3KU9A

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
467
structure length
467
Chain Sequence
TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 164
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ku9A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3ku9A02
1M64A 1GRBA 3LZWA 1GRAA 3NNEA 1GRTA 4CCRA 1GRFA 4YTMA 3GYJA 1K4QA 1XDIA 2VVLG 5TR3A 4Z25A 2BK3A 1IJHA 1TDFA 3L8KA 5KOXA 1B5QA 1MOKA 3M0OA 2VZ2A 4BK2A 4TM3A 2VOUA 5FS7A 2B9WA 2YVJA 5J60A 1FOHA 3UTFA 1KF6A 1COYA 4GDPA 1CC6A 3AE4A 1B4VA 2Y6RA 3ATRA 5M10A 1Y56A 3AB1A 3LOVA 3DJGX 4JNQA 1ZK7A 3Q6JA 1PBFA 2NVKX 4OPIA 1K0JA 4C3YA 3NT6A 1FL2A 2DKHA 2C72A 2JKCA 1E6EA 2YQUA 2YVGA 1GRGA 2IVDA 3OC4A 4NTDA 1K0LA 3ICTA 2GAGB 3H8IA 3B3RA 4GRTA 4EQSA 4OPGA 2J3NA 4JNAA 5JCKA 5IQ4A 3PS9A 3AECA 1D7YA 4C5OA 3CNJA 3HZLA 4H4XA 2B7RA 5FS6A 3IHGA 1PS9A 4H4SA 4EMWA 3NK1X 3AE8A 4I58A 4IA5A 3CPIG 2XDOA 1BZLA 3ALMA 3QFBA 4J31A 4EMIA 3RNMA 4B1BA 4Z2RA 5HY5A 2C73A 2BABA 3NIXA 4FDCB 1FEBA 3DJJA 3K7MX 1PXBA 2GF3A 1KSUA 4UP3A 2GR2A 1P2HA 3G5SA 2V5ZA 3UKPA 1CC4A 4CCQA 3UP5A 2BS4A 2WS3A 2WDQA 3GRSA 2GMHA 2XLPA 1BGJA 2XVEA 1TYTA 4NEVA 3CNSA 3NYCA 4X9NA 1FCDA 3FG2P 1OJDA 4GCMA 2C76A 5U1OA 1GXFA 3RP7A 4Z26A 2YLZA 1DOEA 2GV8A 2XFNA 2WPCA 4FK1A 4MJWA 4U8IA 1EL7A 1GTEA 2XFQA 5EB5A 3NHOX 2X8GA 2XVFA 1JRXA 1PBBA 3CNPA 3ALJA 2GQWA 2WU5A 1E1LA 1P2EA 2BCPA 2WPFA 2F5ZA 1N1PA 3AWIA 2XLTA 3P4SA 3SGLA 1LQTA 2FJAA 3K30A 1NEKA 3GWFA 4Z43A 1MXTA 2XVHA 3EANA 2BACA 5EOWA 5JCMA 3COXA 1X31B 3AD7B 2V6OA 2R0GA 3VRDB 2O9ZA 2Y6QA 1F3PA 4CY6A 2GMJA 1BKWA 4J56A 4Z44A 3BHKA 2W0HA 3DK9A 4FX9A 4U8MA 4HA6A 5J7XA 4RG3A 3CIRA 3IC9A 3NKSA 4H50A 4H2QA 4I59A 1JNZA 4YXDA 1YQ3A 3G5RA 4E0VA 3ADAB 2XLRA 4J33A 4CBQA 3C4NA 3AXBA 4DSHA 3CGCA 3FPZA 1VRQB 3NYFA 2BXSA 2AR8A 2R4JA 1MO9A 2X99A 2YR4A 4H4RA 1GT8A 2GQFA 4J2WA 4OPLA 4U2LA 5HXIA 3IF9A 1ONFA 3EAOA 2FJDA 4XWRA 2A87A 3LZXA 4J34A 3ALLA 4H4WA 1E39A 2GR1A 5C2TA 4UDRA 2YG7A 3S61A 2YWLA 1N4WA 1Q1WA 1O94A 2WP9A 3I3LA 3I6DA 4K5RA 2V3AA 4H7UA 4Y4MA 1F8WA 4C74A 1LVLA 2WEUA 3NH3X 3VR9A 5LV9A 3Q9TA 3LXDA 3NK0X 3CPHG 4J36A 3BI5A 1LPFA 4H4UA 4BV6A 1S2YA 2IVEA 2YLTA 4REKA 2VVMA 3DGHA 4U8KA 1RYIA 1DJQA 2R46A 4PAAA 2WU2A 2CDUA 3ICRA 2APGA 3AE7A 3E1TA 3H8LA 2FJBA 4O5UA 1GESA 4C3XA 2YLWA 3ICSA 1LV0A 5JCIA 1H86A 2JB2A 5JCLA 3KPFA 4YT0A 3NTAA 1NHSA 3OZ2A 2WOVA 1BGNA 1GERA 4EM4A 3II4A 3AEGA 1E1MA 2RGHA 2YM2A 3LADA 4X9MA 4ZN0A 3QFAA 1HYUA 4B65A 4KPRA 4U2SA 3F8DA 2WOWA 1IUVA 2BC1A 5HYMA 3AYIA 1S2QA 4YSXA 1H84A 4JY3A 4XWZA 3UOZA 4J57A 4B66A 5BVAA 3ATQA 4PABA 2H89A 4JDRA 2GVCA 4TM4A 4U8NA 2BA9A 1OJCA 3NK2X 3UTEA 3AEFA 2FJEA 3GRTA 1EL8A 3GMBA 3CNDA 1CL0A 3CN8A 2DKIA 1YQ4A 2R9ZA 4NZHA 1IUXA 2E1MA 3CNTA 1Q1RA 2C70A 3NGCX 2GEWA 4TLZA 5L46A 1L9EA 2OLNA 3AEEA 4IVMB 4TLXA 1KSSA 2YR6A 4P9SA 4H4TA 2GAHB 2B9XA 4DGKA 1YY5A 4D04A 1VQWA 4Z2UA 1KFYA 4EQRA 4GDEA 2XVIA 1BWCA 1GREA 3NG7X 4H2RA 4A6NA 4C77A 2WESA 3K7QX 4A79A 2R0CA 3P4RA 4XXGA 2VVLA 1H81A 2V3BA 3QVPA 4AOSA 4DNAA 4IA6A 3DGZA 4NEWA 1H6VA 1O5WA 1REOA 1FECA 2WP6A 3QSSA 2CFYA 1JEHA 3LB8A 2GB0A 3C96A 5EB4A 2I0ZA 5KVIA 2WP5A 3GD3A 5HHFA 3DK8A 1GNDA 4B67A 4OPTA 1KDGA 3SQPA 1XPQA 4LA1A 1S3BA 1PJ5A 4A7AA 2VQBA 3M12A 2ZBWA 5CKUA 4USRA 2VQ7A 2WDRA 2C3DA 2OLOA 1BF3A 1XHCA 2Q6UA 2X8CA 2ZZBA 1Z6LA 4K22A 3RP8A 2GRTA 1IUUA 1PXAA 2B9YA 2QCUA 1ZP0A 2X3NA 5EBKA 2XFOA 1L9DA 3VRAA 1PBDA 3V3OA 5FMHA 3UCLA 2JBVA 1GEUA 3P9UA 4WCTA 4ICYA 2YVFA 4NTCA 5FS8A 1JRYA 1PBEA 3GYIA 1NAAA 2Q0LA 2A89A 2UZZA 3AE3A 5BULA 1H82A 3DA1A 3AEBA 1QLBA 2C65A 2YM1A 1OJTA 2PYXA 3GD4A 2X50A 1D4EA 3SFDA 5KXJA 2V60A 3DK4A 4K8DA 3D1CA 2YAUA 3RHAA 1UKVG 1ZDLA 4M52A 2EQ7A 3BNMA 1CJ2A 3GWDA 3UKKA 4AP1A 4BJYA 2BCGG 1CJ4A 1H7XA 1DNCA 3WE0A 2NPXA 4H2PA 3M13A 1E1KA 2XLUA 3IWAA 2WHDA 1N4VA 1PXCA 4U8LA 1JU2A 3AD8B 4YWOA 1L0VA 1RP0A 1DODA 3ABVA 3NLCA 3P1WA 4EMJA 1TDEA 4U8JA 3NTDA 3FIMB 2ZZ0A 3B6DA 1GALA 1VG9A 3UKLA 1B8SA 1DOBA 3UOVA 3UOXA 4CY8A 1TYPA 3AE1A 1TDNA 2GH5A 2ACZA 5U25A 2FBWA 3NYEA 3ISHA 1ELIA 2C66A 2RGOA 2V61A 3ITJA 4GR1A 5U63A 3RP6A 4Z2TA 1L9CA 2C3CA 1TDKA 2R0PA 2YG6A 4U2TA 4B69A 4A99A 1D7LA 5C3JA 4Y4NA 4GUVA 3DJEA 2Q7VA 2X8HA 1EL5A 1PDHA 2Q0KA 2E4GA 4BK3A 1QJDA 3QVRA 4RG4A 4OVIA 1JRZA 1NENA 1ZOVA 1GOSA 3BI4A 1NHQA 1LQUA 2YLSA 4Y4LA 3EF6A 1ZMCA 3AE9A 2TMDA 4H4VA 1CBOA 1NHPA 1PN0A 3ZYXA 2CVJA 4JQ9A 3F8PA 2XLSA 4APNA 4AP3A 3AEDA 1K0IA 2JB1A 4ECHA 1CJCA 3S5WA 4K5SA 3F8RA 4YSHA 4USQA 1V59A 1CJ3A 2WOIA 1D5TA 3O0HA 1GSNA 2C7GA 4H4QA 3NN6X 4WX1A 1RSGA 5CQFA 3KU9A 2A8XA 2BYBA 4ZCDA 1KNPA 3G5QA 3FBSA 4YSZA 1DXLA 1EBDA 5BRTA 4AOXA 3BI2A 1JNRA 1Q9IA 2BC0A 3FMWA 4TM0A 2Z5XA 2B76A 2EQ9A 2YG3A 5KWFA 2VRMA 1GV4A 2C67A 4B68A 3SFEA 1LJ1A 1PHHA 2BK5A 2XVJA 4OPUA 2GR0A 2WPEA 1PBCA 1GRHA 4EIQA 4FK1C 4HB9A 3V76A 4CNJA 2BS3A 4UDPA 4AT2A 1E1NA 4B63A 1TDOA 4N9XA 1PJ7A 4BK1A 4CNKA 1H83A 1IUWA 1YQZA 2OA1A 3URHA 1GETA 4YKFA 3GDNA 3UKAA 1D4CA 3PVCA 1TRBA 3QSEA 1JOAA 4RSLA 5DBJA 4CRTA 1GTHA 1GPEA 3C4AA 4UDQA 4OCGA 1F6MA 4YKGA 2R4EA 4EQXA 4B64A 1FEAA 3LJPA 3AEAA 3GMCA 3IHMA 2C64A 3VRBA 2WQYA 2H88A 3KKJA 2C75A 5BUKA 2QA2A 3UKFA 2BXRA 2Z5YA 3CGEA 4K7ZA 1IUTA 2WDVA 3UOYA 2YR5A 4JY2A 1F8RA 3UP4A 1CHUA 3DMEA 4EIPA 2AAQA 3H4KA 1VG0A 3BHFA 4LIIA 4IV9A 3V3NA 1Y56B 3P4QA 2CULA 2VRLA 3DH9A 4GF7A 4NTEA 1B37A 4H2NA 1ZY8A 3CTYA 2PHHA 2WETA 3NRNA 2XFUA 1KNRA 1VDCA 2QA1A 4BJZA 2E5VA 2YG5A 4YSYA 4U8OA 3KA7A 1E7PA 1EL9A 3AYJA 3KD9A 5GRTA 4YTNA 3JSKA 5KOWA 2EQ6A 1ZOYA 1ZMDA 1NDAA 3EPTA 4K2XA 4OPDA 3UTGA 2JAEA 3UKHA 2GR3A 2XFPA 1OJAA 1N4UA 2OAMA 4A65A 1QO8A 3BNUA 2QAEA 4H4ZA 3KVEA 4DSGA 4JN9A 1AOGA 5KRQA 5KVHA 1DOCA 1NG3A 2HQMA 4X4JA 3D8XA 4A6NB 2TPRA 3QJ4A 3K7TA 1NHRA 3AE2A 2JK6A 1DJNA 4LU6A 2WBAA 4D03A 4ADWA 2ARDA 1CC2A 2ZZCA 4OPCA 3ZDNA 1D4DA 2AQJA 3CGBA 4H4PA 1XANA 2OALA 3UTHA 2BK4A 1F8SA 3T37A 2EQ8A 4TM1A 3NN0X 2BS2A 2YLRA 1SEZA 3AE6A 3VR8A 1CF3A 4A9WA 1IUSA 2YLXA 3KLJA 1ZX9A 3L1RA 4KX6A 2IIDA 3REDA 3VQRA 5IPYA 3AE5A 5M0ZA 2R45A 4H4YA 4A5LA 1PJ6A 2YG4A 5GSNA 2XYOA 1NPXA 1LTXR 3GSIA 1O95A 1H7WA 3AD9B 3CPJG 3GDPA 3UKQA 2XCGA 1Y0PA 1YKJA 4O5QA 4YTPA 4ZCCA 3P4PA 1W4XA 2JB3A 2B7SA 4IVOB 2RGJA 5FS9A 5IQ1A 1NG4A 1M6IA 3AYLA 4Z24A 3R9UA 1OJ9A 4EQWA 2RABA 3DJDA 1S3EA 1ZKQA 3PO7A 4U8PA 3SM8A 3CGDA 4BURA 4AT0A 5ER0A 4EM3A 3QSMA 5JCNA
chains in the Genus database with same CATH superfamily
1M64A 1GRBA 3LZWA 1GRAA 3NNEA 1GRTA 4CCRA 1GRFA 4YTMA 3GYJA 1K4QA 1XDIA 2VVLG 5TR3A 4Z25A 2BK3A 1IJHA 1TDFA 3L8KA 5KOXA 1B5QA 1MOKA 3M0OA 2VZ2A 4BK2A 4TM3A 2VOUA 5FS7A 2B9WA 2YVJA 5J60A 1FOHA 3UTFA 1KF6A 1COYA 3SY4A 4GDPA 1CC6A 5KMRA 3AE4A 1B4VA 2Y6RA 3ATRA 5M10A 1Y56A 3AB1A 3LOVA 3DJGX 4JNQA 1ZK7A 3Q6JA 1PBFA 2NVKX 4OPIA 1K0JA 4C3YA 3NT6A 1FL2A 2DKHA 2C72A 2JKCA 4NWZA 1E6EA 2YQUA 2YVGA 1GRGA 2IVDA 3OC4A 4NTDA 1K0LA 3ICTA 2GAGB 3H8IA 3B3RA 4GRTA 4EQSA 4OPGA 2J3NA 4JNAA 5JCKA 5IQ4A 3PS9A 3AECA 1D7YA 4C5OA 3T0KA 3CNJA 3HZLA 4H4XA 3SYIA 4NNJA 2B7RA 5FS6A 3IHGA 1PS9A 4H4SA 4EMWA 3NK1X 3AE8A 3SXIA 4I58A 4IA5A 3CPIG 2XDOA 1BZLA 3ALMA 3QFBA 4J31A 4EMIA 3RNMA 4B1BA 4Z2RA 5HY5A 5KMSA 2C73A 2BABA 3NIXA 4FDCB 1FEBA 3DJJA 3K7MX 1PXBA 2GF3A 1KSUA 4UP3A 2GR2A 1P2HA 3G5SA 2V5ZA 3UKPA 1CC4A 4G9KA 4CCQA 3UP5A 2BS4A 2WS3A 2WDQA 3GRSA 2GMHA 2XLPA 1BGJA 2XVEA 1TYTA 4NEVA 3CNSA 3NYCA 4X9NA 1FCDA 3FG2P 1OJDA 4GCMA 2C76A 5U1OA 1GXFA 3RP7A 4Z26A 2YLZA 1DOEA 2GV8A 4II2A 2XFNA 2WPCA 4FK1A 4MJWA 4U8IA 1EL7A 1GTEA 2XFQA 5EB5A 3NHOX 2X8GA 2XVFA 1JRXA 1PBBA 3CNPA 3ALJA 2GQWA 3SZ0A 2WU5A 1E1LA 1P2EA 2BCPA 2WPFA 2F5ZA 1N1PA 3AWIA 2XLTA 3P4SA 3SGLA 1LQTA 2FJAA 3K30A 1NEKA 3GWFA 4Z43A 1MXTA 2XVHA 3EANA 2BACA 5EOWA 5JCMA 3COXA 1X31B 3AD7B 2V6OA 2R0GA 3VRDB 2O9ZA 2Y6QA 1F3PA 4CY6A 2GMJA 1BKWA 4J56A 4Z44A 3BHKA 2W0HA 3DK9A 4FX9A 4U8MA 2C4CA 4HA6A 4RG3A 3CIRA 5J7XA 3IC9A 3NKSA 4H50A 4H2QA 4I59A 1JNZA 4YXDA 1YQ3A 3G5RA 4E0VA 3ADAB 2XLRA 4J33A 4CBQA 3C4NA 3AXBA 4DSHA 3CGCA 3FPZA 1VRQB 3NYFA 2BXSA 2AR8A 2R4JA 1MO9A 2X99A 2YR4A 4H4RA 1GT8A 2GQFA 4J2WA 4OPLA 4U2LA 5HXIA 3IF9A 1ONFA 3EAOA 2FJDA 4XWRA 3SZFA 2A87A 3LZXA 4J34A 3ALLA 4H4WA 1E39A 2GR1A 5C2TA 4UDRA 2YG7A 3S61A 2YWLA 1N4WA 1Q1WA 1O94A 2WP9A 3I3LA 3I6DA 4K5RA 2V3AA 4H7UA 4Y4MA 1F8WA 4C74A 1LVLA 2WEUA 3NH3X 3VR9A 5LV9A 3Q9TA 3LXDA 3NK0X 3CPHG 4J36A 3BI5A 1LPFA 4H4UA 4BV6A 1S2YA 2IVEA 2YLTA 4REKA 2VVMA 3DGHA 4U8KA 1RYIA 1DJQA 2R46A 4PAAA 2WU2A 2CDUA 3ICRA 2APGA 3AE7A 3E1TA 3H8LA 2FJBA 2BRAA 4O5UA 1GESA 4C3XA 2YLWA 3ICSA 1LV0A 5JCIA 1H86A 2JB2A 5JCLA 3KPFA 4YT0A 3NTAA 1NHSA 3OZ2A 2WOVA 1BGNA 1GERA 4EM4A 3II4A 3AEGA 1E1MA 2RGHA 2YM2A 3LADA 4X9MA 4ZN0A 3QFAA 1HYUA 4B65A 4KPRA 4U2SA 3F8DA 2WOWA 1IUVA 2BC1A 5HYMA 3AYIA 1S2QA 4YSXA 1H84A 3CMMA 4JY3A 4XWZA 3UOZA 4J57A 4B66A 5BVAA 3ATQA 4II3A 2H89A 4JDRA 2GVCA 4PABA 4TM4A 2BA9A 1OJCA 3NK2X 4U8NA 3UTEA 3AEFA 2FJEA 3GRTA 3T31A 1EL8A 3GMBA 3CNDA 1CL0A 3CN8A 2DKIA 1YQ4A 2R9ZA 4NZHA 1IUXA 2E1MA 3CNTA 1Q1RA 2C70A 3NGCX 2GEWA 4TLZA 5L46A 1L9EA 2OLNA 3AEEA 4IVMB 4TLXA 1KSSA 2YR6A 4P9SA 4H4TA 2GAHB 2B9XA 4G73A 4DGKA 1YY5A 4D04A 1VQWA 4Z2UA 1KFYA 4EQRA 3T2ZA 4GDEA 2XVIA 1BWCA 1GREA 3NG7X 4H2RA 4A6NA 4C77A 3T2KA 2WESA 3K7QX 4A79A 2R0CA 3P4RA 4XXGA 2VVLA 1H81A 2V3BA 3QVPA 4AOSA 4DNAA 4IA6A 3DGZA 4NEWA 1H6VA 1O5WA 1REOA 1FECA 2WP6A 3QSSA 2CFYA 1JEHA 3LB8A 2GB0A 3C96A 5EB4A 2I0ZA 5KVIA 2WP5A 3GD3A 5HHFA 3DK8A 1GNDA 4B67A 4OPTA 1KDGA 3SQPA 1XPQA 4LA1A 1S3BA 2BRYA 1PJ5A 4A7AA 2VQBA 3M12A 2ZBWA 5CKUA 4USRA 2VQ7A 2WDRA 2C3DA 2OLOA 1BF3A 1XHCA 2Q6UA 2X8CA 2ZZBA 1Z6LA 4K22A 3RP8A 2GRTA 1IUUA 1PXAA 2B9YA 2QCUA 1ZP0A 2X3NA 5EBKA 2XFOA 1L9DA 3VRAA 1PBDA 3V3OA 5FMHA 3UCLA 2JBVA 1GEUA 3P9UA 4WCTA 4ICYA 2YVFA 4NTCA 5FS8A 1JRYA 1PBEA 3GYIA 1NAAA 2Q0LA 2A89A 2UZZA 3AE3A 5BULA 1H82A 3DA1A 3AEBA 1QLBA 2C65A 2YM1A 1OJTA 2PYXA 3GD4A 2X50A 1D4EA 3SFDA 5KXJA 2V60A 3DK4A 4K8DA 3D1CA 2YAUA 3RHAA 1UKVG 1ZDLA 4M52A 2EQ7A 3BNMA 1CJ2A 3GWDA 3UKKA 4AP1A 4BJYA 2BCGG 1CJ4A 1H7XA 1DNCA 3WE0A 3KPKA 2NPXA 4H2PA 3M13A 1E1KA 2XLUA 3IWAA 2WHDA 1N4VA 1PXCA 4U8LA 1JU2A 3AD8B 4YWOA 1L0VA 1RP0A 1DODA 3ABVA 3NLCA 3P1WA 4EMJA 1TDEA 4U8JA 3NTDA 3FIMB 2ZZ0A 3B6DA 1GALA 1VG9A 3UKLA 1B8SA 1DOBA 3UOVA 3UOXA 4CY8A 1TYPA 3AE1A 1TDNA 2GH5A 2ACZA 5U25A 2FBWA 3NYEA 3ISHA 1ELIA 2C66A 2RGOA 2V61A 3ITJA 4GR1A 5U63A 3RP6A 4Z2TA 1L9CA 2C3CA 1TDKA 2R0PA 2YG6A 4U2TA 4B69A 4A99A 1D7LA 5C3JA 4Y4NA 4GUVA 3DJEA 2Q7VA 2X8HA 1EL5A 1PDHA 2Q0KA 2E4GA 4BK3A 1QJDA 3QVRA 4RG4A 4OVIA 1JRZA 1NENA 1ZOVA 1GOSA 3BI4A 1NHQA 1LQUA 2YLSA 3HYXA 4Y4LA 3EF6A 1ZMCA 3AE9A 5KNLA 2TMDA 4H4VA 1CBOA 1NHPA 1PN0A 3ZYXA 2CVJA 4JQ9A 3F8PA 2XLSA 4APNA 4AP3A 3AEDA 1K0IA 2JB1A 4ECHA 1CJCA 3S5WA 4K5SA 3F8RA 4YSHA 4USQA 1V59A 1CJ3A 2WOIA 1D5TA 3O0HA 1GSNA 2C7GA 4H4QA 3NN6X 4WX1A 1RSGA 5CQFA 3KU9A 2A8XA 2BYBA 4ZCDA 1KNPA 3G5QA 3FBSA 4YSZA 1DXLA 1EBDA 5BRTA 4AOXA 3BI2A 1JNRA 1Q9IA 2BC0A 3FMWA 4TM0A 2Z5XA 2B76A 2EQ9A 2YG3A 5KWFA 2VRMA 1GV4A 2C67A 4B68A 3SFEA 1LJ1A 1PHHA 2BK5A 2XVJA 4OPUA 2GR0A 2WPEA 1PBCA 1GRHA 4EIQA 4FK1C 4HB9A 3V76A 4CNJA 2BS3A 4UDPA 4AT2A 1E1NA 4B63A 1TDOA 4N9XA 1PJ7A 4BK1A 4CNKA 1H83A 1IUWA 1YQZA 2OA1A 3URHA 1GETA 4YKFA 3GDNA 3T14A 3UKAA 1D4CA 4G6GA 3PVCA 1TRBA 3QSEA 1JOAA 4RSLA 5DBJA 4CRTA 1GTHA 1GPEA 3C4AA 4UDQA 4OCGA 1F6MA 3SZWA 4YKGA 2R4EA 4EQXA 4B64A 5KMQA 1FEAA 3LJPA 3GYXA 3AEAA 3GMCA 3IHMA 2C64A 3VRBA 4G74A 2WQYA 2H88A 3KKJA 4GAPA 2C75A 5BUKA 2QA2A 3SX6A 3UKFA 2BXRA 2Z5YA 3CGEA 4K7ZA 1IUTA 2WDVA 3UOYA 2YR5A 4JY2A 1F8RA 3UP4A 1CHUA 3DMEA 4EIPA 2AAQA 3H4KA 1VG0A 3BHFA 4LIIA 4IV9A 3V3NA 1Y56B 3P4QA 2CULA 2VRLA 3HYWA 3DH9A 4GF7A 4NTEA 1B37A 4H2NA 1ZY8A 3CTYA 2PHHA 2WETA 3NRNA 3T2YA 2XFUA 1KNRA 1VDCA 2QA1A 4BJZA 2E5VA 2YG5A 4YSYA 4U8OA 3KA7A 4GAVA 1E7PA 1EL9A 3AYJA 3KD9A 5GRTA 4YTNA 3JSKA 5KOWA 2EQ6A 1ZOYA 1ZMDA 1NDAA 3EPTA 4K2XA 4OPDA 3UTGA 2JAEA 3UKHA 2GR3A 2XFPA 1OJAA 1N4UA 2OAMA 4A65A 1QO8A 3BNUA 2QAEA 4H4ZA 3KVEA 4DSGA 4JN9A 1AOGA 5KRQA 5KVHA 1DOCA 1NG3A 2HQMA 4X4JA 3D8XA 4A6NB 2TPRA 3QJ4A 3K7TA 1NHRA 3AE2A 2JK6A 1DJNA 4LU6A 3SZCA 2WBAA 4D03A 4ADWA 2ARDA 1CC2A 2ZZCA 4OPCA 3ZDNA 1D4DA 2AQJA 3CGBA 4H4PA 1XANA 5KMPA 2OALA 3UTHA 2BK4A 1F8SA 3T37A 2EQ8A 4TM1A 3NN0X 2BS2A 2YLRA 1SEZA 3AE6A 3VR8A 1CF3A 4A9WA 1IUSA 2YLXA 3KLJA 1ZX9A 3L1RA 4KX6A 2IIDA 3REDA 3VQRA 5IPYA 3AE5A 5M0ZA 2R45A 4H4YA 4A5LA 1PJ6A 2YG4A 5GSNA 2XYOA 1NPXA 1LTXR 3GSIA 1O95A 1H7WA 3AD9B 3CPJG 3GDPA 3HYVA 3UKQA 2XCGA 1Y0PA 1YKJA 4O5QA 4YTPA 4ZCCA 3P4PA 1W4XA 2JB3A 2B7SA 4IVOB 2RGJA 5FS9A 5IQ1A 1NG4A 1M6IA 3AYLA 4Z24A 3R9UA 1OJ9A 4G6HA 4EQWA 2RABA 3DJDA 1S3EA 1ZKQA 3PO7A 4U8PA 3SM8A 3CGDA 4BURA 4AT0A 5ER0A 4EM3A 3QSMA 5JCNA
chains in the Genus database with same CATH topology
1M64A 1GRBA 3LZWA 1GRAA 3NNEA 1GRTA 4CCRA 1GRFA 4YTMA 3GYJA 1K4QA 1XDIA 2VVLG 5TR3A 4Z25A 2BK3A 1IJHA 1TDFA 3L8KA 5KOXA 1B5QA 1MOKA 3M0OA 2VZ2A 4BK2A 4TM3A 2VOUA 5FS7A 2B9WA 2YVJA 5J60A 1FOHA 3UTFA 1KF6A 1COYA 3SY4A 4GDPA 1CC6A 5KMRA 3AE4A 1B4VA 2Y6RA 3ATRA 5M10A 1Y56A 3AB1A 3LOVA 3DJGX 4JNQA 1ZK7A 3Q6JA 1PBFA 2NVKX 4OPIA 1K0JA 4C3YA 3NT6A 1FL2A 2DKHA 2C72A 2JKCA 4NWZA 1E6EA 2YQUA 2YVGA 1GRGA 2IVDA 3OC4A 4NTDA 1K0LA 3ICTA 2GAGB 3H8IA 3B3RA 4GRTA 4EQSA 4OPGA 2J3NA 4JNAA 5JCKA 5IQ4A 3PS9A 3AECA 1D7YA 4C5OA 3T0KA 3CNJA 3HZLA 4H4XA 3SYIA 4NNJA 2B7RA 5FS6A 3IHGA 1PS9A 4H4SA 4EMWA 3NK1X 3AE8A 3SXIA 4I58A 4IA5A 3CPIG 2XDOA 1BZLA 3ALMA 3QFBA 4J31A 4EMIA 3RNMA 4B1BA 4Z2RA 5HY5A 5KMSA 2C73A 2BABA 3NIXA 4FDCB 1FEBA 3DJJA 3K7MX 1PXBA 2GF3A 1KSUA 4UP3A 2GR2A 1P2HA 3G5SA 2V5ZA 3UKPA 1CC4A 4G9KA 4CCQA 3UP5A 2BS4A 2WS3A 2WDQA 3GRSA 2GMHA 2XLPA 1BGJA 2XVEA 1TYTA 4NEVA 3CNSA 3NYCA 4X9NA 1FCDA 3FG2P 1OJDA 4GCMA 2C76A 5U1OA 1GXFA 3RP7A 4Z26A 2YLZA 1DOEA 2GV8A 4II2A 2XFNA 2WPCA 4FK1A 4MJWA 4U8IA 1EL7A 1GTEA 2XFQA 5EB5A 3NHOX 2X8GA 2XVFA 1JRXA 1PBBA 3CNPA 3ALJA 2GQWA 3SZ0A 2WU5A 1E1LA 1P2EA 2BCPA 2WPFA 2F5ZA 1N1PA 3AWIA 2XLTA 3P4SA 3SGLA 1LQTA 2FJAA 3K30A 1NEKA 3GWFA 4Z43A 1MXTA 2XVHA 3EANA 2BACA 5EOWA 5JCMA 3COXA 1X31B 3AD7B 2V6OA 2R0GA 3VRDB 2O9ZA 2Y6QA 1F3PA 4CY6A 2GMJA 1BKWA 4J56A 4Z44A 3BHKA 2W0HA 3DK9A 4FX9A 4U8MA 2C4CA 4HA6A 4RG3A 3CIRA 5J7XA 3IC9A 3NKSA 4H50A 4H2QA 4I59A 1JNZA 4YXDA 1YQ3A 3G5RA 4E0VA 3ADAB 2XLRA 4J33A 4CBQA 3C4NA 3AXBA 4DSHA 3CGCA 3FPZA 1VRQB 3NYFA 2BXSA 2AR8A 2R4JA 1MO9A 2X99A 2YR4A 4H4RA 1GT8A 2GQFA 4J2WA 4OPLA 4U2LA 5HXIA 3IF9A 1ONFA 3EAOA 2FJDA 4XWRA 3SZFA 2A87A 3LZXA 4J34A 3ALLA 4H4WA 1E39A 2GR1A 5C2TA 4UDRA 2YG7A 3S61A 2YWLA 1N4WA 1Q1WA 1O94A 2WP9A 3I3LA 3I6DA 4K5RA 2V3AA 4H7UA 4Y4MA 1F8WA 4C74A 1LVLA 2WEUA 3NH3X 3VR9A 5LV9A 3Q9TA 3LXDA 3NK0X 3CPHG 4J36A 3BI5A 1LPFA 4H4UA 4BV6A 1S2YA 2IVEA 2YLTA 4REKA 2VVMA 3DGHA 4U8KA 1RYIA 1DJQA 2R46A 4PAAA 2WU2A 2CDUA 3ICRA 2APGA 3AE7A 3E1TA 3H8LA 2FJBA 2BRAA 4O5UA 1GESA 4C3XA 2YLWA 3ICSA 1LV0A 5JCIA 1H86A 2JB2A 5JCLA 3KPFA 4YT0A 3NTAA 1NHSA 3OZ2A 2WOVA 1BGNA 1GERA 4EM4A 3II4A 3AEGA 1E1MA 2RGHA 2YM2A 3LADA 4X9MA 4ZN0A 3QFAA 1HYUA 4B65A 4KPRA 4U2SA 3F8DA 2WOWA 1IUVA 2BC1A 5HYMA 3AYIA 1S2QA 4YSXA 1H84A 3CMMA 4JY3A 4XWZA 3UOZA 4J57A 4B66A 5BVAA 3ATQA 4II3A 2H89A 4JDRA 2GVCA 4PABA 4TM4A 2BA9A 1OJCA 3NK2X 4U8NA 3UTEA 3AEFA 2FJEA 3GRTA 3T31A 1EL8A 3GMBA 3CNDA 1CL0A 3CN8A 2DKIA 1YQ4A 2R9ZA 4NZHA 1IUXA 2E1MA 3CNTA 1Q1RA 2C70A 3NGCX 2GEWA 4TLZA 5L46A 1L9EA 2OLNA 3AEEA 4IVMB 4TLXA 1KSSA 2YR6A 4P9SA 4H4TA 2GAHB 2B9XA 4G73A 4DGKA 1YY5A 4D04A 1VQWA 4Z2UA 1KFYA 4EQRA 3T2ZA 4GDEA 2XVIA 1BWCA 1GREA 3NG7X 4H2RA 4A6NA 4C77A 3T2KA 2WESA 3K7QX 4A79A 2R0CA 3P4RA 4XXGA 2VVLA 1H81A 2V3BA 3QVPA 4AOSA 4DNAA 4IA6A 3DGZA 4NEWA 1H6VA 1O5WA 1REOA 1FECA 2WP6A 3QSSA 2CFYA 1JEHA 3LB8A 2GB0A 3C96A 5EB4A 2I0ZA 5KVIA 2WP5A 3GD3A 5HHFA 3DK8A 1GNDA 4B67A 4OPTA 1KDGA 3SQPA 1XPQA 4LA1A 1S3BA 2BRYA 1PJ5A 4A7AA 2VQBA 3M12A 2ZBWA 5CKUA 4USRA 2VQ7A 2WDRA 2C3DA 2OLOA 1BF3A 1XHCA 2Q6UA 2X8CA 2ZZBA 1Z6LA 4K22A 3RP8A 2GRTA 1IUUA 1PXAA 2B9YA 2QCUA 1ZP0A 2X3NA 5EBKA 2XFOA 1L9DA 3VRAA 1PBDA 3V3OA 5FMHA 3UCLA 2JBVA 1GEUA 3P9UA 4WCTA 4ICYA 2YVFA 4NTCA 5FS8A 1JRYA 1PBEA 3GYIA 1NAAA 2Q0LA 2A89A 2UZZA 3AE3A 5BULA 1H82A 3DA1A 3AEBA 1QLBA 2C65A 2YM1A 1OJTA 2PYXA 3GD4A 2X50A 1D4EA 3SFDA 5KXJA 2V60A 3DK4A 4K8DA 3D1CA 2YAUA 3RHAA 1UKVG 1ZDLA 4M52A 2EQ7A 3BNMA 1CJ2A 3GWDA 3UKKA 4AP1A 4BJYA 2BCGG 1CJ4A 1H7XA 1DNCA 3WE0A 3KPKA 2NPXA 4H2PA 3M13A 1E1KA 2XLUA 3IWAA 2WHDA 1N4VA 1PXCA 4U8LA 1JU2A 3AD8B 4YWOA 1L0VA 1RP0A 1DODA 3ABVA 3NLCA 3P1WA 4EMJA 1TDEA 4U8JA 3NTDA 3FIMB 2ZZ0A 3B6DA 1GALA 1VG9A 3UKLA 1B8SA 1DOBA 3UOVA 3UOXA 4CY8A 1TYPA 3AE1A 1TDNA 2GH5A 2ACZA 5U25A 2FBWA 3NYEA 3ISHA 1ELIA 2C66A 2RGOA 2V61A 3ITJA 4GR1A 5U63A 3RP6A 4Z2TA 1L9CA 2C3CA 1TDKA 2R0PA 2YG6A 4U2TA 4B69A 4A99A 1D7LA 5C3JA 4Y4NA 4GUVA 3DJEA 2Q7VA 2X8HA 1EL5A 1PDHA 2Q0KA 2E4GA 4BK3A 1QJDA 3QVRA 4RG4A 4OVIA 1JRZA 1NENA 1ZOVA 1GOSA 3BI4A 1NHQA 1LQUA 2YLSA 3HYXA 4Y4LA 3EF6A 1ZMCA 3AE9A 5KNLA 2TMDA 4H4VA 1CBOA 1NHPA 1PN0A 3ZYXA 2CVJA 4JQ9A 3F8PA 2XLSA 4APNA 4AP3A 3AEDA 1K0IA 2JB1A 4ECHA 1CJCA 3S5WA 4K5SA 3F8RA 4YSHA 4USQA 1V59A 1CJ3A 2WOIA 1D5TA 3O0HA 1GSNA 2C7GA 4H4QA 3NN6X 4WX1A 1RSGA 5CQFA 3KU9A 2A8XA 2BYBA 4ZCDA 1KNPA 3G5QA 3FBSA 4YSZA 1DXLA 1EBDA 5BRTA 4AOXA 3BI2A 1JNRA 1Q9IA 2BC0A 3FMWA 4TM0A 2Z5XA 2B76A 2EQ9A 2YG3A 5KWFA 2VRMA 1GV4A 2C67A 4B68A 3SFEA 1LJ1A 1PHHA 2BK5A 2XVJA 4OPUA 2GR0A 2WPEA 1PBCA 1GRHA 4EIQA 4FK1C 4HB9A 3V76A 4CNJA 2BS3A 4UDPA 4AT2A 1E1NA 4B63A 1TDOA 4N9XA 1PJ7A 4BK1A 4CNKA 1H83A 1IUWA 1YQZA 2OA1A 3URHA 1GETA 4YKFA 3GDNA 3T14A 3UKAA 1D4CA 4G6GA 3PVCA 1TRBA 3QSEA 1JOAA 4RSLA 5DBJA 4CRTA 1GTHA 1GPEA 3C4AA 4UDQA 4OCGA 1F6MA 3SZWA 4YKGA 2R4EA 4EQXA 4B64A 5KMQA 1FEAA 3LJPA 3GYXA 3AEAA 3GMCA 3IHMA 2C64A 3VRBA 4G74A 2WQYA 2H88A 3KKJA 4GAPA 2C75A 5BUKA 2QA2A 3SX6A 3UKFA 2BXRA 2Z5YA 3CGEA 4K7ZA 1IUTA 2WDVA 3UOYA 2YR5A 4JY2A 1F8RA 3UP4A 1CHUA 3DMEA 4EIPA 2AAQA 3H4KA 1VG0A 3BHFA 4LIIA 4IV9A 3V3NA 1Y56B 3P4QA 2CULA 2VRLA 3HYWA 3DH9A 4GF7A 4NTEA 1B37A 4H2NA 1ZY8A 3CTYA 2PHHA 2WETA 3NRNA 3T2YA 2XFUA 1KNRA 1VDCA 2QA1A 4BJZA 2E5VA 2YG5A 4YSYA 4U8OA 3KA7A 4GAVA 1E7PA 1EL9A 3AYJA 3KD9A 5GRTA 4YTNA 3JSKA 5KOWA 2EQ6A 1ZOYA 1ZMDA 1NDAA 3EPTA 4K2XA 4OPDA 3UTGA 2JAEA 3UKHA 2GR3A 2XFPA 1OJAA 1N4UA 2OAMA 4A65A 1QO8A 3BNUA 2QAEA 4H4ZA 3KVEA 4DSGA 4JN9A 1AOGA 5KRQA 5KVHA 1DOCA 1NG3A 2HQMA 4X4JA 3D8XA 4A6NB 2TPRA 3QJ4A 3K7TA 1NHRA 3AE2A 2JK6A 1DJNA 4LU6A 3SZCA 2WBAA 4D03A 4ADWA 2ARDA 1CC2A 2ZZCA 4OPCA 3ZDNA 1D4DA 2AQJA 3CGBA 4H4PA 1XANA 5KMPA 2OALA 3UTHA 2BK4A 1F8SA 3T37A 2EQ8A 4TM1A 3NN0X 2BS2A 2YLRA 1SEZA 3AE6A 3VR8A 1CF3A 4A9WA 1IUSA 2YLXA 3KLJA 1ZX9A 3L1RA 4KX6A 2IIDA 3REDA 3VQRA 5IPYA 3AE5A 5M0ZA 2R45A 4H4YA 4A5LA 1PJ6A 2YG4A 5GSNA 2XYOA 1NPXA 1LTXR 3GSIA 1O95A 1H7WA 3AD9B 3CPJG 3GDPA 3HYVA 3UKQA 2XCGA 1Y0PA 1YKJA 4O5QA 4YTPA 4ZCCA 3P4PA 1W4XA 2JB3A 2B7SA 4IVOB 2RGJA 5FS9A 5IQ1A 1NG4A 1M6IA 3AYLA 4Z24A 3R9UA 1OJ9A 4G6HA 4EQWA 2RABA 3DJDA 1S3EA 1ZKQA 3PO7A 4U8PA 3SM8A 3CGDA 4BURA 4AT0A 5ER0A 4EM3A 3QSMA 5JCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M64 A;  1GRB A;  3LZW A;  1GRA A;  3NNE A;  1GRT A;  4CCR A;  1GRF A;  4YTM A;  3GYJ A;  1K4Q A;  1XDI A;  2VVL G;  5TR3 A;  4Z25 A;  2BK3 A;  1IJH A;  1TDF A;  3L8K A;  5KOX A;  1B5Q A;  1MOK A;  3M0O A;  2VZ2 A;  4BK2 A;  4TM3 A;  2VOU A;  5FS7 A;  2B9W A;  2YVJ A;  5J60 A;  1FOH A;  3UTF A;  1KF6 A;  1COY A;  4GDP A;  1CC6 A;  3AE4 A;  1B4V A;  2Y6R A;  3ATR A;  5M10 A;  1Y56 A;  3AB1 A;  3LOV A;  3DJG X;  4JNQ A;  1ZK7 A;  3Q6J A;  1PBF A;  2NVK X;  4OPI A;  1K0J A;  4C3Y A;  3NT6 A;  1FL2 A;  2DKH A;  2C72 A;  2JKC A;  1E6E A;  2YQU A;  2YVG A;  1GRG A;  2IVD A;  3OC4 A;  4NTD A;  1K0L A;  3ICT A;  2GAG B;  3H8I A;  3B3R A;  4GRT A;  4EQS A;  4OPG A;  2J3N A;  4JNA A;  5JCK A;  5IQ4 A;  3PS9 A;  3AEC A;  1D7Y A;  4C5O A;  3CNJ A;  3HZL A;  4H4X A;  2B7R A;  5FS6 A;  3IHG A;  1PS9 A;  4H4S A;  4EMW A;  3NK1 X;  3AE8 A;  4I58 A;  4IA5 A;  3CPI G;  2XDO A;  1BZL A;  3ALM A;  3QFB A;  4J31 A;  4EMI A;  3RNM A;  4B1B A;  4Z2R A;  5HY5 A;  2C73 A;  2BAB A;  3NIX A;  4FDC B;  1FEB A;  3DJJ A;  3K7M X;  1PXB A;  2GF3 A;  1KSU A;  4UP3 A;  2GR2 A;  1P2H A;  3G5S A;  2V5Z A;  3UKP A;  1CC4 A;  4CCQ A;  3UP5 A;  2BS4 A;  2WS3 A;  2WDQ A;  3GRS A;  2GMH A;  2XLP A;  1BGJ A;  2XVE A;  1TYT A;  4NEV A;  3CNS A;  3NYC A;  4X9N A;  1FCD A;  3FG2 P;  1OJD A;  4GCM A;  2C76 A;  5U1O A;  1GXF A;  3RP7 A;  4Z26 A;  2YLZ A;  1DOE A;  2GV8 A;  2XFN A;  2WPC A;  4FK1 A;  4MJW A;  4U8I A;  1EL7 A;  1GTE A;  2XFQ A;  5EB5 A;  3NHO X;  2X8G A;  2XVF A;  1JRX A;  1PBB A;  3CNP A;  3ALJ A;  2GQW A;  2WU5 A;  1E1L A;  1P2E A;  2BCP A;  2WPF A;  2F5Z A;  1N1P A;  3AWI A;  2XLT A;  3P4S A;  3SGL A;  1LQT A;  2FJA A;  3K30 A;  1NEK A;  3GWF A;  4Z43 A;  1MXT A;  2XVH A;  3EAN A;  2BAC A;  5EOW A;  5JCM A;  3COX A;  1X31 B;  3AD7 B;  2V6O A;  2R0G A;  3VRD B;  2O9Z A;  2Y6Q A;  1F3P A;  4CY6 A;  2GMJ A;  1BKW A;  4J56 A;  4Z44 A;  3BHK A;  2W0H A;  3DK9 A;  4FX9 A;  4U8M A;  4HA6 A;  5J7X A;  4RG3 A;  3CIR A;  3IC9 A;  3NKS A;  4H50 A;  4H2Q A;  4I59 A;  1JNZ A;  4YXD A;  1YQ3 A;  3G5R A;  4E0V A;  3ADA B;  2XLR A;  4J33 A;  4CBQ A;  3C4N A;  3AXB A;  4DSH A;  3CGC A;  3FPZ A;  1VRQ B;  3NYF A;  2BXS A;  2AR8 A;  2R4J A;  1MO9 A;  2X99 A;  2YR4 A;  4H4R A;  1GT8 A;  2GQF A;  4J2W A;  4OPL A;  4U2L A;  5HXI A;  3IF9 A;  1ONF A;  3EAO A;  2FJD A;  4XWR A;  2A87 A;  3LZX A;  4J34 A;  3ALL A;  4H4W A;  1E39 A;  2GR1 A;  5C2T A;  4UDR A;  2YG7 A;  3S61 A;  2YWL A;  1N4W A;  1Q1W A;  1O94 A;  2WP9 A;  3I3L A;  3I6D A;  4K5R A;  2V3A A;  4H7U A;  4Y4M A;  1F8W A;  4C74 A;  1LVL A;  2WEU A;  3NH3 X;  3VR9 A;  5LV9 A;  3Q9T A;  3LXD A;  3NK0 X;  3CPH G;  4J36 A;  3BI5 A;  1LPF A;  4H4U A;  4BV6 A;  1S2Y A;  2IVE A;  2YLT A;  4REK A;  2VVM A;  3DGH A;  4U8K A;  1RYI A;  1DJQ A;  2R46 A;  4PAA A;  2WU2 A;  2CDU A;  3ICR A;  2APG A;  3AE7 A;  3E1T A;  3H8L A;  2FJB A;  4O5U A;  1GES A;  4C3X A;  2YLW A;  3ICS A;  1LV0 A;  5JCI A;  1H86 A;  2JB2 A;  5JCL A;  3KPF A;  4YT0 A;  3NTA A;  1NHS A;  3OZ2 A;  2WOV A;  1BGN A;  1GER A;  4EM4 A;  3II4 A;  3AEG A;  1E1M A;  2RGH A;  2YM2 A;  3LAD A;  4X9M A;  4ZN0 A;  3QFA A;  1HYU A;  4B65 A;  4KPR A;  4U2S A;  3F8D A;  2WOW A;  1IUV A;  2BC1 A;  5HYM A;  3AYI A;  1S2Q A;  4YSX A;  1H84 A;  4JY3 A;  4XWZ A;  3UOZ A;  4J57 A;  4B66 A;  5BVA A;  3ATQ A;  4PAB A;  2H89 A;  4JDR A;  2GVC A;  4TM4 A;  4U8N A;  2BA9 A;  1OJC A;  3NK2 X;  3UTE A;  3AEF A;  2FJE A;  3GRT A;  1EL8 A;  3GMB A;  3CND A;  1CL0 A;  3CN8 A;  2DKI A;  1YQ4 A;  2R9Z A;  4NZH A;  1IUX A;  2E1M A;  3CNT A;  1Q1R A;  2C70 A;  3NGC X;  2GEW A;  4TLZ A;  5L46 A;  1L9E A;  2OLN A;  3AEE A;  4IVM B;  4TLX A;  1KSS A;  2YR6 A;  4P9S A;  4H4T A;  2GAH B;  2B9X A;  4DGK A;  1YY5 A;  4D04 A;  1VQW A;  4Z2U A;  1KFY A;  4EQR A;  4GDE A;  2XVI A;  1BWC A;  1GRE A;  3NG7 X;  4H2R A;  4A6N A;  4C77 A;  2WES A;  3K7Q X;  4A79 A;  2R0C A;  3P4R A;  4XXG A;  2VVL A;  1H81 A;  2V3B A;  3QVP A;  4AOS A;  4DNA A;  4IA6 A;  3DGZ A;  4NEW A;  1H6V A;  1O5W A;  1REO A;  1FEC A;  2WP6 A;  3QSS A;  2CFY A;  1JEH A;  3LB8 A;  2GB0 A;  3C96 A;  5EB4 A;  2I0Z A;  5KVI A;  2WP5 A;  3GD3 A;  5HHF A;  3DK8 A;  1GND A;  4B67 A;  4OPT A;  1KDG A;  3SQP A;  1XPQ A;  4LA1 A;  1S3B A;  1PJ5 A;  4A7A A;  2VQB A;  3M12 A;  2ZBW A;  5CKU A;  4USR A;  2VQ7 A;  2WDR A;  2C3D A;  2OLO A;  1BF3 A;  1XHC A;  2Q6U A;  2X8C A;  2ZZB A;  1Z6L A;  4K22 A;  3RP8 A;  2GRT A;  1IUU A;  1PXA A;  2B9Y A;  2QCU A;  1ZP0 A;  2X3N A;  5EBK A;  2XFO A;  1L9D A;  3VRA A;  1PBD A;  3V3O A;  5FMH A;  3UCL A;  2JBV A;  1GEU A;  3P9U A;  4WCT A;  4ICY A;  2YVF A;  4NTC A;  5FS8 A;  1JRY A;  1PBE A;  3GYI A;  1NAA A;  2Q0L A;  2A89 A;  2UZZ A;  3AE3 A;  5BUL A;  1H82 A;  3DA1 A;  3AEB A;  1QLB A;  2C65 A;  2YM1 A;  1OJT A;  2PYX A;  3GD4 A;  2X50 A;  1D4E A;  3SFD A;  5KXJ A;  2V60 A;  3DK4 A;  4K8D A;  3D1C A;  2YAU A;  3RHA A;  1UKV G;  1ZDL A;  4M52 A;  2EQ7 A;  3BNM A;  1CJ2 A;  3GWD A;  3UKK A;  4AP1 A;  4BJY A;  2BCG G;  1CJ4 A;  1H7X A;  1DNC A;  3WE0 A;  2NPX A;  4H2P A;  3M13 A;  1E1K A;  2XLU A;  3IWA A;  2WHD A;  1N4V A;  1PXC A;  4U8L A;  1JU2 A;  3AD8 B;  4YWO A;  1L0V A;  1RP0 A;  1DOD A;  3ABV A;  3NLC A;  3P1W A;  4EMJ A;  1TDE A;  4U8J A;  3NTD A;  3FIM B;  2ZZ0 A;  3B6D A;  1GAL A;  1VG9 A;  3UKL A;  1B8S A;  1DOB A;  3UOV A;  3UOX A;  4CY8 A;  1TYP A;  3AE1 A;  1TDN A;  2GH5 A;  2ACZ A;  5U25 A;  2FBW A;  3NYE A;  3ISH A;  1ELI A;  2C66 A;  2RGO A;  2V61 A;  3ITJ A;  4GR1 A;  5U63 A;  3RP6 A;  4Z2T A;  1L9C A;  2C3C A;  1TDK A;  2R0P A;  2YG6 A;  4U2T A;  4B69 A;  4A99 A;  1D7L A;  5C3J A;  4Y4N A;  4GUV A;  3DJE A;  2Q7V A;  2X8H A;  1EL5 A;  1PDH A;  2Q0K A;  2E4G A;  4BK3 A;  1QJD A;  3QVR A;  4RG4 A;  4OVI A;  1JRZ A;  1NEN A;  1ZOV A;  1GOS A;  3BI4 A;  1NHQ A;  1LQU A;  2YLS A;  4Y4L A;  3EF6 A;  1ZMC A;  3AE9 A;  2TMD A;  4H4V A;  1CBO A;  1NHP A;  1PN0 A;  3ZYX A;  2CVJ A;  4JQ9 A;  3F8P A;  2XLS A;  4APN A;  4AP3 A;  3AED A;  1K0I A;  2JB1 A;  4ECH A;  1CJC A;  3S5W A;  4K5S A;  3F8R A;  4YSH A;  4USQ A;  1V59 A;  1CJ3 A;  2WOI A;  1D5T A;  3O0H A;  1GSN A;  2C7G A;  4H4Q A;  3NN6 X;  4WX1 A;  1RSG A;  5CQF A;  3KU9 A;  2A8X A;  2BYB A;  4ZCD A;  1KNP A;  3G5Q A;  3FBS A;  4YSZ A;  1DXL A;  1EBD A;  5BRT A;  4AOX A;  3BI2 A;  1JNR A;  1Q9I A;  2BC0 A;  3FMW A;  4TM0 A;  2Z5X A;  2B76 A;  2EQ9 A;  2YG3 A;  5KWF A;  2VRM A;  1GV4 A;  2C67 A;  4B68 A;  3SFE A;  1LJ1 A;  1PHH A;  2BK5 A;  2XVJ A;  4OPU A;  2GR0 A;  2WPE A;  1PBC A;  1GRH A;  4EIQ A;  4FK1 C;  4HB9 A;  3V76 A;  4CNJ A;  2BS3 A;  4UDP A;  4AT2 A;  1E1N A;  4B63 A;  1TDO A;  4N9X A;  1PJ7 A;  4BK1 A;  4CNK A;  1H83 A;  1IUW A;  1YQZ A;  2OA1 A;  3URH A;  1GET A;  4YKF A;  3GDN A;  3UKA A;  1D4C A;  3PVC A;  1TRB A;  3QSE A;  1JOA A;  4RSL A;  5DBJ A;  4CRT A;  1GTH A;  1GPE A;  3C4A A;  4UDQ A;  4OCG A;  1F6M A;  4YKG A;  2R4E A;  4EQX A;  4B64 A;  1FEA A;  3LJP A;  3AEA A;  3GMC A;  3IHM A;  2C64 A;  3VRB A;  2WQY A;  2H88 A;  3KKJ A;  2C75 A;  5BUK A;  2QA2 A;  3UKF A;  2BXR A;  2Z5Y A;  3CGE A;  4K7Z A;  1IUT A;  2WDV A;  3UOY A;  2YR5 A;  4JY2 A;  1F8R A;  3UP4 A;  1CHU A;  3DME A;  4EIP A;  2AAQ A;  3H4K A;  1VG0 A;  3BHF A;  4LII A;  4IV9 A;  3V3N A;  1Y56 B;  3P4Q A;  2CUL A;  2VRL A;  3DH9 A;  4GF7 A;  4NTE A;  1B37 A;  4H2N A;  1ZY8 A;  3CTY A;  2PHH A;  2WET A;  3NRN A;  2XFU A;  1KNR A;  1VDC A;  2QA1 A;  4BJZ A;  2E5V A;  2YG5 A;  4YSY A;  4U8O A;  3KA7 A;  1E7P A;  1EL9 A;  3AYJ A;  3KD9 A;  5GRT A;  4YTN A;  3JSK A;  5KOW A;  2EQ6 A;  1ZOY A;  1ZMD A;  1NDA A;  3EPT A;  4K2X A;  4OPD A;  3UTG A;  2JAE A;  3UKH A;  2GR3 A;  2XFP A;  1OJA A;  1N4U A;  2OAM A;  4A65 A;  1QO8 A;  3BNU A;  2QAE A;  4H4Z A;  3KVE A;  4DSG A;  4JN9 A;  1AOG A;  5KRQ A;  5KVH A;  1DOC A;  1NG3 A;  2HQM A;  4X4J A;  3D8X A;  4A6N B;  2TPR A;  3QJ4 A;  3K7T A;  1NHR A;  3AE2 A;  2JK6 A;  1DJN A;  4LU6 A;  2WBA A;  4D03 A;  4ADW A;  2ARD A;  1CC2 A;  2ZZC A;  4OPC A;  3ZDN A;  1D4D A;  2AQJ A;  3CGB A;  4H4P A;  1XAN A;  2OAL A;  3UTH A;  2BK4 A;  1F8S A;  3T37 A;  2EQ8 A;  4TM1 A;  3NN0 X;  2BS2 A;  2YLR A;  1SEZ A;  3AE6 A;  3VR8 A;  1CF3 A;  4A9W A;  1IUS A;  2YLX A;  3KLJ A;  1ZX9 A;  3L1R A;  4KX6 A;  2IID A;  3RED A;  3VQR A;  5IPY A;  3AE5 A;  5M0Z A;  2R45 A;  4H4Y A;  4A5L A;  1PJ6 A;  2YG4 A;  5GSN A;  2XYO A;  1NPX A;  1LTX R;  3GSI A;  1O95 A;  1H7W A;  3AD9 B;  3CPJ G;  3GDP A;  3UKQ A;  2XCG A;  1Y0P A;  1YKJ A;  4O5Q A;  4YTP A;  4ZCC A;  3P4P A;  1W4X A;  2JB3 A;  2B7S A;  4IVO B;  2RGJ A;  5FS9 A;  5IQ1 A;  1NG4 A;  1M6I A;  3AYL A;  4Z24 A;  3R9U A;  1OJ9 A;  4EQW A;  2RAB A;  3DJD A;  1S3E A;  1ZKQ A;  3PO7 A;  4U8P A;  3SM8 A;  3CGD A;  4BUR A;  4AT0 A;  5ER0 A;  4EM3 A;  3QSM A;  5JCN A; 
#chains in the Genus database with same CATH topology
 1M64 A;  1GRB A;  3LZW A;  1GRA A;  3NNE A;  1GRT A;  4CCR A;  1GRF A;  4YTM A;  3GYJ A;  1K4Q A;  1XDI A;  2VVL G;  5TR3 A;  4Z25 A;  2BK3 A;  1IJH A;  1TDF A;  3L8K A;  5KOX A;  1B5Q A;  1MOK A;  3M0O A;  2VZ2 A;  4BK2 A;  4TM3 A;  2VOU A;  5FS7 A;  2B9W A;  2YVJ A;  5J60 A;  1FOH A;  3UTF A;  1KF6 A;  1COY A;  3SY4 A;  4GDP A;  1CC6 A;  5KMR A;  3AE4 A;  1B4V A;  2Y6R A;  3ATR A;  5M10 A;  1Y56 A;  3AB1 A;  3LOV A;  3DJG X;  4JNQ A;  1ZK7 A;  3Q6J A;  1PBF A;  2NVK X;  4OPI A;  1K0J A;  4C3Y A;  3NT6 A;  1FL2 A;  2DKH A;  2C72 A;  2JKC A;  4NWZ A;  1E6E A;  2YQU A;  2YVG A;  1GRG A;  2IVD A;  3OC4 A;  4NTD A;  1K0L A;  3ICT A;  2GAG B;  3H8I A;  3B3R A;  4GRT A;  4EQS A;  4OPG A;  2J3N A;  4JNA A;  5JCK A;  5IQ4 A;  3PS9 A;  3AEC A;  1D7Y A;  4C5O A;  3T0K A;  3CNJ A;  3HZL A;  4H4X A;  3SYI A;  4NNJ A;  2B7R A;  5FS6 A;  3IHG A;  1PS9 A;  4H4S A;  4EMW A;  3NK1 X;  3AE8 A;  3SXI A;  4I58 A;  4IA5 A;  3CPI G;  2XDO A;  1BZL A;  3ALM A;  3QFB A;  4J31 A;  4EMI A;  3RNM A;  4B1B A;  4Z2R A;  5HY5 A;  5KMS A;  2C73 A;  2BAB A;  3NIX A;  4FDC B;  1FEB A;  3DJJ A;  3K7M X;  1PXB A;  2GF3 A;  1KSU A;  4UP3 A;  2GR2 A;  1P2H A;  3G5S A;  2V5Z A;  3UKP A;  1CC4 A;  4G9K A;  4CCQ A;  3UP5 A;  2BS4 A;  2WS3 A;  2WDQ A;  3GRS A;  2GMH A;  2XLP A;  1BGJ A;  2XVE A;  1TYT A;  4NEV A;  3CNS A;  3NYC A;  4X9N A;  1FCD A;  3FG2 P;  1OJD A;  4GCM A;  2C76 A;  5U1O A;  1GXF A;  3RP7 A;  4Z26 A;  2YLZ A;  1DOE A;  2GV8 A;  4II2 A;  2XFN A;  2WPC A;  4FK1 A;  4MJW A;  4U8I A;  1EL7 A;  1GTE A;  2XFQ A;  5EB5 A;  3NHO X;  2X8G A;  2XVF A;  1JRX A;  1PBB A;  3CNP A;  3ALJ A;  2GQW A;  3SZ0 A;  2WU5 A;  1E1L A;  1P2E A;  2BCP A;  2WPF A;  2F5Z A;  1N1P A;  3AWI A;  2XLT A;  3P4S A;  3SGL A;  1LQT A;  2FJA A;  3K30 A;  1NEK A;  3GWF A;  4Z43 A;  1MXT A;  2XVH A;  3EAN A;  2BAC A;  5EOW A;  5JCM A;  3COX A;  1X31 B;  3AD7 B;  2V6O A;  2R0G A;  3VRD B;  2O9Z A;  2Y6Q A;  1F3P A;  4CY6 A;  2GMJ A;  1BKW A;  4J56 A;  4Z44 A;  3BHK A;  2W0H A;  3DK9 A;  4FX9 A;  4U8M A;  2C4C A;  4HA6 A;  4RG3 A;  3CIR A;  5J7X A;  3IC9 A;  3NKS A;  4H50 A;  4H2Q A;  4I59 A;  1JNZ A;  4YXD A;  1YQ3 A;  3G5R A;  4E0V A;  3ADA B;  2XLR A;  4J33 A;  4CBQ A;  3C4N A;  3AXB A;  4DSH A;  3CGC A;  3FPZ A;  1VRQ B;  3NYF A;  2BXS A;  2AR8 A;  2R4J A;  1MO9 A;  2X99 A;  2YR4 A;  4H4R A;  1GT8 A;  2GQF A;  4J2W A;  4OPL A;  4U2L A;  5HXI A;  3IF9 A;  1ONF A;  3EAO A;  2FJD A;  4XWR A;  3SZF A;  2A87 A;  3LZX A;  4J34 A;  3ALL A;  4H4W A;  1E39 A;  2GR1 A;  5C2T A;  4UDR A;  2YG7 A;  3S61 A;  2YWL A;  1N4W A;  1Q1W A;  1O94 A;  2WP9 A;  3I3L A;  3I6D A;  4K5R A;  2V3A A;  4H7U A;  4Y4M A;  1F8W A;  4C74 A;  1LVL A;  2WEU A;  3NH3 X;  3VR9 A;  5LV9 A;  3Q9T A;  3LXD A;  3NK0 X;  3CPH G;  4J36 A;  3BI5 A;  1LPF A;  4H4U A;  4BV6 A;  1S2Y A;  2IVE A;  2YLT A;  4REK A;  2VVM A;  3DGH A;  4U8K A;  1RYI A;  1DJQ A;  2R46 A;  4PAA A;  2WU2 A;  2CDU A;  3ICR A;  2APG A;  3AE7 A;  3E1T A;  3H8L A;  2FJB A;  2BRA A;  4O5U A;  1GES A;  4C3X A;  2YLW A;  3ICS A;  1LV0 A;  5JCI A;  1H86 A;  2JB2 A;  5JCL A;  3KPF A;  4YT0 A;  3NTA A;  1NHS A;  3OZ2 A;  2WOV A;  1BGN A;  1GER A;  4EM4 A;  3II4 A;  3AEG A;  1E1M A;  2RGH A;  2YM2 A;  3LAD A;  4X9M A;  4ZN0 A;  3QFA A;  1HYU A;  4B65 A;  4KPR A;  4U2S A;  3F8D A;  2WOW A;  1IUV A;  2BC1 A;  5HYM A;  3AYI A;  1S2Q A;  4YSX A;  1H84 A;  3CMM A;  4JY3 A;  4XWZ A;  3UOZ A;  4J57 A;  4B66 A;  5BVA A;  3ATQ A;  4II3 A;  2H89 A;  4JDR A;  2GVC A;  4PAB A;  4TM4 A;  2BA9 A;  1OJC A;  3NK2 X;  4U8N A;  3UTE A;  3AEF A;  2FJE A;  3GRT A;  3T31 A;  1EL8 A;  3GMB A;  3CND A;  1CL0 A;  3CN8 A;  2DKI A;  1YQ4 A;  2R9Z A;  4NZH A;  1IUX A;  2E1M A;  3CNT A;  1Q1R A;  2C70 A;  3NGC X;  2GEW A;  4TLZ A;  5L46 A;  1L9E A;  2OLN A;  3AEE A;  4IVM B;  4TLX A;  1KSS A;  2YR6 A;  4P9S A;  4H4T A;  2GAH B;  2B9X A;  4G73 A;  4DGK A;  1YY5 A;  4D04 A;  1VQW A;  4Z2U A;  1KFY A;  4EQR A;  3T2Z A;  4GDE A;  2XVI A;  1BWC A;  1GRE A;  3NG7 X;  4H2R A;  4A6N A;  4C77 A;  3T2K A;  2WES A;  3K7Q X;  4A79 A;  2R0C A;  3P4R A;  4XXG A;  2VVL A;  1H81 A;  2V3B A;  3QVP A;  4AOS A;  4DNA A;  4IA6 A;  3DGZ A;  4NEW A;  1H6V A;  1O5W A;  1REO A;  1FEC A;  2WP6 A;  3QSS A;  2CFY A;  1JEH A;  3LB8 A;  2GB0 A;  3C96 A;  5EB4 A;  2I0Z A;  5KVI A;  2WP5 A;  3GD3 A;  5HHF A;  3DK8 A;  1GND A;  4B67 A;  4OPT A;  1KDG A;  3SQP A;  1XPQ A;  4LA1 A;  1S3B A;  2BRY A;  1PJ5 A;  4A7A A;  2VQB A;  3M12 A;  2ZBW A;  5CKU A;  4USR A;  2VQ7 A;  2WDR A;  2C3D A;  2OLO A;  1BF3 A;  1XHC A;  2Q6U A;  2X8C A;  2ZZB A;  1Z6L A;  4K22 A;  3RP8 A;  2GRT A;  1IUU A;  1PXA A;  2B9Y A;  2QCU A;  1ZP0 A;  2X3N A;  5EBK A;  2XFO A;  1L9D A;  3VRA A;  1PBD A;  3V3O A;  5FMH A;  3UCL A;  2JBV A;  1GEU A;  3P9U A;  4WCT A;  4ICY A;  2YVF A;  4NTC A;  5FS8 A;  1JRY A;  1PBE A;  3GYI A;  1NAA A;  2Q0L A;  2A89 A;  2UZZ A;  3AE3 A;  5BUL A;  1H82 A;  3DA1 A;  3AEB A;  1QLB A;  2C65 A;  2YM1 A;  1OJT A;  2PYX A;  3GD4 A;  2X50 A;  1D4E A;  3SFD A;  5KXJ A;  2V60 A;  3DK4 A;  4K8D A;  3D1C A;  2YAU A;  3RHA A;  1UKV G;  1ZDL A;  4M52 A;  2EQ7 A;  3BNM A;  1CJ2 A;  3GWD A;  3UKK A;  4AP1 A;  4BJY A;  2BCG G;  1CJ4 A;  1H7X A;  1DNC A;  3WE0 A;  3KPK A;  2NPX A;  4H2P A;  3M13 A;  1E1K A;  2XLU A;  3IWA A;  2WHD A;  1N4V A;  1PXC A;  4U8L A;  1JU2 A;  3AD8 B;  4YWO A;  1L0V A;  1RP0 A;  1DOD A;  3ABV A;  3NLC A;  3P1W A;  4EMJ A;  1TDE A;  4U8J A;  3NTD A;  3FIM B;  2ZZ0 A;  3B6D A;  1GAL A;  1VG9 A;  3UKL A;  1B8S A;  1DOB A;  3UOV A;  3UOX A;  4CY8 A;  1TYP A;  3AE1 A;  1TDN A;  2GH5 A;  2ACZ A;  5U25 A;  2FBW A;  3NYE A;  3ISH A;  1ELI A;  2C66 A;  2RGO A;  2V61 A;  3ITJ A;  4GR1 A;  5U63 A;  3RP6 A;  4Z2T A;  1L9C A;  2C3C A;  1TDK A;  2R0P A;  2YG6 A;  4U2T A;  4B69 A;  4A99 A;  1D7L A;  5C3J A;  4Y4N A;  4GUV A;  3DJE A;  2Q7V A;  2X8H A;  1EL5 A;  1PDH A;  2Q0K A;  2E4G A;  4BK3 A;  1QJD A;  3QVR A;  4RG4 A;  4OVI A;  1JRZ A;  1NEN A;  1ZOV A;  1GOS A;  3BI4 A;  1NHQ A;  1LQU A;  2YLS A;  3HYX A;  4Y4L A;  3EF6 A;  1ZMC A;  3AE9 A;  5KNL A;  2TMD A;  4H4V A;  1CBO A;  1NHP A;  1PN0 A;  3ZYX A;  2CVJ A;  4JQ9 A;  3F8P A;  2XLS A;  4APN A;  4AP3 A;  3AED A;  1K0I A;  2JB1 A;  4ECH A;  1CJC A;  3S5W A;  4K5S A;  3F8R A;  4YSH A;  4USQ A;  1V59 A;  1CJ3 A;  2WOI A;  1D5T A;  3O0H A;  1GSN A;  2C7G A;  4H4Q A;  3NN6 X;  4WX1 A;  1RSG A;  5CQF A;  3KU9 A;  2A8X A;  2BYB A;  4ZCD A;  1KNP A;  3G5Q A;  3FBS A;  4YSZ A;  1DXL A;  1EBD A;  5BRT A;  4AOX A;  3BI2 A;  1JNR A;  1Q9I A;  2BC0 A;  3FMW A;  4TM0 A;  2Z5X A;  2B76 A;  2EQ9 A;  2YG3 A;  5KWF A;  2VRM A;  1GV4 A;  2C67 A;  4B68 A;  3SFE A;  1LJ1 A;  1PHH A;  2BK5 A;  2XVJ A;  4OPU A;  2GR0 A;  2WPE A;  1PBC A;  1GRH A;  4EIQ A;  4FK1 C;  4HB9 A;  3V76 A;  4CNJ A;  2BS3 A;  4UDP A;  4AT2 A;  1E1N A;  4B63 A;  1TDO A;  4N9X A;  1PJ7 A;  4BK1 A;  4CNK A;  1H83 A;  1IUW A;  1YQZ A;  2OA1 A;  3URH A;  1GET A;  4YKF A;  3GDN A;  3T14 A;  3UKA A;  1D4C A;  4G6G A;  3PVC A;  1TRB A;  3QSE A;  1JOA A;  4RSL A;  5DBJ A;  4CRT A;  1GTH A;  1GPE A;  3C4A A;  4UDQ A;  4OCG A;  1F6M A;  3SZW A;  4YKG A;  2R4E A;  4EQX A;  4B64 A;  5KMQ A;  1FEA A;  3LJP A;  3GYX A;  3AEA A;  3GMC A;  3IHM A;  2C64 A;  3VRB A;  4G74 A;  2WQY A;  2H88 A;  3KKJ A;  4GAP A;  2C75 A;  5BUK A;  2QA2 A;  3SX6 A;  3UKF A;  2BXR A;  2Z5Y A;  3CGE A;  4K7Z A;  1IUT A;  2WDV A;  3UOY A;  2YR5 A;  4JY2 A;  1F8R A;  3UP4 A;  1CHU A;  3DME A;  4EIP A;  2AAQ A;  3H4K A;  1VG0 A;  3BHF A;  4LII A;  4IV9 A;  3V3N A;  1Y56 B;  3P4Q A;  2CUL A;  2VRL A;  3HYW A;  3DH9 A;  4GF7 A;  4NTE A;  1B37 A;  4H2N A;  1ZY8 A;  3CTY A;  2PHH A;  2WET A;  3NRN A;  3T2Y A;  2XFU A;  1KNR A;  1VDC A;  2QA1 A;  4BJZ A;  2E5V A;  2YG5 A;  4YSY A;  4U8O A;  3KA7 A;  4GAV A;  1E7P A;  1EL9 A;  3AYJ A;  3KD9 A;  5GRT A;  4YTN A;  3JSK A;  5KOW A;  2EQ6 A;  1ZOY A;  1ZMD A;  1NDA A;  3EPT A;  4K2X A;  4OPD A;  3UTG A;  2JAE A;  3UKH A;  2GR3 A;  2XFP A;  1OJA A;  1N4U A;  2OAM A;  4A65 A;  1QO8 A;  3BNU A;  2QAE A;  4H4Z A;  3KVE A;  4DSG A;  4JN9 A;  1AOG A;  5KRQ A;  5KVH A;  1DOC A;  1NG3 A;  2HQM A;  4X4J A;  3D8X A;  4A6N B;  2TPR A;  3QJ4 A;  3K7T A;  1NHR A;  3AE2 A;  2JK6 A;  1DJN A;  4LU6 A;  3SZC A;  2WBA A;  4D03 A;  4ADW A;  2ARD A;  1CC2 A;  2ZZC A;  4OPC A;  3ZDN A;  1D4D A;  2AQJ A;  3CGB A;  4H4P A;  1XAN A;  5KMP A;  2OAL A;  3UTH A;  2BK4 A;  1F8S A;  3T37 A;  2EQ8 A;  4TM1 A;  3NN0 X;  2BS2 A;  2YLR A;  1SEZ A;  3AE6 A;  3VR8 A;  1CF3 A;  4A9W A;  1IUS A;  2YLX A;  3KLJ A;  1ZX9 A;  3L1R A;  4KX6 A;  2IID A;  3RED A;  3VQR A;  5IPY A;  3AE5 A;  5M0Z A;  2R45 A;  4H4Y A;  4A5L A;  1PJ6 A;  2YG4 A;  5GSN A;  2XYO A;  1NPX A;  1LTX R;  3GSI A;  1O95 A;  1H7W A;  3AD9 B;  3CPJ G;  3GDP A;  3HYV A;  3UKQ A;  2XCG A;  1Y0P A;  1YKJ A;  4O5Q A;  4YTP A;  4ZCC A;  3P4P A;  1W4X A;  2JB3 A;  2B7S A;  4IVO B;  2RGJ A;  5FS9 A;  5IQ1 A;  1NG4 A;  1M6I A;  3AYL A;  4Z24 A;  3R9U A;  1OJ9 A;  4G6H A;  4EQW A;  2RAB A;  3DJD A;  1S3E A;  1ZKQ A;  3PO7 A;  4U8P A;  3SM8 A;  3CGD A;  4BUR A;  4AT0 A;  5ER0 A;  4EM3 A;  3QSM A;  5JCN A; 
#chains in the Genus database with same CATH homology
 1M64 A;  1GRB A;  3LZW A;  1GRA A;  3NNE A;  1GRT A;  4CCR A;  1GRF A;  4YTM A;  3GYJ A;  1K4Q A;  1XDI A;  2VVL G;  5TR3 A;  4Z25 A;  2BK3 A;  1IJH A;  1TDF A;  3L8K A;  5KOX A;  1B5Q A;  1MOK A;  3M0O A;  2VZ2 A;  4BK2 A;  4TM3 A;  2VOU A;  5FS7 A;  2B9W A;  2YVJ A;  5J60 A;  1FOH A;  3UTF A;  1KF6 A;  1COY A;  3SY4 A;  4GDP A;  1CC6 A;  5KMR A;  3AE4 A;  1B4V A;  2Y6R A;  3ATR A;  5M10 A;  1Y56 A;  3AB1 A;  3LOV A;  3DJG X;  4JNQ A;  1ZK7 A;  3Q6J A;  1PBF A;  2NVK X;  4OPI A;  1K0J A;  4C3Y A;  3NT6 A;  1FL2 A;  2DKH A;  2C72 A;  2JKC A;  4NWZ A;  1E6E A;  2YQU A;  2YVG A;  1GRG A;  2IVD A;  3OC4 A;  4NTD A;  1K0L A;  3ICT A;  2GAG B;  3H8I A;  3B3R A;  4GRT A;  4EQS A;  4OPG A;  2J3N A;  4JNA A;  5JCK A;  5IQ4 A;  3PS9 A;  3AEC A;  1D7Y A;  4C5O A;  3T0K A;  3CNJ A;  3HZL A;  4H4X A;  3SYI A;  4NNJ A;  2B7R A;  5FS6 A;  3IHG A;  1PS9 A;  4H4S A;  4EMW A;  3NK1 X;  3AE8 A;  3SXI A;  4I58 A;  4IA5 A;  3CPI G;  2XDO A;  1BZL A;  3ALM A;  3QFB A;  4J31 A;  4EMI A;  3RNM A;  4B1B A;  4Z2R A;  5HY5 A;  5KMS A;  2C73 A;  2BAB A;  3NIX A;  4FDC B;  1FEB A;  3DJJ A;  3K7M X;  1PXB A;  2GF3 A;  1KSU A;  4UP3 A;  2GR2 A;  1P2H A;  3G5S A;  2V5Z A;  3UKP A;  1CC4 A;  4G9K A;  4CCQ A;  3UP5 A;  2BS4 A;  2WS3 A;  2WDQ A;  3GRS A;  2GMH A;  2XLP A;  1BGJ A;  2XVE A;  1TYT A;  4NEV A;  3CNS A;  3NYC A;  4X9N A;  1FCD A;  3FG2 P;  1OJD A;  4GCM A;  2C76 A;  5U1O A;  1GXF A;  3RP7 A;  4Z26 A;  2YLZ A;  1DOE A;  2GV8 A;  4II2 A;  2XFN A;  2WPC A;  4FK1 A;  4MJW A;  4U8I A;  1EL7 A;  1GTE A;  2XFQ A;  5EB5 A;  3NHO X;  2X8G A;  2XVF A;  1JRX A;  1PBB A;  3CNP A;  3ALJ A;  2GQW A;  3SZ0 A;  2WU5 A;  1E1L A;  1P2E A;  2BCP A;  2WPF A;  2F5Z A;  1N1P A;  3AWI A;  2XLT A;  3P4S A;  3SGL A;  1LQT A;  2FJA A;  3K30 A;  1NEK A;  3GWF A;  4Z43 A;  1MXT A;  2XVH A;  3EAN A;  2BAC A;  5EOW A;  5JCM A;  3COX A;  1X31 B;  3AD7 B;  2V6O A;  2R0G A;  3VRD B;  2O9Z A;  2Y6Q A;  1F3P A;  4CY6 A;  2GMJ A;  1BKW A;  4J56 A;  4Z44 A;  3BHK A;  2W0H A;  3DK9 A;  4FX9 A;  4U8M A;  2C4C A;  4HA6 A;  4RG3 A;  3CIR A;  5J7X A;  3IC9 A;  3NKS A;  4H50 A;  4H2Q A;  4I59 A;  1JNZ A;  4YXD A;  1YQ3 A;  3G5R A;  4E0V A;  3ADA B;  2XLR A;  4J33 A;  4CBQ A;  3C4N A;  3AXB A;  4DSH A;  3CGC A;  3FPZ A;  1VRQ B;  3NYF A;  2BXS A;  2AR8 A;  2R4J A;  1MO9 A;  2X99 A;  2YR4 A;  4H4R A;  1GT8 A;  2GQF A;  4J2W A;  4OPL A;  4U2L A;  5HXI A;  3IF9 A;  1ONF A;  3EAO A;  2FJD A;  4XWR A;  3SZF A;  2A87 A;  3LZX A;  4J34 A;  3ALL A;  4H4W A;  1E39 A;  2GR1 A;  5C2T A;  4UDR A;  2YG7 A;  3S61 A;  2YWL A;  1N4W A;  1Q1W A;  1O94 A;  2WP9 A;  3I3L A;  3I6D A;  4K5R A;  2V3A A;  4H7U A;  4Y4M A;  1F8W A;  4C74 A;  1LVL A;  2WEU A;  3NH3 X;  3VR9 A;  5LV9 A;  3Q9T A;  3LXD A;  3NK0 X;  3CPH G;  4J36 A;  3BI5 A;  1LPF A;  4H4U A;  4BV6 A;  1S2Y A;  2IVE A;  2YLT A;  4REK A;  2VVM A;  3DGH A;  4U8K A;  1RYI A;  1DJQ A;  2R46 A;  4PAA A;  2WU2 A;  2CDU A;  3ICR A;  2APG A;  3AE7 A;  3E1T A;  3H8L A;  2FJB A;  2BRA A;  4O5U A;  1GES A;  4C3X A;  2YLW A;  3ICS A;  1LV0 A;  5JCI A;  1H86 A;  2JB2 A;  5JCL A;  3KPF A;  4YT0 A;  3NTA A;  1NHS A;  3OZ2 A;  2WOV A;  1BGN A;  1GER A;  4EM4 A;  3II4 A;  3AEG A;  1E1M A;  2RGH A;  2YM2 A;  3LAD A;  4X9M A;  4ZN0 A;  3QFA A;  1HYU A;  4B65 A;  4KPR A;  4U2S A;  3F8D A;  2WOW A;  1IUV A;  2BC1 A;  5HYM A;  3AYI A;  1S2Q A;  4YSX A;  1H84 A;  3CMM A;  4JY3 A;  4XWZ A;  3UOZ A;  4J57 A;  4B66 A;  5BVA A;  3ATQ A;  4II3 A;  2H89 A;  4JDR A;  2GVC A;  4PAB A;  4TM4 A;  2BA9 A;  1OJC A;  3NK2 X;  4U8N A;  3UTE A;  3AEF A;  2FJE A;  3GRT A;  3T31 A;  1EL8 A;  3GMB A;  3CND A;  1CL0 A;  3CN8 A;  2DKI A;  1YQ4 A;  2R9Z A;  4NZH A;  1IUX A;  2E1M A;  3CNT A;  1Q1R A;  2C70 A;  3NGC X;  2GEW A;  4TLZ A;  5L46 A;  1L9E A;  2OLN A;  3AEE A;  4IVM B;  4TLX A;  1KSS A;  2YR6 A;  4P9S A;  4H4T A;  2GAH B;  2B9X A;  4G73 A;  4DGK A;  1YY5 A;  4D04 A;  1VQW A;  4Z2U A;  1KFY A;  4EQR A;  3T2Z A;  4GDE A;  2XVI A;  1BWC A;  1GRE A;  3NG7 X;  4H2R A;  4A6N A;  4C77 A;  3T2K A;  2WES A;  3K7Q X;  4A79 A;  2R0C A;  3P4R A;  4XXG A;  2VVL A;  1H81 A;  2V3B A;  3QVP A;  4AOS A;  4DNA A;  4IA6 A;  3DGZ A;  4NEW A;  1H6V A;  1O5W A;  1REO A;  1FEC A;  2WP6 A;  3QSS A;  2CFY A;  1JEH A;  3LB8 A;  2GB0 A;  3C96 A;  5EB4 A;  2I0Z A;  5KVI A;  2WP5 A;  3GD3 A;  5HHF A;  3DK8 A;  1GND A;  4B67 A;  4OPT A;  1KDG A;  3SQP A;  1XPQ A;  4LA1 A;  1S3B A;  2BRY A;  1PJ5 A;  4A7A A;  2VQB A;  3M12 A;  2ZBW A;  5CKU A;  4USR A;  2VQ7 A;  2WDR A;  2C3D A;  2OLO A;  1BF3 A;  1XHC A;  2Q6U A;  2X8C A;  2ZZB A;  1Z6L A;  4K22 A;  3RP8 A;  2GRT A;  1IUU A;  1PXA A;  2B9Y A;  2QCU A;  1ZP0 A;  2X3N A;  5EBK A;  2XFO A;  1L9D A;  3VRA A;  1PBD A;  3V3O A;  5FMH A;  3UCL A;  2JBV A;  1GEU A;  3P9U A;  4WCT A;  4ICY A;  2YVF A;  4NTC A;  5FS8 A;  1JRY A;  1PBE A;  3GYI A;  1NAA A;  2Q0L A;  2A89 A;  2UZZ A;  3AE3 A;  5BUL A;  1H82 A;  3DA1 A;  3AEB A;  1QLB A;  2C65 A;  2YM1 A;  1OJT A;  2PYX A;  3GD4 A;  2X50 A;  1D4E A;  3SFD A;  5KXJ A;  2V60 A;  3DK4 A;  4K8D A;  3D1C A;  2YAU A;  3RHA A;  1UKV G;  1ZDL A;  4M52 A;  2EQ7 A;  3BNM A;  1CJ2 A;  3GWD A;  3UKK A;  4AP1 A;  4BJY A;  2BCG G;  1CJ4 A;  1H7X A;  1DNC A;  3WE0 A;  3KPK A;  2NPX A;  4H2P A;  3M13 A;  1E1K A;  2XLU A;  3IWA A;  2WHD A;  1N4V A;  1PXC A;  4U8L A;  1JU2 A;  3AD8 B;  4YWO A;  1L0V A;  1RP0 A;  1DOD A;  3ABV A;  3NLC A;  3P1W A;  4EMJ A;  1TDE A;  4U8J A;  3NTD A;  3FIM B;  2ZZ0 A;  3B6D A;  1GAL A;  1VG9 A;  3UKL A;  1B8S A;  1DOB A;  3UOV A;  3UOX A;  4CY8 A;  1TYP A;  3AE1 A;  1TDN A;  2GH5 A;  2ACZ A;  5U25 A;  2FBW A;  3NYE A;  3ISH A;  1ELI A;  2C66 A;  2RGO A;  2V61 A;  3ITJ A;  4GR1 A;  5U63 A;  3RP6 A;  4Z2T A;  1L9C A;  2C3C A;  1TDK A;  2R0P A;  2YG6 A;  4U2T A;  4B69 A;  4A99 A;  1D7L A;  5C3J A;  4Y4N A;  4GUV A;  3DJE A;  2Q7V A;  2X8H A;  1EL5 A;  1PDH A;  2Q0K A;  2E4G A;  4BK3 A;  1QJD A;  3QVR A;  4RG4 A;  4OVI A;  1JRZ A;  1NEN A;  1ZOV A;  1GOS A;  3BI4 A;  1NHQ A;  1LQU A;  2YLS A;  3HYX A;  4Y4L A;  3EF6 A;  1ZMC A;  3AE9 A;  5KNL A;  2TMD A;  4H4V A;  1CBO A;  1NHP A;  1PN0 A;  3ZYX A;  2CVJ A;  4JQ9 A;  3F8P A;  2XLS A;  4APN A;  4AP3 A;  3AED A;  1K0I A;  2JB1 A;  4ECH A;  1CJC A;  3S5W A;  4K5S A;  3F8R A;  4YSH A;  4USQ A;  1V59 A;  1CJ3 A;  2WOI A;  1D5T A;  3O0H A;  1GSN A;  2C7G A;  4H4Q A;  3NN6 X;  4WX1 A;  1RSG A;  5CQF A;  3KU9 A;  2A8X A;  2BYB A;  4ZCD A;  1KNP A;  3G5Q A;  3FBS A;  4YSZ A;  1DXL A;  1EBD A;  5BRT A;  4AOX A;  3BI2 A;  1JNR A;  1Q9I A;  2BC0 A;  3FMW A;  4TM0 A;  2Z5X A;  2B76 A;  2EQ9 A;  2YG3 A;  5KWF A;  2VRM A;  1GV4 A;  2C67 A;  4B68 A;  3SFE A;  1LJ1 A;  1PHH A;  2BK5 A;  2XVJ A;  4OPU A;  2GR0 A;  2WPE A;  1PBC A;  1GRH A;  4EIQ A;  4FK1 C;  4HB9 A;  3V76 A;  4CNJ A;  2BS3 A;  4UDP A;  4AT2 A;  1E1N A;  4B63 A;  1TDO A;  4N9X A;  1PJ7 A;  4BK1 A;  4CNK A;  1H83 A;  1IUW A;  1YQZ A;  2OA1 A;  3URH A;  1GET A;  4YKF A;  3GDN A;  3T14 A;  3UKA A;  1D4C A;  4G6G A;  3PVC A;  1TRB A;  3QSE A;  1JOA A;  4RSL A;  5DBJ A;  4CRT A;  1GTH A;  1GPE A;  3C4A A;  4UDQ A;  4OCG A;  1F6M A;  3SZW A;  4YKG A;  2R4E A;  4EQX A;  4B64 A;  5KMQ A;  1FEA A;  3LJP A;  3GYX A;  3AEA A;  3GMC A;  3IHM A;  2C64 A;  3VRB A;  4G74 A;  2WQY A;  2H88 A;  3KKJ A;  4GAP A;  2C75 A;  5BUK A;  2QA2 A;  3SX6 A;  3UKF A;  2BXR A;  2Z5Y A;  3CGE A;  4K7Z A;  1IUT A;  2WDV A;  3UOY A;  2YR5 A;  4JY2 A;  1F8R A;  3UP4 A;  1CHU A;  3DME A;  4EIP A;  2AAQ A;  3H4K A;  1VG0 A;  3BHF A;  4LII A;  4IV9 A;  3V3N A;  1Y56 B;  3P4Q A;  2CUL A;  2VRL A;  3HYW A;  3DH9 A;  4GF7 A;  4NTE A;  1B37 A;  4H2N A;  1ZY8 A;  3CTY A;  2PHH A;  2WET A;  3NRN A;  3T2Y A;  2XFU A;  1KNR A;  1VDC A;  2QA1 A;  4BJZ A;  2E5V A;  2YG5 A;  4YSY A;  4U8O A;  3KA7 A;  4GAV A;  1E7P A;  1EL9 A;  3AYJ A;  3KD9 A;  5GRT A;  4YTN A;  3JSK A;  5KOW A;  2EQ6 A;  1ZOY A;  1ZMD A;  1NDA A;  3EPT A;  4K2X A;  4OPD A;  3UTG A;  2JAE A;  3UKH A;  2GR3 A;  2XFP A;  1OJA A;  1N4U A;  2OAM A;  4A65 A;  1QO8 A;  3BNU A;  2QAE A;  4H4Z A;  3KVE A;  4DSG A;  4JN9 A;  1AOG A;  5KRQ A;  5KVH A;  1DOC A;  1NG3 A;  2HQM A;  4X4J A;  3D8X A;  4A6N B;  2TPR A;  3QJ4 A;  3K7T A;  1NHR A;  3AE2 A;  2JK6 A;  1DJN A;  4LU6 A;  3SZC A;  2WBA A;  4D03 A;  4ADW A;  2ARD A;  1CC2 A;  2ZZC A;  4OPC A;  3ZDN A;  1D4D A;  2AQJ A;  3CGB A;  4H4P A;  1XAN A;  5KMP A;  2OAL A;  3UTH A;  2BK4 A;  1F8S A;  3T37 A;  2EQ8 A;  4TM1 A;  3NN0 X;  2BS2 A;  2YLR A;  1SEZ A;  3AE6 A;  3VR8 A;  1CF3 A;  4A9W A;  1IUS A;  2YLX A;  3KLJ A;  1ZX9 A;  3L1R A;  4KX6 A;  2IID A;  3RED A;  3VQR A;  5IPY A;  3AE5 A;  5M0Z A;  2R45 A;  4H4Y A;  4A5L A;  1PJ6 A;  2YG4 A;  5GSN A;  2XYO A;  1NPX A;  1LTX R;  3GSI A;  1O95 A;  1H7W A;  3AD9 B;  3CPJ G;  3GDP A;  3HYV A;  3UKQ A;  2XCG A;  1Y0P A;  1YKJ A;  4O5Q A;  4YTP A;  4ZCC A;  3P4P A;  1W4X A;  2JB3 A;  2B7S A;  4IVO B;  2RGJ A;  5FS9 A;  5IQ1 A;  1NG4 A;  1M6I A;  3AYL A;  4Z24 A;  3R9U A;  1OJ9 A;  4G6H A;  4EQW A;  2RAB A;  3DJD A;  1S3E A;  1ZKQ A;  3PO7 A;  4U8P A;  3SM8 A;  3CGD A;  4BUR A;  4AT0 A;  5ER0 A;  4EM3 A;  3QSM A;  5JCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...