5U63A

Crystal structure of putative thioredoxin reductase from haemophilus influenzae
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
315
structure length
315
Chain Sequence
DIKHAKLLILGSGPAGYTAAIYAARANLKPVLVTGLQQGGQLTTTDEIENWPGDFEMTTGSGLMQRMLQHAEKFETEIVFDHINRVDLSSRPFKLFGDVQNFTCDALIIATGASARYIGLPSEENYKGRGVSACATCDGFFYRNKPVGVIGGGNTAVEEALYLANIASTVHLIHRRDSFRAEKILIDRLYKKVEEGKIVLHTDRTLDEVLGDNMGVTGLRLANTKTGEKEELKLDGLFVAIGHSPNTEIFQGQLELNNGYIVVKSGLDGNATATSVEGVFAAGDVMDHNYRQAITSAGTGCMAALDAERYLDAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative thioredoxin reductase from Haemophilus influenzae
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Lyase
molecule keywords Thioredoxin reductase
total genus 99
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2016-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u63A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5u63A02
3NN6X 2JBVA 1CC2A 3C96A 3GDPA 1PBEA 4N9XA 1DNCA 4CBQA 2OLOA 1N4VA 1KNRA 2E1MA 1H82A 1OJAA 2OLNA 3ZYXA 2GF3A 3AEGA 3CNSA 5KXJA 1CJCA 3P1WA 1NDAA 4E0VA 2XYOA 3FPZA 3GMBA 4DSGA 3P4PA 3GDNA 4LA1A 3QVPA 2I0ZA 4TM0A 3CTYA 3NK2X 3DK4A 3UKHA 3VRAA 3NYCA 4H2PA 1E1NA 1JRXA 4EQXA 1VG0A 1GRHA 4EMJA 5KOXA 3UP5A 4H4TA 4EIPA 3DJGX 3GSIA 5ER0A 3AE9A 3ICSA 2V3AA 3ALMA 3NGCX 1L9CA 1DJNA 4A5LA 1AOGA 1DOEA 3AWIA 1QO8A 1XHCA 4GR1A 3H8LA 1SEZA 1N4UA 5FS9A 4YKFA 4Z24A 5JCMA 1BWCA 4J2WA 1GRAA 1OJCA 4BJZA 1ZK7A 2WU2A 3UTFA 3F8DA 2Q6UA 3CNDA 4IV9A 1GXFA 2VVLG 1ZOVA 2GMJA 2X99A 1JU2A 2X8HA 5KWFA 1MXTA 3R9UA 2C70A 1N1PA 3KU9A 1GALA 1Z6LA 2C7GA 4Z2RA 3NN0X 4H4UA 4K5RA 2QA1A 4OPCA 4YKGA 2B7SA 2APGA 2YWLA 2Q7VA 4Y4NA 2IVDA 3D1CA 1GRBA 3BNUA 1Q1WA 4Z26A 1B37A 2VQ7A 4ADWA 4EMWA 1L9DA 3G5SA 5GRTA 2V5ZA 4J33A 4B69A 3P4SA 2YVJA 2Z5YA 3QJ4A 4U8MA 1QLBA 5FS7A 4EM4A 1ONFA 3AEEA 1H86A 2YVFA 4BK2A 3GYJA 1E7PA 3AEFA 3WE0A 1DODA 4HA6A 4Z43A 4LU6A 1CJ2A 3DJJA 4D03A 1ZMDA 3ICTA 4Z44A 1VDCA 2B9WA 1D4DA 3RNMA 1F8SA 2GR1A 3DMEA 4NZHA 5U25A 3UTGA 2C73A 2EQ7A 2VVMA 3NG7X 4IA6A 2YR5A 1ZKQA 2X50A 5KRQA 1QJDA 1ZOYA 4NEVA 2J3NA 3QSSA 2C65A 3SGLA 2JK6A 3H4KA 1GREA 2EQ9A 2VOUA 4B67A 1MO9A 4IVMB 4EQSA 1PS9A 4REKA 4BJYA 2C3DA 4ECHA 1H84A 4YTMA 2RGJA 1NEKA 3S5WA 3SFDA 3UKPA 3PVCA 1GT8A 4DNAA 4K2XA 1KFYA 4OPIA 3K7TA 4CY8A 2R0GA 3IF9A 3NK1X 4B1BA 4CNKA 3G5QA 1RP0A 2Y6RA 2YG6A 1K0IA 3FG2P 3ICRA 2R0PA 2VQBA 1GTHA 5J7XA 3AECA 2NVKX 2YR4A 1FEBA 1PXBA 4JN9A 4JDRA 4GDPA 4U8PA 1YQ3A 2WP9A 1VRQB 1FOHA 2YG3A 3M13A 4RG3A 4YSYA 3FIMB 1PN0A 1EL8A 3QFBA 2BC1A 3IWAA 2YVGA 1D4CA 2BS4A 4K7ZA 4YSXA 1XANA 4OPDA 3B3RA 4K22A 3NRNA 4OPGA 1Q9IA 3CGCA 3UOVA 4DSHA 2FBWA 3LZWA 2ARDA 4A79A 2WQYA 1E1LA 5IQ1A 3DJDA 1NENA 3NTDA 1L9EA 3LOVA 2WESA 2WP6A 1KF6A 4A99A 4B66A 4IA5A 3DH9A 3L1RA 1YQ4A 1PBBA 1IUTA 2GB0A 2WPEA 3ITJA 3LADA 4GF7A 4X4JA 3P4RA 1EL7A 1GV4A 2GR0A 2WHDA 3BI5A 4GCMA 4UDRA 4B63A 2AR8A 1GRFA 1UKVG 3EPTA 3FBSA 1P2EA 2YM1A 3V3OA 1D7YA 4XWRA 3EF6A 3SFEA 4YTNA 4EIQA 1CC4A 1PBCA 1PJ6A 3HZLA 1LV0A 2YAUA 5HXIA 1LQUA 1E1MA 3UOXA 3REDA 2RGOA 3DA1A 3OZ2A 4P9SA 3V76A 3LXDA 1BZLA 3GRSA 1PBDA 2QA2A 3AE5A 4A9WA 3LB8A 2VRMA 5FMHA 2GVCA 2DKIA 2CULA 4BURA 2R9ZA 2YM2A 3GD3A 2XFPA 3UTEA 4RG4A 1RSGA 4C5OA 3DK8A 1E1KA 3NYFA 5EB5A 4DGKA 5IQ4A 5KOWA 4H4YA 2QAEA 3FMWA 5TR3A 3IHMA 2PYXA 3AE2A 1F8WA 5GSNA 1IUXA 3KA7A 3V3NA 1IUWA 2YLZA 3AE7A 3GD4A 1H81A 3JSKA 1H7WA 1GSNA 2C67A 4FK1C 2C76A 3CPIG 2RGHA 4AP1A 4A65A 1Y56B 4BK1A 2XLRA 4JY2A 3UKQA 5BRTA 1CBOA 4H4VA 4I59A 1BF3A 4PABA 1S3EA 3M0OA 1COYA 4J36A 3IC9A 1H7XA 1YKJA 1GRTA 2GAGB 2OAMA 1TRBA 2XVHA 4M52A 3UOYA 1CL0A 4J34A 1D7LA 1IUVA 5BUKA 1TYTA 4WCTA 2X8CA 4XWZA 2C75A 5J60A 1LTXR 3CNJA 4FX9A 4OPUA 2XFOA 2XVJA 3I3LA 5JCLA 1PXCA 2XDOA 3F8RA 3ADAB 1NHPA 1L0VA 4FDCB 3KLJA 4H7UA 2YG7A 1JEHA 4YT0A 2NPXA 1NG4A 4NTCA 2WP5A 4U8LA 3K7MX 1FCDA 1NAAA 2XFNA 3DK9A 3RP6A 1D4EA 2BCPA 1GETA 5FS8A 1F6MA 4C3XA 5JCIA 2BXRA 4JNQA 1O95A 2GMHA 1TDEA 4ZCDA 5EOWA 1XPQA 1DJQA 5U63A 3QSMA 2BCGG 2H88A 2GAHB 3AYLA 1IUSA 2E4GA 4EMIA 2FJAA 4Z2TA 1GEUA 2V3BA 3VRDB 1REOA 1NHSA 3F8PA 1YY5A 3C4NA 4O5UA 5FS6A 2JKCA 2GV8A 1ZMCA 3GRTA 3I6DA 3AE8A 4KPRA 1ZP0A 1V59A 4TLZA 5JCKA 2JB3A 2V60A 3D8XA 1LQTA 2WPFA 1YQZA 2A89A 4TM1A 5DBJA 1ZX9A 3AD7B 4ZCCA 4NEWA 3RP7A 2BS2A 5L46A 4C3YA 1VQWA 3DGZA 4IVOB 1KDGA 2CDUA 4AP3A 4B65A 5M0ZA 1BKWA 3AEDA 2FJBA 3H8IA 3NIXA 1GPEA 4Z25A 3OC4A 3UKFA 4EM3A 3COXA 2XLUA 4AT0A 4YXDA 1GOSA 4O5QA 3ZDNA 3DJEA 2JB1A 2C72A 2WEUA 3NH3X 2BYBA 4H4RA 2YLRA 4TLXA 3LZXA 3UP4A 4YSHA 3BNMA 4C77A 1KNPA 2W0HA 4WX1A 2R45A 2CFYA 3P4QA 3GWDA 1TYPA 1PJ5A 4A6NB 1S3BA 3UCLA 2WDRA 1OJDA 2C66A 1HYUA 3LJPA 3QSEA 2YG4A 3CNPA 3CN8A 1GERA 1LPFA 3IHGA 1K0JA 4USQA 3KD9A 1KSSA 2WDVA 2F5ZA 2FJEA 2B76A 3NNEA 2B9XA 4TM3A 4A6NA 4X9NA 1TDOA 3BHFA 2XVEA 1BGJA 1CC6A 4H2QA 3ATRA 1E39A 1E6EA 4I58A 1OJ9A 2WOWA 3PO7A 5EBKA 3M12A 3UKLA 4Z2UA 2XLTA 5HHFA 2B9YA 2Q0LA 4XXGA 3AXBA 1KSUA 4U8IA 1FECA 4BV6A 3AE3A 2C3CA 3ATQA 2YLTA 2ZZBA 3AE1A 3CPHG 4A7AA 2VVLA 2WOVA 5U1OA 4B68A 1JRYA 3BI4A 1PXAA 2OALA 4J56A 3AE4A 1DOBA 1FEAA 4H2RA 2GR3A 1JRZA 3NKSA 3B6DA 1B8SA 2YG5A 3GYIA 2DKHA 3UOZA 4TM4A 3AEBA 3RP8A 2TPRA 4NTDA 1D5TA 3Q6JA 2WPCA 4JY3A 5BVAA 4APNA 5HY5A 2BK3A 2AAQA 2GRTA 2R0CA 3UKKA 5EB4A 2WDQA 3AYJA 3DGHA 3RHAA 1TDFA 1LVLA 2OA1A 3NK0X 2VRLA 4AOSA 1ELIA 4H4WA 1O94A 4BK3A 1VG9A 4JQ9A 1Q1RA 1JNRA 2UZZA 3KVEA 4K5SA 4ZN0A 4GUVA 2YLSA 2XCGA 4RSLA 1EL5A 1XDIA 2Q0KA 1O5WA 3CGEA 5KVIA 3VQRA 3P9UA 4C74A 2C64A 3NYEA 3KKJA 5C2TA 1Y0PA 3URHA 3K7QX 4YWOA 2WS3A 1CJ3A 3EANA 3QVRA 3NTAA 3G5RA 4U8OA 4YSZA 3AEAA 2EQ6A 2TMDA 1K4QA 4FK1A 5HYMA 2BS3A 2V6OA 1ZY8A 4K8DA 4X9MA 1FL2A 3NT6A 2EQ8A 2YLXA 5C3JA 3C4AA 1JNZA 3EAOA 3BI2A 1CHUA 2GH5A 1B4VA 2IIDA 2XLSA 1F3PA 4AT2A 1F8RA 1Y56A 4H2NA 4H4QA 1CJ4A 1W4XA 1GRGA 2Y6QA 4KX6A 4OCGA 1GNDA 4LIIA 1EBDA 1PJ7A 4UDPA 2GR2A 1S2QA 4U2TA 3SQPA 2GQWA 2BC0A 2IVEA 4NTEA 3E1TA 3CNTA 4YTPA 2YQUA 2ZZ0A 1EL9A 4H4XA 3SM8A 4D04A 4EQRA 4GDEA 1DOCA 3BHKA 3S61A 3Q9TA 4U2SA 4CNJA 4OPLA 1P2HA 2JAEA 3ALJA 2CVJA 4CRTA 1PDHA 2WOIA 2Z5XA 5BULA 1M64A 1JOAA 4HB9A 5CQFA 2B7RA 4B64A 1K0LA 1DXLA 1S2YA 2H89A 3L8KA 4UP3A 2XLPA 1GESA 3VRBA 4U2LA 2X8GA 5LV9A 2A8XA 2XVIA 4MJWA 3AB1A 3ISHA 2BK5A 2V61A 3VR8A 5JCNA 4CY6A 3UTHA 3QFAA 2BABA 1GTEA 1H6VA 3ALLA 4Y4LA 3II4A 2HQMA 3AD8B 1NPXA 3AD9B 1TDNA 5KVHA 4ICYA 1PBFA 3UKAA 1BGNA 4Y4MA 5M10A 2WETA 2WBAA 1IJHA 3CGDA 4H4PA 1TDKA 5CKUA 4J31A 2FJDA 1MOKA 1NHQA 3ABVA 1LJ1A 1RYIA 2XFQA 4GRTA 1B5QA 1OJTA 2YLWA 1PHHA 3CPJG 2YR6A 2ACZA 4CCQA 4USRA 3NHOX 3AYIA 3O0HA 2BK4A 4U8KA 4U8NA 2A87A 1H83A 1M6IA 2GEWA 3PS9A 2BACA 1ZDLA 4PAAA 2AQJA 2QCUA 2O9ZA 3AE6A 1X31B 2R46A 2R4EA 1CF3A 2R4JA 2PHHA 2BA9A 2E5VA 4U8JA 1IUUA 3GMCA 3GWFA 2X3NA 2XVFA 1NHRA 4AOXA 2XFUA 2GQFA 2VZ2A 4J57A 5IPYA 4UDQA 4JNAA 2ZZCA 4OVIA 2ZBWA 3VR9A 2BXSA 3NLCA 4EQWA 3K30A 2WU5A 1NG3A 4OPTA 3CGBA 4CCRA 2RABA 4H4ZA 3T37A 3KPFA 4H50A 4H4SA 3CIRA 1N4WA 2JB2A
chains in the Genus database with same CATH superfamily
3NN6X 2JBVA 1CC2A 3C96A 3GDPA 1PBEA 4N9XA 1DNCA 4CBQA 2OLOA 1N4VA 1KNRA 2E1MA 4II3A 1H82A 1OJAA 2OLNA 3ZYXA 2GF3A 3AEGA 3CNSA 5KNLA 5KXJA 1CJCA 3P1WA 1NDAA 4E0VA 2XYOA 3FPZA 3GMBA 4DSGA 3P4PA 3GDNA 4LA1A 3QVPA 2I0ZA 4TM0A 3CTYA 3NK2X 3DK4A 3UKHA 3VRAA 3NYCA 4H2PA 1E1NA 1JRXA 4EQXA 1VG0A 1GRHA 4EMJA 5KOXA 3UP5A 4H4TA 4EIPA 3DJGX 3GSIA 5ER0A 3AE9A 3ICSA 2V3AA 3ALMA 3NGCX 1L9CA 1DJNA 4A5LA 1AOGA 1DOEA 3AWIA 1QO8A 1XHCA 4GR1A 3H8LA 1SEZA 1N4UA 5FS9A 4YKFA 4Z24A 5JCMA 1BWCA 4J2WA 1GRAA 1OJCA 4BJZA 1ZK7A 2WU2A 3UTFA 3F8DA 2Q6UA 3CNDA 4IV9A 1GXFA 2VVLG 1ZOVA 2GMJA 2X99A 1JU2A 2X8HA 5KWFA 3SYIA 1MXTA 3R9UA 2C70A 1N1PA 3KU9A 1GALA 1Z6LA 2C7GA 4Z2RA 3NN0X 4H4UA 4K5RA 2QA1A 4OPCA 4YKGA 2B7SA 2APGA 2YWLA 2Q7VA 4Y4NA 2IVDA 3D1CA 1GRBA 3BNUA 1Q1WA 5KMQA 4Z26A 1B37A 2VQ7A 4ADWA 4EMWA 1L9DA 3G5SA 5GRTA 2V5ZA 4J33A 4B69A 3P4SA 2YVJA 3SZCA 2Z5YA 3QJ4A 4U8MA 1QLBA 5FS7A 4EM4A 1ONFA 3AEEA 1H86A 2YVFA 4BK2A 3GYJA 1E7PA 3AEFA 3WE0A 1DODA 4HA6A 4Z43A 4LU6A 1CJ2A 5KMSA 3DJJA 4D03A 1ZMDA 3ICTA 4Z44A 1VDCA 2B9WA 1D4DA 3RNMA 1F8SA 2GR1A 3DMEA 4NZHA 5U25A 3UTGA 2C73A 2EQ7A 2VVMA 3NG7X 4IA6A 2YR5A 3KPKA 1ZKQA 2X50A 5KRQA 1QJDA 1ZOYA 4NEVA 2J3NA 3QSSA 2C65A 3SGLA 2JK6A 3H4KA 1GREA 2EQ9A 2VOUA 4B67A 1MO9A 4G74A 4IVMB 4EQSA 1PS9A 4REKA 4BJYA 2C3DA 4ECHA 1H84A 4YTMA 2RGJA 1NEKA 3S5WA 3SFDA 3UKPA 3PVCA 1GT8A 4DNAA 4K2XA 1KFYA 4OPIA 3K7TA 4CY8A 2R0GA 3IF9A 3NK1X 4B1BA 4CNKA 3G5QA 1RP0A 2Y6RA 2YG6A 1K0IA 3FG2P 3ICRA 2R0PA 2VQBA 1GTHA 5J7XA 3AECA 2NVKX 2YR4A 1FEBA 1PXBA 4JN9A 4JDRA 4GDPA 4U8PA 3T31A 1YQ3A 2WP9A 1VRQB 1FOHA 2YG3A 3M13A 4RG3A 4YSYA 3FIMB 1PN0A 1EL8A 3QFBA 2BC1A 3IWAA 2YVGA 1D4CA 2BS4A 4K7ZA 4YSXA 1XANA 4OPDA 3B3RA 4K22A 3NRNA 4OPGA 1Q9IA 3CGCA 3UOVA 4DSHA 2FBWA 3LZWA 2ARDA 3SZWA 2WQYA 1E1LA 5IQ1A 4A79A 3DJDA 1NENA 3NTDA 1L9EA 3LOVA 2WESA 2WP6A 1KF6A 4A99A 4B66A 4IA5A 3DH9A 3L1RA 1YQ4A 1PBBA 1IUTA 2GB0A 2WPEA 3ITJA 3LADA 4GF7A 4X4JA 3P4RA 1EL7A 1GV4A 2BRYA 2GR0A 2WHDA 3BI5A 4GCMA 4UDRA 4B63A 2AR8A 1GRFA 1UKVG 3EPTA 3FBSA 1P2EA 2YM1A 3V3OA 1D7YA 4XWRA 3EF6A 3SFEA 4YTNA 4EIQA 1CC4A 1PBCA 1PJ6A 3HZLA 1LV0A 2YAUA 5HXIA 1LQUA 1E1MA 3UOXA 3REDA 2RGOA 3DA1A 3OZ2A 4P9SA 3V76A 3LXDA 1BZLA 3GRSA 1PBDA 2QA2A 3AE5A 4A9WA 3LB8A 2VRMA 4G6GA 5FMHA 2GVCA 2DKIA 2CULA 4BURA 2R9ZA 2YM2A 3GD3A 2XFPA 3UTEA 4RG4A 1RSGA 4C5OA 3DK8A 1E1KA 3NYFA 5EB5A 3SX6A 4DGKA 5IQ4A 5KOWA 4H4YA 2QAEA 3FMWA 5TR3A 3IHMA 2PYXA 3AE2A 1F8WA 5GSNA 1IUXA 3KA7A 3V3NA 1IUWA 2YLZA 3AE7A 3GD4A 1H81A 3JSKA 1H7WA 1GSNA 2C67A 4FK1C 2C76A 3CPIG 2RGHA 4AP1A 4A65A 1Y56B 4BK1A 3T2ZA 4G9KA 2XLRA 4JY2A 3T2YA 3UKQA 5BRTA 1CBOA 4H4VA 4I59A 1BF3A 4PABA 1S3EA 3M0OA 1COYA 4J36A 3IC9A 1H7XA 1YKJA 1GRTA 2GAGB 2OAMA 1TRBA 2XVHA 4M52A 3UOYA 1CL0A 4J34A 1D7LA 1IUVA 5BUKA 1TYTA 4WCTA 2X8CA 4XWZA 2C75A 5J60A 2BRAA 1LTXR 3CNJA 4FX9A 4OPUA 2XFOA 2XVJA 3I3LA 5JCLA 1PXCA 5KMPA 2XDOA 3F8RA 3ADAB 1NHPA 1L0VA 4FDCB 3KLJA 4H7UA 2YG7A 1JEHA 4YT0A 2NPXA 1NG4A 4NTCA 2WP5A 4U8LA 3K7MX 1FCDA 1NAAA 2XFNA 3DK9A 3RP6A 1D4EA 2BCPA 1GETA 5FS8A 1F6MA 4C3XA 5JCIA 2BXRA 4JNQA 1O95A 2GMHA 5KMRA 1TDEA 4ZCDA 5EOWA 1XPQA 1DJQA 5U63A 3QSMA 2BCGG 2H88A 2GAHB 3AYLA 1IUSA 2E4GA 4EMIA 2FJAA 4Z2TA 1GEUA 2V3BA 3VRDB 2C4CA 1REOA 1NHSA 3F8PA 1YY5A 3C4NA 4O5UA 5FS6A 2JKCA 2GV8A 1ZMCA 3GRTA 3I6DA 3AE8A 4KPRA 1ZP0A 1V59A 4TLZA 5JCKA 2JB3A 2V60A 3D8XA 1LQTA 2WPFA 1YQZA 2A89A 4TM1A 5DBJA 1ZX9A 3AD7B 4ZCCA 4NEWA 3RP7A 2BS2A 5L46A 4C3YA 1VQWA 3DGZA 4IVOB 1KDGA 2CDUA 4AP3A 4B65A 5M0ZA 1BKWA 3AEDA 2FJBA 3H8IA 3NIXA 1GPEA 4Z25A 3OC4A 3UKFA 4EM3A 3COXA 2XLUA 4AT0A 4YXDA 1GOSA 4O5QA 4II2A 3DJEA 3ZDNA 2JB1A 2C72A 2WEUA 3NH3X 2BYBA 4H4RA 2YLRA 4TLXA 3LZXA 3T0KA 3UP4A 4YSHA 3BNMA 4C77A 1KNPA 2W0HA 4WX1A 2R45A 2CFYA 3P4QA 3GWDA 1TYPA 1PJ5A 4A6NB 1S3BA 3UCLA 2WDRA 1OJDA 3SY4A 2C66A 1HYUA 3LJPA 3HYWA 2YG4A 3QSEA 3CNPA 3CN8A 1GERA 1LPFA 3IHGA 1K0JA 4USQA 3KD9A 1KSSA 2WDVA 2F5ZA 2FJEA 2B76A 3NNEA 2B9XA 4TM3A 4A6NA 4X9NA 1TDOA 3BHFA 2XVEA 1BGJA 1CC6A 4H2QA 3ATRA 1E39A 1E6EA 4I58A 1OJ9A 2WOWA 3PO7A 5EBKA 3M12A 3UKLA 4Z2UA 2XLTA 5HHFA 2B9YA 2Q0LA 4XXGA 3AXBA 1KSUA 4U8IA 1FECA 4BV6A 3T14A 3AE3A 2C3CA 3ATQA 2YLTA 2ZZBA 3AE1A 3CPHG 4A7AA 2VVLA 2WOVA 5U1OA 4B68A 1JRYA 3BI4A 1PXAA 3SZ0A 2OALA 4J56A 3AE4A 1DOBA 1FEAA 4H2RA 2GR3A 1JRZA 3NKSA 3B6DA 1B8SA 2YG5A 3GYIA 2DKHA 3UOZA 4TM4A 3AEBA 3RP8A 2TPRA 4NTDA 1D5TA 3Q6JA 2WPCA 4JY3A 5BVAA 4APNA 5HY5A 2BK3A 2AAQA 2GRTA 2R0CA 3UKKA 5EB4A 2WDQA 3AYJA 3DGHA 3RHAA 1TDFA 1LVLA 2OA1A 3NK0X 2VRLA 4AOSA 1ELIA 4H4WA 1O94A 4BK3A 1VG9A 4JQ9A 1Q1RA 1JNRA 2UZZA 3KVEA 4K5SA 4NWZA 4ZN0A 4GUVA 2YLSA 2XCGA 4NNJA 4RSLA 1EL5A 1XDIA 2Q0KA 1O5WA 3CGEA 5KVIA 3VQRA 3P9UA 4C74A 2C64A 4G6HA 3NYEA 3KKJA 5C2TA 1Y0PA 3HYVA 3K7QX 4YWOA 3URHA 2WS3A 1CJ3A 3EANA 3GYXA 3QVRA 3NTAA 3G5RA 3HYXA 4U8OA 4YSZA 3AEAA 2EQ6A 2TMDA 1K4QA 4FK1A 5HYMA 2BS3A 2V6OA 1ZY8A 4K8DA 4X9MA 1FL2A 3NT6A 2EQ8A 2YLXA 5C3JA 3C4AA 1JNZA 3EAOA 3BI2A 1CHUA 2GH5A 1B4VA 2IIDA 2XLSA 1F3PA 4AT2A 1F8RA 4G73A 1Y56A 4H2NA 4H4QA 1CJ4A 1W4XA 1GRGA 2Y6QA 4KX6A 4OCGA 1GNDA 4LIIA 1EBDA 1PJ7A 4UDPA 2GR2A 1S2QA 4U2TA 3SQPA 2GQWA 2BC0A 2IVEA 4NTEA 3E1TA 3CNTA 4YTPA 2YQUA 2ZZ0A 1EL9A 4H4XA 3SM8A 4D04A 4EQRA 4GDEA 1DOCA 3BHKA 3S61A 3Q9TA 4U2SA 4CNJA 4OPLA 1P2HA 2JAEA 3ALJA 2CVJA 4CRTA 1PDHA 2WOIA 2Z5XA 5BULA 1M64A 1JOAA 4HB9A 5CQFA 2B7RA 4B64A 1K0LA 1DXLA 1S2YA 2H89A 3L8KA 4UP3A 2XLPA 1GESA 3VRBA 4U2LA 2X8GA 5LV9A 2A8XA 2XVIA 4MJWA 3AB1A 3ISHA 2BK5A 2V61A 3VR8A 5JCNA 4CY6A 3UTHA 3QFAA 2BABA 1GTEA 1H6VA 3ALLA 4Y4LA 3II4A 2HQMA 3AD8B 1NPXA 3AD9B 1TDNA 5KVHA 4ICYA 1PBFA 3UKAA 1BGNA 4Y4MA 5M10A 2WETA 2WBAA 1IJHA 3CGDA 4H4PA 1TDKA 5CKUA 4J31A 2FJDA 1MOKA 1NHQA 3ABVA 1LJ1A 1RYIA 2XFQA 4GRTA 1B5QA 1OJTA 2YLWA 1PHHA 3CPJG 2YR6A 2ACZA 4CCQA 4USRA 3NHOX 3AYIA 3O0HA 2BK4A 4U8KA 4U8NA 2A87A 1H83A 1M6IA 2GEWA 3PS9A 4GAVA 2BACA 3T2KA 1ZDLA 4PAAA 2AQJA 2QCUA 2O9ZA 3AE6A 1X31B 2R46A 2R4EA 1CF3A 2R4JA 2PHHA 2BA9A 2E5VA 4U8JA 1IUUA 3GMCA 3GWFA 2X3NA 2XVFA 1NHRA 4AOXA 2XFUA 2GQFA 2VZ2A 4J57A 5IPYA 4UDQA 4JNAA 2ZZCA 4OVIA 2ZBWA 3VR9A 2BXSA 3NLCA 4EQWA 3CMMA 2WU5A 1NG3A 3K30A 4GAPA 4OPTA 3SXIA 3SZFA 3CGBA 4CCRA 2RABA 4H4ZA 3T37A 3KPFA 4H50A 4H4SA 3CIRA 1N4WA 2JB2A
chains in the Genus database with same CATH topology
3NN6X 2JBVA 1CC2A 3C96A 3GDPA 1PBEA 4N9XA 1DNCA 4CBQA 2OLOA 1N4VA 1KNRA 2E1MA 4II3A 1H82A 1OJAA 2OLNA 3ZYXA 2GF3A 3AEGA 3CNSA 5KNLA 5KXJA 1CJCA 3P1WA 1NDAA 4E0VA 2XYOA 3FPZA 3GMBA 4DSGA 3P4PA 3GDNA 4LA1A 3QVPA 2I0ZA 4TM0A 3CTYA 3NK2X 3DK4A 3UKHA 3VRAA 3NYCA 4H2PA 1E1NA 1JRXA 4EQXA 1VG0A 1GRHA 4EMJA 5KOXA 3UP5A 4H4TA 4EIPA 3DJGX 3GSIA 5ER0A 3AE9A 3ICSA 2V3AA 3ALMA 3NGCX 1L9CA 1DJNA 4A5LA 1AOGA 1DOEA 3AWIA 1QO8A 1XHCA 4GR1A 3H8LA 1SEZA 1N4UA 5FS9A 4YKFA 4Z24A 5JCMA 1BWCA 4J2WA 1GRAA 1OJCA 4BJZA 1ZK7A 2WU2A 3UTFA 3F8DA 2Q6UA 3CNDA 4IV9A 1GXFA 2VVLG 1ZOVA 2GMJA 2X99A 1JU2A 2X8HA 5KWFA 3SYIA 1MXTA 3R9UA 2C70A 1N1PA 3KU9A 1GALA 1Z6LA 2C7GA 4Z2RA 3NN0X 4H4UA 4K5RA 2QA1A 4OPCA 4YKGA 2B7SA 2APGA 2YWLA 2Q7VA 4Y4NA 2IVDA 3D1CA 1GRBA 3BNUA 1Q1WA 5KMQA 4Z26A 1B37A 2VQ7A 4ADWA 4EMWA 1L9DA 3G5SA 5GRTA 2V5ZA 4J33A 4B69A 3P4SA 2YVJA 3SZCA 2Z5YA 3QJ4A 4U8MA 1QLBA 5FS7A 4EM4A 1ONFA 3AEEA 1H86A 2YVFA 4BK2A 3GYJA 1E7PA 3AEFA 3WE0A 1DODA 4HA6A 4Z43A 4LU6A 1CJ2A 5KMSA 3DJJA 4D03A 1ZMDA 3ICTA 4Z44A 1VDCA 2B9WA 1D4DA 3RNMA 1F8SA 2GR1A 3DMEA 4NZHA 5U25A 3UTGA 2C73A 2EQ7A 2VVMA 3NG7X 4IA6A 2YR5A 3KPKA 1ZKQA 2X50A 5KRQA 1QJDA 1ZOYA 4NEVA 2J3NA 3QSSA 2C65A 3SGLA 2JK6A 3H4KA 1GREA 2EQ9A 2VOUA 4B67A 1MO9A 4G74A 4IVMB 4EQSA 1PS9A 4REKA 4BJYA 2C3DA 4ECHA 1H84A 4YTMA 2RGJA 1NEKA 3S5WA 3SFDA 3UKPA 3PVCA 1GT8A 4DNAA 4K2XA 1KFYA 4OPIA 3K7TA 4CY8A 2R0GA 3IF9A 3NK1X 4B1BA 4CNKA 3G5QA 1RP0A 2Y6RA 2YG6A 1K0IA 3FG2P 3ICRA 2R0PA 2VQBA 1GTHA 5J7XA 3AECA 2NVKX 2YR4A 1FEBA 1PXBA 4JN9A 4JDRA 4GDPA 4U8PA 3T31A 1YQ3A 2WP9A 1VRQB 1FOHA 2YG3A 3M13A 4RG3A 4YSYA 3FIMB 1PN0A 1EL8A 3QFBA 2BC1A 3IWAA 2YVGA 1D4CA 2BS4A 4K7ZA 4YSXA 1XANA 4OPDA 3B3RA 4K22A 3NRNA 4OPGA 1Q9IA 3CGCA 3UOVA 4DSHA 2FBWA 3LZWA 2ARDA 3SZWA 2WQYA 1E1LA 5IQ1A 4A79A 3DJDA 1NENA 3NTDA 1L9EA 3LOVA 2WESA 2WP6A 1KF6A 4A99A 4B66A 4IA5A 3DH9A 3L1RA 1YQ4A 1PBBA 1IUTA 2GB0A 2WPEA 3ITJA 3LADA 4GF7A 4X4JA 3P4RA 1EL7A 1GV4A 2BRYA 2GR0A 2WHDA 3BI5A 4GCMA 4UDRA 4B63A 2AR8A 1GRFA 1UKVG 3EPTA 3FBSA 1P2EA 2YM1A 3V3OA 1D7YA 4XWRA 3EF6A 3SFEA 4YTNA 4EIQA 1CC4A 1PBCA 1PJ6A 3HZLA 1LV0A 2YAUA 5HXIA 1LQUA 1E1MA 3UOXA 3REDA 2RGOA 3DA1A 3OZ2A 4P9SA 3V76A 3LXDA 1BZLA 3GRSA 1PBDA 2QA2A 3AE5A 4A9WA 3LB8A 2VRMA 4G6GA 5FMHA 2GVCA 2DKIA 2CULA 4BURA 2R9ZA 2YM2A 3GD3A 2XFPA 3UTEA 4RG4A 1RSGA 4C5OA 3DK8A 1E1KA 3NYFA 5EB5A 3SX6A 4DGKA 5IQ4A 5KOWA 4H4YA 2QAEA 3FMWA 5TR3A 3IHMA 2PYXA 3AE2A 1F8WA 5GSNA 1IUXA 3KA7A 3V3NA 1IUWA 2YLZA 3AE7A 3GD4A 1H81A 3JSKA 1H7WA 1GSNA 2C67A 4FK1C 2C76A 3CPIG 2RGHA 4AP1A 4A65A 1Y56B 4BK1A 3T2ZA 4G9KA 2XLRA 4JY2A 3T2YA 3UKQA 5BRTA 1CBOA 4H4VA 4I59A 1BF3A 4PABA 1S3EA 3M0OA 1COYA 4J36A 3IC9A 1H7XA 1YKJA 1GRTA 2GAGB 2OAMA 1TRBA 2XVHA 4M52A 3UOYA 1CL0A 4J34A 1D7LA 1IUVA 5BUKA 1TYTA 4WCTA 2X8CA 4XWZA 2C75A 5J60A 2BRAA 1LTXR 3CNJA 4FX9A 4OPUA 2XFOA 2XVJA 3I3LA 5JCLA 1PXCA 5KMPA 2XDOA 3F8RA 3ADAB 1NHPA 1L0VA 4FDCB 3KLJA 4H7UA 2YG7A 1JEHA 4YT0A 2NPXA 1NG4A 4NTCA 2WP5A 4U8LA 3K7MX 1FCDA 1NAAA 2XFNA 3DK9A 3RP6A 1D4EA 2BCPA 1GETA 5FS8A 1F6MA 4C3XA 5JCIA 2BXRA 4JNQA 1O95A 2GMHA 5KMRA 1TDEA 4ZCDA 5EOWA 1XPQA 1DJQA 5U63A 3QSMA 2BCGG 2H88A 2GAHB 3AYLA 1IUSA 2E4GA 4EMIA 2FJAA 4Z2TA 1GEUA 2V3BA 3VRDB 2C4CA 1REOA 1NHSA 3F8PA 1YY5A 3C4NA 4O5UA 5FS6A 2JKCA 2GV8A 1ZMCA 3GRTA 3I6DA 3AE8A 4KPRA 1ZP0A 1V59A 4TLZA 5JCKA 2JB3A 2V60A 3D8XA 1LQTA 2WPFA 1YQZA 2A89A 4TM1A 5DBJA 1ZX9A 3AD7B 4ZCCA 4NEWA 3RP7A 2BS2A 5L46A 4C3YA 1VQWA 3DGZA 4IVOB 1KDGA 2CDUA 4AP3A 4B65A 5M0ZA 1BKWA 3AEDA 2FJBA 3H8IA 3NIXA 1GPEA 4Z25A 3OC4A 3UKFA 4EM3A 3COXA 2XLUA 4AT0A 4YXDA 1GOSA 4O5QA 4II2A 3DJEA 3ZDNA 2JB1A 2C72A 2WEUA 3NH3X 2BYBA 4H4RA 2YLRA 4TLXA 3LZXA 3T0KA 3UP4A 4YSHA 3BNMA 4C77A 1KNPA 2W0HA 4WX1A 2R45A 2CFYA 3P4QA 3GWDA 1TYPA 1PJ5A 4A6NB 1S3BA 3UCLA 2WDRA 1OJDA 3SY4A 2C66A 1HYUA 3LJPA 3HYWA 2YG4A 3QSEA 3CNPA 3CN8A 1GERA 1LPFA 3IHGA 1K0JA 4USQA 3KD9A 1KSSA 2WDVA 2F5ZA 2FJEA 2B76A 3NNEA 2B9XA 4TM3A 4A6NA 4X9NA 1TDOA 3BHFA 2XVEA 1BGJA 1CC6A 4H2QA 3ATRA 1E39A 1E6EA 4I58A 1OJ9A 2WOWA 3PO7A 5EBKA 3M12A 3UKLA 4Z2UA 2XLTA 5HHFA 2B9YA 2Q0LA 4XXGA 3AXBA 1KSUA 4U8IA 1FECA 4BV6A 3T14A 3AE3A 2C3CA 3ATQA 2YLTA 2ZZBA 3AE1A 3CPHG 4A7AA 2VVLA 2WOVA 5U1OA 4B68A 1JRYA 3BI4A 1PXAA 3SZ0A 2OALA 4J56A 3AE4A 1DOBA 1FEAA 4H2RA 2GR3A 1JRZA 3NKSA 3B6DA 1B8SA 2YG5A 3GYIA 2DKHA 3UOZA 4TM4A 3AEBA 3RP8A 2TPRA 4NTDA 1D5TA 3Q6JA 2WPCA 4JY3A 5BVAA 4APNA 5HY5A 2BK3A 2AAQA 2GRTA 2R0CA 3UKKA 5EB4A 2WDQA 3AYJA 3DGHA 3RHAA 1TDFA 1LVLA 2OA1A 3NK0X 2VRLA 4AOSA 1ELIA 4H4WA 1O94A 4BK3A 1VG9A 4JQ9A 1Q1RA 1JNRA 2UZZA 3KVEA 4K5SA 4NWZA 4ZN0A 4GUVA 2YLSA 2XCGA 4NNJA 4RSLA 1EL5A 1XDIA 2Q0KA 1O5WA 3CGEA 5KVIA 3VQRA 3P9UA 4C74A 2C64A 4G6HA 3NYEA 3KKJA 5C2TA 1Y0PA 3HYVA 3K7QX 4YWOA 3URHA 2WS3A 1CJ3A 3EANA 3GYXA 3QVRA 3NTAA 3G5RA 3HYXA 4U8OA 4YSZA 3AEAA 2EQ6A 2TMDA 1K4QA 4FK1A 5HYMA 2BS3A 2V6OA 1ZY8A 4K8DA 4X9MA 1FL2A 3NT6A 2EQ8A 2YLXA 5C3JA 3C4AA 1JNZA 3EAOA 3BI2A 1CHUA 2GH5A 1B4VA 2IIDA 2XLSA 1F3PA 4AT2A 1F8RA 4G73A 1Y56A 4H2NA 4H4QA 1CJ4A 1W4XA 1GRGA 2Y6QA 4KX6A 4OCGA 1GNDA 4LIIA 1EBDA 1PJ7A 4UDPA 2GR2A 1S2QA 4U2TA 3SQPA 2GQWA 2BC0A 2IVEA 4NTEA 3E1TA 3CNTA 4YTPA 2YQUA 2ZZ0A 1EL9A 4H4XA 3SM8A 4D04A 4EQRA 4GDEA 1DOCA 3BHKA 3S61A 3Q9TA 4U2SA 4CNJA 4OPLA 1P2HA 2JAEA 3ALJA 2CVJA 4CRTA 1PDHA 2WOIA 2Z5XA 5BULA 1M64A 1JOAA 4HB9A 5CQFA 2B7RA 4B64A 1K0LA 1DXLA 1S2YA 2H89A 3L8KA 4UP3A 2XLPA 1GESA 3VRBA 4U2LA 2X8GA 5LV9A 2A8XA 2XVIA 4MJWA 3AB1A 3ISHA 2BK5A 2V61A 3VR8A 5JCNA 4CY6A 3UTHA 3QFAA 2BABA 1GTEA 1H6VA 3ALLA 4Y4LA 3II4A 2HQMA 3AD8B 1NPXA 3AD9B 1TDNA 5KVHA 4ICYA 1PBFA 3UKAA 1BGNA 4Y4MA 5M10A 2WETA 2WBAA 1IJHA 3CGDA 4H4PA 1TDKA 5CKUA 4J31A 2FJDA 1MOKA 1NHQA 3ABVA 1LJ1A 1RYIA 2XFQA 4GRTA 1B5QA 1OJTA 2YLWA 1PHHA 3CPJG 2YR6A 2ACZA 4CCQA 4USRA 3NHOX 3AYIA 3O0HA 2BK4A 4U8KA 4U8NA 2A87A 1H83A 1M6IA 2GEWA 3PS9A 4GAVA 2BACA 3T2KA 1ZDLA 4PAAA 2AQJA 2QCUA 2O9ZA 3AE6A 1X31B 2R46A 2R4EA 1CF3A 2R4JA 2PHHA 2BA9A 2E5VA 4U8JA 1IUUA 3GMCA 3GWFA 2X3NA 2XVFA 1NHRA 4AOXA 2XFUA 2GQFA 2VZ2A 4J57A 5IPYA 4UDQA 4JNAA 2ZZCA 4OVIA 2ZBWA 3VR9A 2BXSA 3NLCA 4EQWA 3CMMA 2WU5A 1NG3A 3K30A 4GAPA 4OPTA 3SXIA 3SZFA 3CGBA 4CCRA 2RABA 4H4ZA 3T37A 3KPFA 4H50A 4H4SA 3CIRA 1N4WA 2JB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NN6 X;  2JBV A;  1CC2 A;  3C96 A;  3GDP A;  1PBE A;  4N9X A;  1DNC A;  4CBQ A;  2OLO A;  1N4V A;  1KNR A;  2E1M A;  1H82 A;  1OJA A;  2OLN A;  3ZYX A;  2GF3 A;  3AEG A;  3CNS A;  5KXJ A;  1CJC A;  3P1W A;  1NDA A;  4E0V A;  2XYO A;  3FPZ A;  3GMB A;  4DSG A;  3P4P A;  3GDN A;  4LA1 A;  3QVP A;  2I0Z A;  4TM0 A;  3CTY A;  3NK2 X;  3DK4 A;  3UKH A;  3VRA A;  3NYC A;  4H2P A;  1E1N A;  1JRX A;  4EQX A;  1VG0 A;  1GRH A;  4EMJ A;  5KOX A;  3UP5 A;  4H4T A;  4EIP A;  3DJG X;  3GSI A;  5ER0 A;  3AE9 A;  3ICS A;  2V3A A;  3ALM A;  3NGC X;  1L9C A;  1DJN A;  4A5L A;  1AOG A;  1DOE A;  3AWI A;  1QO8 A;  1XHC A;  4GR1 A;  3H8L A;  1SEZ A;  1N4U A;  5FS9 A;  4YKF A;  4Z24 A;  5JCM A;  1BWC A;  4J2W A;  1GRA A;  1OJC A;  4BJZ A;  1ZK7 A;  2WU2 A;  3UTF A;  3F8D A;  2Q6U A;  3CND A;  4IV9 A;  1GXF A;  2VVL G;  1ZOV A;  2GMJ A;  2X99 A;  1JU2 A;  2X8H A;  5KWF A;  1MXT A;  3R9U A;  2C70 A;  1N1P A;  3KU9 A;  1GAL A;  1Z6L A;  2C7G A;  4Z2R A;  3NN0 X;  4H4U A;  4K5R A;  2QA1 A;  4OPC A;  4YKG A;  2B7S A;  2APG A;  2YWL A;  2Q7V A;  4Y4N A;  2IVD A;  3D1C A;  1GRB A;  3BNU A;  1Q1W A;  4Z26 A;  1B37 A;  2VQ7 A;  4ADW A;  4EMW A;  1L9D A;  3G5S A;  5GRT A;  2V5Z A;  4J33 A;  4B69 A;  3P4S A;  2YVJ A;  2Z5Y A;  3QJ4 A;  4U8M A;  1QLB A;  5FS7 A;  4EM4 A;  1ONF A;  3AEE A;  1H86 A;  2YVF A;  4BK2 A;  3GYJ A;  1E7P A;  3AEF A;  3WE0 A;  1DOD A;  4HA6 A;  4Z43 A;  4LU6 A;  1CJ2 A;  3DJJ A;  4D03 A;  1ZMD A;  3ICT A;  4Z44 A;  1VDC A;  2B9W A;  1D4D A;  3RNM A;  1F8S A;  2GR1 A;  3DME A;  4NZH A;  5U25 A;  3UTG A;  2C73 A;  2EQ7 A;  2VVM A;  3NG7 X;  4IA6 A;  2YR5 A;  1ZKQ A;  2X50 A;  5KRQ A;  1QJD A;  1ZOY A;  4NEV A;  2J3N A;  3QSS A;  2C65 A;  3SGL A;  2JK6 A;  3H4K A;  1GRE A;  2EQ9 A;  2VOU A;  4B67 A;  1MO9 A;  4IVM B;  4EQS A;  1PS9 A;  4REK A;  4BJY A;  2C3D A;  4ECH A;  1H84 A;  4YTM A;  2RGJ A;  1NEK A;  3S5W A;  3SFD A;  3UKP A;  3PVC A;  1GT8 A;  4DNA A;  4K2X A;  1KFY A;  4OPI A;  3K7T A;  4CY8 A;  2R0G A;  3IF9 A;  3NK1 X;  4B1B A;  4CNK A;  3G5Q A;  1RP0 A;  2Y6R A;  2YG6 A;  1K0I A;  3FG2 P;  3ICR A;  2R0P A;  2VQB A;  1GTH A;  5J7X A;  3AEC A;  2NVK X;  2YR4 A;  1FEB A;  1PXB A;  4JN9 A;  4JDR A;  4GDP A;  4U8P A;  1YQ3 A;  2WP9 A;  1VRQ B;  1FOH A;  2YG3 A;  3M13 A;  4RG3 A;  4YSY A;  3FIM B;  1PN0 A;  1EL8 A;  3QFB A;  2BC1 A;  3IWA A;  2YVG A;  1D4C A;  2BS4 A;  4K7Z A;  4YSX A;  1XAN A;  4OPD A;  3B3R A;  4K22 A;  3NRN A;  4OPG A;  1Q9I A;  3CGC A;  3UOV A;  4DSH A;  2FBW A;  3LZW A;  2ARD A;  4A79 A;  2WQY A;  1E1L A;  5IQ1 A;  3DJD A;  1NEN A;  3NTD A;  1L9E A;  3LOV A;  2WES A;  2WP6 A;  1KF6 A;  4A99 A;  4B66 A;  4IA5 A;  3DH9 A;  3L1R A;  1YQ4 A;  1PBB A;  1IUT A;  2GB0 A;  2WPE A;  3ITJ A;  3LAD A;  4GF7 A;  4X4J A;  3P4R A;  1EL7 A;  1GV4 A;  2GR0 A;  2WHD A;  3BI5 A;  4GCM A;  4UDR A;  4B63 A;  2AR8 A;  1GRF A;  1UKV G;  3EPT A;  3FBS A;  1P2E A;  2YM1 A;  3V3O A;  1D7Y A;  4XWR A;  3EF6 A;  3SFE A;  4YTN A;  4EIQ A;  1CC4 A;  1PBC A;  1PJ6 A;  3HZL A;  1LV0 A;  2YAU A;  5HXI A;  1LQU A;  1E1M A;  3UOX A;  3RED A;  2RGO A;  3DA1 A;  3OZ2 A;  4P9S A;  3V76 A;  3LXD A;  1BZL A;  3GRS A;  1PBD A;  2QA2 A;  3AE5 A;  4A9W A;  3LB8 A;  2VRM A;  5FMH A;  2GVC A;  2DKI A;  2CUL A;  4BUR A;  2R9Z A;  2YM2 A;  3GD3 A;  2XFP A;  3UTE A;  4RG4 A;  1RSG A;  4C5O A;  3DK8 A;  1E1K A;  3NYF A;  5EB5 A;  4DGK A;  5IQ4 A;  5KOW A;  4H4Y A;  2QAE A;  3FMW A;  5TR3 A;  3IHM A;  2PYX A;  3AE2 A;  1F8W A;  5GSN A;  1IUX A;  3KA7 A;  3V3N A;  1IUW A;  2YLZ A;  3AE7 A;  3GD4 A;  1H81 A;  3JSK A;  1H7W A;  1GSN A;  2C67 A;  4FK1 C;  2C76 A;  3CPI G;  2RGH A;  4AP1 A;  4A65 A;  1Y56 B;  4BK1 A;  2XLR A;  4JY2 A;  3UKQ A;  5BRT A;  1CBO A;  4H4V A;  4I59 A;  1BF3 A;  4PAB A;  1S3E A;  3M0O A;  1COY A;  4J36 A;  3IC9 A;  1H7X A;  1YKJ A;  1GRT A;  2GAG B;  2OAM A;  1TRB A;  2XVH A;  4M52 A;  3UOY A;  1CL0 A;  4J34 A;  1D7L A;  1IUV A;  5BUK A;  1TYT A;  4WCT A;  2X8C A;  4XWZ A;  2C75 A;  5J60 A;  1LTX R;  3CNJ A;  4FX9 A;  4OPU A;  2XFO A;  2XVJ A;  3I3L A;  5JCL A;  1PXC A;  2XDO A;  3F8R A;  3ADA B;  1NHP A;  1L0V A;  4FDC B;  3KLJ A;  4H7U A;  2YG7 A;  1JEH A;  4YT0 A;  2NPX A;  1NG4 A;  4NTC A;  2WP5 A;  4U8L A;  3K7M X;  1FCD A;  1NAA A;  2XFN A;  3DK9 A;  3RP6 A;  1D4E A;  2BCP A;  1GET A;  5FS8 A;  1F6M A;  4C3X A;  5JCI A;  2BXR A;  4JNQ A;  1O95 A;  2GMH A;  1TDE A;  4ZCD A;  5EOW A;  1XPQ A;  1DJQ A;  5U63 A;  3QSM A;  2BCG G;  2H88 A;  2GAH B;  3AYL A;  1IUS A;  2E4G A;  4EMI A;  2FJA A;  4Z2T A;  1GEU A;  2V3B A;  3VRD B;  1REO A;  1NHS A;  3F8P A;  1YY5 A;  3C4N A;  4O5U A;  5FS6 A;  2JKC A;  2GV8 A;  1ZMC A;  3GRT A;  3I6D A;  3AE8 A;  4KPR A;  1ZP0 A;  1V59 A;  4TLZ A;  5JCK A;  2JB3 A;  2V60 A;  3D8X A;  1LQT A;  2WPF A;  1YQZ A;  2A89 A;  4TM1 A;  5DBJ A;  1ZX9 A;  3AD7 B;  4ZCC A;  4NEW A;  3RP7 A;  2BS2 A;  5L46 A;  4C3Y A;  1VQW A;  3DGZ A;  4IVO B;  1KDG A;  2CDU A;  4AP3 A;  4B65 A;  5M0Z A;  1BKW A;  3AED A;  2FJB A;  3H8I A;  3NIX A;  1GPE A;  4Z25 A;  3OC4 A;  3UKF A;  4EM3 A;  3COX A;  2XLU A;  4AT0 A;  4YXD A;  1GOS A;  4O5Q A;  3ZDN A;  3DJE A;  2JB1 A;  2C72 A;  2WEU A;  3NH3 X;  2BYB A;  4H4R A;  2YLR A;  4TLX A;  3LZX A;  3UP4 A;  4YSH A;  3BNM A;  4C77 A;  1KNP A;  2W0H A;  4WX1 A;  2R45 A;  2CFY A;  3P4Q A;  3GWD A;  1TYP A;  1PJ5 A;  4A6N B;  1S3B A;  3UCL A;  2WDR A;  1OJD A;  2C66 A;  1HYU A;  3LJP A;  3QSE A;  2YG4 A;  3CNP A;  3CN8 A;  1GER A;  1LPF A;  3IHG A;  1K0J A;  4USQ A;  3KD9 A;  1KSS A;  2WDV A;  2F5Z A;  2FJE A;  2B76 A;  3NNE A;  2B9X A;  4TM3 A;  4A6N A;  4X9N A;  1TDO A;  3BHF A;  2XVE A;  1BGJ A;  1CC6 A;  4H2Q A;  3ATR A;  1E39 A;  1E6E A;  4I58 A;  1OJ9 A;  2WOW A;  3PO7 A;  5EBK A;  3M12 A;  3UKL A;  4Z2U A;  2XLT A;  5HHF A;  2B9Y A;  2Q0L A;  4XXG A;  3AXB A;  1KSU A;  4U8I A;  1FEC A;  4BV6 A;  3AE3 A;  2C3C A;  3ATQ A;  2YLT A;  2ZZB A;  3AE1 A;  3CPH G;  4A7A A;  2VVL A;  2WOV A;  5U1O A;  4B68 A;  1JRY A;  3BI4 A;  1PXA A;  2OAL A;  4J56 A;  3AE4 A;  1DOB A;  1FEA A;  4H2R A;  2GR3 A;  1JRZ A;  3NKS A;  3B6D A;  1B8S A;  2YG5 A;  3GYI A;  2DKH A;  3UOZ A;  4TM4 A;  3AEB A;  3RP8 A;  2TPR A;  4NTD A;  1D5T A;  3Q6J A;  2WPC A;  4JY3 A;  5BVA A;  4APN A;  5HY5 A;  2BK3 A;  2AAQ A;  2GRT A;  2R0C A;  3UKK A;  5EB4 A;  2WDQ A;  3AYJ A;  3DGH A;  3RHA A;  1TDF A;  1LVL A;  2OA1 A;  3NK0 X;  2VRL A;  4AOS A;  1ELI A;  4H4W A;  1O94 A;  4BK3 A;  1VG9 A;  4JQ9 A;  1Q1R A;  1JNR A;  2UZZ A;  3KVE A;  4K5S A;  4ZN0 A;  4GUV A;  2YLS A;  2XCG A;  4RSL A;  1EL5 A;  1XDI A;  2Q0K A;  1O5W A;  3CGE A;  5KVI A;  3VQR A;  3P9U A;  4C74 A;  2C64 A;  3NYE A;  3KKJ A;  5C2T A;  1Y0P A;  3URH A;  3K7Q X;  4YWO A;  2WS3 A;  1CJ3 A;  3EAN A;  3QVR A;  3NTA A;  3G5R A;  4U8O A;  4YSZ A;  3AEA A;  2EQ6 A;  2TMD A;  1K4Q A;  4FK1 A;  5HYM A;  2BS3 A;  2V6O A;  1ZY8 A;  4K8D A;  4X9M A;  1FL2 A;  3NT6 A;  2EQ8 A;  2YLX A;  5C3J A;  3C4A A;  1JNZ A;  3EAO A;  3BI2 A;  1CHU A;  2GH5 A;  1B4V A;  2IID A;  2XLS A;  1F3P A;  4AT2 A;  1F8R A;  1Y56 A;  4H2N A;  4H4Q A;  1CJ4 A;  1W4X A;  1GRG A;  2Y6Q A;  4KX6 A;  4OCG A;  1GND A;  4LII A;  1EBD A;  1PJ7 A;  4UDP A;  2GR2 A;  1S2Q A;  4U2T A;  3SQP A;  2GQW A;  2BC0 A;  2IVE A;  4NTE A;  3E1T A;  3CNT A;  4YTP A;  2YQU A;  2ZZ0 A;  1EL9 A;  4H4X A;  3SM8 A;  4D04 A;  4EQR A;  4GDE A;  1DOC A;  3BHK A;  3S61 A;  3Q9T A;  4U2S A;  4CNJ A;  4OPL A;  1P2H A;  2JAE A;  3ALJ A;  2CVJ A;  4CRT A;  1PDH A;  2WOI A;  2Z5X A;  5BUL A;  1M64 A;  1JOA A;  4HB9 A;  5CQF A;  2B7R A;  4B64 A;  1K0L A;  1DXL A;  1S2Y A;  2H89 A;  3L8K A;  4UP3 A;  2XLP A;  1GES A;  3VRB A;  4U2L A;  2X8G A;  5LV9 A;  2A8X A;  2XVI A;  4MJW A;  3AB1 A;  3ISH A;  2BK5 A;  2V61 A;  3VR8 A;  5JCN A;  4CY6 A;  3UTH A;  3QFA A;  2BAB A;  1GTE A;  1H6V A;  3ALL A;  4Y4L A;  3II4 A;  2HQM A;  3AD8 B;  1NPX A;  3AD9 B;  1TDN A;  5KVH A;  4ICY A;  1PBF A;  3UKA A;  1BGN A;  4Y4M A;  5M10 A;  2WET A;  2WBA A;  1IJH A;  3CGD A;  4H4P A;  1TDK A;  5CKU A;  4J31 A;  2FJD A;  1MOK A;  1NHQ A;  3ABV A;  1LJ1 A;  1RYI A;  2XFQ A;  4GRT A;  1B5Q A;  1OJT A;  2YLW A;  1PHH A;  3CPJ G;  2YR6 A;  2ACZ A;  4CCQ A;  4USR A;  3NHO X;  3AYI A;  3O0H A;  2BK4 A;  4U8K A;  4U8N A;  2A87 A;  1H83 A;  1M6I A;  2GEW A;  3PS9 A;  2BAC A;  1ZDL A;  4PAA A;  2AQJ A;  2QCU A;  2O9Z A;  3AE6 A;  1X31 B;  2R46 A;  2R4E A;  1CF3 A;  2R4J A;  2PHH A;  2BA9 A;  2E5V A;  4U8J A;  1IUU A;  3GMC A;  3GWF A;  2X3N A;  2XVF A;  1NHR A;  4AOX A;  2XFU A;  2GQF A;  2VZ2 A;  4J57 A;  5IPY A;  4UDQ A;  4JNA A;  2ZZC A;  4OVI A;  2ZBW A;  3VR9 A;  2BXS A;  3NLC A;  4EQW A;  3K30 A;  2WU5 A;  1NG3 A;  4OPT A;  3CGB A;  4CCR A;  2RAB A;  4H4Z A;  3T37 A;  3KPF A;  4H50 A;  4H4S A;  3CIR A;  1N4W A;  2JB2 A; 
#chains in the Genus database with same CATH topology
 3NN6 X;  2JBV A;  1CC2 A;  3C96 A;  3GDP A;  1PBE A;  4N9X A;  1DNC A;  4CBQ A;  2OLO A;  1N4V A;  1KNR A;  2E1M A;  4II3 A;  1H82 A;  1OJA A;  2OLN A;  3ZYX A;  2GF3 A;  3AEG A;  3CNS A;  5KNL A;  5KXJ A;  1CJC A;  3P1W A;  1NDA A;  4E0V A;  2XYO A;  3FPZ A;  3GMB A;  4DSG A;  3P4P A;  3GDN A;  4LA1 A;  3QVP A;  2I0Z A;  4TM0 A;  3CTY A;  3NK2 X;  3DK4 A;  3UKH A;  3VRA A;  3NYC A;  4H2P A;  1E1N A;  1JRX A;  4EQX A;  1VG0 A;  1GRH A;  4EMJ A;  5KOX A;  3UP5 A;  4H4T A;  4EIP A;  3DJG X;  3GSI A;  5ER0 A;  3AE9 A;  3ICS A;  2V3A A;  3ALM A;  3NGC X;  1L9C A;  1DJN A;  4A5L A;  1AOG A;  1DOE A;  3AWI A;  1QO8 A;  1XHC A;  4GR1 A;  3H8L A;  1SEZ A;  1N4U A;  5FS9 A;  4YKF A;  4Z24 A;  5JCM A;  1BWC A;  4J2W A;  1GRA A;  1OJC A;  4BJZ A;  1ZK7 A;  2WU2 A;  3UTF A;  3F8D A;  2Q6U A;  3CND A;  4IV9 A;  1GXF A;  2VVL G;  1ZOV A;  2GMJ A;  2X99 A;  1JU2 A;  2X8H A;  5KWF A;  3SYI A;  1MXT A;  3R9U A;  2C70 A;  1N1P A;  3KU9 A;  1GAL A;  1Z6L A;  2C7G A;  4Z2R A;  3NN0 X;  4H4U A;  4K5R A;  2QA1 A;  4OPC A;  4YKG A;  2B7S A;  2APG A;  2YWL A;  2Q7V A;  4Y4N A;  2IVD A;  3D1C A;  1GRB A;  3BNU A;  1Q1W A;  5KMQ A;  4Z26 A;  1B37 A;  2VQ7 A;  4ADW A;  4EMW A;  1L9D A;  3G5S A;  5GRT A;  2V5Z A;  4J33 A;  4B69 A;  3P4S A;  2YVJ A;  3SZC A;  2Z5Y A;  3QJ4 A;  4U8M A;  1QLB A;  5FS7 A;  4EM4 A;  1ONF A;  3AEE A;  1H86 A;  2YVF A;  4BK2 A;  3GYJ A;  1E7P A;  3AEF A;  3WE0 A;  1DOD A;  4HA6 A;  4Z43 A;  4LU6 A;  1CJ2 A;  5KMS A;  3DJJ A;  4D03 A;  1ZMD A;  3ICT A;  4Z44 A;  1VDC A;  2B9W A;  1D4D A;  3RNM A;  1F8S A;  2GR1 A;  3DME A;  4NZH A;  5U25 A;  3UTG A;  2C73 A;  2EQ7 A;  2VVM A;  3NG7 X;  4IA6 A;  2YR5 A;  3KPK A;  1ZKQ A;  2X50 A;  5KRQ A;  1QJD A;  1ZOY A;  4NEV A;  2J3N A;  3QSS A;  2C65 A;  3SGL A;  2JK6 A;  3H4K A;  1GRE A;  2EQ9 A;  2VOU A;  4B67 A;  1MO9 A;  4G74 A;  4IVM B;  4EQS A;  1PS9 A;  4REK A;  4BJY A;  2C3D A;  4ECH A;  1H84 A;  4YTM A;  2RGJ A;  1NEK A;  3S5W A;  3SFD A;  3UKP A;  3PVC A;  1GT8 A;  4DNA A;  4K2X A;  1KFY A;  4OPI A;  3K7T A;  4CY8 A;  2R0G A;  3IF9 A;  3NK1 X;  4B1B A;  4CNK A;  3G5Q A;  1RP0 A;  2Y6R A;  2YG6 A;  1K0I A;  3FG2 P;  3ICR A;  2R0P A;  2VQB A;  1GTH A;  5J7X A;  3AEC A;  2NVK X;  2YR4 A;  1FEB A;  1PXB A;  4JN9 A;  4JDR A;  4GDP A;  4U8P A;  3T31 A;  1YQ3 A;  2WP9 A;  1VRQ B;  1FOH A;  2YG3 A;  3M13 A;  4RG3 A;  4YSY A;  3FIM B;  1PN0 A;  1EL8 A;  3QFB A;  2BC1 A;  3IWA A;  2YVG A;  1D4C A;  2BS4 A;  4K7Z A;  4YSX A;  1XAN A;  4OPD A;  3B3R A;  4K22 A;  3NRN A;  4OPG A;  1Q9I A;  3CGC A;  3UOV A;  4DSH A;  2FBW A;  3LZW A;  2ARD A;  3SZW A;  2WQY A;  1E1L A;  5IQ1 A;  4A79 A;  3DJD A;  1NEN A;  3NTD A;  1L9E A;  3LOV A;  2WES A;  2WP6 A;  1KF6 A;  4A99 A;  4B66 A;  4IA5 A;  3DH9 A;  3L1R A;  1YQ4 A;  1PBB A;  1IUT A;  2GB0 A;  2WPE A;  3ITJ A;  3LAD A;  4GF7 A;  4X4J A;  3P4R A;  1EL7 A;  1GV4 A;  2BRY A;  2GR0 A;  2WHD A;  3BI5 A;  4GCM A;  4UDR A;  4B63 A;  2AR8 A;  1GRF A;  1UKV G;  3EPT A;  3FBS A;  1P2E A;  2YM1 A;  3V3O A;  1D7Y A;  4XWR A;  3EF6 A;  3SFE A;  4YTN A;  4EIQ A;  1CC4 A;  1PBC A;  1PJ6 A;  3HZL A;  1LV0 A;  2YAU A;  5HXI A;  1LQU A;  1E1M A;  3UOX A;  3RED A;  2RGO A;  3DA1 A;  3OZ2 A;  4P9S A;  3V76 A;  3LXD A;  1BZL A;  3GRS A;  1PBD A;  2QA2 A;  3AE5 A;  4A9W A;  3LB8 A;  2VRM A;  4G6G A;  5FMH A;  2GVC A;  2DKI A;  2CUL A;  4BUR A;  2R9Z A;  2YM2 A;  3GD3 A;  2XFP A;  3UTE A;  4RG4 A;  1RSG A;  4C5O A;  3DK8 A;  1E1K A;  3NYF A;  5EB5 A;  3SX6 A;  4DGK A;  5IQ4 A;  5KOW A;  4H4Y A;  2QAE A;  3FMW A;  5TR3 A;  3IHM A;  2PYX A;  3AE2 A;  1F8W A;  5GSN A;  1IUX A;  3KA7 A;  3V3N A;  1IUW A;  2YLZ A;  3AE7 A;  3GD4 A;  1H81 A;  3JSK A;  1H7W A;  1GSN A;  2C67 A;  4FK1 C;  2C76 A;  3CPI G;  2RGH A;  4AP1 A;  4A65 A;  1Y56 B;  4BK1 A;  3T2Z A;  4G9K A;  2XLR A;  4JY2 A;  3T2Y A;  3UKQ A;  5BRT A;  1CBO A;  4H4V A;  4I59 A;  1BF3 A;  4PAB A;  1S3E A;  3M0O A;  1COY A;  4J36 A;  3IC9 A;  1H7X A;  1YKJ A;  1GRT A;  2GAG B;  2OAM A;  1TRB A;  2XVH A;  4M52 A;  3UOY A;  1CL0 A;  4J34 A;  1D7L A;  1IUV A;  5BUK A;  1TYT A;  4WCT A;  2X8C A;  4XWZ A;  2C75 A;  5J60 A;  2BRA A;  1LTX R;  3CNJ A;  4FX9 A;  4OPU A;  2XFO A;  2XVJ A;  3I3L A;  5JCL A;  1PXC A;  5KMP A;  2XDO A;  3F8R A;  3ADA B;  1NHP A;  1L0V A;  4FDC B;  3KLJ A;  4H7U A;  2YG7 A;  1JEH A;  4YT0 A;  2NPX A;  1NG4 A;  4NTC A;  2WP5 A;  4U8L A;  3K7M X;  1FCD A;  1NAA A;  2XFN A;  3DK9 A;  3RP6 A;  1D4E A;  2BCP A;  1GET A;  5FS8 A;  1F6M A;  4C3X A;  5JCI A;  2BXR A;  4JNQ A;  1O95 A;  2GMH A;  5KMR A;  1TDE A;  4ZCD A;  5EOW A;  1XPQ A;  1DJQ A;  5U63 A;  3QSM A;  2BCG G;  2H88 A;  2GAH B;  3AYL A;  1IUS A;  2E4G A;  4EMI A;  2FJA A;  4Z2T A;  1GEU A;  2V3B A;  3VRD B;  2C4C A;  1REO A;  1NHS A;  3F8P A;  1YY5 A;  3C4N A;  4O5U A;  5FS6 A;  2JKC A;  2GV8 A;  1ZMC A;  3GRT A;  3I6D A;  3AE8 A;  4KPR A;  1ZP0 A;  1V59 A;  4TLZ A;  5JCK A;  2JB3 A;  2V60 A;  3D8X A;  1LQT A;  2WPF A;  1YQZ A;  2A89 A;  4TM1 A;  5DBJ A;  1ZX9 A;  3AD7 B;  4ZCC A;  4NEW A;  3RP7 A;  2BS2 A;  5L46 A;  4C3Y A;  1VQW A;  3DGZ A;  4IVO B;  1KDG A;  2CDU A;  4AP3 A;  4B65 A;  5M0Z A;  1BKW A;  3AED A;  2FJB A;  3H8I A;  3NIX A;  1GPE A;  4Z25 A;  3OC4 A;  3UKF A;  4EM3 A;  3COX A;  2XLU A;  4AT0 A;  4YXD A;  1GOS A;  4O5Q A;  4II2 A;  3DJE A;  3ZDN A;  2JB1 A;  2C72 A;  2WEU A;  3NH3 X;  2BYB A;  4H4R A;  2YLR A;  4TLX A;  3LZX A;  3T0K A;  3UP4 A;  4YSH A;  3BNM A;  4C77 A;  1KNP A;  2W0H A;  4WX1 A;  2R45 A;  2CFY A;  3P4Q A;  3GWD A;  1TYP A;  1PJ5 A;  4A6N B;  1S3B A;  3UCL A;  2WDR A;  1OJD A;  3SY4 A;  2C66 A;  1HYU A;  3LJP A;  3HYW A;  2YG4 A;  3QSE A;  3CNP A;  3CN8 A;  1GER A;  1LPF A;  3IHG A;  1K0J A;  4USQ A;  3KD9 A;  1KSS A;  2WDV A;  2F5Z A;  2FJE A;  2B76 A;  3NNE A;  2B9X A;  4TM3 A;  4A6N A;  4X9N A;  1TDO A;  3BHF A;  2XVE A;  1BGJ A;  1CC6 A;  4H2Q A;  3ATR A;  1E39 A;  1E6E A;  4I58 A;  1OJ9 A;  2WOW A;  3PO7 A;  5EBK A;  3M12 A;  3UKL A;  4Z2U A;  2XLT A;  5HHF A;  2B9Y A;  2Q0L A;  4XXG A;  3AXB A;  1KSU A;  4U8I A;  1FEC A;  4BV6 A;  3T14 A;  3AE3 A;  2C3C A;  3ATQ A;  2YLT A;  2ZZB A;  3AE1 A;  3CPH G;  4A7A A;  2VVL A;  2WOV A;  5U1O A;  4B68 A;  1JRY A;  3BI4 A;  1PXA A;  3SZ0 A;  2OAL A;  4J56 A;  3AE4 A;  1DOB A;  1FEA A;  4H2R A;  2GR3 A;  1JRZ A;  3NKS A;  3B6D A;  1B8S A;  2YG5 A;  3GYI A;  2DKH A;  3UOZ A;  4TM4 A;  3AEB A;  3RP8 A;  2TPR A;  4NTD A;  1D5T A;  3Q6J A;  2WPC A;  4JY3 A;  5BVA A;  4APN A;  5HY5 A;  2BK3 A;  2AAQ A;  2GRT A;  2R0C A;  3UKK A;  5EB4 A;  2WDQ A;  3AYJ A;  3DGH A;  3RHA A;  1TDF A;  1LVL A;  2OA1 A;  3NK0 X;  2VRL A;  4AOS A;  1ELI A;  4H4W A;  1O94 A;  4BK3 A;  1VG9 A;  4JQ9 A;  1Q1R A;  1JNR A;  2UZZ A;  3KVE A;  4K5S A;  4NWZ A;  4ZN0 A;  4GUV A;  2YLS A;  2XCG A;  4NNJ A;  4RSL A;  1EL5 A;  1XDI A;  2Q0K A;  1O5W A;  3CGE A;  5KVI A;  3VQR A;  3P9U A;  4C74 A;  2C64 A;  4G6H A;  3NYE A;  3KKJ A;  5C2T A;  1Y0P A;  3HYV A;  3K7Q X;  4YWO A;  3URH A;  2WS3 A;  1CJ3 A;  3EAN A;  3GYX A;  3QVR A;  3NTA A;  3G5R A;  3HYX A;  4U8O A;  4YSZ A;  3AEA A;  2EQ6 A;  2TMD A;  1K4Q A;  4FK1 A;  5HYM A;  2BS3 A;  2V6O A;  1ZY8 A;  4K8D A;  4X9M A;  1FL2 A;  3NT6 A;  2EQ8 A;  2YLX A;  5C3J A;  3C4A A;  1JNZ A;  3EAO A;  3BI2 A;  1CHU A;  2GH5 A;  1B4V A;  2IID A;  2XLS A;  1F3P A;  4AT2 A;  1F8R A;  4G73 A;  1Y56 A;  4H2N A;  4H4Q A;  1CJ4 A;  1W4X A;  1GRG A;  2Y6Q A;  4KX6 A;  4OCG A;  1GND A;  4LII A;  1EBD A;  1PJ7 A;  4UDP A;  2GR2 A;  1S2Q A;  4U2T A;  3SQP A;  2GQW A;  2BC0 A;  2IVE A;  4NTE A;  3E1T A;  3CNT A;  4YTP A;  2YQU A;  2ZZ0 A;  1EL9 A;  4H4X A;  3SM8 A;  4D04 A;  4EQR A;  4GDE A;  1DOC A;  3BHK A;  3S61 A;  3Q9T A;  4U2S A;  4CNJ A;  4OPL A;  1P2H A;  2JAE A;  3ALJ A;  2CVJ A;  4CRT A;  1PDH A;  2WOI A;  2Z5X A;  5BUL A;  1M64 A;  1JOA A;  4HB9 A;  5CQF A;  2B7R A;  4B64 A;  1K0L A;  1DXL A;  1S2Y A;  2H89 A;  3L8K A;  4UP3 A;  2XLP A;  1GES A;  3VRB A;  4U2L A;  2X8G A;  5LV9 A;  2A8X A;  2XVI A;  4MJW A;  3AB1 A;  3ISH A;  2BK5 A;  2V61 A;  3VR8 A;  5JCN A;  4CY6 A;  3UTH A;  3QFA A;  2BAB A;  1GTE A;  1H6V A;  3ALL A;  4Y4L A;  3II4 A;  2HQM A;  3AD8 B;  1NPX A;  3AD9 B;  1TDN A;  5KVH A;  4ICY A;  1PBF A;  3UKA A;  1BGN A;  4Y4M A;  5M10 A;  2WET A;  2WBA A;  1IJH A;  3CGD A;  4H4P A;  1TDK A;  5CKU A;  4J31 A;  2FJD A;  1MOK A;  1NHQ A;  3ABV A;  1LJ1 A;  1RYI A;  2XFQ A;  4GRT A;  1B5Q A;  1OJT A;  2YLW A;  1PHH A;  3CPJ G;  2YR6 A;  2ACZ A;  4CCQ A;  4USR A;  3NHO X;  3AYI A;  3O0H A;  2BK4 A;  4U8K A;  4U8N A;  2A87 A;  1H83 A;  1M6I A;  2GEW A;  3PS9 A;  4GAV A;  2BAC A;  3T2K A;  1ZDL A;  4PAA A;  2AQJ A;  2QCU A;  2O9Z A;  3AE6 A;  1X31 B;  2R46 A;  2R4E A;  1CF3 A;  2R4J A;  2PHH A;  2BA9 A;  2E5V A;  4U8J A;  1IUU A;  3GMC A;  3GWF A;  2X3N A;  2XVF A;  1NHR A;  4AOX A;  2XFU A;  2GQF A;  2VZ2 A;  4J57 A;  5IPY A;  4UDQ A;  4JNA A;  2ZZC A;  4OVI A;  2ZBW A;  3VR9 A;  2BXS A;  3NLC A;  4EQW A;  3CMM A;  2WU5 A;  1NG3 A;  3K30 A;  4GAP A;  4OPT A;  3SXI A;  3SZF A;  3CGB A;  4CCR A;  2RAB A;  4H4Z A;  3T37 A;  3KPF A;  4H50 A;  4H4S A;  3CIR A;  1N4W A;  2JB2 A; 
#chains in the Genus database with same CATH homology
 3NN6 X;  2JBV A;  1CC2 A;  3C96 A;  3GDP A;  1PBE A;  4N9X A;  1DNC A;  4CBQ A;  2OLO A;  1N4V A;  1KNR A;  2E1M A;  4II3 A;  1H82 A;  1OJA A;  2OLN A;  3ZYX A;  2GF3 A;  3AEG A;  3CNS A;  5KNL A;  5KXJ A;  1CJC A;  3P1W A;  1NDA A;  4E0V A;  2XYO A;  3FPZ A;  3GMB A;  4DSG A;  3P4P A;  3GDN A;  4LA1 A;  3QVP A;  2I0Z A;  4TM0 A;  3CTY A;  3NK2 X;  3DK4 A;  3UKH A;  3VRA A;  3NYC A;  4H2P A;  1E1N A;  1JRX A;  4EQX A;  1VG0 A;  1GRH A;  4EMJ A;  5KOX A;  3UP5 A;  4H4T A;  4EIP A;  3DJG X;  3GSI A;  5ER0 A;  3AE9 A;  3ICS A;  2V3A A;  3ALM A;  3NGC X;  1L9C A;  1DJN A;  4A5L A;  1AOG A;  1DOE A;  3AWI A;  1QO8 A;  1XHC A;  4GR1 A;  3H8L A;  1SEZ A;  1N4U A;  5FS9 A;  4YKF A;  4Z24 A;  5JCM A;  1BWC A;  4J2W A;  1GRA A;  1OJC A;  4BJZ A;  1ZK7 A;  2WU2 A;  3UTF A;  3F8D A;  2Q6U A;  3CND A;  4IV9 A;  1GXF A;  2VVL G;  1ZOV A;  2GMJ A;  2X99 A;  1JU2 A;  2X8H A;  5KWF A;  3SYI A;  1MXT A;  3R9U A;  2C70 A;  1N1P A;  3KU9 A;  1GAL A;  1Z6L A;  2C7G A;  4Z2R A;  3NN0 X;  4H4U A;  4K5R A;  2QA1 A;  4OPC A;  4YKG A;  2B7S A;  2APG A;  2YWL A;  2Q7V A;  4Y4N A;  2IVD A;  3D1C A;  1GRB A;  3BNU A;  1Q1W A;  5KMQ A;  4Z26 A;  1B37 A;  2VQ7 A;  4ADW A;  4EMW A;  1L9D A;  3G5S A;  5GRT A;  2V5Z A;  4J33 A;  4B69 A;  3P4S A;  2YVJ A;  3SZC A;  2Z5Y A;  3QJ4 A;  4U8M A;  1QLB A;  5FS7 A;  4EM4 A;  1ONF A;  3AEE A;  1H86 A;  2YVF A;  4BK2 A;  3GYJ A;  1E7P A;  3AEF A;  3WE0 A;  1DOD A;  4HA6 A;  4Z43 A;  4LU6 A;  1CJ2 A;  5KMS A;  3DJJ A;  4D03 A;  1ZMD A;  3ICT A;  4Z44 A;  1VDC A;  2B9W A;  1D4D A;  3RNM A;  1F8S A;  2GR1 A;  3DME A;  4NZH A;  5U25 A;  3UTG A;  2C73 A;  2EQ7 A;  2VVM A;  3NG7 X;  4IA6 A;  2YR5 A;  3KPK A;  1ZKQ A;  2X50 A;  5KRQ A;  1QJD A;  1ZOY A;  4NEV A;  2J3N A;  3QSS A;  2C65 A;  3SGL A;  2JK6 A;  3H4K A;  1GRE A;  2EQ9 A;  2VOU A;  4B67 A;  1MO9 A;  4G74 A;  4IVM B;  4EQS A;  1PS9 A;  4REK A;  4BJY A;  2C3D A;  4ECH A;  1H84 A;  4YTM A;  2RGJ A;  1NEK A;  3S5W A;  3SFD A;  3UKP A;  3PVC A;  1GT8 A;  4DNA A;  4K2X A;  1KFY A;  4OPI A;  3K7T A;  4CY8 A;  2R0G A;  3IF9 A;  3NK1 X;  4B1B A;  4CNK A;  3G5Q A;  1RP0 A;  2Y6R A;  2YG6 A;  1K0I A;  3FG2 P;  3ICR A;  2R0P A;  2VQB A;  1GTH A;  5J7X A;  3AEC A;  2NVK X;  2YR4 A;  1FEB A;  1PXB A;  4JN9 A;  4JDR A;  4GDP A;  4U8P A;  3T31 A;  1YQ3 A;  2WP9 A;  1VRQ B;  1FOH A;  2YG3 A;  3M13 A;  4RG3 A;  4YSY A;  3FIM B;  1PN0 A;  1EL8 A;  3QFB A;  2BC1 A;  3IWA A;  2YVG A;  1D4C A;  2BS4 A;  4K7Z A;  4YSX A;  1XAN A;  4OPD A;  3B3R A;  4K22 A;  3NRN A;  4OPG A;  1Q9I A;  3CGC A;  3UOV A;  4DSH A;  2FBW A;  3LZW A;  2ARD A;  3SZW A;  2WQY A;  1E1L A;  5IQ1 A;  4A79 A;  3DJD A;  1NEN A;  3NTD A;  1L9E A;  3LOV A;  2WES A;  2WP6 A;  1KF6 A;  4A99 A;  4B66 A;  4IA5 A;  3DH9 A;  3L1R A;  1YQ4 A;  1PBB A;  1IUT A;  2GB0 A;  2WPE A;  3ITJ A;  3LAD A;  4GF7 A;  4X4J A;  3P4R A;  1EL7 A;  1GV4 A;  2BRY A;  2GR0 A;  2WHD A;  3BI5 A;  4GCM A;  4UDR A;  4B63 A;  2AR8 A;  1GRF A;  1UKV G;  3EPT A;  3FBS A;  1P2E A;  2YM1 A;  3V3O A;  1D7Y A;  4XWR A;  3EF6 A;  3SFE A;  4YTN A;  4EIQ A;  1CC4 A;  1PBC A;  1PJ6 A;  3HZL A;  1LV0 A;  2YAU A;  5HXI A;  1LQU A;  1E1M A;  3UOX A;  3RED A;  2RGO A;  3DA1 A;  3OZ2 A;  4P9S A;  3V76 A;  3LXD A;  1BZL A;  3GRS A;  1PBD A;  2QA2 A;  3AE5 A;  4A9W A;  3LB8 A;  2VRM A;  4G6G A;  5FMH A;  2GVC A;  2DKI A;  2CUL A;  4BUR A;  2R9Z A;  2YM2 A;  3GD3 A;  2XFP A;  3UTE A;  4RG4 A;  1RSG A;  4C5O A;  3DK8 A;  1E1K A;  3NYF A;  5EB5 A;  3SX6 A;  4DGK A;  5IQ4 A;  5KOW A;  4H4Y A;  2QAE A;  3FMW A;  5TR3 A;  3IHM A;  2PYX A;  3AE2 A;  1F8W A;  5GSN A;  1IUX A;  3KA7 A;  3V3N A;  1IUW A;  2YLZ A;  3AE7 A;  3GD4 A;  1H81 A;  3JSK A;  1H7W A;  1GSN A;  2C67 A;  4FK1 C;  2C76 A;  3CPI G;  2RGH A;  4AP1 A;  4A65 A;  1Y56 B;  4BK1 A;  3T2Z A;  4G9K A;  2XLR A;  4JY2 A;  3T2Y A;  3UKQ A;  5BRT A;  1CBO A;  4H4V A;  4I59 A;  1BF3 A;  4PAB A;  1S3E A;  3M0O A;  1COY A;  4J36 A;  3IC9 A;  1H7X A;  1YKJ A;  1GRT A;  2GAG B;  2OAM A;  1TRB A;  2XVH A;  4M52 A;  3UOY A;  1CL0 A;  4J34 A;  1D7L A;  1IUV A;  5BUK A;  1TYT A;  4WCT A;  2X8C A;  4XWZ A;  2C75 A;  5J60 A;  2BRA A;  1LTX R;  3CNJ A;  4FX9 A;  4OPU A;  2XFO A;  2XVJ A;  3I3L A;  5JCL A;  1PXC A;  5KMP A;  2XDO A;  3F8R A;  3ADA B;  1NHP A;  1L0V A;  4FDC B;  3KLJ A;  4H7U A;  2YG7 A;  1JEH A;  4YT0 A;  2NPX A;  1NG4 A;  4NTC A;  2WP5 A;  4U8L A;  3K7M X;  1FCD A;  1NAA A;  2XFN A;  3DK9 A;  3RP6 A;  1D4E A;  2BCP A;  1GET A;  5FS8 A;  1F6M A;  4C3X A;  5JCI A;  2BXR A;  4JNQ A;  1O95 A;  2GMH A;  5KMR A;  1TDE A;  4ZCD A;  5EOW A;  1XPQ A;  1DJQ A;  5U63 A;  3QSM A;  2BCG G;  2H88 A;  2GAH B;  3AYL A;  1IUS A;  2E4G A;  4EMI A;  2FJA A;  4Z2T A;  1GEU A;  2V3B A;  3VRD B;  2C4C A;  1REO A;  1NHS A;  3F8P A;  1YY5 A;  3C4N A;  4O5U A;  5FS6 A;  2JKC A;  2GV8 A;  1ZMC A;  3GRT A;  3I6D A;  3AE8 A;  4KPR A;  1ZP0 A;  1V59 A;  4TLZ A;  5JCK A;  2JB3 A;  2V60 A;  3D8X A;  1LQT A;  2WPF A;  1YQZ A;  2A89 A;  4TM1 A;  5DBJ A;  1ZX9 A;  3AD7 B;  4ZCC A;  4NEW A;  3RP7 A;  2BS2 A;  5L46 A;  4C3Y A;  1VQW A;  3DGZ A;  4IVO B;  1KDG A;  2CDU A;  4AP3 A;  4B65 A;  5M0Z A;  1BKW A;  3AED A;  2FJB A;  3H8I A;  3NIX A;  1GPE A;  4Z25 A;  3OC4 A;  3UKF A;  4EM3 A;  3COX A;  2XLU A;  4AT0 A;  4YXD A;  1GOS A;  4O5Q A;  4II2 A;  3DJE A;  3ZDN A;  2JB1 A;  2C72 A;  2WEU A;  3NH3 X;  2BYB A;  4H4R A;  2YLR A;  4TLX A;  3LZX A;  3T0K A;  3UP4 A;  4YSH A;  3BNM A;  4C77 A;  1KNP A;  2W0H A;  4WX1 A;  2R45 A;  2CFY A;  3P4Q A;  3GWD A;  1TYP A;  1PJ5 A;  4A6N B;  1S3B A;  3UCL A;  2WDR A;  1OJD A;  3SY4 A;  2C66 A;  1HYU A;  3LJP A;  3HYW A;  2YG4 A;  3QSE A;  3CNP A;  3CN8 A;  1GER A;  1LPF A;  3IHG A;  1K0J A;  4USQ A;  3KD9 A;  1KSS A;  2WDV A;  2F5Z A;  2FJE A;  2B76 A;  3NNE A;  2B9X A;  4TM3 A;  4A6N A;  4X9N A;  1TDO A;  3BHF A;  2XVE A;  1BGJ A;  1CC6 A;  4H2Q A;  3ATR A;  1E39 A;  1E6E A;  4I58 A;  1OJ9 A;  2WOW A;  3PO7 A;  5EBK A;  3M12 A;  3UKL A;  4Z2U A;  2XLT A;  5HHF A;  2B9Y A;  2Q0L A;  4XXG A;  3AXB A;  1KSU A;  4U8I A;  1FEC A;  4BV6 A;  3T14 A;  3AE3 A;  2C3C A;  3ATQ A;  2YLT A;  2ZZB A;  3AE1 A;  3CPH G;  4A7A A;  2VVL A;  2WOV A;  5U1O A;  4B68 A;  1JRY A;  3BI4 A;  1PXA A;  3SZ0 A;  2OAL A;  4J56 A;  3AE4 A;  1DOB A;  1FEA A;  4H2R A;  2GR3 A;  1JRZ A;  3NKS A;  3B6D A;  1B8S A;  2YG5 A;  3GYI A;  2DKH A;  3UOZ A;  4TM4 A;  3AEB A;  3RP8 A;  2TPR A;  4NTD A;  1D5T A;  3Q6J A;  2WPC A;  4JY3 A;  5BVA A;  4APN A;  5HY5 A;  2BK3 A;  2AAQ A;  2GRT A;  2R0C A;  3UKK A;  5EB4 A;  2WDQ A;  3AYJ A;  3DGH A;  3RHA A;  1TDF A;  1LVL A;  2OA1 A;  3NK0 X;  2VRL A;  4AOS A;  1ELI A;  4H4W A;  1O94 A;  4BK3 A;  1VG9 A;  4JQ9 A;  1Q1R A;  1JNR A;  2UZZ A;  3KVE A;  4K5S A;  4NWZ A;  4ZN0 A;  4GUV A;  2YLS A;  2XCG A;  4NNJ A;  4RSL A;  1EL5 A;  1XDI A;  2Q0K A;  1O5W A;  3CGE A;  5KVI A;  3VQR A;  3P9U A;  4C74 A;  2C64 A;  4G6H A;  3NYE A;  3KKJ A;  5C2T A;  1Y0P A;  3HYV A;  3K7Q X;  4YWO A;  3URH A;  2WS3 A;  1CJ3 A;  3EAN A;  3GYX A;  3QVR A;  3NTA A;  3G5R A;  3HYX A;  4U8O A;  4YSZ A;  3AEA A;  2EQ6 A;  2TMD A;  1K4Q A;  4FK1 A;  5HYM A;  2BS3 A;  2V6O A;  1ZY8 A;  4K8D A;  4X9M A;  1FL2 A;  3NT6 A;  2EQ8 A;  2YLX A;  5C3J A;  3C4A A;  1JNZ A;  3EAO A;  3BI2 A;  1CHU A;  2GH5 A;  1B4V A;  2IID A;  2XLS A;  1F3P A;  4AT2 A;  1F8R A;  4G73 A;  1Y56 A;  4H2N A;  4H4Q A;  1CJ4 A;  1W4X A;  1GRG A;  2Y6Q A;  4KX6 A;  4OCG A;  1GND A;  4LII A;  1EBD A;  1PJ7 A;  4UDP A;  2GR2 A;  1S2Q A;  4U2T A;  3SQP A;  2GQW A;  2BC0 A;  2IVE A;  4NTE A;  3E1T A;  3CNT A;  4YTP A;  2YQU A;  2ZZ0 A;  1EL9 A;  4H4X A;  3SM8 A;  4D04 A;  4EQR A;  4GDE A;  1DOC A;  3BHK A;  3S61 A;  3Q9T A;  4U2S A;  4CNJ A;  4OPL A;  1P2H A;  2JAE A;  3ALJ A;  2CVJ A;  4CRT A;  1PDH A;  2WOI A;  2Z5X A;  5BUL A;  1M64 A;  1JOA A;  4HB9 A;  5CQF A;  2B7R A;  4B64 A;  1K0L A;  1DXL A;  1S2Y A;  2H89 A;  3L8K A;  4UP3 A;  2XLP A;  1GES A;  3VRB A;  4U2L A;  2X8G A;  5LV9 A;  2A8X A;  2XVI A;  4MJW A;  3AB1 A;  3ISH A;  2BK5 A;  2V61 A;  3VR8 A;  5JCN A;  4CY6 A;  3UTH A;  3QFA A;  2BAB A;  1GTE A;  1H6V A;  3ALL A;  4Y4L A;  3II4 A;  2HQM A;  3AD8 B;  1NPX A;  3AD9 B;  1TDN A;  5KVH A;  4ICY A;  1PBF A;  3UKA A;  1BGN A;  4Y4M A;  5M10 A;  2WET A;  2WBA A;  1IJH A;  3CGD A;  4H4P A;  1TDK A;  5CKU A;  4J31 A;  2FJD A;  1MOK A;  1NHQ A;  3ABV A;  1LJ1 A;  1RYI A;  2XFQ A;  4GRT A;  1B5Q A;  1OJT A;  2YLW A;  1PHH A;  3CPJ G;  2YR6 A;  2ACZ A;  4CCQ A;  4USR A;  3NHO X;  3AYI A;  3O0H A;  2BK4 A;  4U8K A;  4U8N A;  2A87 A;  1H83 A;  1M6I A;  2GEW A;  3PS9 A;  4GAV A;  2BAC A;  3T2K A;  1ZDL A;  4PAA A;  2AQJ A;  2QCU A;  2O9Z A;  3AE6 A;  1X31 B;  2R46 A;  2R4E A;  1CF3 A;  2R4J A;  2PHH A;  2BA9 A;  2E5V A;  4U8J A;  1IUU A;  3GMC A;  3GWF A;  2X3N A;  2XVF A;  1NHR A;  4AOX A;  2XFU A;  2GQF A;  2VZ2 A;  4J57 A;  5IPY A;  4UDQ A;  4JNA A;  2ZZC A;  4OVI A;  2ZBW A;  3VR9 A;  2BXS A;  3NLC A;  4EQW A;  3CMM A;  2WU5 A;  1NG3 A;  3K30 A;  4GAP A;  4OPT A;  3SXI A;  3SZF A;  3CGB A;  4CCR A;  2RAB A;  4H4Z A;  3T37 A;  3KPF A;  4H50 A;  4H4S A;  3CIR A;  1N4W A;  2JB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...