4FK1C

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
298
Chain Sequence
YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin reductase
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
total genus 89
structure length 298
sequence length 299
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C02
1ZOVA 4DSHA 4WX1A 4K8DA 3VRAA 5C2TA 1H82A 1VDCA 3DJEA 2B9XA 1PHHA 3KKJA 1TDKA 1PXCA 3CGEA 2R0PA 2BABA 3AE2A 2QA2A 2Q6UA 4BJZA 3GMCA 1DJNA 1GRAA 3DJJA 3DGHA 4H4RA 2WOWA 4JY3A 4B65A 1OJTA 2Y6RA 4YSZA 4OVIA 1CJ3A 4DGKA 1LPFA 4Z2TA 3PS9A 1CBOA 2VQBA 3H8LA 3NYEA 4B66A 3D8XA 4LA1A 1H6VA 1KSSA 2WDRA 1KFYA 4RG4A 3GMBA 2Y6QA 1E39A 4UP3A 1P2EA 2BS3A 3SM8A 3ADAB 4EMIA 2ZBWA 2YWLA 3B6DA 4C74A 4USRA 3D1CA 3O0HA 1FECA 3OC4A 3CGCA 4UDPA 2C73A 2YLTA 2BCPA 2E4GA 3AE3A 2WS3A 1IUVA 5ER0A 2R4EA 3KPFA 3CNPA 3AEEA 3OZ2A 2BACA 1CL0A 2XLPA 2NPXA 3QFAA 1O94A 2WOVA 2VVMA 4I58A 4AOXA 1IJHA 1GPEA 3GYIA 3ALJA 1TDEA 3KVEA 4IVMB 4ICYA 5IQ4A 3CNTA 4M52A 4Z43A 4UDRA 3CPJG 3AD9B 3UKFA 2CULA 1KDGA 4H2PA 2IIDA 2GF3A 2ZZ0A 3GYJA 1TDOA 1BGNA 1GOSA 5IQ1A 1GNDA 1EL9A 4N9XA 3NN6X 4ZCDA 4J33A 4A7AA 1E7PA 1Q1RA 4H2NA 3PVCA 3AD7B 5EOWA 5GSNA 4AP1A 2R4JA 3AEDA 4D04A 1PS9A 4KPRA 1CF3A 5L46A 3ABVA 5M10A 1GREA 3UKKA 4EQWA 1DOCA 4NTDA 1BWCA 1Y0PA 2V60A 3NHOX 3NNEA 2GAGB 4GF7A 5KVHA 4K5RA 1EL5A 1FCDA 2WEUA 4EIPA 1B5QA 4USQA 2C64A 3P4RA 3CNDA 3FG2P 3ALMA 4XWRA 4U8JA 4MJWA 2EQ9A 1QJDA 3FBSA 4J57A 3II4A 4PABA 3VQRA 4AT0A 4U8IA 2DKIA 3NT6A 4H2RA 2XYOA 1E1KA 4O5QA 4A5LA 2BK3A 1CJ4A 4K22A 3ZDNA 3UKQA 1XANA 3UOZA 2WOIA 3NTDA 2WPCA 4FDCB 2QA1A 4JDRA 3RP6A 2YLXA 1NHQA 4HB9A 4BK3A 5KRQA 4Z26A 1CC6A 1CJCA 2WPEA 4U8LA 1GRTA 2GR3A 1BZLA 1Q1WA 3GDPA 3K30A 4X9NA 3BI2A 4LU6A 4C3XA 4H4UA 2XCGA 1X31B 2GAHB 4EIQA 2Q0KA 4EQRA 1H86A 4YKGA 2XFPA 3UP5A 4OPLA 2ACZA 4H4WA 4ADWA 3ZYXA 2FJDA 3AB1A 1O95A 4AP3A 5KOWA 3K7MX 4U8MA 3IWAA 4EQSA 1H81A 3KD9A 2A87A 1RYIA 1F3PA 2I0ZA 1E1LA 2OLNA 4C5OA 2RGOA 2XLUA 4K2XA 4CY6A 3V76A 2WU5A 1EL8A 4J31A 3DGZA 2H89A 1LTXR 4Y4LA 2JKCA 2AR8A 2Z5XA 1ZMDA 5HHFA 2AQJA 2JK6A 2YLZA 4K5SA 2APGA 5BULA 5HXIA 3F8PA 4APNA 1GEUA 2E1MA 4Z44A 2B7RA 2GR0A 1HYUA 1XPQA 1JRYA 1GERA 2FJAA 2VVLA 3LXDA 3NKSA 1L9DA 2GMHA 2J3NA 1D5TA 3UTHA 3QSSA 4IA5A 2R0CA 3G5QA 4H4TA 1NG3A 3CPIG 2WP9A 1B4VA 4U2SA 4H4ZA 4B63A 1PDHA 2C3DA 3RP8A 3GWFA 4IA6A 1OJAA 2X8HA 1S2QA 5JCNA 4Z25A 2B9YA 3RP7A 1NAAA 5FS8A 2GR1A 3C4NA 3ISHA 2XVFA 3FMWA 3AE4A 1JRXA 4A6NB 2YG5A 2VZ2A 3UOXA 3ATQA 1H83A 1NDAA 1NPXA 2QCUA 4GRTA 4U8PA 4PAAA 1VG0A 3ALLA 3BNMA 3Q9TA 2BXSA 1ZMCA 1YKJA 1P2HA 3EAOA 4AOSA 3QVPA 2PHHA 4BK1A 1V59A 5FS7A 2V61A 4EMJA 1CC4A 1PJ6A 1B8SA 1BGJA 2ZZCA 4BK2A 2V5ZA 2NVKX 4XXGA 3DMEA 4B1BA 2Q0LA 3IC9A 4H4VA 2XDOA 2C76A 3KLJA 2EQ7A 3I6DA 4GDEA 5EB4A 3P4SA 1DOEA 2H88A 3R9UA 2V3BA 4JNQA 4CNKA 1K0IA 3KU9A 4O5UA 3RNMA 2VRMA 3GWDA 4YSHA 2RGJA 1OJCA 1H7WA 2EQ8A 3DH9A 1ELIA 2BK4A 3F8RA 4U8NA 3S5WA 5LV9A 2JB1A 2VRLA 2CVJA 4TM4A 3C96A 3UTFA 2O9ZA 2Q7VA 1TYPA 1FL2A 2XFUA 2FJBA 4BV6A 4Z2RA 4IV9A 1M64A 1N4WA 3NG7X 1S3BA 2CFYA 1CC2A 2WP5A 3NH3X 4TM0A 5IPYA 5GRTA 3JSKA 2WP6A 4TM3A 4NEWA 1IUWA 4OPIA 1E1NA 1PBCA 1K0LA 2BC0A 4BJYA 3COXA 2BCGG 2VOUA 1BKWA 1GRHA 2ZZBA 2X8CA 2XLTA 2Z5YA 3HZLA 4BURA 2X50A 1NHSA 2VQ7A 2WQYA 3BI5A 1MO9A 2YM2A 1KNRA 1KSUA 2XVIA 2JB2A 4X9MA 1EL7A 1YY5A 1ZX9A 1D4DA 5TR3A 5KXJA 3T37A 4EM4A 3EPTA 1GETA 2YR5A 3S61A 1Z6LA 4NZHA 4A6NA 1NHRA 3G5SA 3K7TA 2TMDA 4IVOB 3EANA 4FK1C 5JCLA 1Y56A 1KNPA 3SQPA 4YSXA 2YAUA 2GEWA 1JEHA 3NTAA 3NYCA 1GXFA 3AD8B 4H4PA 5U25A 4OPTA 3GD3A 2TPRA 4CCRA 4U2LA 1D7LA 2WDVA 1PN0A 5EB5A 3CN8A 2IVDA 3BHKA 2C7GA 4DSGA 1H84A 3AE8A 3DK8A 4A65A 1MOKA 1GT8A 3AEFA 3CGBA 3CTYA 4U8OA 3CGDA 2JAEA 3LZWA 3F8DA 3AYLA 1GESA 2OALA 2EQ6A 3GRTA 1DNCA 2OAMA 3FPZA 4I59A 4H2QA 3V3OA 1PXBA 2RGHA 1JOAA 1W4XA 3PO7A 4B68A 3KA7A 2X3NA 1GTHA 3REDA 3AEBA 5JCMA 4ZCCA 3VRBA 5C3JA 4B64A 1IUUA 3DA1A 4CCQA 4C3YA 1GRFA 1REOA 4ZN0A 3ITJA 4JNAA 1YQ3A 2B76A 2XLRA 1ZY8A 2WHDA 1COYA 1D4CA 2OLOA 2XFNA 3AEGA 3UKLA 4YXDA 4EM3A 2YVFA 3L1RA 1M6IA 3AWIA 1PJ7A 1PJ5A 2GH5A 1S3EA 2R46A 2WESA 2WBAA 3AYIA 3UKHA 4P9SA 1GV4A 4NEVA 2JBVA 1L9CA 1N1PA 5KOXA 1NG4A 1VQWA 3LOVA 3NK2X 4NTCA 3AE7A 1ONFA 3SFEA 3LZXA 4GDPA 4GCMA 1F8SA 2GR2A 4H4QA 3ICTA 1RP0A 2QAEA 2GB0A 1L9EA 1FEBA 3BNUA 2BS4A 2YLWA 3P9UA 4LIIA 3LJPA 1F8WA 4RG3A 5M0ZA 4A99A 2GMJA 1E1MA 2RABA 5BVAA 3NN0X 1N4UA 1SEZA 1L0VA 3CIRA 5JCKA 2B7SA 2W0HA 4J2WA 4OPGA 4YKFA 3ICSA 4D03A 4REKA 1QLBA 4HA6A 3CNSA 3SFDA 3ATRA 3LADA 1YQZA 2GV8A 1Y56B 2R0GA 2YM1A 4H4YA 1IUXA 1XDIA 1PXAA 2XLSA 1YQ4A 2ARDA 3DK9A 3QVRA 1OJ9A 4JN9A 3AE5A 1LQUA 1MXTA 3CNJA 4OPUA 4B69A 4C77A 2YG4A 1GALA 1H7XA 1TYTA 4J34A 3QFBA 1B37A 2C72A 1O5WA 3AE1A 3UKAA 3RHAA 4Z24A 1AOGA 4OPDA 4KX6A 3I3LA 4J36A 2FJEA 1NEKA 2C75A 3UP4A 1DODA 3M0OA 1E6EA 2B9WA 2PYXA 3M12A 4FX9A 3GDNA 2BXRA 4YTNA 1EBDA 3H4KA 3IHMA 5FMHA 3AE9A 2AAQA 4GUVA 3AEAA 1F6MA 3UOVA 4YTMA 4YTPA 1JRZA 3FIMB 4OPCA 1QO8A 1BF3A 1RSGA 1PBFA 3AE6A 2WDQA 1VRQB 2E5VA 5JCIA 1VG9A 3NIXA 4RSLA 1GSNA 1IUTA 5HY5A 4XWZA 2C65A 2BK5A 2YLSA 3UOYA 3P4QA 3ICRA 3QJ4A 1LVLA 2UZZA 1JNRA 3H8IA 1DJQA 5EBKA 3K7QX 2GQFA 4H7UA 2YQUA 1ZP0A 4H4XA 1GRBA 4X4JA 3G5RA 5U1OA 5KVIA 1GRGA 3QSMA 3AECA 1OJDA 1PBDA 3NK0X 1FEAA 2XVJA 2XFQA 5J60A 3NLCA 1JNZA 2C3CA 4H4SA 4TLXA 3GSIA 2R45A 3UTGA 1DOBA 3WE0A 1NHPA 3P1WA 5CKUA 2IVEA 3UCLA 2YR4A 3QSEA 2YLRA 1JU2A 1Q9IA 2BS2A 3LB8A 3Q6JA 4FK1A 4CBQA 3CPHG 4K7ZA 4EMWA 1ZOYA 1DXLA 1D7YA 1TDNA 5BRTA 4CRTA 2GVCA 4DNAA 2XFOA 4Y4MA 1UKVG 3UKPA 1PBEA 1CJ2A 2GQWA 4AT2A 1K4QA 4JQ9A 5CQFA 1ZK7A 3NRNA 1LV0A 5HYMA 4Z2UA 1LQTA 2YVJA 2JB3A 2YG7A 4U8KA 2C66A 3URHA 4WCTA 2X99A 2C67A 4TLZA 2CDUA 4H50A 3V3NA 2FBWA 5FS9A 4CY8A 3C4AA 2YG3A 2X8GA 4CNJA 4J56A 3EF6A 1NENA 3DK4A 1N4VA 2WPFA 1TDFA 5J7XA 3VRDB 3AXBA 2DKHA 1ZKQA 3BHFA 2OA1A 4YSYA 4E0VA 2R9ZA 4JY2A 3VR9A 3GRSA 1D4EA 5DBJA 2BA9A 2WETA 3IHGA 3L8KA 2WU2A 3NYFA 4NTEA 2YG6A 3NGCX 1F8RA 3B3RA 3IF9A 4Y4NA 1S2YA 4U2TA 5KWFA 1CHUA 2F5ZA 2HQMA 1ZDLA 2A8XA 2V3AA 1PBBA 3GD4A 3UTEA 4A79A 3SGLA 2XVHA 4OCGA 4YT0A 3DJDA 5BUKA 5U63A 4GR1A 3E1TA 2BYBA 1IUSA 4A9WA 3BI4A 2V6OA 1K0JA 3VR8A 4B67A 4EQXA 3NK1X 2XVEA 5FS6A 4ECHA 1FOHA 2YVGA 3M13A 4TM1A 3P4PA 1LJ1A 1GTEA 3DJGX 2A89A 3AYJA 2GRTA 2VVLG 4UDQA 2BC1A 4YWOA 2YR6A 1TRBA 2C70A 1XHCA 1KF6A
chains in the Genus database with same CATH superfamily
1ZOVA 4DSHA 4WX1A 4K8DA 3VRAA 5C2TA 1H82A 1VDCA 3DJEA 2B9XA 1PHHA 3KKJA 1TDKA 1PXCA 3CGEA 2R0PA 2BABA 5KMRA 3AE2A 2QA2A 2Q6UA 4BJZA 3GMCA 1DJNA 1GRAA 3DJJA 3DGHA 4H4RA 2WOWA 4JY3A 4B65A 1OJTA 2Y6RA 3SYIA 4YSZA 4OVIA 1CJ3A 4DGKA 1LPFA 4Z2TA 3PS9A 1CBOA 2VQBA 3H8LA 3NYEA 4B66A 3D8XA 4LA1A 1H6VA 1KSSA 2WDRA 4G6GA 1KFYA 4RG4A 3GMBA 2Y6QA 1E39A 4UP3A 1P2EA 2BS3A 3SM8A 3ADAB 4EMIA 2ZBWA 2YWLA 3B6DA 4C74A 4USRA 3D1CA 3O0HA 1FECA 3OC4A 3CGCA 4UDPA 2C73A 2YLTA 2BCPA 2E4GA 3AE3A 2WS3A 1IUVA 5ER0A 2R4EA 3KPFA 3CNPA 3AEEA 3OZ2A 2BACA 1CL0A 2XLPA 2NPXA 3QFAA 1O94A 2WOVA 2VVMA 4I58A 4AOXA 3GYXA 1IJHA 1GPEA 3GYIA 3ALJA 1TDEA 3KVEA 4IVMB 4ICYA 5IQ4A 3CNTA 4M52A 4Z43A 4UDRA 3CPJG 3AD9B 3UKFA 2CULA 1KDGA 3SZWA 4H2PA 2IIDA 2GF3A 2ZZ0A 3GYJA 1TDOA 1BGNA 1GOSA 5IQ1A 1GNDA 1EL9A 4N9XA 3NN6X 4ZCDA 4J33A 4A7AA 1E7PA 1Q1RA 4H2NA 3PVCA 3AD7B 5EOWA 5GSNA 4AP1A 2R4JA 3AEDA 4D04A 1PS9A 4KPRA 1CF3A 5L46A 3ABVA 5M10A 1GREA 3UKKA 4EQWA 1DOCA 4NTDA 1BWCA 1Y0PA 2V60A 3NHOX 3NNEA 2GAGB 4GF7A 5KVHA 4K5RA 1EL5A 1FCDA 2WEUA 4EIPA 1B5QA 4USQA 2C64A 3P4RA 3CNDA 3FG2P 3ALMA 4XWRA 4U8JA 4MJWA 2EQ9A 1QJDA 3FBSA 4J57A 3II4A 4PABA 3VQRA 4AT0A 4U8IA 2DKIA 3NT6A 4H2RA 2XYOA 3SX6A 1E1KA 4O5QA 4A5LA 2BK3A 1CJ4A 4K22A 3ZDNA 3UKQA 1XANA 3UOZA 2WOIA 3NTDA 2WPCA 4FDCB 2QA1A 4JDRA 3RP6A 2YLXA 1NHQA 4HB9A 3T14A 4BK3A 5KRQA 4Z26A 1CC6A 4G9KA 1CJCA 2WPEA 4U8LA 1GRTA 2GR3A 1BZLA 1Q1WA 3GDPA 3K30A 4X9NA 3T31A 3BI2A 3HYXA 4LU6A 4C3XA 4H4UA 2XCGA 1X31B 2GAHB 2BRYA 4EIQA 2Q0KA 4EQRA 1H86A 4YKGA 2XFPA 5KMQA 3UP5A 4OPLA 2ACZA 4H4WA 4ADWA 4G74A 3ZYXA 2FJDA 3AB1A 1O95A 4AP3A 5KOWA 3K7MX 4U8MA 3IWAA 4EQSA 1H81A 3KD9A 2A87A 1RYIA 1F3PA 2I0ZA 1E1LA 2OLNA 4C5OA 2RGOA 2XLUA 4K2XA 4CY6A 3V76A 2WU5A 1EL8A 4J31A 3DGZA 2H89A 1LTXR 4Y4LA 2JKCA 2AR8A 2Z5XA 1ZMDA 5HHFA 2AQJA 2JK6A 2YLZA 4K5SA 2APGA 5BULA 5HXIA 3F8PA 4APNA 1GEUA 2E1MA 4Z44A 2B7RA 2GR0A 1HYUA 1XPQA 1JRYA 1GERA 2FJAA 2VVLA 3LXDA 3NKSA 1L9DA 2GMHA 2J3NA 1D5TA 3UTHA 3QSSA 4IA5A 2R0CA 3G5QA 4H4TA 1NG3A 3CPIG 2WP9A 1B4VA 4U2SA 4GAVA 4H4ZA 1PDHA 4B63A 2C3DA 3RP8A 3GWFA 4IA6A 1OJAA 4II3A 2X8HA 1S2QA 3T2ZA 5JCNA 4Z25A 2B9YA 3RP7A 1NAAA 5FS8A 2GR1A 3C4NA 3ISHA 5KMSA 2XVFA 3FMWA 3AE4A 1JRXA 4A6NB 2YG5A 2VZ2A 3UOXA 3ATQA 1H83A 1NDAA 1NPXA 2QCUA 4GRTA 4U8PA 4PAAA 1VG0A 3ALLA 3BNMA 3Q9TA 2BXSA 1ZMCA 1YKJA 1P2HA 3EAOA 4AOSA 3QVPA 2PHHA 4NNJA 3T2YA 4BK1A 1V59A 5FS7A 2V61A 4EMJA 1CC4A 1PJ6A 1B8SA 1BGJA 2ZZCA 4BK2A 2V5ZA 2NVKX 4XXGA 3DMEA 4B1BA 2Q0LA 3IC9A 4H4VA 2XDOA 2C76A 3KLJA 2EQ7A 3I6DA 4GDEA 5EB4A 3P4SA 1DOEA 2H88A 3R9UA 2V3BA 4JNQA 4CNKA 1K0IA 3KU9A 4O5UA 3RNMA 2VRMA 3GWDA 4YSHA 2RGJA 1OJCA 1H7WA 2EQ8A 3DH9A 1ELIA 2BK4A 3F8RA 4U8NA 3S5WA 5LV9A 2JB1A 2VRLA 2CVJA 4TM4A 3C96A 3UTFA 2O9ZA 2Q7VA 1TYPA 1FL2A 2XFUA 2FJBA 4BV6A 4Z2RA 4IV9A 1M64A 1N4WA 3NG7X 1S3BA 2CFYA 1CC2A 2WP5A 3NH3X 3SY4A 4TM0A 5IPYA 5GRTA 3JSKA 2WP6A 4TM3A 4NEWA 1IUWA 4OPIA 1E1NA 4GAPA 1PBCA 1K0LA 2BC0A 4BJYA 3COXA 2BCGG 2VOUA 1BKWA 1GRHA 2ZZBA 2X8CA 2XLTA 2Z5YA 3HZLA 4BURA 2X50A 1NHSA 2VQ7A 2WQYA 3BI5A 1MO9A 2YM2A 1KNRA 1KSUA 2XVIA 2JB2A 4X9MA 1EL7A 1YY5A 1ZX9A 1D4DA 5TR3A 5KXJA 3T37A 4EM4A 3EPTA 1GETA 2YR5A 3S61A 1Z6LA 4NZHA 4A6NA 1NHRA 4G73A 3G5SA 3K7TA 2TMDA 4IVOB 3EANA 4FK1C 5JCLA 1Y56A 1KNPA 3SQPA 4YSXA 2YAUA 2GEWA 1JEHA 3NTAA 3NYCA 1GXFA 3AD8B 4H4PA 5U25A 4OPTA 3GD3A 2TPRA 4CCRA 4U2LA 1D7LA 2WDVA 1PN0A 5EB5A 3CN8A 2IVDA 3T0KA 3BHKA 2C7GA 3KPKA 4DSGA 1H84A 3AE8A 3DK8A 4A65A 1MOKA 1GT8A 3AEFA 3CGBA 3CTYA 4U8OA 3CGDA 2JAEA 3LZWA 3F8DA 3AYLA 1GESA 2OALA 2EQ6A 3GRTA 1DNCA 2OAMA 3FPZA 4I59A 4H2QA 3V3OA 1PXBA 2RGHA 1JOAA 1W4XA 3PO7A 4B68A 3KA7A 2X3NA 1GTHA 3REDA 3AEBA 5JCMA 4ZCCA 3VRBA 5C3JA 4B64A 1IUUA 3DA1A 4CCQA 4C3YA 1GRFA 1REOA 4ZN0A 3ITJA 4JNAA 1YQ3A 2B76A 2XLRA 1ZY8A 2WHDA 1COYA 1D4CA 2OLOA 2XFNA 3AEGA 3UKLA 4YXDA 4EM3A 2YVFA 3L1RA 1M6IA 3AWIA 1PJ7A 1PJ5A 2GH5A 1S3EA 2R46A 2WESA 2WBAA 3AYIA 3UKHA 4P9SA 1GV4A 4NEVA 2JBVA 1L9CA 1N1PA 5KOXA 1NG4A 1VQWA 3LOVA 3NK2X 4NTCA 3AE7A 1ONFA 3SFEA 3LZXA 4GDPA 4GCMA 1F8SA 2GR2A 4H4QA 3ICTA 1RP0A 2QAEA 2GB0A 1L9EA 1FEBA 3BNUA 2BS4A 2YLWA 3P9UA 4LIIA 3LJPA 1F8WA 4RG3A 5M0ZA 4A99A 2GMJA 1E1MA 2RABA 5BVAA 3NN0X 1N4UA 1SEZA 1L0VA 3CIRA 5JCKA 2B7SA 2W0HA 4J2WA 4OPGA 4YKFA 3ICSA 4D03A 4REKA 1QLBA 4HA6A 3CNSA 3SFDA 3ATRA 3LADA 1YQZA 2GV8A 1Y56B 2R0GA 2YM1A 4H4YA 1IUXA 1XDIA 1PXAA 2XLSA 1YQ4A 2ARDA 3DK9A 3QVRA 1OJ9A 4JN9A 3AE5A 1LQUA 1MXTA 3CNJA 4OPUA 4B69A 4C77A 2YG4A 1GALA 1H7XA 1TYTA 4J34A 3QFBA 1B37A 2C72A 1O5WA 3AE1A 3UKAA 3RHAA 4Z24A 1AOGA 3HYVA 4OPDA 4KX6A 3I3LA 4J36A 2FJEA 1NEKA 2C75A 3UP4A 1DODA 3M0OA 1E6EA 2B9WA 2PYXA 3M12A 4FX9A 3GDNA 2BXRA 4YTNA 1EBDA 3H4KA 3IHMA 5FMHA 3AE9A 3SZFA 2AAQA 4GUVA 3AEAA 1F6MA 3UOVA 4YTMA 4YTPA 1JRZA 3FIMB 4OPCA 1QO8A 1BF3A 1RSGA 1PBFA 3AE6A 2WDQA 1VRQB 2E5VA 5JCIA 1VG9A 3NIXA 4RSLA 1GSNA 1IUTA 5HY5A 4XWZA 2C65A 2BK5A 2YLSA 3UOYA 3P4QA 3ICRA 3QJ4A 1LVLA 2UZZA 1JNRA 3H8IA 1DJQA 5EBKA 3K7QX 2GQFA 4H7UA 3T2KA 2YQUA 1ZP0A 4H4XA 1GRBA 4X4JA 3G5RA 5U1OA 5KVIA 1GRGA 2C4CA 3SZ0A 3QSMA 3AECA 1OJDA 1PBDA 3NK0X 1FEAA 2XVJA 2XFQA 5J60A 3NLCA 1JNZA 2C3CA 4H4SA 4TLXA 3GSIA 2R45A 3UTGA 1DOBA 3WE0A 1NHPA 3P1WA 5CKUA 2IVEA 3UCLA 2YR4A 3QSEA 2YLRA 1JU2A 3CMMA 1Q9IA 2BS2A 3LB8A 3Q6JA 4FK1A 4CBQA 3CPHG 4K7ZA 4EMWA 1ZOYA 3HYWA 1DXLA 1D7YA 1TDNA 5BRTA 4CRTA 2GVCA 4DNAA 2XFOA 4Y4MA 1UKVG 3UKPA 1PBEA 1CJ2A 2GQWA 3SXIA 3SZCA 4AT2A 1K4QA 4JQ9A 5CQFA 1ZK7A 3NRNA 1LV0A 5HYMA 4Z2UA 1LQTA 2YVJA 2JB3A 2YG7A 4U8KA 2C66A 3URHA 4WCTA 2X99A 2C67A 4TLZA 2CDUA 4H50A 3V3NA 2FBWA 5FS9A 4CY8A 3C4AA 2YG3A 2X8GA 4CNJA 4J56A 3EF6A 1NENA 3DK4A 1N4VA 2WPFA 1TDFA 5J7XA 3VRDB 3AXBA 2DKHA 1ZKQA 3BHFA 2OA1A 4YSYA 5KMPA 4E0VA 2R9ZA 4JY2A 3VR9A 3GRSA 1D4EA 5DBJA 2BA9A 2BRAA 2WETA 3IHGA 3L8KA 2WU2A 3NYFA 4NTEA 2YG6A 3NGCX 1F8RA 3B3RA 3IF9A 4Y4NA 1S2YA 4U2TA 5KWFA 1CHUA 2F5ZA 2HQMA 1ZDLA 2A8XA 2V3AA 1PBBA 3GD4A 3UTEA 4A79A 3SGLA 2XVHA 4OCGA 4YT0A 3DJDA 5BUKA 5U63A 4GR1A 3E1TA 2BYBA 1IUSA 4NWZA 4A9WA 3BI4A 5KNLA 2V6OA 1K0JA 4G6HA 3VR8A 4B67A 4EQXA 3NK1X 2XVEA 5FS6A 4ECHA 1FOHA 2YVGA 3M13A 4TM1A 3P4PA 1LJ1A 1GTEA 3DJGX 2A89A 3AYJA 4II2A 2GRTA 2VVLG 4UDQA 2BC1A 4YWOA 2YR6A 1TRBA 2C70A 1XHCA 1KF6A
chains in the Genus database with same CATH topology
1ZOVA 4DSHA 4WX1A 4K8DA 3VRAA 5C2TA 1H82A 1VDCA 3DJEA 2B9XA 1PHHA 3KKJA 1TDKA 1PXCA 3CGEA 2R0PA 2BABA 5KMRA 3AE2A 2QA2A 2Q6UA 4BJZA 3GMCA 1DJNA 1GRAA 3DJJA 3DGHA 4H4RA 2WOWA 4JY3A 4B65A 1OJTA 2Y6RA 3SYIA 4YSZA 4OVIA 1CJ3A 4DGKA 1LPFA 4Z2TA 3PS9A 1CBOA 2VQBA 3H8LA 3NYEA 4B66A 3D8XA 4LA1A 1H6VA 1KSSA 2WDRA 4G6GA 1KFYA 4RG4A 3GMBA 2Y6QA 1E39A 4UP3A 1P2EA 2BS3A 3SM8A 3ADAB 4EMIA 2ZBWA 2YWLA 3B6DA 4C74A 4USRA 3D1CA 3O0HA 1FECA 3OC4A 3CGCA 4UDPA 2C73A 2YLTA 2BCPA 2E4GA 3AE3A 2WS3A 1IUVA 5ER0A 2R4EA 3KPFA 3CNPA 3AEEA 3OZ2A 2BACA 1CL0A 2XLPA 2NPXA 3QFAA 1O94A 2WOVA 2VVMA 4I58A 4AOXA 3GYXA 1IJHA 1GPEA 3GYIA 3ALJA 1TDEA 3KVEA 4IVMB 4ICYA 5IQ4A 3CNTA 4M52A 4Z43A 4UDRA 3CPJG 3AD9B 3UKFA 2CULA 1KDGA 3SZWA 4H2PA 2IIDA 2GF3A 2ZZ0A 3GYJA 1TDOA 1BGNA 1GOSA 5IQ1A 1GNDA 1EL9A 4N9XA 3NN6X 4ZCDA 4J33A 4A7AA 1E7PA 1Q1RA 4H2NA 3PVCA 3AD7B 5EOWA 5GSNA 4AP1A 2R4JA 3AEDA 4D04A 1PS9A 4KPRA 1CF3A 5L46A 3ABVA 5M10A 1GREA 3UKKA 4EQWA 1DOCA 4NTDA 1BWCA 1Y0PA 2V60A 3NHOX 3NNEA 2GAGB 4GF7A 5KVHA 4K5RA 1EL5A 1FCDA 2WEUA 4EIPA 1B5QA 4USQA 2C64A 3P4RA 3CNDA 3FG2P 3ALMA 4XWRA 4U8JA 4MJWA 2EQ9A 1QJDA 3FBSA 4J57A 3II4A 4PABA 3VQRA 4AT0A 4U8IA 2DKIA 3NT6A 4H2RA 2XYOA 3SX6A 1E1KA 4O5QA 4A5LA 2BK3A 1CJ4A 4K22A 3ZDNA 3UKQA 1XANA 3UOZA 2WOIA 3NTDA 2WPCA 4FDCB 2QA1A 4JDRA 3RP6A 2YLXA 1NHQA 4HB9A 3T14A 4BK3A 5KRQA 4Z26A 1CC6A 4G9KA 1CJCA 2WPEA 4U8LA 1GRTA 2GR3A 1BZLA 1Q1WA 3GDPA 3K30A 4X9NA 3T31A 3BI2A 3HYXA 4LU6A 4C3XA 4H4UA 2XCGA 1X31B 2GAHB 2BRYA 4EIQA 2Q0KA 4EQRA 1H86A 4YKGA 2XFPA 5KMQA 3UP5A 4OPLA 2ACZA 4H4WA 4ADWA 4G74A 3ZYXA 2FJDA 3AB1A 1O95A 4AP3A 5KOWA 3K7MX 4U8MA 3IWAA 4EQSA 1H81A 3KD9A 2A87A 1RYIA 1F3PA 2I0ZA 1E1LA 2OLNA 4C5OA 2RGOA 2XLUA 4K2XA 4CY6A 3V76A 2WU5A 1EL8A 4J31A 3DGZA 2H89A 1LTXR 4Y4LA 2JKCA 2AR8A 2Z5XA 1ZMDA 5HHFA 2AQJA 2JK6A 2YLZA 4K5SA 2APGA 5BULA 5HXIA 3F8PA 4APNA 1GEUA 2E1MA 4Z44A 2B7RA 2GR0A 1HYUA 1XPQA 1JRYA 1GERA 2FJAA 2VVLA 3LXDA 3NKSA 1L9DA 2GMHA 2J3NA 1D5TA 3UTHA 3QSSA 4IA5A 2R0CA 3G5QA 4H4TA 1NG3A 3CPIG 2WP9A 1B4VA 4U2SA 4GAVA 4H4ZA 1PDHA 4B63A 2C3DA 3RP8A 3GWFA 4IA6A 1OJAA 4II3A 2X8HA 1S2QA 3T2ZA 5JCNA 4Z25A 2B9YA 3RP7A 1NAAA 5FS8A 2GR1A 3C4NA 3ISHA 5KMSA 2XVFA 3FMWA 3AE4A 1JRXA 4A6NB 2YG5A 2VZ2A 3UOXA 3ATQA 1H83A 1NDAA 1NPXA 2QCUA 4GRTA 4U8PA 4PAAA 1VG0A 3ALLA 3BNMA 3Q9TA 2BXSA 1ZMCA 1YKJA 1P2HA 3EAOA 4AOSA 3QVPA 2PHHA 4NNJA 3T2YA 4BK1A 1V59A 5FS7A 2V61A 4EMJA 1CC4A 1PJ6A 1B8SA 1BGJA 2ZZCA 4BK2A 2V5ZA 2NVKX 4XXGA 3DMEA 4B1BA 2Q0LA 3IC9A 4H4VA 2XDOA 2C76A 3KLJA 2EQ7A 3I6DA 4GDEA 5EB4A 3P4SA 1DOEA 2H88A 3R9UA 2V3BA 4JNQA 4CNKA 1K0IA 3KU9A 4O5UA 3RNMA 2VRMA 3GWDA 4YSHA 2RGJA 1OJCA 1H7WA 2EQ8A 3DH9A 1ELIA 2BK4A 3F8RA 4U8NA 3S5WA 5LV9A 2JB1A 2VRLA 2CVJA 4TM4A 3C96A 3UTFA 2O9ZA 2Q7VA 1TYPA 1FL2A 2XFUA 2FJBA 4BV6A 4Z2RA 4IV9A 1M64A 1N4WA 3NG7X 1S3BA 2CFYA 1CC2A 2WP5A 3NH3X 3SY4A 4TM0A 5IPYA 5GRTA 3JSKA 2WP6A 4TM3A 4NEWA 1IUWA 4OPIA 1E1NA 4GAPA 1PBCA 1K0LA 2BC0A 4BJYA 3COXA 2BCGG 2VOUA 1BKWA 1GRHA 2ZZBA 2X8CA 2XLTA 2Z5YA 3HZLA 4BURA 2X50A 1NHSA 2VQ7A 2WQYA 3BI5A 1MO9A 2YM2A 1KNRA 1KSUA 2XVIA 2JB2A 4X9MA 1EL7A 1YY5A 1ZX9A 1D4DA 5TR3A 5KXJA 3T37A 4EM4A 3EPTA 1GETA 2YR5A 3S61A 1Z6LA 4NZHA 4A6NA 1NHRA 4G73A 3G5SA 3K7TA 2TMDA 4IVOB 3EANA 4FK1C 5JCLA 1Y56A 1KNPA 3SQPA 4YSXA 2YAUA 2GEWA 1JEHA 3NTAA 3NYCA 1GXFA 3AD8B 4H4PA 5U25A 4OPTA 3GD3A 2TPRA 4CCRA 4U2LA 1D7LA 2WDVA 1PN0A 5EB5A 3CN8A 2IVDA 3T0KA 3BHKA 2C7GA 3KPKA 4DSGA 1H84A 3AE8A 3DK8A 4A65A 1MOKA 1GT8A 3AEFA 3CGBA 3CTYA 4U8OA 3CGDA 2JAEA 3LZWA 3F8DA 3AYLA 1GESA 2OALA 2EQ6A 3GRTA 1DNCA 2OAMA 3FPZA 4I59A 4H2QA 3V3OA 1PXBA 2RGHA 1JOAA 1W4XA 3PO7A 4B68A 3KA7A 2X3NA 1GTHA 3REDA 3AEBA 5JCMA 4ZCCA 3VRBA 5C3JA 4B64A 1IUUA 3DA1A 4CCQA 4C3YA 1GRFA 1REOA 4ZN0A 3ITJA 4JNAA 1YQ3A 2B76A 2XLRA 1ZY8A 2WHDA 1COYA 1D4CA 2OLOA 2XFNA 3AEGA 3UKLA 4YXDA 4EM3A 2YVFA 3L1RA 1M6IA 3AWIA 1PJ7A 1PJ5A 2GH5A 1S3EA 2R46A 2WESA 2WBAA 3AYIA 3UKHA 4P9SA 1GV4A 4NEVA 2JBVA 1L9CA 1N1PA 5KOXA 1NG4A 1VQWA 3LOVA 3NK2X 4NTCA 3AE7A 1ONFA 3SFEA 3LZXA 4GDPA 4GCMA 1F8SA 2GR2A 4H4QA 3ICTA 1RP0A 2QAEA 2GB0A 1L9EA 1FEBA 3BNUA 2BS4A 2YLWA 3P9UA 4LIIA 3LJPA 1F8WA 4RG3A 5M0ZA 4A99A 2GMJA 1E1MA 2RABA 5BVAA 3NN0X 1N4UA 1SEZA 1L0VA 3CIRA 5JCKA 2B7SA 2W0HA 4J2WA 4OPGA 4YKFA 3ICSA 4D03A 4REKA 1QLBA 4HA6A 3CNSA 3SFDA 3ATRA 3LADA 1YQZA 2GV8A 1Y56B 2R0GA 2YM1A 4H4YA 1IUXA 1XDIA 1PXAA 2XLSA 1YQ4A 2ARDA 3DK9A 3QVRA 1OJ9A 4JN9A 3AE5A 1LQUA 1MXTA 3CNJA 4OPUA 4B69A 4C77A 2YG4A 1GALA 1H7XA 1TYTA 4J34A 3QFBA 1B37A 2C72A 1O5WA 3AE1A 3UKAA 3RHAA 4Z24A 1AOGA 3HYVA 4OPDA 4KX6A 3I3LA 4J36A 2FJEA 1NEKA 2C75A 3UP4A 1DODA 3M0OA 1E6EA 2B9WA 2PYXA 3M12A 4FX9A 3GDNA 2BXRA 4YTNA 1EBDA 3H4KA 3IHMA 5FMHA 3AE9A 3SZFA 2AAQA 4GUVA 3AEAA 1F6MA 3UOVA 4YTMA 4YTPA 1JRZA 3FIMB 4OPCA 1QO8A 1BF3A 1RSGA 1PBFA 3AE6A 2WDQA 1VRQB 2E5VA 5JCIA 1VG9A 3NIXA 4RSLA 1GSNA 1IUTA 5HY5A 4XWZA 2C65A 2BK5A 2YLSA 3UOYA 3P4QA 3ICRA 3QJ4A 1LVLA 2UZZA 1JNRA 3H8IA 1DJQA 5EBKA 3K7QX 2GQFA 4H7UA 3T2KA 2YQUA 1ZP0A 4H4XA 1GRBA 4X4JA 3G5RA 5U1OA 5KVIA 1GRGA 2C4CA 3SZ0A 3QSMA 3AECA 1OJDA 1PBDA 3NK0X 1FEAA 2XVJA 2XFQA 5J60A 3NLCA 1JNZA 2C3CA 4H4SA 4TLXA 3GSIA 2R45A 3UTGA 1DOBA 3WE0A 1NHPA 3P1WA 5CKUA 2IVEA 3UCLA 2YR4A 3QSEA 2YLRA 1JU2A 3CMMA 1Q9IA 2BS2A 3LB8A 3Q6JA 4FK1A 4CBQA 3CPHG 4K7ZA 4EMWA 1ZOYA 3HYWA 1DXLA 1D7YA 1TDNA 5BRTA 4CRTA 2GVCA 4DNAA 2XFOA 4Y4MA 1UKVG 3UKPA 1PBEA 1CJ2A 2GQWA 3SXIA 3SZCA 4AT2A 1K4QA 4JQ9A 5CQFA 1ZK7A 3NRNA 1LV0A 5HYMA 4Z2UA 1LQTA 2YVJA 2JB3A 2YG7A 4U8KA 2C66A 3URHA 4WCTA 2X99A 2C67A 4TLZA 2CDUA 4H50A 3V3NA 2FBWA 5FS9A 4CY8A 3C4AA 2YG3A 2X8GA 4CNJA 4J56A 3EF6A 1NENA 3DK4A 1N4VA 2WPFA 1TDFA 5J7XA 3VRDB 3AXBA 2DKHA 1ZKQA 3BHFA 2OA1A 4YSYA 5KMPA 4E0VA 2R9ZA 4JY2A 3VR9A 3GRSA 1D4EA 5DBJA 2BA9A 2BRAA 2WETA 3IHGA 3L8KA 2WU2A 3NYFA 4NTEA 2YG6A 3NGCX 1F8RA 3B3RA 3IF9A 4Y4NA 1S2YA 4U2TA 5KWFA 1CHUA 2F5ZA 2HQMA 1ZDLA 2A8XA 2V3AA 1PBBA 3GD4A 3UTEA 4A79A 3SGLA 2XVHA 4OCGA 4YT0A 3DJDA 5BUKA 5U63A 4GR1A 3E1TA 2BYBA 1IUSA 4NWZA 4A9WA 3BI4A 5KNLA 2V6OA 1K0JA 4G6HA 3VR8A 4B67A 4EQXA 3NK1X 2XVEA 5FS6A 4ECHA 1FOHA 2YVGA 3M13A 4TM1A 3P4PA 1LJ1A 1GTEA 3DJGX 2A89A 3AYJA 4II2A 2GRTA 2VVLG 4UDQA 2BC1A 4YWOA 2YR6A 1TRBA 2C70A 1XHCA 1KF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZOV A;  4DSH A;  4WX1 A;  4K8D A;  3VRA A;  5C2T A;  1H82 A;  1VDC A;  3DJE A;  2B9X A;  1PHH A;  3KKJ A;  1TDK A;  1PXC A;  3CGE A;  2R0P A;  2BAB A;  3AE2 A;  2QA2 A;  2Q6U A;  4BJZ A;  3GMC A;  1DJN A;  1GRA A;  3DJJ A;  3DGH A;  4H4R A;  2WOW A;  4JY3 A;  4B65 A;  1OJT A;  2Y6R A;  4YSZ A;  4OVI A;  1CJ3 A;  4DGK A;  1LPF A;  4Z2T A;  3PS9 A;  1CBO A;  2VQB A;  3H8L A;  3NYE A;  4B66 A;  3D8X A;  4LA1 A;  1H6V A;  1KSS A;  2WDR A;  1KFY A;  4RG4 A;  3GMB A;  2Y6Q A;  1E39 A;  4UP3 A;  1P2E A;  2BS3 A;  3SM8 A;  3ADA B;  4EMI A;  2ZBW A;  2YWL A;  3B6D A;  4C74 A;  4USR A;  3D1C A;  3O0H A;  1FEC A;  3OC4 A;  3CGC A;  4UDP A;  2C73 A;  2YLT A;  2BCP A;  2E4G A;  3AE3 A;  2WS3 A;  1IUV A;  5ER0 A;  2R4E A;  3KPF A;  3CNP A;  3AEE A;  3OZ2 A;  2BAC A;  1CL0 A;  2XLP A;  2NPX A;  3QFA A;  1O94 A;  2WOV A;  2VVM A;  4I58 A;  4AOX A;  1IJH A;  1GPE A;  3GYI A;  3ALJ A;  1TDE A;  3KVE A;  4IVM B;  4ICY A;  5IQ4 A;  3CNT A;  4M52 A;  4Z43 A;  4UDR A;  3CPJ G;  3AD9 B;  3UKF A;  2CUL A;  1KDG A;  4H2P A;  2IID A;  2GF3 A;  2ZZ0 A;  3GYJ A;  1TDO A;  1BGN A;  1GOS A;  5IQ1 A;  1GND A;  1EL9 A;  4N9X A;  3NN6 X;  4ZCD A;  4J33 A;  4A7A A;  1E7P A;  1Q1R A;  4H2N A;  3PVC A;  3AD7 B;  5EOW A;  5GSN A;  4AP1 A;  2R4J A;  3AED A;  4D04 A;  1PS9 A;  4KPR A;  1CF3 A;  5L46 A;  3ABV A;  5M10 A;  1GRE A;  3UKK A;  4EQW A;  1DOC A;  4NTD A;  1BWC A;  1Y0P A;  2V60 A;  3NHO X;  3NNE A;  2GAG B;  4GF7 A;  5KVH A;  4K5R A;  1EL5 A;  1FCD A;  2WEU A;  4EIP A;  1B5Q A;  4USQ A;  2C64 A;  3P4R A;  3CND A;  3FG2 P;  3ALM A;  4XWR A;  4U8J A;  4MJW A;  2EQ9 A;  1QJD A;  3FBS A;  4J57 A;  3II4 A;  4PAB A;  3VQR A;  4AT0 A;  4U8I A;  2DKI A;  3NT6 A;  4H2R A;  2XYO A;  1E1K A;  4O5Q A;  4A5L A;  2BK3 A;  1CJ4 A;  4K22 A;  3ZDN A;  3UKQ A;  1XAN A;  3UOZ A;  2WOI A;  3NTD A;  2WPC A;  4FDC B;  2QA1 A;  4JDR A;  3RP6 A;  2YLX A;  1NHQ A;  4HB9 A;  4BK3 A;  5KRQ A;  4Z26 A;  1CC6 A;  1CJC A;  2WPE A;  4U8L A;  1GRT A;  2GR3 A;  1BZL A;  1Q1W A;  3GDP A;  3K30 A;  4X9N A;  3BI2 A;  4LU6 A;  4C3X A;  4H4U A;  2XCG A;  1X31 B;  2GAH B;  4EIQ A;  2Q0K A;  4EQR A;  1H86 A;  4YKG A;  2XFP A;  3UP5 A;  4OPL A;  2ACZ A;  4H4W A;  4ADW A;  3ZYX A;  2FJD A;  3AB1 A;  1O95 A;  4AP3 A;  5KOW A;  3K7M X;  4U8M A;  3IWA A;  4EQS A;  1H81 A;  3KD9 A;  2A87 A;  1RYI A;  1F3P A;  2I0Z A;  1E1L A;  2OLN A;  4C5O A;  2RGO A;  2XLU A;  4K2X A;  4CY6 A;  3V76 A;  2WU5 A;  1EL8 A;  4J31 A;  3DGZ A;  2H89 A;  1LTX R;  4Y4L A;  2JKC A;  2AR8 A;  2Z5X A;  1ZMD A;  5HHF A;  2AQJ A;  2JK6 A;  2YLZ A;  4K5S A;  2APG A;  5BUL A;  5HXI A;  3F8P A;  4APN A;  1GEU A;  2E1M A;  4Z44 A;  2B7R A;  2GR0 A;  1HYU A;  1XPQ A;  1JRY A;  1GER A;  2FJA A;  2VVL A;  3LXD A;  3NKS A;  1L9D A;  2GMH A;  2J3N A;  1D5T A;  3UTH A;  3QSS A;  4IA5 A;  2R0C A;  3G5Q A;  4H4T A;  1NG3 A;  3CPI G;  2WP9 A;  1B4V A;  4U2S A;  4H4Z A;  4B63 A;  1PDH A;  2C3D A;  3RP8 A;  3GWF A;  4IA6 A;  1OJA A;  2X8H A;  1S2Q A;  5JCN A;  4Z25 A;  2B9Y A;  3RP7 A;  1NAA A;  5FS8 A;  2GR1 A;  3C4N A;  3ISH A;  2XVF A;  3FMW A;  3AE4 A;  1JRX A;  4A6N B;  2YG5 A;  2VZ2 A;  3UOX A;  3ATQ A;  1H83 A;  1NDA A;  1NPX A;  2QCU A;  4GRT A;  4U8P A;  4PAA A;  1VG0 A;  3ALL A;  3BNM A;  3Q9T A;  2BXS A;  1ZMC A;  1YKJ A;  1P2H A;  3EAO A;  4AOS A;  3QVP A;  2PHH A;  4BK1 A;  1V59 A;  5FS7 A;  2V61 A;  4EMJ A;  1CC4 A;  1PJ6 A;  1B8S A;  1BGJ A;  2ZZC A;  4BK2 A;  2V5Z A;  2NVK X;  4XXG A;  3DME A;  4B1B A;  2Q0L A;  3IC9 A;  4H4V A;  2XDO A;  2C76 A;  3KLJ A;  2EQ7 A;  3I6D A;  4GDE A;  5EB4 A;  3P4S A;  1DOE A;  2H88 A;  3R9U A;  2V3B A;  4JNQ A;  4CNK A;  1K0I A;  3KU9 A;  4O5U A;  3RNM A;  2VRM A;  3GWD A;  4YSH A;  2RGJ A;  1OJC A;  1H7W A;  2EQ8 A;  3DH9 A;  1ELI A;  2BK4 A;  3F8R A;  4U8N A;  3S5W A;  5LV9 A;  2JB1 A;  2VRL A;  2CVJ A;  4TM4 A;  3C96 A;  3UTF A;  2O9Z A;  2Q7V A;  1TYP A;  1FL2 A;  2XFU A;  2FJB A;  4BV6 A;  4Z2R A;  4IV9 A;  1M64 A;  1N4W A;  3NG7 X;  1S3B A;  2CFY A;  1CC2 A;  2WP5 A;  3NH3 X;  4TM0 A;  5IPY A;  5GRT A;  3JSK A;  2WP6 A;  4TM3 A;  4NEW A;  1IUW A;  4OPI A;  1E1N A;  1PBC A;  1K0L A;  2BC0 A;  4BJY A;  3COX A;  2BCG G;  2VOU A;  1BKW A;  1GRH A;  2ZZB A;  2X8C A;  2XLT A;  2Z5Y A;  3HZL A;  4BUR A;  2X50 A;  1NHS A;  2VQ7 A;  2WQY A;  3BI5 A;  1MO9 A;  2YM2 A;  1KNR A;  1KSU A;  2XVI A;  2JB2 A;  4X9M A;  1EL7 A;  1YY5 A;  1ZX9 A;  1D4D A;  5TR3 A;  5KXJ A;  3T37 A;  4EM4 A;  3EPT A;  1GET A;  2YR5 A;  3S61 A;  1Z6L A;  4NZH A;  4A6N A;  1NHR A;  3G5S A;  3K7T A;  2TMD A;  4IVO B;  3EAN A;  4FK1 C;  5JCL A;  1Y56 A;  1KNP A;  3SQP A;  4YSX A;  2YAU A;  2GEW A;  1JEH A;  3NTA A;  3NYC A;  1GXF A;  3AD8 B;  4H4P A;  5U25 A;  4OPT A;  3GD3 A;  2TPR A;  4CCR A;  4U2L A;  1D7L A;  2WDV A;  1PN0 A;  5EB5 A;  3CN8 A;  2IVD A;  3BHK A;  2C7G A;  4DSG A;  1H84 A;  3AE8 A;  3DK8 A;  4A65 A;  1MOK A;  1GT8 A;  3AEF A;  3CGB A;  3CTY A;  4U8O A;  3CGD A;  2JAE A;  3LZW A;  3F8D A;  3AYL A;  1GES A;  2OAL A;  2EQ6 A;  3GRT A;  1DNC A;  2OAM A;  3FPZ A;  4I59 A;  4H2Q A;  3V3O A;  1PXB A;  2RGH A;  1JOA A;  1W4X A;  3PO7 A;  4B68 A;  3KA7 A;  2X3N A;  1GTH A;  3RED A;  3AEB A;  5JCM A;  4ZCC A;  3VRB A;  5C3J A;  4B64 A;  1IUU A;  3DA1 A;  4CCQ A;  4C3Y A;  1GRF A;  1REO A;  4ZN0 A;  3ITJ A;  4JNA A;  1YQ3 A;  2B76 A;  2XLR A;  1ZY8 A;  2WHD A;  1COY A;  1D4C A;  2OLO A;  2XFN A;  3AEG A;  3UKL A;  4YXD A;  4EM3 A;  2YVF A;  3L1R A;  1M6I A;  3AWI A;  1PJ7 A;  1PJ5 A;  2GH5 A;  1S3E A;  2R46 A;  2WES A;  2WBA A;  3AYI A;  3UKH A;  4P9S A;  1GV4 A;  4NEV A;  2JBV A;  1L9C A;  1N1P A;  5KOX A;  1NG4 A;  1VQW A;  3LOV A;  3NK2 X;  4NTC A;  3AE7 A;  1ONF A;  3SFE A;  3LZX A;  4GDP A;  4GCM A;  1F8S A;  2GR2 A;  4H4Q A;  3ICT A;  1RP0 A;  2QAE A;  2GB0 A;  1L9E A;  1FEB A;  3BNU A;  2BS4 A;  2YLW A;  3P9U A;  4LII A;  3LJP A;  1F8W A;  4RG3 A;  5M0Z A;  4A99 A;  2GMJ A;  1E1M A;  2RAB A;  5BVA A;  3NN0 X;  1N4U A;  1SEZ A;  1L0V A;  3CIR A;  5JCK A;  2B7S A;  2W0H A;  4J2W A;  4OPG A;  4YKF A;  3ICS A;  4D03 A;  4REK A;  1QLB A;  4HA6 A;  3CNS A;  3SFD A;  3ATR A;  3LAD A;  1YQZ A;  2GV8 A;  1Y56 B;  2R0G A;  2YM1 A;  4H4Y A;  1IUX A;  1XDI A;  1PXA A;  2XLS A;  1YQ4 A;  2ARD A;  3DK9 A;  3QVR A;  1OJ9 A;  4JN9 A;  3AE5 A;  1LQU A;  1MXT A;  3CNJ A;  4OPU A;  4B69 A;  4C77 A;  2YG4 A;  1GAL A;  1H7X A;  1TYT A;  4J34 A;  3QFB A;  1B37 A;  2C72 A;  1O5W A;  3AE1 A;  3UKA A;  3RHA A;  4Z24 A;  1AOG A;  4OPD A;  4KX6 A;  3I3L A;  4J36 A;  2FJE A;  1NEK A;  2C75 A;  3UP4 A;  1DOD A;  3M0O A;  1E6E A;  2B9W A;  2PYX A;  3M12 A;  4FX9 A;  3GDN A;  2BXR A;  4YTN A;  1EBD A;  3H4K A;  3IHM A;  5FMH A;  3AE9 A;  2AAQ A;  4GUV A;  3AEA A;  1F6M A;  3UOV A;  4YTM A;  4YTP A;  1JRZ A;  3FIM B;  4OPC A;  1QO8 A;  1BF3 A;  1RSG A;  1PBF A;  3AE6 A;  2WDQ A;  1VRQ B;  2E5V A;  5JCI A;  1VG9 A;  3NIX A;  4RSL A;  1GSN A;  1IUT A;  5HY5 A;  4XWZ A;  2C65 A;  2BK5 A;  2YLS A;  3UOY A;  3P4Q A;  3ICR A;  3QJ4 A;  1LVL A;  2UZZ A;  1JNR A;  3H8I A;  1DJQ A;  5EBK A;  3K7Q X;  2GQF A;  4H7U A;  2YQU A;  1ZP0 A;  4H4X A;  1GRB A;  4X4J A;  3G5R A;  5U1O A;  5KVI A;  1GRG A;  3QSM A;  3AEC A;  1OJD A;  1PBD A;  3NK0 X;  1FEA A;  2XVJ A;  2XFQ A;  5J60 A;  3NLC A;  1JNZ A;  2C3C A;  4H4S A;  4TLX A;  3GSI A;  2R45 A;  3UTG A;  1DOB A;  3WE0 A;  1NHP A;  3P1W A;  5CKU A;  2IVE A;  3UCL A;  2YR4 A;  3QSE A;  2YLR A;  1JU2 A;  1Q9I A;  2BS2 A;  3LB8 A;  3Q6J A;  4FK1 A;  4CBQ A;  3CPH G;  4K7Z A;  4EMW A;  1ZOY A;  1DXL A;  1D7Y A;  1TDN A;  5BRT A;  4CRT A;  2GVC A;  4DNA A;  2XFO A;  4Y4M A;  1UKV G;  3UKP A;  1PBE A;  1CJ2 A;  2GQW A;  4AT2 A;  1K4Q A;  4JQ9 A;  5CQF A;  1ZK7 A;  3NRN A;  1LV0 A;  5HYM A;  4Z2U A;  1LQT A;  2YVJ A;  2JB3 A;  2YG7 A;  4U8K A;  2C66 A;  3URH A;  4WCT A;  2X99 A;  2C67 A;  4TLZ A;  2CDU A;  4H50 A;  3V3N A;  2FBW A;  5FS9 A;  4CY8 A;  3C4A A;  2YG3 A;  2X8G A;  4CNJ A;  4J56 A;  3EF6 A;  1NEN A;  3DK4 A;  1N4V A;  2WPF A;  1TDF A;  5J7X A;  3VRD B;  3AXB A;  2DKH A;  1ZKQ A;  3BHF A;  2OA1 A;  4YSY A;  4E0V A;  2R9Z A;  4JY2 A;  3VR9 A;  3GRS A;  1D4E A;  5DBJ A;  2BA9 A;  2WET A;  3IHG A;  3L8K A;  2WU2 A;  3NYF A;  4NTE A;  2YG6 A;  3NGC X;  1F8R A;  3B3R A;  3IF9 A;  4Y4N A;  1S2Y A;  4U2T A;  5KWF A;  1CHU A;  2F5Z A;  2HQM A;  1ZDL A;  2A8X A;  2V3A A;  1PBB A;  3GD4 A;  3UTE A;  4A79 A;  3SGL A;  2XVH A;  4OCG A;  4YT0 A;  3DJD A;  5BUK A;  5U63 A;  4GR1 A;  3E1T A;  2BYB A;  1IUS A;  4A9W A;  3BI4 A;  2V6O A;  1K0J A;  3VR8 A;  4B67 A;  4EQX A;  3NK1 X;  2XVE A;  5FS6 A;  4ECH A;  1FOH A;  2YVG A;  3M13 A;  4TM1 A;  3P4P A;  1LJ1 A;  1GTE A;  3DJG X;  2A89 A;  3AYJ A;  2GRT A;  2VVL G;  4UDQ A;  2BC1 A;  4YWO A;  2YR6 A;  1TRB A;  2C70 A;  1XHC A;  1KF6 A; 
#chains in the Genus database with same CATH topology
 1ZOV A;  4DSH A;  4WX1 A;  4K8D A;  3VRA A;  5C2T A;  1H82 A;  1VDC A;  3DJE A;  2B9X A;  1PHH A;  3KKJ A;  1TDK A;  1PXC A;  3CGE A;  2R0P A;  2BAB A;  5KMR A;  3AE2 A;  2QA2 A;  2Q6U A;  4BJZ A;  3GMC A;  1DJN A;  1GRA A;  3DJJ A;  3DGH A;  4H4R A;  2WOW A;  4JY3 A;  4B65 A;  1OJT A;  2Y6R A;  3SYI A;  4YSZ A;  4OVI A;  1CJ3 A;  4DGK A;  1LPF A;  4Z2T A;  3PS9 A;  1CBO A;  2VQB A;  3H8L A;  3NYE A;  4B66 A;  3D8X A;  4LA1 A;  1H6V A;  1KSS A;  2WDR A;  4G6G A;  1KFY A;  4RG4 A;  3GMB A;  2Y6Q A;  1E39 A;  4UP3 A;  1P2E A;  2BS3 A;  3SM8 A;  3ADA B;  4EMI A;  2ZBW A;  2YWL A;  3B6D A;  4C74 A;  4USR A;  3D1C A;  3O0H A;  1FEC A;  3OC4 A;  3CGC A;  4UDP A;  2C73 A;  2YLT A;  2BCP A;  2E4G A;  3AE3 A;  2WS3 A;  1IUV A;  5ER0 A;  2R4E A;  3KPF A;  3CNP A;  3AEE A;  3OZ2 A;  2BAC A;  1CL0 A;  2XLP A;  2NPX A;  3QFA A;  1O94 A;  2WOV A;  2VVM A;  4I58 A;  4AOX A;  3GYX A;  1IJH A;  1GPE A;  3GYI A;  3ALJ A;  1TDE A;  3KVE A;  4IVM B;  4ICY A;  5IQ4 A;  3CNT A;  4M52 A;  4Z43 A;  4UDR A;  3CPJ G;  3AD9 B;  3UKF A;  2CUL A;  1KDG A;  3SZW A;  4H2P A;  2IID A;  2GF3 A;  2ZZ0 A;  3GYJ A;  1TDO A;  1BGN A;  1GOS A;  5IQ1 A;  1GND A;  1EL9 A;  4N9X A;  3NN6 X;  4ZCD A;  4J33 A;  4A7A A;  1E7P A;  1Q1R A;  4H2N A;  3PVC A;  3AD7 B;  5EOW A;  5GSN A;  4AP1 A;  2R4J A;  3AED A;  4D04 A;  1PS9 A;  4KPR A;  1CF3 A;  5L46 A;  3ABV A;  5M10 A;  1GRE A;  3UKK A;  4EQW A;  1DOC A;  4NTD A;  1BWC A;  1Y0P A;  2V60 A;  3NHO X;  3NNE A;  2GAG B;  4GF7 A;  5KVH A;  4K5R A;  1EL5 A;  1FCD A;  2WEU A;  4EIP A;  1B5Q A;  4USQ A;  2C64 A;  3P4R A;  3CND A;  3FG2 P;  3ALM A;  4XWR A;  4U8J A;  4MJW A;  2EQ9 A;  1QJD A;  3FBS A;  4J57 A;  3II4 A;  4PAB A;  3VQR A;  4AT0 A;  4U8I A;  2DKI A;  3NT6 A;  4H2R A;  2XYO A;  3SX6 A;  1E1K A;  4O5Q A;  4A5L A;  2BK3 A;  1CJ4 A;  4K22 A;  3ZDN A;  3UKQ A;  1XAN A;  3UOZ A;  2WOI A;  3NTD A;  2WPC A;  4FDC B;  2QA1 A;  4JDR A;  3RP6 A;  2YLX A;  1NHQ A;  4HB9 A;  3T14 A;  4BK3 A;  5KRQ A;  4Z26 A;  1CC6 A;  4G9K A;  1CJC A;  2WPE A;  4U8L A;  1GRT A;  2GR3 A;  1BZL A;  1Q1W A;  3GDP A;  3K30 A;  4X9N A;  3T31 A;  3BI2 A;  3HYX A;  4LU6 A;  4C3X A;  4H4U A;  2XCG A;  1X31 B;  2GAH B;  2BRY A;  4EIQ A;  2Q0K A;  4EQR A;  1H86 A;  4YKG A;  2XFP A;  5KMQ A;  3UP5 A;  4OPL A;  2ACZ A;  4H4W A;  4ADW A;  4G74 A;  3ZYX A;  2FJD A;  3AB1 A;  1O95 A;  4AP3 A;  5KOW A;  3K7M X;  4U8M A;  3IWA A;  4EQS A;  1H81 A;  3KD9 A;  2A87 A;  1RYI A;  1F3P A;  2I0Z A;  1E1L A;  2OLN A;  4C5O A;  2RGO A;  2XLU A;  4K2X A;  4CY6 A;  3V76 A;  2WU5 A;  1EL8 A;  4J31 A;  3DGZ A;  2H89 A;  1LTX R;  4Y4L A;  2JKC A;  2AR8 A;  2Z5X A;  1ZMD A;  5HHF A;  2AQJ A;  2JK6 A;  2YLZ A;  4K5S A;  2APG A;  5BUL A;  5HXI A;  3F8P A;  4APN A;  1GEU A;  2E1M A;  4Z44 A;  2B7R A;  2GR0 A;  1HYU A;  1XPQ A;  1JRY A;  1GER A;  2FJA A;  2VVL A;  3LXD A;  3NKS A;  1L9D A;  2GMH A;  2J3N A;  1D5T A;  3UTH A;  3QSS A;  4IA5 A;  2R0C A;  3G5Q A;  4H4T A;  1NG3 A;  3CPI G;  2WP9 A;  1B4V A;  4U2S A;  4GAV A;  4H4Z A;  1PDH A;  4B63 A;  2C3D A;  3RP8 A;  3GWF A;  4IA6 A;  1OJA A;  4II3 A;  2X8H A;  1S2Q A;  3T2Z A;  5JCN A;  4Z25 A;  2B9Y A;  3RP7 A;  1NAA A;  5FS8 A;  2GR1 A;  3C4N A;  3ISH A;  5KMS A;  2XVF A;  3FMW A;  3AE4 A;  1JRX A;  4A6N B;  2YG5 A;  2VZ2 A;  3UOX A;  3ATQ A;  1H83 A;  1NDA A;  1NPX A;  2QCU A;  4GRT A;  4U8P A;  4PAA A;  1VG0 A;  3ALL A;  3BNM A;  3Q9T A;  2BXS A;  1ZMC A;  1YKJ A;  1P2H A;  3EAO A;  4AOS A;  3QVP A;  2PHH A;  4NNJ A;  3T2Y A;  4BK1 A;  1V59 A;  5FS7 A;  2V61 A;  4EMJ A;  1CC4 A;  1PJ6 A;  1B8S A;  1BGJ A;  2ZZC A;  4BK2 A;  2V5Z A;  2NVK X;  4XXG A;  3DME A;  4B1B A;  2Q0L A;  3IC9 A;  4H4V A;  2XDO A;  2C76 A;  3KLJ A;  2EQ7 A;  3I6D A;  4GDE A;  5EB4 A;  3P4S A;  1DOE A;  2H88 A;  3R9U A;  2V3B A;  4JNQ A;  4CNK A;  1K0I A;  3KU9 A;  4O5U A;  3RNM A;  2VRM A;  3GWD A;  4YSH A;  2RGJ A;  1OJC A;  1H7W A;  2EQ8 A;  3DH9 A;  1ELI A;  2BK4 A;  3F8R A;  4U8N A;  3S5W A;  5LV9 A;  2JB1 A;  2VRL A;  2CVJ A;  4TM4 A;  3C96 A;  3UTF A;  2O9Z A;  2Q7V A;  1TYP A;  1FL2 A;  2XFU A;  2FJB A;  4BV6 A;  4Z2R A;  4IV9 A;  1M64 A;  1N4W A;  3NG7 X;  1S3B A;  2CFY A;  1CC2 A;  2WP5 A;  3NH3 X;  3SY4 A;  4TM0 A;  5IPY A;  5GRT A;  3JSK A;  2WP6 A;  4TM3 A;  4NEW A;  1IUW A;  4OPI A;  1E1N A;  4GAP A;  1PBC A;  1K0L A;  2BC0 A;  4BJY A;  3COX A;  2BCG G;  2VOU A;  1BKW A;  1GRH A;  2ZZB A;  2X8C A;  2XLT A;  2Z5Y A;  3HZL A;  4BUR A;  2X50 A;  1NHS A;  2VQ7 A;  2WQY A;  3BI5 A;  1MO9 A;  2YM2 A;  1KNR A;  1KSU A;  2XVI A;  2JB2 A;  4X9M A;  1EL7 A;  1YY5 A;  1ZX9 A;  1D4D A;  5TR3 A;  5KXJ A;  3T37 A;  4EM4 A;  3EPT A;  1GET A;  2YR5 A;  3S61 A;  1Z6L A;  4NZH A;  4A6N A;  1NHR A;  4G73 A;  3G5S A;  3K7T A;  2TMD A;  4IVO B;  3EAN A;  4FK1 C;  5JCL A;  1Y56 A;  1KNP A;  3SQP A;  4YSX A;  2YAU A;  2GEW A;  1JEH A;  3NTA A;  3NYC A;  1GXF A;  3AD8 B;  4H4P A;  5U25 A;  4OPT A;  3GD3 A;  2TPR A;  4CCR A;  4U2L A;  1D7L A;  2WDV A;  1PN0 A;  5EB5 A;  3CN8 A;  2IVD A;  3T0K A;  3BHK A;  2C7G A;  3KPK A;  4DSG A;  1H84 A;  3AE8 A;  3DK8 A;  4A65 A;  1MOK A;  1GT8 A;  3AEF A;  3CGB A;  3CTY A;  4U8O A;  3CGD A;  2JAE A;  3LZW A;  3F8D A;  3AYL A;  1GES A;  2OAL A;  2EQ6 A;  3GRT A;  1DNC A;  2OAM A;  3FPZ A;  4I59 A;  4H2Q A;  3V3O A;  1PXB A;  2RGH A;  1JOA A;  1W4X A;  3PO7 A;  4B68 A;  3KA7 A;  2X3N A;  1GTH A;  3RED A;  3AEB A;  5JCM A;  4ZCC A;  3VRB A;  5C3J A;  4B64 A;  1IUU A;  3DA1 A;  4CCQ A;  4C3Y A;  1GRF A;  1REO A;  4ZN0 A;  3ITJ A;  4JNA A;  1YQ3 A;  2B76 A;  2XLR A;  1ZY8 A;  2WHD A;  1COY A;  1D4C A;  2OLO A;  2XFN A;  3AEG A;  3UKL A;  4YXD A;  4EM3 A;  2YVF A;  3L1R A;  1M6I A;  3AWI A;  1PJ7 A;  1PJ5 A;  2GH5 A;  1S3E A;  2R46 A;  2WES A;  2WBA A;  3AYI A;  3UKH A;  4P9S A;  1GV4 A;  4NEV A;  2JBV A;  1L9C A;  1N1P A;  5KOX A;  1NG4 A;  1VQW A;  3LOV A;  3NK2 X;  4NTC A;  3AE7 A;  1ONF A;  3SFE A;  3LZX A;  4GDP A;  4GCM A;  1F8S A;  2GR2 A;  4H4Q A;  3ICT A;  1RP0 A;  2QAE A;  2GB0 A;  1L9E A;  1FEB A;  3BNU A;  2BS4 A;  2YLW A;  3P9U A;  4LII A;  3LJP A;  1F8W A;  4RG3 A;  5M0Z A;  4A99 A;  2GMJ A;  1E1M A;  2RAB A;  5BVA A;  3NN0 X;  1N4U A;  1SEZ A;  1L0V A;  3CIR A;  5JCK A;  2B7S A;  2W0H A;  4J2W A;  4OPG A;  4YKF A;  3ICS A;  4D03 A;  4REK A;  1QLB A;  4HA6 A;  3CNS A;  3SFD A;  3ATR A;  3LAD A;  1YQZ A;  2GV8 A;  1Y56 B;  2R0G A;  2YM1 A;  4H4Y A;  1IUX A;  1XDI A;  1PXA A;  2XLS A;  1YQ4 A;  2ARD A;  3DK9 A;  3QVR A;  1OJ9 A;  4JN9 A;  3AE5 A;  1LQU A;  1MXT A;  3CNJ A;  4OPU A;  4B69 A;  4C77 A;  2YG4 A;  1GAL A;  1H7X A;  1TYT A;  4J34 A;  3QFB A;  1B37 A;  2C72 A;  1O5W A;  3AE1 A;  3UKA A;  3RHA A;  4Z24 A;  1AOG A;  3HYV A;  4OPD A;  4KX6 A;  3I3L A;  4J36 A;  2FJE A;  1NEK A;  2C75 A;  3UP4 A;  1DOD A;  3M0O A;  1E6E A;  2B9W A;  2PYX A;  3M12 A;  4FX9 A;  3GDN A;  2BXR A;  4YTN A;  1EBD A;  3H4K A;  3IHM A;  5FMH A;  3AE9 A;  3SZF A;  2AAQ A;  4GUV A;  3AEA A;  1F6M A;  3UOV A;  4YTM A;  4YTP A;  1JRZ A;  3FIM B;  4OPC A;  1QO8 A;  1BF3 A;  1RSG A;  1PBF A;  3AE6 A;  2WDQ A;  1VRQ B;  2E5V A;  5JCI A;  1VG9 A;  3NIX A;  4RSL A;  1GSN A;  1IUT A;  5HY5 A;  4XWZ A;  2C65 A;  2BK5 A;  2YLS A;  3UOY A;  3P4Q A;  3ICR A;  3QJ4 A;  1LVL A;  2UZZ A;  1JNR A;  3H8I A;  1DJQ A;  5EBK A;  3K7Q X;  2GQF A;  4H7U A;  3T2K A;  2YQU A;  1ZP0 A;  4H4X A;  1GRB A;  4X4J A;  3G5R A;  5U1O A;  5KVI A;  1GRG A;  2C4C A;  3SZ0 A;  3QSM A;  3AEC A;  1OJD A;  1PBD A;  3NK0 X;  1FEA A;  2XVJ A;  2XFQ A;  5J60 A;  3NLC A;  1JNZ A;  2C3C A;  4H4S A;  4TLX A;  3GSI A;  2R45 A;  3UTG A;  1DOB A;  3WE0 A;  1NHP A;  3P1W A;  5CKU A;  2IVE A;  3UCL A;  2YR4 A;  3QSE A;  2YLR A;  1JU2 A;  3CMM A;  1Q9I A;  2BS2 A;  3LB8 A;  3Q6J A;  4FK1 A;  4CBQ A;  3CPH G;  4K7Z A;  4EMW A;  1ZOY A;  3HYW A;  1DXL A;  1D7Y A;  1TDN A;  5BRT A;  4CRT A;  2GVC A;  4DNA A;  2XFO A;  4Y4M A;  1UKV G;  3UKP A;  1PBE A;  1CJ2 A;  2GQW A;  3SXI A;  3SZC A;  4AT2 A;  1K4Q A;  4JQ9 A;  5CQF A;  1ZK7 A;  3NRN A;  1LV0 A;  5HYM A;  4Z2U A;  1LQT A;  2YVJ A;  2JB3 A;  2YG7 A;  4U8K A;  2C66 A;  3URH A;  4WCT A;  2X99 A;  2C67 A;  4TLZ A;  2CDU A;  4H50 A;  3V3N A;  2FBW A;  5FS9 A;  4CY8 A;  3C4A A;  2YG3 A;  2X8G A;  4CNJ A;  4J56 A;  3EF6 A;  1NEN A;  3DK4 A;  1N4V A;  2WPF A;  1TDF A;  5J7X A;  3VRD B;  3AXB A;  2DKH A;  1ZKQ A;  3BHF A;  2OA1 A;  4YSY A;  5KMP A;  4E0V A;  2R9Z A;  4JY2 A;  3VR9 A;  3GRS A;  1D4E A;  5DBJ A;  2BA9 A;  2BRA A;  2WET A;  3IHG A;  3L8K A;  2WU2 A;  3NYF A;  4NTE A;  2YG6 A;  3NGC X;  1F8R A;  3B3R A;  3IF9 A;  4Y4N A;  1S2Y A;  4U2T A;  5KWF A;  1CHU A;  2F5Z A;  2HQM A;  1ZDL A;  2A8X A;  2V3A A;  1PBB A;  3GD4 A;  3UTE A;  4A79 A;  3SGL A;  2XVH A;  4OCG A;  4YT0 A;  3DJD A;  5BUK A;  5U63 A;  4GR1 A;  3E1T A;  2BYB A;  1IUS A;  4NWZ A;  4A9W A;  3BI4 A;  5KNL A;  2V6O A;  1K0J A;  4G6H A;  3VR8 A;  4B67 A;  4EQX A;  3NK1 X;  2XVE A;  5FS6 A;  4ECH A;  1FOH A;  2YVG A;  3M13 A;  4TM1 A;  3P4P A;  1LJ1 A;  1GTE A;  3DJG X;  2A89 A;  3AYJ A;  4II2 A;  2GRT A;  2VVL G;  4UDQ A;  2BC1 A;  4YWO A;  2YR6 A;  1TRB A;  2C70 A;  1XHC A;  1KF6 A; 
#chains in the Genus database with same CATH homology
 1ZOV A;  4DSH A;  4WX1 A;  4K8D A;  3VRA A;  5C2T A;  1H82 A;  1VDC A;  3DJE A;  2B9X A;  1PHH A;  3KKJ A;  1TDK A;  1PXC A;  3CGE A;  2R0P A;  2BAB A;  5KMR A;  3AE2 A;  2QA2 A;  2Q6U A;  4BJZ A;  3GMC A;  1DJN A;  1GRA A;  3DJJ A;  3DGH A;  4H4R A;  2WOW A;  4JY3 A;  4B65 A;  1OJT A;  2Y6R A;  3SYI A;  4YSZ A;  4OVI A;  1CJ3 A;  4DGK A;  1LPF A;  4Z2T A;  3PS9 A;  1CBO A;  2VQB A;  3H8L A;  3NYE A;  4B66 A;  3D8X A;  4LA1 A;  1H6V A;  1KSS A;  2WDR A;  4G6G A;  1KFY A;  4RG4 A;  3GMB A;  2Y6Q A;  1E39 A;  4UP3 A;  1P2E A;  2BS3 A;  3SM8 A;  3ADA B;  4EMI A;  2ZBW A;  2YWL A;  3B6D A;  4C74 A;  4USR A;  3D1C A;  3O0H A;  1FEC A;  3OC4 A;  3CGC A;  4UDP A;  2C73 A;  2YLT A;  2BCP A;  2E4G A;  3AE3 A;  2WS3 A;  1IUV A;  5ER0 A;  2R4E A;  3KPF A;  3CNP A;  3AEE A;  3OZ2 A;  2BAC A;  1CL0 A;  2XLP A;  2NPX A;  3QFA A;  1O94 A;  2WOV A;  2VVM A;  4I58 A;  4AOX A;  3GYX A;  1IJH A;  1GPE A;  3GYI A;  3ALJ A;  1TDE A;  3KVE A;  4IVM B;  4ICY A;  5IQ4 A;  3CNT A;  4M52 A;  4Z43 A;  4UDR A;  3CPJ G;  3AD9 B;  3UKF A;  2CUL A;  1KDG A;  3SZW A;  4H2P A;  2IID A;  2GF3 A;  2ZZ0 A;  3GYJ A;  1TDO A;  1BGN A;  1GOS A;  5IQ1 A;  1GND A;  1EL9 A;  4N9X A;  3NN6 X;  4ZCD A;  4J33 A;  4A7A A;  1E7P A;  1Q1R A;  4H2N A;  3PVC A;  3AD7 B;  5EOW A;  5GSN A;  4AP1 A;  2R4J A;  3AED A;  4D04 A;  1PS9 A;  4KPR A;  1CF3 A;  5L46 A;  3ABV A;  5M10 A;  1GRE A;  3UKK A;  4EQW A;  1DOC A;  4NTD A;  1BWC A;  1Y0P A;  2V60 A;  3NHO X;  3NNE A;  2GAG B;  4GF7 A;  5KVH A;  4K5R A;  1EL5 A;  1FCD A;  2WEU A;  4EIP A;  1B5Q A;  4USQ A;  2C64 A;  3P4R A;  3CND A;  3FG2 P;  3ALM A;  4XWR A;  4U8J A;  4MJW A;  2EQ9 A;  1QJD A;  3FBS A;  4J57 A;  3II4 A;  4PAB A;  3VQR A;  4AT0 A;  4U8I A;  2DKI A;  3NT6 A;  4H2R A;  2XYO A;  3SX6 A;  1E1K A;  4O5Q A;  4A5L A;  2BK3 A;  1CJ4 A;  4K22 A;  3ZDN A;  3UKQ A;  1XAN A;  3UOZ A;  2WOI A;  3NTD A;  2WPC A;  4FDC B;  2QA1 A;  4JDR A;  3RP6 A;  2YLX A;  1NHQ A;  4HB9 A;  3T14 A;  4BK3 A;  5KRQ A;  4Z26 A;  1CC6 A;  4G9K A;  1CJC A;  2WPE A;  4U8L A;  1GRT A;  2GR3 A;  1BZL A;  1Q1W A;  3GDP A;  3K30 A;  4X9N A;  3T31 A;  3BI2 A;  3HYX A;  4LU6 A;  4C3X A;  4H4U A;  2XCG A;  1X31 B;  2GAH B;  2BRY A;  4EIQ A;  2Q0K A;  4EQR A;  1H86 A;  4YKG A;  2XFP A;  5KMQ A;  3UP5 A;  4OPL A;  2ACZ A;  4H4W A;  4ADW A;  4G74 A;  3ZYX A;  2FJD A;  3AB1 A;  1O95 A;  4AP3 A;  5KOW A;  3K7M X;  4U8M A;  3IWA A;  4EQS A;  1H81 A;  3KD9 A;  2A87 A;  1RYI A;  1F3P A;  2I0Z A;  1E1L A;  2OLN A;  4C5O A;  2RGO A;  2XLU A;  4K2X A;  4CY6 A;  3V76 A;  2WU5 A;  1EL8 A;  4J31 A;  3DGZ A;  2H89 A;  1LTX R;  4Y4L A;  2JKC A;  2AR8 A;  2Z5X A;  1ZMD A;  5HHF A;  2AQJ A;  2JK6 A;  2YLZ A;  4K5S A;  2APG A;  5BUL A;  5HXI A;  3F8P A;  4APN A;  1GEU A;  2E1M A;  4Z44 A;  2B7R A;  2GR0 A;  1HYU A;  1XPQ A;  1JRY A;  1GER A;  2FJA A;  2VVL A;  3LXD A;  3NKS A;  1L9D A;  2GMH A;  2J3N A;  1D5T A;  3UTH A;  3QSS A;  4IA5 A;  2R0C A;  3G5Q A;  4H4T A;  1NG3 A;  3CPI G;  2WP9 A;  1B4V A;  4U2S A;  4GAV A;  4H4Z A;  1PDH A;  4B63 A;  2C3D A;  3RP8 A;  3GWF A;  4IA6 A;  1OJA A;  4II3 A;  2X8H A;  1S2Q A;  3T2Z A;  5JCN A;  4Z25 A;  2B9Y A;  3RP7 A;  1NAA A;  5FS8 A;  2GR1 A;  3C4N A;  3ISH A;  5KMS A;  2XVF A;  3FMW A;  3AE4 A;  1JRX A;  4A6N B;  2YG5 A;  2VZ2 A;  3UOX A;  3ATQ A;  1H83 A;  1NDA A;  1NPX A;  2QCU A;  4GRT A;  4U8P A;  4PAA A;  1VG0 A;  3ALL A;  3BNM A;  3Q9T A;  2BXS A;  1ZMC A;  1YKJ A;  1P2H A;  3EAO A;  4AOS A;  3QVP A;  2PHH A;  4NNJ A;  3T2Y A;  4BK1 A;  1V59 A;  5FS7 A;  2V61 A;  4EMJ A;  1CC4 A;  1PJ6 A;  1B8S A;  1BGJ A;  2ZZC A;  4BK2 A;  2V5Z A;  2NVK X;  4XXG A;  3DME A;  4B1B A;  2Q0L A;  3IC9 A;  4H4V A;  2XDO A;  2C76 A;  3KLJ A;  2EQ7 A;  3I6D A;  4GDE A;  5EB4 A;  3P4S A;  1DOE A;  2H88 A;  3R9U A;  2V3B A;  4JNQ A;  4CNK A;  1K0I A;  3KU9 A;  4O5U A;  3RNM A;  2VRM A;  3GWD A;  4YSH A;  2RGJ A;  1OJC A;  1H7W A;  2EQ8 A;  3DH9 A;  1ELI A;  2BK4 A;  3F8R A;  4U8N A;  3S5W A;  5LV9 A;  2JB1 A;  2VRL A;  2CVJ A;  4TM4 A;  3C96 A;  3UTF A;  2O9Z A;  2Q7V A;  1TYP A;  1FL2 A;  2XFU A;  2FJB A;  4BV6 A;  4Z2R A;  4IV9 A;  1M64 A;  1N4W A;  3NG7 X;  1S3B A;  2CFY A;  1CC2 A;  2WP5 A;  3NH3 X;  3SY4 A;  4TM0 A;  5IPY A;  5GRT A;  3JSK A;  2WP6 A;  4TM3 A;  4NEW A;  1IUW A;  4OPI A;  1E1N A;  4GAP A;  1PBC A;  1K0L A;  2BC0 A;  4BJY A;  3COX A;  2BCG G;  2VOU A;  1BKW A;  1GRH A;  2ZZB A;  2X8C A;  2XLT A;  2Z5Y A;  3HZL A;  4BUR A;  2X50 A;  1NHS A;  2VQ7 A;  2WQY A;  3BI5 A;  1MO9 A;  2YM2 A;  1KNR A;  1KSU A;  2XVI A;  2JB2 A;  4X9M A;  1EL7 A;  1YY5 A;  1ZX9 A;  1D4D A;  5TR3 A;  5KXJ A;  3T37 A;  4EM4 A;  3EPT A;  1GET A;  2YR5 A;  3S61 A;  1Z6L A;  4NZH A;  4A6N A;  1NHR A;  4G73 A;  3G5S A;  3K7T A;  2TMD A;  4IVO B;  3EAN A;  4FK1 C;  5JCL A;  1Y56 A;  1KNP A;  3SQP A;  4YSX A;  2YAU A;  2GEW A;  1JEH A;  3NTA A;  3NYC A;  1GXF A;  3AD8 B;  4H4P A;  5U25 A;  4OPT A;  3GD3 A;  2TPR A;  4CCR A;  4U2L A;  1D7L A;  2WDV A;  1PN0 A;  5EB5 A;  3CN8 A;  2IVD A;  3T0K A;  3BHK A;  2C7G A;  3KPK A;  4DSG A;  1H84 A;  3AE8 A;  3DK8 A;  4A65 A;  1MOK A;  1GT8 A;  3AEF A;  3CGB A;  3CTY A;  4U8O A;  3CGD A;  2JAE A;  3LZW A;  3F8D A;  3AYL A;  1GES A;  2OAL A;  2EQ6 A;  3GRT A;  1DNC A;  2OAM A;  3FPZ A;  4I59 A;  4H2Q A;  3V3O A;  1PXB A;  2RGH A;  1JOA A;  1W4X A;  3PO7 A;  4B68 A;  3KA7 A;  2X3N A;  1GTH A;  3RED A;  3AEB A;  5JCM A;  4ZCC A;  3VRB A;  5C3J A;  4B64 A;  1IUU A;  3DA1 A;  4CCQ A;  4C3Y A;  1GRF A;  1REO A;  4ZN0 A;  3ITJ A;  4JNA A;  1YQ3 A;  2B76 A;  2XLR A;  1ZY8 A;  2WHD A;  1COY A;  1D4C A;  2OLO A;  2XFN A;  3AEG A;  3UKL A;  4YXD A;  4EM3 A;  2YVF A;  3L1R A;  1M6I A;  3AWI A;  1PJ7 A;  1PJ5 A;  2GH5 A;  1S3E A;  2R46 A;  2WES A;  2WBA A;  3AYI A;  3UKH A;  4P9S A;  1GV4 A;  4NEV A;  2JBV A;  1L9C A;  1N1P A;  5KOX A;  1NG4 A;  1VQW A;  3LOV A;  3NK2 X;  4NTC A;  3AE7 A;  1ONF A;  3SFE A;  3LZX A;  4GDP A;  4GCM A;  1F8S A;  2GR2 A;  4H4Q A;  3ICT A;  1RP0 A;  2QAE A;  2GB0 A;  1L9E A;  1FEB A;  3BNU A;  2BS4 A;  2YLW A;  3P9U A;  4LII A;  3LJP A;  1F8W A;  4RG3 A;  5M0Z A;  4A99 A;  2GMJ A;  1E1M A;  2RAB A;  5BVA A;  3NN0 X;  1N4U A;  1SEZ A;  1L0V A;  3CIR A;  5JCK A;  2B7S A;  2W0H A;  4J2W A;  4OPG A;  4YKF A;  3ICS A;  4D03 A;  4REK A;  1QLB A;  4HA6 A;  3CNS A;  3SFD A;  3ATR A;  3LAD A;  1YQZ A;  2GV8 A;  1Y56 B;  2R0G A;  2YM1 A;  4H4Y A;  1IUX A;  1XDI A;  1PXA A;  2XLS A;  1YQ4 A;  2ARD A;  3DK9 A;  3QVR A;  1OJ9 A;  4JN9 A;  3AE5 A;  1LQU A;  1MXT A;  3CNJ A;  4OPU A;  4B69 A;  4C77 A;  2YG4 A;  1GAL A;  1H7X A;  1TYT A;  4J34 A;  3QFB A;  1B37 A;  2C72 A;  1O5W A;  3AE1 A;  3UKA A;  3RHA A;  4Z24 A;  1AOG A;  3HYV A;  4OPD A;  4KX6 A;  3I3L A;  4J36 A;  2FJE A;  1NEK A;  2C75 A;  3UP4 A;  1DOD A;  3M0O A;  1E6E A;  2B9W A;  2PYX A;  3M12 A;  4FX9 A;  3GDN A;  2BXR A;  4YTN A;  1EBD A;  3H4K A;  3IHM A;  5FMH A;  3AE9 A;  3SZF A;  2AAQ A;  4GUV A;  3AEA A;  1F6M A;  3UOV A;  4YTM A;  4YTP A;  1JRZ A;  3FIM B;  4OPC A;  1QO8 A;  1BF3 A;  1RSG A;  1PBF A;  3AE6 A;  2WDQ A;  1VRQ B;  2E5V A;  5JCI A;  1VG9 A;  3NIX A;  4RSL A;  1GSN A;  1IUT A;  5HY5 A;  4XWZ A;  2C65 A;  2BK5 A;  2YLS A;  3UOY A;  3P4Q A;  3ICR A;  3QJ4 A;  1LVL A;  2UZZ A;  1JNR A;  3H8I A;  1DJQ A;  5EBK A;  3K7Q X;  2GQF A;  4H7U A;  3T2K A;  2YQU A;  1ZP0 A;  4H4X A;  1GRB A;  4X4J A;  3G5R A;  5U1O A;  5KVI A;  1GRG A;  2C4C A;  3SZ0 A;  3QSM A;  3AEC A;  1OJD A;  1PBD A;  3NK0 X;  1FEA A;  2XVJ A;  2XFQ A;  5J60 A;  3NLC A;  1JNZ A;  2C3C A;  4H4S A;  4TLX A;  3GSI A;  2R45 A;  3UTG A;  1DOB A;  3WE0 A;  1NHP A;  3P1W A;  5CKU A;  2IVE A;  3UCL A;  2YR4 A;  3QSE A;  2YLR A;  1JU2 A;  3CMM A;  1Q9I A;  2BS2 A;  3LB8 A;  3Q6J A;  4FK1 A;  4CBQ A;  3CPH G;  4K7Z A;  4EMW A;  1ZOY A;  3HYW A;  1DXL A;  1D7Y A;  1TDN A;  5BRT A;  4CRT A;  2GVC A;  4DNA A;  2XFO A;  4Y4M A;  1UKV G;  3UKP A;  1PBE A;  1CJ2 A;  2GQW A;  3SXI A;  3SZC A;  4AT2 A;  1K4Q A;  4JQ9 A;  5CQF A;  1ZK7 A;  3NRN A;  1LV0 A;  5HYM A;  4Z2U A;  1LQT A;  2YVJ A;  2JB3 A;  2YG7 A;  4U8K A;  2C66 A;  3URH A;  4WCT A;  2X99 A;  2C67 A;  4TLZ A;  2CDU A;  4H50 A;  3V3N A;  2FBW A;  5FS9 A;  4CY8 A;  3C4A A;  2YG3 A;  2X8G A;  4CNJ A;  4J56 A;  3EF6 A;  1NEN A;  3DK4 A;  1N4V A;  2WPF A;  1TDF A;  5J7X A;  3VRD B;  3AXB A;  2DKH A;  1ZKQ A;  3BHF A;  2OA1 A;  4YSY A;  5KMP A;  4E0V A;  2R9Z A;  4JY2 A;  3VR9 A;  3GRS A;  1D4E A;  5DBJ A;  2BA9 A;  2BRA A;  2WET A;  3IHG A;  3L8K A;  2WU2 A;  3NYF A;  4NTE A;  2YG6 A;  3NGC X;  1F8R A;  3B3R A;  3IF9 A;  4Y4N A;  1S2Y A;  4U2T A;  5KWF A;  1CHU A;  2F5Z A;  2HQM A;  1ZDL A;  2A8X A;  2V3A A;  1PBB A;  3GD4 A;  3UTE A;  4A79 A;  3SGL A;  2XVH A;  4OCG A;  4YT0 A;  3DJD A;  5BUK A;  5U63 A;  4GR1 A;  3E1T A;  2BYB A;  1IUS A;  4NWZ A;  4A9W A;  3BI4 A;  5KNL A;  2V6O A;  1K0J A;  4G6H A;  3VR8 A;  4B67 A;  4EQX A;  3NK1 X;  2XVE A;  5FS6 A;  4ECH A;  1FOH A;  2YVG A;  3M13 A;  4TM1 A;  3P4P A;  1LJ1 A;  1GTE A;  3DJG X;  2A89 A;  3AYJ A;  4II2 A;  2GRT A;  2VVL G;  4UDQ A;  2BC1 A;  4YWO A;  2YR6 A;  1TRB A;  2C70 A;  1XHC A;  1KF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...