3ALJA

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, reduced form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
369
structure length
369
Chain Sequence
TRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
total genus 130
structure length 369
sequence length 369
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 3aljA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3aljA01
4C74A 5C3JA 4B66A 4EMWA 3DMEA 2JB3A 2JBVA 3AE9A 3KA7A 3O0HA 2BACA 1QO8A 4H2RA 3NN6X 4DSGA 2X99A 4TM1A 3NYFA 2H89A 2BCPA 3IC9A 3ICSA 1M64A 3P4QA 4IA6A 5HHFA 1K0JA 4A99A 2GH5A 3DJGX 3NH3X 3UKHA 1L9DA 3COXA 1TDKA 2OALA 4A9WA 2VZ2A 2QCUA 2XVHA 3NIXA 3AE8A 3S5WA 3QSEA 4UDRA 3CN8A 4N9XA 2DKIA 1QJDA 1GRAA 4OPCA 3CTYA 2GQWA 4WCTA 1REOA 3UCLA 2B9WA 4U8PA 4JNQA 1PXAA 4TLXA 3ZDNA 1YQ3A 4CCRA 3P4SA 1CC6A 3UP4A 2B7SA 1P2EA 2ZBWA 2CULA 1F8RA 1V59A 3NK0X 3UKQA 1E1LA 1LQTA 1JOAA 3ZYXA 4EQXA 2RGOA 2OA1A 4B68A 4YKFA 3UKLA 1DNCA 3IHGA 2BS3A 2VQ7A 1N4VA 3RP7A 2CFYA 4YKGA 1OJCA 3EANA 4IVMB 2GVCA 2BXSA 4U2TA 1KFYA 2OLOA 1SEZA 2VVLG 4Z25A 2BC1A 4U8OA 4YWOA 3ITJA 5EB4A 4X4JA 1YQZA 2WOVA 5CQFA 1MXTA 5JCLA 2GAGB 2GMHA 4RSLA 3NTDA 1PJ6A 3AEGA 3H8LA 2GQFA 4NEWA 4GDPA 2XYOA 3GYJA 4H4RA 4BK3A 1N4UA 3CGEA 4H2QA 2R4EA 5KOWA 3AE2A 2CDUA 2B76A 2FBWA 2FJDA 3AD8B 3DJJA 3V3NA 4AP3A 3IWAA 3CPIG 3KD9A 4YTNA 1BKWA 3UOVA 2XVFA 3LZXA 1GV4A 1CF3A 2XLSA 1VG9A 5EB5A 2C7GA 1DOBA 5IPYA 1E1MA 2BS4A 2C66A 2PHHA 2VRLA 4NZHA 2BC0A 4UDQA 3P4RA 3M0OA 2GR0A 4ZCDA 3UOZA 3EAOA 5JCIA 1PBEA 5FS8A 1EL8A 3AECA 2WEUA 2AR8A 2WHDA 5CKUA 5M10A 3RP6A 3KU9A 3UTFA 1ZKQA 4EQSA 4M52A 1ONFA 4CNJA 2A87A 1E7PA 2BK5A 1D4EA 3IF9A 1NHPA 3AYIA 3G5QA 3ALLA 5KVIA 1IUWA 2XLPA 2XLUA 3BI2A 2EQ8A 2X3NA 1L9CA 3SFDA 2VOUA 2R0GA 2C75A 3DJEA 4USRA 3AE7A 3DK9A 1GRHA 4CY8A 2V3AA 3NGCX 4ICYA 4D04A 4JDRA 4Z43A 4X9MA 3FPZA 1KNRA 3PS9A 1PBCA 5J60A 3CIRA 3OZ2A 4Y4NA 4A79A 1COYA 2YLRA 1JEHA 1OJTA 3BI5A 1TDNA 2GR2A 1ZX9A 2JB2A 1GETA 1K4QA 2B9XA 3Q9TA 5IQ4A 1O94A 4WX1A 1MOKA 2GV8A 5U1OA 4H2PA 1FOHA 4U2LA 4CY6A 4CCQA 1GPEA 2GB0A 2JKCA 3SFEA 4B64A 1TYPA 1F8WA 1H7WA 3GDNA 3QJ4A 4ADWA 3GD3A 2J3NA 1GOSA 1GREA 2XCGA 2GAHB 4AT2A 2AAQA 4GF7A 1D7YA 2YWLA 4LIIA 3VRBA 4GR1A 4A6NA 2RGJA 3CPJG 1OJAA 3UKFA 2YLSA 2BK3A 3CGBA 3EF6A 4K8DA 3BNMA 3FIMB 1CJ3A 2F5ZA 2NVKX 4JN9A 2OAMA 1UKVG 3AE3A 2C67A 4O5UA 5GRTA 3VR8A 2CVJA 3Q6JA 2QA1A 4A7AA 4CBQA 3I6DA 1ELIA 4H4PA 1TDEA 2YLXA 2GR1A 1B4VA 2FJAA 3QSMA 4DNAA 4K2XA 2QAEA 2XFUA 1E6EA 4C77A 4IA5A 1B37A 1PDHA 2EQ9A 4OPUA 1BGJA 3CPHG 3URHA 1GTHA 2HQMA 2YR4A 3ADAB 3UKPA 2V60A 4EM4A 2Q0KA 3M12A 4APNA 3FMWA 4C3YA 4K7ZA 3GWFA 3NG7X 4P9SA 3DH9A 4XXGA 3UKAA 3P4PA 2GRTA 1FEBA 3K30A 3UKKA 5BULA 1K0LA 1S2QA 1CJCA 2WETA 4O5QA 2X8GA 5M0ZA 4C3XA 3C4AA 3UOYA 4B67A 1F3PA 1KSUA 3C4NA 5C2TA 3G5RA 1AOGA 3AYLA 1Y56A 1EL5A 3VQRA 1BWCA 3AEEA 2GF3A 2XVIA 3I3LA 1CJ2A 5U63A 2ACZA 3JSKA 2WU2A 5JCKA 4H50A 3CGCA 4FX9A 1TDFA 2O9ZA 3AB1A 3AXBA 4H4XA 3AD9B 4DSHA 1YY5A 3UP5A 1TDOA 1E39A 4X9NA 2TMDA 3CNDA 3RHAA 3G5SA 4Z2UA 4H2NA 4HA6A 3LJPA 3QVPA 3LB8A 2V3BA 4JQ9A 1CL0A 1VG0A 2XDOA 3B3RA 4FK1A 4NEVA 1H86A 3GMCA 3NHOX 2WP6A 4B1BA 1ZK7A 3ABVA 3SQPA 2X50A 2FJBA 2GMJA 1PS9A 2WU5A 4BV6A 4BK1A 4BURA 4BJZA 2TPRA 2WBAA 4U8MA 1EBDA 2GR3A 4OPIA 1E1NA 1W4XA 3RP8A 2R9ZA 1XHCA 3AEBA 1GT8A 3RNMA 5GSNA 1H7XA 4J33A 4CNKA 4KPRA 3KLJA 4J36A 2Q6UA 2YVGA 4EIQA 3HZLA 1PHHA 4H4ZA 4Z24A 2I0ZA 1JRXA 2V5ZA 3BI4A 5BRTA 1KDGA 2JB1A 1H6VA 2R0PA 1BZLA 4GUVA 4TM0A 2B9YA 2GEWA 3VR9A 2C65A 4Z2RA 1PBBA 1GESA 1HYUA 3H4KA 2ZZ0A 3AE4A 1RSGA 1O5WA 1XPQA 1Y0PA 3NTAA 4H4YA 4I59A 4EQWA 4MJWA 1DJQA 4K5RA 1N1PA 5FS9A 1GRFA 1BGNA 3GRSA 2YG6A 2OLNA 1ZP0A 2R4JA 4U8IA 1CBOA 2PYXA 2FJEA 1EL9A 3CNJA 1S3EA 4A65A 4FK1C 1OJ9A 2Z5YA 3DGHA 2WDQA 5JCMA 4Y4MA 4GRTA 1PN0A 2BXRA 1DXLA 4ZCCA 1GEUA 2Y6RA 1D7LA 1Q1WA 1PJ5A 2B7RA 3ATQA 3KKJA 4H7UA 4J56A 2YVJA 3NK2X 1VDCA 5KOXA 5JCNA 1H81A 3S61A 3DA1A 4NTDA 2EQ7A 1VQWA 3SM8A 3NKSA 3LZWA 4PAAA 4GDEA 1IUUA 4EMIA 5EBKA 3AEFA 2VVLA 3C96A 4D03A 4OPDA 1S2YA 4J2WA 1K0IA 2ARDA 4J57A 1B8SA 3GSIA 1RP0A 2IVDA 2C70A 1MO9A 4YTMA 2ZZCA 3VRDB 1LVLA 2BYBA 2RGHA 4AT0A 5IQ1A 3DK8A 3ICTA 5TR3A 1PBFA 2DKHA 2YG7A 3GWDA 3QFBA 4XWRA 3KPFA 2VVMA 2VQBA 3UOXA 2APGA 2UZZA 1D4DA 2R0CA 1PXCA 1GALA 1LQUA 1JNZA 3L8KA 2E4GA 2YG3A 4J34A 1ZOVA 4IV9A 1N4WA 1F6MA 1DJNA 5HY5A 2XLRA 1TYTA 2A89A 4B69A 1FEAA 2R45A 2BA9A 3NYCA 2XVJA 1ZOYA 4OCGA 1H82A 2Z5XA 4Y4LA 1OJDA 4U8LA 2WPFA 3AWIA 4EIPA 2V6OA 3ATRA 3V3OA 3FG2P 1GTEA 1IJHA 3L1RA 3DGZA 4Z26A 1Q1RA 2R46A 2Y6QA 1LV0A 1X31B 3AE5A 4PABA 4A5LA 1NHRA 5DBJA 3LOVA 1JU2A 2WOWA 1ZY8A 4H4UA 4TM4A 1QLBA 1NAAA 4B65A 2RABA 3CNPA 3QFAA 4NTCA 3NN0X 5J7XA 4H4SA 3PO7A 1GRGA 4I58A 2WOIA 1FL2A 4C5OA 1NENA 2YR5A 3B6DA 3QVRA 4HB9A 1ZDLA 3GRTA 4CRTA 2YR6A 1CHUA 3BHFA 2YG4A 3ICRA 1BF3A 1CJ4A 2IIDA 1LTXR 3WE0A 5L46A 5BUKA 4JY2A 1IUXA 4BJYA 4YT0A 4UP3A 1PJ7A 2XFPA 3NNEA 4OPLA 4U8KA 1CC2A 5U25A 2X8CA 4BK2A 3CGDA 4OPGA 4AOSA 2IVEA 1ZMCA 2WDVA 1PBDA 3GDPA 4ZN0A 4DGKA 2ZZBA 5KWFA 3P1WA 1XDIA 1EL7A 1YQ4A 4JNAA 1ZMDA 5HXIA 3NYEA 1IUTA 3QSSA 1M6IA 3NLCA 1FECA 2WP5A 2WDRA 1H83A 2YLWA 3BNUA 1Z6LA 4JY3A 4EM3A 2H88A 4XWZA 3M13A 2YVFA 1O95A 3NK1X 2C3CA 2C3DA 2C76A 3REDA 4YTPA 1NHQA 4GCMA 4IVOB 3UTGA 2XFNA 2XLTA 1D4CA 2YAUA 4YXDA 1GRTA 1L9EA 3II4A 2QA2A 4KX6A 2XFOA 1XANA 4UDPA 1GERA 1DODA 1JNRA 2A8XA 2WS3A 1CC4A 4USQA 1LPFA 3PVCA 3UTHA 2V61A 3NT6A 1IUVA 2XFQA 4LU6A 4TM3A 5FMHA 5HYMA 3T37A 4H4WA 1TRBA 3KVEA 4K22A 5FS6A 2WPEA 3CNTA 3GMBA 3LXDA 2C72A 1JRYA 4OPTA 5EOWA 1Q9IA 2WQYA 3AYJA 1NHSA 1DOEA 1NEKA 3CNSA 4U8JA 3DK4A 4EQRA 1NDAA 2AQJA 2C64A 2E5VA 1KNPA 2WPCA 2BABA 1IUSA 3R9UA 2YM2A 2EQ6A 4B63A 2C73A 2YG5A 4AOXA 4TLZA 3D1CA 3AE1A 4J31A 2VRMA 3P9UA 3F8PA 3IHMA 4EMJA 1B5QA 2BK4A 1PXBA 1S3BA 1KF6A 2XVEA 4AP1A 3EPTA 2E1MA 3SGLA 3H8IA 3V76A 5BVAA 1GRBA 2YLZA 2BCGG 4A6NB 3VRAA 4YSZA 5ER0A 5KRQA 1D5TA 1NG3A 1KSSA 3ISHA 4NTEA 3DJDA 2Q7VA 3F8RA 4K5SA 1DOCA 3AE6A 5KXJA 2YQUA 1VRQB 3ALMA 1GNDA 4H4QA 1JRZA 4FDCB 2Q0LA 3FBSA 1NG4A 3BHKA 1Y56B 1GSNA 4RG3A 3K7MX 1P2HA 3GYIA 2W0HA 4REKA 1L0VA 1F8SA 2WESA 2WP9A 4YSHA 4YSYA 4U2SA 4Z2TA 3OC4A 4OVIA 4ECHA 3K7TA 1RYIA 4U8NA 4Z44A 3AEAA 2YLTA 3K7QX 1LJ1A 4RG4A 4H4TA 2YM1A 3AEDA 3ALJA 3E1TA 4H4VA 2BS2A 2X8HA 4LA1A 3AD7B 2NPXA 1GXFA 1YKJA 4YSXA 3GD4A 3F8DA 1E1KA 3LADA 3NRNA 1H84A 2JAEA 5FS7A 3D8XA 1NPXA 4E0VA 5KVHA 5LV9A 1FCDA 3UTEA 2JK6A
chains in the Genus database with same CATH superfamily
4C74A 5C3JA 4B66A 4EMWA 2BRAA 3DMEA 2JB3A 2JBVA 3AE9A 3KA7A 3O0HA 2BACA 1QO8A 4H2RA 3NN6X 4DSGA 2X99A 4TM1A 3NYFA 2H89A 4IA6A 2BCPA 3IC9A 1M64A 3ICSA 3P4QA 5HHFA 1K0JA 4A99A 2GH5A 3DJGX 3NH3X 3HYXA 3UKHA 1L9DA 2E48A 3COXA 1TDKA 2OALA 4A9WA 2VZ2A 2QCUA 2XVHA 3NIXA 3AE8A 3S5WA 3QSEA 4UDRA 3CN8A 4N9XA 2DKIA 1QJDA 1GRAA 4OPCA 3CTYA 4WCTA 2GQWA 3T31A 1REOA 3UCLA 2B9WA 4U8PA 4JNQA 1PXAA 4TLXA 3ZDNA 1YQ3A 4CCRA 3P4SA 3SXIA 1CC6A 3UP4A 2B7SA 1P2EA 2ZBWA 2CULA 1F8RA 1V59A 3NK0X 3UKQA 4JQ9A 1E1LA 1LQTA 1JOAA 3ZYXA 4EQXA 2RGOA 2OA1A 4B68A 4YKFA 3UKLA 1DNCA 1DDOA 3IHGA 2BS3A 2VQ7A 1N4VA 3RP7A 2CFYA 4G6GA 4YKGA 1OJCA 3EANA 4IVMB 2GVCA 2BXSA 4U2TA 2OLOA 1KFYA 1SEZA 2VVLG 4Z25A 2BC1A 4U8OA 4YWOA 3ITJA 5EB4A 4X4JA 1YQZA 2WOVA 5CQFA 1MXTA 5JCLA 2GAGB 2GMHA 4RSLA 3NTDA 1PJ6A 3AEGA 3H8LA 2GQFA 4NEWA 4GDPA 2XYOA 3GYJA 4BK3A 4H4RA 1N4UA 3CGEA 2R4EA 4H2QA 5KMSA 5KOWA 4II2A 3AE2A 2CDUA 2B76A 3AD8B 2FBWA 2FJDA 3DJJA 3V3NA 4AP3A 3IWAA 3CPIG 3KD9A 4YTNA 1BKWA 3UOVA 2XVFA 3LZXA 1GV4A 1CF3A 2XLSA 1VG9A 5EB5A 2C7GA 1DOBA 5IPYA 4QFDA 2PHHA 1E1MA 2BS4A 2C66A 2VRLA 4NZHA 2BC0A 1C0PA 4UDQA 3SX6A 3P4RA 3M0OA 2GR0A 4ZCDA 3UOZA 3EAOA 5JCIA 1PBEA 3T2YA 3WGTA 1EL8A 5FS8A 3AECA 2WEUA 2AR8A 2WHDA 5CKUA 5M10A 3RP6A 3KU9A 3UTFA 1ZKQA 4EQSA 4M52A 1ONFA 4CNJA 2A87A 3IF9A 1E7PA 1D4EA 2BK5A 1NHPA 3AYIA 3G5QA 3ALLA 5KVIA 1IUWA 2XLPA 2XLUA 3BI2A 3SZWA 2EQ8A 2X3NA 1L9CA 4G6HA 3SFDA 2VOUA 2R0GA 2C75A 3DJEA 4USRA 3AE7A 3DK9A 3T2KA 1GRHA 4CY8A 2V3AA 3NGCX 4ICYA 4D04A 4JDRA 4Z43A 4X9MA 3FPZA 1KNRA 3PS9A 1PBCA 5J60A 3CIRA 3OZ2A 4Y4NA 4A79A 1COYA 2YLRA 1JEHA 1OJTA 3BI5A 1TDNA 2GR2A 1ZX9A 2JB2A 1GETA 1K4QA 2B9XA 3Q9TA 5IQ4A 1O94A 4WX1A 1MOKA 2GV8A 5U1OA 1FOHA 4H2PA 4U2LA 4CY6A 4CCQA 2GB0A 1GPEA 1C0KA 2JKCA 3SFEA 4B64A 1TYPA 1F8WA 1H7WA 3GDNA 3QJ4A 4ADWA 3GD3A 2J3NA 1GOSA 1AN9A 2BRYA 1GREA 5KMPA 2XCGA 2GAHB 4AT2A 2AAQA 4GF7A 1D7YA 2YWLA 4LIIA 3VRBA 3KPKA 4GR1A 4A6NA 2RGJA 3CPJG 1OJAA 3UKFA 2YLSA 2BK3A 3CGBA 3EF6A 4K8DA 3BNMA 3FIMB 1CJ3A 2F5ZA 2NVKX 4JN9A 2OAMA 1UKVG 3AE3A 2C67A 4O5UA 5GRTA 3VR8A 2CVJA 3Q6JA 2QA1A 4A7AA 4CBQA 3I6DA 1ELIA 4H4PA 1TDEA 2YLXA 2GR1A 1B4VA 2FJAA 3QSMA 4DNAA 4K2XA 1C0LA 2QAEA 2XFUA 1E6EA 4C77A 4IA5A 1B37A 1PDHA 2EQ9A 4OPUA 1BGJA 3CPHG 3URHA 1GTHA 2HQMA 3ADAB 2YR4A 3UKPA 2V60A 4EM4A 3M12A 2Q0KA 3T14A 4APNA 3ZNPA 3FMWA 4C3YA 4K7ZA 3GWFA 4P9SA 3NG7X 3DH9A 4XXGA 3UKAA 3P4PA 1FEBA 2GRTA 3K30A 3UKKA 5BULA 1K0LA 1S2QA 1CJCA 2WETA 4O5QA 2E82A 2X8GA 4QFCA 5M0ZA 4C3XA 3C4AA 3UOYA 4B67A 1F3PA 1KSUA 3C4NA 5C2TA 3G5RA 1AOGA 3AYLA 1Y56A 1EL5A 3VQRA 1BWCA 3AEEA 2GF3A 2XVIA 3I3LA 1CJ2A 5U63A 2ACZA 3JSKA 2WU2A 5JCKA 4H50A 3CGCA 4FX9A 3AXBA 1TDFA 2O9ZA 3AB1A 4H4XA 3AD9B 4DSHA 1YY5A 3UP5A 4X9NA 1E39A 1TDOA 2TMDA 3CNDA 3RHAA 3G5SA 2E49A 4Z2UA 4H2NA 4HA6A 1DAOA 3LJPA 3QVPA 3LB8A 3G3EA 2V3BA 1CL0A 1VG0A 2XDOA 3B3RA 4FK1A 4G74A 1H86A 3GMCA 4NEVA 4YJGA 2WP6A 3NHOX 4B1BA 1ZK7A 3ABVA 3SQPA 2X50A 2FJBA 2GMJA 1PS9A 2WU5A 4BV6A 4BK1A 4BURA 4BJZA 2TPRA 4YJHB 2WBAA 4U8MA 1VE9A 1EBDA 2GR3A 4OPIA 3RP8A 1E1NA 1W4XA 2R9ZA 1XHCA 3AEBA 4GAVA 1GT8A 3RNMA 5GSNA 3ZNNA 1H7XA 4J33A 4CNKA 4KPRA 3KLJA 4J36A 4YJDA 2Q6UA 2YVGA 3HZLA 4EIQA 1PHHA 4H4ZA 4Z24A 2I0ZA 1JRXA 2V5ZA 3BI4A 5BRTA 1KDGA 2JB1A 1H6VA 2R0PA 3W4KA 1BZLA 4GUVA 4TM0A 2B9YA 2GEWA 3VR9A 2C65A 3GYXA 4Z2RA 1PBBA 1GESA 1HYUA 3H4KA 2ZZ0A 3AE4A 1RSGA 1O5WA 1XPQA 1Y0PA 3NTAA 4H4YA 4I59A 3SYIA 4EQWA 4MJWA 1DJQA 4K5RA 1N1PA 5FS9A 4YJHA 1BGNA 1GRFA 2YG6A 2OLNA 1ZP0A 3GRSA 2R4JA 4U8IA 1CBOA 2PYXA 2FJEA 1EL9A 3CNJA 1S3EA 4A65A 3SZ0A 4FK1C 1OJ9A 2Z5YA 3DGHA 2WDQA 5JCMA 4Y4MA 4GRTA 1PN0A 2BXRA 1DXLA 4ZCCA 2DU8A 1GEUA 2Y6RA 1D7LA 1PJ5A 1Q1WA 2B7RA 3ATQA 3CMMA 3KKJA 4H7UA 4J56A 2YVJA 3NK2X 1VDCA 5KOXA 5JCNA 1H81A 3S61A 3DA1A 4NTDA 2EQ7A 2C4CA 1VQWA 3SM8A 3NKSA 3LZWA 4PAAA 4GDEA 1IUUA 4EMIA 5EBKA 3AEFA 2VVLA 3C96A 4D03A 4OPDA 1S2YA 4J2WA 1K0IA 4G73A 2ARDA 4YJFA 4J57A 3GSIA 1B8SA 1RP0A 2IVDA 2C70A 1MO9A 4YTMA 2ZZCA 3W4JA 1LVLA 2RGHA 2BYBA 3VRDB 4AT0A 5IQ1A 3DK8A 3ICTA 5TR3A 1PBFA 2DKHA 2YG7A 3GWDA 3QFBA 4XWRA 3KPFA 2VVMA 2VQBA 3UOXA 2UZZA 2APGA 1D4DA 1PXCA 2R0CA 5KMRA 1GALA 1LQUA 1JNZA 3L8KA 2E4GA 2YG3A 4J34A 1ZOVA 4IV9A 1N4WA 1F6MA 1DJNA 4G9KA 5HY5A 2XLRA 1TYTA 2A89A 4B69A 3SZFA 1FEAA 2R45A 2BA9A 3NYCA 2XVJA 1ZOYA 4OCGA 1H82A 3HYVA 2Z5XA 4Y4LA 1OJDA 4U8LA 3AWIA 2WPFA 4EIPA 2V6OA 3ATRA 3V3OA 3FG2P 1GTEA 1IJHA 3L1RA 3DGZA 4Z26A 1Q1RA 2R46A 2Y6QA 1LV0A 1X31B 4PABA 3AE5A 5KMQA 4A5LA 1NHRA 5DBJA 1KIFA 3LOVA 1JU2A 2WOWA 1ZY8A 4H4UA 4TM4A 1QLBA 1NAAA 4B65A 2RABA 3CNPA 3QFAA 4NTCA 3NN0X 5J7XA 4H4SA 3W4IA 3PO7A 1GRGA 1EVIA 4I58A 2WOIA 1FL2A 4C5OA 1NENA 2YR5A 3B6DA 3QVRA 4HB9A 1ZDLA 3GRTA 4CRTA 2YR6A 1CHUA 3BHFA 2YG4A 5L46A 1BF3A 1CJ4A 2IIDA 1LTXR 3ICRA 3WE0A 5BUKA 4JY2A 1IUXA 4BJYA 4YT0A 4UP3A 1PJ7A 2XFPA 4YJGB 3NNEA 4OPLA 4U8KA 1CC2A 5U25A 4BK2A 2X8CA 3CGDA 4OPGA 4AOSA 2IVEA 1ZMCA 2WDVA 1PBDA 3GDPA 4ZN0A 4DGKA 2ZZBA 5KWFA 3P1WA 1C0IA 1XDIA 1EL7A 1YQ4A 4JNAA 3ZNQA 1ZMDA 3NYEA 5HXIA 1IUTA 3QSSA 1M6IA 2E4AA 1FECA 2WP5A 3NLCA 2WDRA 1H83A 2YLWA 3BNUA 1Z6LA 3CUKA 4JY3A 4EM3A 2H88A 4XWZA 3M13A 2YVFA 1O95A 3NK1X 2C3CA 2C3DA 2C76A 3REDA 4YTPA 1NHQA 4GCMA 4IVOB 3UTGA 2XFNA 2XLTA 1D4CA 2YAUA 4YXDA 1GRTA 1L9EA 3II4A 2QA2A 4KX6A 2XFOA 1XANA 4UDPA 1GERA 1DODA 1JNRA 2A8XA 2WS3A 1CC4A 4USQA 3T2ZA 1LPFA 3PVCA 3UTHA 2V61A 3NT6A 1IUVA 2XFQA 4LU6A 5HYMA 4TM3A 5FMHA 3T37A 4H4WA 1TRBA 3KVEA 4K22A 5FS6A 2WPEA 3CNTA 3GMBA 3LXDA 2C72A 1JRYA 4OPTA 5EOWA 1Q9IA 2WQYA 3AYJA 1NHSA 1DOEA 1NEKA 3CNSA 4U8JA 3DK4A 4EQRA 1NDAA 2AQJA 2C64A 2E5VA 1KNPA 2WPCA 2BABA 1IUSA 3R9UA 2YM2A 2EQ6A 3SZCA 4B63A 2C73A 2YG5A 4AOXA 4TLZA 3D1CA 3AE1A 4J31A 2VRMA 3P9UA 3F8PA 3IHMA 4EMJA 4II3A 1B5QA 2BK4A 1PXBA 1S3BA 1KF6A 2XVEA 4AP1A 3EPTA 3SGLA 2E1MA 3H8IA 3V76A 5BVAA 1GRBA 4GAPA 2YLZA 5KNLA 2BCGG 4A6NB 3VRAA 4YSZA 5ER0A 3ZNOA 5KRQA 1D5TA 1NG3A 1KSSA 3ISHA 4NTEA 3DJDA 2Q7VA 3F8RA 4K5SA 1DOCA 3AE6A 4NWZA 5KXJA 2YQUA 1VRQB 3ALMA 1GNDA 4H4QA 1JRZA 4FDCB 2Q0LA 3FBSA 1NG4A 3BHKA 1Y56B 1GSNA 3HYWA 4RG3A 4NNJA 3K7MX 1P2HA 3GYIA 2W0HA 4REKA 1L0VA 1F8SA 2WESA 2WP9A 4YSHA 4YSYA 4U2SA 4Z2TA 3OC4A 4OVIA 4ECHA 3K7TA 1RYIA 4U8NA 4Z44A 3T0KA 3AEAA 2YLTA 3K7QX 1LJ1A 4RG4A 4H4TA 2YM1A 3AEDA 3ALJA 3E1TA 4YJFB 4H4VA 2BS2A 3SY4A 2X8HA 4LA1A 3AD7B 2NPXA 1GXFA 1YKJA 4YSXA 3GD4A 3F8DA 1E1KA 3LADA 3NRNA 1H84A 2JAEA 5FS7A 3D8XA 1NPXA 4E0VA 5KVHA 5LV9A 1FCDA 3UTEA 2JK6A
chains in the Genus database with same CATH topology
4C74A 5C3JA 4B66A 4EMWA 2BRAA 3DMEA 2JB3A 2JBVA 3AE9A 3KA7A 3O0HA 2BACA 1QO8A 4H2RA 3NN6X 4DSGA 2X99A 4TM1A 3NYFA 2H89A 4IA6A 2BCPA 3IC9A 1M64A 3ICSA 3P4QA 5HHFA 1K0JA 4A99A 2GH5A 3DJGX 3NH3X 3HYXA 3UKHA 1L9DA 3COXA 1TDKA 2OALA 4A9WA 2VZ2A 2QCUA 2XVHA 3NIXA 3AE8A 3S5WA 3QSEA 4UDRA 3CN8A 4N9XA 2DKIA 1QJDA 1GRAA 4OPCA 3CTYA 2GQWA 4WCTA 3T31A 1REOA 3UCLA 2B9WA 4U8PA 4JNQA 1PXAA 4TLXA 3ZDNA 1YQ3A 4CCRA 3P4SA 3SXIA 1CC6A 3UP4A 2B7SA 1P2EA 2ZBWA 2CULA 1F8RA 1V59A 3NK0X 3UKQA 1E1LA 1LQTA 1JOAA 3ZYXA 4EQXA 2RGOA 2OA1A 4B68A 4YKFA 3UKLA 1DNCA 3IHGA 2BS3A 2VQ7A 1N4VA 3RP7A 2CFYA 4G6GA 4YKGA 1OJCA 3EANA 4IVMB 2GVCA 2BXSA 4U2TA 1KFYA 2OLOA 1SEZA 2VVLG 4Z25A 2BC1A 4U8OA 4YWOA 3ITJA 5EB4A 4X4JA 1YQZA 2WOVA 5CQFA 1MXTA 5JCLA 2GAGB 2GMHA 4RSLA 3NTDA 1PJ6A 3AEGA 3H8LA 2GQFA 4NEWA 4GDPA 2XYOA 3GYJA 4BK3A 4H4RA 1N4UA 3CGEA 4H2QA 2R4EA 5KMSA 5KOWA 4II2A 3AE2A 2CDUA 2B76A 2FBWA 2FJDA 3AD8B 3DJJA 3V3NA 4AP3A 3IWAA 3CPIG 3KD9A 4YTNA 1BKWA 3UOVA 2XVFA 3LZXA 1GV4A 1CF3A 2XLSA 1VG9A 5EB5A 2C7GA 1DOBA 5IPYA 1E1MA 2BS4A 2C66A 2PHHA 2VRLA 4NZHA 2BC0A 4UDQA 3SX6A 3P4RA 3M0OA 2GR0A 4ZCDA 3UOZA 3EAOA 5JCIA 1PBEA 3T2YA 5FS8A 1EL8A 3AECA 2WEUA 2AR8A 2WHDA 5CKUA 5M10A 3RP6A 3KU9A 3UTFA 1ZKQA 4EQSA 4M52A 1ONFA 4CNJA 2A87A 1E7PA 2BK5A 1D4EA 3IF9A 1NHPA 3AYIA 3G5QA 3ALLA 5KVIA 1IUWA 2XLPA 2XLUA 3BI2A 3SZWA 2EQ8A 2X3NA 1L9CA 4G6HA 3SFDA 2VOUA 2R0GA 2C75A 3DJEA 4USRA 3AE7A 3DK9A 3T2KA 1GRHA 4CY8A 2V3AA 3NGCX 4ICYA 4D04A 4JDRA 4Z43A 4X9MA 3FPZA 1KNRA 3PS9A 1PBCA 5J60A 3CIRA 3OZ2A 4Y4NA 4A79A 1COYA 2YLRA 1JEHA 1OJTA 3BI5A 1TDNA 2GR2A 1ZX9A 2JB2A 1GETA 1K4QA 2B9XA 3Q9TA 5IQ4A 1O94A 4WX1A 1MOKA 2GV8A 5U1OA 4H2PA 1FOHA 4U2LA 4CY6A 4CCQA 1GPEA 2GB0A 2JKCA 3SFEA 4B64A 1TYPA 1F8WA 1H7WA 3GDNA 3QJ4A 4ADWA 3GD3A 2J3NA 1GOSA 2BRYA 1GREA 5KMPA 2XCGA 2GAHB 4AT2A 2AAQA 4GF7A 1D7YA 2YWLA 4LIIA 3VRBA 3KPKA 4GR1A 4A6NA 2RGJA 3CPJG 1OJAA 3UKFA 2YLSA 2BK3A 3CGBA 3EF6A 4K8DA 3BNMA 3FIMB 1CJ3A 2F5ZA 2NVKX 4JN9A 2OAMA 1UKVG 3AE3A 2C67A 4O5UA 5GRTA 3VR8A 2CVJA 3Q6JA 2QA1A 4A7AA 4CBQA 3I6DA 1ELIA 4H4PA 1TDEA 2YLXA 2GR1A 1B4VA 2FJAA 3QSMA 4DNAA 4K2XA 2QAEA 2XFUA 1E6EA 4C77A 4IA5A 1B37A 1PDHA 2EQ9A 4OPUA 1BGJA 3CPHG 3URHA 1GTHA 2HQMA 2YR4A 3ADAB 3UKPA 2V60A 4EM4A 2Q0KA 3M12A 3T14A 4APNA 3FMWA 4C3YA 4K7ZA 3GWFA 3NG7X 4P9SA 3DH9A 4XXGA 3UKAA 3P4PA 1FEBA 2GRTA 3K30A 3UKKA 5BULA 1K0LA 1S2QA 1CJCA 2WETA 4O5QA 2X8GA 5M0ZA 4C3XA 3C4AA 3UOYA 4B67A 1F3PA 1KSUA 3C4NA 5C2TA 3G5RA 1AOGA 3AYLA 1Y56A 1EL5A 3VQRA 1BWCA 3AEEA 2GF3A 2XVIA 3I3LA 1CJ2A 5U63A 2ACZA 3JSKA 2WU2A 5JCKA 4H50A 3CGCA 4FX9A 1TDFA 2O9ZA 3AB1A 3AXBA 4H4XA 3AD9B 4DSHA 1YY5A 3UP5A 1TDOA 1E39A 4X9NA 2TMDA 3CNDA 3RHAA 3G5SA 4Z2UA 4H2NA 4HA6A 3LJPA 3QVPA 3LB8A 2V3BA 4JQ9A 1CL0A 1VG0A 2XDOA 3B3RA 4FK1A 4G74A 1H86A 3GMCA 4NEVA 3NHOX 2WP6A 4B1BA 1ZK7A 3ABVA 3SQPA 2X50A 2FJBA 2GMJA 1PS9A 2WU5A 4BV6A 4BK1A 4BURA 4BJZA 2TPRA 2WBAA 4U8MA 1EBDA 2GR3A 4OPIA 3RP8A 1E1NA 1W4XA 2R9ZA 1XHCA 3AEBA 4GAVA 1GT8A 3RNMA 5GSNA 1H7XA 4J33A 4CNKA 4KPRA 3KLJA 4J36A 2Q6UA 2YVGA 4EIQA 3HZLA 1PHHA 4H4ZA 4Z24A 2I0ZA 1JRXA 2V5ZA 3BI4A 5BRTA 1KDGA 2JB1A 1H6VA 2R0PA 1BZLA 4GUVA 4TM0A 2B9YA 2GEWA 3VR9A 2C65A 3GYXA 4Z2RA 1PBBA 1GESA 1HYUA 3H4KA 2ZZ0A 3AE4A 1RSGA 1O5WA 1XPQA 1Y0PA 3NTAA 4H4YA 4I59A 3SYIA 4EQWA 4MJWA 1DJQA 4K5RA 1N1PA 5FS9A 1GRFA 1BGNA 3GRSA 2YG6A 2OLNA 1ZP0A 2R4JA 4U8IA 1CBOA 2PYXA 2FJEA 1EL9A 3CNJA 1S3EA 4A65A 3SZ0A 4FK1C 1OJ9A 2Z5YA 3DGHA 2WDQA 5JCMA 4Y4MA 4GRTA 1PN0A 2BXRA 1DXLA 4ZCCA 1GEUA 2Y6RA 1D7LA 1Q1WA 1PJ5A 2B7RA 3ATQA 3CMMA 3KKJA 4H7UA 4J56A 2YVJA 3NK2X 1VDCA 5KOXA 5JCNA 1H81A 3S61A 3DA1A 4NTDA 2EQ7A 2C4CA 1VQWA 3SM8A 3NKSA 3LZWA 4PAAA 4GDEA 1IUUA 4EMIA 5EBKA 3AEFA 2VVLA 3C96A 4D03A 4OPDA 1S2YA 4J2WA 1K0IA 4G73A 2ARDA 4J57A 1B8SA 3GSIA 1RP0A 2IVDA 2C70A 1MO9A 4YTMA 2ZZCA 3VRDB 1LVLA 2BYBA 2RGHA 4AT0A 5IQ1A 3DK8A 3ICTA 5TR3A 1PBFA 2DKHA 2YG7A 3GWDA 3QFBA 4XWRA 3KPFA 2VVMA 2VQBA 3UOXA 2APGA 2UZZA 1D4DA 2R0CA 1PXCA 5KMRA 1GALA 1LQUA 1JNZA 3L8KA 2E4GA 2YG3A 4J34A 1ZOVA 4IV9A 1N4WA 1F6MA 1DJNA 4G9KA 5HY5A 2XLRA 1TYTA 2A89A 4B69A 3SZFA 1FEAA 2R45A 2BA9A 3NYCA 2XVJA 1ZOYA 4OCGA 1H82A 3HYVA 2Z5XA 4Y4LA 1OJDA 4U8LA 2WPFA 3AWIA 4EIPA 2V6OA 3ATRA 3V3OA 3FG2P 1GTEA 1IJHA 3L1RA 3DGZA 4Z26A 1Q1RA 2R46A 2Y6QA 1LV0A 1X31B 3AE5A 4PABA 5KMQA 4A5LA 1NHRA 5DBJA 3LOVA 1JU2A 2WOWA 1ZY8A 4H4UA 4TM4A 1QLBA 1NAAA 4B65A 2RABA 3CNPA 3QFAA 4NTCA 3NN0X 5J7XA 4H4SA 3PO7A 1GRGA 4I58A 2WOIA 1FL2A 4C5OA 1NENA 2YR5A 3B6DA 3QVRA 4HB9A 1ZDLA 3GRTA 4CRTA 2YR6A 1CHUA 3BHFA 2YG4A 3ICRA 1BF3A 1CJ4A 2IIDA 1LTXR 3WE0A 5L46A 5BUKA 4JY2A 4BJYA 1IUXA 4YT0A 4UP3A 1PJ7A 2XFPA 3NNEA 4OPLA 4U8KA 1CC2A 5U25A 4BK2A 2X8CA 3CGDA 4OPGA 4AOSA 2IVEA 1ZMCA 2WDVA 1PBDA 3GDPA 4ZN0A 4DGKA 2ZZBA 5KWFA 3P1WA 1XDIA 1EL7A 1YQ4A 4JNAA 1ZMDA 5HXIA 3NYEA 1IUTA 3QSSA 1M6IA 3NLCA 1FECA 2WP5A 2WDRA 1H83A 2YLWA 3BNUA 1Z6LA 4JY3A 4EM3A 2H88A 4XWZA 3M13A 2YVFA 1O95A 3NK1X 2C3CA 2C3DA 2C76A 3REDA 4YTPA 1NHQA 4GCMA 4IVOB 3UTGA 2XFNA 2XLTA 1D4CA 2YAUA 4YXDA 1GRTA 1L9EA 3II4A 2QA2A 4KX6A 2XFOA 1XANA 4UDPA 1GERA 1DODA 1JNRA 2A8XA 2WS3A 1CC4A 4USQA 3T2ZA 1LPFA 3PVCA 3UTHA 2V61A 3NT6A 1IUVA 2XFQA 4LU6A 5HYMA 4TM3A 5FMHA 3T37A 4H4WA 1TRBA 3KVEA 4K22A 5FS6A 2WPEA 3CNTA 3GMBA 3LXDA 2C72A 1JRYA 4OPTA 5EOWA 1Q9IA 2WQYA 3AYJA 1NHSA 1DOEA 1NEKA 3CNSA 4U8JA 3DK4A 4EQRA 1NDAA 2C64A 2AQJA 2E5VA 1KNPA 2WPCA 2BABA 1IUSA 3R9UA 2YM2A 2EQ6A 3SZCA 4B63A 2C73A 2YG5A 4AOXA 4TLZA 3D1CA 3AE1A 4J31A 2VRMA 3P9UA 3F8PA 3IHMA 4EMJA 4II3A 1B5QA 2BK4A 1PXBA 1S3BA 1KF6A 2XVEA 4AP1A 3EPTA 2E1MA 3SGLA 3H8IA 3V76A 5BVAA 1GRBA 4GAPA 2YLZA 5KNLA 2BCGG 4A6NB 3VRAA 4YSZA 5ER0A 5KRQA 1D5TA 1NG3A 1KSSA 3ISHA 4NTEA 3DJDA 2Q7VA 3F8RA 4K5SA 1DOCA 3AE6A 4NWZA 5KXJA 2YQUA 1VRQB 3ALMA 1GNDA 4H4QA 1JRZA 4FDCB 2Q0LA 3FBSA 1NG4A 3BHKA 1Y56B 1GSNA 3HYWA 4RG3A 4NNJA 3K7MX 1P2HA 3GYIA 2W0HA 4REKA 1L0VA 1F8SA 2WESA 2WP9A 4YSHA 4YSYA 4U2SA 4Z2TA 3OC4A 4OVIA 4ECHA 3K7TA 1RYIA 4U8NA 4Z44A 3T0KA 3AEAA 2YLTA 3K7QX 1LJ1A 4RG4A 4H4TA 2YM1A 3AEDA 3ALJA 3E1TA 4H4VA 2BS2A 3SY4A 2X8HA 4LA1A 3AD7B 2NPXA 1GXFA 1YKJA 4YSXA 3GD4A 3F8DA 1E1KA 3LADA 3NRNA 1H84A 2JAEA 5FS7A 3D8XA 1NPXA 4E0VA 5KVHA 5LV9A 1FCDA 3UTEA 2JK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C74 A;  5C3J A;  4B66 A;  4EMW A;  3DME A;  2JB3 A;  2JBV A;  3AE9 A;  3KA7 A;  3O0H A;  2BAC A;  1QO8 A;  4H2R A;  3NN6 X;  4DSG A;  2X99 A;  4TM1 A;  3NYF A;  2H89 A;  2BCP A;  3IC9 A;  3ICS A;  1M64 A;  3P4Q A;  4IA6 A;  5HHF A;  1K0J A;  4A99 A;  2GH5 A;  3DJG X;  3NH3 X;  3UKH A;  1L9D A;  3COX A;  1TDK A;  2OAL A;  4A9W A;  2VZ2 A;  2QCU A;  2XVH A;  3NIX A;  3AE8 A;  3S5W A;  3QSE A;  4UDR A;  3CN8 A;  4N9X A;  2DKI A;  1QJD A;  1GRA A;  4OPC A;  3CTY A;  2GQW A;  4WCT A;  1REO A;  3UCL A;  2B9W A;  4U8P A;  4JNQ A;  1PXA A;  4TLX A;  3ZDN A;  1YQ3 A;  4CCR A;  3P4S A;  1CC6 A;  3UP4 A;  2B7S A;  1P2E A;  2ZBW A;  2CUL A;  1F8R A;  1V59 A;  3NK0 X;  3UKQ A;  1E1L A;  1LQT A;  1JOA A;  3ZYX A;  4EQX A;  2RGO A;  2OA1 A;  4B68 A;  4YKF A;  3UKL A;  1DNC A;  3IHG A;  2BS3 A;  2VQ7 A;  1N4V A;  3RP7 A;  2CFY A;  4YKG A;  1OJC A;  3EAN A;  4IVM B;  2GVC A;  2BXS A;  4U2T A;  1KFY A;  2OLO A;  1SEZ A;  2VVL G;  4Z25 A;  2BC1 A;  4U8O A;  4YWO A;  3ITJ A;  5EB4 A;  4X4J A;  1YQZ A;  2WOV A;  5CQF A;  1MXT A;  5JCL A;  2GAG B;  2GMH A;  4RSL A;  3NTD A;  1PJ6 A;  3AEG A;  3H8L A;  2GQF A;  4NEW A;  4GDP A;  2XYO A;  3GYJ A;  4H4R A;  4BK3 A;  1N4U A;  3CGE A;  4H2Q A;  2R4E A;  5KOW A;  3AE2 A;  2CDU A;  2B76 A;  2FBW A;  2FJD A;  3AD8 B;  3DJJ A;  3V3N A;  4AP3 A;  3IWA A;  3CPI G;  3KD9 A;  4YTN A;  1BKW A;  3UOV A;  2XVF A;  3LZX A;  1GV4 A;  1CF3 A;  2XLS A;  1VG9 A;  5EB5 A;  2C7G A;  1DOB A;  5IPY A;  1E1M A;  2BS4 A;  2C66 A;  2PHH A;  2VRL A;  4NZH A;  2BC0 A;  4UDQ A;  3P4R A;  3M0O A;  2GR0 A;  4ZCD A;  3UOZ A;  3EAO A;  5JCI A;  1PBE A;  5FS8 A;  1EL8 A;  3AEC A;  2WEU A;  2AR8 A;  2WHD A;  5CKU A;  5M10 A;  3RP6 A;  3KU9 A;  3UTF A;  1ZKQ A;  4EQS A;  4M52 A;  1ONF A;  4CNJ A;  2A87 A;  1E7P A;  2BK5 A;  1D4E A;  3IF9 A;  1NHP A;  3AYI A;  3G5Q A;  3ALL A;  5KVI A;  1IUW A;  2XLP A;  2XLU A;  3BI2 A;  2EQ8 A;  2X3N A;  1L9C A;  3SFD A;  2VOU A;  2R0G A;  2C75 A;  3DJE A;  4USR A;  3AE7 A;  3DK9 A;  1GRH A;  4CY8 A;  2V3A A;  3NGC X;  4ICY A;  4D04 A;  4JDR A;  4Z43 A;  4X9M A;  3FPZ A;  1KNR A;  3PS9 A;  1PBC A;  5J60 A;  3CIR A;  3OZ2 A;  4Y4N A;  4A79 A;  1COY A;  2YLR A;  1JEH A;  1OJT A;  3BI5 A;  1TDN A;  2GR2 A;  1ZX9 A;  2JB2 A;  1GET A;  1K4Q A;  2B9X A;  3Q9T A;  5IQ4 A;  1O94 A;  4WX1 A;  1MOK A;  2GV8 A;  5U1O A;  4H2P A;  1FOH A;  4U2L A;  4CY6 A;  4CCQ A;  1GPE A;  2GB0 A;  2JKC A;  3SFE A;  4B64 A;  1TYP A;  1F8W A;  1H7W A;  3GDN A;  3QJ4 A;  4ADW A;  3GD3 A;  2J3N A;  1GOS A;  1GRE A;  2XCG A;  2GAH B;  4AT2 A;  2AAQ A;  4GF7 A;  1D7Y A;  2YWL A;  4LII A;  3VRB A;  4GR1 A;  4A6N A;  2RGJ A;  3CPJ G;  1OJA A;  3UKF A;  2YLS A;  2BK3 A;  3CGB A;  3EF6 A;  4K8D A;  3BNM A;  3FIM B;  1CJ3 A;  2F5Z A;  2NVK X;  4JN9 A;  2OAM A;  1UKV G;  3AE3 A;  2C67 A;  4O5U A;  5GRT A;  3VR8 A;  2CVJ A;  3Q6J A;  2QA1 A;  4A7A A;  4CBQ A;  3I6D A;  1ELI A;  4H4P A;  1TDE A;  2YLX A;  2GR1 A;  1B4V A;  2FJA A;  3QSM A;  4DNA A;  4K2X A;  2QAE A;  2XFU A;  1E6E A;  4C77 A;  4IA5 A;  1B37 A;  1PDH A;  2EQ9 A;  4OPU A;  1BGJ A;  3CPH G;  3URH A;  1GTH A;  2HQM A;  2YR4 A;  3ADA B;  3UKP A;  2V60 A;  4EM4 A;  2Q0K A;  3M12 A;  4APN A;  3FMW A;  4C3Y A;  4K7Z A;  3GWF A;  3NG7 X;  4P9S A;  3DH9 A;  4XXG A;  3UKA A;  3P4P A;  2GRT A;  1FEB A;  3K30 A;  3UKK A;  5BUL A;  1K0L A;  1S2Q A;  1CJC A;  2WET A;  4O5Q A;  2X8G A;  5M0Z A;  4C3X A;  3C4A A;  3UOY A;  4B67 A;  1F3P A;  1KSU A;  3C4N A;  5C2T A;  3G5R A;  1AOG A;  3AYL A;  1Y56 A;  1EL5 A;  3VQR A;  1BWC A;  3AEE A;  2GF3 A;  2XVI A;  3I3L A;  1CJ2 A;  5U63 A;  2ACZ A;  3JSK A;  2WU2 A;  5JCK A;  4H50 A;  3CGC A;  4FX9 A;  1TDF A;  2O9Z A;  3AB1 A;  3AXB A;  4H4X A;  3AD9 B;  4DSH A;  1YY5 A;  3UP5 A;  1TDO A;  1E39 A;  4X9N A;  2TMD A;  3CND A;  3RHA A;  3G5S A;  4Z2U A;  4H2N A;  4HA6 A;  3LJP A;  3QVP A;  3LB8 A;  2V3B A;  4JQ9 A;  1CL0 A;  1VG0 A;  2XDO A;  3B3R A;  4FK1 A;  4NEV A;  1H86 A;  3GMC A;  3NHO X;  2WP6 A;  4B1B A;  1ZK7 A;  3ABV A;  3SQP A;  2X50 A;  2FJB A;  2GMJ A;  1PS9 A;  2WU5 A;  4BV6 A;  4BK1 A;  4BUR A;  4BJZ A;  2TPR A;  2WBA A;  4U8M A;  1EBD A;  2GR3 A;  4OPI A;  1E1N A;  1W4X A;  3RP8 A;  2R9Z A;  1XHC A;  3AEB A;  1GT8 A;  3RNM A;  5GSN A;  1H7X A;  4J33 A;  4CNK A;  4KPR A;  3KLJ A;  4J36 A;  2Q6U A;  2YVG A;  4EIQ A;  3HZL A;  1PHH A;  4H4Z A;  4Z24 A;  2I0Z A;  1JRX A;  2V5Z A;  3BI4 A;  5BRT A;  1KDG A;  2JB1 A;  1H6V A;  2R0P A;  1BZL A;  4GUV A;  4TM0 A;  2B9Y A;  2GEW A;  3VR9 A;  2C65 A;  4Z2R A;  1PBB A;  1GES A;  1HYU A;  3H4K A;  2ZZ0 A;  3AE4 A;  1RSG A;  1O5W A;  1XPQ A;  1Y0P A;  3NTA A;  4H4Y A;  4I59 A;  4EQW A;  4MJW A;  1DJQ A;  4K5R A;  1N1P A;  5FS9 A;  1GRF A;  1BGN A;  3GRS A;  2YG6 A;  2OLN A;  1ZP0 A;  2R4J A;  4U8I A;  1CBO A;  2PYX A;  2FJE A;  1EL9 A;  3CNJ A;  1S3E A;  4A65 A;  4FK1 C;  1OJ9 A;  2Z5Y A;  3DGH A;  2WDQ A;  5JCM A;  4Y4M A;  4GRT A;  1PN0 A;  2BXR A;  1DXL A;  4ZCC A;  1GEU A;  2Y6R A;  1D7L A;  1Q1W A;  1PJ5 A;  2B7R A;  3ATQ A;  3KKJ A;  4H7U A;  4J56 A;  2YVJ A;  3NK2 X;  1VDC A;  5KOX A;  5JCN A;  1H81 A;  3S61 A;  3DA1 A;  4NTD A;  2EQ7 A;  1VQW A;  3SM8 A;  3NKS A;  3LZW A;  4PAA A;  4GDE A;  1IUU A;  4EMI A;  5EBK A;  3AEF A;  2VVL A;  3C96 A;  4D03 A;  4OPD A;  1S2Y A;  4J2W A;  1K0I A;  2ARD A;  4J57 A;  1B8S A;  3GSI A;  1RP0 A;  2IVD A;  2C70 A;  1MO9 A;  4YTM A;  2ZZC A;  3VRD B;  1LVL A;  2BYB A;  2RGH A;  4AT0 A;  5IQ1 A;  3DK8 A;  3ICT A;  5TR3 A;  1PBF A;  2DKH A;  2YG7 A;  3GWD A;  3QFB A;  4XWR A;  3KPF A;  2VVM A;  2VQB A;  3UOX A;  2APG A;  2UZZ A;  1D4D A;  2R0C A;  1PXC A;  1GAL A;  1LQU A;  1JNZ A;  3L8K A;  2E4G A;  2YG3 A;  4J34 A;  1ZOV A;  4IV9 A;  1N4W A;  1F6M A;  1DJN A;  5HY5 A;  2XLR A;  1TYT A;  2A89 A;  4B69 A;  1FEA A;  2R45 A;  2BA9 A;  3NYC A;  2XVJ A;  1ZOY A;  4OCG A;  1H82 A;  2Z5X A;  4Y4L A;  1OJD A;  4U8L A;  2WPF A;  3AWI A;  4EIP A;  2V6O A;  3ATR A;  3V3O A;  3FG2 P;  1GTE A;  1IJH A;  3L1R A;  3DGZ A;  4Z26 A;  1Q1R A;  2R46 A;  2Y6Q A;  1LV0 A;  1X31 B;  3AE5 A;  4PAB A;  4A5L A;  1NHR A;  5DBJ A;  3LOV A;  1JU2 A;  2WOW A;  1ZY8 A;  4H4U A;  4TM4 A;  1QLB A;  1NAA A;  4B65 A;  2RAB A;  3CNP A;  3QFA A;  4NTC A;  3NN0 X;  5J7X A;  4H4S A;  3PO7 A;  1GRG A;  4I58 A;  2WOI A;  1FL2 A;  4C5O A;  1NEN A;  2YR5 A;  3B6D A;  3QVR A;  4HB9 A;  1ZDL A;  3GRT A;  4CRT A;  2YR6 A;  1CHU A;  3BHF A;  2YG4 A;  3ICR A;  1BF3 A;  1CJ4 A;  2IID A;  1LTX R;  3WE0 A;  5L46 A;  5BUK A;  4JY2 A;  1IUX A;  4BJY A;  4YT0 A;  4UP3 A;  1PJ7 A;  2XFP A;  3NNE A;  4OPL A;  4U8K A;  1CC2 A;  5U25 A;  2X8C A;  4BK2 A;  3CGD A;  4OPG A;  4AOS A;  2IVE A;  1ZMC A;  2WDV A;  1PBD A;  3GDP A;  4ZN0 A;  4DGK A;  2ZZB A;  5KWF A;  3P1W A;  1XDI A;  1EL7 A;  1YQ4 A;  4JNA A;  1ZMD A;  5HXI A;  3NYE A;  1IUT A;  3QSS A;  1M6I A;  3NLC A;  1FEC A;  2WP5 A;  2WDR A;  1H83 A;  2YLW A;  3BNU A;  1Z6L A;  4JY3 A;  4EM3 A;  2H88 A;  4XWZ A;  3M13 A;  2YVF A;  1O95 A;  3NK1 X;  2C3C A;  2C3D A;  2C76 A;  3RED A;  4YTP A;  1NHQ A;  4GCM A;  4IVO B;  3UTG A;  2XFN A;  2XLT A;  1D4C A;  2YAU A;  4YXD A;  1GRT A;  1L9E A;  3II4 A;  2QA2 A;  4KX6 A;  2XFO A;  1XAN A;  4UDP A;  1GER A;  1DOD A;  1JNR A;  2A8X A;  2WS3 A;  1CC4 A;  4USQ A;  1LPF A;  3PVC A;  3UTH A;  2V61 A;  3NT6 A;  1IUV A;  2XFQ A;  4LU6 A;  4TM3 A;  5FMH A;  5HYM A;  3T37 A;  4H4W A;  1TRB A;  3KVE A;  4K22 A;  5FS6 A;  2WPE A;  3CNT A;  3GMB A;  3LXD A;  2C72 A;  1JRY A;  4OPT A;  5EOW A;  1Q9I A;  2WQY A;  3AYJ A;  1NHS A;  1DOE A;  1NEK A;  3CNS A;  4U8J A;  3DK4 A;  4EQR A;  1NDA A;  2AQJ A;  2C64 A;  2E5V A;  1KNP A;  2WPC A;  2BAB A;  1IUS A;  3R9U A;  2YM2 A;  2EQ6 A;  4B63 A;  2C73 A;  2YG5 A;  4AOX A;  4TLZ A;  3D1C A;  3AE1 A;  4J31 A;  2VRM A;  3P9U A;  3F8P A;  3IHM A;  4EMJ A;  1B5Q A;  2BK4 A;  1PXB A;  1S3B A;  1KF6 A;  2XVE A;  4AP1 A;  3EPT A;  2E1M A;  3SGL A;  3H8I A;  3V76 A;  5BVA A;  1GRB A;  2YLZ A;  2BCG G;  4A6N B;  3VRA A;  4YSZ A;  5ER0 A;  5KRQ A;  1D5T A;  1NG3 A;  1KSS A;  3ISH A;  4NTE A;  3DJD A;  2Q7V A;  3F8R A;  4K5S A;  1DOC A;  3AE6 A;  5KXJ A;  2YQU A;  1VRQ B;  3ALM A;  1GND A;  4H4Q A;  1JRZ A;  4FDC B;  2Q0L A;  3FBS A;  1NG4 A;  3BHK A;  1Y56 B;  1GSN A;  4RG3 A;  3K7M X;  1P2H A;  3GYI A;  2W0H A;  4REK A;  1L0V A;  1F8S A;  2WES A;  2WP9 A;  4YSH A;  4YSY A;  4U2S A;  4Z2T A;  3OC4 A;  4OVI A;  4ECH A;  3K7T A;  1RYI A;  4U8N A;  4Z44 A;  3AEA A;  2YLT A;  3K7Q X;  1LJ1 A;  4RG4 A;  4H4T A;  2YM1 A;  3AED A;  3ALJ A;  3E1T A;  4H4V A;  2BS2 A;  2X8H A;  4LA1 A;  3AD7 B;  2NPX A;  1GXF A;  1YKJ A;  4YSX A;  3GD4 A;  3F8D A;  1E1K A;  3LAD A;  3NRN A;  1H84 A;  2JAE A;  5FS7 A;  3D8X A;  1NPX A;  4E0V A;  5KVH A;  5LV9 A;  1FCD A;  3UTE A;  2JK6 A; 
#chains in the Genus database with same CATH topology
 4C74 A;  5C3J A;  4B66 A;  4EMW A;  2BRA A;  3DME A;  2JB3 A;  2JBV A;  3AE9 A;  3KA7 A;  3O0H A;  2BAC A;  1QO8 A;  4H2R A;  3NN6 X;  4DSG A;  2X99 A;  4TM1 A;  3NYF A;  2H89 A;  4IA6 A;  2BCP A;  3IC9 A;  1M64 A;  3ICS A;  3P4Q A;  5HHF A;  1K0J A;  4A99 A;  2GH5 A;  3DJG X;  3NH3 X;  3HYX A;  3UKH A;  1L9D A;  2E48 A;  3COX A;  1TDK A;  2OAL A;  4A9W A;  2VZ2 A;  2QCU A;  2XVH A;  3NIX A;  3AE8 A;  3S5W A;  3QSE A;  4UDR A;  3CN8 A;  4N9X A;  2DKI A;  1QJD A;  1GRA A;  4OPC A;  3CTY A;  4WCT A;  2GQW A;  3T31 A;  1REO A;  3UCL A;  2B9W A;  4U8P A;  4JNQ A;  1PXA A;  4TLX A;  3ZDN A;  1YQ3 A;  4CCR A;  3P4S A;  3SXI A;  1CC6 A;  3UP4 A;  2B7S A;  1P2E A;  2ZBW A;  2CUL A;  1F8R A;  1V59 A;  3NK0 X;  3UKQ A;  4JQ9 A;  1E1L A;  1LQT A;  1JOA A;  3ZYX A;  4EQX A;  2RGO A;  2OA1 A;  4B68 A;  4YKF A;  3UKL A;  1DNC A;  1DDO A;  3IHG A;  2BS3 A;  2VQ7 A;  1N4V A;  3RP7 A;  2CFY A;  4G6G A;  4YKG A;  1OJC A;  3EAN A;  4IVM B;  2GVC A;  2BXS A;  4U2T A;  2OLO A;  1KFY A;  1SEZ A;  2VVL G;  4Z25 A;  2BC1 A;  4U8O A;  4YWO A;  3ITJ A;  5EB4 A;  4X4J A;  1YQZ A;  2WOV A;  5CQF A;  1MXT A;  5JCL A;  2GAG B;  2GMH A;  4RSL A;  3NTD A;  1PJ6 A;  3AEG A;  3H8L A;  2GQF A;  4NEW A;  4GDP A;  2XYO A;  3GYJ A;  4BK3 A;  4H4R A;  1N4U A;  3CGE A;  2R4E A;  4H2Q A;  5KMS A;  5KOW A;  4II2 A;  3AE2 A;  2CDU A;  2B76 A;  3AD8 B;  2FBW A;  2FJD A;  3DJJ A;  3V3N A;  4AP3 A;  3IWA A;  3CPI G;  3KD9 A;  4YTN A;  1BKW A;  3UOV A;  2XVF A;  3LZX A;  1GV4 A;  1CF3 A;  2XLS A;  1VG9 A;  5EB5 A;  2C7G A;  1DOB A;  5IPY A;  4QFD A;  2PHH A;  1E1M A;  2BS4 A;  2C66 A;  2VRL A;  4NZH A;  2BC0 A;  1C0P A;  4UDQ A;  3SX6 A;  3P4R A;  3M0O A;  2GR0 A;  4ZCD A;  3UOZ A;  3EAO A;  5JCI A;  1PBE A;  3T2Y A;  3WGT A;  1EL8 A;  5FS8 A;  3AEC A;  2WEU A;  2AR8 A;  2WHD A;  5CKU A;  5M10 A;  3RP6 A;  3KU9 A;  3UTF A;  1ZKQ A;  4EQS A;  4M52 A;  1ONF A;  4CNJ A;  2A87 A;  3IF9 A;  1E7P A;  1D4E A;  2BK5 A;  1NHP A;  3AYI A;  3G5Q A;  3ALL A;  5KVI A;  1IUW A;  2XLP A;  2XLU A;  3BI2 A;  3SZW A;  2EQ8 A;  2X3N A;  1L9C A;  4G6H A;  3SFD A;  2VOU A;  2R0G A;  2C75 A;  3DJE A;  4USR A;  3AE7 A;  3DK9 A;  3T2K A;  1GRH A;  4CY8 A;  2V3A A;  3NGC X;  4ICY A;  4D04 A;  4JDR A;  4Z43 A;  4X9M A;  3FPZ A;  1KNR A;  3PS9 A;  1PBC A;  5J60 A;  3CIR A;  3OZ2 A;  4Y4N A;  4A79 A;  1COY A;  2YLR A;  1JEH A;  1OJT A;  3BI5 A;  1TDN A;  2GR2 A;  1ZX9 A;  2JB2 A;  1GET A;  1K4Q A;  2B9X A;  3Q9T A;  5IQ4 A;  1O94 A;  4WX1 A;  1MOK A;  2GV8 A;  5U1O A;  1FOH A;  4H2P A;  4U2L A;  4CY6 A;  4CCQ A;  2GB0 A;  1GPE A;  1C0K A;  2JKC A;  3SFE A;  4B64 A;  1TYP A;  1F8W A;  1H7W A;  3GDN A;  3QJ4 A;  4ADW A;  3GD3 A;  2J3N A;  1GOS A;  1AN9 A;  2BRY A;  1GRE A;  5KMP A;  2XCG A;  2GAH B;  4AT2 A;  2AAQ A;  4GF7 A;  1D7Y A;  2YWL A;  4LII A;  3VRB A;  3KPK A;  4GR1 A;  4A6N A;  2RGJ A;  3CPJ G;  1OJA A;  3UKF A;  2YLS A;  2BK3 A;  3CGB A;  3EF6 A;  4K8D A;  3BNM A;  3FIM B;  1CJ3 A;  2F5Z A;  2NVK X;  4JN9 A;  2OAM A;  1UKV G;  3AE3 A;  2C67 A;  4O5U A;  5GRT A;  3VR8 A;  2CVJ A;  3Q6J A;  2QA1 A;  4A7A A;  4CBQ A;  3I6D A;  1ELI A;  4H4P A;  1TDE A;  2YLX A;  2GR1 A;  1B4V A;  2FJA A;  3QSM A;  4DNA A;  4K2X A;  1C0L A;  2QAE A;  2XFU A;  1E6E A;  4C77 A;  4IA5 A;  1B37 A;  1PDH A;  2EQ9 A;  4OPU A;  1BGJ A;  3CPH G;  3URH A;  1GTH A;  2HQM A;  3ADA B;  2YR4 A;  3UKP A;  2V60 A;  4EM4 A;  3M12 A;  2Q0K A;  3T14 A;  4APN A;  3ZNP A;  3FMW A;  4C3Y A;  4K7Z A;  3GWF A;  4P9S A;  3NG7 X;  3DH9 A;  4XXG A;  3UKA A;  3P4P A;  1FEB A;  2GRT A;  3K30 A;  3UKK A;  5BUL A;  1K0L A;  1S2Q A;  1CJC A;  2WET A;  4O5Q A;  2E82 A;  2X8G A;  4QFC A;  5M0Z A;  4C3X A;  3C4A A;  3UOY A;  4B67 A;  1F3P A;  1KSU A;  3C4N A;  5C2T A;  3G5R A;  1AOG A;  3AYL A;  1Y56 A;  1EL5 A;  3VQR A;  1BWC A;  3AEE A;  2GF3 A;  2XVI A;  3I3L A;  1CJ2 A;  5U63 A;  2ACZ A;  3JSK A;  2WU2 A;  5JCK A;  4H50 A;  3CGC A;  4FX9 A;  3AXB A;  1TDF A;  2O9Z A;  3AB1 A;  4H4X A;  3AD9 B;  4DSH A;  1YY5 A;  3UP5 A;  4X9N A;  1E39 A;  1TDO A;  2TMD A;  3CND A;  3RHA A;  3G5S A;  2E49 A;  4Z2U A;  4H2N A;  4HA6 A;  1DAO A;  3LJP A;  3QVP A;  3LB8 A;  3G3E A;  2V3B A;  1CL0 A;  1VG0 A;  2XDO A;  3B3R A;  4FK1 A;  4G74 A;  1H86 A;  3GMC A;  4NEV A;  4YJG A;  2WP6 A;  3NHO X;  4B1B A;  1ZK7 A;  3ABV A;  3SQP A;  2X50 A;  2FJB A;  2GMJ A;  1PS9 A;  2WU5 A;  4BV6 A;  4BK1 A;  4BUR A;  4BJZ A;  2TPR A;  4YJH B;  2WBA A;  4U8M A;  1VE9 A;  1EBD A;  2GR3 A;  4OPI A;  3RP8 A;  1E1N A;  1W4X A;  2R9Z A;  1XHC A;  3AEB A;  4GAV A;  1GT8 A;  3RNM A;  5GSN A;  3ZNN A;  1H7X A;  4J33 A;  4CNK A;  4KPR A;  3KLJ A;  4J36 A;  4YJD A;  2Q6U A;  2YVG A;  3HZL A;  4EIQ A;  1PHH A;  4H4Z A;  4Z24 A;  2I0Z A;  1JRX A;  2V5Z A;  3BI4 A;  5BRT A;  1KDG A;  2JB1 A;  1H6V A;  2R0P A;  3W4K A;  1BZL A;  4GUV A;  4TM0 A;  2B9Y A;  2GEW A;  3VR9 A;  2C65 A;  3GYX A;  4Z2R A;  1PBB A;  1GES A;  1HYU A;  3H4K A;  2ZZ0 A;  3AE4 A;  1RSG A;  1O5W A;  1XPQ A;  1Y0P A;  3NTA A;  4H4Y A;  4I59 A;  3SYI A;  4EQW A;  4MJW A;  1DJQ A;  4K5R A;  1N1P A;  5FS9 A;  4YJH A;  1BGN A;  1GRF A;  2YG6 A;  2OLN A;  1ZP0 A;  3GRS A;  2R4J A;  4U8I A;  1CBO A;  2PYX A;  2FJE A;  1EL9 A;  3CNJ A;  1S3E A;  4A65 A;  3SZ0 A;  4FK1 C;  1OJ9 A;  2Z5Y A;  3DGH A;  2WDQ A;  5JCM A;  4Y4M A;  4GRT A;  1PN0 A;  2BXR A;  1DXL A;  4ZCC A;  2DU8 A;  1GEU A;  2Y6R A;  1D7L A;  1PJ5 A;  1Q1W A;  2B7R A;  3ATQ A;  3CMM A;  3KKJ A;  4H7U A;  4J56 A;  2YVJ A;  3NK2 X;  1VDC A;  5KOX A;  5JCN A;  1H81 A;  3S61 A;  3DA1 A;  4NTD A;  2EQ7 A;  2C4C A;  1VQW A;  3SM8 A;  3NKS A;  3LZW A;  4PAA A;  4GDE A;  1IUU A;  4EMI A;  5EBK A;  3AEF A;  2VVL A;  3C96 A;  4D03 A;  4OPD A;  1S2Y A;  4J2W A;  1K0I A;  4G73 A;  2ARD A;  4YJF A;  4J57 A;  3GSI A;  1B8S A;  1RP0 A;  2IVD A;  2C70 A;  1MO9 A;  4YTM A;  2ZZC A;  3W4J A;  1LVL A;  2RGH A;  2BYB A;  3VRD B;  4AT0 A;  5IQ1 A;  3DK8 A;  3ICT A;  5TR3 A;  1PBF A;  2DKH A;  2YG7 A;  3GWD A;  3QFB A;  4XWR A;  3KPF A;  2VVM A;  2VQB A;  3UOX A;  2UZZ A;  2APG A;  1D4D A;  1PXC A;  2R0C A;  5KMR A;  1GAL A;  1LQU A;  1JNZ A;  3L8K A;  2E4G A;  2YG3 A;  4J34 A;  1ZOV A;  4IV9 A;  1N4W A;  1F6M A;  1DJN A;  4G9K A;  5HY5 A;  2XLR A;  1TYT A;  2A89 A;  4B69 A;  3SZF A;  1FEA A;  2R45 A;  2BA9 A;  3NYC A;  2XVJ A;  1ZOY A;  4OCG A;  1H82 A;  3HYV A;  2Z5X A;  4Y4L A;  1OJD A;  4U8L A;  3AWI A;  2WPF A;  4EIP A;  2V6O A;  3ATR A;  3V3O A;  3FG2 P;  1GTE A;  1IJH A;  3L1R A;  3DGZ A;  4Z26 A;  1Q1R A;  2R46 A;  2Y6Q A;  1LV0 A;  1X31 B;  4PAB A;  3AE5 A;  5KMQ A;  4A5L A;  1NHR A;  5DBJ A;  1KIF A;  3LOV A;  1JU2 A;  2WOW A;  1ZY8 A;  4H4U A;  4TM4 A;  1QLB A;  1NAA A;  4B65 A;  2RAB A;  3CNP A;  3QFA A;  4NTC A;  3NN0 X;  5J7X A;  4H4S A;  3W4I A;  3PO7 A;  1GRG A;  1EVI A;  4I58 A;  2WOI A;  1FL2 A;  4C5O A;  1NEN A;  2YR5 A;  3B6D A;  3QVR A;  4HB9 A;  1ZDL A;  3GRT A;  4CRT A;  2YR6 A;  1CHU A;  3BHF A;  2YG4 A;  5L46 A;  1BF3 A;  1CJ4 A;  2IID A;  1LTX R;  3ICR A;  3WE0 A;  5BUK A;  4JY2 A;  1IUX A;  4BJY A;  4YT0 A;  4UP3 A;  1PJ7 A;  2XFP A;  4YJG B;  3NNE A;  4OPL A;  4U8K A;  1CC2 A;  5U25 A;  4BK2 A;  2X8C A;  3CGD A;  4OPG A;  4AOS A;  2IVE A;  1ZMC A;  2WDV A;  1PBD A;  3GDP A;  4ZN0 A;  4DGK A;  2ZZB A;  5KWF A;  3P1W A;  1C0I A;  1XDI A;  1EL7 A;  1YQ4 A;  4JNA A;  3ZNQ A;  1ZMD A;  3NYE A;  5HXI A;  1IUT A;  3QSS A;  1M6I A;  2E4A A;  1FEC A;  2WP5 A;  3NLC A;  2WDR A;  1H83 A;  2YLW A;  3BNU A;  1Z6L A;  3CUK A;  4JY3 A;  4EM3 A;  2H88 A;  4XWZ A;  3M13 A;  2YVF A;  1O95 A;  3NK1 X;  2C3C A;  2C3D A;  2C76 A;  3RED A;  4YTP A;  1NHQ A;  4GCM A;  4IVO B;  3UTG A;  2XFN A;  2XLT A;  1D4C A;  2YAU A;  4YXD A;  1GRT A;  1L9E A;  3II4 A;  2QA2 A;  4KX6 A;  2XFO A;  1XAN A;  4UDP A;  1GER A;  1DOD A;  1JNR A;  2A8X A;  2WS3 A;  1CC4 A;  4USQ A;  3T2Z A;  1LPF A;  3PVC A;  3UTH A;  2V61 A;  3NT6 A;  1IUV A;  2XFQ A;  4LU6 A;  5HYM A;  4TM3 A;  5FMH A;  3T37 A;  4H4W A;  1TRB A;  3KVE A;  4K22 A;  5FS6 A;  2WPE A;  3CNT A;  3GMB A;  3LXD A;  2C72 A;  1JRY A;  4OPT A;  5EOW A;  1Q9I A;  2WQY A;  3AYJ A;  1NHS A;  1DOE A;  1NEK A;  3CNS A;  4U8J A;  3DK4 A;  4EQR A;  1NDA A;  2AQJ A;  2C64 A;  2E5V A;  1KNP A;  2WPC A;  2BAB A;  1IUS A;  3R9U A;  2YM2 A;  2EQ6 A;  3SZC A;  4B63 A;  2C73 A;  2YG5 A;  4AOX A;  4TLZ A;  3D1C A;  3AE1 A;  4J31 A;  2VRM A;  3P9U A;  3F8P A;  3IHM A;  4EMJ A;  4II3 A;  1B5Q A;  2BK4 A;  1PXB A;  1S3B A;  1KF6 A;  2XVE A;  4AP1 A;  3EPT A;  3SGL A;  2E1M A;  3H8I A;  3V76 A;  5BVA A;  1GRB A;  4GAP A;  2YLZ A;  5KNL A;  2BCG G;  4A6N B;  3VRA A;  4YSZ A;  5ER0 A;  3ZNO A;  5KRQ A;  1D5T A;  1NG3 A;  1KSS A;  3ISH A;  4NTE A;  3DJD A;  2Q7V A;  3F8R A;  4K5S A;  1DOC A;  3AE6 A;  4NWZ A;  5KXJ A;  2YQU A;  1VRQ B;  3ALM A;  1GND A;  4H4Q A;  1JRZ A;  4FDC B;  2Q0L A;  3FBS A;  1NG4 A;  3BHK A;  1Y56 B;  1GSN A;  3HYW A;  4RG3 A;  4NNJ A;  3K7M X;  1P2H A;  3GYI A;  2W0H A;  4REK A;  1L0V A;  1F8S A;  2WES A;  2WP9 A;  4YSH A;  4YSY A;  4U2S A;  4Z2T A;  3OC4 A;  4OVI A;  4ECH A;  3K7T A;  1RYI A;  4U8N A;  4Z44 A;  3T0K A;  3AEA A;  2YLT A;  3K7Q X;  1LJ1 A;  4RG4 A;  4H4T A;  2YM1 A;  3AED A;  3ALJ A;  3E1T A;  4YJF B;  4H4V A;  2BS2 A;  3SY4 A;  2X8H A;  4LA1 A;  3AD7 B;  2NPX A;  1GXF A;  1YKJ A;  4YSX A;  3GD4 A;  3F8D A;  1E1K A;  3LAD A;  3NRN A;  1H84 A;  2JAE A;  5FS7 A;  3D8X A;  1NPX A;  4E0V A;  5KVH A;  5LV9 A;  1FCD A;  3UTE A;  2JK6 A; 
#chains in the Genus database with same CATH homology
 4C74 A;  5C3J A;  4B66 A;  4EMW A;  2BRA A;  3DME A;  2JB3 A;  2JBV A;  3AE9 A;  3KA7 A;  3O0H A;  2BAC A;  1QO8 A;  4H2R A;  3NN6 X;  4DSG A;  2X99 A;  4TM1 A;  3NYF A;  2H89 A;  4IA6 A;  2BCP A;  3IC9 A;  1M64 A;  3ICS A;  3P4Q A;  5HHF A;  1K0J A;  4A99 A;  2GH5 A;  3DJG X;  3NH3 X;  3HYX A;  3UKH A;  1L9D A;  3COX A;  1TDK A;  2OAL A;  4A9W A;  2VZ2 A;  2QCU A;  2XVH A;  3NIX A;  3AE8 A;  3S5W A;  3QSE A;  4UDR A;  3CN8 A;  4N9X A;  2DKI A;  1QJD A;  1GRA A;  4OPC A;  3CTY A;  2GQW A;  4WCT A;  3T31 A;  1REO A;  3UCL A;  2B9W A;  4U8P A;  4JNQ A;  1PXA A;  4TLX A;  3ZDN A;  1YQ3 A;  4CCR A;  3P4S A;  3SXI A;  1CC6 A;  3UP4 A;  2B7S A;  1P2E A;  2ZBW A;  2CUL A;  1F8R A;  1V59 A;  3NK0 X;  3UKQ A;  1E1L A;  1LQT A;  1JOA A;  3ZYX A;  4EQX A;  2RGO A;  2OA1 A;  4B68 A;  4YKF A;  3UKL A;  1DNC A;  3IHG A;  2BS3 A;  2VQ7 A;  1N4V A;  3RP7 A;  2CFY A;  4G6G A;  4YKG A;  1OJC A;  3EAN A;  4IVM B;  2GVC A;  2BXS A;  4U2T A;  1KFY A;  2OLO A;  1SEZ A;  2VVL G;  4Z25 A;  2BC1 A;  4U8O A;  4YWO A;  3ITJ A;  5EB4 A;  4X4J A;  1YQZ A;  2WOV A;  5CQF A;  1MXT A;  5JCL A;  2GAG B;  2GMH A;  4RSL A;  3NTD A;  1PJ6 A;  3AEG A;  3H8L A;  2GQF A;  4NEW A;  4GDP A;  2XYO A;  3GYJ A;  4BK3 A;  4H4R A;  1N4U A;  3CGE A;  4H2Q A;  2R4E A;  5KMS A;  5KOW A;  4II2 A;  3AE2 A;  2CDU A;  2B76 A;  2FBW A;  2FJD A;  3AD8 B;  3DJJ A;  3V3N A;  4AP3 A;  3IWA A;  3CPI G;  3KD9 A;  4YTN A;  1BKW A;  3UOV A;  2XVF A;  3LZX A;  1GV4 A;  1CF3 A;  2XLS A;  1VG9 A;  5EB5 A;  2C7G A;  1DOB A;  5IPY A;  1E1M A;  2BS4 A;  2C66 A;  2PHH A;  2VRL A;  4NZH A;  2BC0 A;  4UDQ A;  3SX6 A;  3P4R A;  3M0O A;  2GR0 A;  4ZCD A;  3UOZ A;  3EAO A;  5JCI A;  1PBE A;  3T2Y A;  5FS8 A;  1EL8 A;  3AEC A;  2WEU A;  2AR8 A;  2WHD A;  5CKU A;  5M10 A;  3RP6 A;  3KU9 A;  3UTF A;  1ZKQ A;  4EQS A;  4M52 A;  1ONF A;  4CNJ A;  2A87 A;  1E7P A;  2BK5 A;  1D4E A;  3IF9 A;  1NHP A;  3AYI A;  3G5Q A;  3ALL A;  5KVI A;  1IUW A;  2XLP A;  2XLU A;  3BI2 A;  3SZW A;  2EQ8 A;  2X3N A;  1L9C A;  4G6H A;  3SFD A;  2VOU A;  2R0G A;  2C75 A;  3DJE A;  4USR A;  3AE7 A;  3DK9 A;  3T2K A;  1GRH A;  4CY8 A;  2V3A A;  3NGC X;  4ICY A;  4D04 A;  4JDR A;  4Z43 A;  4X9M A;  3FPZ A;  1KNR A;  3PS9 A;  1PBC A;  5J60 A;  3CIR A;  3OZ2 A;  4Y4N A;  4A79 A;  1COY A;  2YLR A;  1JEH A;  1OJT A;  3BI5 A;  1TDN A;  2GR2 A;  1ZX9 A;  2JB2 A;  1GET A;  1K4Q A;  2B9X A;  3Q9T A;  5IQ4 A;  1O94 A;  4WX1 A;  1MOK A;  2GV8 A;  5U1O A;  4H2P A;  1FOH A;  4U2L A;  4CY6 A;  4CCQ A;  1GPE A;  2GB0 A;  2JKC A;  3SFE A;  4B64 A;  1TYP A;  1F8W A;  1H7W A;  3GDN A;  3QJ4 A;  4ADW A;  3GD3 A;  2J3N A;  1GOS A;  2BRY A;  1GRE A;  5KMP A;  2XCG A;  2GAH B;  4AT2 A;  2AAQ A;  4GF7 A;  1D7Y A;  2YWL A;  4LII A;  3VRB A;  3KPK A;  4GR1 A;  4A6N A;  2RGJ A;  3CPJ G;  1OJA A;  3UKF A;  2YLS A;  2BK3 A;  3CGB A;  3EF6 A;  4K8D A;  3BNM A;  3FIM B;  1CJ3 A;  2F5Z A;  2NVK X;  4JN9 A;  2OAM A;  1UKV G;  3AE3 A;  2C67 A;  4O5U A;  5GRT A;  3VR8 A;  2CVJ A;  3Q6J A;  2QA1 A;  4A7A A;  4CBQ A;  3I6D A;  1ELI A;  4H4P A;  1TDE A;  2YLX A;  2GR1 A;  1B4V A;  2FJA A;  3QSM A;  4DNA A;  4K2X A;  2QAE A;  2XFU A;  1E6E A;  4C77 A;  4IA5 A;  1B37 A;  1PDH A;  2EQ9 A;  4OPU A;  1BGJ A;  3CPH G;  3URH A;  1GTH A;  2HQM A;  2YR4 A;  3ADA B;  3UKP A;  2V60 A;  4EM4 A;  2Q0K A;  3M12 A;  3T14 A;  4APN A;  3FMW A;  4C3Y A;  4K7Z A;  3GWF A;  3NG7 X;  4P9S A;  3DH9 A;  4XXG A;  3UKA A;  3P4P A;  1FEB A;  2GRT A;  3K30 A;  3UKK A;  5BUL A;  1K0L A;  1S2Q A;  1CJC A;  2WET A;  4O5Q A;  2X8G A;  5M0Z A;  4C3X A;  3C4A A;  3UOY A;  4B67 A;  1F3P A;  1KSU A;  3C4N A;  5C2T A;  3G5R A;  1AOG A;  3AYL A;  1Y56 A;  1EL5 A;  3VQR A;  1BWC A;  3AEE A;  2GF3 A;  2XVI A;  3I3L A;  1CJ2 A;  5U63 A;  2ACZ A;  3JSK A;  2WU2 A;  5JCK A;  4H50 A;  3CGC A;  4FX9 A;  1TDF A;  2O9Z A;  3AB1 A;  3AXB A;  4H4X A;  3AD9 B;  4DSH A;  1YY5 A;  3UP5 A;  1TDO A;  1E39 A;  4X9N A;  2TMD A;  3CND A;  3RHA A;  3G5S A;  4Z2U A;  4H2N A;  4HA6 A;  3LJP A;  3QVP A;  3LB8 A;  2V3B A;  4JQ9 A;  1CL0 A;  1VG0 A;  2XDO A;  3B3R A;  4FK1 A;  4G74 A;  1H86 A;  3GMC A;  4NEV A;  3NHO X;  2WP6 A;  4B1B A;  1ZK7 A;  3ABV A;  3SQP A;  2X50 A;  2FJB A;  2GMJ A;  1PS9 A;  2WU5 A;  4BV6 A;  4BK1 A;  4BUR A;  4BJZ A;  2TPR A;  2WBA A;  4U8M A;  1EBD A;  2GR3 A;  4OPI A;  3RP8 A;  1E1N A;  1W4X A;  2R9Z A;  1XHC A;  3AEB A;  4GAV A;  1GT8 A;  3RNM A;  5GSN A;  1H7X A;  4J33 A;  4CNK A;  4KPR A;  3KLJ A;  4J36 A;  2Q6U A;  2YVG A;  4EIQ A;  3HZL A;  1PHH A;  4H4Z A;  4Z24 A;  2I0Z A;  1JRX A;  2V5Z A;  3BI4 A;  5BRT A;  1KDG A;  2JB1 A;  1H6V A;  2R0P A;  1BZL A;  4GUV A;  4TM0 A;  2B9Y A;  2GEW A;  3VR9 A;  2C65 A;  3GYX A;  4Z2R A;  1PBB A;  1GES A;  1HYU A;  3H4K A;  2ZZ0 A;  3AE4 A;  1RSG A;  1O5W A;  1XPQ A;  1Y0P A;  3NTA A;  4H4Y A;  4I59 A;  3SYI A;  4EQW A;  4MJW A;  1DJQ A;  4K5R A;  1N1P A;  5FS9 A;  1GRF A;  1BGN A;  3GRS A;  2YG6 A;  2OLN A;  1ZP0 A;  2R4J A;  4U8I A;  1CBO A;  2PYX A;  2FJE A;  1EL9 A;  3CNJ A;  1S3E A;  4A65 A;  3SZ0 A;  4FK1 C;  1OJ9 A;  2Z5Y A;  3DGH A;  2WDQ A;  5JCM A;  4Y4M A;  4GRT A;  1PN0 A;  2BXR A;  1DXL A;  4ZCC A;  1GEU A;  2Y6R A;  1D7L A;  1Q1W A;  1PJ5 A;  2B7R A;  3ATQ A;  3CMM A;  3KKJ A;  4H7U A;  4J56 A;  2YVJ A;  3NK2 X;  1VDC A;  5KOX A;  5JCN A;  1H81 A;  3S61 A;  3DA1 A;  4NTD A;  2EQ7 A;  2C4C A;  1VQW A;  3SM8 A;  3NKS A;  3LZW A;  4PAA A;  4GDE A;  1IUU A;  4EMI A;  5EBK A;  3AEF A;  2VVL A;  3C96 A;  4D03 A;  4OPD A;  1S2Y A;  4J2W A;  1K0I A;  4G73 A;  2ARD A;  4J57 A;  1B8S A;  3GSI A;  1RP0 A;  2IVD A;  2C70 A;  1MO9 A;  4YTM A;  2ZZC A;  3VRD B;  1LVL A;  2BYB A;  2RGH A;  4AT0 A;  5IQ1 A;  3DK8 A;  3ICT A;  5TR3 A;  1PBF A;  2DKH A;  2YG7 A;  3GWD A;  3QFB A;  4XWR A;  3KPF A;  2VVM A;  2VQB A;  3UOX A;  2APG A;  2UZZ A;  1D4D A;  2R0C A;  1PXC A;  5KMR A;  1GAL A;  1LQU A;  1JNZ A;  3L8K A;  2E4G A;  2YG3 A;  4J34 A;  1ZOV A;  4IV9 A;  1N4W A;  1F6M A;  1DJN A;  4G9K A;  5HY5 A;  2XLR A;  1TYT A;  2A89 A;  4B69 A;  3SZF A;  1FEA A;  2R45 A;  2BA9 A;  3NYC A;  2XVJ A;  1ZOY A;  4OCG A;  1H82 A;  3HYV A;  2Z5X A;  4Y4L A;  1OJD A;  4U8L A;  2WPF A;  3AWI A;  4EIP A;  2V6O A;  3ATR A;  3V3O A;  3FG2 P;  1GTE A;  1IJH A;  3L1R A;  3DGZ A;  4Z26 A;  1Q1R A;  2R46 A;  2Y6Q A;  1LV0 A;  1X31 B;  3AE5 A;  4PAB A;  5KMQ A;  4A5L A;  1NHR A;  5DBJ A;  3LOV A;  1JU2 A;  2WOW A;  1ZY8 A;  4H4U A;  4TM4 A;  1QLB A;  1NAA A;  4B65 A;  2RAB A;  3CNP A;  3QFA A;  4NTC A;  3NN0 X;  5J7X A;  4H4S A;  3PO7 A;  1GRG A;  4I58 A;  2WOI A;  1FL2 A;  4C5O A;  1NEN A;  2YR5 A;  3B6D A;  3QVR A;  4HB9 A;  1ZDL A;  3GRT A;  4CRT A;  2YR6 A;  1CHU A;  3BHF A;  2YG4 A;  3ICR A;  1BF3 A;  1CJ4 A;  2IID A;  1LTX R;  3WE0 A;  5L46 A;  5BUK A;  4JY2 A;  4BJY A;  1IUX A;  4YT0 A;  4UP3 A;  1PJ7 A;  2XFP A;  3NNE A;  4OPL A;  4U8K A;  1CC2 A;  5U25 A;  4BK2 A;  2X8C A;  3CGD A;  4OPG A;  4AOS A;  2IVE A;  1ZMC A;  2WDV A;  1PBD A;  3GDP A;  4ZN0 A;  4DGK A;  2ZZB A;  5KWF A;  3P1W A;  1XDI A;  1EL7 A;  1YQ4 A;  4JNA A;  1ZMD A;  5HXI A;  3NYE A;  1IUT A;  3QSS A;  1M6I A;  3NLC A;  1FEC A;  2WP5 A;  2WDR A;  1H83 A;  2YLW A;  3BNU A;  1Z6L A;  4JY3 A;  4EM3 A;  2H88 A;  4XWZ A;  3M13 A;  2YVF A;  1O95 A;  3NK1 X;  2C3C A;  2C3D A;  2C76 A;  3RED A;  4YTP A;  1NHQ A;  4GCM A;  4IVO B;  3UTG A;  2XFN A;  2XLT A;  1D4C A;  2YAU A;  4YXD A;  1GRT A;  1L9E A;  3II4 A;  2QA2 A;  4KX6 A;  2XFO A;  1XAN A;  4UDP A;  1GER A;  1DOD A;  1JNR A;  2A8X A;  2WS3 A;  1CC4 A;  4USQ A;  3T2Z A;  1LPF A;  3PVC A;  3UTH A;  2V61 A;  3NT6 A;  1IUV A;  2XFQ A;  4LU6 A;  5HYM A;  4TM3 A;  5FMH A;  3T37 A;  4H4W A;  1TRB A;  3KVE A;  4K22 A;  5FS6 A;  2WPE A;  3CNT A;  3GMB A;  3LXD A;  2C72 A;  1JRY A;  4OPT A;  5EOW A;  1Q9I A;  2WQY A;  3AYJ A;  1NHS A;  1DOE A;  1NEK A;  3CNS A;  4U8J A;  3DK4 A;  4EQR A;  1NDA A;  2C64 A;  2AQJ A;  2E5V A;  1KNP A;  2WPC A;  2BAB A;  1IUS A;  3R9U A;  2YM2 A;  2EQ6 A;  3SZC A;  4B63 A;  2C73 A;  2YG5 A;  4AOX A;  4TLZ A;  3D1C A;  3AE1 A;  4J31 A;  2VRM A;  3P9U A;  3F8P A;  3IHM A;  4EMJ A;  4II3 A;  1B5Q A;  2BK4 A;  1PXB A;  1S3B A;  1KF6 A;  2XVE A;  4AP1 A;  3EPT A;  2E1M A;  3SGL A;  3H8I A;  3V76 A;  5BVA A;  1GRB A;  4GAP A;  2YLZ A;  5KNL A;  2BCG G;  4A6N B;  3VRA A;  4YSZ A;  5ER0 A;  5KRQ A;  1D5T A;  1NG3 A;  1KSS A;  3ISH A;  4NTE A;  3DJD A;  2Q7V A;  3F8R A;  4K5S A;  1DOC A;  3AE6 A;  4NWZ A;  5KXJ A;  2YQU A;  1VRQ B;  3ALM A;  1GND A;  4H4Q A;  1JRZ A;  4FDC B;  2Q0L A;  3FBS A;  1NG4 A;  3BHK A;  1Y56 B;  1GSN A;  3HYW A;  4RG3 A;  4NNJ A;  3K7M X;  1P2H A;  3GYI A;  2W0H A;  4REK A;  1L0V A;  1F8S A;  2WES A;  2WP9 A;  4YSH A;  4YSY A;  4U2S A;  4Z2T A;  3OC4 A;  4OVI A;  4ECH A;  3K7T A;  1RYI A;  4U8N A;  4Z44 A;  3T0K A;  3AEA A;  2YLT A;  3K7Q X;  1LJ1 A;  4RG4 A;  4H4T A;  2YM1 A;  3AED A;  3ALJ A;  3E1T A;  4H4V A;  2BS2 A;  3SY4 A;  2X8H A;  4LA1 A;  3AD7 B;  2NPX A;  1GXF A;  1YKJ A;  4YSX A;  3GD4 A;  3F8D A;  1E1K A;  3LAD A;  3NRN A;  1H84 A;  2JAE A;  5FS7 A;  3D8X A;  1NPX A;  4E0V A;  5KVH A;  5LV9 A;  1FCD A;  3UTE A;  2JK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...