1CL0A

Crystal structure of reduced thioredoxin reductase from escherichia coli.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of reduced thioredoxin reductase from Escherichia coli: structural flexibility in the isoalloxazine ring of the flavin adenine dinucleotide cofactor.
pubmed rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 97
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1999-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1cl0A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1cl0A02
2Q0KA 1PJ6A 3UTHA 3EPTA 2IVEA 4RG3A 4EQWA 4Z2TA 4Y4LA 3ITJA 5J60A 3CIRA 3CN8A 3NK0X 2V5ZA 3SFDA 1GRGA 3DJEA 2WDQA 3GRSA 5FS9A 1GRFA 1ELIA 2BABA 3CPHG 3F8DA 5U25A 4NTCA 4B64A 5FS8A 5EBKA 1GRAA 4CCQA 1IUWA 3ATQA 1NG4A 3UKLA 4CNKA 2BYBA 2XFPA 2Z5XA 4JDRA 1QJDA 1H84A 3HZLA 1YKJA 4X4JA 1NHQA 4J31A 1E7PA 2C73A 4XXGA 2WDRA 3JSKA 3SGLA 2BK4A 3NGCX 4UDRA 4U8KA 2BXSA 3CNSA 2XFOA 4U2SA 3VR9A 2TMDA 1IUTA 2GR1A 3NTDA 2XVIA 3H4KA 4AT0A 2YG4A 3BHFA 2C66A 4B65A 1OJCA 4IA5A 4H4UA 2GV8A 3NRNA 2WBAA 2DKIA 3V3OA 2EQ8A 4O5UA 3KU9A 2V61A 3M13A 3DK8A 4C77A 5KVIA 4H2QA 2EQ6A 3QVPA 1QO8A 1KDGA 2BS4A 4KPRA 2VVLG 1CJ3A 3LZWA 2XVFA 1F6MA 1N4VA 4A79A 3FBSA 4YKGA 1YQZA 3VRDB 2X3NA 1KSUA 1CC4A 4EIQA 2FJBA 3AEDA 3VRAA 1VQWA 2W0HA 3PO7A 3GYIA 1GPEA 1K0JA 2V3AA 4U8JA 3KD9A 3H8LA 3AEFA 1MXTA 3NTAA 2GAGB 1F3PA 2A87A 4K22A 4K2XA 4K8DA 4P9SA 4B67A 1VDCA 3UTEA 1PBDA 1KSSA 3GDPA 4I58A 4HA6A 2APGA 5HHFA 1PDHA 3LXDA 3DK9A 2YG3A 5JCLA 2FJAA 4B69A 1CBOA 1ONFA 1H82A 4H4YA 1EL8A 3NK1X 4RSLA 2VVMA 3AEEA 3GSIA 1LV0A 3PVCA 1Y56B 1GRBA 2R4EA 4H4VA 3IWAA 3LADA 1M64A 2V3BA 2GR3A 2JB2A 2JB3A 1GETA 1LQTA 3C4AA 2WOWA 3P9UA 4JY2A 3AWIA 4B63A 2YG6A 5M10A 3AE3A 1S3EA 3L8KA 5ER0A 3NNEA 4O5QA 5GRTA 1S2QA 3F8RA 4GF7A 1D5TA 4OPUA 1XPQA 4U8IA 3RP8A 2VRMA 3ZDNA 2CDUA 3CGCA 3G5RA 2FJDA 3ADAB 4J34A 4U2LA 2GQWA 3AE9A 4DSGA 4OPCA 3S61A 4EMJA 4OPLA 3II4A 1PBEA 1KNPA 1PXBA 2JBVA 2FBWA 1F8RA 1GTHA 1GV4A 1Z6LA 2OLNA 2GEWA 2Q6UA 4GDPA 4D03A 3AEAA 4A9WA 1H83A 4H4XA 1DOBA 5IQ1A 4WX1A 4GR1A 3EAOA 4OVIA 2XLUA 1FEAA 2VRLA 1PJ7A 1GALA 4MJWA 3VRBA 2WP5A 2X50A 2B7SA 3GD4A 2BC1A 1NHPA 4CY6A 2BA9A 5KVHA 2B9YA 2YM2A 2VZ2A 1D7YA 2GH5A 3CGDA 1JNZA 3G5QA 4D04A 2Y6QA 3LZXA 1E6EA 1PBCA 5KOWA 3R9UA 1N4WA 3ABVA 3GD3A 3K7MX 5C3JA 5KRQA 3Q6JA 1ZOYA 4LU6A 5JCMA 3GRTA 2XLSA 2DKHA 5LV9A 4H7UA 3BNUA 1DXLA 1ZX9A 1TDOA 1DOCA 3AD8B 3NYFA 4HB9A 3RP7A 2ARDA 4XWRA 2IVDA 4YWOA 1DJNA 4RG4A 2WOIA 3O0HA 2YR6A 3WE0A 4EMIA 4Z26A 1DOEA 2E4GA 2XVEA 3H8IA 2C76A 2ACZA 2YWLA 4GDEA 5CKUA 3V3NA 1EL7A 2GF3A 3K7QX 3IF9A 4A65A 4AT2A 3UOYA 2GR2A 1REOA 2ZZ0A 1LTXR 5HXIA 1TDEA 4UP3A 3GDNA 2RABA 1TDKA 1XHCA 4H4RA 1GERA 2WESA 1PS9A 1GTEA 4K5RA 1PXAA 3BI4A 2YVJA 1Q9IA 4DSHA 3DGHA 1LJ1A 4YSZA 2E5VA 1YQ3A 2YLSA 2R9ZA 4CCRA 1NG3A 4U8OA 4CY8A 3QFBA 3QFAA 2YG7A 3NK2X 1CF3A 2WDVA 2XLRA 1PBBA 2C67A 2GMHA 4ZCDA 3UKPA 1Q1RA 2C70A 4K7ZA 2PHHA 4BK2A 2JK6A 3AE2A 2VQBA 4LIIA 1PJ5A 2GR0A 3C4NA 4OPTA 2F5ZA 1RP0A 3IHGA 1BZLA 4YSHA 1NHSA 2E1MA 3AE7A 3K7TA 3ATRA 4Z25A 2R45A 1TDFA 1F8SA 5J7XA 4IVMB 3DJGX 3UKFA 4KX6A 3K30A 1QLBA 1S3BA 4M52A 2XLPA 4APNA 4C5OA 1NENA 2XYOA 2AQJA 4BJYA 4YTMA 2WEUA 3DA1A 2YLTA 1JNRA 1N4UA 2WPEA 3V76A 4U8NA 2A89A 3P4RA 4I59A 2WHDA 4IVOB 4EIPA 1B5QA 1RSGA 1ZKQA 1D7LA 5DBJA 1W4XA 1S2YA 2XVJA 3NYEA 4GCMA 3AE5A 2X8GA 3OC4A 2QAEA 3CGEA 1E1LA 3D8XA 2YLXA 2QCUA 2BXRA 4IA6A 3AD9B 1JEHA 1H7WA 1FEBA 1GEUA 2C7GA 4BK1A 3UOZA 3L1RA 4EMWA 2C3CA 3P4PA 2BCGG 4TM1A 3AE6A 3DH9A 4DGKA 2XFUA 1H86A 2O9ZA 4X9MA 2YLZA 2C72A 1ZOVA 1BGNA 2WU5A 3NH3X 2BC0A 1B4VA 4H2RA 1RYIA 2I0ZA 3AXBA 4JN9A 4A6NB 1BGJA 1SEZA 1B37A 2R0PA 4C3XA 2OALA 4J57A 1EL5A 4BURA 5IQ4A 2YAUA 4FX9A 1GXFA 2NVKX 2YVGA 4H4PA 4ZCCA 4EQSA 4YSXA 1GRTA 3ICRA 4TM0A 1E1KA 2WP9A 3LB8A 2Z5YA 2PYXA 4GRTA 3KPFA 2JKCA 1AOGA 4YXDA 4Y4MA 2EQ7A 3CNJA 2XVHA 3GMCA 4AOSA 2WS3A 3BHKA 3QVRA 2WETA 4Z2UA 4CBQA 2OAMA 4IV9A 1OJAA 2VVLA 1O95A 1IUXA 1CC6A 3GYJA 3FPZA 3CPIG 2B9WA 3AE4A 2OA1A 1YY5A 1E39A 1GESA 2XFQA 3KVEA 3NHOX 4J33A 3RHAA 3LJPA 4CRTA 3ALJA 2BS2A 3UKQA 1CHUA 4USQA 1L0VA 1IUVA 4TLZA 1NHRA 1NDAA 4ADWA 1ZMDA 4K5SA 1XANA 3Q9TA 4A99A 4C74A 1JRXA 3T37A 5CQFA 5BUKA 3URHA 1H6VA 4JNQA 2V60A 3NKSA 2WOVA 2V6OA 1MO9A 2WQYA 1ZP0A 5U1OA 3UKAA 1BWCA 4C3YA 3RNMA 4OPGA 4H4ZA 2R0CA 1VG0A 1CL0A 2C64A 3UCLA 4EQXA 3M0OA 3UKHA 4FK1C 5EOWA 1LPFA 1IUSA 2YR5A 4UDQA 1YQ4A 1TRBA 3AYJA 1Y0PA 1DJQA 2A8XA 4UDPA 2RGHA 1H7XA 1PBFA 4GUVA 5C2TA 1KNRA 1ZMCA 3EF6A 3SQPA 4EQRA 1OJTA 3NIXA 2GMJA 2B9XA 1VG9A 4NEWA 4ECHA 1TYPA 2ZZBA 1CJ4A 2CVJA 1CC2A 1DODA 2GB0A 2ZZCA 3F8PA 3I3LA 3ICTA 1L9EA 3AEBA 4X9NA 4U8MA 4Z2RA 5JCNA 3NN6X 2RGJA 2X8CA 2WPFA 3VR8A 2WU2A 1E1MA 1O94A 1TYTA 1VRQB 2XCGA 2WPCA 4N9XA 3KKJA 2JB1A 3P4QA 2BK3A 3COXA 3OZ2A 1K0IA 3AECA 4ICYA 4NZHA 3C96A 1M6IA 5JCKA 3S5WA 4H4SA 3NYCA 3PS9A 1UKVG 4NEVA 2AR8A 4J56A 4TM3A 2C75A 4A6NA 2X99A 3I6DA 4YKFA 1OJ9A 1NPXA 1B8SA 1GSNA 2GRTA 4YTPA 3E1TA 3ICSA 2GVCA 3UTFA 1FOHA 2VOUA 2QA1A 1MOKA 1IJHA 5FMHA 3UTGA 3ALLA 3GWDA 4Z24A 1KFYA 3UP5A 3CPJG 4YTNA 3FIMB 2Y6RA 3BNMA 4AP1A 1HYUA 2Q7VA 4AOXA 3UOXA 4EM3A 4NTEA 1FCDA 2OLOA 1BF3A 3IC9A 3NG7X 2R46A 3EANA 2C65A 4TLXA 1Y56A 1KF6A 3M12A 4B68A 1L9CA 1L9DA 5TR3A 4A7AA 4XWZA 4E0VA 3KLJA 3P1WA 3ZYXA 1BKWA 1LQUA 2R4JA 3CTYA 2BCPA 3DGZA 4B66A 3AYIA 3QSSA 1CJ2A 1NAAA 1LVLA 1NEKA 1P2HA 3CNTA 2NPXA 4OPDA 3AD7B 1GOSA 2XDOA 4J36A 1Q1WA 2Q0LA 1JU2A 5BULA 3DJJA 2BACA 3NLCA 2GQFA 4U2TA 5IPYA 4DNAA 4USRA 4JY3A 1F8WA 3RP6A 1ZY8A 2WP6A 4BV6A 2YR4A 1H81A 4JQ9A 3UOVA 4WCTA 3GWFA 3ISHA 4J2WA 4LA1A 1PXCA 1CJCA 2J3NA 1TDNA 2BS3A 3DJDA 3UKKA 1P2EA 1D4DA 4BK3A 5JCIA 3IHMA 2YM1A 4H4TA 5EB5A 3QJ4A 2UZZA 5KWFA 3P4SA 4FK1A 1EL9A 3CNPA 1D4CA 3FG2P 2YVFA 2C3DA 4REKA 5FS7A 3UP4A 1FL2A 2H88A 2VQ7A 4AP3A 3BI2A 3CNDA 2AAQA 3B3RA 2TPRA 1O5WA 4YSYA 4PABA 2B7RA 2IIDA 4OPIA 5U63A 1EBDA 2CULA 4H2PA 5KOXA 4PAAA 1ZK7A 2GAHB 3REDA 1X31B 4Z43A 4U8LA 2R0GA 3B6DA 4U8PA 4CNJA 2FJEA 4H2NA 1V59A 2CFYA 1GNDA 2QA2A 4Y4NA 2RGOA 3FMWA 1K0LA 3DMEA 1XDIA 1JRYA 3SFEA 4FDCB 4H4QA 1DNCA 1GT8A 3KA7A 2EQ9A 3LOVA 4ZN0A 4NTDA 3NT6A 2XFNA 1PHHA 1JRZA 4JNAA 1OJDA 4B1BA 5L46A 4Z44A 3CGBA 3AEGA 5KXJA 3ALMA 3DK4A 2YG5A 5BVAA 3QSEA 2B76A 3G5SA 2BK5A 3GMBA 1N1PA 1D4EA 5M0ZA 5FS6A 1GRHA 3AE1A 5EB4A 5GSNA 1E1NA 3NN0X 2H89A 3AYLA 1IUUA 3SM8A 4BJZA 1GREA 4A5LA 2JAEA 1FECA 4EM4A 3BI5A 1K4QA 4H50A 1COYA 5BRTA 2YLRA 3VQRA 2YQUA 2YLWA 3AE8A 1PN0A 3QSMA 4YT0A 2ZBWA 4H4WA 2X8HA 5HYMA 1ZDLA 2XLTA 5HY5A 1JOAA 3AB1A 4TM4A 4OCGA 3D1CA 2HQMA
chains in the Genus database with same CATH superfamily
2Q0KA 4G73A 1PJ6A 3UTHA 3EPTA 2IVEA 4RG3A 4EQWA 4Z2TA 4Y4LA 3ITJA 5J60A 3CIRA 3CN8A 3NK0X 2V5ZA 4II3A 3SFDA 1GRGA 3DJEA 2WDQA 3GRSA 5FS9A 1GRFA 1ELIA 2BABA 3CPHG 3F8DA 5U25A 4NTCA 4B64A 5FS8A 5EBKA 1GRAA 4CCQA 1IUWA 3ATQA 1NG4A 3UKLA 4CNKA 2BYBA 2XFPA 2Z5XA 4JDRA 1QJDA 1H84A 3HZLA 1YKJA 4X4JA 1NHQA 3SXIA 4J31A 1E7PA 2C73A 4XXGA 2WDRA 3JSKA 3SGLA 2BK4A 3NGCX 4UDRA 4U8KA 2BXSA 3CNSA 2XFOA 4U2SA 3VR9A 2TMDA 1IUTA 2GR1A 3NTDA 2XVIA 3H4KA 4AT0A 2YG4A 3BHFA 2C66A 5KMQA 1OJCA 4B65A 4IA5A 4H4UA 2GV8A 3NRNA 2WBAA 2DKIA 3V3OA 2EQ8A 4O5UA 3KU9A 2V61A 3M13A 3DK8A 4C77A 5KVIA 4H2QA 2EQ6A 3QVPA 1QO8A 1KDGA 2BS4A 4KPRA 2VVLG 1CJ3A 3LZWA 2XVFA 1F6MA 1N4VA 4A79A 3FBSA 4YKGA 1YQZA 3VRDB 4G74A 2X3NA 4GAVA 1KSUA 1CC4A 4EIQA 2FJBA 3AEDA 3VRAA 1VQWA 2W0HA 3PO7A 3GYIA 2C4CA 1GPEA 1K0JA 2V3AA 4U8JA 3KD9A 3H8LA 3AEFA 1MXTA 3NTAA 2GAGB 1F3PA 2A87A 4K22A 4K2XA 3CMMA 4K8DA 4P9SA 4B67A 1VDCA 3UTEA 1PBDA 1KSSA 3GDPA 4I58A 4HA6A 2APGA 5HHFA 1PDHA 3LXDA 3DK9A 2YG3A 5JCLA 2FJAA 4B69A 1CBOA 1ONFA 1H82A 4H4YA 1EL8A 3NK1X 4RSLA 2VVMA 3AEEA 3GSIA 1LV0A 3PVCA 1Y56B 1GRBA 2R4EA 4H4VA 3T14A 3IWAA 3LADA 3T2YA 1M64A 2V3BA 2GR3A 2JB2A 2JB3A 1GETA 1LQTA 3C4AA 2WOWA 3P9UA 4JY2A 3AWIA 4B63A 2YG6A 5M10A 3AE3A 1S3EA 3L8KA 5ER0A 3NNEA 4O5QA 5GRTA 1S2QA 3F8RA 4GF7A 1D5TA 4OPUA 1XPQA 4U8IA 3RP8A 2VRMA 3ZDNA 2CDUA 3CGCA 3G5RA 2FJDA 3ADAB 4J34A 4U2LA 2GQWA 3AE9A 4DSGA 4OPCA 3S61A 4EMJA 4OPLA 3II4A 1PBEA 1KNPA 1PXBA 2JBVA 2FBWA 1F8RA 1GTHA 1GV4A 1Z6LA 2OLNA 2GEWA 2Q6UA 4GDPA 4D03A 3AEAA 4A9WA 1H83A 4H4XA 1DOBA 5IQ1A 4WX1A 4GR1A 3EAOA 5KMSA 4OVIA 2XLUA 1FEAA 2VRLA 1PJ7A 1GALA 4MJWA 3VRBA 2WP5A 3SZFA 2X50A 2B7SA 3GD4A 2BC1A 1NHPA 4CY6A 2BA9A 5KVHA 2B9YA 2YM2A 2VZ2A 1D7YA 2GH5A 3CGDA 3GYXA 1JNZA 3G5QA 4D04A 2Y6QA 3LZXA 1E6EA 1PBCA 4II2A 5KOWA 3R9UA 1N4WA 3ABVA 3GD3A 3K7MX 5C3JA 5KRQA 3Q6JA 3SZ0A 1ZOYA 4LU6A 5JCMA 3GRTA 2XLSA 2DKHA 5LV9A 4H7UA 3BNUA 1DXLA 1ZX9A 1TDOA 1DOCA 3AD8B 3NYFA 4HB9A 3RP7A 2ARDA 4XWRA 2IVDA 4YWOA 1DJNA 4RG4A 2WOIA 3O0HA 2YR6A 3WE0A 4EMIA 4Z26A 5KNLA 1DOEA 2E4GA 2XVEA 3H8IA 2C76A 2ACZA 2YWLA 4GDEA 5CKUA 3V3NA 1EL7A 2GF3A 2BRAA 3K7QX 3IF9A 4A65A 4AT2A 3UOYA 2GR2A 1REOA 2ZZ0A 1LTXR 5HXIA 1TDEA 4UP3A 3GDNA 2RABA 1TDKA 1XHCA 4H4RA 1GERA 2WESA 1PS9A 1GTEA 4K5RA 1PXAA 3BI4A 2YVJA 1Q9IA 4DSHA 3DGHA 1LJ1A 4YSZA 2E5VA 1YQ3A 2YLSA 2R9ZA 4CCRA 1NG3A 4U8OA 4CY8A 3QFBA 3QFAA 2YG7A 3NK2X 1CF3A 2WDVA 2XLRA 1PBBA 2C67A 2GMHA 4ZCDA 3UKPA 1Q1RA 2C70A 4K7ZA 2PHHA 4BK2A 2JK6A 3AE2A 2VQBA 4LIIA 1PJ5A 2GR0A 3C4NA 4OPTA 2F5ZA 1RP0A 3IHGA 1BZLA 4YSHA 1NHSA 2E1MA 3AE7A 3K7TA 3ATRA 4Z25A 2R45A 1TDFA 1F8SA 5J7XA 4IVMB 3DJGX 3UKFA 3T2KA 4KX6A 3K30A 1QLBA 1S3BA 4M52A 2XLPA 4APNA 4C5OA 1NENA 2XYOA 2AQJA 4BJYA 4YTMA 2WEUA 3DA1A 2YLTA 1JNRA 1N4UA 2WPEA 3V76A 4U8NA 2A89A 3P4RA 4I59A 2WHDA 4IVOB 3T0KA 1B5QA 1RSGA 1ZKQA 4EIPA 1D7LA 5DBJA 1W4XA 1S2YA 2XVJA 3NYEA 4GCMA 3AE5A 2X8GA 3OC4A 5KMPA 2QAEA 3CGEA 1E1LA 3D8XA 2YLXA 2QCUA 2BXRA 4IA6A 3AD9B 1JEHA 1H7WA 1FEBA 1GEUA 2C7GA 4BK1A 3UOZA 3L1RA 4EMWA 2C3CA 3P4PA 2BCGG 4TM1A 3AE6A 3DH9A 4DGKA 2XFUA 3SZCA 1H86A 2O9ZA 4X9MA 2YLZA 2C72A 1ZOVA 1BGNA 2WU5A 3NH3X 2BC0A 4G9KA 1B4VA 4H2RA 1RYIA 2I0ZA 3AXBA 4JN9A 4A6NB 1BGJA 1SEZA 1B37A 2R0PA 4C3XA 2OALA 4J57A 1EL5A 4BURA 5IQ4A 2YAUA 4FX9A 1GXFA 3SY4A 2NVKX 2YVGA 4H4PA 4ZCCA 4EQSA 4YSXA 1GRTA 3ICRA 4TM0A 1E1KA 2WP9A 3LB8A 2Z5YA 2PYXA 4GRTA 3KPFA 2JKCA 1AOGA 4YXDA 4Y4MA 2EQ7A 3CNJA 2XVHA 3GMCA 4AOSA 2WS3A 3BHKA 3QVRA 2WETA 4Z2UA 4CBQA 2OAMA 4IV9A 1OJAA 2VVLA 1O95A 1IUXA 1CC6A 3GYJA 3FPZA 3CPIG 2B9WA 3AE4A 2OA1A 4GAPA 1YY5A 1E39A 1GESA 2XFQA 3KVEA 3NHOX 4J33A 3RHAA 3LJPA 4CRTA 3ALJA 2BS2A 3UKQA 1CHUA 4USQA 1L0VA 1IUVA 4TLZA 1NHRA 1NDAA 4ADWA 1ZMDA 4K5SA 1XANA 3Q9TA 4A99A 4C74A 1JRXA 3T37A 5CQFA 5BUKA 3URHA 1H6VA 4JNQA 2V60A 3NKSA 2WOVA 2V6OA 1MO9A 2WQYA 1ZP0A 5U1OA 3UKAA 1BWCA 4C3YA 3RNMA 4OPGA 4H4ZA 2R0CA 1VG0A 3SYIA 1CL0A 2C64A 4NNJA 3UCLA 4EQXA 3M0OA 3UKHA 4FK1C 5EOWA 1LPFA 1IUSA 2YR5A 4UDQA 1YQ4A 1TRBA 3AYJA 1Y0PA 1DJQA 2A8XA 4UDPA 2RGHA 1H7XA 1PBFA 4GUVA 5C2TA 1KNRA 1ZMCA 3EF6A 3SQPA 4EQRA 1OJTA 3NIXA 2GMJA 2B9XA 1VG9A 4NEWA 4ECHA 1TYPA 2ZZBA 1CJ4A 2CVJA 1CC2A 1DODA 2GB0A 2ZZCA 3F8PA 3I3LA 3ICTA 1L9EA 3AEBA 4X9NA 4U8MA 4Z2RA 5JCNA 3NN6X 2RGJA 2X8CA 2WPFA 3VR8A 2WU2A 1E1MA 1O94A 1TYTA 1VRQB 2XCGA 2WPCA 4N9XA 3KKJA 2JB1A 3P4QA 2BK3A 3COXA 3OZ2A 1K0IA 3AECA 4ICYA 4NZHA 3C96A 1M6IA 3SX6A 3T31A 5JCKA 3S5WA 4H4SA 3NYCA 3PS9A 1UKVG 4NEVA 2BRYA 2AR8A 4J56A 4TM3A 2C75A 4A6NA 2X99A 3I6DA 4YKFA 1OJ9A 1NPXA 1B8SA 1GSNA 2GRTA 4YTPA 3E1TA 3ICSA 2GVCA 3UTFA 1FOHA 2VOUA 2QA1A 5KMRA 1MOKA 1IJHA 5FMHA 3UTGA 3ALLA 3GWDA 4Z24A 1KFYA 3UP5A 3CPJG 4YTNA 3FIMB 2Y6RA 4NWZA 3BNMA 4AP1A 1HYUA 2Q7VA 4AOXA 3UOXA 4EM3A 4NTEA 1FCDA 2OLOA 1BF3A 3IC9A 3NG7X 2R46A 4G6HA 3EANA 2C65A 4TLXA 1Y56A 1KF6A 3M12A 4B68A 1L9CA 1L9DA 5TR3A 4A7AA 3HYXA 4XWZA 4E0VA 3KLJA 3P1WA 3ZYXA 1BKWA 3HYWA 1LQUA 2R4JA 3CTYA 2BCPA 3DGZA 4B66A 3AYIA 3QSSA 1CJ2A 1NAAA 1LVLA 1NEKA 1P2HA 3CNTA 2NPXA 4OPDA 3AD7B 1GOSA 2XDOA 4J36A 1Q1WA 2Q0LA 1JU2A 5BULA 3DJJA 2BACA 3NLCA 2GQFA 4U2TA 5IPYA 4DNAA 4USRA 4JY3A 1F8WA 3RP6A 1ZY8A 2WP6A 4BV6A 2YR4A 1H81A 4JQ9A 3UOVA 4WCTA 3GWFA 3ISHA 4J2WA 4LA1A 1PXCA 1CJCA 2J3NA 1TDNA 2BS3A 3DJDA 3UKKA 1P2EA 1D4DA 4BK3A 5JCIA 3IHMA 2YM1A 4H4TA 5EB5A 3QJ4A 2UZZA 5KWFA 3P4SA 4FK1A 1EL9A 3CNPA 1D4CA 3FG2P 2YVFA 3HYVA 2C3DA 4REKA 5FS7A 3UP4A 1FL2A 2H88A 2VQ7A 4AP3A 3BI2A 3CNDA 2AAQA 3B3RA 2TPRA 1O5WA 4YSYA 4PABA 2B7RA 2IIDA 4OPIA 5U63A 1EBDA 2CULA 4H2PA 5KOXA 4PAAA 1ZK7A 2GAHB 3REDA 1X31B 4Z43A 4U8LA 2R0GA 3B6DA 4U8PA 4CNJA 2FJEA 4H2NA 1V59A 2CFYA 1GNDA 2QA2A 4Y4NA 2RGOA 3FMWA 1K0LA 3DMEA 1XDIA 4G6GA 1JRYA 3T2ZA 3SFEA 4FDCB 4H4QA 1DNCA 1GT8A 3KA7A 2EQ9A 3LOVA 4ZN0A 4NTDA 3NT6A 2XFNA 1PHHA 1JRZA 4JNAA 1OJDA 4B1BA 5L46A 4Z44A 3CGBA 3AEGA 5KXJA 3ALMA 3DK4A 2YG5A 5BVAA 3QSEA 2B76A 3G5SA 2BK5A 3GMBA 1N1PA 3SZWA 1D4EA 5M0ZA 5FS6A 1GRHA 3AE1A 5EB4A 5GSNA 1E1NA 3NN0X 2H89A 3AYLA 1IUUA 3SM8A 4BJZA 1GREA 4A5LA 2JAEA 1FECA 4EM4A 3BI5A 1K4QA 4H50A 1COYA 5BRTA 2YLRA 3VQRA 2YQUA 2YLWA 3AE8A 1PN0A 3QSMA 4YT0A 2ZBWA 4H4WA 2X8HA 5HYMA 1ZDLA 3KPKA 2XLTA 5HY5A 1JOAA 3AB1A 4TM4A 4OCGA 3D1CA 2HQMA
chains in the Genus database with same CATH topology
2Q0KA 4G73A 1PJ6A 3UTHA 3EPTA 2IVEA 4RG3A 4EQWA 4Z2TA 4Y4LA 3ITJA 5J60A 3CIRA 3CN8A 3NK0X 2V5ZA 4II3A 3SFDA 1GRGA 3DJEA 2WDQA 3GRSA 5FS9A 1GRFA 1ELIA 2BABA 3CPHG 3F8DA 5U25A 4NTCA 4B64A 5FS8A 5EBKA 1GRAA 4CCQA 1IUWA 3ATQA 1NG4A 3UKLA 4CNKA 2BYBA 2XFPA 2Z5XA 4JDRA 1QJDA 1H84A 3HZLA 1YKJA 4X4JA 1NHQA 3SXIA 4J31A 1E7PA 2C73A 4XXGA 2WDRA 3JSKA 3SGLA 2BK4A 3NGCX 4UDRA 4U8KA 2BXSA 3CNSA 2XFOA 4U2SA 3VR9A 2TMDA 1IUTA 2GR1A 3NTDA 2XVIA 3H4KA 4AT0A 2YG4A 3BHFA 2C66A 5KMQA 1OJCA 4B65A 4IA5A 4H4UA 2GV8A 3NRNA 2WBAA 2DKIA 3V3OA 2EQ8A 4O5UA 3KU9A 2V61A 3M13A 3DK8A 4C77A 5KVIA 4H2QA 2EQ6A 3QVPA 1QO8A 1KDGA 2BS4A 4KPRA 2VVLG 1CJ3A 3LZWA 2XVFA 1F6MA 1N4VA 4A79A 3FBSA 4YKGA 1YQZA 3VRDB 4G74A 2X3NA 4GAVA 1KSUA 1CC4A 4EIQA 2FJBA 3AEDA 3VRAA 1VQWA 2W0HA 3PO7A 3GYIA 2C4CA 1GPEA 1K0JA 2V3AA 4U8JA 3KD9A 3H8LA 3AEFA 1MXTA 3NTAA 2GAGB 1F3PA 2A87A 4K22A 4K2XA 3CMMA 4K8DA 4P9SA 4B67A 1VDCA 3UTEA 1PBDA 1KSSA 3GDPA 4I58A 4HA6A 2APGA 5HHFA 1PDHA 3LXDA 3DK9A 2YG3A 5JCLA 2FJAA 4B69A 1CBOA 1ONFA 1H82A 4H4YA 1EL8A 3NK1X 4RSLA 2VVMA 3AEEA 3GSIA 1LV0A 3PVCA 1Y56B 1GRBA 2R4EA 4H4VA 3T14A 3IWAA 3LADA 3T2YA 1M64A 2V3BA 2GR3A 2JB2A 2JB3A 1GETA 1LQTA 3C4AA 2WOWA 3P9UA 4JY2A 3AWIA 4B63A 2YG6A 5M10A 3AE3A 1S3EA 3L8KA 5ER0A 3NNEA 4O5QA 5GRTA 1S2QA 3F8RA 4GF7A 1D5TA 4OPUA 1XPQA 4U8IA 3RP8A 2VRMA 3ZDNA 2CDUA 3CGCA 3G5RA 2FJDA 3ADAB 4J34A 4U2LA 2GQWA 3AE9A 4DSGA 4OPCA 3S61A 4EMJA 4OPLA 3II4A 1PBEA 1KNPA 1PXBA 2JBVA 2FBWA 1F8RA 1GTHA 1GV4A 1Z6LA 2OLNA 2GEWA 2Q6UA 4GDPA 4D03A 3AEAA 4A9WA 1H83A 4H4XA 1DOBA 5IQ1A 4WX1A 4GR1A 3EAOA 5KMSA 4OVIA 2XLUA 1FEAA 2VRLA 1PJ7A 1GALA 4MJWA 3VRBA 2WP5A 3SZFA 2X50A 2B7SA 3GD4A 2BC1A 1NHPA 4CY6A 2BA9A 5KVHA 2B9YA 2YM2A 2VZ2A 1D7YA 2GH5A 3CGDA 3GYXA 1JNZA 3G5QA 4D04A 2Y6QA 3LZXA 1E6EA 1PBCA 4II2A 5KOWA 3R9UA 1N4WA 3ABVA 3GD3A 3K7MX 5C3JA 5KRQA 3Q6JA 3SZ0A 1ZOYA 4LU6A 5JCMA 3GRTA 2XLSA 2DKHA 5LV9A 4H7UA 3BNUA 1DXLA 1ZX9A 1TDOA 1DOCA 3AD8B 3NYFA 4HB9A 3RP7A 2ARDA 4XWRA 2IVDA 4YWOA 1DJNA 4RG4A 2WOIA 3O0HA 2YR6A 3WE0A 4EMIA 4Z26A 5KNLA 1DOEA 2E4GA 2XVEA 3H8IA 2C76A 2ACZA 2YWLA 4GDEA 5CKUA 3V3NA 1EL7A 2GF3A 2BRAA 3K7QX 3IF9A 4A65A 4AT2A 3UOYA 2GR2A 1REOA 2ZZ0A 1LTXR 5HXIA 1TDEA 4UP3A 3GDNA 2RABA 1TDKA 1XHCA 4H4RA 1GERA 2WESA 1PS9A 1GTEA 4K5RA 1PXAA 3BI4A 2YVJA 1Q9IA 4DSHA 3DGHA 1LJ1A 4YSZA 2E5VA 1YQ3A 2YLSA 2R9ZA 4CCRA 1NG3A 4U8OA 4CY8A 3QFBA 3QFAA 2YG7A 3NK2X 1CF3A 2WDVA 2XLRA 1PBBA 2C67A 2GMHA 4ZCDA 3UKPA 1Q1RA 2C70A 4K7ZA 2PHHA 4BK2A 2JK6A 3AE2A 2VQBA 4LIIA 1PJ5A 2GR0A 3C4NA 4OPTA 2F5ZA 1RP0A 3IHGA 1BZLA 4YSHA 1NHSA 2E1MA 3AE7A 3K7TA 3ATRA 4Z25A 2R45A 1TDFA 1F8SA 5J7XA 4IVMB 3DJGX 3UKFA 3T2KA 4KX6A 3K30A 1QLBA 1S3BA 4M52A 2XLPA 4APNA 4C5OA 1NENA 2XYOA 2AQJA 4BJYA 4YTMA 2WEUA 3DA1A 2YLTA 1JNRA 1N4UA 2WPEA 3V76A 4U8NA 2A89A 3P4RA 4I59A 2WHDA 4IVOB 3T0KA 1B5QA 1RSGA 1ZKQA 4EIPA 1D7LA 5DBJA 1W4XA 1S2YA 2XVJA 3NYEA 4GCMA 3AE5A 2X8GA 3OC4A 5KMPA 2QAEA 3CGEA 1E1LA 3D8XA 2YLXA 2QCUA 2BXRA 4IA6A 3AD9B 1JEHA 1H7WA 1FEBA 1GEUA 2C7GA 4BK1A 3UOZA 3L1RA 4EMWA 2C3CA 3P4PA 2BCGG 4TM1A 3AE6A 3DH9A 4DGKA 2XFUA 3SZCA 1H86A 2O9ZA 4X9MA 2YLZA 2C72A 1ZOVA 1BGNA 2WU5A 3NH3X 2BC0A 4G9KA 1B4VA 4H2RA 1RYIA 2I0ZA 3AXBA 4JN9A 4A6NB 1BGJA 1SEZA 1B37A 2R0PA 4C3XA 2OALA 4J57A 1EL5A 4BURA 5IQ4A 2YAUA 4FX9A 1GXFA 3SY4A 2NVKX 2YVGA 4H4PA 4ZCCA 4EQSA 4YSXA 1GRTA 3ICRA 4TM0A 1E1KA 2WP9A 3LB8A 2Z5YA 2PYXA 4GRTA 3KPFA 2JKCA 1AOGA 4YXDA 4Y4MA 2EQ7A 3CNJA 2XVHA 3GMCA 4AOSA 2WS3A 3BHKA 3QVRA 2WETA 4Z2UA 4CBQA 2OAMA 4IV9A 1OJAA 2VVLA 1O95A 1IUXA 1CC6A 3GYJA 3FPZA 3CPIG 2B9WA 3AE4A 2OA1A 4GAPA 1YY5A 1E39A 1GESA 2XFQA 3KVEA 3NHOX 4J33A 3RHAA 3LJPA 4CRTA 3ALJA 2BS2A 3UKQA 1CHUA 4USQA 1L0VA 1IUVA 4TLZA 1NHRA 1NDAA 4ADWA 1ZMDA 4K5SA 1XANA 3Q9TA 4A99A 4C74A 1JRXA 3T37A 5CQFA 5BUKA 3URHA 1H6VA 4JNQA 2V60A 3NKSA 2WOVA 2V6OA 1MO9A 2WQYA 1ZP0A 5U1OA 3UKAA 1BWCA 4C3YA 3RNMA 4OPGA 4H4ZA 2R0CA 1VG0A 3SYIA 1CL0A 2C64A 4NNJA 3UCLA 4EQXA 3M0OA 3UKHA 4FK1C 5EOWA 1LPFA 1IUSA 2YR5A 4UDQA 1YQ4A 1TRBA 3AYJA 1Y0PA 1DJQA 2A8XA 4UDPA 2RGHA 1H7XA 1PBFA 4GUVA 5C2TA 1KNRA 1ZMCA 3EF6A 3SQPA 4EQRA 1OJTA 3NIXA 2GMJA 2B9XA 1VG9A 4NEWA 4ECHA 1TYPA 2ZZBA 1CJ4A 2CVJA 1CC2A 1DODA 2GB0A 2ZZCA 3F8PA 3I3LA 3ICTA 1L9EA 3AEBA 4X9NA 4U8MA 4Z2RA 5JCNA 3NN6X 2RGJA 2X8CA 2WPFA 3VR8A 2WU2A 1E1MA 1O94A 1TYTA 1VRQB 2XCGA 2WPCA 4N9XA 3KKJA 2JB1A 3P4QA 2BK3A 3COXA 3OZ2A 1K0IA 3AECA 4ICYA 4NZHA 3C96A 1M6IA 3SX6A 3T31A 5JCKA 3S5WA 4H4SA 3NYCA 3PS9A 1UKVG 4NEVA 2BRYA 2AR8A 4J56A 4TM3A 2C75A 4A6NA 2X99A 3I6DA 4YKFA 1OJ9A 1NPXA 1B8SA 1GSNA 2GRTA 4YTPA 3E1TA 3ICSA 2GVCA 3UTFA 1FOHA 2VOUA 2QA1A 5KMRA 1MOKA 1IJHA 5FMHA 3UTGA 3ALLA 3GWDA 4Z24A 1KFYA 3UP5A 3CPJG 4YTNA 3FIMB 2Y6RA 4NWZA 3BNMA 4AP1A 1HYUA 2Q7VA 4AOXA 3UOXA 4EM3A 4NTEA 1FCDA 2OLOA 1BF3A 3IC9A 3NG7X 2R46A 4G6HA 3EANA 2C65A 4TLXA 1Y56A 1KF6A 3M12A 4B68A 1L9CA 1L9DA 5TR3A 4A7AA 3HYXA 4XWZA 4E0VA 3KLJA 3P1WA 3ZYXA 1BKWA 3HYWA 1LQUA 2R4JA 3CTYA 2BCPA 3DGZA 4B66A 3AYIA 3QSSA 1CJ2A 1NAAA 1LVLA 1NEKA 1P2HA 3CNTA 2NPXA 4OPDA 3AD7B 1GOSA 2XDOA 4J36A 1Q1WA 2Q0LA 1JU2A 5BULA 3DJJA 2BACA 3NLCA 2GQFA 4U2TA 5IPYA 4DNAA 4USRA 4JY3A 1F8WA 3RP6A 1ZY8A 2WP6A 4BV6A 2YR4A 1H81A 4JQ9A 3UOVA 4WCTA 3GWFA 3ISHA 4J2WA 4LA1A 1PXCA 1CJCA 2J3NA 1TDNA 2BS3A 3DJDA 3UKKA 1P2EA 1D4DA 4BK3A 5JCIA 3IHMA 2YM1A 4H4TA 5EB5A 3QJ4A 2UZZA 5KWFA 3P4SA 4FK1A 1EL9A 3CNPA 1D4CA 3FG2P 2YVFA 3HYVA 2C3DA 4REKA 5FS7A 3UP4A 1FL2A 2H88A 2VQ7A 4AP3A 3BI2A 3CNDA 2AAQA 3B3RA 2TPRA 1O5WA 4YSYA 4PABA 2B7RA 2IIDA 4OPIA 5U63A 1EBDA 2CULA 4H2PA 5KOXA 4PAAA 1ZK7A 2GAHB 3REDA 1X31B 4Z43A 4U8LA 2R0GA 3B6DA 4U8PA 4CNJA 2FJEA 4H2NA 1V59A 2CFYA 1GNDA 2QA2A 4Y4NA 2RGOA 3FMWA 1K0LA 3DMEA 1XDIA 4G6GA 1JRYA 3T2ZA 3SFEA 4FDCB 4H4QA 1DNCA 1GT8A 3KA7A 2EQ9A 3LOVA 4ZN0A 4NTDA 3NT6A 2XFNA 1PHHA 1JRZA 4JNAA 1OJDA 4B1BA 5L46A 4Z44A 3CGBA 3AEGA 5KXJA 3ALMA 3DK4A 2YG5A 5BVAA 3QSEA 2B76A 3G5SA 2BK5A 3GMBA 1N1PA 3SZWA 1D4EA 5M0ZA 5FS6A 1GRHA 3AE1A 5EB4A 5GSNA 1E1NA 3NN0X 2H89A 3AYLA 1IUUA 3SM8A 4BJZA 1GREA 4A5LA 2JAEA 1FECA 4EM4A 3BI5A 1K4QA 4H50A 1COYA 5BRTA 2YLRA 3VQRA 2YQUA 2YLWA 3AE8A 1PN0A 3QSMA 4YT0A 2ZBWA 4H4WA 2X8HA 5HYMA 1ZDLA 3KPKA 2XLTA 5HY5A 1JOAA 3AB1A 4TM4A 4OCGA 3D1CA 2HQMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q0K A;  1PJ6 A;  3UTH A;  3EPT A;  2IVE A;  4RG3 A;  4EQW A;  4Z2T A;  4Y4L A;  3ITJ A;  5J60 A;  3CIR A;  3CN8 A;  3NK0 X;  2V5Z A;  3SFD A;  1GRG A;  3DJE A;  2WDQ A;  3GRS A;  5FS9 A;  1GRF A;  1ELI A;  2BAB A;  3CPH G;  3F8D A;  5U25 A;  4NTC A;  4B64 A;  5FS8 A;  5EBK A;  1GRA A;  4CCQ A;  1IUW A;  3ATQ A;  1NG4 A;  3UKL A;  4CNK A;  2BYB A;  2XFP A;  2Z5X A;  4JDR A;  1QJD A;  1H84 A;  3HZL A;  1YKJ A;  4X4J A;  1NHQ A;  4J31 A;  1E7P A;  2C73 A;  4XXG A;  2WDR A;  3JSK A;  3SGL A;  2BK4 A;  3NGC X;  4UDR A;  4U8K A;  2BXS A;  3CNS A;  2XFO A;  4U2S A;  3VR9 A;  2TMD A;  1IUT A;  2GR1 A;  3NTD A;  2XVI A;  3H4K A;  4AT0 A;  2YG4 A;  3BHF A;  2C66 A;  4B65 A;  1OJC A;  4IA5 A;  4H4U A;  2GV8 A;  3NRN A;  2WBA A;  2DKI A;  3V3O A;  2EQ8 A;  4O5U A;  3KU9 A;  2V61 A;  3M13 A;  3DK8 A;  4C77 A;  5KVI A;  4H2Q A;  2EQ6 A;  3QVP A;  1QO8 A;  1KDG A;  2BS4 A;  4KPR A;  2VVL G;  1CJ3 A;  3LZW A;  2XVF A;  1F6M A;  1N4V A;  4A79 A;  3FBS A;  4YKG A;  1YQZ A;  3VRD B;  2X3N A;  1KSU A;  1CC4 A;  4EIQ A;  2FJB A;  3AED A;  3VRA A;  1VQW A;  2W0H A;  3PO7 A;  3GYI A;  1GPE A;  1K0J A;  2V3A A;  4U8J A;  3KD9 A;  3H8L A;  3AEF A;  1MXT A;  3NTA A;  2GAG B;  1F3P A;  2A87 A;  4K22 A;  4K2X A;  4K8D A;  4P9S A;  4B67 A;  1VDC A;  3UTE A;  1PBD A;  1KSS A;  3GDP A;  4I58 A;  4HA6 A;  2APG A;  5HHF A;  1PDH A;  3LXD A;  3DK9 A;  2YG3 A;  5JCL A;  2FJA A;  4B69 A;  1CBO A;  1ONF A;  1H82 A;  4H4Y A;  1EL8 A;  3NK1 X;  4RSL A;  2VVM A;  3AEE A;  3GSI A;  1LV0 A;  3PVC A;  1Y56 B;  1GRB A;  2R4E A;  4H4V A;  3IWA A;  3LAD A;  1M64 A;  2V3B A;  2GR3 A;  2JB2 A;  2JB3 A;  1GET A;  1LQT A;  3C4A A;  2WOW A;  3P9U A;  4JY2 A;  3AWI A;  4B63 A;  2YG6 A;  5M10 A;  3AE3 A;  1S3E A;  3L8K A;  5ER0 A;  3NNE A;  4O5Q A;  5GRT A;  1S2Q A;  3F8R A;  4GF7 A;  1D5T A;  4OPU A;  1XPQ A;  4U8I A;  3RP8 A;  2VRM A;  3ZDN A;  2CDU A;  3CGC A;  3G5R A;  2FJD A;  3ADA B;  4J34 A;  4U2L A;  2GQW A;  3AE9 A;  4DSG A;  4OPC A;  3S61 A;  4EMJ A;  4OPL A;  3II4 A;  1PBE A;  1KNP A;  1PXB A;  2JBV A;  2FBW A;  1F8R A;  1GTH A;  1GV4 A;  1Z6L A;  2OLN A;  2GEW A;  2Q6U A;  4GDP A;  4D03 A;  3AEA A;  4A9W A;  1H83 A;  4H4X A;  1DOB A;  5IQ1 A;  4WX1 A;  4GR1 A;  3EAO A;  4OVI A;  2XLU A;  1FEA A;  2VRL A;  1PJ7 A;  1GAL A;  4MJW A;  3VRB A;  2WP5 A;  2X50 A;  2B7S A;  3GD4 A;  2BC1 A;  1NHP A;  4CY6 A;  2BA9 A;  5KVH A;  2B9Y A;  2YM2 A;  2VZ2 A;  1D7Y A;  2GH5 A;  3CGD A;  1JNZ A;  3G5Q A;  4D04 A;  2Y6Q A;  3LZX A;  1E6E A;  1PBC A;  5KOW A;  3R9U A;  1N4W A;  3ABV A;  3GD3 A;  3K7M X;  5C3J A;  5KRQ A;  3Q6J A;  1ZOY A;  4LU6 A;  5JCM A;  3GRT A;  2XLS A;  2DKH A;  5LV9 A;  4H7U A;  3BNU A;  1DXL A;  1ZX9 A;  1TDO A;  1DOC A;  3AD8 B;  3NYF A;  4HB9 A;  3RP7 A;  2ARD A;  4XWR A;  2IVD A;  4YWO A;  1DJN A;  4RG4 A;  2WOI A;  3O0H A;  2YR6 A;  3WE0 A;  4EMI A;  4Z26 A;  1DOE A;  2E4G A;  2XVE A;  3H8I A;  2C76 A;  2ACZ A;  2YWL A;  4GDE A;  5CKU A;  3V3N A;  1EL7 A;  2GF3 A;  3K7Q X;  3IF9 A;  4A65 A;  4AT2 A;  3UOY A;  2GR2 A;  1REO A;  2ZZ0 A;  1LTX R;  5HXI A;  1TDE A;  4UP3 A;  3GDN A;  2RAB A;  1TDK A;  1XHC A;  4H4R A;  1GER A;  2WES A;  1PS9 A;  1GTE A;  4K5R A;  1PXA A;  3BI4 A;  2YVJ A;  1Q9I A;  4DSH A;  3DGH A;  1LJ1 A;  4YSZ A;  2E5V A;  1YQ3 A;  2YLS A;  2R9Z A;  4CCR A;  1NG3 A;  4U8O A;  4CY8 A;  3QFB A;  3QFA A;  2YG7 A;  3NK2 X;  1CF3 A;  2WDV A;  2XLR A;  1PBB A;  2C67 A;  2GMH A;  4ZCD A;  3UKP A;  1Q1R A;  2C70 A;  4K7Z A;  2PHH A;  4BK2 A;  2JK6 A;  3AE2 A;  2VQB A;  4LII A;  1PJ5 A;  2GR0 A;  3C4N A;  4OPT A;  2F5Z A;  1RP0 A;  3IHG A;  1BZL A;  4YSH A;  1NHS A;  2E1M A;  3AE7 A;  3K7T A;  3ATR A;  4Z25 A;  2R45 A;  1TDF A;  1F8S A;  5J7X A;  4IVM B;  3DJG X;  3UKF A;  4KX6 A;  3K30 A;  1QLB A;  1S3B A;  4M52 A;  2XLP A;  4APN A;  4C5O A;  1NEN A;  2XYO A;  2AQJ A;  4BJY A;  4YTM A;  2WEU A;  3DA1 A;  2YLT A;  1JNR A;  1N4U A;  2WPE A;  3V76 A;  4U8N A;  2A89 A;  3P4R A;  4I59 A;  2WHD A;  4IVO B;  4EIP A;  1B5Q A;  1RSG A;  1ZKQ A;  1D7L A;  5DBJ A;  1W4X A;  1S2Y A;  2XVJ A;  3NYE A;  4GCM A;  3AE5 A;  2X8G A;  3OC4 A;  2QAE A;  3CGE A;  1E1L A;  3D8X A;  2YLX A;  2QCU A;  2BXR A;  4IA6 A;  3AD9 B;  1JEH A;  1H7W A;  1FEB A;  1GEU A;  2C7G A;  4BK1 A;  3UOZ A;  3L1R A;  4EMW A;  2C3C A;  3P4P A;  2BCG G;  4TM1 A;  3AE6 A;  3DH9 A;  4DGK A;  2XFU A;  1H86 A;  2O9Z A;  4X9M A;  2YLZ A;  2C72 A;  1ZOV A;  1BGN A;  2WU5 A;  3NH3 X;  2BC0 A;  1B4V A;  4H2R A;  1RYI A;  2I0Z A;  3AXB A;  4JN9 A;  4A6N B;  1BGJ A;  1SEZ A;  1B37 A;  2R0P A;  4C3X A;  2OAL A;  4J57 A;  1EL5 A;  4BUR A;  5IQ4 A;  2YAU A;  4FX9 A;  1GXF A;  2NVK X;  2YVG A;  4H4P A;  4ZCC A;  4EQS A;  4YSX A;  1GRT A;  3ICR A;  4TM0 A;  1E1K A;  2WP9 A;  3LB8 A;  2Z5Y A;  2PYX A;  4GRT A;  3KPF A;  2JKC A;  1AOG A;  4YXD A;  4Y4M A;  2EQ7 A;  3CNJ A;  2XVH A;  3GMC A;  4AOS A;  2WS3 A;  3BHK A;  3QVR A;  2WET A;  4Z2U A;  4CBQ A;  2OAM A;  4IV9 A;  1OJA A;  2VVL A;  1O95 A;  1IUX A;  1CC6 A;  3GYJ A;  3FPZ A;  3CPI G;  2B9W A;  3AE4 A;  2OA1 A;  1YY5 A;  1E39 A;  1GES A;  2XFQ A;  3KVE A;  3NHO X;  4J33 A;  3RHA A;  3LJP A;  4CRT A;  3ALJ A;  2BS2 A;  3UKQ A;  1CHU A;  4USQ A;  1L0V A;  1IUV A;  4TLZ A;  1NHR A;  1NDA A;  4ADW A;  1ZMD A;  4K5S A;  1XAN A;  3Q9T A;  4A99 A;  4C74 A;  1JRX A;  3T37 A;  5CQF A;  5BUK A;  3URH A;  1H6V A;  4JNQ A;  2V60 A;  3NKS A;  2WOV A;  2V6O A;  1MO9 A;  2WQY A;  1ZP0 A;  5U1O A;  3UKA A;  1BWC A;  4C3Y A;  3RNM A;  4OPG A;  4H4Z A;  2R0C A;  1VG0 A;  1CL0 A;  2C64 A;  3UCL A;  4EQX A;  3M0O A;  3UKH A;  4FK1 C;  5EOW A;  1LPF A;  1IUS A;  2YR5 A;  4UDQ A;  1YQ4 A;  1TRB A;  3AYJ A;  1Y0P A;  1DJQ A;  2A8X A;  4UDP A;  2RGH A;  1H7X A;  1PBF A;  4GUV A;  5C2T A;  1KNR A;  1ZMC A;  3EF6 A;  3SQP A;  4EQR A;  1OJT A;  3NIX A;  2GMJ A;  2B9X A;  1VG9 A;  4NEW A;  4ECH A;  1TYP A;  2ZZB A;  1CJ4 A;  2CVJ A;  1CC2 A;  1DOD A;  2GB0 A;  2ZZC A;  3F8P A;  3I3L A;  3ICT A;  1L9E A;  3AEB A;  4X9N A;  4U8M A;  4Z2R A;  5JCN A;  3NN6 X;  2RGJ A;  2X8C A;  2WPF A;  3VR8 A;  2WU2 A;  1E1M A;  1O94 A;  1TYT A;  1VRQ B;  2XCG A;  2WPC A;  4N9X A;  3KKJ A;  2JB1 A;  3P4Q A;  2BK3 A;  3COX A;  3OZ2 A;  1K0I A;  3AEC A;  4ICY A;  4NZH A;  3C96 A;  1M6I A;  5JCK A;  3S5W A;  4H4S A;  3NYC A;  3PS9 A;  1UKV G;  4NEV A;  2AR8 A;  4J56 A;  4TM3 A;  2C75 A;  4A6N A;  2X99 A;  3I6D A;  4YKF A;  1OJ9 A;  1NPX A;  1B8S A;  1GSN A;  2GRT A;  4YTP A;  3E1T A;  3ICS A;  2GVC A;  3UTF A;  1FOH A;  2VOU A;  2QA1 A;  1MOK A;  1IJH A;  5FMH A;  3UTG A;  3ALL A;  3GWD A;  4Z24 A;  1KFY A;  3UP5 A;  3CPJ G;  4YTN A;  3FIM B;  2Y6R A;  3BNM A;  4AP1 A;  1HYU A;  2Q7V A;  4AOX A;  3UOX A;  4EM3 A;  4NTE A;  1FCD A;  2OLO A;  1BF3 A;  3IC9 A;  3NG7 X;  2R46 A;  3EAN A;  2C65 A;  4TLX A;  1Y56 A;  1KF6 A;  3M12 A;  4B68 A;  1L9C A;  1L9D A;  5TR3 A;  4A7A A;  4XWZ A;  4E0V A;  3KLJ A;  3P1W A;  3ZYX A;  1BKW A;  1LQU A;  2R4J A;  3CTY A;  2BCP A;  3DGZ A;  4B66 A;  3AYI A;  3QSS A;  1CJ2 A;  1NAA A;  1LVL A;  1NEK A;  1P2H A;  3CNT A;  2NPX A;  4OPD A;  3AD7 B;  1GOS A;  2XDO A;  4J36 A;  1Q1W A;  2Q0L A;  1JU2 A;  5BUL A;  3DJJ A;  2BAC A;  3NLC A;  2GQF A;  4U2T A;  5IPY A;  4DNA A;  4USR A;  4JY3 A;  1F8W A;  3RP6 A;  1ZY8 A;  2WP6 A;  4BV6 A;  2YR4 A;  1H81 A;  4JQ9 A;  3UOV A;  4WCT A;  3GWF A;  3ISH A;  4J2W A;  4LA1 A;  1PXC A;  1CJC A;  2J3N A;  1TDN A;  2BS3 A;  3DJD A;  3UKK A;  1P2E A;  1D4D A;  4BK3 A;  5JCI A;  3IHM A;  2YM1 A;  4H4T A;  5EB5 A;  3QJ4 A;  2UZZ A;  5KWF A;  3P4S A;  4FK1 A;  1EL9 A;  3CNP A;  1D4C A;  3FG2 P;  2YVF A;  2C3D A;  4REK A;  5FS7 A;  3UP4 A;  1FL2 A;  2H88 A;  2VQ7 A;  4AP3 A;  3BI2 A;  3CND A;  2AAQ A;  3B3R A;  2TPR A;  1O5W A;  4YSY A;  4PAB A;  2B7R A;  2IID A;  4OPI A;  5U63 A;  1EBD A;  2CUL A;  4H2P A;  5KOX A;  4PAA A;  1ZK7 A;  2GAH B;  3RED A;  1X31 B;  4Z43 A;  4U8L A;  2R0G A;  3B6D A;  4U8P A;  4CNJ A;  2FJE A;  4H2N A;  1V59 A;  2CFY A;  1GND A;  2QA2 A;  4Y4N A;  2RGO A;  3FMW A;  1K0L A;  3DME A;  1XDI A;  1JRY A;  3SFE A;  4FDC B;  4H4Q A;  1DNC A;  1GT8 A;  3KA7 A;  2EQ9 A;  3LOV A;  4ZN0 A;  4NTD A;  3NT6 A;  2XFN A;  1PHH A;  1JRZ A;  4JNA A;  1OJD A;  4B1B A;  5L46 A;  4Z44 A;  3CGB A;  3AEG A;  5KXJ A;  3ALM A;  3DK4 A;  2YG5 A;  5BVA A;  3QSE A;  2B76 A;  3G5S A;  2BK5 A;  3GMB A;  1N1P A;  1D4E A;  5M0Z A;  5FS6 A;  1GRH A;  3AE1 A;  5EB4 A;  5GSN A;  1E1N A;  3NN0 X;  2H89 A;  3AYL A;  1IUU A;  3SM8 A;  4BJZ A;  1GRE A;  4A5L A;  2JAE A;  1FEC A;  4EM4 A;  3BI5 A;  1K4Q A;  4H50 A;  1COY A;  5BRT A;  2YLR A;  3VQR A;  2YQU A;  2YLW A;  3AE8 A;  1PN0 A;  3QSM A;  4YT0 A;  2ZBW A;  4H4W A;  2X8H A;  5HYM A;  1ZDL A;  2XLT A;  5HY5 A;  1JOA A;  3AB1 A;  4TM4 A;  4OCG A;  3D1C A;  2HQM A; 
#chains in the Genus database with same CATH topology
 2Q0K A;  4G73 A;  1PJ6 A;  3UTH A;  3EPT A;  2IVE A;  4RG3 A;  4EQW A;  4Z2T A;  4Y4L A;  3ITJ A;  5J60 A;  3CIR A;  3CN8 A;  3NK0 X;  2V5Z A;  4II3 A;  3SFD A;  1GRG A;  3DJE A;  2WDQ A;  3GRS A;  5FS9 A;  1GRF A;  1ELI A;  2BAB A;  3CPH G;  3F8D A;  5U25 A;  4NTC A;  4B64 A;  5FS8 A;  5EBK A;  1GRA A;  4CCQ A;  1IUW A;  3ATQ A;  1NG4 A;  3UKL A;  4CNK A;  2BYB A;  2XFP A;  2Z5X A;  4JDR A;  1QJD A;  1H84 A;  3HZL A;  1YKJ A;  4X4J A;  1NHQ A;  3SXI A;  4J31 A;  1E7P A;  2C73 A;  4XXG A;  2WDR A;  3JSK A;  3SGL A;  2BK4 A;  3NGC X;  4UDR A;  4U8K A;  2BXS A;  3CNS A;  2XFO A;  4U2S A;  3VR9 A;  2TMD A;  1IUT A;  2GR1 A;  3NTD A;  2XVI A;  3H4K A;  4AT0 A;  2YG4 A;  3BHF A;  2C66 A;  5KMQ A;  1OJC A;  4B65 A;  4IA5 A;  4H4U A;  2GV8 A;  3NRN A;  2WBA A;  2DKI A;  3V3O A;  2EQ8 A;  4O5U A;  3KU9 A;  2V61 A;  3M13 A;  3DK8 A;  4C77 A;  5KVI A;  4H2Q A;  2EQ6 A;  3QVP A;  1QO8 A;  1KDG A;  2BS4 A;  4KPR A;  2VVL G;  1CJ3 A;  3LZW A;  2XVF A;  1F6M A;  1N4V A;  4A79 A;  3FBS A;  4YKG A;  1YQZ A;  3VRD B;  4G74 A;  2X3N A;  4GAV A;  1KSU A;  1CC4 A;  4EIQ A;  2FJB A;  3AED A;  3VRA A;  1VQW A;  2W0H A;  3PO7 A;  3GYI A;  2C4C A;  1GPE A;  1K0J A;  2V3A A;  4U8J A;  3KD9 A;  3H8L A;  3AEF A;  1MXT A;  3NTA A;  2GAG B;  1F3P A;  2A87 A;  4K22 A;  4K2X A;  3CMM A;  4K8D A;  4P9S A;  4B67 A;  1VDC A;  3UTE A;  1PBD A;  1KSS A;  3GDP A;  4I58 A;  4HA6 A;  2APG A;  5HHF A;  1PDH A;  3LXD A;  3DK9 A;  2YG3 A;  5JCL A;  2FJA A;  4B69 A;  1CBO A;  1ONF A;  1H82 A;  4H4Y A;  1EL8 A;  3NK1 X;  4RSL A;  2VVM A;  3AEE A;  3GSI A;  1LV0 A;  3PVC A;  1Y56 B;  1GRB A;  2R4E A;  4H4V A;  3T14 A;  3IWA A;  3LAD A;  3T2Y A;  1M64 A;  2V3B A;  2GR3 A;  2JB2 A;  2JB3 A;  1GET A;  1LQT A;  3C4A A;  2WOW A;  3P9U A;  4JY2 A;  3AWI A;  4B63 A;  2YG6 A;  5M10 A;  3AE3 A;  1S3E A;  3L8K A;  5ER0 A;  3NNE A;  4O5Q A;  5GRT A;  1S2Q A;  3F8R A;  4GF7 A;  1D5T A;  4OPU A;  1XPQ A;  4U8I A;  3RP8 A;  2VRM A;  3ZDN A;  2CDU A;  3CGC A;  3G5R A;  2FJD A;  3ADA B;  4J34 A;  4U2L A;  2GQW A;  3AE9 A;  4DSG A;  4OPC A;  3S61 A;  4EMJ A;  4OPL A;  3II4 A;  1PBE A;  1KNP A;  1PXB A;  2JBV A;  2FBW A;  1F8R A;  1GTH A;  1GV4 A;  1Z6L A;  2OLN A;  2GEW A;  2Q6U A;  4GDP A;  4D03 A;  3AEA A;  4A9W A;  1H83 A;  4H4X A;  1DOB A;  5IQ1 A;  4WX1 A;  4GR1 A;  3EAO A;  5KMS A;  4OVI A;  2XLU A;  1FEA A;  2VRL A;  1PJ7 A;  1GAL A;  4MJW A;  3VRB A;  2WP5 A;  3SZF A;  2X50 A;  2B7S A;  3GD4 A;  2BC1 A;  1NHP A;  4CY6 A;  2BA9 A;  5KVH A;  2B9Y A;  2YM2 A;  2VZ2 A;  1D7Y A;  2GH5 A;  3CGD A;  3GYX A;  1JNZ A;  3G5Q A;  4D04 A;  2Y6Q A;  3LZX A;  1E6E A;  1PBC A;  4II2 A;  5KOW A;  3R9U A;  1N4W A;  3ABV A;  3GD3 A;  3K7M X;  5C3J A;  5KRQ A;  3Q6J A;  3SZ0 A;  1ZOY A;  4LU6 A;  5JCM A;  3GRT A;  2XLS A;  2DKH A;  5LV9 A;  4H7U A;  3BNU A;  1DXL A;  1ZX9 A;  1TDO A;  1DOC A;  3AD8 B;  3NYF A;  4HB9 A;  3RP7 A;  2ARD A;  4XWR A;  2IVD A;  4YWO A;  1DJN A;  4RG4 A;  2WOI A;  3O0H A;  2YR6 A;  3WE0 A;  4EMI A;  4Z26 A;  5KNL A;  1DOE A;  2E4G A;  2XVE A;  3H8I A;  2C76 A;  2ACZ A;  2YWL A;  4GDE A;  5CKU A;  3V3N A;  1EL7 A;  2GF3 A;  2BRA A;  3K7Q X;  3IF9 A;  4A65 A;  4AT2 A;  3UOY A;  2GR2 A;  1REO A;  2ZZ0 A;  1LTX R;  5HXI A;  1TDE A;  4UP3 A;  3GDN A;  2RAB A;  1TDK A;  1XHC A;  4H4R A;  1GER A;  2WES A;  1PS9 A;  1GTE A;  4K5R A;  1PXA A;  3BI4 A;  2YVJ A;  1Q9I A;  4DSH A;  3DGH A;  1LJ1 A;  4YSZ A;  2E5V A;  1YQ3 A;  2YLS A;  2R9Z A;  4CCR A;  1NG3 A;  4U8O A;  4CY8 A;  3QFB A;  3QFA A;  2YG7 A;  3NK2 X;  1CF3 A;  2WDV A;  2XLR A;  1PBB A;  2C67 A;  2GMH A;  4ZCD A;  3UKP A;  1Q1R A;  2C70 A;  4K7Z A;  2PHH A;  4BK2 A;  2JK6 A;  3AE2 A;  2VQB A;  4LII A;  1PJ5 A;  2GR0 A;  3C4N A;  4OPT A;  2F5Z A;  1RP0 A;  3IHG A;  1BZL A;  4YSH A;  1NHS A;  2E1M A;  3AE7 A;  3K7T A;  3ATR A;  4Z25 A;  2R45 A;  1TDF A;  1F8S A;  5J7X A;  4IVM B;  3DJG X;  3UKF A;  3T2K A;  4KX6 A;  3K30 A;  1QLB A;  1S3B A;  4M52 A;  2XLP A;  4APN A;  4C5O A;  1NEN A;  2XYO A;  2AQJ A;  4BJY A;  4YTM A;  2WEU A;  3DA1 A;  2YLT A;  1JNR A;  1N4U A;  2WPE A;  3V76 A;  4U8N A;  2A89 A;  3P4R A;  4I59 A;  2WHD A;  4IVO B;  3T0K A;  1B5Q A;  1RSG A;  1ZKQ A;  4EIP A;  1D7L A;  5DBJ A;  1W4X A;  1S2Y A;  2XVJ A;  3NYE A;  4GCM A;  3AE5 A;  2X8G A;  3OC4 A;  5KMP A;  2QAE A;  3CGE A;  1E1L A;  3D8X A;  2YLX A;  2QCU A;  2BXR A;  4IA6 A;  3AD9 B;  1JEH A;  1H7W A;  1FEB A;  1GEU A;  2C7G A;  4BK1 A;  3UOZ A;  3L1R A;  4EMW A;  2C3C A;  3P4P A;  2BCG G;  4TM1 A;  3AE6 A;  3DH9 A;  4DGK A;  2XFU A;  3SZC A;  1H86 A;  2O9Z A;  4X9M A;  2YLZ A;  2C72 A;  1ZOV A;  1BGN A;  2WU5 A;  3NH3 X;  2BC0 A;  4G9K A;  1B4V A;  4H2R A;  1RYI A;  2I0Z A;  3AXB A;  4JN9 A;  4A6N B;  1BGJ A;  1SEZ A;  1B37 A;  2R0P A;  4C3X A;  2OAL A;  4J57 A;  1EL5 A;  4BUR A;  5IQ4 A;  2YAU A;  4FX9 A;  1GXF A;  3SY4 A;  2NVK X;  2YVG A;  4H4P A;  4ZCC A;  4EQS A;  4YSX A;  1GRT A;  3ICR A;  4TM0 A;  1E1K A;  2WP9 A;  3LB8 A;  2Z5Y A;  2PYX A;  4GRT A;  3KPF A;  2JKC A;  1AOG A;  4YXD A;  4Y4M A;  2EQ7 A;  3CNJ A;  2XVH A;  3GMC A;  4AOS A;  2WS3 A;  3BHK A;  3QVR A;  2WET A;  4Z2U A;  4CBQ A;  2OAM A;  4IV9 A;  1OJA A;  2VVL A;  1O95 A;  1IUX A;  1CC6 A;  3GYJ A;  3FPZ A;  3CPI G;  2B9W A;  3AE4 A;  2OA1 A;  4GAP A;  1YY5 A;  1E39 A;  1GES A;  2XFQ A;  3KVE A;  3NHO X;  4J33 A;  3RHA A;  3LJP A;  4CRT A;  3ALJ A;  2BS2 A;  3UKQ A;  1CHU A;  4USQ A;  1L0V A;  1IUV A;  4TLZ A;  1NHR A;  1NDA A;  4ADW A;  1ZMD A;  4K5S A;  1XAN A;  3Q9T A;  4A99 A;  4C74 A;  1JRX A;  3T37 A;  5CQF A;  5BUK A;  3URH A;  1H6V A;  4JNQ A;  2V60 A;  3NKS A;  2WOV A;  2V6O A;  1MO9 A;  2WQY A;  1ZP0 A;  5U1O A;  3UKA A;  1BWC A;  4C3Y A;  3RNM A;  4OPG A;  4H4Z A;  2R0C A;  1VG0 A;  3SYI A;  1CL0 A;  2C64 A;  4NNJ A;  3UCL A;  4EQX A;  3M0O A;  3UKH A;  4FK1 C;  5EOW A;  1LPF A;  1IUS A;  2YR5 A;  4UDQ A;  1YQ4 A;  1TRB A;  3AYJ A;  1Y0P A;  1DJQ A;  2A8X A;  4UDP A;  2RGH A;  1H7X A;  1PBF A;  4GUV A;  5C2T A;  1KNR A;  1ZMC A;  3EF6 A;  3SQP A;  4EQR A;  1OJT A;  3NIX A;  2GMJ A;  2B9X A;  1VG9 A;  4NEW A;  4ECH A;  1TYP A;  2ZZB A;  1CJ4 A;  2CVJ A;  1CC2 A;  1DOD A;  2GB0 A;  2ZZC A;  3F8P A;  3I3L A;  3ICT A;  1L9E A;  3AEB A;  4X9N A;  4U8M A;  4Z2R A;  5JCN A;  3NN6 X;  2RGJ A;  2X8C A;  2WPF A;  3VR8 A;  2WU2 A;  1E1M A;  1O94 A;  1TYT A;  1VRQ B;  2XCG A;  2WPC A;  4N9X A;  3KKJ A;  2JB1 A;  3P4Q A;  2BK3 A;  3COX A;  3OZ2 A;  1K0I A;  3AEC A;  4ICY A;  4NZH A;  3C96 A;  1M6I A;  3SX6 A;  3T31 A;  5JCK A;  3S5W A;  4H4S A;  3NYC A;  3PS9 A;  1UKV G;  4NEV A;  2BRY A;  2AR8 A;  4J56 A;  4TM3 A;  2C75 A;  4A6N A;  2X99 A;  3I6D A;  4YKF A;  1OJ9 A;  1NPX A;  1B8S A;  1GSN A;  2GRT A;  4YTP A;  3E1T A;  3ICS A;  2GVC A;  3UTF A;  1FOH A;  2VOU A;  2QA1 A;  5KMR A;  1MOK A;  1IJH A;  5FMH A;  3UTG A;  3ALL A;  3GWD A;  4Z24 A;  1KFY A;  3UP5 A;  3CPJ G;  4YTN A;  3FIM B;  2Y6R A;  4NWZ A;  3BNM A;  4AP1 A;  1HYU A;  2Q7V A;  4AOX A;  3UOX A;  4EM3 A;  4NTE A;  1FCD A;  2OLO A;  1BF3 A;  3IC9 A;  3NG7 X;  2R46 A;  4G6H A;  3EAN A;  2C65 A;  4TLX A;  1Y56 A;  1KF6 A;  3M12 A;  4B68 A;  1L9C A;  1L9D A;  5TR3 A;  4A7A A;  3HYX A;  4XWZ A;  4E0V A;  3KLJ A;  3P1W A;  3ZYX A;  1BKW A;  3HYW A;  1LQU A;  2R4J A;  3CTY A;  2BCP A;  3DGZ A;  4B66 A;  3AYI A;  3QSS A;  1CJ2 A;  1NAA A;  1LVL A;  1NEK A;  1P2H A;  3CNT A;  2NPX A;  4OPD A;  3AD7 B;  1GOS A;  2XDO A;  4J36 A;  1Q1W A;  2Q0L A;  1JU2 A;  5BUL A;  3DJJ A;  2BAC A;  3NLC A;  2GQF A;  4U2T A;  5IPY A;  4DNA A;  4USR A;  4JY3 A;  1F8W A;  3RP6 A;  1ZY8 A;  2WP6 A;  4BV6 A;  2YR4 A;  1H81 A;  4JQ9 A;  3UOV A;  4WCT A;  3GWF A;  3ISH A;  4J2W A;  4LA1 A;  1PXC A;  1CJC A;  2J3N A;  1TDN A;  2BS3 A;  3DJD A;  3UKK A;  1P2E A;  1D4D A;  4BK3 A;  5JCI A;  3IHM A;  2YM1 A;  4H4T A;  5EB5 A;  3QJ4 A;  2UZZ A;  5KWF A;  3P4S A;  4FK1 A;  1EL9 A;  3CNP A;  1D4C A;  3FG2 P;  2YVF A;  3HYV A;  2C3D A;  4REK A;  5FS7 A;  3UP4 A;  1FL2 A;  2H88 A;  2VQ7 A;  4AP3 A;  3BI2 A;  3CND A;  2AAQ A;  3B3R A;  2TPR A;  1O5W A;  4YSY A;  4PAB A;  2B7R A;  2IID A;  4OPI A;  5U63 A;  1EBD A;  2CUL A;  4H2P A;  5KOX A;  4PAA A;  1ZK7 A;  2GAH B;  3RED A;  1X31 B;  4Z43 A;  4U8L A;  2R0G A;  3B6D A;  4U8P A;  4CNJ A;  2FJE A;  4H2N A;  1V59 A;  2CFY A;  1GND A;  2QA2 A;  4Y4N A;  2RGO A;  3FMW A;  1K0L A;  3DME A;  1XDI A;  4G6G A;  1JRY A;  3T2Z A;  3SFE A;  4FDC B;  4H4Q A;  1DNC A;  1GT8 A;  3KA7 A;  2EQ9 A;  3LOV A;  4ZN0 A;  4NTD A;  3NT6 A;  2XFN A;  1PHH A;  1JRZ A;  4JNA A;  1OJD A;  4B1B A;  5L46 A;  4Z44 A;  3CGB A;  3AEG A;  5KXJ A;  3ALM A;  3DK4 A;  2YG5 A;  5BVA A;  3QSE A;  2B76 A;  3G5S A;  2BK5 A;  3GMB A;  1N1P A;  3SZW A;  1D4E A;  5M0Z A;  5FS6 A;  1GRH A;  3AE1 A;  5EB4 A;  5GSN A;  1E1N A;  3NN0 X;  2H89 A;  3AYL A;  1IUU A;  3SM8 A;  4BJZ A;  1GRE A;  4A5L A;  2JAE A;  1FEC A;  4EM4 A;  3BI5 A;  1K4Q A;  4H50 A;  1COY A;  5BRT A;  2YLR A;  3VQR A;  2YQU A;  2YLW A;  3AE8 A;  1PN0 A;  3QSM A;  4YT0 A;  2ZBW A;  4H4W A;  2X8H A;  5HYM A;  1ZDL A;  3KPK A;  2XLT A;  5HY5 A;  1JOA A;  3AB1 A;  4TM4 A;  4OCG A;  3D1C A;  2HQM A; 
#chains in the Genus database with same CATH homology
 2Q0K A;  4G73 A;  1PJ6 A;  3UTH A;  3EPT A;  2IVE A;  4RG3 A;  4EQW A;  4Z2T A;  4Y4L A;  3ITJ A;  5J60 A;  3CIR A;  3CN8 A;  3NK0 X;  2V5Z A;  4II3 A;  3SFD A;  1GRG A;  3DJE A;  2WDQ A;  3GRS A;  5FS9 A;  1GRF A;  1ELI A;  2BAB A;  3CPH G;  3F8D A;  5U25 A;  4NTC A;  4B64 A;  5FS8 A;  5EBK A;  1GRA A;  4CCQ A;  1IUW A;  3ATQ A;  1NG4 A;  3UKL A;  4CNK A;  2BYB A;  2XFP A;  2Z5X A;  4JDR A;  1QJD A;  1H84 A;  3HZL A;  1YKJ A;  4X4J A;  1NHQ A;  3SXI A;  4J31 A;  1E7P A;  2C73 A;  4XXG A;  2WDR A;  3JSK A;  3SGL A;  2BK4 A;  3NGC X;  4UDR A;  4U8K A;  2BXS A;  3CNS A;  2XFO A;  4U2S A;  3VR9 A;  2TMD A;  1IUT A;  2GR1 A;  3NTD A;  2XVI A;  3H4K A;  4AT0 A;  2YG4 A;  3BHF A;  2C66 A;  5KMQ A;  1OJC A;  4B65 A;  4IA5 A;  4H4U A;  2GV8 A;  3NRN A;  2WBA A;  2DKI A;  3V3O A;  2EQ8 A;  4O5U A;  3KU9 A;  2V61 A;  3M13 A;  3DK8 A;  4C77 A;  5KVI A;  4H2Q A;  2EQ6 A;  3QVP A;  1QO8 A;  1KDG A;  2BS4 A;  4KPR A;  2VVL G;  1CJ3 A;  3LZW A;  2XVF A;  1F6M A;  1N4V A;  4A79 A;  3FBS A;  4YKG A;  1YQZ A;  3VRD B;  4G74 A;  2X3N A;  4GAV A;  1KSU A;  1CC4 A;  4EIQ A;  2FJB A;  3AED A;  3VRA A;  1VQW A;  2W0H A;  3PO7 A;  3GYI A;  2C4C A;  1GPE A;  1K0J A;  2V3A A;  4U8J A;  3KD9 A;  3H8L A;  3AEF A;  1MXT A;  3NTA A;  2GAG B;  1F3P A;  2A87 A;  4K22 A;  4K2X A;  3CMM A;  4K8D A;  4P9S A;  4B67 A;  1VDC A;  3UTE A;  1PBD A;  1KSS A;  3GDP A;  4I58 A;  4HA6 A;  2APG A;  5HHF A;  1PDH A;  3LXD A;  3DK9 A;  2YG3 A;  5JCL A;  2FJA A;  4B69 A;  1CBO A;  1ONF A;  1H82 A;  4H4Y A;  1EL8 A;  3NK1 X;  4RSL A;  2VVM A;  3AEE A;  3GSI A;  1LV0 A;  3PVC A;  1Y56 B;  1GRB A;  2R4E A;  4H4V A;  3T14 A;  3IWA A;  3LAD A;  3T2Y A;  1M64 A;  2V3B A;  2GR3 A;  2JB2 A;  2JB3 A;  1GET A;  1LQT A;  3C4A A;  2WOW A;  3P9U A;  4JY2 A;  3AWI A;  4B63 A;  2YG6 A;  5M10 A;  3AE3 A;  1S3E A;  3L8K A;  5ER0 A;  3NNE A;  4O5Q A;  5GRT A;  1S2Q A;  3F8R A;  4GF7 A;  1D5T A;  4OPU A;  1XPQ A;  4U8I A;  3RP8 A;  2VRM A;  3ZDN A;  2CDU A;  3CGC A;  3G5R A;  2FJD A;  3ADA B;  4J34 A;  4U2L A;  2GQW A;  3AE9 A;  4DSG A;  4OPC A;  3S61 A;  4EMJ A;  4OPL A;  3II4 A;  1PBE A;  1KNP A;  1PXB A;  2JBV A;  2FBW A;  1F8R A;  1GTH A;  1GV4 A;  1Z6L A;  2OLN A;  2GEW A;  2Q6U A;  4GDP A;  4D03 A;  3AEA A;  4A9W A;  1H83 A;  4H4X A;  1DOB A;  5IQ1 A;  4WX1 A;  4GR1 A;  3EAO A;  5KMS A;  4OVI A;  2XLU A;  1FEA A;  2VRL A;  1PJ7 A;  1GAL A;  4MJW A;  3VRB A;  2WP5 A;  3SZF A;  2X50 A;  2B7S A;  3GD4 A;  2BC1 A;  1NHP A;  4CY6 A;  2BA9 A;  5KVH A;  2B9Y A;  2YM2 A;  2VZ2 A;  1D7Y A;  2GH5 A;  3CGD A;  3GYX A;  1JNZ A;  3G5Q A;  4D04 A;  2Y6Q A;  3LZX A;  1E6E A;  1PBC A;  4II2 A;  5KOW A;  3R9U A;  1N4W A;  3ABV A;  3GD3 A;  3K7M X;  5C3J A;  5KRQ A;  3Q6J A;  3SZ0 A;  1ZOY A;  4LU6 A;  5JCM A;  3GRT A;  2XLS A;  2DKH A;  5LV9 A;  4H7U A;  3BNU A;  1DXL A;  1ZX9 A;  1TDO A;  1DOC A;  3AD8 B;  3NYF A;  4HB9 A;  3RP7 A;  2ARD A;  4XWR A;  2IVD A;  4YWO A;  1DJN A;  4RG4 A;  2WOI A;  3O0H A;  2YR6 A;  3WE0 A;  4EMI A;  4Z26 A;  5KNL A;  1DOE A;  2E4G A;  2XVE A;  3H8I A;  2C76 A;  2ACZ A;  2YWL A;  4GDE A;  5CKU A;  3V3N A;  1EL7 A;  2GF3 A;  2BRA A;  3K7Q X;  3IF9 A;  4A65 A;  4AT2 A;  3UOY A;  2GR2 A;  1REO A;  2ZZ0 A;  1LTX R;  5HXI A;  1TDE A;  4UP3 A;  3GDN A;  2RAB A;  1TDK A;  1XHC A;  4H4R A;  1GER A;  2WES A;  1PS9 A;  1GTE A;  4K5R A;  1PXA A;  3BI4 A;  2YVJ A;  1Q9I A;  4DSH A;  3DGH A;  1LJ1 A;  4YSZ A;  2E5V A;  1YQ3 A;  2YLS A;  2R9Z A;  4CCR A;  1NG3 A;  4U8O A;  4CY8 A;  3QFB A;  3QFA A;  2YG7 A;  3NK2 X;  1CF3 A;  2WDV A;  2XLR A;  1PBB A;  2C67 A;  2GMH A;  4ZCD A;  3UKP A;  1Q1R A;  2C70 A;  4K7Z A;  2PHH A;  4BK2 A;  2JK6 A;  3AE2 A;  2VQB A;  4LII A;  1PJ5 A;  2GR0 A;  3C4N A;  4OPT A;  2F5Z A;  1RP0 A;  3IHG A;  1BZL A;  4YSH A;  1NHS A;  2E1M A;  3AE7 A;  3K7T A;  3ATR A;  4Z25 A;  2R45 A;  1TDF A;  1F8S A;  5J7X A;  4IVM B;  3DJG X;  3UKF A;  3T2K A;  4KX6 A;  3K30 A;  1QLB A;  1S3B A;  4M52 A;  2XLP A;  4APN A;  4C5O A;  1NEN A;  2XYO A;  2AQJ A;  4BJY A;  4YTM A;  2WEU A;  3DA1 A;  2YLT A;  1JNR A;  1N4U A;  2WPE A;  3V76 A;  4U8N A;  2A89 A;  3P4R A;  4I59 A;  2WHD A;  4IVO B;  3T0K A;  1B5Q A;  1RSG A;  1ZKQ A;  4EIP A;  1D7L A;  5DBJ A;  1W4X A;  1S2Y A;  2XVJ A;  3NYE A;  4GCM A;  3AE5 A;  2X8G A;  3OC4 A;  5KMP A;  2QAE A;  3CGE A;  1E1L A;  3D8X A;  2YLX A;  2QCU A;  2BXR A;  4IA6 A;  3AD9 B;  1JEH A;  1H7W A;  1FEB A;  1GEU A;  2C7G A;  4BK1 A;  3UOZ A;  3L1R A;  4EMW A;  2C3C A;  3P4P A;  2BCG G;  4TM1 A;  3AE6 A;  3DH9 A;  4DGK A;  2XFU A;  3SZC A;  1H86 A;  2O9Z A;  4X9M A;  2YLZ A;  2C72 A;  1ZOV A;  1BGN A;  2WU5 A;  3NH3 X;  2BC0 A;  4G9K A;  1B4V A;  4H2R A;  1RYI A;  2I0Z A;  3AXB A;  4JN9 A;  4A6N B;  1BGJ A;  1SEZ A;  1B37 A;  2R0P A;  4C3X A;  2OAL A;  4J57 A;  1EL5 A;  4BUR A;  5IQ4 A;  2YAU A;  4FX9 A;  1GXF A;  3SY4 A;  2NVK X;  2YVG A;  4H4P A;  4ZCC A;  4EQS A;  4YSX A;  1GRT A;  3ICR A;  4TM0 A;  1E1K A;  2WP9 A;  3LB8 A;  2Z5Y A;  2PYX A;  4GRT A;  3KPF A;  2JKC A;  1AOG A;  4YXD A;  4Y4M A;  2EQ7 A;  3CNJ A;  2XVH A;  3GMC A;  4AOS A;  2WS3 A;  3BHK A;  3QVR A;  2WET A;  4Z2U A;  4CBQ A;  2OAM A;  4IV9 A;  1OJA A;  2VVL A;  1O95 A;  1IUX A;  1CC6 A;  3GYJ A;  3FPZ A;  3CPI G;  2B9W A;  3AE4 A;  2OA1 A;  4GAP A;  1YY5 A;  1E39 A;  1GES A;  2XFQ A;  3KVE A;  3NHO X;  4J33 A;  3RHA A;  3LJP A;  4CRT A;  3ALJ A;  2BS2 A;  3UKQ A;  1CHU A;  4USQ A;  1L0V A;  1IUV A;  4TLZ A;  1NHR A;  1NDA A;  4ADW A;  1ZMD A;  4K5S A;  1XAN A;  3Q9T A;  4A99 A;  4C74 A;  1JRX A;  3T37 A;  5CQF A;  5BUK A;  3URH A;  1H6V A;  4JNQ A;  2V60 A;  3NKS A;  2WOV A;  2V6O A;  1MO9 A;  2WQY A;  1ZP0 A;  5U1O A;  3UKA A;  1BWC A;  4C3Y A;  3RNM A;  4OPG A;  4H4Z A;  2R0C A;  1VG0 A;  3SYI A;  1CL0 A;  2C64 A;  4NNJ A;  3UCL A;  4EQX A;  3M0O A;  3UKH A;  4FK1 C;  5EOW A;  1LPF A;  1IUS A;  2YR5 A;  4UDQ A;  1YQ4 A;  1TRB A;  3AYJ A;  1Y0P A;  1DJQ A;  2A8X A;  4UDP A;  2RGH A;  1H7X A;  1PBF A;  4GUV A;  5C2T A;  1KNR A;  1ZMC A;  3EF6 A;  3SQP A;  4EQR A;  1OJT A;  3NIX A;  2GMJ A;  2B9X A;  1VG9 A;  4NEW A;  4ECH A;  1TYP A;  2ZZB A;  1CJ4 A;  2CVJ A;  1CC2 A;  1DOD A;  2GB0 A;  2ZZC A;  3F8P A;  3I3L A;  3ICT A;  1L9E A;  3AEB A;  4X9N A;  4U8M A;  4Z2R A;  5JCN A;  3NN6 X;  2RGJ A;  2X8C A;  2WPF A;  3VR8 A;  2WU2 A;  1E1M A;  1O94 A;  1TYT A;  1VRQ B;  2XCG A;  2WPC A;  4N9X A;  3KKJ A;  2JB1 A;  3P4Q A;  2BK3 A;  3COX A;  3OZ2 A;  1K0I A;  3AEC A;  4ICY A;  4NZH A;  3C96 A;  1M6I A;  3SX6 A;  3T31 A;  5JCK A;  3S5W A;  4H4S A;  3NYC A;  3PS9 A;  1UKV G;  4NEV A;  2BRY A;  2AR8 A;  4J56 A;  4TM3 A;  2C75 A;  4A6N A;  2X99 A;  3I6D A;  4YKF A;  1OJ9 A;  1NPX A;  1B8S A;  1GSN A;  2GRT A;  4YTP A;  3E1T A;  3ICS A;  2GVC A;  3UTF A;  1FOH A;  2VOU A;  2QA1 A;  5KMR A;  1MOK A;  1IJH A;  5FMH A;  3UTG A;  3ALL A;  3GWD A;  4Z24 A;  1KFY A;  3UP5 A;  3CPJ G;  4YTN A;  3FIM B;  2Y6R A;  4NWZ A;  3BNM A;  4AP1 A;  1HYU A;  2Q7V A;  4AOX A;  3UOX A;  4EM3 A;  4NTE A;  1FCD A;  2OLO A;  1BF3 A;  3IC9 A;  3NG7 X;  2R46 A;  4G6H A;  3EAN A;  2C65 A;  4TLX A;  1Y56 A;  1KF6 A;  3M12 A;  4B68 A;  1L9C A;  1L9D A;  5TR3 A;  4A7A A;  3HYX A;  4XWZ A;  4E0V A;  3KLJ A;  3P1W A;  3ZYX A;  1BKW A;  3HYW A;  1LQU A;  2R4J A;  3CTY A;  2BCP A;  3DGZ A;  4B66 A;  3AYI A;  3QSS A;  1CJ2 A;  1NAA A;  1LVL A;  1NEK A;  1P2H A;  3CNT A;  2NPX A;  4OPD A;  3AD7 B;  1GOS A;  2XDO A;  4J36 A;  1Q1W A;  2Q0L A;  1JU2 A;  5BUL A;  3DJJ A;  2BAC A;  3NLC A;  2GQF A;  4U2T A;  5IPY A;  4DNA A;  4USR A;  4JY3 A;  1F8W A;  3RP6 A;  1ZY8 A;  2WP6 A;  4BV6 A;  2YR4 A;  1H81 A;  4JQ9 A;  3UOV A;  4WCT A;  3GWF A;  3ISH A;  4J2W A;  4LA1 A;  1PXC A;  1CJC A;  2J3N A;  1TDN A;  2BS3 A;  3DJD A;  3UKK A;  1P2E A;  1D4D A;  4BK3 A;  5JCI A;  3IHM A;  2YM1 A;  4H4T A;  5EB5 A;  3QJ4 A;  2UZZ A;  5KWF A;  3P4S A;  4FK1 A;  1EL9 A;  3CNP A;  1D4C A;  3FG2 P;  2YVF A;  3HYV A;  2C3D A;  4REK A;  5FS7 A;  3UP4 A;  1FL2 A;  2H88 A;  2VQ7 A;  4AP3 A;  3BI2 A;  3CND A;  2AAQ A;  3B3R A;  2TPR A;  1O5W A;  4YSY A;  4PAB A;  2B7R A;  2IID A;  4OPI A;  5U63 A;  1EBD A;  2CUL A;  4H2P A;  5KOX A;  4PAA A;  1ZK7 A;  2GAH B;  3RED A;  1X31 B;  4Z43 A;  4U8L A;  2R0G A;  3B6D A;  4U8P A;  4CNJ A;  2FJE A;  4H2N A;  1V59 A;  2CFY A;  1GND A;  2QA2 A;  4Y4N A;  2RGO A;  3FMW A;  1K0L A;  3DME A;  1XDI A;  4G6G A;  1JRY A;  3T2Z A;  3SFE A;  4FDC B;  4H4Q A;  1DNC A;  1GT8 A;  3KA7 A;  2EQ9 A;  3LOV A;  4ZN0 A;  4NTD A;  3NT6 A;  2XFN A;  1PHH A;  1JRZ A;  4JNA A;  1OJD A;  4B1B A;  5L46 A;  4Z44 A;  3CGB A;  3AEG A;  5KXJ A;  3ALM A;  3DK4 A;  2YG5 A;  5BVA A;  3QSE A;  2B76 A;  3G5S A;  2BK5 A;  3GMB A;  1N1P A;  3SZW A;  1D4E A;  5M0Z A;  5FS6 A;  1GRH A;  3AE1 A;  5EB4 A;  5GSN A;  1E1N A;  3NN0 X;  2H89 A;  3AYL A;  1IUU A;  3SM8 A;  4BJZ A;  1GRE A;  4A5L A;  2JAE A;  1FEC A;  4EM4 A;  3BI5 A;  1K4Q A;  4H50 A;  1COY A;  5BRT A;  2YLR A;  3VQR A;  2YQU A;  2YLW A;  3AE8 A;  1PN0 A;  3QSM A;  4YT0 A;  2ZBW A;  4H4W A;  2X8H A;  5HYM A;  1ZDL A;  3KPK A;  2XLT A;  5HY5 A;  1JOA A;  3AB1 A;  4TM4 A;  4OCG A;  3D1C A;  2HQM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...