  4A6N A;  1LTX R;  2BXR A;  3NGC X;  2CFY A;  4A79 A;  2JBV A;  1H84 A;  1H82 A;  2WDR A;  3L1R A;  1F3P A;  4K8D A;  3LZX A;  4TM3 A;  3CNT A;  1PBB A;  3H8I A;  3QFB A;  2BA9 A;  3ISH A;  3AE6 A;  2GQW A;  1D4E A;  2YVJ A;  2YR6 A;  1GRB A;  5M10 A;  4NTE A;  4CY6 A;  3NTD A;  4UDR A;  4YSX A;  1IUT A;  4LU6 A;  2CUL A;  2FJD A;  2YG7 A;  2B9X A;  2XFP A;  5KXJ A;  2BAC A;  2YWL A;  1DJN A;  1XPQ A;  2R4E A;  3H4K A;  4OPG A;  1KFY A;  1YQZ A;  2Z5X A;  4U2S A;  3BI2 A;  3K30 A;  3M13 A;  4B65 A;  3NH3 X;  4OPL A;  2JB1 A;  4EM3 A;  2C70 A;  4A7A A;  2AAQ A;  3AE1 A;  3UKP A;  4J31 A;  3PVC A;  1CC4 A;  1LVL A;  4EMW A;  2BRA A;  1GTE A;  1GRE A;  1IUS A;  1IUW A;  1DJQ A;  4J56 A;  3GSI A;  1LV0 A;  2XLT A;  3GD4 A;  4YTP A;  4K22 A;  1DOE A;  5KMR A;  3QSS A;  1H81 A;  5JCN A;  2B9Y A;  2ACZ A;  1P2E A;  2Q7V A;  3HYX A;  2WPF A;  4Z26 A;  4YTN A;  1F8W A;  2QA2 A;  1JOA A;  1GND A;  2GR2 A;  4A5L A;  2VZ2 A;  1O5W A;  2X50 A;  2WOW A;  1OJ9 A;  2QAE A;  4OVI A;  4H4R A;  4EM4 A;  2XYO A;  4TLX A;  1KDG A;  1KF6 A;  2R0P A;  4USR A;  5HHF A;  2YLT A;  3SGL A;  4YSY A;  2GMH A;  1PBE A;  3VR9 A;  2GR3 A;  3RP6 A;  2A87 A;  3II4 A;  1GRH A;  2ZZ0 A;  3PS9 A;  3QFA A;  4CY8 A;  2X99 A;  2JK6 A;  5JCL A;  2Q0L A;  1TDK A;  4U8K A;  3RED A;  4Z44 A;  3JSK A;  4EIQ A;  1ZOV A;  4ICY A;  4GCM A;  3CGD A;  1N4U A;  1SEZ A;  2BK5 A;  5EB5 A;  3CPJ G;  1F6M A;  3P4P A;  4TM0 A;  1K4Q A;  1CC6 A;  3AYJ A;  3FIM B;  3L8K A;  3DJG X;  1Q1R A;  2QA1 A;  3SFE A;  4YSZ A;  1KSU A;  3BNM A;  3ICR A;  1FL2 A;  2VQ7 A;  4OPI A;  1H7W A;  4H4Z A;  5IPY A;  4WX1 A;  4YKF A;  3AWI A;  4X9M A;  3AYI A;  1S2Q A;  4YWO A;  1NAA A;  3UP5 A;  3CN8 A;  3S61 A;  4K5R A;  3UKL A;  3AE7 A;  4B66 A;  3UOV A;  4K5S A;  4Z25 A;  2BRY A;  3AE8 A;  2YVF A;  4H2R A;  4K2X A;  4OPU A;  2XDO A;  3CMM A;  4B64 A;  2XFN A;  3IHM A;  1ZP0 A;  3EAO A;  1NEK A;  3KVE A;  3GRT A;  4B1B A;  3D1C A;  3LJP A;  1UKV G;  2V5Z A;  4J33 A;  1PXA A;  5TR3 A;  1L9C A;  4D04 A;  1AOG A;  3NYE A;  2R45 A;  3M0O A;  3C4A A;  3EPT A;  5U1O A;  5CQF A;  3T2K A;  1Y56 B;  4Y4N A;  3R9U A;  3KD9 A;  4JY3 A;  3URH A;  1H6V A;  2XVI A;  3OC4 A;  2X3N A;  3EF6 A;  1RYI A;  3GWD A;  4C5O A;  4GAV A;  3RHA A;  1YKJ A;  5BUK A;  2FJB A;  3ABV A;  3UKA A;  2VVL A;  3DA1 A;  1FEB A;  2GAG B;  1N4V A;  1IUU A;  5KNL A;  2HQM A;  2ARD A;  2YLR A;  1CJ4 A;  4II2 A;  1RSG A;  2V3A A;  5J7X A;  1CC2 A;  4DSH A;  1FCD A;  4O5Q A;  2GH5 A;  3DGZ A;  3CPH G;  4H4X A;  2R9Z A;  2X8C A;  3Q6J A;  1O95 A;  1KNR A;  4WCT A;  2BXS A;  4K7Z A;  2R0G A;  1LQU A;  4A9W A;  4AOX A;  4YXD A;  4FDC B;  4XWR A;  2CVJ A;  1XDI A;  2WOV A;  1K0L A;  1GRG A;  2YR4 A;  4DSG A;  3AXB A;  1TDO A;  3ATQ A;  4IV9 A;  2OLO A;  3ICT A;  3SZF A;  1GV4 A;  4II3 A;  4YT0 A;  1FEA A;  2WDQ A;  3VRA A;  1CHU A;  4EQS A;  4U8O A;  4H4P A;  3AE3 A;  3ZDN A;  4IA6 A;  3ADA B;  3NN6 X;  2WPE A;  3IHG A;  1GAL A;  3BNU A;  5EBK A;  2X8G A;  3T2Y A;  2H89 A;  2C72 A;  3NYC A;  1OJT A;  4HA6 A;  1ZX9 A;  3KPK A;  4EMI A;  1QLB A;  1CJ3 A;  3UKF A;  2WDV A;  2V6O A;  2Q0K A;  1E39 A;  5FS7 A;  3NTA A;  1GRA A;  4GAP A;  1NDA A;  2WU2 A;  3ALL A;  1H7X A;  1LQT A;  3NKS A;  3CPI G;  3P9U A;  3HZL A;  2WOI A;  3I6D A;  2WET A;  5BRT A;  3I3L A;  4G73 A;  4CCR A;  3UKK A;  2GR1 A;  1E1K A;  3SFD A;  5HYM A;  2JB2 A;  4Y4L A;  4IVO B;  1P2H A;  3ATR A;  4UP3 A;  1B37 A;  3G5R A;  5KOW A;  3DK4 A;  1PS9 A;  2GAH B;  4H4U A;  1CJ2 A;  3NLC A;  4H2N A;  5HY5 A;  1B4V A;  4USQ A;  5L46 A;  1Y56 A;  2A89 A;  3CNS A;  4JQ9 A;  3PO7 A;  3AEB A;  3SY4 A;  2C64 A;  2XCG A;  5CKU A;  2WP9 A;  4GR1 A;  4I59 A;  1NHS A;  5C2T A;  2WES A;  3LB8 A;  1VG0 A;  3CND A;  3RP7 A;  5BUL A;  1E1M A;  1D7L A;  2WQY A;  1GTH A;  4B63 A;  4OCG A;  5IQ4 A;  2TMD A;  4KPR A;  1EL9 A;  3DH9 A;  1XAN A;  3WE0 A;  1PBF A;  5FS9 A;  1YY5 A;  1ZOY A;  2JB3 A;  2I0Z A;  1HYU A;  2GR0 A;  1JNZ A;  1PDH A;  2OA1 A;  3B3R A;  3F8R A;  3NK2 X;  2NVK X;  3AE9 A;  1TYT A;  1EL8 A;  2BK4 A;  2W0H A;  2YLX A;  3QSM A;  1V59 A;  1ZK7 A;  4UDQ A;  3V3O A;  4ADW A;  3E1T A;  3FG2 P;  4NZH A;  2TPR A;  1CJC A;  2A8X A;  1BKW A;  3KLJ A;  1COY A;  4NTC A;  2BS3 A;  2BC1 A;  3BI4 A;  4C74 A;  3AEC A;  2UZZ A;  4O5U A;  5HXI A;  2V60 A;  3SYI A;  5FS6 A;  4ZCC A;  1ELI A;  4Z2T A;  2GMJ A;  1FOH A; 
#chains in the Genus database with same CATH homology
 1YQ3 A;  3KU9 A;  2B9W A;  3UP4 A;  3AYL A;  3V3N A;  1D7Y A;  3H8L A;  2EQ6 A;  3SQP A;  1E1L A;  2FBW A;  2XLS A;  2EQ8 A;  3T0K A;  3VQR A;  1MOK A;  1Y0P A;  3T2Z A;  4CNK A;  3C4N A;  1FEC A;  3P4S A;  4KX6 A;  2XLP A;  4J2W A;  1JU2 A;  1H86 A;  2B7R A;  1DNC A;  4X9N A;  3AE2 A;  4J34 A;  4A99 A;  2C66 A;  2V61 A;  4FK1 C;  1TDF A;  1CF3 A;  1NEN A;  5M0Z A;  2OAL A;  2WBA A;  4HB9 A;  2OAM A;  4PAA A;  4I58 A;  2J3N A;  4OPC A;  1PBC A;  3GDN A;  5C3J A;  1ZDL A;  1ZMC A;  4G9K A;  3ITJ A;  3QSE A;  2DKI A;  3P4Q A;  4B67 A;  4IA5 A;  1RP0 A;  4PAB A;  2NPX A;  1PXC A;  2ZZC A;  4RSL A;  2WP5 A;  2BS2 A;  3AED A;  3CNJ A;  1K0J A;  4MJW A;  4U2T A;  3QJ4 A;  4NTD A;  4DNA A;  2C67 A;  4H7U A;  3ALM A;  5EB4 A;  3VRD B;  3VRB A;  3FMW A;  1GPE A;  4E0V A;  5BVA A;  1GER A;  1KNP A;  4D03 A;  4XXG A;  2FJE A;  1VRQ B;  1JEH A;  2IVD A;  2RGJ A;  3G5S A;  2EQ7 A;  3K7M X;  3T31 A;  4AT2 A;  1H83 A;  2VOU A;  1S2Y A;  2IID A;  4H4W A;  2R4J A;  4UDP A;  1BF3 A;  2BK3 A;  3G5Q A;  3KPF A;  3UTG A;  1CL0 A;  3T37 A;  2C75 A;  1YQ4 A;  2WHD A;  3FBS A;  1OJC A;  3EAN A;  1EBD A;  1GES A;  3LAD A;  1DOD A;  1IUX A;  1JRZ A;  3CGC A;  1MXT A;  3NN0 X;  3RNM A;  4H4T A;  4FK1 A;  3ZYX A;  4GF7 A;  2C76 A;  2RGO A;  1IUV A;  1CBO A;  4U8M A;  2PHH A;  4RG4 A;  4DGK A;  3GDP A;  1JRX A;  2Z5Y A;  3AEE A;  3BHK A;  1NG3 A;  2YG6 A;  3HYV A;  3DJD A;  2R0C A;  2DKH A;  1GOS A;  5GSN A;  2VQB A;  1GEU A;  2VVL G;  2FJA A;  1EL5 A;  3NK1 X;  3IC9 A;  2XVE A;  1ZKQ A;  1DOC A;  3DK9 A;  4A65 A;  4FX9 A;  4C3Y A;  2Y6R A;  4CCQ A;  2GB0 A;  3DJJ A;  3NK0 X;  1S3B A;  4EQX A;  1M64 A;  3QVP A;  2XVH A;  1GSN A;  3LOV A;  2YLS A;  3BHF A;  5KMQ A;  5KVI A;  4JNA A;  4AP1 A;  3M12 A;  4JNQ A;  2XVF A;  4OPT A;  4C77 A;  1E7P A;  4LII A;  2XFO A;  3LXD A;  4EQW A;  2AR8 A;  2C4C A;  2RAB A;  1Q1W A;  3KA7 A;  2F5Z A;  1B5Q A;  1NHR A;  1PN0 A;  2GV8 A;  3GYX A;  5KMS A;  4APN A;  5KRQ A;  4H4Y A;  4NNJ A;  4CBQ A;  4U8N A;  2C65 A;  2XVJ A;  4G6H A;  1PJ6 A;  2B76 A;  4ECH A;  2PYX A;  3ALJ A;  3GYJ A;  1D5T A;  2BC0 A;  2XFU A;  2GVC A;  1D4C A;  1N1P A;  2E4G A;  3COX A;  2YR5 A;  2Q6U A;  4GRT A;  2VRM A;  2CDU A;  2GF3 A;  1JRY A;  3CIR A;  1REO A;  4J57 A;  1Q9I A;  1GXF A;  4Y4M A;  4YTM A;  3CNP A;  5FMH A;  5IQ1 A;  1TYP A;  3BI5 A;  4B69 A;  2AQJ A;  1QO8 A;  3CGE A;  3Q9T A;  1EL7 A;  3HYW A;  2APG A;  4NWZ A;  3CTY A;  4TM4 A;  3UCL A;  2XLR A;  2E5V A;  2QCU A;  4JN9 A;  1L9D A;  3F8P A;  3V76 A;  3S5W A;  3GWF A;  4YKG A;  3NIX A;  5FS8 A;  4Z2R A;  3SZC A;  1LPF A;  3UTE A;  1KSS A;  5EOW A;  2C3D A;  3UOY A;  1B8S A;  3GMB A;  5JCK A;  3QVR A;  1O94 A;  1ONF A;  2GRT A;  2WPC A;  1GET A;  3CGB A;  5U25 A;  3SZW A;  1L0V A;  3RP8 A;  4H4V A;  2YG5 A;  1L9E A;  3DJE A;  3GD3 A;  3GMC A;  4BJZ A;  4BK1 A;  2GEW A;  3UTF A;  1ZY8 A;  4U2L A;  2EQ9 A;  1MO9 A;  4M52 A;  1DOB A;  4AT0 A;  4EIP A;  3NNE A;  4JDR A;  4NEW A;  2JKC A;  3NG7 X;  4X4J A;  1TDN A;  4BUR A;  4G74 A;  1IJH A;  1S3E A;  4AP3 A;  2ZBW A;  3GYI A;  2YAU A;  4GDP A;  4U8P A;  4H4Q A;  4G6G A;  4YSH A;  4H50 A;  1N4W A;  3AEF A;  2Y6Q A;  1DXL A;  2XLU A;  2C7G A;  3VR8 A;  1D4D A;  1TDE A;  5KWF A;  3AD8 B;  2YLZ A;  2ZZB A;  4GUV A;  1E6E A;  1PBD A;  2YVG A;  3IWA A;  1BGN A;  4Z2U A;  4Z43 A;  4U8L A;  2VVM A;  1K0I A;  2O9Z A;  3NYF A;  1ZMD A;  4JY2 A;  4BK3 A;  2BS4 A;  1BZL A;  2IVE A;  3NRN A;  5GRT A;  2VRL A;  1BWC A;  3UOX A;  2XFQ A;  2R46 A;  2YG4 A;  1F8R A;  3SZ0 A;  1Z6L A;  2YLW A;  4A6N B;  2RGH A;  4ZCD A;  1NHP A;  3AE5 A;  2JAE A;  3D8X A;  4N9X A;  4REK A;  3UKQ A;  2YQU A;  4CRT A;  1VQW A;  3LZW A;  4C3X A;  3IF9 A;  4J36 A;  1BGJ A;  3AEA A;  1M6I A;  1OJA A;  3AD7 B;  1PHH A;  4NEV A;  4EQR A;  3OZ2 A;  4XWZ A;  3AD9 B;  5KOX A;  4CNJ A;  2YM1 A;  5J60 A;  5JCI A;  1QJD A;  3KKJ A;  1VDC A;  4BJY A;  1W4X A;  2OLN A;  3SM8 A;  2E1M A;  2C73 A;  3C96 A;  4TM1 A;  4EMJ A;  5ER0 A;  4ZN0 A;  3ICS A;  5KVH A;  3P4R A;  4BV6 A;  2BYB A;  1E1N A;  4RG3 A;  2BCG G;  3NHO X;  2C3C A;  3SX6 A;  1GRF A;  3AE4 A;  3UKH A;  3P1W A;  4OPD A;  1TRB A;  3GRS A;  1PXB A;  2H88 A;  3K7T A;  1JNR A;  4B68 A;  1OJD A;  4BK2 A;  2GQF A;  1NG4 A;  2WS3 A;  1LJ1 A;  3DGH A;  2BAB A;  5LV9 A;  4AOS A;  4U8I A;  1NHQ A;  2B7S A;  3T14 A;  5JCM A;  3DME A;  1GT8 A;  4H2Q A;  1VG9 A;  1X31 B;  5U63 A;  3O0H A;  2WU5 A;  4TLZ A;  4U8J A;  3NT6 A;  4GDE A;  3DK8 A;  3SXI A;  2WEU A;  3AB1 A;  3AEG A;  4H2P A;  1XHC A;  4P9S A;  1NPX A;  5DBJ A;  3FPZ A;  3UTH A;  4H4S A;  4LA1 A;  2BCP A;  1PJ5 A;  3K7Q X;  1F8S A;  2YM2 A;  3UOZ A;  4Z24 A;  5KMP A;  2WP6 A;  4IVM B;  2YG3 A;  3B6D A;  3F8D A;  2X8H A;  1GRT A;  2V3B A;  1PJ7 A;  4A6N A;  1LTX R;  2BXR A;  3NGC X;  2CFY A;  4A79 A;  2JBV A;  1H84 A;  1H82 A;  2WDR A;  3L1R A;  1F3P A;  4K8D A;  3LZX A;  4TM3 A;  3CNT A;  1PBB A;  3H8I A;  3QFB A;  2BA9 A;  3ISH A;  3AE6 A;  2GQW A;  1D4E A;  2YVJ A;  2YR6 A;  1GRB A;  5M10 A;  4NTE A;  4CY6 A;  3NTD A;  4UDR A;  4YSX A;  1IUT A;  4LU6 A;  2CUL A;  2FJD A;  2YG7 A;  2B9X A;  2XFP A;  5KXJ A;  2BAC A;  2YWL A;  1DJN A;  1XPQ A;  2R4E A;  3H4K A;  4OPG A;  1KFY A;  1YQZ A;  2Z5X A;  4U2S A;  3BI2 A;  3K30 A;  3M13 A;  4B65 A;  3NH3 X;  4OPL A;  2JB1 A;  4EM3 A;  2C70 A;  4A7A A;  2AAQ A;  3AE1 A;  3UKP A;  4J31 A;  3PVC A;  1CC4 A;  1LVL A;  4EMW A;  2BRA A;  1GTE A;  1GRE A;  1IUS A;  1IUW A;  1DJQ A;  4J56 A;  3GSI A;  1LV0 A;  2XLT A;  3GD4 A;  4YTP A;  4K22 A;  1DOE A;  5KMR A;  3QSS A;  1H81 A;  5JCN A;  2B9Y A;  2ACZ A;  1P2E A;  2Q7V A;  3HYX A;  2WPF A;  4Z26 A;  4YTN A;  1F8W A;  2QA2 A;  1JOA A;  1GND A;  2GR2 A;  4A5L A;  2VZ2 A;  1O5W A;  2X50 A;  2WOW A;  1OJ9 A;  2QAE A;  4OVI A;  4H4R A;  4EM4 A;  2XYO A;  4TLX A;  1KDG A;  1KF6 A;  2R0P A;  4USR A;  5HHF A;  2YLT A;  3SGL A;  4YSY A;  2GMH A;  1PBE A;  3VR9 A;  2GR3 A;  3RP6 A;  2A87 A;  3II4 A;  1GRH A;  2ZZ0 A;  3PS9 A;  3QFA A;  4CY8 A;  2X99 A;  2JK6 A;  5JCL A;  2Q0L A;  1TDK A;  4U8K A;  3RED A;  4Z44 A;  3JSK A;  4EIQ A;  1ZOV A;  4ICY A;  4GCM A;  3CGD A;  1N4U A;  1SEZ A;  2BK5 A;  5EB5 A;  3CPJ G;  1F6M A;  3P4P A;  4TM0 A;  1K4Q A;  1CC6 A;  3AYJ A;  3FIM B;  3L8K A;  3DJG X;  1Q1R A;  2QA1 A;  3SFE A;  4YSZ A;  1KSU A;  3BNM A;  3ICR A;  1FL2 A;  2VQ7 A;  4OPI A;  1H7W A;  4H4Z A;  5IPY A;  4WX1 A;  4YKF A;  3AWI A;  4X9M A;  3AYI A;  1S2Q A;  4YWO A;  1NAA A;  3UP5 A;  3CN8 A;  3S61 A;  4K5R A;  3UKL A;  3AE7 A;  4B66 A;  3UOV A;  4K5S A;  4Z25 A;  2BRY A;  3AE8 A;  2YVF A;  4H2R A;  4K2X A;  4OPU A;  2XDO A;  3CMM A;  4B64 A;  2XFN A;  3IHM A;  1ZP0 A;  3EAO A;  1NEK A;  3KVE A;  3GRT A;  4B1B A;  3D1C A;  3LJP A;  1UKV G;  2V5Z A;  4J33 A;  1PXA A;  5TR3 A;  1L9C A;  4D04 A;  1AOG A;  3NYE A;  2R45 A;  3M0O A;  3C4A A;  3EPT A;  5U1O A;  5CQF A;  3T2K A;  1Y56 B;  4Y4N A;  3R9U A;  3KD9 A;  4JY3 A;  3URH A;  1H6V A;  2XVI A;  3OC4 A;  2X3N A;  3EF6 A;  1RYI A;  3GWD A;  4C5O A;  4GAV A;  3RHA A;  1YKJ A;  5BUK A;  2FJB A;  3ABV A;  3UKA A;  2VVL A;  3DA1 A;  1FEB A;  2GAG B;  1N4V A;  1IUU A;  5KNL A;  2HQM A;  2ARD A;  2YLR A;  1CJ4 A;  4II2 A;  1RSG A;  2V3A A;  5J7X A;  1CC2 A;  4DSH A;  1FCD A;  4O5Q A;  2GH5 A;  3DGZ A;  3CPH G;  4H4X A;  2R9Z A;  2X8C A;  3Q6J A;  1O95 A;  1KNR A;  4WCT A;  2BXS A;  4K7Z A;  2R0G A;  1LQU A;  4A9W A;  4AOX A;  4YXD A;  4FDC B;  4XWR A;  2CVJ A;  1XDI A;  2WOV A;  1K0L A;  1GRG A;  2YR4 A;  4DSG A;  3AXB A;  1TDO A;  3ATQ A;  4IV9 A;  2OLO A;  3ICT A;  3SZF A;  1GV4 A;  4II3 A;  4YT0 A;  1FEA A;  2WDQ A;  3VRA A;  1CHU A;  4EQS A;  4U8O A;  4H4P A;  3AE3 A;  3ZDN A;  4IA6 A;  3ADA B;  3NN6 X;  2WPE A;  3IHG A;  1GAL A;  3BNU A;  5EBK A;  2X8G A;  3T2Y A;  2H89 A;  2C72 A;  3NYC A;  1OJT A;  4HA6 A;  1ZX9 A;  3KPK A;  4EMI A;  1QLB A;  1CJ3 A;  3UKF A;  2WDV A;  2V6O A;  2Q0K A;  1E39 A;  5FS7 A;  3NTA A;  1GRA A;  4GAP A;  1NDA A;  2WU2 A;  3ALL A;  1H7X A;  1LQT A;  3NKS A;  3CPI G;  3P9U A;  3HZL A;  2WOI A;  3I6D A;  2WET A;  5BRT A;  3I3L A;  4G73 A;  4CCR A;  3UKK A;  2GR1 A;  1E1K A;  3SFD A;  5HYM A;  2JB2 A;  4Y4L A;  4IVO B;  1P2H A;  3ATR A;  4UP3 A;  1B37 A;  3G5R A;  5KOW A;  3DK4 A;  1PS9 A;  2GAH B;  4H4U A;  1CJ2 A;  3NLC A;  4H2N A;  5HY5 A;  1B4V A;  4USQ A;  5L46 A;  1Y56 A;  2A89 A;  3CNS A;  4JQ9 A;  3PO7 A;  3AEB A;  3SY4 A;  2C64 A;  2XCG A;  5CKU A;  2WP9 A;  4GR1 A;  4I59 A;  1NHS A;  5C2T A;  2WES A;  3LB8 A;  1VG0 A;  3CND A;  3RP7 A;  5BUL A;  1E1M A;  1D7L A;  2WQY A;  1GTH A;  4B63 A;  4OCG A;  5IQ4 A;  2TMD A;  4KPR A;  1EL9 A;  3DH9 A;  1XAN A;  3WE0 A;  1PBF A;  5FS9 A;  1YY5 A;  1ZOY A;  2JB3 A;  2I0Z A;  1HYU A;  2GR0 A;  1JNZ A;  1PDH A;  2OA1 A;  3B3R A;  3F8R A;  3NK2 X;  2NVK X;  3AE9 A;  1TYT A;  1EL8 A;  2BK4 A;  2W0H A;  2YLX A;  3QSM A;  1V59 A;  1ZK7 A;  4UDQ A;  3V3O A;  4ADW A;  3E1T A;  3FG2 P;  4NZH A;  2TPR A;  1CJC A;  2A8X A;  1BKW A;  3KLJ A;  1COY A;  4NTC A;  2BS3 A;  2BC1 A;  3BI4 A;  4C74 A;  3AEC A;  2UZZ A;  4O5U A;  5HXI A;  2V60 A;  3SYI A;  5FS6 A;  4ZCC A;  1ELI A;  4Z2T A;  2GMJ A;  1FOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...