3ALJA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, reduced form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
total genus 130
structure length 369
sequence length 369
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3aljA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3aljA01
3B6DA 3GD3A 2YWLA 4GRTA 2V3BA 4JNQA 1QO8A 3CNDA 3NN0X 3LZXA 4H4SA 1EL9A 3RHAA 2JB1A 2WP5A 4U2SA 5HXIA 4H4XA 5GSNA 2E1MA 1F8SA 2TPRA 3GRTA 3IC9A 2E4GA 3OZ2A 2X8GA 3LOVA 4CY8A 1PBBA 4DSGA 3UKLA 4EM3A 1P2EA 2C72A 4YTMA 1LPFA 2WS3A 2Q0LA 1PJ6A 2WHDA 3NK0X 4JQ9A 2EQ6A 1QJDA 3NNEA 3CGEA 3NK1X 1MO9A 2XVEA 1IUXA 3VR8A 2WOIA 2Z5YA 4J31A 3Q9TA 4H4RA 2NPXA 2WP6A 2F5ZA 2WOWA 4EM4A 2Y6QA 1L9DA 2FJDA 1H86A 4FK1C 1EL7A 4JY3A 3H8LA 4RG4A 1CJ4A 1PBDA 1PHHA 2C75A 1GT8A 1W4XA 2AQJA 2J3NA 1VRQB 4BURA 4EQSA 2CFYA 5DBJA 4UDPA 1Q1RA 4REKA 1ZDLA 2TMDA 2CULA 3LXDA 4APNA 3NK2X 3ABVA 5U1OA 3F8DA 4GF7A 2YLZA 1MXTA 3AB1A 3DJEA 3V76A 2GV8A 2XVIA 3UTFA 3CNTA 4ZN0A 1ZMCA 3WE0A 1GESA 1GRHA 1NAAA 4YSZA 1PS9A 3NYEA 1GPEA 1YQ4A 1DJNA 3BNMA 2R45A 3P4PA 3AEBA 4M52A 2CVJA 1JRZA 4EQRA 1N4WA 4C5OA 4H4QA 1GRBA 1D7YA 2YM2A 3D1CA 3KVEA 2FBWA 4PAAA 5LV9A 3GWFA 3ATQA 4A99A 4TM0A 3AE8A 2EQ8A 4FX9A 3DK9A 4LIIA 4AOXA 3Q6JA 3FIMB 4DSHA 4D04A 1K4QA 2V60A 4TLXA 2BK4A 4AP3A 1NDAA 2B9YA 2GVCA 3CN8A 2DKHA 3GSIA 3UP5A 3QVRA 2YG3A 1AOGA 3F8RA 3NLCA 2I0ZA 4YSHA 1GTHA 3CGDA 4O5QA 2O9ZA 3BI4A 3T37A 1Q9IA 2BS4A 4J56A 1KNRA 4XXGA 1NHQA 2R0PA 4GDPA 4OPUA 3QFAA 2YLSA 3GMBA 1KSSA 5BVAA 4H2QA 1E7PA 5HY5A 4H7UA 3EPTA 1VQWA 1GEUA 2XYOA 4X9NA 2YVFA 3UKKA 4WX1A 2IIDA 3NRNA 2ZZ0A 3DJDA 2WP9A 2YG6A 3ZDNA 3BI2A 4A65A 4X4JA 5JCLA 2BS2A 5FS7A 4AT2A 1REOA 2C66A 1Y0PA 4IA5A 1B8SA 3CGBA 2ARDA 4IVMB 3UP4A 3P1WA 5KVIA 5CKUA 4ZCDA 1KNPA 2GF3A 5JCIA 4OPCA 2VZ2A 2H89A 5JCKA 2XFQA 1GTEA 2YM1A 2JB3A 3NTDA 2HQMA 2WPFA 4X9MA 4Z25A 4K7ZA 3UOYA 4H4VA 1M6IA 4D03A 1E1MA 2QAEA 4K5RA 4YXDA 1KSUA 1OJCA 1LVLA 2YLWA 1DJQA 1NENA 4B67A 2GAGB 2OA1A 1E39A 3BHKA 3DJGX 1IUSA 3QSEA 4GCMA 1Y56A 5J60A 2XLPA 2BA9A 1YY5A 2C65A 4O5UA 5EB4A 5JCNA 2R9ZA 5EBKA 3NN6X 1BF3A 1OJAA 2GQWA 4MJWA 1B4VA 3IF9A 5FS9A 3CGCA 2WDVA 1TDKA 2BS3A 4USQA 2XVHA 3SM8A 3O0HA 3GWDA 1ZOYA 2Q6UA 3GDNA 3P9UA 2B76A 3CPJG 1GNDA 3ICSA 2B7RA 3UKHA 2WPEA 2XCGA 2X99A 4GR1A 2BK3A 1YQZA 1XHCA 1O5WA 3JSKA 3AE7A 2C64A 1ZP0A 1H83A 3FBSA 1DXLA 5BULA 3K7MX 2DKIA 2WESA 1NHRA 4WCTA 1FECA 3AE3A 1B37A 3RNMA 3H8IA 1EBDA 2VOUA 3ATRA 3QVPA 3UOZA 2YLXA 4JN9A 3K7QX 4A79A 4YSYA 4Z2RA 2PHHA 3M13A 3CNJA 4YKGA 2BXRA 1JEHA 2BC0A 2C3CA 2FJAA 5ER0A 4YTNA 2ZZCA 4NTDA 4AOSA 4EQWA 4H2RA 3SGLA 4IA6A 3ALMA 1L9EA 3L8KA 1KDGA 2YG4A 2YR6A 4KX6A 4U2LA 4ADWA 4B66A 5BRTA 3EAOA 5M10A 3C4AA 3K7TA 3ADAB 1LJ1A 2EQ7A 4B68A 1ELIA 3ISHA 2B7SA 4KPRA 4Z43A 1MOKA 4Z24A 2YR4A 3AECA 2GMJA 4GDEA 4TM3A 3C4NA 4CY6A 2R4EA 1D4CA 4B1BA 3DGHA 1P2HA 1F8RA 1JOAA 1NPXA 4Y4MA 4PABA 2ACZA 3BHFA 2XVJA 1ONFA 5KOXA 3AE5A 5IQ1A 1FEBA 3V3NA 4Z26A 3NG7X 4NTCA 4OCGA 1GREA 3UTGA 1D5TA 2YVJA 1F6MA 1CC4A 1N4VA 2GH5A 4Y4NA 1EL5A 2R4JA 2XFPA 3UOXA 4EQXA 5IQ4A 4OPLA 2BABA 2JK6A 4U8NA 4A5LA 3V3OA 1PDHA 2GQFA 2CDUA 3LJPA 3UTEA 1BGJA 1GETA 1Z6LA 2JBVA 3D8XA 4JNAA 1ZX9A 3C96A 4CRTA 4EIPA 4B65A 5JCMA 2OALA 4NEVA 1H7XA 1GSNA 3BI5A 1RP0A 1DOCA 2BCGG 2OAMA 2OLNA 3GYJA 3QSSA 2JB2A 2Z5XA 2WOVA 1VG9A 3GD4A 2C67A 3E1TA 3UKQA 3UOVA 2RGHA 3CNSA 2C70A 2W0HA 4E0VA 2VRLA 3GMCA 5KRQA 3LZWA 1JNZA 5J7XA 3RP6A 2VVLG 4K2XA 1CL0A 1COYA 1B5QA 3LADA 4U8KA 3UCLA 4DNAA 3EF6A 2R46A 4RG3A 1PBFA 2QA1A 3AE4A 1H7WA 3EANA 1TDFA 2BXSA 1FEAA 2YG7A 2VVLA 1N1PA 2WDQA 1D7LA 2A87A 1LTXR 4U8MA 5U63A 2C3DA 2R0GA 4H4UA 2EQ9A 1KF6A 5C3JA 1IUTA 4BK3A 3PO7A 3URHA 2WBAA 4OVIA 3VRDB 4TM4A 4LU6A 2ZBWA 1HYUA 4H2NA 3AEDA 3OC4A 3QFBA 3QJ4A 5KWFA 3G5RA 4A9WA 4J36A 3CPHG 3FG2P 3VRAA 3AE1A 4EIQA 3KPFA 5GRTA 1TDEA 1GRAA 2OLOA 4EMJA 1TYPA 4C3XA 1YKJA 4UP3A 1NG3A 3SFEA 4LA1A 4U8IA 2WEUA 2WETA 3KLJA 2E5VA 3RP8A 1JRXA 5EB5A 4Z2UA 2C76A 2X8HA 3CIRA 2AR8A 4CNJA 1E1NA 2AAQA 3B3RA 1S3BA 4CNKA 3P4QA 3NHOX 2FJBA 1F3PA 2IVEA 2RGOA 3QSMA 4HA6A 1UKVG 5L46A 4FK1A 1H6VA 2RGJA 2XFUA 1N4UA 2WDRA 2V6OA 2GRTA 2JKCA 5IPYA 1JU2A 4TM1A 3DK8A 1GERA 3DMEA 3IWAA 1L9CA 2WU5A 3AE2A 3NGCX 1IUVA 2WU2A 3NTAA 4IV9A 4UDRA 4U2TA 4USRA 4AP1A 1CC6A 5TR3A 1PXCA 3KA7A 3VRBA 3AEEA 2A8XA 4Z44A 4H4WA 1PXBA 5BUKA 4NZHA 1CJ2A 4J2WA 2GR1A 2V5ZA 5FS6A 4BV6A 4C74A 4NTEA 4OPIA 1OJTA 3DGZA 4H4PA 1K0JA 4BJYA 1JRYA 1CJCA 1TDOA 4K22A 1RYIA 2YR5A 2YG5A 5FMHA 1PN0A 4I58A 4AT0A 3AE9A 3CTYA 3CPIG 4NEWA 4K8DA 1GRTA 2BC1A 5EOWA 1E6EA 3SFDA 3UKAA 3CNPA 5CQFA 2FJEA 4YSXA 2GEWA 3NH3X 2GMHA 3RP7A 2BACA 1XPQA 2GR2A 4DGKA 2WPCA 2QCUA 2XLSA 1CJ3A 3S5WA 4CCRA 5C2TA 3LB8A 4JY2A 1K0LA 2XLTA 3ALJA 2V61A 3AYJA 4RSLA 3ALLA 1ZMDA 2YVGA 1IUUA 2X3NA 2Q7VA 1NEKA 1QLBA 4C77A 3UTHA 4ICYA 3AD9B 2VVMA 4H2PA 3DJJA 3UKFA 3KD9A 2C73A 3GDPA 3BNUA 2V3AA 2WQYA 2X8CA 4J33A 3GYIA 5KVHA 3AEFA 1OJ9A 3DH9A 1EL8A 3ITJA 4B63A 4CCQA 1XDIA 1GRFA 3AWIA 5U25A 4CBQA 1M64A 1DOEA 2RABA 4BJZA 3ICTA 1OJDA 1K0IA 1H81A 1YQ3A 4TLZA 2XFOA 3AEAA 4U8LA 1PJ7A 2X50A 5KOWA 2YQUA 4H4TA 2ZZBA 1NHSA 3AEGA 2A89A 2JAEA 4P9SA 3IHMA 1NG4A 3NYCA 3AD7B 3P4RA 3DK4A 3REDA 1SEZA 2YLTA 3M0OA 4GUVA 2XFNA 2YLRA 4BK1A 1NHPA 3AXBA 3G5SA 2GB0A 1D4EA 2QA2A 3KU9A 1Q1WA 1BWCA 3ICRA 4C3YA 1ZKQA 1LV0A 2B9XA 5M0ZA 4XWZA 4A6NB 5HHFA 3F8PA 3G5QA 3FMWA 1E1LA 3PS9A 1IJHA 1PBEA 1H82A 4Y4LA 4YTPA 4ECHA 4OPDA 1GRGA 1S3EA 2GR0A 4H4ZA 1TDNA 1GOSA 4A6NA 1PBCA 3NIXA 3H4KA 4EMWA 1H84A 2VRMA 1TRBA 1FCDA 3AD8B 1GXFA 3NYFA 4H4YA 3DA1A 4N9XA 3PVCA 1TYTA 3AYLA 4YT0A 4YWOA 4J57A 4H50A 1FL2A 2VQBA 2BCPA 3I3LA 2XLRA 2IVDA 4I59A 1V59A 1IUWA 2BYBA 1CC2A 2XLUA 4K5SA 3HZLA 3NT6A 4UDQA 4EMIA 1LQUA 2Y6RA 2YAUA 3FPZA 1CF3A 1KFYA 1O95A 1D4DA 1DODA 4J34A 4ZCCA 2GR3A 3ZYXA 4B64A 1CHUA 3K30A 1PJ5A 4YKFA 2NVKX 3II4A 4OPTA 1ZK7A 3SQPA 1FOHA 1F8WA 4A7AA 5HYMA 1S2YA 3VQRA 1O94A 1GALA 2GAHB 3AYIA 3R9UA 3UKPA 2R0CA 1GV4A 1VDCA 1XANA 3S61A 4U8JA 1DOBA 1RSGA 1ZOVA 4B69A 4Z2TA 1VG0A 2Q0KA 4IVOB 4U8OA 5KXJA 4OPGA 3IHGA 2UZZA 2BK5A 1JNRA 3P4SA 3VR9A 4FDCB 5FS8A 3AE6A 2XDOA 4BK2A 1L0VA 1Y56B 2XVFA 2C7GA 3I6DA 1BKWA 1LQTA 2APGA 3L1RA 3M12A 1PXAA 2B9WA 1BGNA 2PYXA 1CBOA 1DNCA 1S2QA 2H88A 2VQ7A 3COXA 3NKSA 4XWRA 4U8PA 3GRSA 1X31B 4HB9A 1ZY8A 3KKJA 1BZLA 4JDRA 1E1KA
chains in the Genus database with same CATH superfamily
3B6DA 3GD3A 2YWLA 4GRTA 4G73A 2V3BA 4JNQA 1QO8A 3CNDA 4GAVA 3NN0X 3LZXA 4H4SA 1EL9A 3RHAA 2JB1A 2WP5A 4U2SA 5HXIA 4H4XA 5GSNA 2E1MA 1F8SA 2TPRA 3GYXA 3GRTA 3IC9A 2E4GA 3OZ2A 2X8GA 3LOVA 4CY8A 1PBBA 4DSGA 3UKLA 4EM3A 2C4CA 1P2EA 2C72A 3KPKA 4G74A 4YTMA 1LPFA 2WS3A 3W4KA 2Q0LA 1PJ6A 2WHDA 3NK0X 4JQ9A 2EQ6A 1QJDA 3NNEA 3CGEA 3NK1X 1MO9A 2XVEA 1IUXA 3VR8A 2WOIA 2Z5YA 4J31A 3HYWA 3Q9TA 4H4RA 2NPXA 2WP6A 2F5ZA 2WOWA 4EM4A 2Y6QA 1L9DA 2FJDA 1H86A 4FK1C 1EL7A 4JY3A 3H8LA 4RG4A 1CJ4A 1PBDA 1PHHA 2C75A 4II2A 1GT8A 1W4XA 2AQJA 2BRAA 1VRQB 2J3NA 3SXIA 4BURA 4EQSA 2CFYA 5DBJA 4UDPA 1Q1RA 4REKA 1ZDLA 3ZNNA 2TMDA 2CULA 3LXDA 4APNA 3NK2X 3ABVA 5U1OA 3F8DA 4GF7A 2YLZA 1MXTA 3AB1A 3DJEA 3V76A 2GV8A 2XVIA 1AN9A 3CNTA 3UTFA 4ZN0A 1ZMCA 3WE0A 5KNLA 1GESA 1GRHA 1NAAA 4YSZA 1PS9A 3NYEA 1GPEA 1YQ4A 1DJNA 3BNMA 2R45A 3P4PA 3AEBA 4M52A 2CVJA 1JRZA 4EQRA 1N4WA 4C5OA 4H4QA 1GRBA 1D7YA 2YM2A 3D1CA 3KVEA 4PAAA 4YJGA 2FBWA 5LV9A 3GWFA 3ATQA 4A99A 4TM0A 3AE8A 2EQ8A 4FX9A 3DK9A 4LIIA 4AOXA 3Q6JA 3FIMB 4DSHA 4D04A 1K4QA 2V60A 4TLXA 2BK4A 4AP3A 1NDAA 2B9YA 2GVCA 3CN8A 2DKHA 3GSIA 3UP5A 3QVRA 2YG3A 1AOGA 3F8RA 3NLCA 2I0ZA 4YSHA 1GTHA 3CGDA 4O5QA 2O9ZA 3BI4A 3T37A 1Q9IA 2BS4A 4J56A 1KNRA 3SZ0A 4XXGA 1NHQA 2R0PA 4GDPA 4OPUA 3QFAA 3T14A 2YLSA 3GMBA 1KSSA 5BVAA 4H2QA 1E7PA 5HY5A 4H7UA 3EPTA 4GAPA 1VQWA 1VE9A 4X9NA 1GEUA 2XYOA 2YVFA 3UKKA 4WX1A 2IIDA 3NRNA 2BRYA 3DJDA 2ZZ0A 2WP9A 2YG6A 3ZDNA 3BI2A 4A65A 4X4JA 5JCLA 2BS2A 5FS7A 4AT2A 1DAOA 1REOA 3ZNPA 2C66A 4IA5A 1Y0PA 1B8SA 3CGBA 2ARDA 4IVMB 3UP4A 5KMPA 3P1WA 5KVIA 5CKUA 4ZCDA 2GF3A 1KNPA 5JCIA 5KMRA 4OPCA 2VZ2A 3SX6A 2H89A 5JCKA 2XFQA 1GTEA 2YM1A 4YJFB 2JB3A 4X9MA 2HQMA 2WPFA 3NTDA 4Z25A 4K7ZA 3UOYA 4H4VA 1M6IA 4D03A 1E1MA 2QAEA 4K5RA 4YXDA 1KSUA 1OJCA 1LVLA 2YLWA 1DJQA 1NENA 4B67A 2GAGB 2OA1A 3BHKA 1E39A 3DJGX 1IUSA 3QSEA 4GCMA 1Y56A 5J60A 2XLPA 2BA9A 1YY5A 2C65A 3SY4A 4O5UA 5EB4A 5JCNA 2E48A 2R9ZA 5EBKA 3NN6X 1BF3A 1OJAA 2GQWA 4MJWA 1B4VA 3IF9A 5FS9A 3CGCA 2WDVA 1TDKA 2BS3A 3SM8A 2XVHA 4USQA 3O0HA 3GWDA 2Q6UA 1ZOYA 3GDNA 3P9UA 2B76A 3CPJG 1GNDA 3ICSA 2B7RA 3UKHA 2WPEA 2XCGA 2X99A 4GR1A 2BK3A 1YQZA 1C0IA 1XHCA 1O5WA 3JSKA 3AE7A 3T2KA 2C64A 1ZP0A 1H83A 3FBSA 1DXLA 5BULA 3K7MX 2DKIA 4G9KA 2WESA 1NHRA 1C0LA 4WCTA 1FECA 3AE3A 1B37A 3RNMA 3H8IA 1EBDA 2VOUA 3ATRA 3QVPA 3UOZA 2YLXA 4JN9A 3K7QX 4A79A 4YSYA 5KMQA 4Z2RA 2PHHA 3M13A 3CNJA 4YKGA 4YJHB 2BXRA 1JEHA 2BC0A 2C3CA 2FJAA 5ER0A 4YTNA 2ZZCA 4NTDA 4AOSA 4EQWA 4H2RA 4YJHA 3SGLA 4IA6A 1L9EA 3ALMA 3L8KA 1KDGA 2YG4A 2YR6A 3CMMA 4KX6A 4U2LA 4ADWA 4B66A 3EAOA 5BRTA 5M10A 3C4AA 3K7TA 3ADAB 1LJ1A 4QFDA 2EQ7A 4B68A 1ELIA 3ISHA 2B7SA 4KPRA 4Z43A 1MOKA 4Z24A 2YR4A 2E49A 3AECA 2GMJA 4GDEA 4TM3A 3C4NA 4CY6A 2R4EA 1D4CA 4B1BA 3DGHA 1P2HA 1EVIA 1F8RA 1JOAA 1NPXA 3T31A 4Y4MA 4PABA 2ACZA 3BHFA 2XVJA 1ONFA 5KOXA 3AE5A 5IQ1A 1FEBA 3V3NA 4Z26A 3NG7X 4NTCA 4OCGA 1GREA 3UTGA 1D5TA 2YVJA 1F6MA 1CC4A 1N4VA 2GH5A 4Y4NA 1EL5A 2R4JA 2XFPA 3UOXA 4EQXA 5IQ4A 4OPLA 2BABA 2JK6A 4U8NA 4A5LA 3V3OA 1PDHA 2GQFA 2CDUA 3LJPA 3UTEA 1BGJA 1GETA 1Z6LA 2JBVA 3D8XA 4JNAA 3C96A 1ZX9A 4CRTA 4EIPA 3T0KA 4B65A 5JCMA 2OALA 4NEVA 1H7XA 1GSNA 3BI5A 1RP0A 1DOCA 2BCGG 2OAMA 2OLNA 3QSSA 3GYJA 2JB2A 2Z5XA 2WOVA 1VG9A 3GD4A 3E1TA 2C67A 3UKQA 3UOVA 2RGHA 3CNSA 2C70A 2W0HA 4E0VA 2VRLA 3GMCA 5KRQA 3LZWA 3RP6A 1JNZA 5J7XA 2VVLG 4K2XA 1CL0A 1COYA 1B5QA 3LADA 4U8KA 3UCLA 4DNAA 3EF6A 2R46A 4RG3A 1PBFA 2QA1A 3AE4A 1H7WA 4G6HA 3EANA 1TDFA 2BXSA 1FEAA 2YG7A 2VVLA 1N1PA 2WDQA 1D7LA 2A87A 1LTXR 4U8MA 5U63A 2C3DA 2R0GA 2E4AA 4H4UA 2EQ9A 1KF6A 5C3JA 1IUTA 4BK3A 3PO7A 3URHA 2WBAA 4OVIA 3VRDB 4TM4A 4LU6A 2ZBWA 4G6GA 1HYUA 4H2NA 3AEDA 3OC4A 3QFBA 3QJ4A 5KWFA 3G5RA 4A9WA 4J36A 3CPHG 3FG2P 3VRAA 3AE1A 3T2ZA 4EIQA 3KPFA 5GRTA 1TDEA 1GRAA 2OLOA 4EMJA 1TYPA 4C3XA 1YKJA 4YJFA 4UP3A 1NG3A 3SFEA 4LA1A 4U8IA 2WEUA 2WETA 3KLJA 2E5VA 3RP8A 1JRXA 5EB5A 4Z2UA 2C76A 2X8HA 3CIRA 2AR8A 4YJDA 1E1NA 4CNJA 2AAQA 3B3RA 1S3BA 4CNKA 3P4QA 3NHOX 2FJBA 1KIFA 1F3PA 2E82A 2RGOA 2IVEA 3QSMA 4HA6A 1UKVG 5L46A 4FK1A 1H6VA 2RGJA 2XFUA 1N4UA 2WDRA 2V6OA 2GRTA 2JKCA 5IPYA 1JU2A 4TM1A 3DK8A 1GERA 3DMEA 3IWAA 1L9CA 2WU5A 3AE2A 3NGCX 1IUVA 2WU2A 3NTAA 4IV9A 4UDRA 4U2TA 4USRA 3G3EA 4AP1A 1CC6A 5TR3A 1PXCA 3KA7A 3VRBA 3AEEA 2A8XA 4Z44A 4H4WA 1PXBA 5BUKA 4NZHA 1CJ2A 3HYVA 3CUKA 4J2WA 2GR1A 2V5ZA 5FS6A 4BV6A 3SZFA 4C74A 4NTEA 4OPIA 1OJTA 3DGZA 4H4PA 1K0JA 4BJYA 1JRYA 1CJCA 1TDOA 1RYIA 4K22A 2YR5A 2YG5A 5FMHA 1PN0A 4I58A 4AT0A 3AE9A 3CTYA 3CPIG 4NEWA 4K8DA 1GRTA 2BC1A 5EOWA 1E6EA 3SFDA 3UKAA 3CNPA 5CQFA 2FJEA 4YSXA 2GEWA 3NH3X 2GMHA 3RP7A 2BACA 1XPQA 2GR2A 3WGTA 4DGKA 2WPCA 2QCUA 2XLSA 1CJ3A 3S5WA 2DU8A 4CCRA 5C2TA 3LB8A 4JY2A 1K0LA 2XLTA 3ALJA 2V61A 3AYJA 4RSLA 3ALLA 1ZMDA 2YVGA 1IUUA 2X3NA 2Q7VA 3HYXA 1NEKA 1QLBA 4C77A 3UTHA 4ICYA 3AD9B 2VVMA 4H2PA 3DJJA 3UKFA 3KD9A 4NNJA 2C73A 3GDPA 3BNUA 2V3AA 2WQYA 2X8CA 4J33A 3GYIA 5KVHA 3AEFA 1OJ9A 3DH9A 3ZNOA 1EL8A 3ITJA 4B63A 4CCQA 1XDIA 1GRFA 3AWIA 5U25A 4CBQA 1M64A 1DOEA 4BJZA 2RABA 3ICTA 1OJDA 1K0IA 1H81A 1YQ3A 3W4IA 4TLZA 2XFOA 3AEAA 4YJGB 4U8LA 1PJ7A 2X50A 5KOWA 2YQUA 4H4TA 2ZZBA 1NHSA 3AEGA 2A89A 2JAEA 4P9SA 3IHMA 1NG4A 3NYCA 3AD7B 3P4RA 3DK4A 3REDA 5KMSA 1SEZA 3M0OA 2YLTA 4GUVA 2XFNA 4BK1A 2YLRA 1NHPA 3AXBA 3G5SA 2GB0A 1D4EA 2QA2A 3KU9A 1Q1WA 1BWCA 3ICRA 4C3YA 1ZKQA 1LV0A 2B9XA 5M0ZA 4XWZA 4A6NB 5HHFA 3F8PA 3G5QA 3FMWA 3PS9A 1E1LA 1IJHA 1PBEA 1H82A 4Y4LA 4YTPA 4ECHA 4OPDA 1GRGA 1S3EA 2GR0A 4H4ZA 1TDNA 1GOSA 4A6NA 1PBCA 3NIXA 3H4KA 4EMWA 3ZNQA 1H84A 2VRMA 1TRBA 1FCDA 3AD8B 1GXFA 3NYFA 4H4YA 3DA1A 4N9XA 3PVCA 1TYTA 3AYLA 4YT0A 4YWOA 3SZWA 4J57A 4H50A 1FL2A 2VQBA 2BCPA 3I3LA 2XLRA 2IVDA 4I59A 1V59A 1IUWA 2BYBA 1CC2A 2XLUA 1DDOA 4K5SA 3HZLA 3NT6A 4UDQA 4EMIA 1C0PA 4QFCA 1LQUA 2Y6RA 2YAUA 3FPZA 1CF3A 1KFYA 1O95A 1DODA 1D4DA 4J34A 4ZCCA 2GR3A 3ZYXA 4B64A 1CHUA 3K30A 1PJ5A 4YKFA 2NVKX 3II4A 3W4JA 4OPTA 1ZK7A 3SQPA 1FOHA 1F8WA 5HYMA 4A7AA 1S2YA 3VQRA 1O94A 2GAHB 1GALA 3AYIA 3R9UA 3UKPA 2R0CA 1GV4A 1VDCA 1XANA 3S61A 4U8JA 1DOBA 1RSGA 1ZOVA 4B69A 4Z2TA 1VG0A 1C0KA 2Q0KA 4IVOB 4U8OA 4OPGA 5KXJA 2UZZA 3IHGA 2BK5A 1JNRA 3P4SA 4NWZA 3VR9A 4FDCB 5FS8A 3AE6A 2XDOA 4II3A 4BK2A 1L0VA 1Y56B 2XVFA 2C7GA 3I6DA 1BKWA 3M12A 1LQTA 2APGA 3L1RA 3SYIA 1PXAA 2B9WA 1BGNA 2PYXA 1CBOA 1DNCA 1S2QA 2H88A 2VQ7A 3COXA 3NKSA 4XWRA 3SZCA 4U8PA 3GRSA 1X31B 4HB9A 1ZY8A 3KKJA 1BZLA 4JDRA 1E1KA 3T2YA
chains in the Genus database with same CATH topology
3B6DA 3GD3A 2YWLA 4GRTA 4G73A 2V3BA 4JNQA 1QO8A 3CNDA 4GAVA 3NN0X 3LZXA 4H4SA 1EL9A 3RHAA 2JB1A 2WP5A 4U2SA 5HXIA 4H4XA 5GSNA 2E1MA 1F8SA 2TPRA 3GYXA 3GRTA 3IC9A 2E4GA 3OZ2A 2X8GA 3LOVA 4CY8A 1PBBA 4DSGA 3UKLA 4EM3A 2C4CA 1P2EA 2C72A 3KPKA 4G74A 4YTMA 1LPFA 2WS3A 2Q0LA 1PJ6A 2WHDA 3NK0X 4JQ9A 2EQ6A 1QJDA 3NNEA 3CGEA 3NK1X 1MO9A 2XVEA 1IUXA 3VR8A 2WOIA 2Z5YA 4J31A 3HYWA 3Q9TA 4H4RA 2NPXA 2WP6A 2F5ZA 2WOWA 4EM4A 2Y6QA 1L9DA 2FJDA 1H86A 4FK1C 1EL7A 4JY3A 3H8LA 4RG4A 1CJ4A 1PBDA 1PHHA 2C75A 4II2A 1GT8A 1W4XA 2AQJA 2BRAA 1VRQB 2J3NA 3SXIA 4BURA 4EQSA 2CFYA 5DBJA 4UDPA 1Q1RA 4REKA 1ZDLA 2TMDA 2CULA 3LXDA 4APNA 3NK2X 3ABVA 5U1OA 3F8DA 4GF7A 2YLZA 1MXTA 3AB1A 3DJEA 3V76A 2GV8A 2XVIA 3UTFA 3CNTA 4ZN0A 5KNLA 1ZMCA 3WE0A 1GESA 1GRHA 1NAAA 4YSZA 1PS9A 3NYEA 1GPEA 1YQ4A 1DJNA 3BNMA 2R45A 3P4PA 3AEBA 4M52A 2CVJA 1JRZA 4EQRA 1N4WA 4C5OA 4H4QA 1GRBA 1D7YA 2YM2A 3D1CA 3KVEA 2FBWA 4PAAA 5LV9A 3GWFA 3ATQA 4A99A 4TM0A 3AE8A 2EQ8A 4FX9A 3DK9A 4LIIA 4AOXA 3Q6JA 3FIMB 4DSHA 4D04A 1K4QA 2V60A 4TLXA 2BK4A 4AP3A 1NDAA 2B9YA 2GVCA 3CN8A 2DKHA 3GSIA 3UP5A 3QVRA 2YG3A 1AOGA 3F8RA 3NLCA 2I0ZA 4YSHA 1GTHA 3CGDA 4O5QA 2O9ZA 3BI4A 3T37A 1Q9IA 2BS4A 4J56A 1KNRA 3SZ0A 4XXGA 1NHQA 2R0PA 4GDPA 4OPUA 3QFAA 3T14A 2YLSA 3GMBA 1KSSA 5BVAA 4H2QA 1E7PA 5HY5A 4H7UA 3EPTA 4GAPA 1VQWA 1GEUA 2XYOA 4X9NA 2YVFA 3UKKA 4WX1A 2IIDA 3NRNA 2BRYA 2ZZ0A 3DJDA 2WP9A 2YG6A 3ZDNA 3BI2A 4A65A 4X4JA 5JCLA 2BS2A 5FS7A 4AT2A 1REOA 2C66A 1Y0PA 4IA5A 1B8SA 3CGBA 2ARDA 4IVMB 3UP4A 5KMPA 3P1WA 5KVIA 5CKUA 4ZCDA 1KNPA 2GF3A 5JCIA 5KMRA 4OPCA 2VZ2A 3SX6A 2H89A 5JCKA 2XFQA 1GTEA 2YM1A 2JB3A 3NTDA 2HQMA 2WPFA 4X9MA 4Z25A 4K7ZA 3UOYA 4H4VA 1M6IA 4D03A 1E1MA 2QAEA 4K5RA 4YXDA 1KSUA 1OJCA 1LVLA 2YLWA 1DJQA 1NENA 4B67A 2GAGB 2OA1A 1E39A 3BHKA 3DJGX 1IUSA 3QSEA 4GCMA 1Y56A 5J60A 2XLPA 2BA9A 1YY5A 2C65A 3SY4A 4O5UA 5EB4A 5JCNA 2R9ZA 5EBKA 3NN6X 1BF3A 1OJAA 2GQWA 4MJWA 1B4VA 3IF9A 5FS9A 3CGCA 2WDVA 1TDKA 2BS3A 4USQA 2XVHA 3SM8A 3O0HA 3GWDA 1ZOYA 2Q6UA 3GDNA 3P9UA 2B76A 3CPJG 1GNDA 3ICSA 2B7RA 3UKHA 2WPEA 2XCGA 2X99A 4GR1A 2BK3A 1YQZA 1XHCA 1O5WA 3JSKA 3AE7A 3T2KA 2C64A 1ZP0A 1H83A 3FBSA 1DXLA 5BULA 3K7MX 2DKIA 4G9KA 2WESA 1NHRA 4WCTA 1FECA 3AE3A 1B37A 3RNMA 3H8IA 1EBDA 2VOUA 3ATRA 3QVPA 3UOZA 2YLXA 4JN9A 3K7QX 4A79A 4YSYA 5KMQA 4Z2RA 2PHHA 3M13A 3CNJA 4YKGA 2BXRA 1JEHA 2BC0A 2C3CA 2FJAA 5ER0A 4YTNA 2ZZCA 4NTDA 4AOSA 4EQWA 4H2RA 3SGLA 4IA6A 3ALMA 1L9EA 3L8KA 1KDGA 2YG4A 2YR6A 3CMMA 4KX6A 4U2LA 4ADWA 4B66A 3EAOA 5BRTA 5M10A 3C4AA 3K7TA 3ADAB 1LJ1A 2EQ7A 4B68A 1ELIA 3ISHA 2B7SA 4KPRA 4Z43A 1MOKA 4Z24A 2YR4A 3AECA 2GMJA 4GDEA 4TM3A 3C4NA 4CY6A 2R4EA 1D4CA 4B1BA 3DGHA 1P2HA 3T31A 1F8RA 1JOAA 1NPXA 4Y4MA 4PABA 2ACZA 3BHFA 2XVJA 1ONFA 5KOXA 3AE5A 5IQ1A 1FEBA 3V3NA 4Z26A 3NG7X 4NTCA 4OCGA 1GREA 3UTGA 1D5TA 2YVJA 1F6MA 1CC4A 1N4VA 2GH5A 4Y4NA 1EL5A 2R4JA 2XFPA 3UOXA 4EQXA 5IQ4A 4OPLA 2BABA 2JK6A 4U8NA 4A5LA 3V3OA 1PDHA 2GQFA 2CDUA 3LJPA 3UTEA 1BGJA 1GETA 1Z6LA 2JBVA 3D8XA 4JNAA 3C96A 1ZX9A 4CRTA 4EIPA 3T0KA 4B65A 5JCMA 2OALA 4NEVA 1H7XA 1GSNA 3BI5A 1RP0A 1DOCA 2BCGG 2OAMA 2OLNA 3GYJA 3QSSA 2JB2A 2Z5XA 2WOVA 1VG9A 3GD4A 3E1TA 2C67A 3UKQA 3UOVA 2RGHA 3CNSA 2C70A 2W0HA 4E0VA 2VRLA 3GMCA 5KRQA 3LZWA 3RP6A 1JNZA 5J7XA 2VVLG 4K2XA 1CL0A 1COYA 1B5QA 3LADA 4U8KA 3UCLA 4DNAA 3EF6A 2R46A 4RG3A 1PBFA 2QA1A 3AE4A 1H7WA 4G6HA 3EANA 1TDFA 2BXSA 1FEAA 2YG7A 2VVLA 1N1PA 2WDQA 1D7LA 2A87A 1LTXR 4U8MA 5U63A 2C3DA 2R0GA 4H4UA 2EQ9A 1KF6A 5C3JA 1IUTA 4BK3A 3PO7A 3URHA 2WBAA 4OVIA 3VRDB 4TM4A 4LU6A 2ZBWA 4G6GA 1HYUA 4H2NA 3AEDA 3OC4A 3QFBA 3QJ4A 5KWFA 3G5RA 4A9WA 4J36A 3CPHG 3FG2P 3VRAA 3AE1A 3T2ZA 4EIQA 3KPFA 5GRTA 1TDEA 1GRAA 2OLOA 4EMJA 1TYPA 4C3XA 1YKJA 4UP3A 1NG3A 3SFEA 4LA1A 4U8IA 2WEUA 2WETA 3KLJA 2E5VA 3RP8A 1JRXA 5EB5A 4Z2UA 2C76A 2X8HA 3CIRA 2AR8A 4CNJA 1E1NA 2AAQA 3B3RA 1S3BA 4CNKA 3P4QA 3NHOX 2FJBA 1F3PA 2IVEA 2RGOA 3QSMA 4HA6A 1UKVG 5L46A 4FK1A 1H6VA 2RGJA 2XFUA 1N4UA 2WDRA 2V6OA 2GRTA 2JKCA 5IPYA 1JU2A 4TM1A 3DK8A 1GERA 3DMEA 3IWAA 1L9CA 2WU5A 3AE2A 3NGCX 1IUVA 2WU2A 3NTAA 4IV9A 4UDRA 4U2TA 4USRA 4AP1A 1CC6A 5TR3A 1PXCA 3KA7A 3VRBA 3AEEA 2A8XA 4Z44A 4H4WA 1PXBA 5BUKA 4NZHA 1CJ2A 3HYVA 4J2WA 2GR1A 2V5ZA 5FS6A 4BV6A 3SZFA 4C74A 4NTEA 4OPIA 1OJTA 3DGZA 4H4PA 4BJYA 1K0JA 1JRYA 1CJCA 1TDOA 4K22A 1RYIA 2YR5A 2YG5A 5FMHA 1PN0A 4I58A 4AT0A 3AE9A 3CTYA 3CPIG 4NEWA 4K8DA 1GRTA 2BC1A 5EOWA 1E6EA 3SFDA 3UKAA 3CNPA 5CQFA 2FJEA 4YSXA 2GEWA 3NH3X 2GMHA 3RP7A 2BACA 1XPQA 2GR2A 4DGKA 2WPCA 2QCUA 2XLSA 1CJ3A 3S5WA 4CCRA 5C2TA 3LB8A 4JY2A 1K0LA 2XLTA 3ALJA 2V61A 3AYJA 4RSLA 3ALLA 1ZMDA 2YVGA 1IUUA 2X3NA 2Q7VA 3HYXA 1NEKA 1QLBA 4C77A 3UTHA 4ICYA 3AD9B 2VVMA 4H2PA 3DJJA 3UKFA 3KD9A 4NNJA 2C73A 3GDPA 3BNUA 2V3AA 2WQYA 2X8CA 4J33A 3GYIA 5KVHA 3AEFA 1OJ9A 3DH9A 1EL8A 3ITJA 4B63A 4CCQA 1XDIA 1GRFA 3AWIA 5U25A 4CBQA 1M64A 4BJZA 1DOEA 2RABA 3ICTA 1OJDA 1K0IA 1H81A 1YQ3A 4TLZA 2XFOA 3AEAA 4U8LA 1PJ7A 2X50A 5KOWA 2YQUA 4H4TA 2ZZBA 1NHSA 3AEGA 2A89A 2JAEA 4P9SA 3IHMA 1NG4A 3NYCA 3AD7B 3P4RA 3DK4A 3REDA 5KMSA 1SEZA 2YLTA 3M0OA 4GUVA 2XFNA 4BK1A 2YLRA 1NHPA 3AXBA 3G5SA 2GB0A 1D4EA 2QA2A 3KU9A 1Q1WA 1BWCA 3ICRA 4C3YA 1ZKQA 1LV0A 2B9XA 5M0ZA 4XWZA 4A6NB 5HHFA 3F8PA 3G5QA 3FMWA 1E1LA 3PS9A 1IJHA 1PBEA 1H82A 4Y4LA 4YTPA 4ECHA 4OPDA 1GRGA 1S3EA 2GR0A 4H4ZA 1TDNA 1GOSA 4A6NA 1PBCA 3NIXA 3H4KA 4EMWA 1H84A 2VRMA 1TRBA 1FCDA 3AD8B 1GXFA 3NYFA 4H4YA 3DA1A 4N9XA 3PVCA 1TYTA 3AYLA 4YT0A 4YWOA 3SZWA 4J57A 4H50A 1FL2A 2VQBA 2BCPA 3I3LA 2XLRA 2IVDA 4I59A 1V59A 1IUWA 2BYBA 1CC2A 2XLUA 4K5SA 3HZLA 3NT6A 4UDQA 4EMIA 1LQUA 2Y6RA 2YAUA 3FPZA 1CF3A 1KFYA 1O95A 1D4DA 1DODA 4J34A 4ZCCA 2GR3A 3ZYXA 4B64A 1CHUA 3K30A 1PJ5A 4YKFA 2NVKX 3II4A 4OPTA 1ZK7A 3SQPA 1FOHA 1F8WA 5HYMA 4A7AA 1S2YA 3VQRA 1O94A 1GALA 2GAHB 3AYIA 3R9UA 3UKPA 2R0CA 1GV4A 1VDCA 1XANA 3S61A 4U8JA 1DOBA 1RSGA 1ZOVA 4B69A 4Z2TA 1VG0A 2Q0KA 4IVOB 4U8OA 5KXJA 4OPGA 3IHGA 2UZZA 2BK5A 1JNRA 3P4SA 4NWZA 3VR9A 4FDCB 5FS8A 3AE6A 2XDOA 4II3A 4BK2A 1L0VA 1Y56B 2XVFA 2C7GA 3I6DA 1BKWA 1LQTA 2APGA 3L1RA 3M12A 3SYIA 1PXAA 2B9WA 1BGNA 2PYXA 1CBOA 1DNCA 1S2QA 2H88A 2VQ7A 3COXA 3NKSA 4XWRA 3SZCA 4U8PA 3GRSA 1X31B 4HB9A 1ZY8A 3KKJA 1BZLA 4JDRA 1E1KA 3T2YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6D A;  3GD3 A;  2YWL A;  4GRT A;  2V3B A;  4JNQ A;  1QO8 A;  3CND A;  3NN0 X;  3LZX A;  4H4S A;  1EL9 A;  3RHA A;  2JB1 A;  2WP5 A;  4U2S A;  5HXI A;  4H4X A;  5GSN A;  2E1M A;  1F8S A;  2TPR A;  3GRT A;  3IC9 A;  2E4G A;  3OZ2 A;  2X8G A;  3LOV A;  4CY8 A;  1PBB A;  4DSG A;  3UKL A;  4EM3 A;  1P2E A;  2C72 A;  4YTM A;  1LPF A;  2WS3 A;  2Q0L A;  1PJ6 A;  2WHD A;  3NK0 X;  4JQ9 A;  2EQ6 A;  1QJD A;  3NNE A;  3CGE A;  3NK1 X;  1MO9 A;  2XVE A;  1IUX A;  3VR8 A;  2WOI A;  2Z5Y A;  4J31 A;  3Q9T A;  4H4R A;  2NPX A;  2WP6 A;  2F5Z A;  2WOW A;  4EM4 A;  2Y6Q A;  1L9D A;  2FJD A;  1H86 A;  4FK1 C;  1EL7 A;  4JY3 A;  3H8L A;  4RG4 A;  1CJ4 A;  1PBD A;  1PHH A;  2C75 A;  1GT8 A;  1W4X A;  2AQJ A;  2J3N A;  1VRQ B;  4BUR A;  4EQS A;  2CFY A;  5DBJ A;  4UDP A;  1Q1R A;  4REK A;  1ZDL A;  2TMD A;  2CUL A;  3LXD A;  4APN A;  3NK2 X;  3ABV A;  5U1O A;  3F8D A;  4GF7 A;  2YLZ A;  1MXT A;  3AB1 A;  3DJE A;  3V76 A;  2GV8 A;  2XVI A;  3UTF A;  3CNT A;  4ZN0 A;  1ZMC A;  3WE0 A;  1GES A;  1GRH A;  1NAA A;  4YSZ A;  1PS9 A;  3NYE A;  1GPE A;  1YQ4 A;  1DJN A;  3BNM A;  2R45 A;  3P4P A;  3AEB A;  4M52 A;  2CVJ A;  1JRZ A;  4EQR A;  1N4W A;  4C5O A;  4H4Q A;  1GRB A;  1D7Y A;  2YM2 A;  3D1C A;  3KVE A;  2FBW A;  4PAA A;  5LV9 A;  3GWF A;  3ATQ A;  4A99 A;  4TM0 A;  3AE8 A;  2EQ8 A;  4FX9 A;  3DK9 A;  4LII A;  4AOX A;  3Q6J A;  3FIM B;  4DSH A;  4D04 A;  1K4Q A;  2V60 A;  4TLX A;  2BK4 A;  4AP3 A;  1NDA A;  2B9Y A;  2GVC A;  3CN8 A;  2DKH A;  3GSI A;  3UP5 A;  3QVR A;  2YG3 A;  1AOG A;  3F8R A;  3NLC A;  2I0Z A;  4YSH A;  1GTH A;  3CGD A;  4O5Q A;  2O9Z A;  3BI4 A;  3T37 A;  1Q9I A;  2BS4 A;  4J56 A;  1KNR A;  4XXG A;  1NHQ A;  2R0P A;  4GDP A;  4OPU A;  3QFA A;  2YLS A;  3GMB A;  1KSS A;  5BVA A;  4H2Q A;  1E7P A;  5HY5 A;  4H7U A;  3EPT A;  1VQW A;  1GEU A;  2XYO A;  4X9N A;  2YVF A;  3UKK A;  4WX1 A;  2IID A;  3NRN A;  2ZZ0 A;  3DJD A;  2WP9 A;  2YG6 A;  3ZDN A;  3BI2 A;  4A65 A;  4X4J A;  5JCL A;  2BS2 A;  5FS7 A;  4AT2 A;  1REO A;  2C66 A;  1Y0P A;  4IA5 A;  1B8S A;  3CGB A;  2ARD A;  4IVM B;  3UP4 A;  3P1W A;  5KVI A;  5CKU A;  4ZCD A;  1KNP A;  2GF3 A;  5JCI A;  4OPC A;  2VZ2 A;  2H89 A;  5JCK A;  2XFQ A;  1GTE A;  2YM1 A;  2JB3 A;  3NTD A;  2HQM A;  2WPF A;  4X9M A;  4Z25 A;  4K7Z A;  3UOY A;  4H4V A;  1M6I A;  4D03 A;  1E1M A;  2QAE A;  4K5R A;  4YXD A;  1KSU A;  1OJC A;  1LVL A;  2YLW A;  1DJQ A;  1NEN A;  4B67 A;  2GAG B;  2OA1 A;  1E39 A;  3BHK A;  3DJG X;  1IUS A;  3QSE A;  4GCM A;  1Y56 A;  5J60 A;  2XLP A;  2BA9 A;  1YY5 A;  2C65 A;  4O5U A;  5EB4 A;  5JCN A;  2R9Z A;  5EBK A;  3NN6 X;  1BF3 A;  1OJA A;  2GQW A;  4MJW A;  1B4V A;  3IF9 A;  5FS9 A;  3CGC A;  2WDV A;  1TDK A;  2BS3 A;  4USQ A;  2XVH A;  3SM8 A;  3O0H A;  3GWD A;  1ZOY A;  2Q6U A;  3GDN A;  3P9U A;  2B76 A;  3CPJ G;  1GND A;  3ICS A;  2B7R A;  3UKH A;  2WPE A;  2XCG A;  2X99 A;  4GR1 A;  2BK3 A;  1YQZ A;  1XHC A;  1O5W A;  3JSK A;  3AE7 A;  2C64 A;  1ZP0 A;  1H83 A;  3FBS A;  1DXL A;  5BUL A;  3K7M X;  2DKI A;  2WES A;  1NHR A;  4WCT A;  1FEC A;  3AE3 A;  1B37 A;  3RNM A;  3H8I A;  1EBD A;  2VOU A;  3ATR A;  3QVP A;  3UOZ A;  2YLX A;  4JN9 A;  3K7Q X;  4A79 A;  4YSY A;  4Z2R A;  2PHH A;  3M13 A;  3CNJ A;  4YKG A;  2BXR A;  1JEH A;  2BC0 A;  2C3C A;  2FJA A;  5ER0 A;  4YTN A;  2ZZC A;  4NTD A;  4AOS A;  4EQW A;  4H2R A;  3SGL A;  4IA6 A;  3ALM A;  1L9E A;  3L8K A;  1KDG A;  2YG4 A;  2YR6 A;  4KX6 A;  4U2L A;  4ADW A;  4B66 A;  5BRT A;  3EAO A;  5M10 A;  3C4A A;  3K7T A;  3ADA B;  1LJ1 A;  2EQ7 A;  4B68 A;  1ELI A;  3ISH A;  2B7S A;  4KPR A;  4Z43 A;  1MOK A;  4Z24 A;  2YR4 A;  3AEC A;  2GMJ A;  4GDE A;  4TM3 A;  3C4N A;  4CY6 A;  2R4E A;  1D4C A;  4B1B A;  3DGH A;  1P2H A;  1F8R A;  1JOA A;  1NPX A;  4Y4M A;  4PAB A;  2ACZ A;  3BHF A;  2XVJ A;  1ONF A;  5KOX A;  3AE5 A;  5IQ1 A;  1FEB A;  3V3N A;  4Z26 A;  3NG7 X;  4NTC A;  4OCG A;  1GRE A;  3UTG A;  1D5T A;  2YVJ A;  1F6M A;  1CC4 A;  1N4V A;  2GH5 A;  4Y4N A;  1EL5 A;  2R4J A;  2XFP A;  3UOX A;  4EQX A;  5IQ4 A;  4OPL A;  2BAB A;  2JK6 A;  4U8N A;  4A5L A;  3V3O A;  1PDH A;  2GQF A;  2CDU A;  3LJP A;  3UTE A;  1BGJ A;  1GET A;  1Z6L A;  2JBV A;  3D8X A;  4JNA A;  1ZX9 A;  3C96 A;  4CRT A;  4EIP A;  4B65 A;  5JCM A;  2OAL A;  4NEV A;  1H7X A;  1GSN A;  3BI5 A;  1RP0 A;  1DOC A;  2BCG G;  2OAM A;  2OLN A;  3GYJ A;  3QSS A;  2JB2 A;  2Z5X A;  2WOV A;  1VG9 A;  3GD4 A;  2C67 A;  3E1T A;  3UKQ A;  3UOV A;  2RGH A;  3CNS A;  2C70 A;  2W0H A;  4E0V A;  2VRL A;  3GMC A;  5KRQ A;  3LZW A;  1JNZ A;  5J7X A;  3RP6 A;  2VVL G;  4K2X A;  1CL0 A;  1COY A;  1B5Q A;  3LAD A;  4U8K A;  3UCL A;  4DNA A;  3EF6 A;  2R46 A;  4RG3 A;  1PBF A;  2QA1 A;  3AE4 A;  1H7W A;  3EAN A;  1TDF A;  2BXS A;  1FEA A;  2YG7 A;  2VVL A;  1N1P A;  2WDQ A;  1D7L A;  2A87 A;  1LTX R;  4U8M A;  5U63 A;  2C3D A;  2R0G A;  4H4U A;  2EQ9 A;  1KF6 A;  5C3J A;  1IUT A;  4BK3 A;  3PO7 A;  3URH A;  2WBA A;  4OVI A;  3VRD B;  4TM4 A;  4LU6 A;  2ZBW A;  1HYU A;  4H2N A;  3AED A;  3OC4 A;  3QFB A;  3QJ4 A;  5KWF A;  3G5R A;  4A9W A;  4J36 A;  3CPH G;  3FG2 P;  3VRA A;  3AE1 A;  4EIQ A;  3KPF A;  5GRT A;  1TDE A;  1GRA A;  2OLO A;  4EMJ A;  1TYP A;  4C3X A;  1YKJ A;  4UP3 A;  1NG3 A;  3SFE A;  4LA1 A;  4U8I A;  2WEU A;  2WET A;  3KLJ A;  2E5V A;  3RP8 A;  1JRX A;  5EB5 A;  4Z2U A;  2C76 A;  2X8H A;  3CIR A;  2AR8 A;  4CNJ A;  1E1N A;  2AAQ A;  3B3R A;  1S3B A;  4CNK A;  3P4Q A;  3NHO X;  2FJB A;  1F3P A;  2IVE A;  2RGO A;  3QSM A;  4HA6 A;  1UKV G;  5L46 A;  4FK1 A;  1H6V A;  2RGJ A;  2XFU A;  1N4U A;  2WDR A;  2V6O A;  2GRT A;  2JKC A;  5IPY A;  1JU2 A;  4TM1 A;  3DK8 A;  1GER A;  3DME A;  3IWA A;  1L9C A;  2WU5 A;  3AE2 A;  3NGC X;  1IUV A;  2WU2 A;  3NTA A;  4IV9 A;  4UDR A;  4U2T A;  4USR A;  4AP1 A;  1CC6 A;  5TR3 A;  1PXC A;  3KA7 A;  3VRB A;  3AEE A;  2A8X A;  4Z44 A;  4H4W A;  1PXB A;  5BUK A;  4NZH A;  1CJ2 A;  4J2W A;  2GR1 A;  2V5Z A;  5FS6 A;  4BV6 A;  4C74 A;  4NTE A;  4OPI A;  1OJT A;  3DGZ A;  4H4P A;  1K0J A;  4BJY A;  1JRY A;  1CJC A;  1TDO A;  4K22 A;  1RYI A;  2YR5 A;  2YG5 A;  5FMH A;  1PN0 A;  4I58 A;  4AT0 A;  3AE9 A;  3CTY A;  3CPI G;  4NEW A;  4K8D A;  1GRT A;  2BC1 A;  5EOW A;  1E6E A;  3SFD A;  3UKA A;  3CNP A;  5CQF A;  2FJE A;  4YSX A;  2GEW A;  3NH3 X;  2GMH A;  3RP7 A;  2BAC A;  1XPQ A;  2GR2 A;  4DGK A;  2WPC A;  2QCU A;  2XLS A;  1CJ3 A;  3S5W A;  4CCR A;  5C2T A;  3LB8 A;  4JY2 A;  1K0L A;  2XLT A;  3ALJ A;  2V61 A;  3AYJ A;  4RSL A;  3ALL A;  1ZMD A;  2YVG A;  1IUU A;  2X3N A;  2Q7V A;  1NEK A;  1QLB A;  4C77 A;  3UTH A;  4ICY A;  3AD9 B;  2VVM A;  4H2P A;  3DJJ A;  3UKF A;  3KD9 A;  2C73 A;  3GDP A;  3BNU A;  2V3A A;  2WQY A;  2X8C A;  4J33 A;  3GYI A;  5KVH A;  3AEF A;  1OJ9 A;  3DH9 A;  1EL8 A;  3ITJ A;  4B63 A;  4CCQ A;  1XDI A;  1GRF A;  3AWI A;  5U25 A;  4CBQ A;  1M64 A;  1DOE A;  2RAB A;  4BJZ A;  3ICT A;  1OJD A;  1K0I A;  1H81 A;  1YQ3 A;  4TLZ A;  2XFO A;  3AEA A;  4U8L A;  1PJ7 A;  2X50 A;  5KOW A;  2YQU A;  4H4T A;  2ZZB A;  1NHS A;  3AEG A;  2A89 A;  2JAE A;  4P9S A;  3IHM A;  1NG4 A;  3NYC A;  3AD7 B;  3P4R A;  3DK4 A;  3RED A;  1SEZ A;  2YLT A;  3M0O A;  4GUV A;  2XFN A;  2YLR A;  4BK1 A;  1NHP A;  3AXB A;  3G5S A;  2GB0 A;  1D4E A;  2QA2 A;  3KU9 A;  1Q1W A;  1BWC A;  3ICR A;  4C3Y A;  1ZKQ A;  1LV0 A;  2B9X A;  5M0Z A;  4XWZ A;  4A6N B;  5HHF A;  3F8P A;  3G5Q A;  3FMW A;  1E1L A;  3PS9 A;  1IJH A;  1PBE A;  1H82 A;  4Y4L A;  4YTP A;  4ECH A;  4OPD A;  1GRG A;  1S3E A;  2GR0 A;  4H4Z A;  1TDN A;  1GOS A;  4A6N A;  1PBC A;  3NIX A;  3H4K A;  4EMW A;  1H84 A;  2VRM A;  1TRB A;  1FCD A;  3AD8 B;  1GXF A;  3NYF A;  4H4Y A;  3DA1 A;  4N9X A;  3PVC A;  1TYT A;  3AYL A;  4YT0 A;  4YWO A;  4J57 A;  4H50 A;  1FL2 A;  2VQB A;  2BCP A;  3I3L A;  2XLR A;  2IVD A;  4I59 A;  1V59 A;  1IUW A;  2BYB A;  1CC2 A;  2XLU A;  4K5S A;  3HZL A;  3NT6 A;  4UDQ A;  4EMI A;  1LQU A;  2Y6R A;  2YAU A;  3FPZ A;  1CF3 A;  1KFY A;  1O95 A;  1D4D A;  1DOD A;  4J34 A;  4ZCC A;  2GR3 A;  3ZYX A;  4B64 A;  1CHU A;  3K30 A;  1PJ5 A;  4YKF A;  2NVK X;  3II4 A;  4OPT A;  1ZK7 A;  3SQP A;  1FOH A;  1F8W A;  4A7A A;  5HYM A;  1S2Y A;  3VQR A;  1O94 A;  1GAL A;  2GAH B;  3AYI A;  3R9U A;  3UKP A;  2R0C A;  1GV4 A;  1VDC A;  1XAN A;  3S61 A;  4U8J A;  1DOB A;  1RSG A;  1ZOV A;  4B69 A;  4Z2T A;  1VG0 A;  2Q0K A;  4IVO B;  4U8O A;  5KXJ A;  4OPG A;  3IHG A;  2UZZ A;  2BK5 A;  1JNR A;  3P4S A;  3VR9 A;  4FDC B;  5FS8 A;  3AE6 A;  2XDO A;  4BK2 A;  1L0V A;  1Y56 B;  2XVF A;  2C7G A;  3I6D A;  1BKW A;  1LQT A;  2APG A;  3L1R A;  3M12 A;  1PXA A;  2B9W A;  1BGN A;  2PYX A;  1CBO A;  1DNC A;  1S2Q A;  2H88 A;  2VQ7 A;  3COX A;  3NKS A;  4XWR A;  4U8P A;  3GRS A;  1X31 B;  4HB9 A;  1ZY8 A;  3KKJ A;  1BZL A;  4JDR A;  1E1K A; 
#chains in the Genus database with same CATH topology
 3B6D A;  3GD3 A;  2YWL A;  4GRT A;  4G73 A;  2V3B A;  4JNQ A;  1QO8 A;  3CND A;  4GAV A;  3NN0 X;  3LZX A;  4H4S A;  1EL9 A;  3RHA A;  2JB1 A;  2WP5 A;  4U2S A;  5HXI A;  4H4X A;  5GSN A;  2E1M A;  1F8S A;  2TPR A;  3GYX A;  3GRT A;  3IC9 A;  2E4G A;  3OZ2 A;  2X8G A;  3LOV A;  4CY8 A;  1PBB A;  4DSG A;  3UKL A;  4EM3 A;  2C4C A;  1P2E A;  2C72 A;  3KPK A;  4G74 A;  4YTM A;  1LPF A;  2WS3 A;  3W4K A;  2Q0L A;  1PJ6 A;  2WHD A;  3NK0 X;  4JQ9 A;  2EQ6 A;  1QJD A;  3NNE A;  3CGE A;  3NK1 X;  1MO9 A;  2XVE A;  1IUX A;  3VR8 A;  2WOI A;  2Z5Y A;  4J31 A;  3HYW A;  3Q9T A;  4H4R A;  2NPX A;  2WP6 A;  2F5Z A;  2WOW A;  4EM4 A;  2Y6Q A;  1L9D A;  2FJD A;  1H86 A;  4FK1 C;  1EL7 A;  4JY3 A;  3H8L A;  4RG4 A;  1CJ4 A;  1PBD A;  1PHH A;  2C75 A;  4II2 A;  1GT8 A;  1W4X A;  2AQJ A;  2BRA A;  1VRQ B;  2J3N A;  3SXI A;  4BUR A;  4EQS A;  2CFY A;  5DBJ A;  4UDP A;  1Q1R A;  4REK A;  1ZDL A;  3ZNN A;  2TMD A;  2CUL A;  3LXD A;  4APN A;  3NK2 X;  3ABV A;  5U1O A;  3F8D A;  4GF7 A;  2YLZ A;  1MXT A;  3AB1 A;  3DJE A;  3V76 A;  2GV8 A;  2XVI A;  1AN9 A;  3CNT A;  3UTF A;  4ZN0 A;  1ZMC A;  3WE0 A;  5KNL A;  1GES A;  1GRH A;  1NAA A;  4YSZ A;  1PS9 A;  3NYE A;  1GPE A;  1YQ4 A;  1DJN A;  3BNM A;  2R45 A;  3P4P A;  3AEB A;  4M52 A;  2CVJ A;  1JRZ A;  4EQR A;  1N4W A;  4C5O A;  4H4Q A;  1GRB A;  1D7Y A;  2YM2 A;  3D1C A;  3KVE A;  4PAA A;  4YJG A;  2FBW A;  5LV9 A;  3GWF A;  3ATQ A;  4A99 A;  4TM0 A;  3AE8 A;  2EQ8 A;  4FX9 A;  3DK9 A;  4LII A;  4AOX A;  3Q6J A;  3FIM B;  4DSH A;  4D04 A;  1K4Q A;  2V60 A;  4TLX A;  2BK4 A;  4AP3 A;  1NDA A;  2B9Y A;  2GVC A;  3CN8 A;  2DKH A;  3GSI A;  3UP5 A;  3QVR A;  2YG3 A;  1AOG A;  3F8R A;  3NLC A;  2I0Z A;  4YSH A;  1GTH A;  3CGD A;  4O5Q A;  2O9Z A;  3BI4 A;  3T37 A;  1Q9I A;  2BS4 A;  4J56 A;  1KNR A;  3SZ0 A;  4XXG A;  1NHQ A;  2R0P A;  4GDP A;  4OPU A;  3QFA A;  3T14 A;  2YLS A;  3GMB A;  1KSS A;  5BVA A;  4H2Q A;  1E7P A;  5HY5 A;  4H7U A;  3EPT A;  4GAP A;  1VQW A;  1VE9 A;  4X9N A;  1GEU A;  2XYO A;  2YVF A;  3UKK A;  4WX1 A;  2IID A;  3NRN A;  2BRY A;  3DJD A;  2ZZ0 A;  2WP9 A;  2YG6 A;  3ZDN A;  3BI2 A;  4A65 A;  4X4J A;  5JCL A;  2BS2 A;  5FS7 A;  4AT2 A;  1DAO A;  1REO A;  3ZNP A;  2C66 A;  4IA5 A;  1Y0P A;  1B8S A;  3CGB A;  2ARD A;  4IVM B;  3UP4 A;  5KMP A;  3P1W A;  5KVI A;  5CKU A;  4ZCD A;  2GF3 A;  1KNP A;  5JCI A;  5KMR A;  4OPC A;  2VZ2 A;  3SX6 A;  2H89 A;  5JCK A;  2XFQ A;  1GTE A;  2YM1 A;  4YJF B;  2JB3 A;  4X9M A;  2HQM A;  2WPF A;  3NTD A;  4Z25 A;  4K7Z A;  3UOY A;  4H4V A;  1M6I A;  4D03 A;  1E1M A;  2QAE A;  4K5R A;  4YXD A;  1KSU A;  1OJC A;  1LVL A;  2YLW A;  1DJQ A;  1NEN A;  4B67 A;  2GAG B;  2OA1 A;  3BHK A;  1E39 A;  3DJG X;  1IUS A;  3QSE A;  4GCM A;  1Y56 A;  5J60 A;  2XLP A;  2BA9 A;  1YY5 A;  2C65 A;  3SY4 A;  4O5U A;  5EB4 A;  5JCN A;  2E48 A;  2R9Z A;  5EBK A;  3NN6 X;  1BF3 A;  1OJA A;  2GQW A;  4MJW A;  1B4V A;  3IF9 A;  5FS9 A;  3CGC A;  2WDV A;  1TDK A;  2BS3 A;  3SM8 A;  2XVH A;  4USQ A;  3O0H A;  3GWD A;  2Q6U A;  1ZOY A;  3GDN A;  3P9U A;  2B76 A;  3CPJ G;  1GND A;  3ICS A;  2B7R A;  3UKH A;  2WPE A;  2XCG A;  2X99 A;  4GR1 A;  2BK3 A;  1YQZ A;  1C0I A;  1XHC A;  1O5W A;  3JSK A;  3AE7 A;  3T2K A;  2C64 A;  1ZP0 A;  1H83 A;  3FBS A;  1DXL A;  5BUL A;  3K7M X;  2DKI A;  4G9K A;  2WES A;  1NHR A;  1C0L A;  4WCT A;  1FEC A;  3AE3 A;  1B37 A;  3RNM A;  3H8I A;  1EBD A;  2VOU A;  3ATR A;  3QVP A;  3UOZ A;  2YLX A;  4JN9 A;  3K7Q X;  4A79 A;  4YSY A;  5KMQ A;  4Z2R A;  2PHH A;  3M13 A;  3CNJ A;  4YKG A;  4YJH B;  2BXR A;  1JEH A;  2BC0 A;  2C3C A;  2FJA A;  5ER0 A;  4YTN A;  2ZZC A;  4NTD A;  4AOS A;  4EQW A;  4H2R A;  4YJH A;  3SGL A;  4IA6 A;  1L9E A;  3ALM A;  3L8K A;  1KDG A;  2YG4 A;  2YR6 A;  3CMM A;  4KX6 A;  4U2L A;  4ADW A;  4B66 A;  3EAO A;  5BRT A;  5M10 A;  3C4A A;  3K7T A;  3ADA B;  1LJ1 A;  4QFD A;  2EQ7 A;  4B68 A;  1ELI A;  3ISH A;  2B7S A;  4KPR A;  4Z43 A;  1MOK A;  4Z24 A;  2YR4 A;  2E49 A;  3AEC A;  2GMJ A;  4GDE A;  4TM3 A;  3C4N A;  4CY6 A;  2R4E A;  1D4C A;  4B1B A;  3DGH A;  1P2H A;  1EVI A;  1F8R A;  1JOA A;  1NPX A;  3T31 A;  4Y4M A;  4PAB A;  2ACZ A;  3BHF A;  2XVJ A;  1ONF A;  5KOX A;  3AE5 A;  5IQ1 A;  1FEB A;  3V3N A;  4Z26 A;  3NG7 X;  4NTC A;  4OCG A;  1GRE A;  3UTG A;  1D5T A;  2YVJ A;  1F6M A;  1CC4 A;  1N4V A;  2GH5 A;  4Y4N A;  1EL5 A;  2R4J A;  2XFP A;  3UOX A;  4EQX A;  5IQ4 A;  4OPL A;  2BAB A;  2JK6 A;  4U8N A;  4A5L A;  3V3O A;  1PDH A;  2GQF A;  2CDU A;  3LJP A;  3UTE A;  1BGJ A;  1GET A;  1Z6L A;  2JBV A;  3D8X A;  4JNA A;  3C96 A;  1ZX9 A;  4CRT A;  4EIP A;  3T0K A;  4B65 A;  5JCM A;  2OAL A;  4NEV A;  1H7X A;  1GSN A;  3BI5 A;  1RP0 A;  1DOC A;  2BCG G;  2OAM A;  2OLN A;  3QSS A;  3GYJ A;  2JB2 A;  2Z5X A;  2WOV A;  1VG9 A;  3GD4 A;  3E1T A;  2C67 A;  3UKQ A;  3UOV A;  2RGH A;  3CNS A;  2C70 A;  2W0H A;  4E0V A;  2VRL A;  3GMC A;  5KRQ A;  3LZW A;  3RP6 A;  1JNZ A;  5J7X A;  2VVL G;  4K2X A;  1CL0 A;  1COY A;  1B5Q A;  3LAD A;  4U8K A;  3UCL A;  4DNA A;  3EF6 A;  2R46 A;  4RG3 A;  1PBF A;  2QA1 A;  3AE4 A;  1H7W A;  4G6H A;  3EAN A;  1TDF A;  2BXS A;  1FEA A;  2YG7 A;  2VVL A;  1N1P A;  2WDQ A;  1D7L A;  2A87 A;  1LTX R;  4U8M A;  5U63 A;  2C3D A;  2R0G A;  2E4A A;  4H4U A;  2EQ9 A;  1KF6 A;  5C3J A;  1IUT A;  4BK3 A;  3PO7 A;  3URH A;  2WBA A;  4OVI A;  3VRD B;  4TM4 A;  4LU6 A;  2ZBW A;  4G6G A;  1HYU A;  4H2N A;  3AED A;  3OC4 A;  3QFB A;  3QJ4 A;  5KWF A;  3G5R A;  4A9W A;  4J36 A;  3CPH G;  3FG2 P;  3VRA A;  3AE1 A;  3T2Z A;  4EIQ A;  3KPF A;  5GRT A;  1TDE A;  1GRA A;  2OLO A;  4EMJ A;  1TYP A;  4C3X A;  1YKJ A;  4YJF A;  4UP3 A;  1NG3 A;  3SFE A;  4LA1 A;  4U8I A;  2WEU A;  2WET A;  3KLJ A;  2E5V A;  3RP8 A;  1JRX A;  5EB5 A;  4Z2U A;  2C76 A;  2X8H A;  3CIR A;  2AR8 A;  4YJD A;  1E1N A;  4CNJ A;  2AAQ A;  3B3R A;  1S3B A;  4CNK A;  3P4Q A;  3NHO X;  2FJB A;  1KIF A;  1F3P A;  2E82 A;  2RGO A;  2IVE A;  3QSM A;  4HA6 A;  1UKV G;  5L46 A;  4FK1 A;  1H6V A;  2RGJ A;  2XFU A;  1N4U A;  2WDR A;  2V6O A;  2GRT A;  2JKC A;  5IPY A;  1JU2 A;  4TM1 A;  3DK8 A;  1GER A;  3DME A;  3IWA A;  1L9C A;  2WU5 A;  3AE2 A;  3NGC X;  1IUV A;  2WU2 A;  3NTA A;  4IV9 A;  4UDR A;  4U2T A;  4USR A;  3G3E A;  4AP1 A;  1CC6 A;  5TR3 A;  1PXC A;  3KA7 A;  3VRB A;  3AEE A;  2A8X A;  4Z44 A;  4H4W A;  1PXB A;  5BUK A;  4NZH A;  1CJ2 A;  3HYV A;  3CUK A;  4J2W A;  2GR1 A;  2V5Z A;  5FS6 A;  4BV6 A;  3SZF A;  4C74 A;  4NTE A;  4OPI A;  1OJT A;  3DGZ A;  4H4P A;  1K0J A;  4BJY A;  1JRY A;  1CJC A;  1TDO A;  1RYI A;  4K22 A;  2YR5 A;  2YG5 A;  5FMH A;  1PN0 A;  4I58 A;  4AT0 A;  3AE9 A;  3CTY A;  3CPI G;  4NEW A;  4K8D A;  1GRT A;  2BC1 A;  5EOW A;  1E6E A;  3SFD A;  3UKA A;  3CNP A;  5CQF A;  2FJE A;  4YSX A;  2GEW A;  3NH3 X;  2GMH A;  3RP7 A;  2BAC A;  1XPQ A;  2GR2 A;  3WGT A;  4DGK A;  2WPC A;  2QCU A;  2XLS A;  1CJ3 A;  3S5W A;  2DU8 A;  4CCR A;  5C2T A;  3LB8 A;  4JY2 A;  1K0L A;  2XLT A;  3ALJ A;  2V61 A;  3AYJ A;  4RSL A;  3ALL A;  1ZMD A;  2YVG A;  1IUU A;  2X3N A;  2Q7V A;  3HYX A;  1NEK A;  1QLB A;  4C77 A;  3UTH A;  4ICY A;  3AD9 B;  2VVM A;  4H2P A;  3DJJ A;  3UKF A;  3KD9 A;  4NNJ A;  2C73 A;  3GDP A;  3BNU A;  2V3A A;  2WQY A;  2X8C A;  4J33 A;  3GYI A;  5KVH A;  3AEF A;  1OJ9 A;  3DH9 A;  3ZNO A;  1EL8 A;  3ITJ A;  4B63 A;  4CCQ A;  1XDI A;  1GRF A;  3AWI A;  5U25 A;  4CBQ A;  1M64 A;  1DOE A;  4BJZ A;  2RAB A;  3ICT A;  1OJD A;  1K0I A;  1H81 A;  1YQ3 A;  3W4I A;  4TLZ A;  2XFO A;  3AEA A;  4YJG B;  4U8L A;  1PJ7 A;  2X50 A;  5KOW A;  2YQU A;  4H4T A;  2ZZB A;  1NHS A;  3AEG A;  2A89 A;  2JAE A;  4P9S A;  3IHM A;  1NG4 A;  3NYC A;  3AD7 B;  3P4R A;  3DK4 A;  3RED A;  5KMS A;  1SEZ A;  3M0O A;  2YLT A;  4GUV A;  2XFN A;  4BK1 A;  2YLR A;  1NHP A;  3AXB A;  3G5S A;  2GB0 A;  1D4E A;  2QA2 A;  3KU9 A;  1Q1W A;  1BWC A;  3ICR A;  4C3Y A;  1ZKQ A;  1LV0 A;  2B9X A;  5M0Z A;  4XWZ A;  4A6N B;  5HHF A;  3F8P A;  3G5Q A;  3FMW A;  3PS9 A;  1E1L A;  1IJH A;  1PBE A;  1H82 A;  4Y4L A;  4YTP A;  4ECH A;  4OPD A;  1GRG A;  1S3E A;  2GR0 A;  4H4Z A;  1TDN A;  1GOS A;  4A6N A;  1PBC A;  3NIX A;  3H4K A;  4EMW A;  3ZNQ A;  1H84 A;  2VRM A;  1TRB A;  1FCD A;  3AD8 B;  1GXF A;  3NYF A;  4H4Y A;  3DA1 A;  4N9X A;  3PVC A;  1TYT A;  3AYL A;  4YT0 A;  4YWO A;  3SZW A;  4J57 A;  4H50 A;  1FL2 A;  2VQB A;  2BCP A;  3I3L A;  2XLR A;  2IVD A;  4I59 A;  1V59 A;  1IUW A;  2BYB A;  1CC2 A;  2XLU A;  1DDO A;  4K5S A;  3HZL A;  3NT6 A;  4UDQ A;  4EMI A;  1C0P A;  4QFC A;  1LQU A;  2Y6R A;  2YAU A;  3FPZ A;  1CF3 A;  1KFY A;  1O95 A;  1DOD A;  1D4D A;  4J34 A;  4ZCC A;  2GR3 A;  3ZYX A;  4B64 A;  1CHU A;  3K30 A;  1PJ5 A;  4YKF A;  2NVK X;  3II4 A;  3W4J A;  4OPT A;  1ZK7 A;  3SQP A;  1FOH A;  1F8W A;  5HYM A;  4A7A A;  1S2Y A;  3VQR A;  1O94 A;  2GAH B;  1GAL A;  3AYI A;  3R9U A;  3UKP A;  2R0C A;  1GV4 A;  1VDC A;  1XAN A;  3S61 A;  4U8J A;  1DOB A;  1RSG A;  1ZOV A;  4B69 A;  4Z2T A;  1VG0 A;  1C0K A;  2Q0K A;  4IVO B;  4U8O A;  4OPG A;  5KXJ A;  2UZZ A;  3IHG A;  2BK5 A;  1JNR A;  3P4S A;  4NWZ A;  3VR9 A;  4FDC B;  5FS8 A;  3AE6 A;  2XDO A;  4II3 A;  4BK2 A;  1L0V A;  1Y56 B;  2XVF A;  2C7G A;  3I6D A;  1BKW A;  3M12 A;  1LQT A;  2APG A;  3L1R A;  3SYI A;  1PXA A;  2B9W A;  1BGN A;  2PYX A;  1CBO A;  1DNC A;  1S2Q A;  2H88 A;  2VQ7 A;  3COX A;  3NKS A;  4XWR A;  3SZC A;  4U8P A;  3GRS A;  1X31 B;  4HB9 A;  1ZY8 A;  3KKJ A;  1BZL A;  4JDR A;  1E1K A;  3T2Y A; 
#chains in the Genus database with same CATH homology
 3B6D A;  3GD3 A;  2YWL A;  4GRT A;  4G73 A;  2V3B A;  4JNQ A;  1QO8 A;  3CND A;  4GAV A;  3NN0 X;  3LZX A;  4H4S A;  1EL9 A;  3RHA A;  2JB1 A;  2WP5 A;  4U2S A;  5HXI A;  4H4X A;  5GSN A;  2E1M A;  1F8S A;  2TPR A;  3GYX A;  3GRT A;  3IC9 A;  2E4G A;  3OZ2 A;  2X8G A;  3LOV A;  4CY8 A;  1PBB A;  4DSG A;  3UKL A;  4EM3 A;  2C4C A;  1P2E A;  2C72 A;  3KPK A;  4G74 A;  4YTM A;  1LPF A;  2WS3 A;  2Q0L A;  1PJ6 A;  2WHD A;  3NK0 X;  4JQ9 A;  2EQ6 A;  1QJD A;  3NNE A;  3CGE A;  3NK1 X;  1MO9 A;  2XVE A;  1IUX A;  3VR8 A;  2WOI A;  2Z5Y A;  4J31 A;  3HYW A;  3Q9T A;  4H4R A;  2NPX A;  2WP6 A;  2F5Z A;  2WOW A;  4EM4 A;  2Y6Q A;  1L9D A;  2FJD A;  1H86 A;  4FK1 C;  1EL7 A;  4JY3 A;  3H8L A;  4RG4 A;  1CJ4 A;  1PBD A;  1PHH A;  2C75 A;  4II2 A;  1GT8 A;  1W4X A;  2AQJ A;  2BRA A;  1VRQ B;  2J3N A;  3SXI A;  4BUR A;  4EQS A;  2CFY A;  5DBJ A;  4UDP A;  1Q1R A;  4REK A;  1ZDL A;  2TMD A;  2CUL A;  3LXD A;  4APN A;  3NK2 X;  3ABV A;  5U1O A;  3F8D A;  4GF7 A;  2YLZ A;  1MXT A;  3AB1 A;  3DJE A;  3V76 A;  2GV8 A;  2XVI A;  3UTF A;  3CNT A;  4ZN0 A;  5KNL A;  1ZMC A;  3WE0 A;  1GES A;  1GRH A;  1NAA A;  4YSZ A;  1PS9 A;  3NYE A;  1GPE A;  1YQ4 A;  1DJN A;  3BNM A;  2R45 A;  3P4P A;  3AEB A;  4M52 A;  2CVJ A;  1JRZ A;  4EQR A;  1N4W A;  4C5O A;  4H4Q A;  1GRB A;  1D7Y A;  2YM2 A;  3D1C A;  3KVE A;  2FBW A;  4PAA A;  5LV9 A;  3GWF A;  3ATQ A;  4A99 A;  4TM0 A;  3AE8 A;  2EQ8 A;  4FX9 A;  3DK9 A;  4LII A;  4AOX A;  3Q6J A;  3FIM B;  4DSH A;  4D04 A;  1K4Q A;  2V60 A;  4TLX A;  2BK4 A;  4AP3 A;  1NDA A;  2B9Y A;  2GVC A;  3CN8 A;  2DKH A;  3GSI A;  3UP5 A;  3QVR A;  2YG3 A;  1AOG A;  3F8R A;  3NLC A;  2I0Z A;  4YSH A;  1GTH A;  3CGD A;  4O5Q A;  2O9Z A;  3BI4 A;  3T37 A;  1Q9I A;  2BS4 A;  4J56 A;  1KNR A;  3SZ0 A;  4XXG A;  1NHQ A;  2R0P A;  4GDP A;  4OPU A;  3QFA A;  3T14 A;  2YLS A;  3GMB A;  1KSS A;  5BVA A;  4H2Q A;  1E7P A;  5HY5 A;  4H7U A;  3EPT A;  4GAP A;  1VQW A;  1GEU A;  2XYO A;  4X9N A;  2YVF A;  3UKK A;  4WX1 A;  2IID A;  3NRN A;  2BRY A;  2ZZ0 A;  3DJD A;  2WP9 A;  2YG6 A;  3ZDN A;  3BI2 A;  4A65 A;  4X4J A;  5JCL A;  2BS2 A;  5FS7 A;  4AT2 A;  1REO A;  2C66 A;  1Y0P A;  4IA5 A;  1B8S A;  3CGB A;  2ARD A;  4IVM B;  3UP4 A;  5KMP A;  3P1W A;  5KVI A;  5CKU A;  4ZCD A;  1KNP A;  2GF3 A;  5JCI A;  5KMR A;  4OPC A;  2VZ2 A;  3SX6 A;  2H89 A;  5JCK A;  2XFQ A;  1GTE A;  2YM1 A;  2JB3 A;  3NTD A;  2HQM A;  2WPF A;  4X9M A;  4Z25 A;  4K7Z A;  3UOY A;  4H4V A;  1M6I A;  4D03 A;  1E1M A;  2QAE A;  4K5R A;  4YXD A;  1KSU A;  1OJC A;  1LVL A;  2YLW A;  1DJQ A;  1NEN A;  4B67 A;  2GAG B;  2OA1 A;  1E39 A;  3BHK A;  3DJG X;  1IUS A;  3QSE A;  4GCM A;  1Y56 A;  5J60 A;  2XLP A;  2BA9 A;  1YY5 A;  2C65 A;  3SY4 A;  4O5U A;  5EB4 A;  5JCN A;  2R9Z A;  5EBK A;  3NN6 X;  1BF3 A;  1OJA A;  2GQW A;  4MJW A;  1B4V A;  3IF9 A;  5FS9 A;  3CGC A;  2WDV A;  1TDK A;  2BS3 A;  4USQ A;  2XVH A;  3SM8 A;  3O0H A;  3GWD A;  1ZOY A;  2Q6U A;  3GDN A;  3P9U A;  2B76 A;  3CPJ G;  1GND A;  3ICS A;  2B7R A;  3UKH A;  2WPE A;  2XCG A;  2X99 A;  4GR1 A;  2BK3 A;  1YQZ A;  1XHC A;  1O5W A;  3JSK A;  3AE7 A;  3T2K A;  2C64 A;  1ZP0 A;  1H83 A;  3FBS A;  1DXL A;  5BUL A;  3K7M X;  2DKI A;  4G9K A;  2WES A;  1NHR A;  4WCT A;  1FEC A;  3AE3 A;  1B37 A;  3RNM A;  3H8I A;  1EBD A;  2VOU A;  3ATR A;  3QVP A;  3UOZ A;  2YLX A;  4JN9 A;  3K7Q X;  4A79 A;  4YSY A;  5KMQ A;  4Z2R A;  2PHH A;  3M13 A;  3CNJ A;  4YKG A;  2BXR A;  1JEH A;  2BC0 A;  2C3C A;  2FJA A;  5ER0 A;  4YTN A;  2ZZC A;  4NTD A;  4AOS A;  4EQW A;  4H2R A;  3SGL A;  4IA6 A;  3ALM A;  1L9E A;  3L8K A;  1KDG A;  2YG4 A;  2YR6 A;  3CMM A;  4KX6 A;  4U2L A;  4ADW A;  4B66 A;  3EAO A;  5BRT A;  5M10 A;  3C4A A;  3K7T A;  3ADA B;  1LJ1 A;  2EQ7 A;  4B68 A;  1ELI A;  3ISH A;  2B7S A;  4KPR A;  4Z43 A;  1MOK A;  4Z24 A;  2YR4 A;  3AEC A;  2GMJ A;  4GDE A;  4TM3 A;  3C4N A;  4CY6 A;  2R4E A;  1D4C A;  4B1B A;  3DGH A;  1P2H A;  3T31 A;  1F8R A;  1JOA A;  1NPX A;  4Y4M A;  4PAB A;  2ACZ A;  3BHF A;  2XVJ A;  1ONF A;  5KOX A;  3AE5 A;  5IQ1 A;  1FEB A;  3V3N A;  4Z26 A;  3NG7 X;  4NTC A;  4OCG A;  1GRE A;  3UTG A;  1D5T A;  2YVJ A;  1F6M A;  1CC4 A;  1N4V A;  2GH5 A;  4Y4N A;  1EL5 A;  2R4J A;  2XFP A;  3UOX A;  4EQX A;  5IQ4 A;  4OPL A;  2BAB A;  2JK6 A;  4U8N A;  4A5L A;  3V3O A;  1PDH A;  2GQF A;  2CDU A;  3LJP A;  3UTE A;  1BGJ A;  1GET A;  1Z6L A;  2JBV A;  3D8X A;  4JNA A;  3C96 A;  1ZX9 A;  4CRT A;  4EIP A;  3T0K A;  4B65 A;  5JCM A;  2OAL A;  4NEV A;  1H7X A;  1GSN A;  3BI5 A;  1RP0 A;  1DOC A;  2BCG G;  2OAM A;  2OLN A;  3GYJ A;  3QSS A;  2JB2 A;  2Z5X A;  2WOV A;  1VG9 A;  3GD4 A;  3E1T A;  2C67 A;  3UKQ A;  3UOV A;  2RGH A;  3CNS A;  2C70 A;  2W0H A;  4E0V A;  2VRL A;  3GMC A;  5KRQ A;  3LZW A;  3RP6 A;  1JNZ A;  5J7X A;  2VVL G;  4K2X A;  1CL0 A;  1COY A;  1B5Q A;  3LAD A;  4U8K A;  3UCL A;  4DNA A;  3EF6 A;  2R46 A;  4RG3 A;  1PBF A;  2QA1 A;  3AE4 A;  1H7W A;  4G6H A;  3EAN A;  1TDF A;  2BXS A;  1FEA A;  2YG7 A;  2VVL A;  1N1P A;  2WDQ A;  1D7L A;  2A87 A;  1LTX R;  4U8M A;  5U63 A;  2C3D A;  2R0G A;  4H4U A;  2EQ9 A;  1KF6 A;  5C3J A;  1IUT A;  4BK3 A;  3PO7 A;  3URH A;  2WBA A;  4OVI A;  3VRD B;  4TM4 A;  4LU6 A;  2ZBW A;  4G6G A;  1HYU A;  4H2N A;  3AED A;  3OC4 A;  3QFB A;  3QJ4 A;  5KWF A;  3G5R A;  4A9W A;  4J36 A;  3CPH G;  3FG2 P;  3VRA A;  3AE1 A;  3T2Z A;  4EIQ A;  3KPF A;  5GRT A;  1TDE A;  1GRA A;  2OLO A;  4EMJ A;  1TYP A;  4C3X A;  1YKJ A;  4UP3 A;  1NG3 A;  3SFE A;  4LA1 A;  4U8I A;  2WEU A;  2WET A;  3KLJ A;  2E5V A;  3RP8 A;  1JRX A;  5EB5 A;  4Z2U A;  2C76 A;  2X8H A;  3CIR A;  2AR8 A;  4CNJ A;  1E1N A;  2AAQ A;  3B3R A;  1S3B A;  4CNK A;  3P4Q A;  3NHO X;  2FJB A;  1F3P A;  2IVE A;  2RGO A;  3QSM A;  4HA6 A;  1UKV G;  5L46 A;  4FK1 A;  1H6V A;  2RGJ A;  2XFU A;  1N4U A;  2WDR A;  2V6O A;  2GRT A;  2JKC A;  5IPY A;  1JU2 A;  4TM1 A;  3DK8 A;  1GER A;  3DME A;  3IWA A;  1L9C A;  2WU5 A;  3AE2 A;  3NGC X;  1IUV A;  2WU2 A;  3NTA A;  4IV9 A;  4UDR A;  4U2T A;  4USR A;  4AP1 A;  1CC6 A;  5TR3 A;  1PXC A;  3KA7 A;  3VRB A;  3AEE A;  2A8X A;  4Z44 A;  4H4W A;  1PXB A;  5BUK A;  4NZH A;  1CJ2 A;  3HYV A;  4J2W A;  2GR1 A;  2V5Z A;  5FS6 A;  4BV6 A;  3SZF A;  4C74 A;  4NTE A;  4OPI A;  1OJT A;  3DGZ A;  4H4P A;  4BJY A;  1K0J A;  1JRY A;  1CJC A;  1TDO A;  4K22 A;  1RYI A;  2YR5 A;  2YG5 A;  5FMH A;  1PN0 A;  4I58 A;  4AT0 A;  3AE9 A;  3CTY A;  3CPI G;  4NEW A;  4K8D A;  1GRT A;  2BC1 A;  5EOW A;  1E6E A;  3SFD A;  3UKA A;  3CNP A;  5CQF A;  2FJE A;  4YSX A;  2GEW A;  3NH3 X;  2GMH A;  3RP7 A;  2BAC A;  1XPQ A;  2GR2 A;  4DGK A;  2WPC A;  2QCU A;  2XLS A;  1CJ3 A;  3S5W A;  4CCR A;  5C2T A;  3LB8 A;  4JY2 A;  1K0L A;  2XLT A;  3ALJ A;  2V61 A;  3AYJ A;  4RSL A;  3ALL A;  1ZMD A;  2YVG A;  1IUU A;  2X3N A;  2Q7V A;  3HYX A;  1NEK A;  1QLB A;  4C77 A;  3UTH A;  4ICY A;  3AD9 B;  2VVM A;  4H2P A;  3DJJ A;  3UKF A;  3KD9 A;  4NNJ A;  2C73 A;  3GDP A;  3BNU A;  2V3A A;  2WQY A;  2X8C A;  4J33 A;  3GYI A;  5KVH A;  3AEF A;  1OJ9 A;  3DH9 A;  1EL8 A;  3ITJ A;  4B63 A;  4CCQ A;  1XDI A;  1GRF A;  3AWI A;  5U25 A;  4CBQ A;  1M64 A;  4BJZ A;  1DOE A;  2RAB A;  3ICT A;  1OJD A;  1K0I A;  1H81 A;  1YQ3 A;  4TLZ A;  2XFO A;  3AEA A;  4U8L A;  1PJ7 A;  2X50 A;  5KOW A;  2YQU A;  4H4T A;  2ZZB A;  1NHS A;  3AEG A;  2A89 A;  2JAE A;  4P9S A;  3IHM A;  1NG4 A;  3NYC A;  3AD7 B;  3P4R A;  3DK4 A;  3RED A;  5KMS A;  1SEZ A;  2YLT A;  3M0O A;  4GUV A;  2XFN A;  4BK1 A;  2YLR A;  1NHP A;  3AXB A;  3G5S A;  2GB0 A;  1D4E A;  2QA2 A;  3KU9 A;  1Q1W A;  1BWC A;  3ICR A;  4C3Y A;  1ZKQ A;  1LV0 A;  2B9X A;  5M0Z A;  4XWZ A;  4A6N B;  5HHF A;  3F8P A;  3G5Q A;  3FMW A;  1E1L A;  3PS9 A;  1IJH A;  1PBE A;  1H82 A;  4Y4L A;  4YTP A;  4ECH A;  4OPD A;  1GRG A;  1S3E A;  2GR0 A;  4H4Z A;  1TDN A;  1GOS A;  4A6N A;  1PBC A;  3NIX A;  3H4K A;  4EMW A;  1H84 A;  2VRM A;  1TRB A;  1FCD A;  3AD8 B;  1GXF A;  3NYF A;  4H4Y A;  3DA1 A;  4N9X A;  3PVC A;  1TYT A;  3AYL A;  4YT0 A;  4YWO A;  3SZW A;  4J57 A;  4H50 A;  1FL2 A;  2VQB A;  2BCP A;  3I3L A;  2XLR A;  2IVD A;  4I59 A;  1V59 A;  1IUW A;  2BYB A;  1CC2 A;  2XLU A;  4K5S A;  3HZL A;  3NT6 A;  4UDQ A;  4EMI A;  1LQU A;  2Y6R A;  2YAU A;  3FPZ A;  1CF3 A;  1KFY A;  1O95 A;  1D4D A;  1DOD A;  4J34 A;  4ZCC A;  2GR3 A;  3ZYX A;  4B64 A;  1CHU A;  3K30 A;  1PJ5 A;  4YKF A;  2NVK X;  3II4 A;  4OPT A;  1ZK7 A;  3SQP A;  1FOH A;  1F8W A;  5HYM A;  4A7A A;  1S2Y A;  3VQR A;  1O94 A;  1GAL A;  2GAH B;  3AYI A;  3R9U A;  3UKP A;  2R0C A;  1GV4 A;  1VDC A;  1XAN A;  3S61 A;  4U8J A;  1DOB A;  1RSG A;  1ZOV A;  4B69 A;  4Z2T A;  1VG0 A;  2Q0K A;  4IVO B;  4U8O A;  5KXJ A;  4OPG A;  3IHG A;  2UZZ A;  2BK5 A;  1JNR A;  3P4S A;  4NWZ A;  3VR9 A;  4FDC B;  5FS8 A;  3AE6 A;  2XDO A;  4II3 A;  4BK2 A;  1L0V A;  1Y56 B;  2XVF A;  2C7G A;  3I6D A;  1BKW A;  1LQT A;  2APG A;  3L1R A;  3M12 A;  3SYI A;  1PXA A;  2B9W A;  1BGN A;  2PYX A;  1CBO A;  1DNC A;  1S2Q A;  2H88 A;  2VQ7 A;  3COX A;  3NKS A;  4XWR A;  3SZC A;  4U8P A;  3GRS A;  1X31 B;  4HB9 A;  1ZY8 A;  3KKJ A;  1BZL A;  4JDR A;  1E1K A;  3T2Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...