3KU9A

X-ray structure of the mutant lys300met of polyamine oxidase from zea mays in complex with spermine
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
467
structure length
467
Chain Sequence
b'TVGPRVIVVGAGMSGISAAKRLSEAGITDLLILEATDHIGGRMHKTNFAGINVELGANWVEGVNGGKMNPIWPIVNSTLKLRNFRSDFDYLAQNVYKEDGGVYDEDYVQKRIELADSVEEMGEKLSATLHASGRDDMSILAMQRLNEHQPNGPATPVDMVVDYYKFDYEFAEPPRVTSLQNTVPLATFSDFGDDVYFVADQRGYEAVVYYLAGQYLKTDDKSGKIVDPRLQLNKVVREIKYSPGGVTVKTEDNSVYSADYVMVSASLGVLQSDLIQFKPKLPTWKVRAIYQFDMAVYTMIFLKFPRKFWPEGKGREFFLYASSRRGYYGVWQEFEKQYPDANVLLVTVTDEESRRIEQQSDEQTKAEIMQVLRKMFPGKDVPDATDILVPRWWSDRFYKGTFSNWPVGVNRYEYDQLRAPVGRVYFTGEHTSEHYNGYVHGAYLSGIDSAEILINCAQKKMCKYHVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polyamine oxidase
publication title The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis
rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 164
structure length 467
sequence length 467
chains with identical sequence B
ec nomenclature ec 1.5.3.14: Polyamine oxidase (propane-1,3-diamine-forming).
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ku9A01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3ku9A02
3LXDA 1OJDA 2WETA 4YXDA 2Q6UA 3LZXA 1PS9A 1PJ5A 3UTFA 3PS9A 4YT0A 1ONFA 1O94A 3UKAA 1EL5A 3UTHA 3VRAA 3CTYA 1DXLA 1F3PA 1QLBA 3OC4A 3QSSA 4CCRA 4LIIA 4PABA 2Z5XA 2C73A 2YR4A 2GH5A 5M10A 1YQZA 3AE5A 1B8SA 3AE1A 4KX6A 4USQA 1F6MA 1GRBA 3CGCA 4WX1A 3AE3A 2V3BA 1CC2A 4J57A 3UKPA 3UOZA 2CFYA 1GPEA 5BVAA 3F8RA 4Z26A 3L1RA 3PO7A 1E1LA 2ZBWA 4AOXA 1PHHA 2A8XA 3BI4A 1M6IA 1GETA 2FJAA 4X9MA 1RSGA 5KOXA 3LZWA 4EQSA 4TLZA 2B76A 5FS6A 3SGLA 2GQWA 2ZZCA 4H2PA 3SFEA 3FBSA 1BZLA 2JAEA 3BHFA 1Q1WA 2OA1A 4OPLA 2EQ6A 4XWRA 3SQPA 5JCNA 2OLOA 2R9ZA 3B3RA 3NG7X 5JCIA 2GV8A 2Y6RA 2C66A 3G5QA 3FIMB 3K7MX 2WBAA 3FG2P 2OLNA 2RABA 2WS3A 4RSLA 4OPDA 4H4VA 3DMEA 4K8DA 3GDNA 2WDQA 1NHRA 2X8CA 2Y6QA 2YVFA 1HYUA 2XFOA 1COYA 3CNTA 2WP9A 1H6VA 2C65A 1LVLA 2WPEA 4Z2TA 1GERA 2XLUA 3I6DA 1VQWA 1AOGA 4OPUA 1GRFA 5J60A 2R46A 1JNZA 1H7XA 5EB4A 2WDVA 2WP6A 2PHHA 1JRXA 2BACA 3R9UA 2C3CA 3DGHA 3NNEA 3AE6A 4C5OA 4B64A 4YSZA 5BULA 1FOHA 3Q6JA 2BK3A 4H7UA 4U8JA 3DJEA 3PVCA 4FK1A 5HHFA 3DK8A 3NKSA 1TDFA 2VRMA 2OALA 2XLTA 3UOVA 1GRGA 4B69A 4K7ZA 1GSNA 5L46A 3T37A 3DJGX 4ZCCA 3AD9B 1E1KA 1KDGA 3RNMA 1NDAA 4HB9A 4UDPA 3ATQA 2RGOA 2WQYA 4A6NB 1L9CA 3ALJA 1CHUA 3IWAA 1YQ3A 4OCGA 4XXGA 1B37A 2VZ2A 3CPIG 2JBVA 3CNDA 4IVOB 4IA6A 3UKQA 2O9ZA 4ADWA 3KD9A 2ARDA 2GR2A 2V61A 1M64A 1TDNA 4Y4MA 2WPFA 4ZCDA 3ITJA 2XCGA 1S2YA 3LJPA 1KNRA 3SM8A 3DK9A 3GMCA 3WE0A 4AT2A 1JU2A 4O5UA 3VRDB 2VQ7A 1PBBA 3NYEA 3AE9A 3NHOX 1YQ4A 2GMJA 3NT6A 3QSMA 3DJDA 2E1MA 2IVDA 1S2QA 4OPIA 3AEEA 3P4SA 2X3NA 4CCQA 1GRHA 3QFAA 2GF3A 1CJ2A 2V60A 2WU5A 3QVRA 1D4EA 1KFYA 5IQ1A 1D7YA 4B66A 4ECHA 2WDRA 3P1WA 3E1TA 1DJQA 1TRBA 4D04A 5HY5A 2Q0KA 2BXSA 3AWIA 4U8NA 1ZMDA 3VR9A 3GRSA 4Z2UA 5FS7A 4YSHA 1LJ1A 4LU6A 2Q7VA 3UCLA 1KNPA 3NRNA 1ZOVA 2FJBA 1PXCA 1ZX9A 5FMHA 4BURA 4UDQA 4B67A 2GR0A 3D1CA 2CDUA 2TPRA 2AR8A 4K22A 2C72A 4JN9A 2J3NA 4ICYA 3NTDA 2XLPA 1E39A 4A65A 3Q9TA 1GRAA 2ACZA 1O5WA 1IUUA 3KU9A 3NGCX 4J56A 2BC0A 2XFQA 3GYIA 2JKCA 4P9SA 3KKJA 1ELIA 1P2HA 1DJNA 4NTDA 1TDEA 2WESA 2YG3A 3EANA 3GD4A 2VRLA 1GTEA 3CIRA 4I58A 3ALLA 1YKJA 4FX9A 1TDKA 3LB8A 2WOWA 2V3AA 5EBKA 2B7SA 3COXA 4C77A 2C64A 5EB5A 3CN8A 1NEKA 1PJ7A 1Y56A 2C75A 4WCTA 4YKFA 1NHPA 3GWFA 3S5WA 4U2SA 4AT0A 4NTEA 3UOXA 4GR1A 4GRTA 1GT8A 4YWOA 2WPCA 3H8IA 4YSXA 4K2XA 3IF9A 3BNUA 2WU2A 3H8LA 1L9DA 1IUVA 3AYIA 4UP3A 3ISHA 4APNA 4NEVA 2YG4A 3FMWA 2RGJA 2FJEA 1PDHA 1NAAA 1GEUA 2GMHA 1FCDA 2VOUA 4J31A 3P4QA 4LA1A 4M52A 1GNDA 1DOBA 4GUVA 4A9WA 1NENA 4N9XA 3K30A 3ALMA 4EM3A 2BCGG 1BKWA 4C74A 3AE7A 3CNJA 4C3YA 5TR3A 1ZP0A 2GRTA 1FL2A 3D8XA 2VVLG 1JOAA 1RP0A 2YR6A 1D4DA 4BJYA 5IQ4A 5JCKA 2XVHA 3G5SA 4IV9A 3GSIA 1E7PA 5U63A 1LQUA 1NG4A 4FK1C 4EQXA 1PBEA 2WOIA 4RG3A 2XLSA 4OPGA 4EM4A 2Z5YA 4YSYA 2X8GA 1FECA 2WOVA 1K0JA 3AEBA 2RGHA 3BI2A 3UKHA 2XFNA 2YM2A 5KWFA 1H86A 3AECA 3G5RA 5LV9A 4DSGA 4H4XA 4IA5A 1GOSA 1GESA 1DNCA 1OJ9A 3F8DA 4A79A 1K4QA 5C2TA 4H4PA 1ZKQA 3ATRA 4H4UA 1PXBA 4RG4A 4Z25A 1S3BA 3IC9A 1B5QA 4J33A 2BK5A 3P4RA 3UKFA 2QAEA 3JSKA 3EF6A 4YTPA 1BWCA 4TM4A 4U8OA 4EMJA 2AQJA 5C3JA 2JB3A 2XVEA 4KPRA 3CNPA 2FBWA 1F8SA 2XDOA 3M12A 4A6NA 3KVEA 1H83A 2DKIA 1E1NA 4Z2RA 1L9EA 3NK2X 5GSNA 2BCPA 2HQMA 2X50A 4NEWA 4TM1A 4EIQA 1X31B 3O0HA 1LV0A 5KXJA 3ZYXA 2V5ZA 4E0VA 2JK6A 2W0HA 4XWZA 4Z44A 5HYMA 2BS2A 1IUSA 5M0ZA 1ZK7A 4BK1A 2YLTA 2R0GA 3NN6X 2X99A 4DNAA 5JCMA 3AEFA 3IHGA 2C67A 2BABA 4I59A 2R0CA 3VRBA 4U8MA 1BGJA 2FJDA 2JB2A 1P2EA 2TMDA 3EPTA 2XVIA 1QJDA 2ZZ0A 4Y4LA 3P9UA 4EMIA 5DBJA 3UKKA 3II4A 2CULA 2DKHA 3AYLA 4U8IA 4U2TA 1GTHA 2B9YA 2C7GA 3C4AA 1BF3A 4B63A 1Z6LA 4BJZA 1ZDLA 2VVLA 1TYPA 3NLCA 3DK4A 5U25A 2F5ZA 3ZDNA 5U1OA 3AE8A 3DH9A 3GD3A 2I0ZA 2ZZBA 3UTGA 3HZLA 4X9NA 1D7LA 3BHKA 2VVMA 4A5LA 2YLSA 1L0VA 2YWLA 3ICRA 4OPTA 1UKVG 2APGA 1Q9IA 4AOSA 2AAQA 1SEZA 2YVGA 1CF3A 4J34A 1REOA 2YLXA 1F8RA 1KF6A 2XFUA 4H4WA 1Y0PA 2C3DA 1XHCA 3CPJG 3OZ2A 2QA1A 3DGZA 4FDCB 4CNJA 4H4RA 3AE2A 1IUXA 2XFPA 3UKLA 1N4VA 3SFDA 1FEBA 5J7XA 2BS4A 5KVHA 1FEAA 2H88A 4BK3A 3GWDA 1CJ4A 5GRTA 2YG5A 3VR8A 3REDA 3V76A 3CGBA 4AP3A 4CBQA 5FS9A 4A7AA 2A89A 1CC6A 3GYJA 1JEHA 3FPZA 4UDRA 3UP4A 4U2LA 1VG9A 1YY5A 3NYCA 2NPXA 1NG3A 2IVEA 3ICTA 3LOVA 4H2NA 3NK1X 3BI5A 5KVIA 3L8KA 5EOWA 1IJHA 2EQ9A 2YAUA 4EQWA 1LTXR 4C3XA 4A99A 2YLRA 3LADA 1ZY8A 3IHMA 1BGNA 2BC1A 3AE4A 1TDOA 4MJWA 2V6OA 5JCLA 4J2WA 4OVIA 3EAOA 2XVFA 2R4EA 3K7QX 4B65A 1MXTA 2BK4A 4CY8A 1E6EA 2XLRA 1DOCA 1GALA 2WEUA 3NN0X 5BRTA 4JQ9A 4CY6A 2A87A 4K5RA 1EL9A 2NVKX 4USRA 1IUTA 2E4GA 3CGDA 1N1PA 4K5SA 3RP6A 2QCUA 2H89A 1N4WA 4X4JA 3F8PA 3AD7B 4B68A 1PN0A 2C70A 5FS8A 4BV6A 2R45A 2XVJA 2GR1A 3V3OA 5HXIA 4ZN0A 1MO9A 2B9XA 1XDIA 2GVCA 2YLZA 4EMWA 1Q1RA 3ABVA 3AEDA 2GB0A 4JDRA 1LPFA 2BYBA 3ADAB 1H84A 1EL8A 3KPFA 3ICSA 3S61A 1QO8A 3C96A 4EIPA 1K0IA 2OAMA 1CJ3A 3I3LA 3KLJA 1MOKA 3UTEA 2CVJA 2QA2A 4TM0A 4PAAA 2GR3A 1PBDA 5CQFA 4Z43A 2GAHB 2YG6A 3C4NA 1LQTA 2XYOA 4CNKA 4JNAA 3AEGA 2WP5A 4O5QA 3UP5A 4B1BA 3AB1A 5ER0A 4DSHA 4JY2A 3K7TA 4NTCA 5KOWA 1GXFA 1PXAA 1PJ6A 3CPHG 3NK0X 2R4JA 1OJCA 3V3NA 1W4XA 1XPQA 3M0OA 4J36A 1TYTA 4JY3A 3KA7A 4H4TA 1CL0A 1GV4A 1E1MA 4NZHA 1K0LA 2B7RA 4OPCA 1ZOYA 1NPXA 3AYJA 4GDPA 2YG7A 1VG0A 3DJJA 1B4VA 4GCMA 4GDEA 2IIDA 5CKUA 3B6DA 4AP1A 3GRTA 1CC4A 4TM3A 5IPYA 1PBFA 4H4YA 1S3EA 1V59A 3CGEA 4H4ZA 1JRZA 2EQ8A 1H82A 2GEWA 4U8KA 5KRQA 4U8LA 1CJCA 4YTMA 1KSSA 3QJ4A 4U8PA 1D4CA 1GRTA 2JB1A 1D5TA 4YTNA 3URHA 4H2QA 3RHAA 4D03A 3RP7A 2GAGB 3DA1A 1NHQA 2GQFA 3AEAA 1JNRA 1OJTA 2YR5A 4IVMB 3CNSA 4JNQA 1RYIA 1N4UA 3QFBA 4GF7A 1H81A 1KSUA 2UZZA 4H50A 2WHDA 1ZMCA 2R0PA 2Q0LA 4Y4NA 2PYXA 1O95A 1DOEA 3NYFA 4H4QA 3AD8B 1DODA 1JRYA 1VRQB 1CBOA 2YQUA 2BA9A 2BS3A 1EL7A 1GREA 3AXBA 3GMBA 2X8HA 3H4KA 1PBCA 3VQRA 1EBDA 2BXRA 4H2RA 3NH3X 1IUWA 2YM1A 3NTAA 3QVPA 1NHSA 5BUKA 2YLWA 4Z24A 3NIXA 2VQBA 2E5VA 3BNMA 4REKA 2B9WA 1F8WA 4H4SA 1XANA 2YVJA 1H7WA 2C76A 3UOYA 3P4PA 2EQ7A 3GDPA 4EQRA 1Y56B 4HA6A 3RP8A 3M13A 4BK2A 4TLXA 3QSEA 1VDCA 1OJAA 4YKGA 4CRTA 4DGKA
chains in the Genus database with same CATH superfamily
3LXDA 1OJDA 2WETA 4YXDA 2Q6UA 3LZXA 1PS9A 1PJ5A 3UTFA 3PS9A 4YT0A 1ONFA 1O94A 3CMMA 1EL5A 3UKAA 3UTHA 3VRAA 3CTYA 1DXLA 1F3PA 1QLBA 3OC4A 3QSSA 4CCRA 4LIIA 4PABA 2Z5XA 2C73A 4G9KA 2YR4A 2GH5A 5M10A 1YQZA 3AE5A 1B8SA 3AE1A 4KX6A 4USQA 1F6MA 1GRBA 3CGCA 4WX1A 3AE3A 2V3BA 1CC2A 4J57A 3UKPA 3UOZA 2CFYA 1GPEA 5BVAA 3F8RA 4Z26A 3L1RA 3PO7A 1E1LA 2ZBWA 4AOXA 1PHHA 2A8XA 3BI4A 1M6IA 1GETA 2FJAA 4X9MA 1RSGA 5KOXA 3LZWA 4EQSA 4TLZA 2B76A 5FS6A 3SGLA 2GQWA 2ZZCA 4H2PA 3SFEA 3FBSA 1BZLA 3SYIA 2JAEA 3BHFA 1Q1WA 2OA1A 4OPLA 2EQ6A 4XWRA 3SQPA 5JCNA 2OLOA 2R9ZA 3B3RA 3NG7X 5JCIA 2GV8A 2Y6RA 2C66A 3G5QA 3FIMB 3K7MX 2WBAA 3FG2P 2OLNA 2RABA 2WS3A 4RSLA 4OPDA 4H4VA 3DMEA 4K8DA 3GDNA 2WDQA 1NHRA 2X8CA 2Y6QA 2YVFA 1HYUA 2XFOA 1COYA 3CNTA 2WP9A 1H6VA 2C65A 1LVLA 2WPEA 4Z2TA 1GERA 2XLUA 3I6DA 1VQWA 1AOGA 4OPUA 1GRFA 5J60A 2R46A 1JNZA 1H7XA 5EB4A 2WDVA 2WP6A 2PHHA 1JRXA 2BACA 3R9UA 2C3CA 3DGHA 3NNEA 3AE6A 4C5OA 4B64A 4YSZA 5BULA 1FOHA 3Q6JA 2BK3A 4H7UA 4U8JA 3DJEA 3PVCA 4FK1A 5HHFA 3DK8A 3NKSA 1TDFA 2VRMA 2OALA 2XLTA 3UOVA 1GRGA 3HYXA 4K7ZA 1GSNA 4B69A 5L46A 3T37A 3DJGX 4ZCCA 3AD9B 1E1KA 1KDGA 3RNMA 1NDAA 4HB9A 4UDPA 3ATQA 2RGOA 2WQYA 4A6NB 1L9CA 3ALJA 1CHUA 3IWAA 1YQ3A 4OCGA 4XXGA 1B37A 2VZ2A 3CPIG 2JBVA 3CNDA 4IVOB 4IA6A 3UKQA 2O9ZA 4ADWA 3KD9A 2ARDA 2GR2A 2V61A 1M64A 1TDNA 4Y4MA 2WPFA 4ZCDA 3ITJA 2XCGA 1S2YA 3LJPA 1KNRA 3SM8A 3DK9A 3GMCA 3T0KA 3WE0A 4AT2A 1JU2A 4O5UA 3VRDB 2VQ7A 1PBBA 3NYEA 3AE9A 3NHOX 1YQ4A 3SZFA 2GMJA 3NT6A 3QSMA 3DJDA 2E1MA 2IVDA 1S2QA 4OPIA 3AEEA 3P4SA 2X3NA 4CCQA 1GRHA 3QFAA 2GF3A 1CJ2A 2V60A 2WU5A 3QVRA 1D4EA 1KFYA 5IQ1A 1D7YA 4B66A 4ECHA 2WDRA 3P1WA 3SY4A 3E1TA 1DJQA 1TRBA 4D04A 5HY5A 2Q0KA 2BXSA 3AWIA 4U8NA 1ZMDA 3VR9A 3GRSA 4Z2UA 5FS7A 4YSHA 1LJ1A 4LU6A 2Q7VA 3UCLA 1KNPA 3NRNA 1ZOVA 2FJBA 1PXCA 3HYWA 3T2ZA 1ZX9A 5FMHA 4BURA 4UDQA 4B67A 2GR0A 3KPKA 3D1CA 2CDUA 2TPRA 2AR8A 4K22A 2C72A 4JN9A 2J3NA 4ICYA 3NTDA 2XLPA 1E39A 4A65A 3Q9TA 1GRAA 2ACZA 4NWZA 1O5WA 1IUUA 3KU9A 3NGCX 4J56A 2BC0A 2XFQA 3GYIA 3SZ0A 2JKCA 4P9SA 3KKJA 1ELIA 1P2HA 1DJNA 4NTDA 1TDEA 2WESA 2YG3A 3EANA 3GD4A 2VRLA 1GTEA 3CIRA 4I58A 3ALLA 1YKJA 4FX9A 1TDKA 3LB8A 2WOWA 2V3AA 5EBKA 2B7SA 3COXA 4C77A 2C64A 5EB5A 3CN8A 1NEKA 1PJ7A 1Y56A 2C75A 4WCTA 4YKFA 1NHPA 3GWFA 3S5WA 4U2SA 4AT0A 4NTEA 3UOXA 4GR1A 4GRTA 1GT8A 4YWOA 2WPCA 3H8IA 4YSXA 4K2XA 3IF9A 3BNUA 2WU2A 3H8LA 1L9DA 3T14A 1IUVA 3AYIA 4UP3A 3ISHA 4APNA 4NEVA 2YG4A 3FMWA 2RGJA 2FJEA 1PDHA 1NAAA 1GEUA 2GMHA 1FCDA 2VOUA 4J31A 3P4QA 4LA1A 4M52A 1GNDA 1DOBA 4GUVA 4A9WA 1NENA 4N9XA 3K30A 3ALMA 4EM3A 2BCGG 5KMQA 1BKWA 4C74A 3AE7A 3CNJA 4C3YA 5TR3A 1ZP0A 2GRTA 1FL2A 3D8XA 2VVLG 1JOAA 1RP0A 2YR6A 1D4DA 4BJYA 5IQ4A 5JCKA 2XVHA 3G5SA 5KMSA 4IV9A 3GSIA 3T2YA 1E7PA 5U63A 1LQUA 1NG4A 4FK1C 4EQXA 1PBEA 2WOIA 4RG3A 2XLSA 4OPGA 4EM4A 2Z5YA 4YSYA 2X8GA 1FECA 2WOVA 1K0JA 3AEBA 2RGHA 3BI2A 3UKHA 2XFNA 2YM2A 5KWFA 1H86A 3AECA 3G5RA 5LV9A 4DSGA 4H4XA 4IA5A 1GOSA 1GESA 1DNCA 1OJ9A 3F8DA 3SX6A 4A79A 1K4QA 5C2TA 4H4PA 1ZKQA 3ATRA 4H4UA 1PXBA 4RG4A 4Z25A 1S3BA 3IC9A 1B5QA 4J33A 2BK5A 3P4RA 3UKFA 2QAEA 3JSKA 3EF6A 4YTPA 1BWCA 4TM4A 4U8OA 4EMJA 2AQJA 5C3JA 2JB3A 2XVEA 4KPRA 3CNPA 2FBWA 1F8SA 2XDOA 3M12A 4A6NA 3KVEA 1H83A 2DKIA 1E1NA 4Z2RA 1L9EA 3NK2X 5GSNA 2BCPA 2HQMA 2X50A 4NEWA 4TM1A 4EIQA 1X31B 3O0HA 1LV0A 5KXJA 3ZYXA 2V5ZA 4E0VA 2JK6A 2W0HA 4XWZA 4Z44A 5HYMA 2BS2A 1IUSA 5M0ZA 1ZK7A 4BK1A 2YLTA 2R0GA 3NN6X 2X99A 4DNAA 5JCMA 3AEFA 3IHGA 2C67A 2BABA 4I59A 2R0CA 3VRBA 4U8MA 1BGJA 2FJDA 2JB2A 1P2EA 2TMDA 3EPTA 2XVIA 1QJDA 2ZZ0A 4Y4LA 3P9UA 4EMIA 5DBJA 3UKKA 3II4A 2CULA 2DKHA 3AYLA 4U8IA 4U2TA 1GTHA 2B9YA 2C7GA 3C4AA 1BF3A 4B63A 1Z6LA 4BJZA 1ZDLA 2VVLA 1TYPA 3NLCA 3DK4A 4GAVA 5U25A 2F5ZA 3ZDNA 5U1OA 3AE8A 3DH9A 3GD3A 2I0ZA 2ZZBA 3UTGA 3HZLA 4X9NA 1D7LA 3BHKA 2VVMA 4NNJA 2BRAA 4A5LA 2YLSA 4G73A 1L0VA 2YWLA 4G6HA 3ICRA 4OPTA 1UKVG 2APGA 2BRYA 1Q9IA 4AOSA 2AAQA 1SEZA 2YVGA 1CF3A 4J34A 1REOA 2YLXA 1F8RA 1KF6A 2XFUA 4H4WA 1Y0PA 2C3DA 1XHCA 3CPJG 3OZ2A 2QA1A 3DGZA 4FDCB 3HYVA 5KNLA 4CNJA 4H4RA 3AE2A 1IUXA 2XFPA 3UKLA 5KMRA 1N4VA 3SFDA 1FEBA 5J7XA 2BS4A 5KVHA 1FEAA 2H88A 4BK3A 3GWDA 1CJ4A 5GRTA 2YG5A 3VR8A 3REDA 3V76A 3CGBA 4AP3A 4CBQA 5FS9A 4A7AA 2A89A 1CC6A 3GYJA 1JEHA 3FPZA 4UDRA 3UP4A 4U2LA 1VG9A 1YY5A 3NYCA 2NPXA 1NG3A 2IVEA 3ICTA 3LOVA 4H2NA 3NK1X 3BI5A 5KVIA 3L8KA 5EOWA 1IJHA 2EQ9A 2YAUA 4EQWA 1LTXR 4C3XA 4A99A 2YLRA 3LADA 1ZY8A 3IHMA 1BGNA 2BC1A 3AE4A 1TDOA 4MJWA 2V6OA 5JCLA 4J2WA 4OVIA 3EAOA 2XVFA 2R4EA 3K7QX 4B65A 1MXTA 2BK4A 4CY8A 1E6EA 2XLRA 1DOCA 1GALA 2WEUA 3NN0X 5BRTA 4JQ9A 4CY6A 2A87A 4K5RA 1EL9A 2NVKX 4USRA 1IUTA 2E4GA 3CGDA 1N1PA 4K5SA 3RP6A 2QCUA 2H89A 1N4WA 4X4JA 3F8PA 3AD7B 4B68A 1PN0A 2C70A 5FS8A 4BV6A 2R45A 2XVJA 2GR1A 3V3OA 5HXIA 4ZN0A 1MO9A 2B9XA 1XDIA 2GVCA 2YLZA 4EMWA 4GAPA 1Q1RA 3ABVA 3AEDA 2GB0A 4JDRA 1LPFA 2BYBA 3ADAB 1H84A 1EL8A 3KPFA 3T31A 3ICSA 3S61A 1QO8A 3C96A 4EIPA 1K0IA 2OAMA 1CJ3A 3I3LA 3KLJA 1MOKA 3UTEA 2CVJA 2QA2A 4TM0A 4PAAA 2GR3A 1PBDA 5CQFA 4Z43A 2GAHB 2YG6A 3C4NA 1LQTA 2XYOA 4CNKA 3T2KA 4JNAA 3AEGA 2WP5A 4O5QA 3UP5A 4II3A 4B1BA 3AB1A 5ER0A 4DSHA 4JY2A 3K7TA 4NTCA 5KOWA 1GXFA 1PXAA 1PJ6A 3CPHG 3SZCA 3NK0X 2R4JA 1OJCA 3V3NA 1W4XA 1XPQA 3M0OA 4J36A 1TYTA 4JY3A 3KA7A 4H4TA 1CL0A 1GV4A 1E1MA 4NZHA 1K0LA 2B7RA 4OPCA 1ZOYA 4G6GA 1NPXA 3AYJA 4GDPA 2YG7A 1VG0A 3DJJA 1B4VA 4GCMA 4GDEA 2IIDA 5CKUA 3B6DA 4AP1A 3GRTA 1CC4A 4TM3A 5IPYA 5KMPA 1PBFA 4H4YA 1S3EA 1V59A 3CGEA 4H4ZA 1JRZA 2EQ8A 1H82A 2GEWA 3SZWA 4U8KA 3SXIA 5KRQA 4U8LA 1CJCA 4YTMA 1KSSA 3QJ4A 4U8PA 1D4CA 1GRTA 2JB1A 1D5TA 4YTNA 3URHA 4H2QA 3RHAA 4D03A 3RP7A 2GAGB 3DA1A 1NHQA 2GQFA 3AEAA 1JNRA 1OJTA 3GYXA 2YR5A 4IVMB 3CNSA 4JNQA 1RYIA 1N4UA 4II2A 3QFBA 4GF7A 1H81A 1KSUA 2UZZA 4H50A 2WHDA 1ZMCA 2R0PA 2Q0LA 4Y4NA 2PYXA 1O95A 1DOEA 3NYFA 4H4QA 3AD8B 1DODA 1JRYA 1VRQB 1CBOA 2YQUA 2C4CA 2BA9A 2BS3A 1EL7A 1GREA 3AXBA 3GMBA 2X8HA 3H4KA 1PBCA 3VQRA 1EBDA 2BXRA 4H2RA 3NH3X 1IUWA 2YM1A 3NTAA 3QVPA 1NHSA 5BUKA 2YLWA 4Z24A 3NIXA 2VQBA 2E5VA 3BNMA 4REKA 2B9WA 1F8WA 4H4SA 1XANA 2YVJA 1H7WA 2C76A 3UOYA 3P4PA 2EQ7A 3GDPA 4EQRA 1Y56B 4HA6A 4G74A 3RP8A 3M13A 4BK2A 4TLXA 3QSEA 1VDCA 1OJAA 4YKGA 4CRTA 4DGKA
chains in the Genus database with same CATH topology
3LXDA 1OJDA 2WETA 4YXDA 2Q6UA 3LZXA 1PS9A 1PJ5A 3UTFA 3PS9A 4YT0A 1ONFA 1O94A 3CMMA 1EL5A 3UKAA 3UTHA 3VRAA 3CTYA 1DXLA 1F3PA 1QLBA 3OC4A 3QSSA 4CCRA 4LIIA 4PABA 2Z5XA 2C73A 4G9KA 2YR4A 2GH5A 5M10A 1YQZA 3AE5A 1B8SA 3AE1A 4KX6A 4USQA 1F6MA 1GRBA 3CGCA 4WX1A 3AE3A 2V3BA 1CC2A 4J57A 3UKPA 3UOZA 2CFYA 1GPEA 5BVAA 3F8RA 4Z26A 3L1RA 3PO7A 1E1LA 2ZBWA 4AOXA 1PHHA 2A8XA 3BI4A 1M6IA 1GETA 2FJAA 4X9MA 1RSGA 5KOXA 3LZWA 4EQSA 4TLZA 2B76A 5FS6A 3SGLA 2GQWA 2ZZCA 4H2PA 3SFEA 3FBSA 1BZLA 3SYIA 2JAEA 3BHFA 1Q1WA 2OA1A 4OPLA 2EQ6A 4XWRA 3SQPA 5JCNA 2OLOA 2R9ZA 3B3RA 3NG7X 5JCIA 2GV8A 2Y6RA 2C66A 3G5QA 3FIMB 3K7MX 2WBAA 3FG2P 2OLNA 2RABA 2WS3A 4RSLA 4OPDA 4H4VA 3DMEA 4K8DA 3GDNA 2WDQA 1NHRA 2X8CA 2Y6QA 2YVFA 1HYUA 2XFOA 1COYA 3CNTA 2WP9A 1H6VA 2C65A 1LVLA 2WPEA 4Z2TA 1GERA 2XLUA 3I6DA 1VQWA 1AOGA 4OPUA 1GRFA 5J60A 2R46A 1JNZA 1H7XA 5EB4A 2WDVA 2WP6A 2PHHA 1JRXA 2BACA 3R9UA 2C3CA 3DGHA 3NNEA 3AE6A 4C5OA 4B64A 4YSZA 5BULA 1FOHA 3Q6JA 2BK3A 4H7UA 4U8JA 3DJEA 3PVCA 4FK1A 5HHFA 3DK8A 3NKSA 1TDFA 2VRMA 2OALA 2XLTA 3UOVA 1GRGA 3HYXA 4K7ZA 1GSNA 4B69A 5L46A 3T37A 3DJGX 4ZCCA 3AD9B 1E1KA 1KDGA 3RNMA 1NDAA 4HB9A 4UDPA 3ATQA 2RGOA 2WQYA 4A6NB 1L9CA 3ALJA 1CHUA 3IWAA 1YQ3A 4OCGA 4XXGA 1B37A 2VZ2A 3CPIG 2JBVA 3CNDA 4IVOB 4IA6A 3UKQA 2O9ZA 4ADWA 3KD9A 2ARDA 2GR2A 2V61A 1M64A 1TDNA 4Y4MA 2WPFA 4ZCDA 3ITJA 2XCGA 1S2YA 3LJPA 1KNRA 3SM8A 3DK9A 3GMCA 3T0KA 3WE0A 4AT2A 1JU2A 4O5UA 3VRDB 2VQ7A 1PBBA 3NYEA 3AE9A 3NHOX 1YQ4A 3SZFA 2GMJA 3NT6A 3QSMA 3DJDA 2E1MA 2IVDA 1S2QA 4OPIA 3AEEA 3P4SA 2X3NA 4CCQA 1GRHA 3QFAA 2GF3A 1CJ2A 2V60A 2WU5A 3QVRA 1D4EA 1KFYA 5IQ1A 1D7YA 4B66A 4ECHA 2WDRA 3P1WA 3SY4A 3E1TA 1DJQA 1TRBA 4D04A 5HY5A 2Q0KA 2BXSA 3AWIA 4U8NA 1ZMDA 3VR9A 3GRSA 4Z2UA 5FS7A 4YSHA 1LJ1A 4LU6A 2Q7VA 3UCLA 1KNPA 3NRNA 1ZOVA 2FJBA 1PXCA 3HYWA 3T2ZA 1ZX9A 5FMHA 4BURA 4UDQA 4B67A 2GR0A 3KPKA 3D1CA 2CDUA 2TPRA 2AR8A 4K22A 2C72A 4JN9A 2J3NA 4ICYA 3NTDA 2XLPA 1E39A 4A65A 3Q9TA 1GRAA 2ACZA 4NWZA 1O5WA 1IUUA 3KU9A 3NGCX 4J56A 2BC0A 2XFQA 3GYIA 3SZ0A 2JKCA 4P9SA 3KKJA 1ELIA 1P2HA 1DJNA 4NTDA 1TDEA 2WESA 2YG3A 3EANA 3GD4A 2VRLA 1GTEA 3CIRA 4I58A 3ALLA 1YKJA 4FX9A 1TDKA 3LB8A 2WOWA 2V3AA 5EBKA 2B7SA 3COXA 4C77A 2C64A 5EB5A 3CN8A 1NEKA 1PJ7A 1Y56A 2C75A 4WCTA 4YKFA 1NHPA 3GWFA 3S5WA 4U2SA 4AT0A 4NTEA 3UOXA 4GR1A 4GRTA 1GT8A 4YWOA 2WPCA 3H8IA 4YSXA 4K2XA 3IF9A 3BNUA 2WU2A 3H8LA 1L9DA 3T14A 1IUVA 3AYIA 4UP3A 3ISHA 4APNA 4NEVA 2YG4A 3FMWA 2RGJA 2FJEA 1PDHA 1NAAA 1GEUA 2GMHA 1FCDA 2VOUA 4J31A 3P4QA 4LA1A 4M52A 1GNDA 1DOBA 4GUVA 4A9WA 1NENA 4N9XA 3K30A 3ALMA 4EM3A 2BCGG 5KMQA 1BKWA 4C74A 3AE7A 3CNJA 4C3YA 5TR3A 1ZP0A 2GRTA 1FL2A 3D8XA 2VVLG 1JOAA 1RP0A 2YR6A 1D4DA 4BJYA 5IQ4A 5JCKA 2XVHA 3G5SA 5KMSA 4IV9A 3GSIA 3T2YA 1E7PA 5U63A 1LQUA 1NG4A 4FK1C 4EQXA 1PBEA 2WOIA 4RG3A 2XLSA 4OPGA 4EM4A 2Z5YA 4YSYA 2X8GA 1FECA 2WOVA 1K0JA 3AEBA 2RGHA 3BI2A 3UKHA 2XFNA 2YM2A 5KWFA 1H86A 3AECA 3G5RA 5LV9A 4DSGA 4H4XA 4IA5A 1GOSA 1GESA 1DNCA 1OJ9A 3F8DA 3SX6A 4A79A 1K4QA 5C2TA 4H4PA 1ZKQA 3ATRA 4H4UA 1PXBA 4RG4A 4Z25A 1S3BA 3IC9A 1B5QA 4J33A 2BK5A 3P4RA 3UKFA 2QAEA 3JSKA 3EF6A 4YTPA 1BWCA 4TM4A 4U8OA 4EMJA 2AQJA 5C3JA 2JB3A 2XVEA 4KPRA 3CNPA 2FBWA 1F8SA 2XDOA 3M12A 4A6NA 3KVEA 1H83A 2DKIA 1E1NA 4Z2RA 1L9EA 3NK2X 5GSNA 2BCPA 2HQMA 2X50A 4NEWA 4TM1A 4EIQA 1X31B 3O0HA 1LV0A 5KXJA 3ZYXA 2V5ZA 4E0VA 2JK6A 2W0HA 4XWZA 4Z44A 5HYMA 2BS2A 1IUSA 5M0ZA 1ZK7A 4BK1A 2YLTA 2R0GA 3NN6X 2X99A 4DNAA 5JCMA 3AEFA 3IHGA 2C67A 2BABA 4I59A 2R0CA 3VRBA 4U8MA 1BGJA 2FJDA 2JB2A 1P2EA 2TMDA 3EPTA 2XVIA 1QJDA 2ZZ0A 4Y4LA 3P9UA 4EMIA 5DBJA 3UKKA 3II4A 2CULA 2DKHA 3AYLA 4U8IA 4U2TA 1GTHA 2B9YA 2C7GA 3C4AA 1BF3A 4B63A 1Z6LA 4BJZA 1ZDLA 2VVLA 1TYPA 3NLCA 3DK4A 4GAVA 5U25A 2F5ZA 3ZDNA 5U1OA 3AE8A 3DH9A 3GD3A 2I0ZA 2ZZBA 3UTGA 3HZLA 4X9NA 1D7LA 3BHKA 2VVMA 4NNJA 2BRAA 4A5LA 2YLSA 4G73A 1L0VA 2YWLA 4G6HA 3ICRA 4OPTA 1UKVG 2APGA 2BRYA 1Q9IA 4AOSA 2AAQA 1SEZA 2YVGA 1CF3A 4J34A 1REOA 2YLXA 1F8RA 1KF6A 2XFUA 4H4WA 1Y0PA 2C3DA 1XHCA 3CPJG 3OZ2A 2QA1A 3DGZA 4FDCB 3HYVA 5KNLA 4CNJA 4H4RA 3AE2A 1IUXA 2XFPA 3UKLA 5KMRA 1N4VA 3SFDA 1FEBA 5J7XA 2BS4A 5KVHA 1FEAA 2H88A 4BK3A 3GWDA 1CJ4A 5GRTA 2YG5A 3VR8A 3REDA 3V76A 3CGBA 4AP3A 4CBQA 5FS9A 4A7AA 2A89A 1CC6A 3GYJA 1JEHA 3FPZA 4UDRA 3UP4A 4U2LA 1VG9A 1YY5A 3NYCA 2NPXA 1NG3A 2IVEA 3ICTA 3LOVA 4H2NA 3NK1X 3BI5A 5KVIA 3L8KA 5EOWA 1IJHA 2EQ9A 2YAUA 4EQWA 1LTXR 4C3XA 4A99A 2YLRA 3LADA 1ZY8A 3IHMA 1BGNA 2BC1A 3AE4A 1TDOA 4MJWA 2V6OA 5JCLA 4J2WA 4OVIA 3EAOA 2XVFA 2R4EA 3K7QX 4B65A 1MXTA 2BK4A 4CY8A 1E6EA 2XLRA 1DOCA 1GALA 2WEUA 3NN0X 5BRTA 4JQ9A 4CY6A 2A87A 4K5RA 1EL9A 2NVKX 4USRA 1IUTA 2E4GA 3CGDA 1N1PA 4K5SA 3RP6A 2QCUA 2H89A 1N4WA 4X4JA 3F8PA 3AD7B 4B68A 1PN0A 2C70A 5FS8A 4BV6A 2R45A 2XVJA 2GR1A 3V3OA 5HXIA 4ZN0A 1MO9A 2B9XA 1XDIA 2GVCA 2YLZA 4EMWA 4GAPA 1Q1RA 3ABVA 3AEDA 2GB0A 4JDRA 1LPFA 2BYBA 3ADAB 1H84A 1EL8A 3KPFA 3T31A 3ICSA 3S61A 1QO8A 3C96A 4EIPA 1K0IA 2OAMA 1CJ3A 3I3LA 3KLJA 1MOKA 3UTEA 2CVJA 2QA2A 4TM0A 4PAAA 2GR3A 1PBDA 5CQFA 4Z43A 2GAHB 2YG6A 3C4NA 1LQTA 2XYOA 4CNKA 3T2KA 4JNAA 3AEGA 2WP5A 4O5QA 3UP5A 4II3A 4B1BA 3AB1A 5ER0A 4DSHA 4JY2A 3K7TA 4NTCA 5KOWA 1GXFA 1PXAA 1PJ6A 3CPHG 3SZCA 3NK0X 2R4JA 1OJCA 3V3NA 1W4XA 1XPQA 3M0OA 4J36A 1TYTA 4JY3A 3KA7A 4H4TA 1CL0A 1GV4A 1E1MA 4NZHA 1K0LA 2B7RA 4OPCA 1ZOYA 4G6GA 1NPXA 3AYJA 4GDPA 2YG7A 1VG0A 3DJJA 1B4VA 4GCMA 4GDEA 2IIDA 5CKUA 3B6DA 4AP1A 3GRTA 1CC4A 4TM3A 5IPYA 5KMPA 1PBFA 4H4YA 1S3EA 1V59A 3CGEA 4H4ZA 1JRZA 2EQ8A 1H82A 2GEWA 3SZWA 4U8KA 3SXIA 5KRQA 4U8LA 1CJCA 4YTMA 1KSSA 3QJ4A 4U8PA 1D4CA 1GRTA 2JB1A 1D5TA 4YTNA 3URHA 4H2QA 3RHAA 4D03A 3RP7A 2GAGB 3DA1A 1NHQA 2GQFA 3AEAA 1JNRA 1OJTA 3GYXA 2YR5A 4IVMB 3CNSA 4JNQA 1RYIA 1N4UA 4II2A 3QFBA 4GF7A 1H81A 1KSUA 2UZZA 4H50A 2WHDA 1ZMCA 2R0PA 2Q0LA 4Y4NA 2PYXA 1O95A 1DOEA 3NYFA 4H4QA 3AD8B 1DODA 1JRYA 1VRQB 1CBOA 2YQUA 2C4CA 2BA9A 2BS3A 1EL7A 1GREA 3AXBA 3GMBA 2X8HA 3H4KA 1PBCA 3VQRA 1EBDA 2BXRA 4H2RA 3NH3X 1IUWA 2YM1A 3NTAA 3QVPA 1NHSA 5BUKA 2YLWA 4Z24A 3NIXA 2VQBA 2E5VA 3BNMA 4REKA 2B9WA 1F8WA 4H4SA 1XANA 2YVJA 1H7WA 2C76A 3UOYA 3P4PA 2EQ7A 3GDPA 4EQRA 1Y56B 4HA6A 4G74A 3RP8A 3M13A 4BK2A 4TLXA 3QSEA 1VDCA 1OJAA 4YKGA 4CRTA 4DGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LXD A;  1OJD A;  2WET A;  4YXD A;  2Q6U A;  3LZX A;  1PS9 A;  1PJ5 A;  3UTF A;  3PS9 A;  4YT0 A;  1ONF A;  1O94 A;  3UKA A;  1EL5 A;  3UTH A;  3VRA A;  3CTY A;  1DXL A;  1F3P A;  1QLB A;  3OC4 A;  3QSS A;  4CCR A;  4LII A;  4PAB A;  2Z5X A;  2C73 A;  2YR4 A;  2GH5 A;  5M10 A;  1YQZ A;  3AE5 A;  1B8S A;  3AE1 A;  4KX6 A;  4USQ A;  1F6M A;  1GRB A;  3CGC A;  4WX1 A;  3AE3 A;  2V3B A;  1CC2 A;  4J57 A;  3UKP A;  3UOZ A;  2CFY A;  1GPE A;  5BVA A;  3F8R A;  4Z26 A;  3L1R A;  3PO7 A;  1E1L A;  2ZBW A;  4AOX A;  1PHH A;  2A8X A;  3BI4 A;  1M6I A;  1GET A;  2FJA A;  4X9M A;  1RSG A;  5KOX A;  3LZW A;  4EQS A;  4TLZ A;  2B76 A;  5FS6 A;  3SGL A;  2GQW A;  2ZZC A;  4H2P A;  3SFE A;  3FBS A;  1BZL A;  2JAE A;  3BHF A;  1Q1W A;  2OA1 A;  4OPL A;  2EQ6 A;  4XWR A;  3SQP A;  5JCN A;  2OLO A;  2R9Z A;  3B3R A;  3NG7 X;  5JCI A;  2GV8 A;  2Y6R A;  2C66 A;  3G5Q A;  3FIM B;  3K7M X;  2WBA A;  3FG2 P;  2OLN A;  2RAB A;  2WS3 A;  4RSL A;  4OPD A;  4H4V A;  3DME A;  4K8D A;  3GDN A;  2WDQ A;  1NHR A;  2X8C A;  2Y6Q A;  2YVF A;  1HYU A;  2XFO A;  1COY A;  3CNT A;  2WP9 A;  1H6V A;  2C65 A;  1LVL A;  2WPE A;  4Z2T A;  1GER A;  2XLU A;  3I6D A;  1VQW A;  1AOG A;  4OPU A;  1GRF A;  5J60 A;  2R46 A;  1JNZ A;  1H7X A;  5EB4 A;  2WDV A;  2WP6 A;  2PHH A;  1JRX A;  2BAC A;  3R9U A;  2C3C A;  3DGH A;  3NNE A;  3AE6 A;  4C5O A;  4B64 A;  4YSZ A;  5BUL A;  1FOH A;  3Q6J A;  2BK3 A;  4H7U A;  4U8J A;  3DJE A;  3PVC A;  4FK1 A;  5HHF A;  3DK8 A;  3NKS A;  1TDF A;  2VRM A;  2OAL A;  2XLT A;  3UOV A;  1GRG A;  4B69 A;  4K7Z A;  1GSN A;  5L46 A;  3T37 A;  3DJG X;  4ZCC A;  3AD9 B;  1E1K A;  1KDG A;  3RNM A;  1NDA A;  4HB9 A;  4UDP A;  3ATQ A;  2RGO A;  2WQY A;  4A6N B;  1L9C A;  3ALJ A;  1CHU A;  3IWA A;  1YQ3 A;  4OCG A;  4XXG A;  1B37 A;  2VZ2 A;  3CPI G;  2JBV A;  3CND A;  4IVO B;  4IA6 A;  3UKQ A;  2O9Z A;  4ADW A;  3KD9 A;  2ARD A;  2GR2 A;  2V61 A;  1M64 A;  1TDN A;  4Y4M A;  2WPF A;  4ZCD A;  3ITJ A;  2XCG A;  1S2Y A;  3LJP A;  1KNR A;  3SM8 A;  3DK9 A;  3GMC A;  3WE0 A;  4AT2 A;  1JU2 A;  4O5U A;  3VRD B;  2VQ7 A;  1PBB A;  3NYE A;  3AE9 A;  3NHO X;  1YQ4 A;  2GMJ A;  3NT6 A;  3QSM A;  3DJD A;  2E1M A;  2IVD A;  1S2Q A;  4OPI A;  3AEE A;  3P4S A;  2X3N A;  4CCQ A;  1GRH A;  3QFA A;  2GF3 A;  1CJ2 A;  2V60 A;  2WU5 A;  3QVR A;  1D4E A;  1KFY A;  5IQ1 A;  1D7Y A;  4B66 A;  4ECH A;  2WDR A;  3P1W A;  3E1T A;  1DJQ A;  1TRB A;  4D04 A;  5HY5 A;  2Q0K A;  2BXS A;  3AWI A;  4U8N A;  1ZMD A;  3VR9 A;  3GRS A;  4Z2U A;  5FS7 A;  4YSH A;  1LJ1 A;  4LU6 A;  2Q7V A;  3UCL A;  1KNP A;  3NRN A;  1ZOV A;  2FJB A;  1PXC A;  1ZX9 A;  5FMH A;  4BUR A;  4UDQ A;  4B67 A;  2GR0 A;  3D1C A;  2CDU A;  2TPR A;  2AR8 A;  4K22 A;  2C72 A;  4JN9 A;  2J3N A;  4ICY A;  3NTD A;  2XLP A;  1E39 A;  4A65 A;  3Q9T A;  1GRA A;  2ACZ A;  1O5W A;  1IUU A;  3KU9 A;  3NGC X;  4J56 A;  2BC0 A;  2XFQ A;  3GYI A;  2JKC A;  4P9S A;  3KKJ A;  1ELI A;  1P2H A;  1DJN A;  4NTD A;  1TDE A;  2WES A;  2YG3 A;  3EAN A;  3GD4 A;  2VRL A;  1GTE A;  3CIR A;  4I58 A;  3ALL A;  1YKJ A;  4FX9 A;  1TDK A;  3LB8 A;  2WOW A;  2V3A A;  5EBK A;  2B7S A;  3COX A;  4C77 A;  2C64 A;  5EB5 A;  3CN8 A;  1NEK A;  1PJ7 A;  1Y56 A;  2C75 A;  4WCT A;  4YKF A;  1NHP A;  3GWF A;  3S5W A;  4U2S A;  4AT0 A;  4NTE A;  3UOX A;  4GR1 A;  4GRT A;  1GT8 A;  4YWO A;  2WPC A;  3H8I A;  4YSX A;  4K2X A;  3IF9 A;  3BNU A;  2WU2 A;  3H8L A;  1L9D A;  1IUV A;  3AYI A;  4UP3 A;  3ISH A;  4APN A;  4NEV A;  2YG4 A;  3FMW A;  2RGJ A;  2FJE A;  1PDH A;  1NAA A;  1GEU A;  2GMH A;  1FCD A;  2VOU A;  4J31 A;  3P4Q A;  4LA1 A;  4M52 A;  1GND A;  1DOB A;  4GUV A;  4A9W A;  1NEN A;  4N9X A;  3K30 A;  3ALM A;  4EM3 A;  2BCG G;  1BKW A;  4C74 A;  3AE7 A;  3CNJ A;  4C3Y A;  5TR3 A;  1ZP0 A;  2GRT A;  1FL2 A;  3D8X A;  2VVL G;  1JOA A;  1RP0 A;  2YR6 A;  1D4D A;  4BJY A;  5IQ4 A;  5JCK A;  2XVH A;  3G5S A;  4IV9 A;  3GSI A;  1E7P A;  5U63 A;  1LQU A;  1NG4 A;  4FK1 C;  4EQX A;  1PBE A;  2WOI A;  4RG3 A;  2XLS A;  4OPG A;  4EM4 A;  2Z5Y A;  4YSY A;  2X8G A;  1FEC A;  2WOV A;  1K0J A;  3AEB A;  2RGH A;  3BI2 A;  3UKH A;  2XFN A;  2YM2 A;  5KWF A;  1H86 A;  3AEC A;  3G5R A;  5LV9 A;  4DSG A;  4H4X A;  4IA5 A;  1GOS A;  1GES A;  1DNC A;  1OJ9 A;  3F8D A;  4A79 A;  1K4Q A;  5C2T A;  4H4P A;  1ZKQ A;  3ATR A;  4H4U A;  1PXB A;  4RG4 A;  4Z25 A;  1S3B A;  3IC9 A;  1B5Q A;  4J33 A;  2BK5 A;  3P4R A;  3UKF A;  2QAE A;  3JSK A;  3EF6 A;  4YTP A;  1BWC A;  4TM4 A;  4U8O A;  4EMJ A;  2AQJ A;  5C3J A;  2JB3 A;  2XVE A;  4KPR A;  3CNP A;  2FBW A;  1F8S A;  2XDO A;  3M12 A;  4A6N A;  3KVE A;  1H83 A;  2DKI A;  1E1N A;  4Z2R A;  1L9E A;  3NK2 X;  5GSN A;  2BCP A;  2HQM A;  2X50 A;  4NEW A;  4TM1 A;  4EIQ A;  1X31 B;  3O0H A;  1LV0 A;  5KXJ A;  3ZYX A;  2V5Z A;  4E0V A;  2JK6 A;  2W0H A;  4XWZ A;  4Z44 A;  5HYM A;  2BS2 A;  1IUS A;  5M0Z A;  1ZK7 A;  4BK1 A;  2YLT A;  2R0G A;  3NN6 X;  2X99 A;  4DNA A;  5JCM A;  3AEF A;  3IHG A;  2C67 A;  2BAB A;  4I59 A;  2R0C A;  3VRB A;  4U8M A;  1BGJ A;  2FJD A;  2JB2 A;  1P2E A;  2TMD A;  3EPT A;  2XVI A;  1QJD A;  2ZZ0 A;  4Y4L A;  3P9U A;  4EMI A;  5DBJ A;  3UKK A;  3II4 A;  2CUL A;  2DKH A;  3AYL A;  4U8I A;  4U2T A;  1GTH A;  2B9Y A;  2C7G A;  3C4A A;  1BF3 A;  4B63 A;  1Z6L A;  4BJZ A;  1ZDL A;  2VVL A;  1TYP A;  3NLC A;  3DK4 A;  5U25 A;  2F5Z A;  3ZDN A;  5U1O A;  3AE8 A;  3DH9 A;  3GD3 A;  2I0Z A;  2ZZB A;  3UTG A;  3HZL A;  4X9N A;  1D7L A;  3BHK A;  2VVM A;  4A5L A;  2YLS A;  1L0V A;  2YWL A;  3ICR A;  4OPT A;  1UKV G;  2APG A;  1Q9I A;  4AOS A;  2AAQ A;  1SEZ A;  2YVG A;  1CF3 A;  4J34 A;  1REO A;  2YLX A;  1F8R A;  1KF6 A;  2XFU A;  4H4W A;  1Y0P A;  2C3D A;  1XHC A;  3CPJ G;  3OZ2 A;  2QA1 A;  3DGZ A;  4FDC B;  4CNJ A;  4H4R A;  3AE2 A;  1IUX A;  2XFP A;  3UKL A;  1N4V A;  3SFD A;  1FEB A;  5J7X A;  2BS4 A;  5KVH A;  1FEA A;  2H88 A;  4BK3 A;  3GWD A;  1CJ4 A;  5GRT A;  2YG5 A;  3VR8 A;  3RED A;  3V76 A;  3CGB A;  4AP3 A;  4CBQ A;  5FS9 A;  4A7A A;  2A89 A;  1CC6 A;  3GYJ A;  1JEH A;  3FPZ A;  4UDR A;  3UP4 A;  4U2L A;  1VG9 A;  1YY5 A;  3NYC A;  2NPX A;  1NG3 A;  2IVE A;  3ICT A;  3LOV A;  4H2N A;  3NK1 X;  3BI5 A;  5KVI A;  3L8K A;  5EOW A;  1IJH A;  2EQ9 A;  2YAU A;  4EQW A;  1LTX R;  4C3X A;  4A99 A;  2YLR A;  3LAD A;  1ZY8 A;  3IHM A;  1BGN A;  2BC1 A;  3AE4 A;  1TDO A;  4MJW A;  2V6O A;  5JCL A;  4J2W A;  4OVI A;  3EAO A;  2XVF A;  2R4E A;  3K7Q X;  4B65 A;  1MXT A;  2BK4 A;  4CY8 A;  1E6E A;  2XLR A;  1DOC A;  1GAL A;  2WEU A;  3NN0 X;  5BRT A;  4JQ9 A;  4CY6 A;  2A87 A;  4K5R A;  1EL9 A;  2NVK X;  4USR A;  1IUT A;  2E4G A;  3CGD A;  1N1P A;  4K5S A;  3RP6 A;  2QCU A;  2H89 A;  1N4W A;  4X4J A;  3F8P A;  3AD7 B;  4B68 A;  1PN0 A;  2C70 A;  5FS8 A;  4BV6 A;  2R45 A;  2XVJ A;  2GR1 A;  3V3O A;  5HXI A;  4ZN0 A;  1MO9 A;  2B9X A;  1XDI A;  2GVC A;  2YLZ A;  4EMW A;  1Q1R A;  3ABV A;  3AED A;  2GB0 A;  4JDR A;  1LPF A;  2BYB A;  3ADA B;  1H84 A;  1EL8 A;  3KPF A;  3ICS A;  3S61 A;  1QO8 A;  3C96 A;  4EIP A;  1K0I A;  2OAM A;  1CJ3 A;  3I3L A;  3KLJ A;  1MOK A;  3UTE A;  2CVJ A;  2QA2 A;  4TM0 A;  4PAA A;  2GR3 A;  1PBD A;  5CQF A;  4Z43 A;  2GAH B;  2YG6 A;  3C4N A;  1LQT A;  2XYO A;  4CNK A;  4JNA A;  3AEG A;  2WP5 A;  4O5Q A;  3UP5 A;  4B1B A;  3AB1 A;  5ER0 A;  4DSH A;  4JY2 A;  3K7T A;  4NTC A;  5KOW A;  1GXF A;  1PXA A;  1PJ6 A;  3CPH G;  3NK0 X;  2R4J A;  1OJC A;  3V3N A;  1W4X A;  1XPQ A;  3M0O A;  4J36 A;  1TYT A;  4JY3 A;  3KA7 A;  4H4T A;  1CL0 A;  1GV4 A;  1E1M A;  4NZH A;  1K0L A;  2B7R A;  4OPC A;  1ZOY A;  1NPX A;  3AYJ A;  4GDP A;  2YG7 A;  1VG0 A;  3DJJ A;  1B4V A;  4GCM A;  4GDE A;  2IID A;  5CKU A;  3B6D A;  4AP1 A;  3GRT A;  1CC4 A;  4TM3 A;  5IPY A;  1PBF A;  4H4Y A;  1S3E A;  1V59 A;  3CGE A;  4H4Z A;  1JRZ A;  2EQ8 A;  1H82 A;  2GEW A;  4U8K A;  5KRQ A;  4U8L A;  1CJC A;  4YTM A;  1KSS A;  3QJ4 A;  4U8P A;  1D4C A;  1GRT A;  2JB1 A;  1D5T A;  4YTN A;  3URH A;  4H2Q A;  3RHA A;  4D03 A;  3RP7 A;  2GAG B;  3DA1 A;  1NHQ A;  2GQF A;  3AEA A;  1JNR A;  1OJT A;  2YR5 A;  4IVM B;  3CNS A;  4JNQ A;  1RYI A;  1N4U A;  3QFB A;  4GF7 A;  1H81 A;  1KSU A;  2UZZ A;  4H50 A;  2WHD A;  1ZMC A;  2R0P A;  2Q0L A;  4Y4N A;  2PYX A;  1O95 A;  1DOE A;  3NYF A;  4H4Q A;  3AD8 B;  1DOD A;  1JRY A;  1VRQ B;  1CBO A;  2YQU A;  2BA9 A;  2BS3 A;  1EL7 A;  1GRE A;  3AXB A;  3GMB A;  2X8H A;  3H4K A;  1PBC A;  3VQR A;  1EBD A;  2BXR A;  4H2R A;  3NH3 X;  1IUW A;  2YM1 A;  3NTA A;  3QVP A;  1NHS A;  5BUK A;  2YLW A;  4Z24 A;  3NIX A;  2VQB A;  2E5V A;  3BNM A;  4REK A;  2B9W A;  1F8W A;  4H4S A;  1XAN A;  2YVJ A;  1H7W A;  2C76 A;  3UOY A;  3P4P A;  2EQ7 A;  3GDP A;  4EQR A;  1Y56 B;  4HA6 A;  3RP8 A;  3M13 A;  4BK2 A;  4TLX A;  3QSE A;  1VDC A;  1OJA A;  4YKG A;  4CRT A;  4DGK A; 
#chains in the Genus database with same CATH topology
 3LXD A;  1OJD A;  2WET A;  4YXD A;  2Q6U A;  3LZX A;  1PS9 A;  1PJ5 A;  3UTF A;  3PS9 A;  4YT0 A;  1ONF A;  1O94 A;  3CMM A;  1EL5 A;  3UKA A;  3UTH A;  3VRA A;  3CTY A;  1DXL A;  1F3P A;  1QLB A;  3OC4 A;  3QSS A;  4CCR A;  4LII A;  4PAB A;  2Z5X A;  2C73 A;  4G9K A;  2YR4 A;  2GH5 A;  5M10 A;  1YQZ A;  3AE5 A;  1B8S A;  3AE1 A;  4KX6 A;  4USQ A;  1F6M A;  1GRB A;  3CGC A;  4WX1 A;  3AE3 A;  2V3B A;  1CC2 A;  4J57 A;  3UKP A;  3UOZ A;  2CFY A;  1GPE A;  5BVA A;  3F8R A;  4Z26 A;  3L1R A;  3PO7 A;  1E1L A;  2ZBW A;  4AOX A;  1PHH A;  2A8X A;  3BI4 A;  1M6I A;  1GET A;  2FJA A;  4X9M A;  1RSG A;  5KOX A;  3LZW A;  4EQS A;  4TLZ A;  2B76 A;  5FS6 A;  3SGL A;  2GQW A;  2ZZC A;  4H2P A;  3SFE A;  3FBS A;  1BZL A;  3SYI A;  2JAE A;  3BHF A;  1Q1W A;  2OA1 A;  4OPL A;  2EQ6 A;  4XWR A;  3SQP A;  5JCN A;  2OLO A;  2R9Z A;  3B3R A;  3NG7 X;  5JCI A;  2GV8 A;  2Y6R A;  2C66 A;  3G5Q A;  3FIM B;  3K7M X;  2WBA A;  3FG2 P;  2OLN A;  2RAB A;  2WS3 A;  4RSL A;  4OPD A;  4H4V A;  3DME A;  4K8D A;  3GDN A;  2WDQ A;  1NHR A;  2X8C A;  2Y6Q A;  2YVF A;  1HYU A;  2XFO A;  1COY A;  3CNT A;  2WP9 A;  1H6V A;  2C65 A;  1LVL A;  2WPE A;  4Z2T A;  1GER A;  2XLU A;  3I6D A;  1VQW A;  1AOG A;  4OPU A;  1GRF A;  5J60 A;  2R46 A;  1JNZ A;  1H7X A;  5EB4 A;  2WDV A;  2WP6 A;  2PHH A;  1JRX A;  2BAC A;  3R9U A;  2C3C A;  3DGH A;  3NNE A;  3AE6 A;  4C5O A;  4B64 A;  4YSZ A;  5BUL A;  1FOH A;  3Q6J A;  2BK3 A;  4H7U A;  4U8J A;  3DJE A;  3PVC A;  4FK1 A;  5HHF A;  3DK8 A;  3NKS A;  1TDF A;  2VRM A;  2OAL A;  2XLT A;  3UOV A;  1GRG A;  3HYX A;  4K7Z A;  1GSN A;  4B69 A;  5L46 A;  3T37 A;  3DJG X;  4ZCC A;  3AD9 B;  1E1K A;  1KDG A;  3RNM A;  1NDA A;  4HB9 A;  4UDP A;  3ATQ A;  2RGO A;  2WQY A;  4A6N B;  1L9C A;  3ALJ A;  1CHU A;  3IWA A;  1YQ3 A;  4OCG A;  4XXG A;  1B37 A;  2VZ2 A;  3CPI G;  2JBV A;  3CND A;  4IVO B;  4IA6 A;  3UKQ A;  2O9Z A;  4ADW A;  3KD9 A;  2ARD A;  2GR2 A;  2V61 A;  1M64 A;  1TDN A;  4Y4M A;  2WPF A;  4ZCD A;  3ITJ A;  2XCG A;  1S2Y A;  3LJP A;  1KNR A;  3SM8 A;  3DK9 A;  3GMC A;  3T0K A;  3WE0 A;  4AT2 A;  1JU2 A;  4O5U A;  3VRD B;  2VQ7 A;  1PBB A;  3NYE A;  3AE9 A;  3NHO X;  1YQ4 A;  3SZF A;  2GMJ A;  3NT6 A;  3QSM A;  3DJD A;  2E1M A;  2IVD A;  1S2Q A;  4OPI A;  3AEE A;  3P4S A;  2X3N A;  4CCQ A;  1GRH A;  3QFA A;  2GF3 A;  1CJ2 A;  2V60 A;  2WU5 A;  3QVR A;  1D4E A;  1KFY A;  5IQ1 A;  1D7Y A;  4B66 A;  4ECH A;  2WDR A;  3P1W A;  3SY4 A;  3E1T A;  1DJQ A;  1TRB A;  4D04 A;  5HY5 A;  2Q0K A;  2BXS A;  3AWI A;  4U8N A;  1ZMD A;  3VR9 A;  3GRS A;  4Z2U A;  5FS7 A;  4YSH A;  1LJ1 A;  4LU6 A;  2Q7V A;  3UCL A;  1KNP A;  3NRN A;  1ZOV A;  2FJB A;  1PXC A;  3HYW A;  3T2Z A;  1ZX9 A;  5FMH A;  4BUR A;  4UDQ A;  4B67 A;  2GR0 A;  3KPK A;  3D1C A;  2CDU A;  2TPR A;  2AR8 A;  4K22 A;  2C72 A;  4JN9 A;  2J3N A;  4ICY A;  3NTD A;  2XLP A;  1E39 A;  4A65 A;  3Q9T A;  1GRA A;  2ACZ A;  4NWZ A;  1O5W A;  1IUU A;  3KU9 A;  3NGC X;  4J56 A;  2BC0 A;  2XFQ A;  3GYI A;  3SZ0 A;  2JKC A;  4P9S A;  3KKJ A;  1ELI A;  1P2H A;  1DJN A;  4NTD A;  1TDE A;  2WES A;  2YG3 A;  3EAN A;  3GD4 A;  2VRL A;  1GTE A;  3CIR A;  4I58 A;  3ALL A;  1YKJ A;  4FX9 A;  1TDK A;  3LB8 A;  2WOW A;  2V3A A;  5EBK A;  2B7S A;  3COX A;  4C77 A;  2C64 A;  5EB5 A;  3CN8 A;  1NEK A;  1PJ7 A;  1Y56 A;  2C75 A;  4WCT A;  4YKF A;  1NHP A;  3GWF A;  3S5W A;  4U2S A;  4AT0 A;  4NTE A;  3UOX A;  4GR1 A;  4GRT A;  1GT8 A;  4YWO A;  2WPC A;  3H8I A;  4YSX A;  4K2X A;  3IF9 A;  3BNU A;  2WU2 A;  3H8L A;  1L9D A;  3T14 A;  1IUV A;  3AYI A;  4UP3 A;  3ISH A;  4APN A;  4NEV A;  2YG4 A;  3FMW A;  2RGJ A;  2FJE A;  1PDH A;  1NAA A;  1GEU A;  2GMH A;  1FCD A;  2VOU A;  4J31 A;  3P4Q A;  4LA1 A;  4M52 A;  1GND A;  1DOB A;  4GUV A;  4A9W A;  1NEN A;  4N9X A;  3K30 A;  3ALM A;  4EM3 A;  2BCG G;  5KMQ A;  1BKW A;  4C74 A;  3AE7 A;  3CNJ A;  4C3Y A;  5TR3 A;  1ZP0 A;  2GRT A;  1FL2 A;  3D8X A;  2VVL G;  1JOA A;  1RP0 A;  2YR6 A;  1D4D A;  4BJY A;  5IQ4 A;  5JCK A;  2XVH A;  3G5S A;  5KMS A;  4IV9 A;  3GSI A;  3T2Y A;  1E7P A;  5U63 A;  1LQU A;  1NG4 A;  4FK1 C;  4EQX A;  1PBE A;  2WOI A;  4RG3 A;  2XLS A;  4OPG A;  4EM4 A;  2Z5Y A;  4YSY A;  2X8G A;  1FEC A;  2WOV A;  1K0J A;  3AEB A;  2RGH A;  3BI2 A;  3UKH A;  2XFN A;  2YM2 A;  5KWF A;  1H86 A;  3AEC A;  3G5R A;  5LV9 A;  4DSG A;  4H4X A;  4IA5 A;  1GOS A;  1GES A;  1DNC A;  1OJ9 A;  3F8D A;  3SX6 A;  4A79 A;  1K4Q A;  5C2T A;  4H4P A;  1ZKQ A;  3ATR A;  4H4U A;  1PXB A;  4RG4 A;  4Z25 A;  1S3B A;  3IC9 A;  1B5Q A;  4J33 A;  2BK5 A;  3P4R A;  3UKF A;  2QAE A;  3JSK A;  3EF6 A;  4YTP A;  1BWC A;  4TM4 A;  4U8O A;  4EMJ A;  2AQJ A;  5C3J A;  2JB3 A;  2XVE A;  4KPR A;  3CNP A;  2FBW A;  1F8S A;  2XDO A;  3M12 A;  4A6N A;  3KVE A;  1H83 A;  2DKI A;  1E1N A;  4Z2R A;  1L9E A;  3NK2 X;  5GSN A;  2BCP A;  2HQM A;  2X50 A;  4NEW A;  4TM1 A;  4EIQ A;  1X31 B;  3O0H A;  1LV0 A;  5KXJ A;  3ZYX A;  2V5Z A;  4E0V A;  2JK6 A;  2W0H A;  4XWZ A;  4Z44 A;  5HYM A;  2BS2 A;  1IUS A;  5M0Z A;  1ZK7 A;  4BK1 A;  2YLT A;  2R0G A;  3NN6 X;  2X99 A;  4DNA A;  5JCM A;  3AEF A;  3IHG A;  2C67 A;  2BAB A;  4I59 A;  2R0C A;  3VRB A;  4U8M A;  1BGJ A;  2FJD A;  2JB2 A;  1P2E A;  2TMD A;  3EPT A;  2XVI A;  1QJD A;  2ZZ0 A;  4Y4L A;  3P9U A;  4EMI A;  5DBJ A;  3UKK A;  3II4 A;  2CUL A;  2DKH A;  3AYL A;  4U8I A;  4U2T A;  1GTH A;  2B9Y A;  2C7G A;  3C4A A;  1BF3 A;  4B63 A;  1Z6L A;  4BJZ A;  1ZDL A;  2VVL A;  1TYP A;  3NLC A;  3DK4 A;  4GAV A;  5U25 A;  2F5Z A;  3ZDN A;  5U1O A;  3AE8 A;  3DH9 A;  3GD3 A;  2I0Z A;  2ZZB A;  3UTG A;  3HZL A;  4X9N A;  1D7L A;  3BHK A;  2VVM A;  4NNJ A;  2BRA A;  4A5L A;  2YLS A;  4G73 A;  1L0V A;  2YWL A;  4G6H A;  3ICR A;  4OPT A;  1UKV G;  2APG A;  2BRY A;  1Q9I A;  4AOS A;  2AAQ A;  1SEZ A;  2YVG A;  1CF3 A;  4J34 A;  1REO A;  2YLX A;  1F8R A;  1KF6 A;  2XFU A;  4H4W A;  1Y0P A;  2C3D A;  1XHC A;  3CPJ G;  3OZ2 A;  2QA1 A;  3DGZ A;  4FDC B;  3HYV A;  5KNL A;  4CNJ A;  4H4R A;  3AE2 A;  1IUX A;  2XFP A;  3UKL A;  5KMR A;  1N4V A;  3SFD A;  1FEB A;  5J7X A;  2BS4 A;  5KVH A;  1FEA A;  2H88 A;  4BK3 A;  3GWD A;  1CJ4 A;  5GRT A;  2YG5 A;  3VR8 A;  3RED A;  3V76 A;  3CGB A;  4AP3 A;  4CBQ A;  5FS9 A;  4A7A A;  2A89 A;  1CC6 A;  3GYJ A;  1JEH A;  3FPZ A;  4UDR A;  3UP4 A;  4U2L A;  1VG9 A;  1YY5 A;  3NYC A;  2NPX A;  1NG3 A;  2IVE A;  3ICT A;  3LOV A;  4H2N A;  3NK1 X;  3BI5 A;  5KVI A;  3L8K A;  5EOW A;  1IJH A;  2EQ9 A;  2YAU A;  4EQW A;  1LTX R;  4C3X A;  4A99 A;  2YLR A;  3LAD A;  1ZY8 A;  3IHM A;  1BGN A;  2BC1 A;  3AE4 A;  1TDO A;  4MJW A;  2V6O A;  5JCL A;  4J2W A;  4OVI A;  3EAO A;  2XVF A;  2R4E A;  3K7Q X;  4B65 A;  1MXT A;  2BK4 A;  4CY8 A;  1E6E A;  2XLR A;  1DOC A;  1GAL A;  2WEU A;  3NN0 X;  5BRT A;  4JQ9 A;  4CY6 A;  2A87 A;  4K5R A;  1EL9 A;  2NVK X;  4USR A;  1IUT A;  2E4G A;  3CGD A;  1N1P A;  4K5S A;  3RP6 A;  2QCU A;  2H89 A;  1N4W A;  4X4J A;  3F8P A;  3AD7 B;  4B68 A;  1PN0 A;  2C70 A;  5FS8 A;  4BV6 A;  2R45 A;  2XVJ A;  2GR1 A;  3V3O A;  5HXI A;  4ZN0 A;  1MO9 A;  2B9X A;  1XDI A;  2GVC A;  2YLZ A;  4EMW A;  4GAP A;  1Q1R A;  3ABV A;  3AED A;  2GB0 A;  4JDR A;  1LPF A;  2BYB A;  3ADA B;  1H84 A;  1EL8 A;  3KPF A;  3T31 A;  3ICS A;  3S61 A;  1QO8 A;  3C96 A;  4EIP A;  1K0I A;  2OAM A;  1CJ3 A;  3I3L A;  3KLJ A;  1MOK A;  3UTE A;  2CVJ A;  2QA2 A;  4TM0 A;  4PAA A;  2GR3 A;  1PBD A;  5CQF A;  4Z43 A;  2GAH B;  2YG6 A;  3C4N A;  1LQT A;  2XYO A;  4CNK A;  3T2K A;  4JNA A;  3AEG A;  2WP5 A;  4O5Q A;  3UP5 A;  4II3 A;  4B1B A;  3AB1 A;  5ER0 A;  4DSH A;  4JY2 A;  3K7T A;  4NTC A;  5KOW A;  1GXF A;  1PXA A;  1PJ6 A;  3CPH G;  3SZC A;  3NK0 X;  2R4J A;  1OJC A;  3V3N A;  1W4X A;  1XPQ A;  3M0O A;  4J36 A;  1TYT A;  4JY3 A;  3KA7 A;  4H4T A;  1CL0 A;  1GV4 A;  1E1M A;  4NZH A;  1K0L A;  2B7R A;  4OPC A;  1ZOY A;  4G6G A;  1NPX A;  3AYJ A;  4GDP A;  2YG7 A;  1VG0 A;  3DJJ A;  1B4V A;  4GCM A;  4GDE A;  2IID A;  5CKU A;  3B6D A;  4AP1 A;  3GRT A;  1CC4 A;  4TM3 A;  5IPY A;  5KMP A;  1PBF A;  4H4Y A;  1S3E A;  1V59 A;  3CGE A;  4H4Z A;  1JRZ A;  2EQ8 A;  1H82 A;  2GEW A;  3SZW A;  4U8K A;  3SXI A;  5KRQ A;  4U8L A;  1CJC A;  4YTM A;  1KSS A;  3QJ4 A;  4U8P A;  1D4C A;  1GRT A;  2JB1 A;  1D5T A;  4YTN A;  3URH A;  4H2Q A;  3RHA A;  4D03 A;  3RP7 A;  2GAG B;  3DA1 A;  1NHQ A;  2GQF A;  3AEA A;  1JNR A;  1OJT A;  3GYX A;  2YR5 A;  4IVM B;  3CNS A;  4JNQ A;  1RYI A;  1N4U A;  4II2 A;  3QFB A;  4GF7 A;  1H81 A;  1KSU A;  2UZZ A;  4H50 A;  2WHD A;  1ZMC A;  2R0P A;  2Q0L A;  4Y4N A;  2PYX A;  1O95 A;  1DOE A;  3NYF A;  4H4Q A;  3AD8 B;  1DOD A;  1JRY A;  1VRQ B;  1CBO A;  2YQU A;  2C4C A;  2BA9 A;  2BS3 A;  1EL7 A;  1GRE A;  3AXB A;  3GMB A;  2X8H A;  3H4K A;  1PBC A;  3VQR A;  1EBD A;  2BXR A;  4H2R A;  3NH3 X;  1IUW A;  2YM1 A;  3NTA A;  3QVP A;  1NHS A;  5BUK A;  2YLW A;  4Z24 A;  3NIX A;  2VQB A;  2E5V A;  3BNM A;  4REK A;  2B9W A;  1F8W A;  4H4S A;  1XAN A;  2YVJ A;  1H7W A;  2C76 A;  3UOY A;  3P4P A;  2EQ7 A;  3GDP A;  4EQR A;  1Y56 B;  4HA6 A;  4G74 A;  3RP8 A;  3M13 A;  4BK2 A;  4TLX A;  3QSE A;  1VDC A;  1OJA A;  4YKG A;  4CRT A;  4DGK A; 
#chains in the Genus database with same CATH homology
 3LXD A;  1OJD A;  2WET A;  4YXD A;  2Q6U A;  3LZX A;  1PS9 A;  1PJ5 A;  3UTF A;  3PS9 A;  4YT0 A;  1ONF A;  1O94 A;  3CMM A;  1EL5 A;  3UKA A;  3UTH A;  3VRA A;  3CTY A;  1DXL A;  1F3P A;  1QLB A;  3OC4 A;  3QSS A;  4CCR A;  4LII A;  4PAB A;  2Z5X A;  2C73 A;  4G9K A;  2YR4 A;  2GH5 A;  5M10 A;  1YQZ A;  3AE5 A;  1B8S A;  3AE1 A;  4KX6 A;  4USQ A;  1F6M A;  1GRB A;  3CGC A;  4WX1 A;  3AE3 A;  2V3B A;  1CC2 A;  4J57 A;  3UKP A;  3UOZ A;  2CFY A;  1GPE A;  5BVA A;  3F8R A;  4Z26 A;  3L1R A;  3PO7 A;  1E1L A;  2ZBW A;  4AOX A;  1PHH A;  2A8X A;  3BI4 A;  1M6I A;  1GET A;  2FJA A;  4X9M A;  1RSG A;  5KOX A;  3LZW A;  4EQS A;  4TLZ A;  2B76 A;  5FS6 A;  3SGL A;  2GQW A;  2ZZC A;  4H2P A;  3SFE A;  3FBS A;  1BZL A;  3SYI A;  2JAE A;  3BHF A;  1Q1W A;  2OA1 A;  4OPL A;  2EQ6 A;  4XWR A;  3SQP A;  5JCN A;  2OLO A;  2R9Z A;  3B3R A;  3NG7 X;  5JCI A;  2GV8 A;  2Y6R A;  2C66 A;  3G5Q A;  3FIM B;  3K7M X;  2WBA A;  3FG2 P;  2OLN A;  2RAB A;  2WS3 A;  4RSL A;  4OPD A;  4H4V A;  3DME A;  4K8D A;  3GDN A;  2WDQ A;  1NHR A;  2X8C A;  2Y6Q A;  2YVF A;  1HYU A;  2XFO A;  1COY A;  3CNT A;  2WP9 A;  1H6V A;  2C65 A;  1LVL A;  2WPE A;  4Z2T A;  1GER A;  2XLU A;  3I6D A;  1VQW A;  1AOG A;  4OPU A;  1GRF A;  5J60 A;  2R46 A;  1JNZ A;  1H7X A;  5EB4 A;  2WDV A;  2WP6 A;  2PHH A;  1JRX A;  2BAC A;  3R9U A;  2C3C A;  3DGH A;  3NNE A;  3AE6 A;  4C5O A;  4B64 A;  4YSZ A;  5BUL A;  1FOH A;  3Q6J A;  2BK3 A;  4H7U A;  4U8J A;  3DJE A;  3PVC A;  4FK1 A;  5HHF A;  3DK8 A;  3NKS A;  1TDF A;  2VRM A;  2OAL A;  2XLT A;  3UOV A;  1GRG A;  3HYX A;  4K7Z A;  1GSN A;  4B69 A;  5L46 A;  3T37 A;  3DJG X;  4ZCC A;  3AD9 B;  1E1K A;  1KDG A;  3RNM A;  1NDA A;  4HB9 A;  4UDP A;  3ATQ A;  2RGO A;  2WQY A;  4A6N B;  1L9C A;  3ALJ A;  1CHU A;  3IWA A;  1YQ3 A;  4OCG A;  4XXG A;  1B37 A;  2VZ2 A;  3CPI G;  2JBV A;  3CND A;  4IVO B;  4IA6 A;  3UKQ A;  2O9Z A;  4ADW A;  3KD9 A;  2ARD A;  2GR2 A;  2V61 A;  1M64 A;  1TDN A;  4Y4M A;  2WPF A;  4ZCD A;  3ITJ A;  2XCG A;  1S2Y A;  3LJP A;  1KNR A;  3SM8 A;  3DK9 A;  3GMC A;  3T0K A;  3WE0 A;  4AT2 A;  1JU2 A;  4O5U A;  3VRD B;  2VQ7 A;  1PBB A;  3NYE A;  3AE9 A;  3NHO X;  1YQ4 A;  3SZF A;  2GMJ A;  3NT6 A;  3QSM A;  3DJD A;  2E1M A;  2IVD A;  1S2Q A;  4OPI A;  3AEE A;  3P4S A;  2X3N A;  4CCQ A;  1GRH A;  3QFA A;  2GF3 A;  1CJ2 A;  2V60 A;  2WU5 A;  3QVR A;  1D4E A;  1KFY A;  5IQ1 A;  1D7Y A;  4B66 A;  4ECH A;  2WDR A;  3P1W A;  3SY4 A;  3E1T A;  1DJQ A;  1TRB A;  4D04 A;  5HY5 A;  2Q0K A;  2BXS A;  3AWI A;  4U8N A;  1ZMD A;  3VR9 A;  3GRS A;  4Z2U A;  5FS7 A;  4YSH A;  1LJ1 A;  4LU6 A;  2Q7V A;  3UCL A;  1KNP A;  3NRN A;  1ZOV A;  2FJB A;  1PXC A;  3HYW A;  3T2Z A;  1ZX9 A;  5FMH A;  4BUR A;  4UDQ A;  4B67 A;  2GR0 A;  3KPK A;  3D1C A;  2CDU A;  2TPR A;  2AR8 A;  4K22 A;  2C72 A;  4JN9 A;  2J3N A;  4ICY A;  3NTD A;  2XLP A;  1E39 A;  4A65 A;  3Q9T A;  1GRA A;  2ACZ A;  4NWZ A;  1O5W A;  1IUU A;  3KU9 A;  3NGC X;  4J56 A;  2BC0 A;  2XFQ A;  3GYI A;  3SZ0 A;  2JKC A;  4P9S A;  3KKJ A;  1ELI A;  1P2H A;  1DJN A;  4NTD A;  1TDE A;  2WES A;  2YG3 A;  3EAN A;  3GD4 A;  2VRL A;  1GTE A;  3CIR A;  4I58 A;  3ALL A;  1YKJ A;  4FX9 A;  1TDK A;  3LB8 A;  2WOW A;  2V3A A;  5EBK A;  2B7S A;  3COX A;  4C77 A;  2C64 A;  5EB5 A;  3CN8 A;  1NEK A;  1PJ7 A;  1Y56 A;  2C75 A;  4WCT A;  4YKF A;  1NHP A;  3GWF A;  3S5W A;  4U2S A;  4AT0 A;  4NTE A;  3UOX A;  4GR1 A;  4GRT A;  1GT8 A;  4YWO A;  2WPC A;  3H8I A;  4YSX A;  4K2X A;  3IF9 A;  3BNU A;  2WU2 A;  3H8L A;  1L9D A;  3T14 A;  1IUV A;  3AYI A;  4UP3 A;  3ISH A;  4APN A;  4NEV A;  2YG4 A;  3FMW A;  2RGJ A;  2FJE A;  1PDH A;  1NAA A;  1GEU A;  2GMH A;  1FCD A;  2VOU A;  4J31 A;  3P4Q A;  4LA1 A;  4M52 A;  1GND A;  1DOB A;  4GUV A;  4A9W A;  1NEN A;  4N9X A;  3K30 A;  3ALM A;  4EM3 A;  2BCG G;  5KMQ A;  1BKW A;  4C74 A;  3AE7 A;  3CNJ A;  4C3Y A;  5TR3 A;  1ZP0 A;  2GRT A;  1FL2 A;  3D8X A;  2VVL G;  1JOA A;  1RP0 A;  2YR6 A;  1D4D A;  4BJY A;  5IQ4 A;  5JCK A;  2XVH A;  3G5S A;  5KMS A;  4IV9 A;  3GSI A;  3T2Y A;  1E7P A;  5U63 A;  1LQU A;  1NG4 A;  4FK1 C;  4EQX A;  1PBE A;  2WOI A;  4RG3 A;  2XLS A;  4OPG A;  4EM4 A;  2Z5Y A;  4YSY A;  2X8G A;  1FEC A;  2WOV A;  1K0J A;  3AEB A;  2RGH A;  3BI2 A;  3UKH A;  2XFN A;  2YM2 A;  5KWF A;  1H86 A;  3AEC A;  3G5R A;  5LV9 A;  4DSG A;  4H4X A;  4IA5 A;  1GOS A;  1GES A;  1DNC A;  1OJ9 A;  3F8D A;  3SX6 A;  4A79 A;  1K4Q A;  5C2T A;  4H4P A;  1ZKQ A;  3ATR A;  4H4U A;  1PXB A;  4RG4 A;  4Z25 A;  1S3B A;  3IC9 A;  1B5Q A;  4J33 A;  2BK5 A;  3P4R A;  3UKF A;  2QAE A;  3JSK A;  3EF6 A;  4YTP A;  1BWC A;  4TM4 A;  4U8O A;  4EMJ A;  2AQJ A;  5C3J A;  2JB3 A;  2XVE A;  4KPR A;  3CNP A;  2FBW A;  1F8S A;  2XDO A;  3M12 A;  4A6N A;  3KVE A;  1H83 A;  2DKI A;  1E1N A;  4Z2R A;  1L9E A;  3NK2 X;  5GSN A;  2BCP A;  2HQM A;  2X50 A;  4NEW A;  4TM1 A;  4EIQ A;  1X31 B;  3O0H A;  1LV0 A;  5KXJ A;  3ZYX A;  2V5Z A;  4E0V A;  2JK6 A;  2W0H A;  4XWZ A;  4Z44 A;  5HYM A;  2BS2 A;  1IUS A;  5M0Z A;  1ZK7 A;  4BK1 A;  2YLT A;  2R0G A;  3NN6 X;  2X99 A;  4DNA A;  5JCM A;  3AEF A;  3IHG A;  2C67 A;  2BAB A;  4I59 A;  2R0C A;  3VRB A;  4U8M A;  1BGJ A;  2FJD A;  2JB2 A;  1P2E A;  2TMD A;  3EPT A;  2XVI A;  1QJD A;  2ZZ0 A;  4Y4L A;  3P9U A;  4EMI A;  5DBJ A;  3UKK A;  3II4 A;  2CUL A;  2DKH A;  3AYL A;  4U8I A;  4U2T A;  1GTH A;  2B9Y A;  2C7G A;  3C4A A;  1BF3 A;  4B63 A;  1Z6L A;  4BJZ A;  1ZDL A;  2VVL A;  1TYP A;  3NLC A;  3DK4 A;  4GAV A;  5U25 A;  2F5Z A;  3ZDN A;  5U1O A;  3AE8 A;  3DH9 A;  3GD3 A;  2I0Z A;  2ZZB A;  3UTG A;  3HZL A;  4X9N A;  1D7L A;  3BHK A;  2VVM A;  4NNJ A;  2BRA A;  4A5L A;  2YLS A;  4G73 A;  1L0V A;  2YWL A;  4G6H A;  3ICR A;  4OPT A;  1UKV G;  2APG A;  2BRY A;  1Q9I A;  4AOS A;  2AAQ A;  1SEZ A;  2YVG A;  1CF3 A;  4J34 A;  1REO A;  2YLX A;  1F8R A;  1KF6 A;  2XFU A;  4H4W A;  1Y0P A;  2C3D A;  1XHC A;  3CPJ G;  3OZ2 A;  2QA1 A;  3DGZ A;  4FDC B;  3HYV A;  5KNL A;  4CNJ A;  4H4R A;  3AE2 A;  1IUX A;  2XFP A;  3UKL A;  5KMR A;  1N4V A;  3SFD A;  1FEB A;  5J7X A;  2BS4 A;  5KVH A;  1FEA A;  2H88 A;  4BK3 A;  3GWD A;  1CJ4 A;  5GRT A;  2YG5 A;  3VR8 A;  3RED A;  3V76 A;  3CGB A;  4AP3 A;  4CBQ A;  5FS9 A;  4A7A A;  2A89 A;  1CC6 A;  3GYJ A;  1JEH A;  3FPZ A;  4UDR A;  3UP4 A;  4U2L A;  1VG9 A;  1YY5 A;  3NYC A;  2NPX A;  1NG3 A;  2IVE A;  3ICT A;  3LOV A;  4H2N A;  3NK1 X;  3BI5 A;  5KVI A;  3L8K A;  5EOW A;  1IJH A;  2EQ9 A;  2YAU A;  4EQW A;  1LTX R;  4C3X A;  4A99 A;  2YLR A;  3LAD A;  1ZY8 A;  3IHM A;  1BGN A;  2BC1 A;  3AE4 A;  1TDO A;  4MJW A;  2V6O A;  5JCL A;  4J2W A;  4OVI A;  3EAO A;  2XVF A;  2R4E A;  3K7Q X;  4B65 A;  1MXT A;  2BK4 A;  4CY8 A;  1E6E A;  2XLR A;  1DOC A;  1GAL A;  2WEU A;  3NN0 X;  5BRT A;  4JQ9 A;  4CY6 A;  2A87 A;  4K5R A;  1EL9 A;  2NVK X;  4USR A;  1IUT A;  2E4G A;  3CGD A;  1N1P A;  4K5S A;  3RP6 A;  2QCU A;  2H89 A;  1N4W A;  4X4J A;  3F8P A;  3AD7 B;  4B68 A;  1PN0 A;  2C70 A;  5FS8 A;  4BV6 A;  2R45 A;  2XVJ A;  2GR1 A;  3V3O A;  5HXI A;  4ZN0 A;  1MO9 A;  2B9X A;  1XDI A;  2GVC A;  2YLZ A;  4EMW A;  4GAP A;  1Q1R A;  3ABV A;  3AED A;  2GB0 A;  4JDR A;  1LPF A;  2BYB A;  3ADA B;  1H84 A;  1EL8 A;  3KPF A;  3T31 A;  3ICS A;  3S61 A;  1QO8 A;  3C96 A;  4EIP A;  1K0I A;  2OAM A;  1CJ3 A;  3I3L A;  3KLJ A;  1MOK A;  3UTE A;  2CVJ A;  2QA2 A;  4TM0 A;  4PAA A;  2GR3 A;  1PBD A;  5CQF A;  4Z43 A;  2GAH B;  2YG6 A;  3C4N A;  1LQT A;  2XYO A;  4CNK A;  3T2K A;  4JNA A;  3AEG A;  2WP5 A;  4O5Q A;  3UP5 A;  4II3 A;  4B1B A;  3AB1 A;  5ER0 A;  4DSH A;  4JY2 A;  3K7T A;  4NTC A;  5KOW A;  1GXF A;  1PXA A;  1PJ6 A;  3CPH G;  3SZC A;  3NK0 X;  2R4J A;  1OJC A;  3V3N A;  1W4X A;  1XPQ A;  3M0O A;  4J36 A;  1TYT A;  4JY3 A;  3KA7 A;  4H4T A;  1CL0 A;  1GV4 A;  1E1M A;  4NZH A;  1K0L A;  2B7R A;  4OPC A;  1ZOY A;  4G6G A;  1NPX A;  3AYJ A;  4GDP A;  2YG7 A;  1VG0 A;  3DJJ A;  1B4V A;  4GCM A;  4GDE A;  2IID A;  5CKU A;  3B6D A;  4AP1 A;  3GRT A;  1CC4 A;  4TM3 A;  5IPY A;  5KMP A;  1PBF A;  4H4Y A;  1S3E A;  1V59 A;  3CGE A;  4H4Z A;  1JRZ A;  2EQ8 A;  1H82 A;  2GEW A;  3SZW A;  4U8K A;  3SXI A;  5KRQ A;  4U8L A;  1CJC A;  4YTM A;  1KSS A;  3QJ4 A;  4U8P A;  1D4C A;  1GRT A;  2JB1 A;  1D5T A;  4YTN A;  3URH A;  4H2Q A;  3RHA A;  4D03 A;  3RP7 A;  2GAG B;  3DA1 A;  1NHQ A;  2GQF A;  3AEA A;  1JNR A;  1OJT A;  3GYX A;  2YR5 A;  4IVM B;  3CNS A;  4JNQ A;  1RYI A;  1N4U A;  4II2 A;  3QFB A;  4GF7 A;  1H81 A;  1KSU A;  2UZZ A;  4H50 A;  2WHD A;  1ZMC A;  2R0P A;  2Q0L A;  4Y4N A;  2PYX A;  1O95 A;  1DOE A;  3NYF A;  4H4Q A;  3AD8 B;  1DOD A;  1JRY A;  1VRQ B;  1CBO A;  2YQU A;  2C4C A;  2BA9 A;  2BS3 A;  1EL7 A;  1GRE A;  3AXB A;  3GMB A;  2X8H A;  3H4K A;  1PBC A;  3VQR A;  1EBD A;  2BXR A;  4H2R A;  3NH3 X;  1IUW A;  2YM1 A;  3NTA A;  3QVP A;  1NHS A;  5BUK A;  2YLW A;  4Z24 A;  3NIX A;  2VQB A;  2E5V A;  3BNM A;  4REK A;  2B9W A;  1F8W A;  4H4S A;  1XAN A;  2YVJ A;  1H7W A;  2C76 A;  3UOY A;  3P4P A;  2EQ7 A;  3GDP A;  4EQR A;  1Y56 B;  4HA6 A;  4G74 A;  3RP8 A;  3M13 A;  4BK2 A;  4TLX A;  3QSE A;  1VDC A;  1OJA A;  4YKG A;  4CRT A;  4DGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...