3KU9A

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
467
structure length
467
Chain Sequence
TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
rcsb
source organism Zea mays
total genus 164
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ku9A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3ku9A02
5M0ZA 2WU5A 1HYUA 4U8NA 2CFYA 4OPUA 3S61A 1GETA 2V3BA 3QSEA 3UKPA 4H2PA 2B9YA 1H84A 2YLTA 1O95A 2WHDA 5JCIA 3CPIG 3UTHA 4U2TA 1S2YA 3SM8A 3AEAA 3NTDA 3UP5A 2WOWA 4DGKA 1GREA 1BZLA 2GB0A 1EL9A 5TR3A 3UOVA 3K30A 5HYMA 4GRTA 2AR8A 1F6MA 5U25A 4C74A 1E1LA 4C3YA 2EQ6A 1IUSA 3NK1X 1B37A 3CGDA 4K8DA 1H82A 4CNJA 2B76A 2XLTA 2WDQA 4CCQA 1ZP0A 2RABA 1EL5A 5JCKA 3F8PA 2GQWA 1H83A 4DSGA 1E1KA 3DMEA 1SEZA 1CC4A 4Z44A 2AQJA 2XVFA 1PBCA 2OLOA 3K7QX 2OALA 4YSYA 3H8IA 3REDA 3UKAA 1COYA 1CC2A 3ICSA 1CC6A 2YG3A 2WP9A 1ZDLA 3NH3X 3ISHA 4OVIA 5FS7A 4CNKA 1DXLA 3DH9A 2JBVA 4LIIA 1NG4A 4TM4A 5KVHA 3NNEA 2O9ZA 4K7ZA 1L9CA 1MOKA 3UKFA 4EQRA 2UZZA 2R4EA 2VZ2A 2WBAA 2E1MA 4H4XA 3L8KA 2WEUA 3H4KA 2XCGA 4Y4LA 2ZZBA 5HXIA 5KXJA 1ZX9A 3QVRA 3UOYA 4GCMA 1BKWA 2C65A 4H4RA 2Q0LA 2YLWA 4JQ9A 2YG4A 1XPQA 3UKQA 1N4UA 2XFPA 1NHSA 4H4PA 2BCPA 1TYTA 3ITJA 5GSNA 1FOHA 3SFDA 4YKGA 2BS2A 3RP8A 4JN9A 5EB5A 2GVCA 1Z6LA 4H4ZA 1E39A 4BV6A 3BI4A 3RHAA 3DK4A 1FECA 2I0ZA 3KLJA 1KSUA 3KPFA 4H4UA 4PABA 4A99A 3DA1A 1CJ2A 1PJ7A 2YR6A 3AE3A 1LQUA 3FBSA 2JK6A 1DODA 4YSZA 2OAMA 1KDGA 1PHHA 5DBJA 1NAAA 4ADWA 1TRBA 3KU9A 3HZLA 1M64A 4B69A 2YG6A 4H4SA 3DJGX 4U8OA 4U2SA 3AE7A 4P9SA 2Y6RA 3K7TA 3UTEA 4OPLA 5IQ4A 4D04A 1F8SA 2JB1A 2ZBWA 5FS9A 4U8LA 2WU2A 3ADAB 2X8GA 1H7WA 4ECHA 3PS9A 1D7LA 4JY3A 3LZXA 3GWFA 4C77A 1L9EA 2RGOA 2XFNA 1Y56A 3ZDNA 3B6DA 1H7XA 2HQMA 1BGNA 3SFEA 1JU2A 1REOA 2JKCA 4ICYA 3AWIA 1BGJA 4WX1A 2VOUA 4UDPA 1JRZA 3AE8A 1S2QA 3I3LA 1K0LA 2AAQA 5FS8A 3CGBA 1RP0A 1E1NA 5EOWA 3VRDB 1PBFA 3CGEA 4DNAA 2WP6A 1RYIA 2BK3A 1PBDA 3M12A 1LPFA 1XANA 4NTDA 4OCGA 4REKA 3LB8A 5HY5A 4YWOA 2YR5A 4PAAA 3EPTA 4E0VA 1D4DA 1CF3A 1ZY8A 4CBQA 1B8SA 1D4CA 3BNUA 4EM3A 1FEBA 3KKJA 1OJTA 4B64A 4M52A 4NTEA 4EMJA 2V3AA 2YAUA 3AD8B 3QVPA 3AE1A 3NYFA 5JCMA 3O0HA 3P1WA 3CIRA 1KFYA 1JRXA 1DJQA 3P4PA 1N1PA 4Z24A 4YTPA 3QJ4A 4IA6A 3VRBA 3PVCA 4RG3A 1DJNA 1FL2A 3EAOA 2GF3A 5IQ1A 3QSMA 2YM1A 1YQ4A 3AEGA 2FJBA 3V3NA 1GPEA 1L9DA 2EQ9A 2CDUA 2WPFA 2Y6QA 1F8RA 1UKVG 2GMHA 2VRMA 3JSKA 4H2RA 4U2LA 2IVDA 1MO9A 3IF9A 4CY8A 1NG3A 3G5SA 1P2EA 2PYXA 2QA1A 5U63A 1GERA 2CULA 2EQ7A 2FJAA 2XVHA 2JB2A 3UOXA 1ELIA 4H2NA 4K22A 4BK3A 2R45A 1QLBA 2YLSA 4J34A 5U1OA 3ALJA 1M6IA 1ZOYA 1CJ4A 4AT0A 5KWFA 2W0HA 2Q0KA 4H7UA 4B1BA 1LQTA 4EIQA 3UTFA 2R46A 3GDNA 3GRTA 3WE0A 2RGJA 1KF6A 3C96A 2C76A 3CN8A 3CNSA 2ZZ0A 3E1TA 3M13A 2XLRA 1DOEA 4K2XA 3CNTA 2BA9A 2WP5A 3C4NA 3COXA 4YTNA 3AE5A 4Z26A 4LA1A 3BHFA 1ZK7A 2BYBA 3DJJA 3LXDA 5C2TA 2GR0A 1N4WA 2WOVA 2FJEA 1GSNA 2PHHA 4ZN0A 5LV9A 1OJDA 4K5RA 3LJPA 1BWCA 1IUVA 4Y4NA 4TM1A 3L1RA 2H88A 3UKKA 1IUUA 2A89A 2C66A 4NTCA 3FG2P 2C7GA 2Z5XA 4OPTA 4U8KA 3GRSA 3T37A 5J60A 2XFOA 1Y0PA 4JNQA 2A8XA 5GRTA 5JCLA 3DGZA 2ACZA 2WQYA 3EF6A 4XXGA 3F8DA 1Q1RA 1ONFA 2BXSA 4I58A 2R0CA 4K5SA 1GXFA 1PBBA 1ZKQA 2BXRA 1RSGA 1GRAA 3AD9B 3NRNA 2JAEA 5CKUA 3P4QA 3GMBA 1O94A 2GH5A 4B65A 2BABA 4NEVA 2GRTA 1K4QA 3GD4A 4JDRA 2VRLA 3M0OA 1NENA 1VG9A 1Y56B 1LTXR 1YQZA 2XYOA 2YVFA 4MJWA 4IA5A 1GESA 3V76A 4TLXA 3LADA 4GF7A 2V61A 1ZOVA 1EL8A 2OLNA 3KD9A 3NYEA 1NHQA 5EB4A 4GR1A 3URHA 3UKHA 1VRQB 3PO7A 4TM3A 2GQFA 2XDOA 3AYLA 1K0IA 1Q9IA 3BHKA 4B66A 1ZMCA 2ZZCA 4YSXA 3BNMA 5ER0A 1IUTA 3R9UA 4EM4A 1NPXA 4OPGA 3CGCA 2BS4A 2GR2A 1P2HA 1GOSA 3NK0X 2GEWA 4EQSA 4B68A 3OC4A 5J7XA 4O5QA 2BCGG 2C67A 1QO8A 4J2WA 2VQ7A 1PBEA 3G5QA 2YG7A 3AYIA 2XLSA 1NDAA 4YTMA 3UKLA 4CCRA 3NN6X 4WCTA 2XLUA 2GR1A 2F5ZA 3AE2A 3NLCA 5FS6A 2XVJA 5C3JA 4EMWA 2YLXA 1TDKA 4HA6A 1K0JA 3GYJA 4KPRA 1NEKA 1QJDA 1GALA 3CTYA 3NKSA 4YKFA 5FMHA 4KX6A 2DKIA 3K7MX 4UDRA 2WOIA 5KOXA 3UOZA 4GDPA 4Y4MA 3D1CA 4GDEA 4FX9A 4H4TA 4OPDA 4IVMB 1JNZA 1CBOA 2XVEA 1IUWA 4X4JA 3GWDA 1O5WA 1PS9A 2VVLG 4USQA 3NT6A 5KRQA 1MXTA 3ATQA 5BRTA 2VVLA 4YXDA 2V6OA 2QCUA 1GRFA 4LU6A 3LOVA 3II4A 1F3PA 2QAEA 3NN0X 2YR4A 3IC9A 3I6DA 1FEAA 4H50A 3DJEA 2YG5A 4J33A 4USRA 2GAHB 1KNRA 1D7YA 3AECA 3CNDA 4H4VA 4UDQA 4U8IA 1NHRA 3NIXA 2R0GA 2QA2A 3NGCX 1H86A 2X50A 1ZMDA 3C4AA 4OPCA 3SGLA 3KA7A 4D03A 1GTEA 2WPCA 3DK8A 3IHMA 4BJZA 1XHCA 3FIMB 2BC1A 1YKJA 5BUKA 3NTAA 4ZCCA 1TDEA 4H4QA 3H8LA 1DOBA 3V3OA 2NPXA 4BK1A 5JCNA 2X8CA 3LZWA 3P4RA 4N9XA 4JY2A 4NEWA 2XFQA 3DJDA 4H4YA 4Z25A 1GRGA 2DKHA 4Z43A 1GRBA 5IPYA 2C72A 2A87A 2ARDA 1GTHA 4J36A 3SQPA 4A6NB 3DK9A 4X9MA 2WDVA 2C70A 3VR9A 4UP3A 4BURA 2XLPA 3AE6A 3AEBA 4H4WA 1D5TA 4CRTA 1S3BA 4U8JA 2YM2A 3BI5A 5BVAA 1DNCA 2IIDA 2RGHA 3AD7B 3UCLA 4B67A 2Q7VA 5KOWA 2BK4A 2OA1A 1TDFA 1GT8A 1W4XA 3BI2A 4J31A 3ZYXA 4AOXA 3QFAA 1OJ9A 1TYPA 2C75A 1TDOA 4A79A 1B4VA 3AXBA 4APNA 2J3NA 3FMWA 2TMDA 2APGA 5CQFA 4A6NA 3D8XA 1IJHA 2FBWA 3Q9TA 4J57A 3CNPA 3VQRA 2B9WA 2H89A 3QSSA 4RSLA 3B3RA 1YQ3A 3AB1A 4AT2A 3EANA 4CY6A 3CNJA 3UTGA 1AOGA 2GAGB 1PXBA 1X31B 3AEFA 4AP3A 1JEHA 1FCDA 2V60A 2BC0A 4AP1A 2WS3A 3GD3A 4EQXA 5BULA 2FJDA 5KVIA 2C73A 1JNRA 2GR3A 4RG4A 2C3CA 1EBDA 1GRTA 2WETA 1VQWA 4EQWA 4YT0A 3OZ2A 1GNDA 1V59A 4AOSA 3P9UA 3Q6JA 2JB3A 2IVEA 2B7RA 3AE4A 4Z2TA 2B9XA 3NHOX 2BS3A 3VRAA 3ALLA 5HHFA 2YLZA 2R0PA 3S5WA 1GV4A 2WPEA 3RP7A 4EIPA 4Z2UA 1H81A 3IHGA 2YWLA 1CJ3A 2EQ8A 2X8HA 2Z5YA 4H2QA 3ABVA 5L46A 4A7AA 2Q6UA 2C64A 1KSSA 2CVJA 3G5RA 4GUVA 3GYIA 1EL7A 1H6VA 1LVLA 1TDNA 4FK1C 2E5VA 3DGHA 2WESA 2WDRA 3GMCA 3ICTA 2R4JA 3CPJG 4NZHA 4BJYA 1PJ5A 2YQUA 1VG0A 4TM0A 1DOCA 1KNPA 1LJ1A 3ALMA 4X9NA 1CL0A 2GMJA 2X99A 2TPRA 4B63A 1PXAA 3P4SA 4I59A 4BK2A 1OJAA 3AYJA 3GSIA 4J56A 4JNAA 2C3DA 4XWRA 2BK5A 3NG7X 2XVIA 1BF3A 1E1MA 4FK1A 2R9ZA 3FPZA 3NYCA 1VDCA 4HB9A 5EBKA 1YY5A 4U8MA 1GRHA 4EMIA 1CHUA 4Z2RA 4FDCB 1E7PA 1PXCA 1PN0A 2YLRA 3ATRA 4IV9A 3RNMA 3GDPA 3AE9A 1JOAA 2YVGA 3CPHG 1B5QA 3VR8A 1F8WA 1Q1WA 1E6EA 3AEDA 2XFUA 4YSHA 3F8RA 1D4EA 2GV8A 2VVMA 4DSHA 4A5LA 2NVKX 1N4VA 2V5ZA 1NHPA 3RP6A 1LV0A 2B7SA 2X3NA 2YVJA 1CJCA 4IVOB 1S3EA 4C3XA 4TLZA 4O5UA 4U8PA 4A9WA 1PJ6A 3IWAA 3AEEA 4XWZA 4OPIA 3UP4A 1L0VA 3ICRA 1GEUA 1IUXA 1PDHA 3QFBA 2E4GA 3NK2X 1OJCA 1XDIA 1JRYA 2BACA 2VQBA 5M10A 4A65A 4C5OA 3KVEA 4ZCDA
chains in the Genus database with same CATH superfamily
5M0ZA 2WU5A 1HYUA 4U8NA 2CFYA 4OPUA 3S61A 1GETA 2V3BA 3QSEA 3UKPA 4H2PA 2B9YA 1H84A 2YLTA 1O95A 2WHDA 5JCIA 3CPIG 3UTHA 4U2TA 1S2YA 4G6GA 3AEAA 3NTDA 3SM8A 2WOWA 3UP5A 1GREA 4DGKA 1BZLA 4G74A 2GB0A 1EL9A 5TR3A 3UOVA 3K30A 5HYMA 4GRTA 2AR8A 1F6MA 5U25A 4C74A 1E1LA 4C3YA 2EQ6A 1IUSA 3NK1X 1B37A 3CGDA 4K8DA 1H82A 4CNJA 2B76A 2XLTA 2WDQA 4CCQA 1ZP0A 2RABA 1EL5A 5JCKA 3F8PA 2GQWA 1H83A 4DSGA 1E1KA 3DMEA 1SEZA 1CC4A 4Z44A 2AQJA 2XVFA 1PBCA 2OLOA 3K7QX 2BRYA 2OALA 4YSYA 3H8IA 3REDA 3UKAA 1COYA 1CC2A 3ICSA 1CC6A 2YG3A 2WP9A 1ZDLA 3NH3X 3ISHA 4OVIA 5FS7A 4CNKA 1DXLA 3DH9A 2JBVA 4LIIA 1NG4A 4TM4A 5KVHA 3NNEA 2O9ZA 4K7ZA 1L9CA 2BRAA 1MOKA 3UKFA 4EQRA 2UZZA 3KPKA 2R4EA 3T2KA 2VZ2A 2WBAA 2E1MA 4H4XA 3L8KA 2WEUA 3H4KA 2XCGA 4Y4LA 2ZZBA 5HXIA 5KXJA 1ZX9A 3QVRA 3UOYA 4GCMA 1BKWA 2C65A 4H4RA 2Q0LA 2YLWA 4JQ9A 4II3A 2YG4A 1XPQA 3UKQA 1N4UA 2XFPA 1NHSA 4H4PA 2BCPA 1TYTA 3ITJA 5GSNA 1FOHA 3SFDA 4YKGA 2BS2A 3RP8A 4JN9A 5EB5A 2GVCA 1Z6LA 4H4ZA 1E39A 4BV6A 3BI4A 3RHAA 3DK4A 1FECA 2I0ZA 3KLJA 1KSUA 3KPFA 4G6HA 4H4UA 4PABA 3DA1A 1CJ2A 1PJ7A 2YR6A 3AE3A 4G73A 1LQUA 3FBSA 2JK6A 1DODA 4YSZA 2OAMA 1KDGA 1PHHA 5DBJA 1NAAA 4ADWA 1TRBA 3KU9A 3HZLA 1M64A 4B69A 2YG6A 4H4SA 5KNLA 3DJGX 4GAVA 4U2SA 4U8OA 3AE7A 4P9SA 2Y6RA 3SZ0A 4NWZA 3K7TA 3UTEA 4OPLA 5IQ4A 4D04A 1F8SA 2JB1A 2ZBWA 5FS9A 4U8LA 2WU2A 3ADAB 2X8GA 1H7WA 4ECHA 3PS9A 1D7LA 4JY3A 3LZXA 3GWFA 4C77A 1L9EA 2RGOA 2XFNA 1Y56A 3ZDNA 3B6DA 1H7XA 2HQMA 1BGNA 3SFEA 1JU2A 1REOA 2JKCA 4ICYA 3AWIA 1BGJA 4WX1A 2VOUA 4UDPA 1JRZA 3AE8A 1S2QA 3I3LA 1K0LA 2AAQA 5FS8A 3CGBA 1RP0A 1E1NA 5EOWA 3VRDB 1PBFA 3CGEA 2C4CA 2WP6A 4DNAA 1RYIA 2BK3A 1PBDA 3M12A 1LPFA 1XANA 4NTDA 4OCGA 4REKA 3LB8A 5HY5A 4YWOA 2YR5A 4PAAA 3EPTA 4E0VA 1D4DA 1CF3A 1ZY8A 4CBQA 1B8SA 1D4CA 3BNUA 4EM3A 5KMSA 1FEBA 3KKJA 1OJTA 4B64A 4M52A 4NTEA 4EMJA 2V3AA 2YAUA 3AD8B 3QVPA 3AE1A 3NYFA 5JCMA 3O0HA 3P1WA 3CIRA 1KFYA 1JRXA 1DJQA 3P4PA 1N1PA 4Z24A 4YTPA 3QJ4A 4IA6A 3VRBA 3PVCA 4RG3A 1DJNA 1FL2A 3EAOA 3T2YA 2GF3A 5IQ1A 3QSMA 2YM1A 1YQ4A 3AEGA 2FJBA 3V3NA 1GPEA 1L9DA 2CDUA 2EQ9A 2WPFA 2Y6QA 1F8RA 1UKVG 2GMHA 2VRMA 3JSKA 4H2RA 4U2LA 2IVDA 1MO9A 3IF9A 4CY8A 1NG3A 3G5SA 1P2EA 2PYXA 2QA1A 5U63A 1GERA 2CULA 2EQ7A 2FJAA 2XVHA 2JB2A 3UOXA 1ELIA 4H2NA 4K22A 4BK3A 2R45A 1QLBA 2YLSA 4J34A 5U1OA 3ALJA 1M6IA 1ZOYA 1CJ4A 4AT0A 5KWFA 2W0HA 2Q0KA 4H7UA 4B1BA 1LQTA 4EIQA 3UTFA 2R46A 3GDNA 3GRTA 3WE0A 2RGJA 1KF6A 3C96A 2C76A 3CN8A 3CNSA 2ZZ0A 3E1TA 3M13A 2XLRA 1DOEA 4K2XA 3CNTA 2BA9A 2WP5A 3C4NA 3COXA 3T14A 3AE5A 4YTNA 4LA1A 4Z26A 3BHFA 1ZK7A 2BYBA 3DJJA 3LXDA 5C2TA 2GR0A 1N4WA 2WOVA 2FJEA 1GSNA 2PHHA 4ZN0A 5LV9A 1OJDA 4K5RA 3LJPA 1BWCA 1IUVA 4Y4NA 4TM1A 3L1RA 2H88A 3UKKA 1IUUA 2A89A 2C66A 3HYXA 4G9KA 4NTCA 3FG2P 2C7GA 2Z5XA 4OPTA 4U8KA 3GRSA 3T37A 5J60A 2XFOA 1Y0PA 4JNQA 2A8XA 5GRTA 5JCLA 3DGZA 2ACZA 2WQYA 3EF6A 4XXGA 3F8DA 1Q1RA 1ONFA 2BXSA 4I58A 2R0CA 3SYIA 4K5SA 1GXFA 1PBBA 1ZKQA 2BXRA 1RSGA 1GRAA 3AD9B 3NRNA 2JAEA 5CKUA 3P4QA 3GMBA 1O94A 2GH5A 4B65A 2BABA 4NEVA 2GRTA 1K4QA 3GD4A 4JDRA 2VRLA 3M0OA 1NENA 1VG9A 1Y56B 1LTXR 1YQZA 2XYOA 2YVFA 4MJWA 4IA5A 1GESA 3V76A 4TLXA 3LADA 4GF7A 2V61A 1ZOVA 1EL8A 2OLNA 3KD9A 3NYEA 1NHQA 5EB4A 4GR1A 3URHA 3UKHA 1VRQB 3PO7A 4TM3A 2GQFA 2XDOA 3AYLA 1K0IA 1Q9IA 3BHKA 4B66A 1ZMCA 2ZZCA 3SZCA 3BNMA 5ER0A 4YSXA 1IUTA 3R9UA 4EM4A 1NPXA 4OPGA 3CGCA 2BS4A 2GR2A 1P2HA 1GOSA 3NK0X 2GEWA 4EQSA 4B68A 3OC4A 5J7XA 4O5QA 2BCGG 2C67A 1QO8A 4J2WA 2VQ7A 1PBEA 3G5QA 2YG7A 3AYIA 2XLSA 1NDAA 4YTMA 3UKLA 4CCRA 3NN6X 4WCTA 2XLUA 4A99A 2GR1A 2F5ZA 3AE2A 3NLCA 5FS6A 2XVJA 5C3JA 4EMWA 2YLXA 1TDKA 4HA6A 1K0JA 3GYJA 4KPRA 1NEKA 1QJDA 1GALA 3CTYA 3NKSA 4YKFA 5KMPA 5FMHA 4KX6A 2DKIA 3K7MX 4UDRA 2WOIA 5KOXA 3UOZA 4GDPA 4Y4MA 3D1CA 4GDEA 4FX9A 4H4TA 4OPDA 4IVMB 1JNZA 1CBOA 2XVEA 1IUWA 4X4JA 3GWDA 1O5WA 1PS9A 2VVLG 4USQA 3NT6A 5KRQA 1MXTA 3ATQA 5BRTA 2VVLA 4YXDA 2V6OA 2QCUA 5KMRA 1GRFA 4LU6A 3LOVA 3II4A 1F3PA 2QAEA 3NN0X 2YR4A 3IC9A 3I6DA 1FEAA 4H50A 3GYXA 3DJEA 2YG5A 4J33A 4USRA 2GAHB 1KNRA 1D7YA 3AECA 3CNDA 4H4VA 4UDQA 4U8IA 1NHRA 4II2A 3NIXA 3T2ZA 2R0GA 2QA2A 3NGCX 1H86A 2X50A 1ZMDA 3C4AA 4OPCA 3SGLA 3KA7A 4D03A 1GTEA 2WPCA 3DK8A 3IHMA 4BJZA 1XHCA 3SZFA 3FIMB 2BC1A 1YKJA 5BUKA 3NTAA 4ZCCA 1TDEA 4H4QA 3H8LA 1DOBA 3CMMA 3V3OA 2NPXA 4BK1A 5JCNA 2X8CA 3LZWA 3P4RA 4N9XA 4JY2A 4NEWA 2XFQA 3DJDA 4H4YA 4Z25A 1GRGA 2DKHA 4Z43A 1GRBA 5IPYA 2C72A 2A87A 2ARDA 1GTHA 4J36A 3SQPA 4A6NB 3DK9A 4X9MA 2WDVA 2C70A 3VR9A 4UP3A 4BURA 2XLPA 3AE6A 3AEBA 4H4WA 1D5TA 4CRTA 1S3BA 4U8JA 2YM2A 3BI5A 5BVAA 1DNCA 2IIDA 2RGHA 3AD7B 3UCLA 4B67A 2Q7VA 5KOWA 2BK4A 2OA1A 3T31A 1TDFA 1GT8A 1W4XA 3BI2A 4J31A 3ZYXA 4AOXA 3QFAA 1OJ9A 1TYPA 2C75A 1TDOA 4A79A 1B4VA 3AXBA 4APNA 2J3NA 3FMWA 2TMDA 2APGA 5CQFA 4A6NA 3D8XA 1IJHA 2FBWA 3Q9TA 4J57A 3CNPA 3VQRA 2B9WA 2H89A 3QSSA 4RSLA 3B3RA 1YQ3A 3AB1A 4AT2A 3EANA 4CY6A 3CNJA 3UTGA 1AOGA 2GAGB 3HYVA 1PXBA 1X31B 3AEFA 4AP3A 1JEHA 1FCDA 2V60A 2BC0A 4AP1A 2WS3A 3GD3A 4EQXA 5BULA 2FJDA 5KVIA 2C73A 1JNRA 2GR3A 4RG4A 2C3CA 1EBDA 1GRTA 2WETA 1VQWA 4EQWA 4YT0A 3OZ2A 1GNDA 1V59A 4AOSA 3P9UA 3Q6JA 2JB3A 2IVEA 2B7RA 3AE4A 4Z2TA 2B9XA 3NHOX 2BS3A 3VRAA 3ALLA 5HHFA 2YLZA 2R0PA 3S5WA 1GV4A 2WPEA 3RP7A 4EIPA 4Z2UA 1H81A 3IHGA 2YWLA 1CJ3A 2EQ8A 2X8HA 2Z5YA 4H2QA 3ABVA 5L46A 4A7AA 2Q6UA 2C64A 3SY4A 1KSSA 2CVJA 3SZWA 3G5RA 4GUVA 3GYIA 1EL7A 1H6VA 1LVLA 1TDNA 4FK1C 2E5VA 3DGHA 2WESA 2WDRA 3GMCA 3ICTA 2R4JA 3CPJG 4NZHA 4BJYA 1PJ5A 2YQUA 1VG0A 4TM0A 1DOCA 1KNPA 1LJ1A 3ALMA 4X9NA 1CL0A 2GMJA 2X99A 2TPRA 4B63A 1PXAA 3P4SA 4I59A 4BK2A 1OJAA 3AYJA 3GSIA 4J56A 4JNAA 2C3DA 4XWRA 2BK5A 3NG7X 2XVIA 1BF3A 1E1MA 4FK1A 2R9ZA 3FPZA 3NYCA 1VDCA 4HB9A 5EBKA 1YY5A 4U8MA 1GRHA 4EMIA 3T0KA 1CHUA 4Z2RA 4FDCB 1E7PA 1PXCA 1PN0A 2YLRA 3ATRA 4IV9A 3RNMA 3GDPA 3AE9A 1JOAA 2YVGA 3CPHG 1B5QA 3VR8A 1F8WA 1Q1WA 1E6EA 3AEDA 2XFUA 4YSHA 3F8RA 1D4EA 2GV8A 2VVMA 4DSHA 4A5LA 2NVKX 1N4VA 4NNJA 2V5ZA 1NHPA 3RP6A 4GAPA 1LV0A 2B7SA 2X3NA 2YVJA 1CJCA 4IVOB 1S3EA 3SX6A 4C3XA 4TLZA 4O5UA 4U8PA 4A9WA 1PJ6A 3IWAA 3SXIA 3AEEA 4XWZA 4OPIA 3UP4A 1L0VA 3ICRA 1GEUA 1IUXA 1PDHA 3QFBA 2E4GA 3NK2X 1OJCA 1XDIA 5KMQA 1JRYA 2BACA 2VQBA 3HYWA 5M10A 4A65A 4C5OA 3KVEA 4ZCDA
chains in the Genus database with same CATH topology
5M0ZA 2WU5A 1HYUA 4U8NA 2CFYA 4OPUA 3S61A 1GETA 2V3BA 3QSEA 3UKPA 4H2PA 2B9YA 1H84A 2YLTA 1O95A 2WHDA 5JCIA 3CPIG 3UTHA 4U2TA 1S2YA 4G6GA 3AEAA 3NTDA 3SM8A 2WOWA 3UP5A 1GREA 4DGKA 1BZLA 4G74A 2GB0A 1EL9A 5TR3A 3UOVA 3K30A 5HYMA 4GRTA 2AR8A 1F6MA 5U25A 4C74A 1E1LA 4C3YA 2EQ6A 1IUSA 3NK1X 1B37A 3CGDA 4K8DA 1H82A 4CNJA 2B76A 2XLTA 2WDQA 4CCQA 1ZP0A 2RABA 1EL5A 5JCKA 3F8PA 2GQWA 1H83A 4DSGA 1E1KA 3DMEA 1SEZA 1CC4A 4Z44A 2AQJA 2XVFA 1PBCA 2OLOA 3K7QX 2BRYA 2OALA 4YSYA 3H8IA 3REDA 3UKAA 1COYA 1CC2A 3ICSA 1CC6A 2YG3A 2WP9A 1ZDLA 3NH3X 3ISHA 4OVIA 5FS7A 4CNKA 1DXLA 3DH9A 2JBVA 4LIIA 1NG4A 4TM4A 5KVHA 3NNEA 2O9ZA 4K7ZA 1L9CA 2BRAA 1MOKA 3UKFA 4EQRA 2UZZA 3KPKA 2R4EA 3T2KA 2VZ2A 2WBAA 2E1MA 4H4XA 3L8KA 2WEUA 3H4KA 2XCGA 4Y4LA 2ZZBA 5HXIA 5KXJA 1ZX9A 3QVRA 3UOYA 4GCMA 1BKWA 2C65A 4H4RA 2Q0LA 2YLWA 4JQ9A 4II3A 2YG4A 1XPQA 3UKQA 1N4UA 2XFPA 1NHSA 4H4PA 2BCPA 1TYTA 3ITJA 5GSNA 1FOHA 3SFDA 4YKGA 2BS2A 3RP8A 4JN9A 5EB5A 2GVCA 1Z6LA 4H4ZA 1E39A 4BV6A 3BI4A 3RHAA 3DK4A 1FECA 2I0ZA 3KLJA 1KSUA 3KPFA 4G6HA 4H4UA 4PABA 3DA1A 1CJ2A 1PJ7A 2YR6A 3AE3A 4G73A 1LQUA 3FBSA 2JK6A 1DODA 4YSZA 2OAMA 1KDGA 1PHHA 5DBJA 1NAAA 4ADWA 1TRBA 3KU9A 3HZLA 1M64A 4B69A 2YG6A 4H4SA 5KNLA 3DJGX 4GAVA 4U2SA 4U8OA 3AE7A 4P9SA 2Y6RA 3SZ0A 4NWZA 3K7TA 3UTEA 4OPLA 5IQ4A 4D04A 1F8SA 2JB1A 2ZBWA 5FS9A 4U8LA 2WU2A 3ADAB 2X8GA 1H7WA 4ECHA 3PS9A 1D7LA 4JY3A 3LZXA 3GWFA 4C77A 1L9EA 2RGOA 2XFNA 1Y56A 3ZDNA 3B6DA 1H7XA 2HQMA 1BGNA 3SFEA 1JU2A 1REOA 2JKCA 4ICYA 3AWIA 1BGJA 4WX1A 2VOUA 4UDPA 1JRZA 3AE8A 1S2QA 3I3LA 1K0LA 2AAQA 5FS8A 3CGBA 1RP0A 1E1NA 5EOWA 3VRDB 1PBFA 3CGEA 2C4CA 2WP6A 4DNAA 1RYIA 2BK3A 1PBDA 3M12A 1LPFA 1XANA 4NTDA 4OCGA 4REKA 3LB8A 5HY5A 4YWOA 2YR5A 4PAAA 3EPTA 4E0VA 1D4DA 1CF3A 1ZY8A 4CBQA 1B8SA 1D4CA 3BNUA 4EM3A 5KMSA 1FEBA 3KKJA 1OJTA 4B64A 4M52A 4NTEA 4EMJA 2V3AA 2YAUA 3AD8B 3QVPA 3AE1A 3NYFA 5JCMA 3O0HA 3P1WA 3CIRA 1KFYA 1JRXA 1DJQA 3P4PA 1N1PA 4Z24A 4YTPA 3QJ4A 4IA6A 3VRBA 3PVCA 4RG3A 1DJNA 1FL2A 3EAOA 3T2YA 2GF3A 5IQ1A 3QSMA 2YM1A 1YQ4A 3AEGA 2FJBA 3V3NA 1GPEA 1L9DA 2CDUA 2EQ9A 2WPFA 2Y6QA 1F8RA 1UKVG 2GMHA 2VRMA 3JSKA 4H2RA 4U2LA 2IVDA 1MO9A 3IF9A 4CY8A 1NG3A 3G5SA 1P2EA 2PYXA 2QA1A 5U63A 1GERA 2CULA 2EQ7A 2FJAA 2XVHA 2JB2A 3UOXA 1ELIA 4H2NA 4K22A 4BK3A 2R45A 1QLBA 2YLSA 4J34A 5U1OA 3ALJA 1M6IA 1ZOYA 1CJ4A 4AT0A 5KWFA 2W0HA 2Q0KA 4H7UA 4B1BA 1LQTA 4EIQA 3UTFA 2R46A 3GDNA 3GRTA 3WE0A 2RGJA 1KF6A 3C96A 2C76A 3CN8A 3CNSA 2ZZ0A 3E1TA 3M13A 2XLRA 1DOEA 4K2XA 3CNTA 2BA9A 2WP5A 3C4NA 3COXA 3T14A 3AE5A 4YTNA 4LA1A 4Z26A 3BHFA 1ZK7A 2BYBA 3DJJA 3LXDA 5C2TA 2GR0A 1N4WA 2WOVA 2FJEA 1GSNA 2PHHA 4ZN0A 5LV9A 1OJDA 4K5RA 3LJPA 1BWCA 1IUVA 4Y4NA 4TM1A 3L1RA 2H88A 3UKKA 1IUUA 2A89A 2C66A 3HYXA 4G9KA 4NTCA 3FG2P 2C7GA 2Z5XA 4OPTA 4U8KA 3GRSA 3T37A 5J60A 2XFOA 1Y0PA 4JNQA 2A8XA 5GRTA 5JCLA 3DGZA 2ACZA 2WQYA 3EF6A 4XXGA 3F8DA 1Q1RA 1ONFA 2BXSA 4I58A 2R0CA 3SYIA 4K5SA 1GXFA 1PBBA 1ZKQA 2BXRA 1RSGA 1GRAA 3AD9B 3NRNA 2JAEA 5CKUA 3P4QA 3GMBA 1O94A 2GH5A 4B65A 2BABA 4NEVA 2GRTA 1K4QA 3GD4A 4JDRA 2VRLA 3M0OA 1NENA 1VG9A 1Y56B 1LTXR 1YQZA 2XYOA 2YVFA 4MJWA 4IA5A 1GESA 3V76A 4TLXA 3LADA 4GF7A 2V61A 1ZOVA 1EL8A 2OLNA 3KD9A 3NYEA 1NHQA 5EB4A 4GR1A 3URHA 3UKHA 1VRQB 3PO7A 4TM3A 2GQFA 2XDOA 3AYLA 1K0IA 1Q9IA 3BHKA 4B66A 1ZMCA 2ZZCA 3SZCA 3BNMA 5ER0A 4YSXA 1IUTA 3R9UA 4EM4A 1NPXA 4OPGA 3CGCA 2BS4A 2GR2A 1P2HA 1GOSA 3NK0X 2GEWA 4EQSA 4B68A 3OC4A 5J7XA 4O5QA 2BCGG 2C67A 1QO8A 4J2WA 2VQ7A 1PBEA 3G5QA 2YG7A 3AYIA 2XLSA 1NDAA 4YTMA 3UKLA 4CCRA 3NN6X 4WCTA 2XLUA 4A99A 2GR1A 2F5ZA 3AE2A 3NLCA 5FS6A 2XVJA 5C3JA 4EMWA 2YLXA 1TDKA 4HA6A 1K0JA 3GYJA 4KPRA 1NEKA 1QJDA 1GALA 3CTYA 3NKSA 4YKFA 5KMPA 5FMHA 4KX6A 2DKIA 3K7MX 4UDRA 2WOIA 5KOXA 3UOZA 4GDPA 4Y4MA 3D1CA 4GDEA 4FX9A 4H4TA 4OPDA 4IVMB 1JNZA 1CBOA 2XVEA 1IUWA 4X4JA 3GWDA 1O5WA 1PS9A 2VVLG 4USQA 3NT6A 5KRQA 1MXTA 3ATQA 5BRTA 2VVLA 4YXDA 2V6OA 2QCUA 5KMRA 1GRFA 4LU6A 3LOVA 3II4A 1F3PA 2QAEA 3NN0X 2YR4A 3IC9A 3I6DA 1FEAA 4H50A 3GYXA 3DJEA 2YG5A 4J33A 4USRA 2GAHB 1KNRA 1D7YA 3AECA 3CNDA 4H4VA 4UDQA 4U8IA 1NHRA 4II2A 3NIXA 3T2ZA 2R0GA 2QA2A 3NGCX 1H86A 2X50A 1ZMDA 3C4AA 4OPCA 3SGLA 3KA7A 4D03A 1GTEA 2WPCA 3DK8A 3IHMA 4BJZA 1XHCA 3SZFA 3FIMB 2BC1A 1YKJA 5BUKA 3NTAA 4ZCCA 1TDEA 4H4QA 3H8LA 1DOBA 3CMMA 3V3OA 2NPXA 4BK1A 5JCNA 2X8CA 3LZWA 3P4RA 4N9XA 4JY2A 4NEWA 2XFQA 3DJDA 4H4YA 4Z25A 1GRGA 2DKHA 4Z43A 1GRBA 5IPYA 2C72A 2A87A 2ARDA 1GTHA 4J36A 3SQPA 4A6NB 3DK9A 4X9MA 2WDVA 2C70A 3VR9A 4UP3A 4BURA 2XLPA 3AE6A 3AEBA 4H4WA 1D5TA 4CRTA 1S3BA 4U8JA 2YM2A 3BI5A 5BVAA 1DNCA 2IIDA 2RGHA 3AD7B 3UCLA 4B67A 2Q7VA 5KOWA 2BK4A 2OA1A 3T31A 1TDFA 1GT8A 1W4XA 3BI2A 4J31A 3ZYXA 4AOXA 3QFAA 1OJ9A 1TYPA 2C75A 1TDOA 4A79A 1B4VA 3AXBA 4APNA 2J3NA 3FMWA 2TMDA 2APGA 5CQFA 4A6NA 3D8XA 1IJHA 2FBWA 3Q9TA 4J57A 3CNPA 3VQRA 2B9WA 2H89A 3QSSA 4RSLA 3B3RA 1YQ3A 3AB1A 4AT2A 3EANA 4CY6A 3CNJA 3UTGA 1AOGA 2GAGB 3HYVA 1PXBA 1X31B 3AEFA 4AP3A 1JEHA 1FCDA 2V60A 2BC0A 4AP1A 2WS3A 3GD3A 4EQXA 5BULA 2FJDA 5KVIA 2C73A 1JNRA 2GR3A 4RG4A 2C3CA 1EBDA 1GRTA 2WETA 1VQWA 4EQWA 4YT0A 3OZ2A 1GNDA 1V59A 4AOSA 3P9UA 3Q6JA 2JB3A 2IVEA 2B7RA 3AE4A 4Z2TA 2B9XA 3NHOX 2BS3A 3VRAA 3ALLA 5HHFA 2YLZA 2R0PA 3S5WA 1GV4A 2WPEA 3RP7A 4EIPA 4Z2UA 1H81A 3IHGA 2YWLA 1CJ3A 2EQ8A 2X8HA 2Z5YA 4H2QA 3ABVA 5L46A 4A7AA 2Q6UA 2C64A 3SY4A 1KSSA 2CVJA 3SZWA 3G5RA 4GUVA 3GYIA 1EL7A 1H6VA 1LVLA 1TDNA 4FK1C 2E5VA 3DGHA 2WESA 2WDRA 3GMCA 3ICTA 2R4JA 3CPJG 4NZHA 4BJYA 1PJ5A 2YQUA 1VG0A 4TM0A 1DOCA 1KNPA 1LJ1A 3ALMA 4X9NA 1CL0A 2GMJA 2X99A 2TPRA 4B63A 1PXAA 3P4SA 4I59A 4BK2A 1OJAA 3AYJA 3GSIA 4J56A 4JNAA 2C3DA 4XWRA 2BK5A 3NG7X 2XVIA 1BF3A 1E1MA 4FK1A 2R9ZA 3FPZA 3NYCA 1VDCA 4HB9A 5EBKA 1YY5A 4U8MA 1GRHA 4EMIA 3T0KA 1CHUA 4Z2RA 4FDCB 1E7PA 1PXCA 1PN0A 2YLRA 3ATRA 4IV9A 3RNMA 3GDPA 3AE9A 1JOAA 2YVGA 3CPHG 1B5QA 3VR8A 1F8WA 1Q1WA 1E6EA 3AEDA 2XFUA 4YSHA 3F8RA 1D4EA 2GV8A 2VVMA 4DSHA 4A5LA 2NVKX 1N4VA 4NNJA 2V5ZA 1NHPA 3RP6A 4GAPA 1LV0A 2B7SA 2X3NA 2YVJA 1CJCA 4IVOB 1S3EA 3SX6A 4C3XA 4TLZA 4O5UA 4U8PA 4A9WA 1PJ6A 3IWAA 3SXIA 3AEEA 4XWZA 4OPIA 3UP4A 1L0VA 3ICRA 1GEUA 1IUXA 1PDHA 3QFBA 2E4GA 3NK2X 1OJCA 1XDIA 5KMQA 1JRYA 2BACA 2VQBA 3HYWA 5M10A 4A65A 4C5OA 3KVEA 4ZCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M0Z A;  2WU5 A;  1HYU A;  4U8N A;  2CFY A;  4OPU A;  3S61 A;  1GET A;  2V3B A;  3QSE A;  3UKP A;  4H2P A;  2B9Y A;  1H84 A;  2YLT A;  1O95 A;  2WHD A;  5JCI A;  3CPI G;  3UTH A;  4U2T A;  1S2Y A;  3SM8 A;  3AEA A;  3NTD A;  3UP5 A;  2WOW A;  4DGK A;  1GRE A;  1BZL A;  2GB0 A;  1EL9 A;  5TR3 A;  3UOV A;  3K30 A;  5HYM A;  4GRT A;  2AR8 A;  1F6M A;  5U25 A;  4C74 A;  1E1L A;  4C3Y A;  2EQ6 A;  1IUS A;  3NK1 X;  1B37 A;  3CGD A;  4K8D A;  1H82 A;  4CNJ A;  2B76 A;  2XLT A;  2WDQ A;  4CCQ A;  1ZP0 A;  2RAB A;  1EL5 A;  5JCK A;  3F8P A;  2GQW A;  1H83 A;  4DSG A;  1E1K A;  3DME A;  1SEZ A;  1CC4 A;  4Z44 A;  2AQJ A;  2XVF A;  1PBC A;  2OLO A;  3K7Q X;  2OAL A;  4YSY A;  3H8I A;  3RED A;  3UKA A;  1COY A;  1CC2 A;  3ICS A;  1CC6 A;  2YG3 A;  2WP9 A;  1ZDL A;  3NH3 X;  3ISH A;  4OVI A;  5FS7 A;  4CNK A;  1DXL A;  3DH9 A;  2JBV A;  4LII A;  1NG4 A;  4TM4 A;  5KVH A;  3NNE A;  2O9Z A;  4K7Z A;  1L9C A;  1MOK A;  3UKF A;  4EQR A;  2UZZ A;  2R4E A;  2VZ2 A;  2WBA A;  2E1M A;  4H4X A;  3L8K A;  2WEU A;  3H4K A;  2XCG A;  4Y4L A;  2ZZB A;  5HXI A;  5KXJ A;  1ZX9 A;  3QVR A;  3UOY A;  4GCM A;  1BKW A;  2C65 A;  4H4R A;  2Q0L A;  2YLW A;  4JQ9 A;  2YG4 A;  1XPQ A;  3UKQ A;  1N4U A;  2XFP A;  1NHS A;  4H4P A;  2BCP A;  1TYT A;  3ITJ A;  5GSN A;  1FOH A;  3SFD A;  4YKG A;  2BS2 A;  3RP8 A;  4JN9 A;  5EB5 A;  2GVC A;  1Z6L A;  4H4Z A;  1E39 A;  4BV6 A;  3BI4 A;  3RHA A;  3DK4 A;  1FEC A;  2I0Z A;  3KLJ A;  1KSU A;  3KPF A;  4H4U A;  4PAB A;  4A99 A;  3DA1 A;  1CJ2 A;  1PJ7 A;  2YR6 A;  3AE3 A;  1LQU A;  3FBS A;  2JK6 A;  1DOD A;  4YSZ A;  2OAM A;  1KDG A;  1PHH A;  5DBJ A;  1NAA A;  4ADW A;  1TRB A;  3KU9 A;  3HZL A;  1M64 A;  4B69 A;  2YG6 A;  4H4S A;  3DJG X;  4U8O A;  4U2S A;  3AE7 A;  4P9S A;  2Y6R A;  3K7T A;  3UTE A;  4OPL A;  5IQ4 A;  4D04 A;  1F8S A;  2JB1 A;  2ZBW A;  5FS9 A;  4U8L A;  2WU2 A;  3ADA B;  2X8G A;  1H7W A;  4ECH A;  3PS9 A;  1D7L A;  4JY3 A;  3LZX A;  3GWF A;  4C77 A;  1L9E A;  2RGO A;  2XFN A;  1Y56 A;  3ZDN A;  3B6D A;  1H7X A;  2HQM A;  1BGN A;  3SFE A;  1JU2 A;  1REO A;  2JKC A;  4ICY A;  3AWI A;  1BGJ A;  4WX1 A;  2VOU A;  4UDP A;  1JRZ A;  3AE8 A;  1S2Q A;  3I3L A;  1K0L A;  2AAQ A;  5FS8 A;  3CGB A;  1RP0 A;  1E1N A;  5EOW A;  3VRD B;  1PBF A;  3CGE A;  4DNA A;  2WP6 A;  1RYI A;  2BK3 A;  1PBD A;  3M12 A;  1LPF A;  1XAN A;  4NTD A;  4OCG A;  4REK A;  3LB8 A;  5HY5 A;  4YWO A;  2YR5 A;  4PAA A;  3EPT A;  4E0V A;  1D4D A;  1CF3 A;  1ZY8 A;  4CBQ A;  1B8S A;  1D4C A;  3BNU A;  4EM3 A;  1FEB A;  3KKJ A;  1OJT A;  4B64 A;  4M52 A;  4NTE A;  4EMJ A;  2V3A A;  2YAU A;  3AD8 B;  3QVP A;  3AE1 A;  3NYF A;  5JCM A;  3O0H A;  3P1W A;  3CIR A;  1KFY A;  1JRX A;  1DJQ A;  3P4P A;  1N1P A;  4Z24 A;  4YTP A;  3QJ4 A;  4IA6 A;  3VRB A;  3PVC A;  4RG3 A;  1DJN A;  1FL2 A;  3EAO A;  2GF3 A;  5IQ1 A;  3QSM A;  2YM1 A;  1YQ4 A;  3AEG A;  2FJB A;  3V3N A;  1GPE A;  1L9D A;  2EQ9 A;  2CDU A;  2WPF A;  2Y6Q A;  1F8R A;  1UKV G;  2GMH A;  2VRM A;  3JSK A;  4H2R A;  4U2L A;  2IVD A;  1MO9 A;  3IF9 A;  4CY8 A;  1NG3 A;  3G5S A;  1P2E A;  2PYX A;  2QA1 A;  5U63 A;  1GER A;  2CUL A;  2EQ7 A;  2FJA A;  2XVH A;  2JB2 A;  3UOX A;  1ELI A;  4H2N A;  4K22 A;  4BK3 A;  2R45 A;  1QLB A;  2YLS A;  4J34 A;  5U1O A;  3ALJ A;  1M6I A;  1ZOY A;  1CJ4 A;  4AT0 A;  5KWF A;  2W0H A;  2Q0K A;  4H7U A;  4B1B A;  1LQT A;  4EIQ A;  3UTF A;  2R46 A;  3GDN A;  3GRT A;  3WE0 A;  2RGJ A;  1KF6 A;  3C96 A;  2C76 A;  3CN8 A;  3CNS A;  2ZZ0 A;  3E1T A;  3M13 A;  2XLR A;  1DOE A;  4K2X A;  3CNT A;  2BA9 A;  2WP5 A;  3C4N A;  3COX A;  4YTN A;  3AE5 A;  4Z26 A;  4LA1 A;  3BHF A;  1ZK7 A;  2BYB A;  3DJJ A;  3LXD A;  5C2T A;  2GR0 A;  1N4W A;  2WOV A;  2FJE A;  1GSN A;  2PHH A;  4ZN0 A;  5LV9 A;  1OJD A;  4K5R A;  3LJP A;  1BWC A;  1IUV A;  4Y4N A;  4TM1 A;  3L1R A;  2H88 A;  3UKK A;  1IUU A;  2A89 A;  2C66 A;  4NTC A;  3FG2 P;  2C7G A;  2Z5X A;  4OPT A;  4U8K A;  3GRS A;  3T37 A;  5J60 A;  2XFO A;  1Y0P A;  4JNQ A;  2A8X A;  5GRT A;  5JCL A;  3DGZ A;  2ACZ A;  2WQY A;  3EF6 A;  4XXG A;  3F8D A;  1Q1R A;  1ONF A;  2BXS A;  4I58 A;  2R0C A;  4K5S A;  1GXF A;  1PBB A;  1ZKQ A;  2BXR A;  1RSG A;  1GRA A;  3AD9 B;  3NRN A;  2JAE A;  5CKU A;  3P4Q A;  3GMB A;  1O94 A;  2GH5 A;  4B65 A;  2BAB A;  4NEV A;  2GRT A;  1K4Q A;  3GD4 A;  4JDR A;  2VRL A;  3M0O A;  1NEN A;  1VG9 A;  1Y56 B;  1LTX R;  1YQZ A;  2XYO A;  2YVF A;  4MJW A;  4IA5 A;  1GES A;  3V76 A;  4TLX A;  3LAD A;  4GF7 A;  2V61 A;  1ZOV A;  1EL8 A;  2OLN A;  3KD9 A;  3NYE A;  1NHQ A;  5EB4 A;  4GR1 A;  3URH A;  3UKH A;  1VRQ B;  3PO7 A;  4TM3 A;  2GQF A;  2XDO A;  3AYL A;  1K0I A;  1Q9I A;  3BHK A;  4B66 A;  1ZMC A;  2ZZC A;  4YSX A;  3BNM A;  5ER0 A;  1IUT A;  3R9U A;  4EM4 A;  1NPX A;  4OPG A;  3CGC A;  2BS4 A;  2GR2 A;  1P2H A;  1GOS A;  3NK0 X;  2GEW A;  4EQS A;  4B68 A;  3OC4 A;  5J7X A;  4O5Q A;  2BCG G;  2C67 A;  1QO8 A;  4J2W A;  2VQ7 A;  1PBE A;  3G5Q A;  2YG7 A;  3AYI A;  2XLS A;  1NDA A;  4YTM A;  3UKL A;  4CCR A;  3NN6 X;  4WCT A;  2XLU A;  2GR1 A;  2F5Z A;  3AE2 A;  3NLC A;  5FS6 A;  2XVJ A;  5C3J A;  4EMW A;  2YLX A;  1TDK A;  4HA6 A;  1K0J A;  3GYJ A;  4KPR A;  1NEK A;  1QJD A;  1GAL A;  3CTY A;  3NKS A;  4YKF A;  5FMH A;  4KX6 A;  2DKI A;  3K7M X;  4UDR A;  2WOI A;  5KOX A;  3UOZ A;  4GDP A;  4Y4M A;  3D1C A;  4GDE A;  4FX9 A;  4H4T A;  4OPD A;  4IVM B;  1JNZ A;  1CBO A;  2XVE A;  1IUW A;  4X4J A;  3GWD A;  1O5W A;  1PS9 A;  2VVL G;  4USQ A;  3NT6 A;  5KRQ A;  1MXT A;  3ATQ A;  5BRT A;  2VVL A;  4YXD A;  2V6O A;  2QCU A;  1GRF A;  4LU6 A;  3LOV A;  3II4 A;  1F3P A;  2QAE A;  3NN0 X;  2YR4 A;  3IC9 A;  3I6D A;  1FEA A;  4H50 A;  3DJE A;  2YG5 A;  4J33 A;  4USR A;  2GAH B;  1KNR A;  1D7Y A;  3AEC A;  3CND A;  4H4V A;  4UDQ A;  4U8I A;  1NHR A;  3NIX A;  2R0G A;  2QA2 A;  3NGC X;  1H86 A;  2X50 A;  1ZMD A;  3C4A A;  4OPC A;  3SGL A;  3KA7 A;  4D03 A;  1GTE A;  2WPC A;  3DK8 A;  3IHM A;  4BJZ A;  1XHC A;  3FIM B;  2BC1 A;  1YKJ A;  5BUK A;  3NTA A;  4ZCC A;  1TDE A;  4H4Q A;  3H8L A;  1DOB A;  3V3O A;  2NPX A;  4BK1 A;  5JCN A;  2X8C A;  3LZW A;  3P4R A;  4N9X A;  4JY2 A;  4NEW A;  2XFQ A;  3DJD A;  4H4Y A;  4Z25 A;  1GRG A;  2DKH A;  4Z43 A;  1GRB A;  5IPY A;  2C72 A;  2A87 A;  2ARD A;  1GTH A;  4J36 A;  3SQP A;  4A6N B;  3DK9 A;  4X9M A;  2WDV A;  2C70 A;  3VR9 A;  4UP3 A;  4BUR A;  2XLP A;  3AE6 A;  3AEB A;  4H4W A;  1D5T A;  4CRT A;  1S3B A;  4U8J A;  2YM2 A;  3BI5 A;  5BVA A;  1DNC A;  2IID A;  2RGH A;  3AD7 B;  3UCL A;  4B67 A;  2Q7V A;  5KOW A;  2BK4 A;  2OA1 A;  1TDF A;  1GT8 A;  1W4X A;  3BI2 A;  4J31 A;  3ZYX A;  4AOX A;  3QFA A;  1OJ9 A;  1TYP A;  2C75 A;  1TDO A;  4A79 A;  1B4V A;  3AXB A;  4APN A;  2J3N A;  3FMW A;  2TMD A;  2APG A;  5CQF A;  4A6N A;  3D8X A;  1IJH A;  2FBW A;  3Q9T A;  4J57 A;  3CNP A;  3VQR A;  2B9W A;  2H89 A;  3QSS A;  4RSL A;  3B3R A;  1YQ3 A;  3AB1 A;  4AT2 A;  3EAN A;  4CY6 A;  3CNJ A;  3UTG A;  1AOG A;  2GAG B;  1PXB A;  1X31 B;  3AEF A;  4AP3 A;  1JEH A;  1FCD A;  2V60 A;  2BC0 A;  4AP1 A;  2WS3 A;  3GD3 A;  4EQX A;  5BUL A;  2FJD A;  5KVI A;  2C73 A;  1JNR A;  2GR3 A;  4RG4 A;  2C3C A;  1EBD A;  1GRT A;  2WET A;  1VQW A;  4EQW A;  4YT0 A;  3OZ2 A;  1GND A;  1V59 A;  4AOS A;  3P9U A;  3Q6J A;  2JB3 A;  2IVE A;  2B7R A;  3AE4 A;  4Z2T A;  2B9X A;  3NHO X;  2BS3 A;  3VRA A;  3ALL A;  5HHF A;  2YLZ A;  2R0P A;  3S5W A;  1GV4 A;  2WPE A;  3RP7 A;  4EIP A;  4Z2U A;  1H81 A;  3IHG A;  2YWL A;  1CJ3 A;  2EQ8 A;  2X8H A;  2Z5Y A;  4H2Q A;  3ABV A;  5L46 A;  4A7A A;  2Q6U A;  2C64 A;  1KSS A;  2CVJ A;  3G5R A;  4GUV A;  3GYI A;  1EL7 A;  1H6V A;  1LVL A;  1TDN A;  4FK1 C;  2E5V A;  3DGH A;  2WES A;  2WDR A;  3GMC A;  3ICT A;  2R4J A;  3CPJ G;  4NZH A;  4BJY A;  1PJ5 A;  2YQU A;  1VG0 A;  4TM0 A;  1DOC A;  1KNP A;  1LJ1 A;  3ALM A;  4X9N A;  1CL0 A;  2GMJ A;  2X99 A;  2TPR A;  4B63 A;  1PXA A;  3P4S A;  4I59 A;  4BK2 A;  1OJA A;  3AYJ A;  3GSI A;  4J56 A;  4JNA A;  2C3D A;  4XWR A;  2BK5 A;  3NG7 X;  2XVI A;  1BF3 A;  1E1M A;  4FK1 A;  2R9Z A;  3FPZ A;  3NYC A;  1VDC A;  4HB9 A;  5EBK A;  1YY5 A;  4U8M A;  1GRH A;  4EMI A;  1CHU A;  4Z2R A;  4FDC B;  1E7P A;  1PXC A;  1PN0 A;  2YLR A;  3ATR A;  4IV9 A;  3RNM A;  3GDP A;  3AE9 A;  1JOA A;  2YVG A;  3CPH G;  1B5Q A;  3VR8 A;  1F8W A;  1Q1W A;  1E6E A;  3AED A;  2XFU A;  4YSH A;  3F8R A;  1D4E A;  2GV8 A;  2VVM A;  4DSH A;  4A5L A;  2NVK X;  1N4V A;  2V5Z A;  1NHP A;  3RP6 A;  1LV0 A;  2B7S A;  2X3N A;  2YVJ A;  1CJC A;  4IVO B;  1S3E A;  4C3X A;  4TLZ A;  4O5U A;  4U8P A;  4A9W A;  1PJ6 A;  3IWA A;  3AEE A;  4XWZ A;  4OPI A;  3UP4 A;  1L0V A;  3ICR A;  1GEU A;  1IUX A;  1PDH A;  3QFB A;  2E4G A;  3NK2 X;  1OJC A;  1XDI A;  1JRY A;  2BAC A;  2VQB A;  5M10 A;  4A65 A;  4C5O A;  3KVE A;  4ZCD A; 
#chains in the Genus database with same CATH topology
 5M0Z A;  2WU5 A;  1HYU A;  4U8N A;  2CFY A;  4OPU A;  3S61 A;  1GET A;  2V3B A;  3QSE A;  3UKP A;  4H2P A;  2B9Y A;  1H84 A;  2YLT A;  1O95 A;  2WHD A;  5JCI A;  3CPI G;  3UTH A;  4U2T A;  1S2Y A;  4G6G A;  3AEA A;  3NTD A;  3SM8 A;  2WOW A;  3UP5 A;  1GRE A;  4DGK A;  1BZL A;  4G74 A;  2GB0 A;  1EL9 A;  5TR3 A;  3UOV A;  3K30 A;  5HYM A;  4GRT A;  2AR8 A;  1F6M A;  5U25 A;  4C74 A;  1E1L A;  4C3Y A;  2EQ6 A;  1IUS A;  3NK1 X;  1B37 A;  3CGD A;  4K8D A;  1H82 A;  4CNJ A;  2B76 A;  2XLT A;  2WDQ A;  4CCQ A;  1ZP0 A;  2RAB A;  1EL5 A;  5JCK A;  3F8P A;  2GQW A;  1H83 A;  4DSG A;  1E1K A;  3DME A;  1SEZ A;  1CC4 A;  4Z44 A;  2AQJ A;  2XVF A;  1PBC A;  2OLO A;  3K7Q X;  2BRY A;  2OAL A;  4YSY A;  3H8I A;  3RED A;  3UKA A;  1COY A;  1CC2 A;  3ICS A;  1CC6 A;  2YG3 A;  2WP9 A;  1ZDL A;  3NH3 X;  3ISH A;  4OVI A;  5FS7 A;  4CNK A;  1DXL A;  3DH9 A;  2JBV A;  4LII A;  1NG4 A;  4TM4 A;  5KVH A;  3NNE A;  2O9Z A;  4K7Z A;  1L9C A;  2BRA A;  1MOK A;  3UKF A;  4EQR A;  2UZZ A;  3KPK A;  2R4E A;  3T2K A;  2VZ2 A;  2WBA A;  2E1M A;  4H4X A;  3L8K A;  2WEU A;  3H4K A;  2XCG A;  4Y4L A;  2ZZB A;  5HXI A;  5KXJ A;  1ZX9 A;  3QVR A;  3UOY A;  4GCM A;  1BKW A;  2C65 A;  4H4R A;  2Q0L A;  2YLW A;  4JQ9 A;  4II3 A;  2YG4 A;  1XPQ A;  3UKQ A;  1N4U A;  2XFP A;  1NHS A;  4H4P A;  2BCP A;  1TYT A;  3ITJ A;  5GSN A;  1FOH A;  3SFD A;  4YKG A;  2BS2 A;  3RP8 A;  4JN9 A;  5EB5 A;  2GVC A;  1Z6L A;  4H4Z A;  1E39 A;  4BV6 A;  3BI4 A;  3RHA A;  3DK4 A;  1FEC A;  2I0Z A;  3KLJ A;  1KSU A;  3KPF A;  4G6H A;  4H4U A;  4PAB A;  3DA1 A;  1CJ2 A;  1PJ7 A;  2YR6 A;  3AE3 A;  4G73 A;  1LQU A;  3FBS A;  2JK6 A;  1DOD A;  4YSZ A;  2OAM A;  1KDG A;  1PHH A;  5DBJ A;  1NAA A;  4ADW A;  1TRB A;  3KU9 A;  3HZL A;  1M64 A;  4B69 A;  2YG6 A;  4H4S A;  5KNL A;  3DJG X;  4GAV A;  4U2S A;  4U8O A;  3AE7 A;  4P9S A;  2Y6R A;  3SZ0 A;  4NWZ A;  3K7T A;  3UTE A;  4OPL A;  5IQ4 A;  4D04 A;  1F8S A;  2JB1 A;  2ZBW A;  5FS9 A;  4U8L A;  2WU2 A;  3ADA B;  2X8G A;  1H7W A;  4ECH A;  3PS9 A;  1D7L A;  4JY3 A;  3LZX A;  3GWF A;  4C77 A;  1L9E A;  2RGO A;  2XFN A;  1Y56 A;  3ZDN A;  3B6D A;  1H7X A;  2HQM A;  1BGN A;  3SFE A;  1JU2 A;  1REO A;  2JKC A;  4ICY A;  3AWI A;  1BGJ A;  4WX1 A;  2VOU A;  4UDP A;  1JRZ A;  3AE8 A;  1S2Q A;  3I3L A;  1K0L A;  2AAQ A;  5FS8 A;  3CGB A;  1RP0 A;  1E1N A;  5EOW A;  3VRD B;  1PBF A;  3CGE A;  2C4C A;  2WP6 A;  4DNA A;  1RYI A;  2BK3 A;  1PBD A;  3M12 A;  1LPF A;  1XAN A;  4NTD A;  4OCG A;  4REK A;  3LB8 A;  5HY5 A;  4YWO A;  2YR5 A;  4PAA A;  3EPT A;  4E0V A;  1D4D A;  1CF3 A;  1ZY8 A;  4CBQ A;  1B8S A;  1D4C A;  3BNU A;  4EM3 A;  5KMS A;  1FEB A;  3KKJ A;  1OJT A;  4B64 A;  4M52 A;  4NTE A;  4EMJ A;  2V3A A;  2YAU A;  3AD8 B;  3QVP A;  3AE1 A;  3NYF A;  5JCM A;  3O0H A;  3P1W A;  3CIR A;  1KFY A;  1JRX A;  1DJQ A;  3P4P A;  1N1P A;  4Z24 A;  4YTP A;  3QJ4 A;  4IA6 A;  3VRB A;  3PVC A;  4RG3 A;  1DJN A;  1FL2 A;  3EAO A;  3T2Y A;  2GF3 A;  5IQ1 A;  3QSM A;  2YM1 A;  1YQ4 A;  3AEG A;  2FJB A;  3V3N A;  1GPE A;  1L9D A;  2CDU A;  2EQ9 A;  2WPF A;  2Y6Q A;  1F8R A;  1UKV G;  2GMH A;  2VRM A;  3JSK A;  4H2R A;  4U2L A;  2IVD A;  1MO9 A;  3IF9 A;  4CY8 A;  1NG3 A;  3G5S A;  1P2E A;  2PYX A;  2QA1 A;  5U63 A;  1GER A;  2CUL A;  2EQ7 A;  2FJA A;  2XVH A;  2JB2 A;  3UOX A;  1ELI A;  4H2N A;  4K22 A;  4BK3 A;  2R45 A;  1QLB A;  2YLS A;  4J34 A;  5U1O A;  3ALJ A;  1M6I A;  1ZOY A;  1CJ4 A;  4AT0 A;  5KWF A;  2W0H A;  2Q0K A;  4H7U A;  4B1B A;  1LQT A;  4EIQ A;  3UTF A;  2R46 A;  3GDN A;  3GRT A;  3WE0 A;  2RGJ A;  1KF6 A;  3C96 A;  2C76 A;  3CN8 A;  3CNS A;  2ZZ0 A;  3E1T A;  3M13 A;  2XLR A;  1DOE A;  4K2X A;  3CNT A;  2BA9 A;  2WP5 A;  3C4N A;  3COX A;  3T14 A;  3AE5 A;  4YTN A;  4LA1 A;  4Z26 A;  3BHF A;  1ZK7 A;  2BYB A;  3DJJ A;  3LXD A;  5C2T A;  2GR0 A;  1N4W A;  2WOV A;  2FJE A;  1GSN A;  2PHH A;  4ZN0 A;  5LV9 A;  1OJD A;  4K5R A;  3LJP A;  1BWC A;  1IUV A;  4Y4N A;  4TM1 A;  3L1R A;  2H88 A;  3UKK A;  1IUU A;  2A89 A;  2C66 A;  3HYX A;  4G9K A;  4NTC A;  3FG2 P;  2C7G A;  2Z5X A;  4OPT A;  4U8K A;  3GRS A;  3T37 A;  5J60 A;  2XFO A;  1Y0P A;  4JNQ A;  2A8X A;  5GRT A;  5JCL A;  3DGZ A;  2ACZ A;  2WQY A;  3EF6 A;  4XXG A;  3F8D A;  1Q1R A;  1ONF A;  2BXS A;  4I58 A;  2R0C A;  3SYI A;  4K5S A;  1GXF A;  1PBB A;  1ZKQ A;  2BXR A;  1RSG A;  1GRA A;  3AD9 B;  3NRN A;  2JAE A;  5CKU A;  3P4Q A;  3GMB A;  1O94 A;  2GH5 A;  4B65 A;  2BAB A;  4NEV A;  2GRT A;  1K4Q A;  3GD4 A;  4JDR A;  2VRL A;  3M0O A;  1NEN A;  1VG9 A;  1Y56 B;  1LTX R;  1YQZ A;  2XYO A;  2YVF A;  4MJW A;  4IA5 A;  1GES A;  3V76 A;  4TLX A;  3LAD A;  4GF7 A;  2V61 A;  1ZOV A;  1EL8 A;  2OLN A;  3KD9 A;  3NYE A;  1NHQ A;  5EB4 A;  4GR1 A;  3URH A;  3UKH A;  1VRQ B;  3PO7 A;  4TM3 A;  2GQF A;  2XDO A;  3AYL A;  1K0I A;  1Q9I A;  3BHK A;  4B66 A;  1ZMC A;  2ZZC A;  3SZC A;  3BNM A;  5ER0 A;  4YSX A;  1IUT A;  3R9U A;  4EM4 A;  1NPX A;  4OPG A;  3CGC A;  2BS4 A;  2GR2 A;  1P2H A;  1GOS A;  3NK0 X;  2GEW A;  4EQS A;  4B68 A;  3OC4 A;  5J7X A;  4O5Q A;  2BCG G;  2C67 A;  1QO8 A;  4J2W A;  2VQ7 A;  1PBE A;  3G5Q A;  2YG7 A;  3AYI A;  2XLS A;  1NDA A;  4YTM A;  3UKL A;  4CCR A;  3NN6 X;  4WCT A;  2XLU A;  4A99 A;  2GR1 A;  2F5Z A;  3AE2 A;  3NLC A;  5FS6 A;  2XVJ A;  5C3J A;  4EMW A;  2YLX A;  1TDK A;  4HA6 A;  1K0J A;  3GYJ A;  4KPR A;  1NEK A;  1QJD A;  1GAL A;  3CTY A;  3NKS A;  4YKF A;  5KMP A;  5FMH A;  4KX6 A;  2DKI A;  3K7M X;  4UDR A;  2WOI A;  5KOX A;  3UOZ A;  4GDP A;  4Y4M A;  3D1C A;  4GDE A;  4FX9 A;  4H4T A;  4OPD A;  4IVM B;  1JNZ A;  1CBO A;  2XVE A;  1IUW A;  4X4J A;  3GWD A;  1O5W A;  1PS9 A;  2VVL G;  4USQ A;  3NT6 A;  5KRQ A;  1MXT A;  3ATQ A;  5BRT A;  2VVL A;  4YXD A;  2V6O A;  2QCU A;  5KMR A;  1GRF A;  4LU6 A;  3LOV A;  3II4 A;  1F3P A;  2QAE A;  3NN0 X;  2YR4 A;  3IC9 A;  3I6D A;  1FEA A;  4H50 A;  3GYX A;  3DJE A;  2YG5 A;  4J33 A;  4USR A;  2GAH B;  1KNR A;  1D7Y A;  3AEC A;  3CND A;  4H4V A;  4UDQ A;  4U8I A;  1NHR A;  4II2 A;  3NIX A;  3T2Z A;  2R0G A;  2QA2 A;  3NGC X;  1H86 A;  2X50 A;  1ZMD A;  3C4A A;  4OPC A;  3SGL A;  3KA7 A;  4D03 A;  1GTE A;  2WPC A;  3DK8 A;  3IHM A;  4BJZ A;  1XHC A;  3SZF A;  3FIM B;  2BC1 A;  1YKJ A;  5BUK A;  3NTA A;  4ZCC A;  1TDE A;  4H4Q A;  3H8L A;  1DOB A;  3CMM A;  3V3O A;  2NPX A;  4BK1 A;  5JCN A;  2X8C A;  3LZW A;  3P4R A;  4N9X A;  4JY2 A;  4NEW A;  2XFQ A;  3DJD A;  4H4Y A;  4Z25 A;  1GRG A;  2DKH A;  4Z43 A;  1GRB A;  5IPY A;  2C72 A;  2A87 A;  2ARD A;  1GTH A;  4J36 A;  3SQP A;  4A6N B;  3DK9 A;  4X9M A;  2WDV A;  2C70 A;  3VR9 A;  4UP3 A;  4BUR A;  2XLP A;  3AE6 A;  3AEB A;  4H4W A;  1D5T A;  4CRT A;  1S3B A;  4U8J A;  2YM2 A;  3BI5 A;  5BVA A;  1DNC A;  2IID A;  2RGH A;  3AD7 B;  3UCL A;  4B67 A;  2Q7V A;  5KOW A;  2BK4 A;  2OA1 A;  3T31 A;  1TDF A;  1GT8 A;  1W4X A;  3BI2 A;  4J31 A;  3ZYX A;  4AOX A;  3QFA A;  1OJ9 A;  1TYP A;  2C75 A;  1TDO A;  4A79 A;  1B4V A;  3AXB A;  4APN A;  2J3N A;  3FMW A;  2TMD A;  2APG A;  5CQF A;  4A6N A;  3D8X A;  1IJH A;  2FBW A;  3Q9T A;  4J57 A;  3CNP A;  3VQR A;  2B9W A;  2H89 A;  3QSS A;  4RSL A;  3B3R A;  1YQ3 A;  3AB1 A;  4AT2 A;  3EAN A;  4CY6 A;  3CNJ A;  3UTG A;  1AOG A;  2GAG B;  3HYV A;  1PXB A;  1X31 B;  3AEF A;  4AP3 A;  1JEH A;  1FCD A;  2V60 A;  2BC0 A;  4AP1 A;  2WS3 A;  3GD3 A;  4EQX A;  5BUL A;  2FJD A;  5KVI A;  2C73 A;  1JNR A;  2GR3 A;  4RG4 A;  2C3C A;  1EBD A;  1GRT A;  2WET A;  1VQW A;  4EQW A;  4YT0 A;  3OZ2 A;  1GND A;  1V59 A;  4AOS A;  3P9U A;  3Q6J A;  2JB3 A;  2IVE A;  2B7R A;  3AE4 A;  4Z2T A;  2B9X A;  3NHO X;  2BS3 A;  3VRA A;  3ALL A;  5HHF A;  2YLZ A;  2R0P A;  3S5W A;  1GV4 A;  2WPE A;  3RP7 A;  4EIP A;  4Z2U A;  1H81 A;  3IHG A;  2YWL A;  1CJ3 A;  2EQ8 A;  2X8H A;  2Z5Y A;  4H2Q A;  3ABV A;  5L46 A;  4A7A A;  2Q6U A;  2C64 A;  3SY4 A;  1KSS A;  2CVJ A;  3SZW A;  3G5R A;  4GUV A;  3GYI A;  1EL7 A;  1H6V A;  1LVL A;  1TDN A;  4FK1 C;  2E5V A;  3DGH A;  2WES A;  2WDR A;  3GMC A;  3ICT A;  2R4J A;  3CPJ G;  4NZH A;  4BJY A;  1PJ5 A;  2YQU A;  1VG0 A;  4TM0 A;  1DOC A;  1KNP A;  1LJ1 A;  3ALM A;  4X9N A;  1CL0 A;  2GMJ A;  2X99 A;  2TPR A;  4B63 A;  1PXA A;  3P4S A;  4I59 A;  4BK2 A;  1OJA A;  3AYJ A;  3GSI A;  4J56 A;  4JNA A;  2C3D A;  4XWR A;  2BK5 A;  3NG7 X;  2XVI A;  1BF3 A;  1E1M A;  4FK1 A;  2R9Z A;  3FPZ A;  3NYC A;  1VDC A;  4HB9 A;  5EBK A;  1YY5 A;  4U8M A;  1GRH A;  4EMI A;  3T0K A;  1CHU A;  4Z2R A;  4FDC B;  1E7P A;  1PXC A;  1PN0 A;  2YLR A;  3ATR A;  4IV9 A;  3RNM A;  3GDP A;  3AE9 A;  1JOA A;  2YVG A;  3CPH G;  1B5Q A;  3VR8 A;  1F8W A;  1Q1W A;  1E6E A;  3AED A;  2XFU A;  4YSH A;  3F8R A;  1D4E A;  2GV8 A;  2VVM A;  4DSH A;  4A5L A;  2NVK X;  1N4V A;  4NNJ A;  2V5Z A;  1NHP A;  3RP6 A;  4GAP A;  1LV0 A;  2B7S A;  2X3N A;  2YVJ A;  1CJC A;  4IVO B;  1S3E A;  3SX6 A;  4C3X A;  4TLZ A;  4O5U A;  4U8P A;  4A9W A;  1PJ6 A;  3IWA A;  3SXI A;  3AEE A;  4XWZ A;  4OPI A;  3UP4 A;  1L0V A;  3ICR A;  1GEU A;  1IUX A;  1PDH A;  3QFB A;  2E4G A;  3NK2 X;  1OJC A;  1XDI A;  5KMQ A;  1JRY A;  2BAC A;  2VQB A;  3HYW A;  5M10 A;  4A65 A;  4C5O A;  3KVE A;  4ZCD A; 
#chains in the Genus database with same CATH homology
 5M0Z A;  2WU5 A;  1HYU A;  4U8N A;  2CFY A;  4OPU A;  3S61 A;  1GET A;  2V3B A;  3QSE A;  3UKP A;  4H2P A;  2B9Y A;  1H84 A;  2YLT A;  1O95 A;  2WHD A;  5JCI A;  3CPI G;  3UTH A;  4U2T A;  1S2Y A;  4G6G A;  3AEA A;  3NTD A;  3SM8 A;  2WOW A;  3UP5 A;  1GRE A;  4DGK A;  1BZL A;  4G74 A;  2GB0 A;  1EL9 A;  5TR3 A;  3UOV A;  3K30 A;  5HYM A;  4GRT A;  2AR8 A;  1F6M A;  5U25 A;  4C74 A;  1E1L A;  4C3Y A;  2EQ6 A;  1IUS A;  3NK1 X;  1B37 A;  3CGD A;  4K8D A;  1H82 A;  4CNJ A;  2B76 A;  2XLT A;  2WDQ A;  4CCQ A;  1ZP0 A;  2RAB A;  1EL5 A;  5JCK A;  3F8P A;  2GQW A;  1H83 A;  4DSG A;  1E1K A;  3DME A;  1SEZ A;  1CC4 A;  4Z44 A;  2AQJ A;  2XVF A;  1PBC A;  2OLO A;  3K7Q X;  2BRY A;  2OAL A;  4YSY A;  3H8I A;  3RED A;  3UKA A;  1COY A;  1CC2 A;  3ICS A;  1CC6 A;  2YG3 A;  2WP9 A;  1ZDL A;  3NH3 X;  3ISH A;  4OVI A;  5FS7 A;  4CNK A;  1DXL A;  3DH9 A;  2JBV A;  4LII A;  1NG4 A;  4TM4 A;  5KVH A;  3NNE A;  2O9Z A;  4K7Z A;  1L9C A;  2BRA A;  1MOK A;  3UKF A;  4EQR A;  2UZZ A;  3KPK A;  2R4E A;  3T2K A;  2VZ2 A;  2WBA A;  2E1M A;  4H4X A;  3L8K A;  2WEU A;  3H4K A;  2XCG A;  4Y4L A;  2ZZB A;  5HXI A;  5KXJ A;  1ZX9 A;  3QVR A;  3UOY A;  4GCM A;  1BKW A;  2C65 A;  4H4R A;  2Q0L A;  2YLW A;  4JQ9 A;  4II3 A;  2YG4 A;  1XPQ A;  3UKQ A;  1N4U A;  2XFP A;  1NHS A;  4H4P A;  2BCP A;  1TYT A;  3ITJ A;  5GSN A;  1FOH A;  3SFD A;  4YKG A;  2BS2 A;  3RP8 A;  4JN9 A;  5EB5 A;  2GVC A;  1Z6L A;  4H4Z A;  1E39 A;  4BV6 A;  3BI4 A;  3RHA A;  3DK4 A;  1FEC A;  2I0Z A;  3KLJ A;  1KSU A;  3KPF A;  4G6H A;  4H4U A;  4PAB A;  3DA1 A;  1CJ2 A;  1PJ7 A;  2YR6 A;  3AE3 A;  4G73 A;  1LQU A;  3FBS A;  2JK6 A;  1DOD A;  4YSZ A;  2OAM A;  1KDG A;  1PHH A;  5DBJ A;  1NAA A;  4ADW A;  1TRB A;  3KU9 A;  3HZL A;  1M64 A;  4B69 A;  2YG6 A;  4H4S A;  5KNL A;  3DJG X;  4GAV A;  4U2S A;  4U8O A;  3AE7 A;  4P9S A;  2Y6R A;  3SZ0 A;  4NWZ A;  3K7T A;  3UTE A;  4OPL A;  5IQ4 A;  4D04 A;  1F8S A;  2JB1 A;  2ZBW A;  5FS9 A;  4U8L A;  2WU2 A;  3ADA B;  2X8G A;  1H7W A;  4ECH A;  3PS9 A;  1D7L A;  4JY3 A;  3LZX A;  3GWF A;  4C77 A;  1L9E A;  2RGO A;  2XFN A;  1Y56 A;  3ZDN A;  3B6D A;  1H7X A;  2HQM A;  1BGN A;  3SFE A;  1JU2 A;  1REO A;  2JKC A;  4ICY A;  3AWI A;  1BGJ A;  4WX1 A;  2VOU A;  4UDP A;  1JRZ A;  3AE8 A;  1S2Q A;  3I3L A;  1K0L A;  2AAQ A;  5FS8 A;  3CGB A;  1RP0 A;  1E1N A;  5EOW A;  3VRD B;  1PBF A;  3CGE A;  2C4C A;  2WP6 A;  4DNA A;  1RYI A;  2BK3 A;  1PBD A;  3M12 A;  1LPF A;  1XAN A;  4NTD A;  4OCG A;  4REK A;  3LB8 A;  5HY5 A;  4YWO A;  2YR5 A;  4PAA A;  3EPT A;  4E0V A;  1D4D A;  1CF3 A;  1ZY8 A;  4CBQ A;  1B8S A;  1D4C A;  3BNU A;  4EM3 A;  5KMS A;  1FEB A;  3KKJ A;  1OJT A;  4B64 A;  4M52 A;  4NTE A;  4EMJ A;  2V3A A;  2YAU A;  3AD8 B;  3QVP A;  3AE1 A;  3NYF A;  5JCM A;  3O0H A;  3P1W A;  3CIR A;  1KFY A;  1JRX A;  1DJQ A;  3P4P A;  1N1P A;  4Z24 A;  4YTP A;  3QJ4 A;  4IA6 A;  3VRB A;  3PVC A;  4RG3 A;  1DJN A;  1FL2 A;  3EAO A;  3T2Y A;  2GF3 A;  5IQ1 A;  3QSM A;  2YM1 A;  1YQ4 A;  3AEG A;  2FJB A;  3V3N A;  1GPE A;  1L9D A;  2CDU A;  2EQ9 A;  2WPF A;  2Y6Q A;  1F8R A;  1UKV G;  2GMH A;  2VRM A;  3JSK A;  4H2R A;  4U2L A;  2IVD A;  1MO9 A;  3IF9 A;  4CY8 A;  1NG3 A;  3G5S A;  1P2E A;  2PYX A;  2QA1 A;  5U63 A;  1GER A;  2CUL A;  2EQ7 A;  2FJA A;  2XVH A;  2JB2 A;  3UOX A;  1ELI A;  4H2N A;  4K22 A;  4BK3 A;  2R45 A;  1QLB A;  2YLS A;  4J34 A;  5U1O A;  3ALJ A;  1M6I A;  1ZOY A;  1CJ4 A;  4AT0 A;  5KWF A;  2W0H A;  2Q0K A;  4H7U A;  4B1B A;  1LQT A;  4EIQ A;  3UTF A;  2R46 A;  3GDN A;  3GRT A;  3WE0 A;  2RGJ A;  1KF6 A;  3C96 A;  2C76 A;  3CN8 A;  3CNS A;  2ZZ0 A;  3E1T A;  3M13 A;  2XLR A;  1DOE A;  4K2X A;  3CNT A;  2BA9 A;  2WP5 A;  3C4N A;  3COX A;  3T14 A;  3AE5 A;  4YTN A;  4LA1 A;  4Z26 A;  3BHF A;  1ZK7 A;  2BYB A;  3DJJ A;  3LXD A;  5C2T A;  2GR0 A;  1N4W A;  2WOV A;  2FJE A;  1GSN A;  2PHH A;  4ZN0 A;  5LV9 A;  1OJD A;  4K5R A;  3LJP A;  1BWC A;  1IUV A;  4Y4N A;  4TM1 A;  3L1R A;  2H88 A;  3UKK A;  1IUU A;  2A89 A;  2C66 A;  3HYX A;  4G9K A;  4NTC A;  3FG2 P;  2C7G A;  2Z5X A;  4OPT A;  4U8K A;  3GRS A;  3T37 A;  5J60 A;  2XFO A;  1Y0P A;  4JNQ A;  2A8X A;  5GRT A;  5JCL A;  3DGZ A;  2ACZ A;  2WQY A;  3EF6 A;  4XXG A;  3F8D A;  1Q1R A;  1ONF A;  2BXS A;  4I58 A;  2R0C A;  3SYI A;  4K5S A;  1GXF A;  1PBB A;  1ZKQ A;  2BXR A;  1RSG A;  1GRA A;  3AD9 B;  3NRN A;  2JAE A;  5CKU A;  3P4Q A;  3GMB A;  1O94 A;  2GH5 A;  4B65 A;  2BAB A;  4NEV A;  2GRT A;  1K4Q A;  3GD4 A;  4JDR A;  2VRL A;  3M0O A;  1NEN A;  1VG9 A;  1Y56 B;  1LTX R;  1YQZ A;  2XYO A;  2YVF A;  4MJW A;  4IA5 A;  1GES A;  3V76 A;  4TLX A;  3LAD A;  4GF7 A;  2V61 A;  1ZOV A;  1EL8 A;  2OLN A;  3KD9 A;  3NYE A;  1NHQ A;  5EB4 A;  4GR1 A;  3URH A;  3UKH A;  1VRQ B;  3PO7 A;  4TM3 A;  2GQF A;  2XDO A;  3AYL A;  1K0I A;  1Q9I A;  3BHK A;  4B66 A;  1ZMC A;  2ZZC A;  3SZC A;  3BNM A;  5ER0 A;  4YSX A;  1IUT A;  3R9U A;  4EM4 A;  1NPX A;  4OPG A;  3CGC A;  2BS4 A;  2GR2 A;  1P2H A;  1GOS A;  3NK0 X;  2GEW A;  4EQS A;  4B68 A;  3OC4 A;  5J7X A;  4O5Q A;  2BCG G;  2C67 A;  1QO8 A;  4J2W A;  2VQ7 A;  1PBE A;  3G5Q A;  2YG7 A;  3AYI A;  2XLS A;  1NDA A;  4YTM A;  3UKL A;  4CCR A;  3NN6 X;  4WCT A;  2XLU A;  4A99 A;  2GR1 A;  2F5Z A;  3AE2 A;  3NLC A;  5FS6 A;  2XVJ A;  5C3J A;  4EMW A;  2YLX A;  1TDK A;  4HA6 A;  1K0J A;  3GYJ A;  4KPR A;  1NEK A;  1QJD A;  1GAL A;  3CTY A;  3NKS A;  4YKF A;  5KMP A;  5FMH A;  4KX6 A;  2DKI A;  3K7M X;  4UDR A;  2WOI A;  5KOX A;  3UOZ A;  4GDP A;  4Y4M A;  3D1C A;  4GDE A;  4FX9 A;  4H4T A;  4OPD A;  4IVM B;  1JNZ A;  1CBO A;  2XVE A;  1IUW A;  4X4J A;  3GWD A;  1O5W A;  1PS9 A;  2VVL G;  4USQ A;  3NT6 A;  5KRQ A;  1MXT A;  3ATQ A;  5BRT A;  2VVL A;  4YXD A;  2V6O A;  2QCU A;  5KMR A;  1GRF A;  4LU6 A;  3LOV A;  3II4 A;  1F3P A;  2QAE A;  3NN0 X;  2YR4 A;  3IC9 A;  3I6D A;  1FEA A;  4H50 A;  3GYX A;  3DJE A;  2YG5 A;  4J33 A;  4USR A;  2GAH B;  1KNR A;  1D7Y A;  3AEC A;  3CND A;  4H4V A;  4UDQ A;  4U8I A;  1NHR A;  4II2 A;  3NIX A;  3T2Z A;  2R0G A;  2QA2 A;  3NGC X;  1H86 A;  2X50 A;  1ZMD A;  3C4A A;  4OPC A;  3SGL A;  3KA7 A;  4D03 A;  1GTE A;  2WPC A;  3DK8 A;  3IHM A;  4BJZ A;  1XHC A;  3SZF A;  3FIM B;  2BC1 A;  1YKJ A;  5BUK A;  3NTA A;  4ZCC A;  1TDE A;  4H4Q A;  3H8L A;  1DOB A;  3CMM A;  3V3O A;  2NPX A;  4BK1 A;  5JCN A;  2X8C A;  3LZW A;  3P4R A;  4N9X A;  4JY2 A;  4NEW A;  2XFQ A;  3DJD A;  4H4Y A;  4Z25 A;  1GRG A;  2DKH A;  4Z43 A;  1GRB A;  5IPY A;  2C72 A;  2A87 A;  2ARD A;  1GTH A;  4J36 A;  3SQP A;  4A6N B;  3DK9 A;  4X9M A;  2WDV A;  2C70 A;  3VR9 A;  4UP3 A;  4BUR A;  2XLP A;  3AE6 A;  3AEB A;  4H4W A;  1D5T A;  4CRT A;  1S3B A;  4U8J A;  2YM2 A;  3BI5 A;  5BVA A;  1DNC A;  2IID A;  2RGH A;  3AD7 B;  3UCL A;  4B67 A;  2Q7V A;  5KOW A;  2BK4 A;  2OA1 A;  3T31 A;  1TDF A;  1GT8 A;  1W4X A;  3BI2 A;  4J31 A;  3ZYX A;  4AOX A;  3QFA A;  1OJ9 A;  1TYP A;  2C75 A;  1TDO A;  4A79 A;  1B4V A;  3AXB A;  4APN A;  2J3N A;  3FMW A;  2TMD A;  2APG A;  5CQF A;  4A6N A;  3D8X A;  1IJH A;  2FBW A;  3Q9T A;  4J57 A;  3CNP A;  3VQR A;  2B9W A;  2H89 A;  3QSS A;  4RSL A;  3B3R A;  1YQ3 A;  3AB1 A;  4AT2 A;  3EAN A;  4CY6 A;  3CNJ A;  3UTG A;  1AOG A;  2GAG B;  3HYV A;  1PXB A;  1X31 B;  3AEF A;  4AP3 A;  1JEH A;  1FCD A;  2V60 A;  2BC0 A;  4AP1 A;  2WS3 A;  3GD3 A;  4EQX A;  5BUL A;  2FJD A;  5KVI A;  2C73 A;  1JNR A;  2GR3 A;  4RG4 A;  2C3C A;  1EBD A;  1GRT A;  2WET A;  1VQW A;  4EQW A;  4YT0 A;  3OZ2 A;  1GND A;  1V59 A;  4AOS A;  3P9U A;  3Q6J A;  2JB3 A;  2IVE A;  2B7R A;  3AE4 A;  4Z2T A;  2B9X A;  3NHO X;  2BS3 A;  3VRA A;  3ALL A;  5HHF A;  2YLZ A;  2R0P A;  3S5W A;  1GV4 A;  2WPE A;  3RP7 A;  4EIP A;  4Z2U A;  1H81 A;  3IHG A;  2YWL A;  1CJ3 A;  2EQ8 A;  2X8H A;  2Z5Y A;  4H2Q A;  3ABV A;  5L46 A;  4A7A A;  2Q6U A;  2C64 A;  3SY4 A;  1KSS A;  2CVJ A;  3SZW A;  3G5R A;  4GUV A;  3GYI A;  1EL7 A;  1H6V A;  1LVL A;  1TDN A;  4FK1 C;  2E5V A;  3DGH A;  2WES A;  2WDR A;  3GMC A;  3ICT A;  2R4J A;  3CPJ G;  4NZH A;  4BJY A;  1PJ5 A;  2YQU A;  1VG0 A;  4TM0 A;  1DOC A;  1KNP A;  1LJ1 A;  3ALM A;  4X9N A;  1CL0 A;  2GMJ A;  2X99 A;  2TPR A;  4B63 A;  1PXA A;  3P4S A;  4I59 A;  4BK2 A;  1OJA A;  3AYJ A;  3GSI A;  4J56 A;  4JNA A;  2C3D A;  4XWR A;  2BK5 A;  3NG7 X;  2XVI A;  1BF3 A;  1E1M A;  4FK1 A;  2R9Z A;  3FPZ A;  3NYC A;  1VDC A;  4HB9 A;  5EBK A;  1YY5 A;  4U8M A;  1GRH A;  4EMI A;  3T0K A;  1CHU A;  4Z2R A;  4FDC B;  1E7P A;  1PXC A;  1PN0 A;  2YLR A;  3ATR A;  4IV9 A;  3RNM A;  3GDP A;  3AE9 A;  1JOA A;  2YVG A;  3CPH G;  1B5Q A;  3VR8 A;  1F8W A;  1Q1W A;  1E6E A;  3AED A;  2XFU A;  4YSH A;  3F8R A;  1D4E A;  2GV8 A;  2VVM A;  4DSH A;  4A5L A;  2NVK X;  1N4V A;  4NNJ A;  2V5Z A;  1NHP A;  3RP6 A;  4GAP A;  1LV0 A;  2B7S A;  2X3N A;  2YVJ A;  1CJC A;  4IVO B;  1S3E A;  3SX6 A;  4C3X A;  4TLZ A;  4O5U A;  4U8P A;  4A9W A;  1PJ6 A;  3IWA A;  3SXI A;  3AEE A;  4XWZ A;  4OPI A;  3UP4 A;  1L0V A;  3ICR A;  1GEU A;  1IUX A;  1PDH A;  3QFB A;  2E4G A;  3NK2 X;  1OJC A;  1XDI A;  5KMQ A;  1JRY A;  2BAC A;  2VQB A;  3HYW A;  5M10 A;  4A65 A;  4C5O A;  3KVE A;  4ZCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...