1CL0A

Crystal structure of reduced thioredoxin reductase from escherichia coli.
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
316
structure length
316
Chain Sequence
GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title Crystal structure of reduced thioredoxin reductase from Escherichia coli: structural flexibility in the isoalloxazine ring of the flavin adenine dinucleotide cofactor.
pubmed rcsb
source organism Escherichia coli
total genus 97
structure length 316
sequence length 316
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 1999-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1cl0A01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1cl0A02
1JOAA 4H4PA 1TDOA 2EQ9A 2GAGB 4TM1A 2YQUA 1VDCA 2BK4A 1IUTA 2WOVA 2YG5A 3P4SA 1IUXA 4APNA 1MOKA 1Y0PA 4FDCB 5HHFA 1ZMDA 3B6DA 2C66A 4EM4A 3ZDNA 2YVFA 4M52A 2PHHA 1GV4A 2X8GA 4YKGA 4EIQA 1PBEA 4EQRA 3UKLA 2YG7A 2FJAA 4YTPA 1COYA 2FJDA 4PAAA 1FCDA 3CNTA 4EQSA 4U2TA 3DMEA 1VQWA 3T37A 1CJ3A 2XLTA 1KSUA 1P2HA 3ABVA 4LIIA 1K0LA 1ZX9A 3CNPA 4N9XA 2FJBA 1NHQA 1GSNA 3P4PA 4H4UA 4A79A 4OPIA 3F8PA 3GYJA 1EBDA 3I6DA 1GRFA 1D7LA 5KOWA 5L46A 3VR9A 5LV9A 4ZCCA 3H8IA 1XDIA 1RP0A 1X31B 4H2NA 4TLXA 3RNMA 3AEFA 2XFPA 4CRTA 2XVEA 2XLUA 2YG3A 2WESA 4YTNA 2C65A 4YSXA 2OA1A 4K2XA 4DSGA 2X8CA 1FEAA 4H4WA 1TYPA 2AQJA 1OJDA 2GH5A 2XLSA 1TDEA 2EQ8A 2OAMA 3C96A 4J36A 4IA6A 3UOYA 3UKQA 5BUKA 3BNMA 1ZP0A 1H7WA 1DJQA 1PDHA 2DKHA 1F8WA 5FS6A 4CNJA 2VOUA 5BRTA 2C76A 1BGJA 4Z2UA 5EB4A 4ADWA 2JK6A 1PS9A 2E5VA 2OLOA 2R4JA 2X3NA 4A6NB 3NK2X 1B8SA 4RG4A 3KVEA 1S2YA 2Y6QA 3M12A 2YG4A 5KXJA 4XXGA 1LJ1A 1DOBA 4D04A 3UKAA 1CC2A 3BI4A 3UKKA 3AE6A 2YM2A 3AEDA 1V59A 3UKPA 2JAEA 3ALLA 4NEVA 4OPGA 1PJ5A 3BNUA 2OLNA 3GRTA 3UOXA 4H2PA 1ZOVA 1E1MA 4X9MA 2TMDA 2XVIA 1OJTA 3QSEA 3K7TA 4O5QA 1JNZA 5DBJA 4J31A 2VVMA 1GOSA 1L9EA 2JB1A 3GD4A 4GCMA 3Q6JA 4KX6A 1HYUA 1B37A 3PS9A 3V3NA 4AP3A 2A87A 2ZBWA 1S3BA 1NAAA 5U25A 4DGKA 5KOXA 3EAOA 5FMHA 1VG9A 2QCUA 2WS3A 3DH9A 4J33A 3NYFA 5U63A 3AE4A 5HY5A 5BVAA 4A65A 4JNAA 4J56A 2FJEA 2GEWA 3DGHA 4H4QA 3OC4A 4I58A 1PBFA 1K0JA 1QO8A 4NTCA 2C75A 3UOVA 3I3LA 1KDGA 2YM1A 3UCLA 2BC0A 1PJ6A 2X50A 4B67A 1H84A 3BHKA 2RGHA 4U8JA 3UTGA 4TM4A 2V5ZA 1TDNA 4H7UA 1H81A 2Q0LA 5HXIA 1VG0A 1W4XA 3GWFA 5U1OA 2RABA 3URHA 4YT0A 2YR6A 2H89A 1CC4A 1GT8A 3DJGX 2YR5A 3IHMA 1PBDA 2YVGA 4DNAA 4J2WA 4H4VA 4OPUA 2XVJA 3RP7A 2B9YA 4FK1C 1ZOYA 2R0GA 2V6OA 2EQ7A 1EL5A 2Z5XA 3KKJA 3KPFA 5JCMA 2Q7VA 2BK5A 1PHHA 1DNCA 3DJEA 2GF3A 1BF3A 1GNDA 3LB8A 2WDQA 3IHGA 1EL7A 4EIPA 2RGJA 1SEZA 1PJ7A 3GRSA 3LJPA 3S61A 2WPFA 3FBSA 3UKHA 1QJDA 2R9ZA 3SFDA 4AT2A 1REOA 2XFUA 3P9UA 3DGZA 1KSSA 3AE3A 3OZ2A 3QJ4A 4GR1A 2XYOA 3ICSA 4USQA 2CVJA 4AP1A 3NK1X 1PBBA 4OCGA 1K0IA 1BZLA 1IUVA 5CKUA 3HZLA 1BKWA 1FECA 1NHRA 3CNSA 3S5WA 4H4TA 4A5LA 3VRDB 2BXSA 2R0CA 4X4JA 3CNJA 4TLZA 3WE0A 2X99A 3GYIA 1H6VA 3ICRA 1F8SA 2BCGG 1ZKQA 4K8DA 4BK3A 3AD8B 3AE8A 1E1KA 1GXFA 1B4VA 3IWAA 2B76A 2XVHA 1GTHA 2WOWA 4H4XA 1ZK7A 2C7GA 2JB3A 3CN8A 2GV8A 3NRNA 1JNRA 1ZDLA 1CBOA 3BI2A 4U2LA 3KU9A 4EMIA 1PXBA 2VRMA 1D4CA 1XPQA 2BACA 4WCTA 3AE9A 4CY8A 4IVOB 4JN9A 2ZZBA 2C67A 1E39A 3GSIA 4ZN0A 1ZY8A 3NG7X 3AXBA 2YLZA 2R46A 3JSKA 3CNDA 4H4SA 1JEHA 2XFOA 2F5ZA 2E4GA 3AEBA 1H7XA 4OPDA 1E1NA 4C74A 2A8XA 2CULA 3DA1A 3II4A 1LQTA 3NK0X 5KVIA 1JU2A 1IJHA 4I59A 3O0HA 2HQMA 5GSNA 1DOCA 4RSLA 1N4VA 4ECHA 4IA5A 2BS2A 4Z43A 3G5RA 2GR3A 5C2TA 2VQBA 2BABA 4WX1A 2WP9A 5EOWA 5JCKA 4XWRA 1TDKA 4U8NA 1E1LA 3SGLA 1JRXA 2AAQA 3VR8A 2GVCA 1NDAA 2C3CA 4U8MA 3NTAA 5GRTA 1EL9A 1RSGA 1MXTA 3AECA 3LADA 3EANA 2YVJA 1XANA 1GRGA 3ICTA 4H50A 4ICYA 4H2RA 1UKVG 3VRBA 3V3OA 2B7SA 3D8XA 4TM0A 4HB9A 3AEGA 2C73A 1DXLA 4Y4LA 3NN6X 4A9WA 2WDRA 1KF6A 3QSMA 5BULA 3NN0X 3F8DA 4FK1A 4BV6A 2VRLA 3K7MX 3AD9B 4LA1A 3REDA 1FL2A 4J57A 1F8RA 4GF7A 4CNKA 3QFBA 4Z2RA 2C70A 4NTDA 2AR8A 4FX9A 5FS7A 2BS3A 4JY2A 3SFEA 1L9DA 4K22A 4Z2TA 3CGCA 3AEAA 1N1PA 3CGDA 3AYLA 3ALMA 3GMBA 1GRHA 2R45A 3UP5A 4U8IA 2XCGA 1L0VA 4B1BA 2XLPA 2WETA 2WOIA 4YSYA 3P1WA 4NTEA 5FS9A 2BCPA 3RP8A 4DSHA 2B7RA 3UKFA 4D03A 3P4QA 4NEWA 1GALA 3EPTA 3PO7A 2WP5A 3AE7A 4H2QA 4YTMA 1YQZA 2GQWA 3AE1A 5M0ZA 1M64A 2GMHA 1GRAA 2GQFA 2WPCA 4UDRA 5KVHA 2E1MA 1GEUA 2EQ6A 4JY3A 3IC9A 4YXDA 3AB1A 4J34A 1D7YA 2GR1A 3AE2A 2QA1A 2NVKX 3CPIG 3M0OA 5C3JA 3RHAA 2WU2A 1QLBA 1Z6LA 3NKSA 1PXCA 4REKA 5J60A 3UTHA 1PBCA 4BJZA 2ACZA 1N4UA 3AE5A 3M13A 1S3EA 1CJ2A 3F8RA 4IV9A 2FBWA 1ONFA 4Z24A 1IUUA 4OPTA 3L8KA 2YR4A 1E6EA 4C77A 1L9CA 2C64A 3QVPA 1VRQB 1DJNA 2BYBA 4UP3A 3QFAA 1KNPA 3RP6A 2ZZCA 4A7AA 3UOZA 3ZYXA 1CL0A 1B5QA 2XLRA 2YLRA 1GETA 2CDUA 3KA7A 1NENA 4JNQA 4Y4NA 2YWLA 3GWDA 3QSSA 4H4ZA 1Y56A 1YQ3A 5JCLA 4CCQA 5FS8A 2XFQA 1E7PA 2V3BA 2VQ7A 3H4KA 1YKJA 1CC6A 1GPEA 3NHOX 4OVIA 1GESA 1GTEA 1OJAA 2GR2A 1K4QA 3E1TA 2IVEA 4C5OA 3NGCX 1AOGA 4YKFA 4CBQA 2C72A 2Y6RA 4AOXA 2GB0A 1H83A 1EL8A 1ELIA 4H4YA 3VQRA 1RYIA 2BS4A 4K5RA 4BJYA 3ISHA 1D4EA 1TYTA 1DODA 3GDPA 4GRTA 1F3PA 3VRAA 3L1RA 1CF3A 1IUSA 4E0VA 2YLTA 2Z5YA 3G5QA 2B9WA 1JRYA 2JB2A 3CGBA 4OPLA 2V60A 4HA6A 2I0ZA 2GMJA 1D5TA 3NH3X 3CIRA 3NT6A 2BK3A 4OPCA 1PXAA 1Q9IA 1GREA 4EMJA 2PYXA 4GUVA 1O94A 3FG2P 1BWCA 1CJ4A 2GRTA 1F6MA 3ATRA 1OJ9A 3AYJA 2O9ZA 4Z26A 1ZMCA 3FMWA 1NHPA 1TDFA 3AWIA 3DK4A 4AOSA 3AD7B 4U8KA 3BI5A 4AT0A 3UTFA 3D1CA 2WDVA 3DK8A 3ITJA 3NLCA 4PABA 3R9UA 5IPYA 1M6IA 4USRA 5IQ4A 1JRZA 3NIXA 3SQPA 3CTYA 1S2QA 5KRQA 2IVDA 2XVFA 3COXA 3GD3A 3V76A 3CPHG 2XFNA 4KPRA 3DK9A 2NPXA 5EBKA 5J7XA 1PN0A 4Z44A 3P4RA 3GDNA 2OALA 2VVLG 4A99A 5HYMA 2UZZA 3QVRA 3NTDA 2IIDA 1NPXA 2BC1A 1FOHA 4U8LA 4P9SA 5KWFA 1KFYA 4JQ9A 2BXRA 3K30A 4RG3A 2GAHB 3ATQA 2YLSA 1Y56B 3CGEA 4X9NA 5EB5A 2BA9A 4XWZA 1GRBA 4U8OA 3Q9TA 4BURA 2QAEA 4EMWA 1TRBA 3IF9A 5ER0A 3ADAB 4EQWA 2WHDA 1P2EA 2WQYA 4U2SA 4K5SA 4EQXA 1DOEA 4YSHA 1YQ4A 4YWOA 4CY6A 3ALJA 4BK2A 2WBAA 2DKIA 4JDRA 4O5UA 4Z25A 1IUWA 4UDPA 3CPJG 1KNRA 1LPFA 4B63A 2W0HA 2YLXA 4GDEA 2V3AA 1D4DA 2V61A 1NG3A 4ZCDA 4B65A 2YG6A 4YSZA 2J3NA 1O95A 1YY5A 3NYCA 1CHUA 2WP6A 3NYEA 4H4RA 5TR3A 2WEUA 4CCRA 2Q0KA 4B64A 2JBVA 3PVCA 4Y4MA 1OJCA 2CFYA 2Q6UA 2C3DA 2WPEA 3G5SA 4TM3A 3LZXA 2JKCA 2QA2A 3FIMB 4BK1A 2ZZ0A 2A89A 4UDQA 1LV0A 2ARDA 4B69A 3C4NA 4B66A 1FEBA 2VVLA 5JCNA 2APGA 2H88A 3B3RA 4IVMB 2XDOA 1LVLA 1LTXR 3SM8A 1N4WA 2X8HA 5M10A 1Q1WA 4C3YA 3AYIA 4A6NA 3DJDA 1O5WA 2RGOA 5JCIA 4B68A 3BHFA 1H86A 4C3XA 3DJJA 3NNEA 1NG4A 2GR0A 3K7QX 2B9XA 1H82A 1NHSA 4NZHA 3GMCA 3LXDA 2TPRA 2YAUA 3C4AA 4GDPA 4U8PA 1LQUA 2R4EA 5CQFA 2R0PA 2WU5A 3LZWA 3H8LA 1BGNA 4K7ZA 1Q1RA 2YLWA 3FPZA 5IQ1A 1MO9A 1NEKA 3UTEA 1GRTA 3KLJA 4LU6A 3AEEA 2VZ2A 1XHCA 3UP4A 3KD9A 4EM3A 3EF6A 4MJWA 1CJCA 3LOVA 1GERA
chains in the Genus database with same CATH superfamily
1JOAA 4H4PA 1TDOA 2BRYA 2EQ9A 2GAGB 4TM1A 2YQUA 1VDCA 2BK4A 1IUTA 2WOVA 2YG5A 3P4SA 1IUXA 4APNA 1MOKA 1Y0PA 4FDCB 5HHFA 1ZMDA 3B6DA 2C66A 4EM4A 3ZDNA 2YVFA 4M52A 2PHHA 1GV4A 2X8GA 4YKGA 4EIQA 1PBEA 4EQRA 3UKLA 2YG7A 2FJAA 4YTPA 1COYA 2FJDA 4PAAA 1FCDA 3CNTA 4EQSA 4U2TA 3DMEA 1VQWA 3T37A 1CJ3A 2XLTA 1KSUA 1P2HA 3ABVA 4LIIA 1K0LA 1ZX9A 3CNPA 4N9XA 2FJBA 1NHQA 1GSNA 3P4PA 4H4UA 4II2A 4A79A 4OPIA 3F8PA 3GYJA 1EBDA 3I6DA 3T14A 1GRFA 1D7LA 5KOWA 5L46A 3VR9A 5LV9A 4ZCCA 3H8IA 1XDIA 1RP0A 1X31B 4H2NA 4TLXA 3RNMA 3AEFA 2XFPA 4CRTA 2XVEA 2XLUA 2YG3A 2WESA 4YTNA 2C65A 4YSXA 2OA1A 4K2XA 4DSGA 2X8CA 1FEAA 4H4WA 1TYPA 2AQJA 1OJDA 2GH5A 2XLSA 1TDEA 2EQ8A 2OAMA 3C96A 4J36A 4IA6A 3UOYA 3UKQA 5BUKA 3BNMA 1ZP0A 1H7WA 1DJQA 1PDHA 2DKHA 1F8WA 5FS6A 4CNJA 2VOUA 5BRTA 2C76A 1BGJA 4Z2UA 5EB4A 4ADWA 2JK6A 1PS9A 2E5VA 2OLOA 2R4JA 2X3NA 4A6NB 3NK2X 1B8SA 4RG4A 3KVEA 1S2YA 2Y6QA 3M12A 2YG4A 5KXJA 4XXGA 1LJ1A 3SZFA 1DOBA 4D04A 3UKAA 1CC2A 3BI4A 3UKKA 3AE6A 2YM2A 3AEDA 1V59A 3UKPA 2JAEA 3ALLA 4NEVA 4OPGA 1PJ5A 3BNUA 2OLNA 3GRTA 3UOXA 4H2PA 1ZOVA 1E1MA 4X9MA 2TMDA 2XVIA 1OJTA 3QSEA 3K7TA 4O5QA 1JNZA 5DBJA 4J31A 2VVMA 1GOSA 1L9EA 2JB1A 3GD4A 4GCMA 3Q6JA 4KX6A 1HYUA 1B37A 3PS9A 3V3NA 4AP3A 2A87A 2ZBWA 1S3BA 1NAAA 5U25A 4DGKA 5KOXA 3EAOA 5FMHA 1VG9A 2QCUA 2WS3A 3DH9A 4J33A 3NYFA 5U63A 3AE4A 5HY5A 5BVAA 4A65A 4JNAA 4J56A 2FJEA 2GEWA 3DGHA 4H4QA 3OC4A 4I58A 1PBFA 1K0JA 1QO8A 4NTCA 2C75A 3UOVA 3I3LA 1KDGA 2YM1A 3UCLA 2BC0A 1PJ6A 5KMQA 2X50A 4B67A 1H84A 3BHKA 2RGHA 4U8JA 3UTGA 4TM4A 2V5ZA 1TDNA 4H7UA 1H81A 2Q0LA 5HXIA 1VG0A 1W4XA 3GWFA 5U1OA 2RABA 3URHA 4YT0A 2YR6A 2H89A 4YSZA 1CC4A 1GT8A 3DJGX 2YR5A 3IHMA 1PBDA 2YVGA 4DNAA 4J2WA 4H4VA 4OPUA 2XVJA 3RP7A 2B9YA 4FK1C 1ZOYA 2R0GA 2V6OA 2EQ7A 1EL5A 2Z5XA 3KKJA 3KPFA 5JCMA 2Q7VA 2BK5A 1PHHA 1DNCA 3DJEA 2GF3A 1BF3A 1GNDA 3LB8A 2WDQA 3IHGA 1EL7A 4EIPA 2RGJA 1SEZA 1PJ7A 3GRSA 3LJPA 3S61A 2WPFA 3FBSA 3UKHA 1QJDA 2R9ZA 3SFDA 4AT2A 1REOA 2XFUA 3P9UA 3DGZA 1KSSA 3AE3A 3OZ2A 4G9KA 3QJ4A 4GR1A 2XYOA 3ICSA 4USQA 2CVJA 4AP1A 3NK1X 1PBBA 4OCGA 1K0IA 1BZLA 1IUVA 5CKUA 3HYXA 3HZLA 1BKWA 1FECA 1NHRA 3CNSA 3HYVA 4H4TA 3S5WA 4A5LA 3VRDB 5KMPA 2BXSA 2R0CA 4X4JA 3CNJA 4TLZA 3WE0A 2X99A 3GYIA 1H6VA 3ICRA 1F8SA 2BCGG 1ZKQA 4K8DA 4BK3A 3AD8B 3AE8A 1E1KA 1GXFA 1B4VA 3IWAA 2B76A 2XVHA 1GTHA 2WOWA 4H4XA 1ZK7A 2C7GA 2JB3A 3CN8A 2GV8A 3NRNA 1JNRA 1ZDLA 1CBOA 3BI2A 4U2LA 3KU9A 4EMIA 1PXBA 2VRMA 1D4CA 1XPQA 2BACA 4WCTA 3AE9A 4CY8A 4IVOB 4JN9A 2ZZBA 3SY4A 2C67A 1E39A 3GSIA 4ZN0A 1ZY8A 3NG7X 3AXBA 2YLZA 2R46A 3JSKA 3CNDA 4H4SA 1JEHA 2XFOA 2F5ZA 2E4GA 3AEBA 1H7XA 4OPDA 1E1NA 4C74A 2A8XA 2CULA 3DA1A 3II4A 1LQTA 3NK0X 4II3A 5KVIA 1JU2A 1IJHA 4I59A 3O0HA 2HQMA 5GSNA 1DOCA 4RSLA 1N4VA 4ECHA 4IA5A 2BS2A 3SXIA 4Z43A 3G5RA 2GR3A 5C2TA 2VQBA 2BABA 4WX1A 2WP9A 5EOWA 5JCKA 4XWRA 1TDKA 4U8NA 1E1LA 3SGLA 1JRXA 2AAQA 3VR8A 2GVCA 1NDAA 2C3CA 4U8MA 3NTAA 5GRTA 1EL9A 1RSGA 1MXTA 3AECA 3LADA 3EANA 2YVJA 1XANA 1GRGA 3ICTA 4H50A 4ICYA 4H2RA 1UKVG 3VRBA 3V3OA 2B7SA 3D8XA 4TM0A 4G6GA 3T2KA 4HB9A 3AEGA 2C73A 1DXLA 4NWZA 4Y4LA 3NN6X 4A9WA 2WDRA 1KF6A 3QSMA 5BULA 3NN0X 3F8DA 4FK1A 4BV6A 2VRLA 3K7MX 3AD9B 4LA1A 3REDA 1FL2A 4J57A 1F8RA 4GF7A 4CNKA 3QFBA 4Z2RA 2C70A 4NTDA 2AR8A 4FX9A 5FS7A 2BS3A 4JY2A 3SFEA 1L9DA 4K22A 4Z2TA 3CGCA 3AEAA 1N1PA 3CGDA 3AYLA 3ALMA 3GMBA 1GRHA 2R45A 3T2YA 3UP5A 5KMRA 4U8IA 2XCGA 1L0VA 4B1BA 2XLPA 2WETA 2WOIA 4YSYA 3P1WA 4NTEA 5FS9A 2BCPA 3RP8A 4DSHA 2B7RA 3UKFA 4D03A 3P4QA 4NEWA 1GALA 3EPTA 3PO7A 2WP5A 3AE7A 4H2QA 4YTMA 1YQZA 2GQWA 3AE1A 5M0ZA 4NNJA 1M64A 2GMHA 1GRAA 2GQFA 2WPCA 4UDRA 5KVHA 2E1MA 1GEUA 2EQ6A 4JY3A 3IC9A 4YXDA 3AB1A 4J34A 1D7YA 2GR1A 3AE2A 2QA1A 2NVKX 3CPIG 3M0OA 5C3JA 4G74A 3RHAA 2WU2A 1QLBA 1Z6LA 3NKSA 1PXCA 4REKA 5J60A 3UTHA 4G6HA 1PBCA 4BJZA 2ACZA 3KPKA 1N4UA 3AE5A 3M13A 1S3EA 1CJ2A 3F8RA 4IV9A 2FBWA 1ONFA 4Z24A 1IUUA 4OPTA 3L8KA 2YR4A 1E6EA 4C77A 1L9CA 2C64A 3QVPA 1VRQB 1DJNA 3SZWA 2BYBA 3SZ0A 4UP3A 3QFAA 1KNPA 3RP6A 2ZZCA 4A7AA 3UOZA 3ZYXA 1CL0A 1B5QA 2XLRA 2YLRA 1GETA 2CDUA 3KA7A 1NENA 4JNQA 4Y4NA 2YWLA 3GWDA 3QSSA 4H4ZA 1Y56A 1YQ3A 5JCLA 4CCQA 5FS8A 2XFQA 1E7PA 2V3BA 2VQ7A 3H4KA 4G73A 3T31A 1YKJA 1CC6A 1GPEA 3NHOX 4OVIA 1GESA 1GTEA 1OJAA 2GR2A 1K4QA 3E1TA 3CMMA 2IVEA 4C5OA 3NGCX 1AOGA 4YKFA 4CBQA 2C72A 2Y6RA 4AOXA 2GB0A 1H83A 1EL8A 1ELIA 4H4YA 3VQRA 1RYIA 2BS4A 4K5RA 4BJYA 3ISHA 1D4EA 1TYTA 1DODA 3GDPA 4GRTA 1F3PA 3VRAA 3L1RA 1CF3A 1IUSA 4E0VA 2YLTA 2Z5YA 3G5QA 2B9WA 1JRYA 2JB2A 3CGBA 4OPLA 2V60A 4HA6A 2I0ZA 2GMJA 1D5TA 3NH3X 3CIRA 3NT6A 2BK3A 3T0KA 4OPCA 1PXAA 1Q9IA 1GREA 4EMJA 2PYXA 4GUVA 1O94A 3GYXA 3FG2P 1BWCA 1CJ4A 2GRTA 1F6MA 3ATRA 1OJ9A 3AYJA 2O9ZA 4Z26A 1ZMCA 3FMWA 1NHPA 1TDFA 3AWIA 3DK4A 4AOSA 3AD7B 4U8KA 3BI5A 4AT0A 3UTFA 3D1CA 2WDVA 3DK8A 3ITJA 3NLCA 4PABA 3R9UA 5IPYA 1M6IA 4USRA 5IQ4A 1JRZA 3NIXA 3SQPA 4GAVA 3CTYA 1S2QA 5KRQA 2IVDA 2XVFA 3COXA 3GD3A 3T2ZA 3V76A 3CPHG 2XFNA 4KPRA 3DK9A 2NPXA 5EBKA 5J7XA 1PN0A 4Z44A 3P4RA 3GDNA 2OALA 2VVLG 4A99A 5HYMA 2UZZA 3QVRA 3NTDA 2IIDA 1NPXA 2BC1A 1FOHA 4U8LA 4P9SA 5KWFA 1KFYA 4JQ9A 2BXRA 3K30A 3SZCA 4RG3A 2GAHB 3ATQA 2YLSA 1Y56B 3CGEA 4X9NA 5EB5A 2BA9A 4XWZA 1GRBA 4U8OA 3Q9TA 4BURA 2QAEA 4EMWA 1TRBA 3HYWA 3IF9A 5ER0A 3ADAB 4EQWA 2WHDA 1P2EA 2WQYA 4U2SA 4K5SA 4EQXA 1DOEA 4YSHA 1YQ4A 4YWOA 4CY6A 3ALJA 4BK2A 2WBAA 2DKIA 4JDRA 4O5UA 4Z25A 1IUWA 4UDPA 3CPJG 1KNRA 1LPFA 4B63A 2W0HA 2YLXA 4GDEA 2V3AA 1D4DA 2C4CA 1NG3A 2V61A 4ZCDA 2YG6A 4B65A 2J3NA 1O95A 1YY5A 3NYCA 1CHUA 2WP6A 3NYEA 4H4RA 5TR3A 2WEUA 4CCRA 2Q0KA 4B64A 2JBVA 3PVCA 4Y4MA 1OJCA 2CFYA 2Q6UA 2C3DA 2WPEA 4GAPA 5KNLA 3G5SA 4TM3A 3LZXA 3SX6A 2JKCA 2BRAA 2QA2A 3FIMB 4BK1A 2ZZ0A 5KMSA 2A89A 4UDQA 1LV0A 2ARDA 4B69A 3C4NA 4B66A 1FEBA 2VVLA 5JCNA 2APGA 2H88A 3B3RA 4IVMB 2XDOA 1LVLA 1LTXR 3SM8A 1N4WA 2X8HA 5M10A 1Q1WA 4C3YA 3AYIA 4A6NA 3DJDA 1O5WA 2RGOA 5JCIA 4B68A 3BHFA 1H86A 4C3XA 3DJJA 3NNEA 1NG4A 2GR0A 3K7QX 2B9XA 1H82A 1NHSA 4NZHA 3GMCA 3LXDA 2TPRA 2YAUA 3C4AA 4GDPA 4U8PA 1LQUA 2R4EA 5CQFA 2R0PA 2WU5A 3LZWA 3H8LA 1BGNA 4K7ZA 1Q1RA 2YLWA 3FPZA 5IQ1A 1MO9A 1NEKA 3UTEA 1GRTA 3KLJA 4LU6A 3AEEA 2VZ2A 1XHCA 3UP4A 3KD9A 3SYIA 4EM3A 3EF6A 4MJWA 1CJCA 3LOVA 1GERA
chains in the Genus database with same CATH topology
1JOAA 4H4PA 1TDOA 2BRYA 2EQ9A 2GAGB 4TM1A 2YQUA 1VDCA 2BK4A 1IUTA 2WOVA 2YG5A 3P4SA 1IUXA 4APNA 1MOKA 1Y0PA 4FDCB 5HHFA 1ZMDA 3B6DA 2C66A 4EM4A 3ZDNA 2YVFA 4M52A 2PHHA 1GV4A 2X8GA 4YKGA 4EIQA 1PBEA 4EQRA 3UKLA 2YG7A 2FJAA 4YTPA 1COYA 2FJDA 4PAAA 1FCDA 3CNTA 4EQSA 4U2TA 3DMEA 1VQWA 3T37A 1CJ3A 2XLTA 1KSUA 1P2HA 3ABVA 4LIIA 1K0LA 1ZX9A 3CNPA 4N9XA 2FJBA 1NHQA 1GSNA 3P4PA 4H4UA 4II2A 4A79A 4OPIA 3F8PA 3GYJA 1EBDA 3I6DA 3T14A 1GRFA 1D7LA 5KOWA 5L46A 3VR9A 5LV9A 4ZCCA 3H8IA 1XDIA 1RP0A 1X31B 4H2NA 4TLXA 3RNMA 3AEFA 2XFPA 4CRTA 2XVEA 2XLUA 2YG3A 2WESA 4YTNA 2C65A 4YSXA 2OA1A 4K2XA 4DSGA 2X8CA 1FEAA 4H4WA 1TYPA 2AQJA 1OJDA 2GH5A 2XLSA 1TDEA 2EQ8A 2OAMA 3C96A 4J36A 4IA6A 3UOYA 3UKQA 5BUKA 3BNMA 1ZP0A 1H7WA 1DJQA 1PDHA 2DKHA 1F8WA 5FS6A 4CNJA 2VOUA 5BRTA 2C76A 1BGJA 4Z2UA 5EB4A 4ADWA 2JK6A 1PS9A 2E5VA 2OLOA 2R4JA 2X3NA 4A6NB 3NK2X 1B8SA 4RG4A 3KVEA 1S2YA 2Y6QA 3M12A 2YG4A 5KXJA 4XXGA 1LJ1A 3SZFA 1DOBA 4D04A 3UKAA 1CC2A 3BI4A 3UKKA 3AE6A 2YM2A 3AEDA 1V59A 3UKPA 2JAEA 3ALLA 4NEVA 4OPGA 1PJ5A 3BNUA 2OLNA 3GRTA 3UOXA 4H2PA 1ZOVA 1E1MA 4X9MA 2TMDA 2XVIA 1OJTA 3QSEA 3K7TA 4O5QA 1JNZA 5DBJA 4J31A 2VVMA 1GOSA 1L9EA 2JB1A 3GD4A 4GCMA 3Q6JA 4KX6A 1HYUA 1B37A 3PS9A 3V3NA 4AP3A 2A87A 2ZBWA 1S3BA 1NAAA 5U25A 4DGKA 5KOXA 3EAOA 5FMHA 1VG9A 2QCUA 2WS3A 3DH9A 4J33A 3NYFA 5U63A 3AE4A 5HY5A 5BVAA 4A65A 4JNAA 4J56A 2FJEA 2GEWA 3DGHA 4H4QA 3OC4A 4I58A 1PBFA 1K0JA 1QO8A 4NTCA 2C75A 3UOVA 3I3LA 1KDGA 2YM1A 3UCLA 2BC0A 1PJ6A 5KMQA 2X50A 4B67A 1H84A 3BHKA 2RGHA 4U8JA 3UTGA 4TM4A 2V5ZA 1TDNA 4H7UA 1H81A 2Q0LA 5HXIA 1VG0A 1W4XA 3GWFA 5U1OA 2RABA 3URHA 4YT0A 2YR6A 2H89A 4YSZA 1CC4A 1GT8A 3DJGX 2YR5A 3IHMA 1PBDA 2YVGA 4DNAA 4J2WA 4H4VA 4OPUA 2XVJA 3RP7A 2B9YA 4FK1C 1ZOYA 2R0GA 2V6OA 2EQ7A 1EL5A 2Z5XA 3KKJA 3KPFA 5JCMA 2Q7VA 2BK5A 1PHHA 1DNCA 3DJEA 2GF3A 1BF3A 1GNDA 3LB8A 2WDQA 3IHGA 1EL7A 4EIPA 2RGJA 1SEZA 1PJ7A 3GRSA 3LJPA 3S61A 2WPFA 3FBSA 3UKHA 1QJDA 2R9ZA 3SFDA 4AT2A 1REOA 2XFUA 3P9UA 3DGZA 1KSSA 3AE3A 3OZ2A 4G9KA 3QJ4A 4GR1A 2XYOA 3ICSA 4USQA 2CVJA 4AP1A 3NK1X 1PBBA 4OCGA 1K0IA 1BZLA 1IUVA 5CKUA 3HYXA 3HZLA 1BKWA 1FECA 1NHRA 3CNSA 3HYVA 4H4TA 3S5WA 4A5LA 3VRDB 5KMPA 2BXSA 2R0CA 4X4JA 3CNJA 4TLZA 3WE0A 2X99A 3GYIA 1H6VA 3ICRA 1F8SA 2BCGG 1ZKQA 4K8DA 4BK3A 3AD8B 3AE8A 1E1KA 1GXFA 1B4VA 3IWAA 2B76A 2XVHA 1GTHA 2WOWA 4H4XA 1ZK7A 2C7GA 2JB3A 3CN8A 2GV8A 3NRNA 1JNRA 1ZDLA 1CBOA 3BI2A 4U2LA 3KU9A 4EMIA 1PXBA 2VRMA 1D4CA 1XPQA 2BACA 4WCTA 3AE9A 4CY8A 4IVOB 4JN9A 2ZZBA 3SY4A 2C67A 1E39A 3GSIA 4ZN0A 1ZY8A 3NG7X 3AXBA 2YLZA 2R46A 3JSKA 3CNDA 4H4SA 1JEHA 2XFOA 2F5ZA 2E4GA 3AEBA 1H7XA 4OPDA 1E1NA 4C74A 2A8XA 2CULA 3DA1A 3II4A 1LQTA 3NK0X 4II3A 5KVIA 1JU2A 1IJHA 4I59A 3O0HA 2HQMA 5GSNA 1DOCA 4RSLA 1N4VA 4ECHA 4IA5A 2BS2A 3SXIA 4Z43A 3G5RA 2GR3A 5C2TA 2VQBA 2BABA 4WX1A 2WP9A 5EOWA 5JCKA 4XWRA 1TDKA 4U8NA 1E1LA 3SGLA 1JRXA 2AAQA 3VR8A 2GVCA 1NDAA 2C3CA 4U8MA 3NTAA 5GRTA 1EL9A 1RSGA 1MXTA 3AECA 3LADA 3EANA 2YVJA 1XANA 1GRGA 3ICTA 4H50A 4ICYA 4H2RA 1UKVG 3VRBA 3V3OA 2B7SA 3D8XA 4TM0A 4G6GA 3T2KA 4HB9A 3AEGA 2C73A 1DXLA 4NWZA 4Y4LA 3NN6X 4A9WA 2WDRA 1KF6A 3QSMA 5BULA 3NN0X 3F8DA 4FK1A 4BV6A 2VRLA 3K7MX 3AD9B 4LA1A 3REDA 1FL2A 4J57A 1F8RA 4GF7A 4CNKA 3QFBA 4Z2RA 2C70A 4NTDA 2AR8A 4FX9A 5FS7A 2BS3A 4JY2A 3SFEA 1L9DA 4K22A 4Z2TA 3CGCA 3AEAA 1N1PA 3CGDA 3AYLA 3ALMA 3GMBA 1GRHA 2R45A 3T2YA 3UP5A 5KMRA 4U8IA 2XCGA 1L0VA 4B1BA 2XLPA 2WETA 2WOIA 4YSYA 3P1WA 4NTEA 5FS9A 2BCPA 3RP8A 4DSHA 2B7RA 3UKFA 4D03A 3P4QA 4NEWA 1GALA 3EPTA 3PO7A 2WP5A 3AE7A 4H2QA 4YTMA 1YQZA 2GQWA 3AE1A 5M0ZA 4NNJA 1M64A 2GMHA 1GRAA 2GQFA 2WPCA 4UDRA 5KVHA 2E1MA 1GEUA 2EQ6A 4JY3A 3IC9A 4YXDA 3AB1A 4J34A 1D7YA 2GR1A 3AE2A 2QA1A 2NVKX 3CPIG 3M0OA 5C3JA 4G74A 3RHAA 2WU2A 1QLBA 1Z6LA 3NKSA 1PXCA 4REKA 5J60A 3UTHA 4G6HA 1PBCA 4BJZA 2ACZA 3KPKA 1N4UA 3AE5A 3M13A 1S3EA 1CJ2A 3F8RA 4IV9A 2FBWA 1ONFA 4Z24A 1IUUA 4OPTA 3L8KA 2YR4A 1E6EA 4C77A 1L9CA 2C64A 3QVPA 1VRQB 1DJNA 3SZWA 2BYBA 3SZ0A 4UP3A 3QFAA 1KNPA 3RP6A 2ZZCA 4A7AA 3UOZA 3ZYXA 1CL0A 1B5QA 2XLRA 2YLRA 1GETA 2CDUA 3KA7A 1NENA 4JNQA 4Y4NA 2YWLA 3GWDA 3QSSA 4H4ZA 1Y56A 1YQ3A 5JCLA 4CCQA 5FS8A 2XFQA 1E7PA 2V3BA 2VQ7A 3H4KA 4G73A 3T31A 1YKJA 1CC6A 1GPEA 3NHOX 4OVIA 1GESA 1GTEA 1OJAA 2GR2A 1K4QA 3E1TA 3CMMA 2IVEA 4C5OA 3NGCX 1AOGA 4YKFA 4CBQA 2C72A 2Y6RA 4AOXA 2GB0A 1H83A 1EL8A 1ELIA 4H4YA 3VQRA 1RYIA 2BS4A 4K5RA 4BJYA 3ISHA 1D4EA 1TYTA 1DODA 3GDPA 4GRTA 1F3PA 3VRAA 3L1RA 1CF3A 1IUSA 4E0VA 2YLTA 2Z5YA 3G5QA 2B9WA 1JRYA 2JB2A 3CGBA 4OPLA 2V60A 4HA6A 2I0ZA 2GMJA 1D5TA 3NH3X 3CIRA 3NT6A 2BK3A 3T0KA 4OPCA 1PXAA 1Q9IA 1GREA 4EMJA 2PYXA 4GUVA 1O94A 3GYXA 3FG2P 1BWCA 1CJ4A 2GRTA 1F6MA 3ATRA 1OJ9A 3AYJA 2O9ZA 4Z26A 1ZMCA 3FMWA 1NHPA 1TDFA 3AWIA 3DK4A 4AOSA 3AD7B 4U8KA 3BI5A 4AT0A 3UTFA 3D1CA 2WDVA 3DK8A 3ITJA 3NLCA 4PABA 3R9UA 5IPYA 1M6IA 4USRA 5IQ4A 1JRZA 3NIXA 3SQPA 4GAVA 3CTYA 1S2QA 5KRQA 2IVDA 2XVFA 3COXA 3GD3A 3T2ZA 3V76A 3CPHG 2XFNA 4KPRA 3DK9A 2NPXA 5EBKA 5J7XA 1PN0A 4Z44A 3P4RA 3GDNA 2OALA 2VVLG 4A99A 5HYMA 2UZZA 3QVRA 3NTDA 2IIDA 1NPXA 2BC1A 1FOHA 4U8LA 4P9SA 5KWFA 1KFYA 4JQ9A 2BXRA 3K30A 3SZCA 4RG3A 2GAHB 3ATQA 2YLSA 1Y56B 3CGEA 4X9NA 5EB5A 2BA9A 4XWZA 1GRBA 4U8OA 3Q9TA 4BURA 2QAEA 4EMWA 1TRBA 3HYWA 3IF9A 5ER0A 3ADAB 4EQWA 2WHDA 1P2EA 2WQYA 4U2SA 4K5SA 4EQXA 1DOEA 4YSHA 1YQ4A 4YWOA 4CY6A 3ALJA 4BK2A 2WBAA 2DKIA 4JDRA 4O5UA 4Z25A 1IUWA 4UDPA 3CPJG 1KNRA 1LPFA 4B63A 2W0HA 2YLXA 4GDEA 2V3AA 1D4DA 2C4CA 1NG3A 2V61A 4ZCDA 2YG6A 4B65A 2J3NA 1O95A 1YY5A 3NYCA 1CHUA 2WP6A 3NYEA 4H4RA 5TR3A 2WEUA 4CCRA 2Q0KA 4B64A 2JBVA 3PVCA 4Y4MA 1OJCA 2CFYA 2Q6UA 2C3DA 2WPEA 4GAPA 5KNLA 3G5SA 4TM3A 3LZXA 3SX6A 2JKCA 2BRAA 2QA2A 3FIMB 4BK1A 2ZZ0A 5KMSA 2A89A 4UDQA 1LV0A 2ARDA 4B69A 3C4NA 4B66A 1FEBA 2VVLA 5JCNA 2APGA 2H88A 3B3RA 4IVMB 2XDOA 1LVLA 1LTXR 3SM8A 1N4WA 2X8HA 5M10A 1Q1WA 4C3YA 3AYIA 4A6NA 3DJDA 1O5WA 2RGOA 5JCIA 4B68A 3BHFA 1H86A 4C3XA 3DJJA 3NNEA 1NG4A 2GR0A 3K7QX 2B9XA 1H82A 1NHSA 4NZHA 3GMCA 3LXDA 2TPRA 2YAUA 3C4AA 4GDPA 4U8PA 1LQUA 2R4EA 5CQFA 2R0PA 2WU5A 3LZWA 3H8LA 1BGNA 4K7ZA 1Q1RA 2YLWA 3FPZA 5IQ1A 1MO9A 1NEKA 3UTEA 1GRTA 3KLJA 4LU6A 3AEEA 2VZ2A 1XHCA 3UP4A 3KD9A 3SYIA 4EM3A 3EF6A 4MJWA 1CJCA 3LOVA 1GERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOA A;  4H4P A;  1TDO A;  2EQ9 A;  2GAG B;  4TM1 A;  2YQU A;  1VDC A;  2BK4 A;  1IUT A;  2WOV A;  2YG5 A;  3P4S A;  1IUX A;  4APN A;  1MOK A;  1Y0P A;  4FDC B;  5HHF A;  1ZMD A;  3B6D A;  2C66 A;  4EM4 A;  3ZDN A;  2YVF A;  4M52 A;  2PHH A;  1GV4 A;  2X8G A;  4YKG A;  4EIQ A;  1PBE A;  4EQR A;  3UKL A;  2YG7 A;  2FJA A;  4YTP A;  1COY A;  2FJD A;  4PAA A;  1FCD A;  3CNT A;  4EQS A;  4U2T A;  3DME A;  1VQW A;  3T37 A;  1CJ3 A;  2XLT A;  1KSU A;  1P2H A;  3ABV A;  4LII A;  1K0L A;  1ZX9 A;  3CNP A;  4N9X A;  2FJB A;  1NHQ A;  1GSN A;  3P4P A;  4H4U A;  4A79 A;  4OPI A;  3F8P A;  3GYJ A;  1EBD A;  3I6D A;  1GRF A;  1D7L A;  5KOW A;  5L46 A;  3VR9 A;  5LV9 A;  4ZCC A;  3H8I A;  1XDI A;  1RP0 A;  1X31 B;  4H2N A;  4TLX A;  3RNM A;  3AEF A;  2XFP A;  4CRT A;  2XVE A;  2XLU A;  2YG3 A;  2WES A;  4YTN A;  2C65 A;  4YSX A;  2OA1 A;  4K2X A;  4DSG A;  2X8C A;  1FEA A;  4H4W A;  1TYP A;  2AQJ A;  1OJD A;  2GH5 A;  2XLS A;  1TDE A;  2EQ8 A;  2OAM A;  3C96 A;  4J36 A;  4IA6 A;  3UOY A;  3UKQ A;  5BUK A;  3BNM A;  1ZP0 A;  1H7W A;  1DJQ A;  1PDH A;  2DKH A;  1F8W A;  5FS6 A;  4CNJ A;  2VOU A;  5BRT A;  2C76 A;  1BGJ A;  4Z2U A;  5EB4 A;  4ADW A;  2JK6 A;  1PS9 A;  2E5V A;  2OLO A;  2R4J A;  2X3N A;  4A6N B;  3NK2 X;  1B8S A;  4RG4 A;  3KVE A;  1S2Y A;  2Y6Q A;  3M12 A;  2YG4 A;  5KXJ A;  4XXG A;  1LJ1 A;  1DOB A;  4D04 A;  3UKA A;  1CC2 A;  3BI4 A;  3UKK A;  3AE6 A;  2YM2 A;  3AED A;  1V59 A;  3UKP A;  2JAE A;  3ALL A;  4NEV A;  4OPG A;  1PJ5 A;  3BNU A;  2OLN A;  3GRT A;  3UOX A;  4H2P A;  1ZOV A;  1E1M A;  4X9M A;  2TMD A;  2XVI A;  1OJT A;  3QSE A;  3K7T A;  4O5Q A;  1JNZ A;  5DBJ A;  4J31 A;  2VVM A;  1GOS A;  1L9E A;  2JB1 A;  3GD4 A;  4GCM A;  3Q6J A;  4KX6 A;  1HYU A;  1B37 A;  3PS9 A;  3V3N A;  4AP3 A;  2A87 A;  2ZBW A;  1S3B A;  1NAA A;  5U25 A;  4DGK A;  5KOX A;  3EAO A;  5FMH A;  1VG9 A;  2QCU A;  2WS3 A;  3DH9 A;  4J33 A;  3NYF A;  5U63 A;  3AE4 A;  5HY5 A;  5BVA A;  4A65 A;  4JNA A;  4J56 A;  2FJE A;  2GEW A;  3DGH A;  4H4Q A;  3OC4 A;  4I58 A;  1PBF A;  1K0J A;  1QO8 A;  4NTC A;  2C75 A;  3UOV A;  3I3L A;  1KDG A;  2YM1 A;  3UCL A;  2BC0 A;  1PJ6 A;  2X50 A;  4B67 A;  1H84 A;  3BHK A;  2RGH A;  4U8J A;  3UTG A;  4TM4 A;  2V5Z A;  1TDN A;  4H7U A;  1H81 A;  2Q0L A;  5HXI A;  1VG0 A;  1W4X A;  3GWF A;  5U1O A;  2RAB A;  3URH A;  4YT0 A;  2YR6 A;  2H89 A;  1CC4 A;  1GT8 A;  3DJG X;  2YR5 A;  3IHM A;  1PBD A;  2YVG A;  4DNA A;  4J2W A;  4H4V A;  4OPU A;  2XVJ A;  3RP7 A;  2B9Y A;  4FK1 C;  1ZOY A;  2R0G A;  2V6O A;  2EQ7 A;  1EL5 A;  2Z5X A;  3KKJ A;  3KPF A;  5JCM A;  2Q7V A;  2BK5 A;  1PHH A;  1DNC A;  3DJE A;  2GF3 A;  1BF3 A;  1GND A;  3LB8 A;  2WDQ A;  3IHG A;  1EL7 A;  4EIP A;  2RGJ A;  1SEZ A;  1PJ7 A;  3GRS A;  3LJP A;  3S61 A;  2WPF A;  3FBS A;  3UKH A;  1QJD A;  2R9Z A;  3SFD A;  4AT2 A;  1REO A;  2XFU A;  3P9U A;  3DGZ A;  1KSS A;  3AE3 A;  3OZ2 A;  3QJ4 A;  4GR1 A;  2XYO A;  3ICS A;  4USQ A;  2CVJ A;  4AP1 A;  3NK1 X;  1PBB A;  4OCG A;  1K0I A;  1BZL A;  1IUV A;  5CKU A;  3HZL A;  1BKW A;  1FEC A;  1NHR A;  3CNS A;  3S5W A;  4H4T A;  4A5L A;  3VRD B;  2BXS A;  2R0C A;  4X4J A;  3CNJ A;  4TLZ A;  3WE0 A;  2X99 A;  3GYI A;  1H6V A;  3ICR A;  1F8S A;  2BCG G;  1ZKQ A;  4K8D A;  4BK3 A;  3AD8 B;  3AE8 A;  1E1K A;  1GXF A;  1B4V A;  3IWA A;  2B76 A;  2XVH A;  1GTH A;  2WOW A;  4H4X A;  1ZK7 A;  2C7G A;  2JB3 A;  3CN8 A;  2GV8 A;  3NRN A;  1JNR A;  1ZDL A;  1CBO A;  3BI2 A;  4U2L A;  3KU9 A;  4EMI A;  1PXB A;  2VRM A;  1D4C A;  1XPQ A;  2BAC A;  4WCT A;  3AE9 A;  4CY8 A;  4IVO B;  4JN9 A;  2ZZB A;  2C67 A;  1E39 A;  3GSI A;  4ZN0 A;  1ZY8 A;  3NG7 X;  3AXB A;  2YLZ A;  2R46 A;  3JSK A;  3CND A;  4H4S A;  1JEH A;  2XFO A;  2F5Z A;  2E4G A;  3AEB A;  1H7X A;  4OPD A;  1E1N A;  4C74 A;  2A8X A;  2CUL A;  3DA1 A;  3II4 A;  1LQT A;  3NK0 X;  5KVI A;  1JU2 A;  1IJH A;  4I59 A;  3O0H A;  2HQM A;  5GSN A;  1DOC A;  4RSL A;  1N4V A;  4ECH A;  4IA5 A;  2BS2 A;  4Z43 A;  3G5R A;  2GR3 A;  5C2T A;  2VQB A;  2BAB A;  4WX1 A;  2WP9 A;  5EOW A;  5JCK A;  4XWR A;  1TDK A;  4U8N A;  1E1L A;  3SGL A;  1JRX A;  2AAQ A;  3VR8 A;  2GVC A;  1NDA A;  2C3C A;  4U8M A;  3NTA A;  5GRT A;  1EL9 A;  1RSG A;  1MXT A;  3AEC A;  3LAD A;  3EAN A;  2YVJ A;  1XAN A;  1GRG A;  3ICT A;  4H50 A;  4ICY A;  4H2R A;  1UKV G;  3VRB A;  3V3O A;  2B7S A;  3D8X A;  4TM0 A;  4HB9 A;  3AEG A;  2C73 A;  1DXL A;  4Y4L A;  3NN6 X;  4A9W A;  2WDR A;  1KF6 A;  3QSM A;  5BUL A;  3NN0 X;  3F8D A;  4FK1 A;  4BV6 A;  2VRL A;  3K7M X;  3AD9 B;  4LA1 A;  3RED A;  1FL2 A;  4J57 A;  1F8R A;  4GF7 A;  4CNK A;  3QFB A;  4Z2R A;  2C70 A;  4NTD A;  2AR8 A;  4FX9 A;  5FS7 A;  2BS3 A;  4JY2 A;  3SFE A;  1L9D A;  4K22 A;  4Z2T A;  3CGC A;  3AEA A;  1N1P A;  3CGD A;  3AYL A;  3ALM A;  3GMB A;  1GRH A;  2R45 A;  3UP5 A;  4U8I A;  2XCG A;  1L0V A;  4B1B A;  2XLP A;  2WET A;  2WOI A;  4YSY A;  3P1W A;  4NTE A;  5FS9 A;  2BCP A;  3RP8 A;  4DSH A;  2B7R A;  3UKF A;  4D03 A;  3P4Q A;  4NEW A;  1GAL A;  3EPT A;  3PO7 A;  2WP5 A;  3AE7 A;  4H2Q A;  4YTM A;  1YQZ A;  2GQW A;  3AE1 A;  5M0Z A;  1M64 A;  2GMH A;  1GRA A;  2GQF A;  2WPC A;  4UDR A;  5KVH A;  2E1M A;  1GEU A;  2EQ6 A;  4JY3 A;  3IC9 A;  4YXD A;  3AB1 A;  4J34 A;  1D7Y A;  2GR1 A;  3AE2 A;  2QA1 A;  2NVK X;  3CPI G;  3M0O A;  5C3J A;  3RHA A;  2WU2 A;  1QLB A;  1Z6L A;  3NKS A;  1PXC A;  4REK A;  5J60 A;  3UTH A;  1PBC A;  4BJZ A;  2ACZ A;  1N4U A;  3AE5 A;  3M13 A;  1S3E A;  1CJ2 A;  3F8R A;  4IV9 A;  2FBW A;  1ONF A;  4Z24 A;  1IUU A;  4OPT A;  3L8K A;  2YR4 A;  1E6E A;  4C77 A;  1L9C A;  2C64 A;  3QVP A;  1VRQ B;  1DJN A;  2BYB A;  4UP3 A;  3QFA A;  1KNP A;  3RP6 A;  2ZZC A;  4A7A A;  3UOZ A;  3ZYX A;  1CL0 A;  1B5Q A;  2XLR A;  2YLR A;  1GET A;  2CDU A;  3KA7 A;  1NEN A;  4JNQ A;  4Y4N A;  2YWL A;  3GWD A;  3QSS A;  4H4Z A;  1Y56 A;  1YQ3 A;  5JCL A;  4CCQ A;  5FS8 A;  2XFQ A;  1E7P A;  2V3B A;  2VQ7 A;  3H4K A;  1YKJ A;  1CC6 A;  1GPE A;  3NHO X;  4OVI A;  1GES A;  1GTE A;  1OJA A;  2GR2 A;  1K4Q A;  3E1T A;  2IVE A;  4C5O A;  3NGC X;  1AOG A;  4YKF A;  4CBQ A;  2C72 A;  2Y6R A;  4AOX A;  2GB0 A;  1H83 A;  1EL8 A;  1ELI A;  4H4Y A;  3VQR A;  1RYI A;  2BS4 A;  4K5R A;  4BJY A;  3ISH A;  1D4E A;  1TYT A;  1DOD A;  3GDP A;  4GRT A;  1F3P A;  3VRA A;  3L1R A;  1CF3 A;  1IUS A;  4E0V A;  2YLT A;  2Z5Y A;  3G5Q A;  2B9W A;  1JRY A;  2JB2 A;  3CGB A;  4OPL A;  2V60 A;  4HA6 A;  2I0Z A;  2GMJ A;  1D5T A;  3NH3 X;  3CIR A;  3NT6 A;  2BK3 A;  4OPC A;  1PXA A;  1Q9I A;  1GRE A;  4EMJ A;  2PYX A;  4GUV A;  1O94 A;  3FG2 P;  1BWC A;  1CJ4 A;  2GRT A;  1F6M A;  3ATR A;  1OJ9 A;  3AYJ A;  2O9Z A;  4Z26 A;  1ZMC A;  3FMW A;  1NHP A;  1TDF A;  3AWI A;  3DK4 A;  4AOS A;  3AD7 B;  4U8K A;  3BI5 A;  4AT0 A;  3UTF A;  3D1C A;  2WDV A;  3DK8 A;  3ITJ A;  3NLC A;  4PAB A;  3R9U A;  5IPY A;  1M6I A;  4USR A;  5IQ4 A;  1JRZ A;  3NIX A;  3SQP A;  3CTY A;  1S2Q A;  5KRQ A;  2IVD A;  2XVF A;  3COX A;  3GD3 A;  3V76 A;  3CPH G;  2XFN A;  4KPR A;  3DK9 A;  2NPX A;  5EBK A;  5J7X A;  1PN0 A;  4Z44 A;  3P4R A;  3GDN A;  2OAL A;  2VVL G;  4A99 A;  5HYM A;  2UZZ A;  3QVR A;  3NTD A;  2IID A;  1NPX A;  2BC1 A;  1FOH A;  4U8L A;  4P9S A;  5KWF A;  1KFY A;  4JQ9 A;  2BXR A;  3K30 A;  4RG3 A;  2GAH B;  3ATQ A;  2YLS A;  1Y56 B;  3CGE A;  4X9N A;  5EB5 A;  2BA9 A;  4XWZ A;  1GRB A;  4U8O A;  3Q9T A;  4BUR A;  2QAE A;  4EMW A;  1TRB A;  3IF9 A;  5ER0 A;  3ADA B;  4EQW A;  2WHD A;  1P2E A;  2WQY A;  4U2S A;  4K5S A;  4EQX A;  1DOE A;  4YSH A;  1YQ4 A;  4YWO A;  4CY6 A;  3ALJ A;  4BK2 A;  2WBA A;  2DKI A;  4JDR A;  4O5U A;  4Z25 A;  1IUW A;  4UDP A;  3CPJ G;  1KNR A;  1LPF A;  4B63 A;  2W0H A;  2YLX A;  4GDE A;  2V3A A;  1D4D A;  2V61 A;  1NG3 A;  4ZCD A;  4B65 A;  2YG6 A;  4YSZ A;  2J3N A;  1O95 A;  1YY5 A;  3NYC A;  1CHU A;  2WP6 A;  3NYE A;  4H4R A;  5TR3 A;  2WEU A;  4CCR A;  2Q0K A;  4B64 A;  2JBV A;  3PVC A;  4Y4M A;  1OJC A;  2CFY A;  2Q6U A;  2C3D A;  2WPE A;  3G5S A;  4TM3 A;  3LZX A;  2JKC A;  2QA2 A;  3FIM B;  4BK1 A;  2ZZ0 A;  2A89 A;  4UDQ A;  1LV0 A;  2ARD A;  4B69 A;  3C4N A;  4B66 A;  1FEB A;  2VVL A;  5JCN A;  2APG A;  2H88 A;  3B3R A;  4IVM B;  2XDO A;  1LVL A;  1LTX R;  3SM8 A;  1N4W A;  2X8H A;  5M10 A;  1Q1W A;  4C3Y A;  3AYI A;  4A6N A;  3DJD A;  1O5W A;  2RGO A;  5JCI A;  4B68 A;  3BHF A;  1H86 A;  4C3X A;  3DJJ A;  3NNE A;  1NG4 A;  2GR0 A;  3K7Q X;  2B9X A;  1H82 A;  1NHS A;  4NZH A;  3GMC A;  3LXD A;  2TPR A;  2YAU A;  3C4A A;  4GDP A;  4U8P A;  1LQU A;  2R4E A;  5CQF A;  2R0P A;  2WU5 A;  3LZW A;  3H8L A;  1BGN A;  4K7Z A;  1Q1R A;  2YLW A;  3FPZ A;  5IQ1 A;  1MO9 A;  1NEK A;  3UTE A;  1GRT A;  3KLJ A;  4LU6 A;  3AEE A;  2VZ2 A;  1XHC A;  3UP4 A;  3KD9 A;  4EM3 A;  3EF6 A;  4MJW A;  1CJC A;  3LOV A;  1GER A; 
#chains in the Genus database with same CATH topology
 1JOA A;  4H4P A;  1TDO A;  2BRY A;  2EQ9 A;  2GAG B;  4TM1 A;  2YQU A;  1VDC A;  2BK4 A;  1IUT A;  2WOV A;  2YG5 A;  3P4S A;  1IUX A;  4APN A;  1MOK A;  1Y0P A;  4FDC B;  5HHF A;  1ZMD A;  3B6D A;  2C66 A;  4EM4 A;  3ZDN A;  2YVF A;  4M52 A;  2PHH A;  1GV4 A;  2X8G A;  4YKG A;  4EIQ A;  1PBE A;  4EQR A;  3UKL A;  2YG7 A;  2FJA A;  4YTP A;  1COY A;  2FJD A;  4PAA A;  1FCD A;  3CNT A;  4EQS A;  4U2T A;  3DME A;  1VQW A;  3T37 A;  1CJ3 A;  2XLT A;  1KSU A;  1P2H A;  3ABV A;  4LII A;  1K0L A;  1ZX9 A;  3CNP A;  4N9X A;  2FJB A;  1NHQ A;  1GSN A;  3P4P A;  4H4U A;  4II2 A;  4A79 A;  4OPI A;  3F8P A;  3GYJ A;  1EBD A;  3I6D A;  3T14 A;  1GRF A;  1D7L A;  5KOW A;  5L46 A;  3VR9 A;  5LV9 A;  4ZCC A;  3H8I A;  1XDI A;  1RP0 A;  1X31 B;  4H2N A;  4TLX A;  3RNM A;  3AEF A;  2XFP A;  4CRT A;  2XVE A;  2XLU A;  2YG3 A;  2WES A;  4YTN A;  2C65 A;  4YSX A;  2OA1 A;  4K2X A;  4DSG A;  2X8C A;  1FEA A;  4H4W A;  1TYP A;  2AQJ A;  1OJD A;  2GH5 A;  2XLS A;  1TDE A;  2EQ8 A;  2OAM A;  3C96 A;  4J36 A;  4IA6 A;  3UOY A;  3UKQ A;  5BUK A;  3BNM A;  1ZP0 A;  1H7W A;  1DJQ A;  1PDH A;  2DKH A;  1F8W A;  5FS6 A;  4CNJ A;  2VOU A;  5BRT A;  2C76 A;  1BGJ A;  4Z2U A;  5EB4 A;  4ADW A;  2JK6 A;  1PS9 A;  2E5V A;  2OLO A;  2R4J A;  2X3N A;  4A6N B;  3NK2 X;  1B8S A;  4RG4 A;  3KVE A;  1S2Y A;  2Y6Q A;  3M12 A;  2YG4 A;  5KXJ A;  4XXG A;  1LJ1 A;  3SZF A;  1DOB A;  4D04 A;  3UKA A;  1CC2 A;  3BI4 A;  3UKK A;  3AE6 A;  2YM2 A;  3AED A;  1V59 A;  3UKP A;  2JAE A;  3ALL A;  4NEV A;  4OPG A;  1PJ5 A;  3BNU A;  2OLN A;  3GRT A;  3UOX A;  4H2P A;  1ZOV A;  1E1M A;  4X9M A;  2TMD A;  2XVI A;  1OJT A;  3QSE A;  3K7T A;  4O5Q A;  1JNZ A;  5DBJ A;  4J31 A;  2VVM A;  1GOS A;  1L9E A;  2JB1 A;  3GD4 A;  4GCM A;  3Q6J A;  4KX6 A;  1HYU A;  1B37 A;  3PS9 A;  3V3N A;  4AP3 A;  2A87 A;  2ZBW A;  1S3B A;  1NAA A;  5U25 A;  4DGK A;  5KOX A;  3EAO A;  5FMH A;  1VG9 A;  2QCU A;  2WS3 A;  3DH9 A;  4J33 A;  3NYF A;  5U63 A;  3AE4 A;  5HY5 A;  5BVA A;  4A65 A;  4JNA A;  4J56 A;  2FJE A;  2GEW A;  3DGH A;  4H4Q A;  3OC4 A;  4I58 A;  1PBF A;  1K0J A;  1QO8 A;  4NTC A;  2C75 A;  3UOV A;  3I3L A;  1KDG A;  2YM1 A;  3UCL A;  2BC0 A;  1PJ6 A;  5KMQ A;  2X50 A;  4B67 A;  1H84 A;  3BHK A;  2RGH A;  4U8J A;  3UTG A;  4TM4 A;  2V5Z A;  1TDN A;  4H7U A;  1H81 A;  2Q0L A;  5HXI A;  1VG0 A;  1W4X A;  3GWF A;  5U1O A;  2RAB A;  3URH A;  4YT0 A;  2YR6 A;  2H89 A;  4YSZ A;  1CC4 A;  1GT8 A;  3DJG X;  2YR5 A;  3IHM A;  1PBD A;  2YVG A;  4DNA A;  4J2W A;  4H4V A;  4OPU A;  2XVJ A;  3RP7 A;  2B9Y A;  4FK1 C;  1ZOY A;  2R0G A;  2V6O A;  2EQ7 A;  1EL5 A;  2Z5X A;  3KKJ A;  3KPF A;  5JCM A;  2Q7V A;  2BK5 A;  1PHH A;  1DNC A;  3DJE A;  2GF3 A;  1BF3 A;  1GND A;  3LB8 A;  2WDQ A;  3IHG A;  1EL7 A;  4EIP A;  2RGJ A;  1SEZ A;  1PJ7 A;  3GRS A;  3LJP A;  3S61 A;  2WPF A;  3FBS A;  3UKH A;  1QJD A;  2R9Z A;  3SFD A;  4AT2 A;  1REO A;  2XFU A;  3P9U A;  3DGZ A;  1KSS A;  3AE3 A;  3OZ2 A;  4G9K A;  3QJ4 A;  4GR1 A;  2XYO A;  3ICS A;  4USQ A;  2CVJ A;  4AP1 A;  3NK1 X;  1PBB A;  4OCG A;  1K0I A;  1BZL A;  1IUV A;  5CKU A;  3HYX A;  3HZL A;  1BKW A;  1FEC A;  1NHR A;  3CNS A;  3HYV A;  4H4T A;  3S5W A;  4A5L A;  3VRD B;  5KMP A;  2BXS A;  2R0C A;  4X4J A;  3CNJ A;  4TLZ A;  3WE0 A;  2X99 A;  3GYI A;  1H6V A;  3ICR A;  1F8S A;  2BCG G;  1ZKQ A;  4K8D A;  4BK3 A;  3AD8 B;  3AE8 A;  1E1K A;  1GXF A;  1B4V A;  3IWA A;  2B76 A;  2XVH A;  1GTH A;  2WOW A;  4H4X A;  1ZK7 A;  2C7G A;  2JB3 A;  3CN8 A;  2GV8 A;  3NRN A;  1JNR A;  1ZDL A;  1CBO A;  3BI2 A;  4U2L A;  3KU9 A;  4EMI A;  1PXB A;  2VRM A;  1D4C A;  1XPQ A;  2BAC A;  4WCT A;  3AE9 A;  4CY8 A;  4IVO B;  4JN9 A;  2ZZB A;  3SY4 A;  2C67 A;  1E39 A;  3GSI A;  4ZN0 A;  1ZY8 A;  3NG7 X;  3AXB A;  2YLZ A;  2R46 A;  3JSK A;  3CND A;  4H4S A;  1JEH A;  2XFO A;  2F5Z A;  2E4G A;  3AEB A;  1H7X A;  4OPD A;  1E1N A;  4C74 A;  2A8X A;  2CUL A;  3DA1 A;  3II4 A;  1LQT A;  3NK0 X;  4II3 A;  5KVI A;  1JU2 A;  1IJH A;  4I59 A;  3O0H A;  2HQM A;  5GSN A;  1DOC A;  4RSL A;  1N4V A;  4ECH A;  4IA5 A;  2BS2 A;  3SXI A;  4Z43 A;  3G5R A;  2GR3 A;  5C2T A;  2VQB A;  2BAB A;  4WX1 A;  2WP9 A;  5EOW A;  5JCK A;  4XWR A;  1TDK A;  4U8N A;  1E1L A;  3SGL A;  1JRX A;  2AAQ A;  3VR8 A;  2GVC A;  1NDA A;  2C3C A;  4U8M A;  3NTA A;  5GRT A;  1EL9 A;  1RSG A;  1MXT A;  3AEC A;  3LAD A;  3EAN A;  2YVJ A;  1XAN A;  1GRG A;  3ICT A;  4H50 A;  4ICY A;  4H2R A;  1UKV G;  3VRB A;  3V3O A;  2B7S A;  3D8X A;  4TM0 A;  4G6G A;  3T2K A;  4HB9 A;  3AEG A;  2C73 A;  1DXL A;  4NWZ A;  4Y4L A;  3NN6 X;  4A9W A;  2WDR A;  1KF6 A;  3QSM A;  5BUL A;  3NN0 X;  3F8D A;  4FK1 A;  4BV6 A;  2VRL A;  3K7M X;  3AD9 B;  4LA1 A;  3RED A;  1FL2 A;  4J57 A;  1F8R A;  4GF7 A;  4CNK A;  3QFB A;  4Z2R A;  2C70 A;  4NTD A;  2AR8 A;  4FX9 A;  5FS7 A;  2BS3 A;  4JY2 A;  3SFE A;  1L9D A;  4K22 A;  4Z2T A;  3CGC A;  3AEA A;  1N1P A;  3CGD A;  3AYL A;  3ALM A;  3GMB A;  1GRH A;  2R45 A;  3T2Y A;  3UP5 A;  5KMR A;  4U8I A;  2XCG A;  1L0V A;  4B1B A;  2XLP A;  2WET A;  2WOI A;  4YSY A;  3P1W A;  4NTE A;  5FS9 A;  2BCP A;  3RP8 A;  4DSH A;  2B7R A;  3UKF A;  4D03 A;  3P4Q A;  4NEW A;  1GAL A;  3EPT A;  3PO7 A;  2WP5 A;  3AE7 A;  4H2Q A;  4YTM A;  1YQZ A;  2GQW A;  3AE1 A;  5M0Z A;  4NNJ A;  1M64 A;  2GMH A;  1GRA A;  2GQF A;  2WPC A;  4UDR A;  5KVH A;  2E1M A;  1GEU A;  2EQ6 A;  4JY3 A;  3IC9 A;  4YXD A;  3AB1 A;  4J34 A;  1D7Y A;  2GR1 A;  3AE2 A;  2QA1 A;  2NVK X;  3CPI G;  3M0O A;  5C3J A;  4G74 A;  3RHA A;  2WU2 A;  1QLB A;  1Z6L A;  3NKS A;  1PXC A;  4REK A;  5J60 A;  3UTH A;  4G6H A;  1PBC A;  4BJZ A;  2ACZ A;  3KPK A;  1N4U A;  3AE5 A;  3M13 A;  1S3E A;  1CJ2 A;  3F8R A;  4IV9 A;  2FBW A;  1ONF A;  4Z24 A;  1IUU A;  4OPT A;  3L8K A;  2YR4 A;  1E6E A;  4C77 A;  1L9C A;  2C64 A;  3QVP A;  1VRQ B;  1DJN A;  3SZW A;  2BYB A;  3SZ0 A;  4UP3 A;  3QFA A;  1KNP A;  3RP6 A;  2ZZC A;  4A7A A;  3UOZ A;  3ZYX A;  1CL0 A;  1B5Q A;  2XLR A;  2YLR A;  1GET A;  2CDU A;  3KA7 A;  1NEN A;  4JNQ A;  4Y4N A;  2YWL A;  3GWD A;  3QSS A;  4H4Z A;  1Y56 A;  1YQ3 A;  5JCL A;  4CCQ A;  5FS8 A;  2XFQ A;  1E7P A;  2V3B A;  2VQ7 A;  3H4K A;  4G73 A;  3T31 A;  1YKJ A;  1CC6 A;  1GPE A;  3NHO X;  4OVI A;  1GES A;  1GTE A;  1OJA A;  2GR2 A;  1K4Q A;  3E1T A;  3CMM A;  2IVE A;  4C5O A;  3NGC X;  1AOG A;  4YKF A;  4CBQ A;  2C72 A;  2Y6R A;  4AOX A;  2GB0 A;  1H83 A;  1EL8 A;  1ELI A;  4H4Y A;  3VQR A;  1RYI A;  2BS4 A;  4K5R A;  4BJY A;  3ISH A;  1D4E A;  1TYT A;  1DOD A;  3GDP A;  4GRT A;  1F3P A;  3VRA A;  3L1R A;  1CF3 A;  1IUS A;  4E0V A;  2YLT A;  2Z5Y A;  3G5Q A;  2B9W A;  1JRY A;  2JB2 A;  3CGB A;  4OPL A;  2V60 A;  4HA6 A;  2I0Z A;  2GMJ A;  1D5T A;  3NH3 X;  3CIR A;  3NT6 A;  2BK3 A;  3T0K A;  4OPC A;  1PXA A;  1Q9I A;  1GRE A;  4EMJ A;  2PYX A;  4GUV A;  1O94 A;  3GYX A;  3FG2 P;  1BWC A;  1CJ4 A;  2GRT A;  1F6M A;  3ATR A;  1OJ9 A;  3AYJ A;  2O9Z A;  4Z26 A;  1ZMC A;  3FMW A;  1NHP A;  1TDF A;  3AWI A;  3DK4 A;  4AOS A;  3AD7 B;  4U8K A;  3BI5 A;  4AT0 A;  3UTF A;  3D1C A;  2WDV A;  3DK8 A;  3ITJ A;  3NLC A;  4PAB A;  3R9U A;  5IPY A;  1M6I A;  4USR A;  5IQ4 A;  1JRZ A;  3NIX A;  3SQP A;  4GAV A;  3CTY A;  1S2Q A;  5KRQ A;  2IVD A;  2XVF A;  3COX A;  3GD3 A;  3T2Z A;  3V76 A;  3CPH G;  2XFN A;  4KPR A;  3DK9 A;  2NPX A;  5EBK A;  5J7X A;  1PN0 A;  4Z44 A;  3P4R A;  3GDN A;  2OAL A;  2VVL G;  4A99 A;  5HYM A;  2UZZ A;  3QVR A;  3NTD A;  2IID A;  1NPX A;  2BC1 A;  1FOH A;  4U8L A;  4P9S A;  5KWF A;  1KFY A;  4JQ9 A;  2BXR A;  3K30 A;  3SZC A;  4RG3 A;  2GAH B;  3ATQ A;  2YLS A;  1Y56 B;  3CGE A;  4X9N A;  5EB5 A;  2BA9 A;  4XWZ A;  1GRB A;  4U8O A;  3Q9T A;  4BUR A;  2QAE A;  4EMW A;  1TRB A;  3HYW A;  3IF9 A;  5ER0 A;  3ADA B;  4EQW A;  2WHD A;  1P2E A;  2WQY A;  4U2S A;  4K5S A;  4EQX A;  1DOE A;  4YSH A;  1YQ4 A;  4YWO A;  4CY6 A;  3ALJ A;  4BK2 A;  2WBA A;  2DKI A;  4JDR A;  4O5U A;  4Z25 A;  1IUW A;  4UDP A;  3CPJ G;  1KNR A;  1LPF A;  4B63 A;  2W0H A;  2YLX A;  4GDE A;  2V3A A;  1D4D A;  2C4C A;  1NG3 A;  2V61 A;  4ZCD A;  2YG6 A;  4B65 A;  2J3N A;  1O95 A;  1YY5 A;  3NYC A;  1CHU A;  2WP6 A;  3NYE A;  4H4R A;  5TR3 A;  2WEU A;  4CCR A;  2Q0K A;  4B64 A;  2JBV A;  3PVC A;  4Y4M A;  1OJC A;  2CFY A;  2Q6U A;  2C3D A;  2WPE A;  4GAP A;  5KNL A;  3G5S A;  4TM3 A;  3LZX A;  3SX6 A;  2JKC A;  2BRA A;  2QA2 A;  3FIM B;  4BK1 A;  2ZZ0 A;  5KMS A;  2A89 A;  4UDQ A;  1LV0 A;  2ARD A;  4B69 A;  3C4N A;  4B66 A;  1FEB A;  2VVL A;  5JCN A;  2APG A;  2H88 A;  3B3R A;  4IVM B;  2XDO A;  1LVL A;  1LTX R;  3SM8 A;  1N4W A;  2X8H A;  5M10 A;  1Q1W A;  4C3Y A;  3AYI A;  4A6N A;  3DJD A;  1O5W A;  2RGO A;  5JCI A;  4B68 A;  3BHF A;  1H86 A;  4C3X A;  3DJJ A;  3NNE A;  1NG4 A;  2GR0 A;  3K7Q X;  2B9X A;  1H82 A;  1NHS A;  4NZH A;  3GMC A;  3LXD A;  2TPR A;  2YAU A;  3C4A A;  4GDP A;  4U8P A;  1LQU A;  2R4E A;  5CQF A;  2R0P A;  2WU5 A;  3LZW A;  3H8L A;  1BGN A;  4K7Z A;  1Q1R A;  2YLW A;  3FPZ A;  5IQ1 A;  1MO9 A;  1NEK A;  3UTE A;  1GRT A;  3KLJ A;  4LU6 A;  3AEE A;  2VZ2 A;  1XHC A;  3UP4 A;  3KD9 A;  3SYI A;  4EM3 A;  3EF6 A;  4MJW A;  1CJC A;  3LOV A;  1GER A; 
#chains in the Genus database with same CATH homology
 1JOA A;  4H4P A;  1TDO A;  2BRY A;  2EQ9 A;  2GAG B;  4TM1 A;  2YQU A;  1VDC A;  2BK4 A;  1IUT A;  2WOV A;  2YG5 A;  3P4S A;  1IUX A;  4APN A;  1MOK A;  1Y0P A;  4FDC B;  5HHF A;  1ZMD A;  3B6D A;  2C66 A;  4EM4 A;  3ZDN A;  2YVF A;  4M52 A;  2PHH A;  1GV4 A;  2X8G A;  4YKG A;  4EIQ A;  1PBE A;  4EQR A;  3UKL A;  2YG7 A;  2FJA A;  4YTP A;  1COY A;  2FJD A;  4PAA A;  1FCD A;  3CNT A;  4EQS A;  4U2T A;  3DME A;  1VQW A;  3T37 A;  1CJ3 A;  2XLT A;  1KSU A;  1P2H A;  3ABV A;  4LII A;  1K0L A;  1ZX9 A;  3CNP A;  4N9X A;  2FJB A;  1NHQ A;  1GSN A;  3P4P A;  4H4U A;  4II2 A;  4A79 A;  4OPI A;  3F8P A;  3GYJ A;  1EBD A;  3I6D A;  3T14 A;  1GRF A;  1D7L A;  5KOW A;  5L46 A;  3VR9 A;  5LV9 A;  4ZCC A;  3H8I A;  1XDI A;  1RP0 A;  1X31 B;  4H2N A;  4TLX A;  3RNM A;  3AEF A;  2XFP A;  4CRT A;  2XVE A;  2XLU A;  2YG3 A;  2WES A;  4YTN A;  2C65 A;  4YSX A;  2OA1 A;  4K2X A;  4DSG A;  2X8C A;  1FEA A;  4H4W A;  1TYP A;  2AQJ A;  1OJD A;  2GH5 A;  2XLS A;  1TDE A;  2EQ8 A;  2OAM A;  3C96 A;  4J36 A;  4IA6 A;  3UOY A;  3UKQ A;  5BUK A;  3BNM A;  1ZP0 A;  1H7W A;  1DJQ A;  1PDH A;  2DKH A;  1F8W A;  5FS6 A;  4CNJ A;  2VOU A;  5BRT A;  2C76 A;  1BGJ A;  4Z2U A;  5EB4 A;  4ADW A;  2JK6 A;  1PS9 A;  2E5V A;  2OLO A;  2R4J A;  2X3N A;  4A6N B;  3NK2 X;  1B8S A;  4RG4 A;  3KVE A;  1S2Y A;  2Y6Q A;  3M12 A;  2YG4 A;  5KXJ A;  4XXG A;  1LJ1 A;  3SZF A;  1DOB A;  4D04 A;  3UKA A;  1CC2 A;  3BI4 A;  3UKK A;  3AE6 A;  2YM2 A;  3AED A;  1V59 A;  3UKP A;  2JAE A;  3ALL A;  4NEV A;  4OPG A;  1PJ5 A;  3BNU A;  2OLN A;  3GRT A;  3UOX A;  4H2P A;  1ZOV A;  1E1M A;  4X9M A;  2TMD A;  2XVI A;  1OJT A;  3QSE A;  3K7T A;  4O5Q A;  1JNZ A;  5DBJ A;  4J31 A;  2VVM A;  1GOS A;  1L9E A;  2JB1 A;  3GD4 A;  4GCM A;  3Q6J A;  4KX6 A;  1HYU A;  1B37 A;  3PS9 A;  3V3N A;  4AP3 A;  2A87 A;  2ZBW A;  1S3B A;  1NAA A;  5U25 A;  4DGK A;  5KOX A;  3EAO A;  5FMH A;  1VG9 A;  2QCU A;  2WS3 A;  3DH9 A;  4J33 A;  3NYF A;  5U63 A;  3AE4 A;  5HY5 A;  5BVA A;  4A65 A;  4JNA A;  4J56 A;  2FJE A;  2GEW A;  3DGH A;  4H4Q A;  3OC4 A;  4I58 A;  1PBF A;  1K0J A;  1QO8 A;  4NTC A;  2C75 A;  3UOV A;  3I3L A;  1KDG A;  2YM1 A;  3UCL A;  2BC0 A;  1PJ6 A;  5KMQ A;  2X50 A;  4B67 A;  1H84 A;  3BHK A;  2RGH A;  4U8J A;  3UTG A;  4TM4 A;  2V5Z A;  1TDN A;  4H7U A;  1H81 A;  2Q0L A;  5HXI A;  1VG0 A;  1W4X A;  3GWF A;  5U1O A;  2RAB A;  3URH A;  4YT0 A;  2YR6 A;  2H89 A;  4YSZ A;  1CC4 A;  1GT8 A;  3DJG X;  2YR5 A;  3IHM A;  1PBD A;  2YVG A;  4DNA A;  4J2W A;  4H4V A;  4OPU A;  2XVJ A;  3RP7 A;  2B9Y A;  4FK1 C;  1ZOY A;  2R0G A;  2V6O A;  2EQ7 A;  1EL5 A;  2Z5X A;  3KKJ A;  3KPF A;  5JCM A;  2Q7V A;  2BK5 A;  1PHH A;  1DNC A;  3DJE A;  2GF3 A;  1BF3 A;  1GND A;  3LB8 A;  2WDQ A;  3IHG A;  1EL7 A;  4EIP A;  2RGJ A;  1SEZ A;  1PJ7 A;  3GRS A;  3LJP A;  3S61 A;  2WPF A;  3FBS A;  3UKH A;  1QJD A;  2R9Z A;  3SFD A;  4AT2 A;  1REO A;  2XFU A;  3P9U A;  3DGZ A;  1KSS A;  3AE3 A;  3OZ2 A;  4G9K A;  3QJ4 A;  4GR1 A;  2XYO A;  3ICS A;  4USQ A;  2CVJ A;  4AP1 A;  3NK1 X;  1PBB A;  4OCG A;  1K0I A;  1BZL A;  1IUV A;  5CKU A;  3HYX A;  3HZL A;  1BKW A;  1FEC A;  1NHR A;  3CNS A;  3HYV A;  4H4T A;  3S5W A;  4A5L A;  3VRD B;  5KMP A;  2BXS A;  2R0C A;  4X4J A;  3CNJ A;  4TLZ A;  3WE0 A;  2X99 A;  3GYI A;  1H6V A;  3ICR A;  1F8S A;  2BCG G;  1ZKQ A;  4K8D A;  4BK3 A;  3AD8 B;  3AE8 A;  1E1K A;  1GXF A;  1B4V A;  3IWA A;  2B76 A;  2XVH A;  1GTH A;  2WOW A;  4H4X A;  1ZK7 A;  2C7G A;  2JB3 A;  3CN8 A;  2GV8 A;  3NRN A;  1JNR A;  1ZDL A;  1CBO A;  3BI2 A;  4U2L A;  3KU9 A;  4EMI A;  1PXB A;  2VRM A;  1D4C A;  1XPQ A;  2BAC A;  4WCT A;  3AE9 A;  4CY8 A;  4IVO B;  4JN9 A;  2ZZB A;  3SY4 A;  2C67 A;  1E39 A;  3GSI A;  4ZN0 A;  1ZY8 A;  3NG7 X;  3AXB A;  2YLZ A;  2R46 A;  3JSK A;  3CND A;  4H4S A;  1JEH A;  2XFO A;  2F5Z A;  2E4G A;  3AEB A;  1H7X A;  4OPD A;  1E1N A;  4C74 A;  2A8X A;  2CUL A;  3DA1 A;  3II4 A;  1LQT A;  3NK0 X;  4II3 A;  5KVI A;  1JU2 A;  1IJH A;  4I59 A;  3O0H A;  2HQM A;  5GSN A;  1DOC A;  4RSL A;  1N4V A;  4ECH A;  4IA5 A;  2BS2 A;  3SXI A;  4Z43 A;  3G5R A;  2GR3 A;  5C2T A;  2VQB A;  2BAB A;  4WX1 A;  2WP9 A;  5EOW A;  5JCK A;  4XWR A;  1TDK A;  4U8N A;  1E1L A;  3SGL A;  1JRX A;  2AAQ A;  3VR8 A;  2GVC A;  1NDA A;  2C3C A;  4U8M A;  3NTA A;  5GRT A;  1EL9 A;  1RSG A;  1MXT A;  3AEC A;  3LAD A;  3EAN A;  2YVJ A;  1XAN A;  1GRG A;  3ICT A;  4H50 A;  4ICY A;  4H2R A;  1UKV G;  3VRB A;  3V3O A;  2B7S A;  3D8X A;  4TM0 A;  4G6G A;  3T2K A;  4HB9 A;  3AEG A;  2C73 A;  1DXL A;  4NWZ A;  4Y4L A;  3NN6 X;  4A9W A;  2WDR A;  1KF6 A;  3QSM A;  5BUL A;  3NN0 X;  3F8D A;  4FK1 A;  4BV6 A;  2VRL A;  3K7M X;  3AD9 B;  4LA1 A;  3RED A;  1FL2 A;  4J57 A;  1F8R A;  4GF7 A;  4CNK A;  3QFB A;  4Z2R A;  2C70 A;  4NTD A;  2AR8 A;  4FX9 A;  5FS7 A;  2BS3 A;  4JY2 A;  3SFE A;  1L9D A;  4K22 A;  4Z2T A;  3CGC A;  3AEA A;  1N1P A;  3CGD A;  3AYL A;  3ALM A;  3GMB A;  1GRH A;  2R45 A;  3T2Y A;  3UP5 A;  5KMR A;  4U8I A;  2XCG A;  1L0V A;  4B1B A;  2XLP A;  2WET A;  2WOI A;  4YSY A;  3P1W A;  4NTE A;  5FS9 A;  2BCP A;  3RP8 A;  4DSH A;  2B7R A;  3UKF A;  4D03 A;  3P4Q A;  4NEW A;  1GAL A;  3EPT A;  3PO7 A;  2WP5 A;  3AE7 A;  4H2Q A;  4YTM A;  1YQZ A;  2GQW A;  3AE1 A;  5M0Z A;  4NNJ A;  1M64 A;  2GMH A;  1GRA A;  2GQF A;  2WPC A;  4UDR A;  5KVH A;  2E1M A;  1GEU A;  2EQ6 A;  4JY3 A;  3IC9 A;  4YXD A;  3AB1 A;  4J34 A;  1D7Y A;  2GR1 A;  3AE2 A;  2QA1 A;  2NVK X;  3CPI G;  3M0O A;  5C3J A;  4G74 A;  3RHA A;  2WU2 A;  1QLB A;  1Z6L A;  3NKS A;  1PXC A;  4REK A;  5J60 A;  3UTH A;  4G6H A;  1PBC A;  4BJZ A;  2ACZ A;  3KPK A;  1N4U A;  3AE5 A;  3M13 A;  1S3E A;  1CJ2 A;  3F8R A;  4IV9 A;  2FBW A;  1ONF A;  4Z24 A;  1IUU A;  4OPT A;  3L8K A;  2YR4 A;  1E6E A;  4C77 A;  1L9C A;  2C64 A;  3QVP A;  1VRQ B;  1DJN A;  3SZW A;  2BYB A;  3SZ0 A;  4UP3 A;  3QFA A;  1KNP A;  3RP6 A;  2ZZC A;  4A7A A;  3UOZ A;  3ZYX A;  1CL0 A;  1B5Q A;  2XLR A;  2YLR A;  1GET A;  2CDU A;  3KA7 A;  1NEN A;  4JNQ A;  4Y4N A;  2YWL A;  3GWD A;  3QSS A;  4H4Z A;  1Y56 A;  1YQ3 A;  5JCL A;  4CCQ A;  5FS8 A;  2XFQ A;  1E7P A;  2V3B A;  2VQ7 A;  3H4K A;  4G73 A;  3T31 A;  1YKJ A;  1CC6 A;  1GPE A;  3NHO X;  4OVI A;  1GES A;  1GTE A;  1OJA A;  2GR2 A;  1K4Q A;  3E1T A;  3CMM A;  2IVE A;  4C5O A;  3NGC X;  1AOG A;  4YKF A;  4CBQ A;  2C72 A;  2Y6R A;  4AOX A;  2GB0 A;  1H83 A;  1EL8 A;  1ELI A;  4H4Y A;  3VQR A;  1RYI A;  2BS4 A;  4K5R A;  4BJY A;  3ISH A;  1D4E A;  1TYT A;  1DOD A;  3GDP A;  4GRT A;  1F3P A;  3VRA A;  3L1R A;  1CF3 A;  1IUS A;  4E0V A;  2YLT A;  2Z5Y A;  3G5Q A;  2B9W A;  1JRY A;  2JB2 A;  3CGB A;  4OPL A;  2V60 A;  4HA6 A;  2I0Z A;  2GMJ A;  1D5T A;  3NH3 X;  3CIR A;  3NT6 A;  2BK3 A;  3T0K A;  4OPC A;  1PXA A;  1Q9I A;  1GRE A;  4EMJ A;  2PYX A;  4GUV A;  1O94 A;  3GYX A;  3FG2 P;  1BWC A;  1CJ4 A;  2GRT A;  1F6M A;  3ATR A;  1OJ9 A;  3AYJ A;  2O9Z A;  4Z26 A;  1ZMC A;  3FMW A;  1NHP A;  1TDF A;  3AWI A;  3DK4 A;  4AOS A;  3AD7 B;  4U8K A;  3BI5 A;  4AT0 A;  3UTF A;  3D1C A;  2WDV A;  3DK8 A;  3ITJ A;  3NLC A;  4PAB A;  3R9U A;  5IPY A;  1M6I A;  4USR A;  5IQ4 A;  1JRZ A;  3NIX A;  3SQP A;  4GAV A;  3CTY A;  1S2Q A;  5KRQ A;  2IVD A;  2XVF A;  3COX A;  3GD3 A;  3T2Z A;  3V76 A;  3CPH G;  2XFN A;  4KPR A;  3DK9 A;  2NPX A;  5EBK A;  5J7X A;  1PN0 A;  4Z44 A;  3P4R A;  3GDN A;  2OAL A;  2VVL G;  4A99 A;  5HYM A;  2UZZ A;  3QVR A;  3NTD A;  2IID A;  1NPX A;  2BC1 A;  1FOH A;  4U8L A;  4P9S A;  5KWF A;  1KFY A;  4JQ9 A;  2BXR A;  3K30 A;  3SZC A;  4RG3 A;  2GAH B;  3ATQ A;  2YLS A;  1Y56 B;  3CGE A;  4X9N A;  5EB5 A;  2BA9 A;  4XWZ A;  1GRB A;  4U8O A;  3Q9T A;  4BUR A;  2QAE A;  4EMW A;  1TRB A;  3HYW A;  3IF9 A;  5ER0 A;  3ADA B;  4EQW A;  2WHD A;  1P2E A;  2WQY A;  4U2S A;  4K5S A;  4EQX A;  1DOE A;  4YSH A;  1YQ4 A;  4YWO A;  4CY6 A;  3ALJ A;  4BK2 A;  2WBA A;  2DKI A;  4JDR A;  4O5U A;  4Z25 A;  1IUW A;  4UDP A;  3CPJ G;  1KNR A;  1LPF A;  4B63 A;  2W0H A;  2YLX A;  4GDE A;  2V3A A;  1D4D A;  2C4C A;  1NG3 A;  2V61 A;  4ZCD A;  2YG6 A;  4B65 A;  2J3N A;  1O95 A;  1YY5 A;  3NYC A;  1CHU A;  2WP6 A;  3NYE A;  4H4R A;  5TR3 A;  2WEU A;  4CCR A;  2Q0K A;  4B64 A;  2JBV A;  3PVC A;  4Y4M A;  1OJC A;  2CFY A;  2Q6U A;  2C3D A;  2WPE A;  4GAP A;  5KNL A;  3G5S A;  4TM3 A;  3LZX A;  3SX6 A;  2JKC A;  2BRA A;  2QA2 A;  3FIM B;  4BK1 A;  2ZZ0 A;  5KMS A;  2A89 A;  4UDQ A;  1LV0 A;  2ARD A;  4B69 A;  3C4N A;  4B66 A;  1FEB A;  2VVL A;  5JCN A;  2APG A;  2H88 A;  3B3R A;  4IVM B;  2XDO A;  1LVL A;  1LTX R;  3SM8 A;  1N4W A;  2X8H A;  5M10 A;  1Q1W A;  4C3Y A;  3AYI A;  4A6N A;  3DJD A;  1O5W A;  2RGO A;  5JCI A;  4B68 A;  3BHF A;  1H86 A;  4C3X A;  3DJJ A;  3NNE A;  1NG4 A;  2GR0 A;  3K7Q X;  2B9X A;  1H82 A;  1NHS A;  4NZH A;  3GMC A;  3LXD A;  2TPR A;  2YAU A;  3C4A A;  4GDP A;  4U8P A;  1LQU A;  2R4E A;  5CQF A;  2R0P A;  2WU5 A;  3LZW A;  3H8L A;  1BGN A;  4K7Z A;  1Q1R A;  2YLW A;  3FPZ A;  5IQ1 A;  1MO9 A;  1NEK A;  3UTE A;  1GRT A;  3KLJ A;  4LU6 A;  3AEE A;  2VZ2 A;  1XHC A;  3UP4 A;  3KD9 A;  3SYI A;  4EM3 A;  3EF6 A;  4MJW A;  1CJC A;  3LOV A;  1GER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...