4FK1C

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
298
Chain Sequence
YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin reductase
total genus 89
structure length 298
sequence length 299
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C02
3AD7B 2EQ9A 2BA9A 1CJ2A 3LZXA 4YSXA 1H84A 1VQWA 4H2RA 4H2NA 1YY5A 2AR8A 4Z2TA 1D4EA 4IVMB 3ABVA 1VG9A 2XLUA 3BI5A 4BK3A 3GD4A 3NTAA 1EBDA 4GF7A 5JCNA 1ZX9A 1VDCA 4Z25A 1BF3A 2YG6A 2E5VA 1PBEA 3OC4A 4BV6A 1QLBA 1V59A 4J36A 2B9YA 2YLWA 1DOEA 3QSMA 1OJTA 4H2PA 2ZZ0A 3BNMA 4H4XA 4A6NA 2ARDA 2GH5A 2C75A 2XDOA 1E6EA 4EM4A 3CGBA 4GCMA 1TYPA 1UKVG 2Z5XA 4IV9A 4EIPA 4GUVA 2GRTA 4YTNA 4N9XA 1AOGA 3NK2X 4U8OA 3UP5A 2YM2A 1N1PA 1GALA 2C64A 4Y4LA 4A6NB 3RP8A 3O0HA 3UKHA 3AWIA 1F8RA 1GXFA 1LQUA 2VVLG 4J56A 3UKPA 4YSYA 2UZZA 1CJCA 4B1BA 4Z24A 3SFEA 4ZN0A 2B7RA 4EQXA 1IUVA 2XLPA 2RGJA 3EAOA 1X31B 2Y6RA 5EB5A 1TDFA 2GQWA 3IC9A 2FJAA 2GQFA 1PXCA 3AEBA 3C4NA 1FECA 1NHQA 1ZMDA 1LV0A 2WPEA 4C3XA 4U8MA 3C4AA 3CNDA 4UDRA 5CQFA 3AB1A 3NK0X 3NHOX 2XVHA 1N4VA 1MXTA 1OJCA 2C65A 2VQBA 2C66A 4JY2A 2V3BA 2XLTA 2E4GA 4RG4A 2Y6QA 1YQ3A 1D4DA 1GREA 1CC2A 2H88A 1MOKA 2WESA 2XYOA 4YXDA 2XLRA 1D7YA 1H7WA 1ZP0A 5C3JA 3AE7A 1Y56A 4ICYA 3ICSA 1LJ1A 1KDGA 1CC6A 2JBVA 1D5TA 4U8PA 1GETA 3E1TA 1K4QA 2YVGA 4U8IA 5FS7A 2QCUA 2Q6UA 2GV8A 4IVOB 2CULA 2YG3A 4H4SA 5HY5A 1GSNA 2FBWA 2PHHA 1JRXA 3AEDA 5BUKA 5U25A 4I58A 4TLZA 1LTXR 2YG4A 2YLTA 3CPJG 3GMBA 3DMEA 3NN0X 3ZYXA 1B4VA 4DSGA 4B68A 4U2LA 4RG3A 3FBSA 4OVIA 1EL5A 4BURA 2GVCA 2B9WA 2BXSA 5TR3A 1Q1RA 1PJ7A 2FJEA 2YLZA 4ZCDA 5EOWA 1PBDA 3AE5A 1GV4A 2A8XA 3M0OA 4OPIA 1VRQB 1H81A 3UKQA 4H2QA 3NG7X 1BWCA 4X9MA 4Z2RA 1DXLA 5DBJA 3VRBA 2VZ2A 3KKJA 2VRLA 1IJHA 3ICRA 2B7SA 2WOWA 1KFYA 2IVDA 3RP7A 4AP1A 4ECHA 1ZK7A 1O94A 2YR5A 1BGJA 1GERA 3ITJA 1NHSA 4CY8A 4EMJA 1PXBA 4GRTA 1QO8A 1L0VA 1NEKA 1N4UA 2X50A 3CNPA 1RYIA 3SQPA 3S61A 3H8LA 3P9UA 3ATRA 1E1NA 4J34A 4LU6A 4CRTA 2GEWA 2I0ZA 1OJDA 2GR0A 1E1MA 3LJPA 4CY6A 2YAUA 1Z6LA 4X4JA 3LXDA 2XVFA 3AD8B 2IIDA 3KA7A 1S3BA 1ZY8A 2R0GA 3BNUA 1PBBA 4TM0A 4BK2A 3I6DA 4DSHA 4KPRA 2R0PA 1GRGA 2BACA 2C67A 2WETA 1CL0A 2WDVA 1EL7A 3DJGX 3K7QX 3V3NA 2YG5A 3DA1A 3PS9A 4H7UA 1GRBA 4OPGA 4A9WA 1XPQA 1B37A 1REOA 3NGCX 3OZ2A 4USRA 1IUWA 3CPIG 5HHFA 3UOVA 3VR8A 4APNA 2R4EA 2Q0LA 2WOVA 1YKJA 3GRTA 4ZCCA 1O5WA 2BC1A 4KX6A 4A65A 1MO9A 2TMDA 4OPLA 3UKKA 4YTPA 3FIMB 1GRTA 1D7LA 1PXAA 5U63A 1ONFA 2WS3A 1NHRA 4GDEA 2YVJA 5L46A 2XFQA 4FK1A 3GYIA 3UTEA 3SGLA 2RGOA 1PS9A 4JY3A 4OPDA 4EMIA 1P2EA 4H4QA 2WU5A 4A7AA 1NHPA 4D03A 2WP9A 1TDOA 3BI2A 4CNKA 4D04A 2Z5YA 2OLOA 3RNMA 1KF6A 2VVMA 3AYIA 3AEFA 1TRBA 2YG7A 3GD3A 1FEBA 1COYA 2R0CA 3GWFA 4H4YA 4NTCA 4U8KA 4WCTA 5FMHA 3DJEA 2A87A 3B3RA 2WPFA 4NTDA 2ZZBA 3NTDA 4H4VA 4HA6A 2E1MA 3B6DA 5IPYA 3NYFA 3UP4A 3P4SA 4IA6A 4XXGA 2BYBA 2WQYA 3GWDA 2OAMA 1NAAA 5BULA 1TDKA 4BJZA 1F8WA 1GT8A 4FDCB 4XWRA 4PABA 1L9DA 2NVKX 4EMWA 3VR9A 4B63A 1ELIA 3ICTA 3P1WA 2VQ7A 3AE4A 2YLSA 1IUXA 3FPZA 2JB2A 2O9ZA 1F8SA 4J31A 5BVAA 3NKSA 1H7XA 5FS9A 1ZMCA 4JNAA 3QVRA 4I59A 1CHUA 2F5ZA 3UCLA 4GR1A 3C96A 2V3AA 1BZLA 2GAHB 3P4RA 4M52A 3D8XA 3AYJA 2DKHA 2XFUA 4REKA 3F8PA 1JNZA 4NEVA 1GESA 2R46A 2YM1A 2XVJA 5HXIA 3BHFA 1GPEA 1EL8A 1LQTA 3BHKA 1FL2A 2JB1A 1CF3A 4JN9A 2R45A 4K8DA 4BJYA 4EQWA 3NT6A 3ALMA 2VVLA 3NIXA 1B5QA 1PJ5A 4H4RA 2B9XA 3NK1X 2XVEA 4Z26A 2AQJA 3SM8A 4U8JA 2C73A 1JU2A 2V60A 2B76A 3GSIA 1FCDA 4C3YA 3BI4A 3NYEA 2HQMA 1BKWA 3UOYA 2WPCA 1Q1WA 2YR6A 3EF6A 2BXRA 1M6IA 1DOBA 1S3EA 3DJDA 3F8RA 3UTFA 3K7MX 4TM4A 3ADAB 3CNTA 3QFBA 4LA1A 5IQ1A 4C74A 1TDNA 4OPCA 3VQRA 5KOWA 4Y4NA 2BABA 3AE6A 2X8CA 3ZDNA 2PYXA 3JSKA 4AT0A 4AP3A 2BK5A 5GSNA 3URHA 2BCGG 3KVEA 2QA2A 2VOUA 2BK4A 3RHAA 4CCRA 5KXJA 4U2TA 4H4TA 1ZOVA 3GDNA 2GR2A 2C3CA 2V5ZA 2BC0A 1Q9IA 2EQ7A 1IUTA 2GR3A 3SFDA 4NZHA 5FS8A 2ZZCA 1S2YA 3PO7A 4FX9A 4EQSA 2C76A 2V6OA 1H83A 1PHHA 2NPXA 1GRHA 2YR4A 4CBQA 1PJ6A 4K7ZA 3CGCA 4TLXA 3QFAA 1ZDLA 1OJAA 4EIQA 2FJBA 1QJDA 2QAEA 2VRMA 1IUUA 3GDPA 4TM1A 3ATQA 1LPFA 5KOXA 5KWFA 3ISHA 5KRQA 4U2SA 4EQRA 2XFNA 3UKLA 5JCIA 3COXA 3V76A 3EPTA 3LB8A 4MJWA 3CNJA 3REDA 3KU9A 4H4ZA 2JK6A 2QA1A 2RGHA 2A89A 2OA1A 3G5RA 2XVIA 4Y4MA 1K0JA 3H4KA 3QJ4A 5J7XA 2WBAA 4A79A 3DGZA 4CNJA 1JOAA 1GTEA 3GYJA 1P2HA 1K0LA 1KNPA 5KVIA 5KVHA 1ZOYA 3K7TA 4PAAA 1SEZA 4TM3A 4EM3A 2C3DA 4BK1A 2YQUA 3GMCA 4YKGA 1PBFA 1Y56B 4UP3A 4C77A 4HB9A 4Z2UA 3IHMA 5JCMA 4GDPA 2YVFA 1NPXA 4O5QA 3CN8A 3RP6A 5J60A 3AD9B 3DJJA 1JRZA 1GEUA 2WP5A 3FG2P 4Z44A 2BS4A 3AE2A 1CJ3A 3QSSA 1H82A 1L9CA 3H8IA 3T37A 1CBOA 3AEEA 1EL9A 4K5RA 4FK1C 1JEHA 3GRSA 3UOZA 5BRTA 2WU2A 3KLJA 4YT0A 1S2QA 2R4JA 3AE3A 3IF9A 3KPFA 2WDRA 1KNRA 2XLSA 1N4WA 1PDHA 3DK9A 1XDIA 1GNDA 2Q7VA 2J3NA 2BCPA 3NLCA 4B64A 1OJ9A 3NYCA 1IUSA 4JNQA 1CJ4A 2X8HA 5JCKA 2X3NA 1D4CA 1NG3A 3UOXA 4AT2A 5M10A 1JNRA 2ACZA 3EANA 4O5UA 3HZLA 5IQ4A 1JRYA 2WP6A 4H4UA 4X9NA 4YSZA 5GRTA 1RSGA 2EQ6A 1DOCA 2GR1A 2WHDA 4DGKA 1GRAA 1KSSA 3UTGA 3DH9A 3CIRA 2FJDA 3AE1A 1YQ4A 4B69A 3S5WA 3CGEA 3I3LA 3NNEA 5JCLA 2CVJA 3WE0A 3D1CA 2AAQA 2C72A 4IA5A 2CFYA 5U1OA 1M64A 3AECA 4K5SA 3M13A 4K2XA 4DNAA 1PN0A 4YSHA 3VRDB 4UDQA 4P9SA 1F3PA 1RP0A 1CC4A 2BS3A 3ALJA 3CPHG 3R9UA 3II4A 3CTYA 2XFOA 4OPUA 5EB4A 2YWLA 4NTEA 1XANA 3UTHA 2BK3A 2H89A 1B8SA 4H4WA 2APGA 2V61A 2ZBWA 4WX1A 4J33A 4Z43A 4B65A 4A5LA 2RABA 3AEAA 1GOSA 3AE9A 4K22A 4AOSA 4YTMA 3NN6X 3AYLA 3LADA 2X99A 1YQZA 2GMJA 3UKAA 3DK4A 3ALLA 4U8LA 2BS2A 2C70A 3VRAA 3KD9A 2IVEA 2EQ8A 3LOVA 2YLXA 3M12A 2CDUA 2DKIA 2Q0KA 4H50A 3L1RA 4U8NA 2WEUA 2WOIA 3DGHA 3L8KA 2GF3A 3P4QA 5FS6A 1K0IA 3G5QA 3AEGA 4YKFA 1F6MA 3K30A 2WDQA 2XFPA 3F8DA 2JAEA 4NEWA 1VG0A 4USQA 1NG4A 2JB3A 3LZWA 1PBCA 3CGDA 4OCGA 1O95A 2YLRA 1DJQA 1HYUA 3CNSA 3Q6JA 3QVPA 1NENA 3DK8A 1NDAA 4JQ9A 1KSUA 1LVLA 2JKCA 3IHGA 5CKUA 2GMHA 5ER0A 1DNCA 1DODA 4CCQA 5HYMA 1E1LA 1GTHA 3AE8A 1GRFA 4C5OA 2C7GA 1BGNA 3G5SA 4XWZA 4JDRA 4B67A 4UDPA 4B66A 4LIIA 4H4PA 5EBKA 4AOXA 4ADWA 1E1KA 3IWAA 1FOHA 2OLNA 4YWOA 2R9ZA 1DJNA 3AXBA 1TDEA 2XCGA 1W4XA 2GB0A 2OALA 1FEAA 5M0ZA 3FMWA 3Q9TA 1XHCA 4J57A 4E0VA 3NH3X 3QSEA 2X8GA 4RSLA 1E7PA 2W0HA 4J2WA 3V3OA 2GAGB 5LV9A 3UKFA 4A99A 4OPTA 1ZKQA 1H6VA 1Y0PA 1H86A 1TYTA 1E39A 5C2TA 2TPRA 3P4PA 3PVCA 1L9EA 3NRNA
chains in the Genus database with same CATH superfamily
3AD7B 2EQ9A 2BA9A 1CJ2A 3LZXA 4YSXA 1H84A 1VQWA 4H2RA 4H2NA 1YY5A 2AR8A 4Z2TA 1D4EA 4IVMB 3ABVA 1VG9A 2XLUA 3BI5A 4II2A 4BK3A 4G74A 3GD4A 3NTAA 1EBDA 4GF7A 5JCNA 1ZX9A 4G6HA 1VDCA 4Z25A 1BF3A 2YG6A 2E5VA 1PBEA 3OC4A 4BV6A 1QLBA 1V59A 4J36A 2B9YA 2YLWA 1DOEA 3QSMA 1OJTA 4H2PA 2ZZ0A 3BNMA 4H4XA 3SXIA 4A6NA 4G6GA 2ARDA 2GH5A 2C75A 2XDOA 1E6EA 4EM4A 3CGBA 4GCMA 1TYPA 1UKVG 2Z5XA 4IV9A 4EIPA 4GUVA 2GRTA 4YTNA 4N9XA 1AOGA 3NK2X 4U8OA 3UP5A 2YM2A 1N1PA 2BRYA 1GALA 2C64A 4Y4LA 4A6NB 3RP8A 3O0HA 3UKHA 3AWIA 1F8RA 1GXFA 1LQUA 2VVLG 4J56A 5KMRA 3UKPA 4YSYA 2UZZA 1CJCA 4B1BA 3SZWA 4Z24A 3SFEA 4ZN0A 2B7RA 4EQXA 5KMPA 1IUVA 2XLPA 2RGJA 3EAOA 1X31B 2Y6RA 5EB5A 1TDFA 2GQWA 3IC9A 3SZCA 2FJAA 2GQFA 1PXCA 3AEBA 3C4NA 1FECA 1NHQA 1ZMDA 1LV0A 2WPEA 4C3XA 4U8MA 3C4AA 3CNDA 4UDRA 5CQFA 3AB1A 3NK0X 3NHOX 2XVHA 1N4VA 1MXTA 1OJCA 2C65A 2VQBA 2C66A 4JY2A 2V3BA 2XLTA 2E4GA 4RG4A 2Y6QA 1YQ3A 1D4DA 1GREA 1CC2A 2H88A 1MOKA 2WESA 2XYOA 4YXDA 2XLRA 1D7YA 1H7WA 1ZP0A 5C3JA 3AE7A 1Y56A 4ICYA 3ICSA 1LJ1A 1KDGA 1CC6A 2JBVA 1D5TA 4U8PA 1GETA 3E1TA 1K4QA 2YVGA 4U8IA 5FS7A 2QCUA 2Q6UA 2GV8A 4IVOB 2CULA 2YG3A 4H4SA 5HY5A 1GSNA 2FBWA 2PHHA 1JRXA 3AEDA 4G73A 5U25A 4I58A 5BUKA 5KNLA 4TLZA 1LTXR 2YG4A 2YLTA 3CPJG 3GMBA 3DMEA 3NN0X 3ZYXA 1B4VA 4DSGA 4B68A 4U2LA 4RG3A 3FBSA 3CMMA 4OVIA 1EL5A 4BURA 2GVCA 2B9WA 2BXSA 5TR3A 1Q1RA 1PJ7A 4NNJA 2FJEA 2YLZA 4ZCDA 5EOWA 1PBDA 3AE5A 1GV4A 2A8XA 3M0OA 4OPIA 1VRQB 1H81A 3UKQA 4H2QA 3NG7X 1BWCA 4X9MA 4Z2RA 1DXLA 5DBJA 3VRBA 2VZ2A 3KKJA 2VRLA 1IJHA 3ICRA 2B7SA 2WOWA 1KFYA 2IVDA 3RP7A 4AP1A 4ECHA 1ZK7A 1O94A 2YR5A 1BGJA 1GERA 3ITJA 1NHSA 4CY8A 4EMJA 1PXBA 4GRTA 1QO8A 1L0VA 1NEKA 1N4UA 2X50A 3CNPA 1RYIA 3SQPA 3S61A 3H8LA 3P9UA 3ATRA 1E1NA 4J34A 4LU6A 4CRTA 2GEWA 2I0ZA 1OJDA 2GR0A 1E1MA 3LJPA 4CY6A 2YAUA 4GAVA 1Z6LA 4X4JA 3LXDA 4GAPA 2XVFA 3AD8B 2IIDA 3KA7A 1S3BA 1ZY8A 2R0GA 3BNUA 1PBBA 4TM0A 4BK2A 3I6DA 4DSHA 4KPRA 2R0PA 1GRGA 2BACA 2C67A 2WETA 1CL0A 2WDVA 1EL7A 3DJGX 3K7QX 3T2KA 3V3NA 2YG5A 3DA1A 3PS9A 4H7UA 1GRBA 4OPGA 4A9WA 1XPQA 1B37A 1REOA 3NGCX 3OZ2A 4USRA 1IUWA 3CPIG 5HHFA 3SZFA 3VR8A 4APNA 2R4EA 2Q0LA 2WOVA 1YKJA 3GRTA 4ZCCA 1O5WA 2BC1A 4KX6A 4A65A 1MO9A 2TMDA 4OPLA 3UKKA 4YTPA 3FIMB 1GRTA 1D7LA 1PXAA 5U63A 1ONFA 2WS3A 1NHRA 4GDEA 2YVJA 5L46A 2XFQA 4FK1A 3GYIA 3UTEA 3SGLA 2RGOA 1PS9A 4JY3A 4OPDA 4EMIA 1P2EA 4H4QA 2WU5A 4A7AA 1NHPA 4D03A 2WP9A 1TDOA 3BI2A 3SYIA 4CNKA 4D04A 2Z5YA 2OLOA 3RNMA 1KF6A 2VVMA 3AYIA 3AEFA 1TRBA 2YG7A 3GD3A 1FEBA 1COYA 2R0CA 3GWFA 4H4YA 4NTCA 4U8KA 4WCTA 5FMHA 3DJEA 2A87A 3B3RA 2WPFA 4NTDA 2ZZBA 3NTDA 4H4VA 4HA6A 2E1MA 3B6DA 5IPYA 3NYFA 3UP4A 3P4SA 4IA6A 4XXGA 2BYBA 2WQYA 3GWDA 2OAMA 1NAAA 5BULA 1TDKA 4BJZA 1F8WA 1GT8A 3GYXA 4FDCB 4XWRA 4PABA 1L9DA 2NVKX 4EMWA 3VR9A 4B63A 1ELIA 3ICTA 3P1WA 2VQ7A 3AE4A 2YLSA 1IUXA 3FPZA 2JB2A 2O9ZA 1F8SA 4J31A 5BVAA 3NKSA 1H7XA 5FS9A 1ZMCA 4JNAA 3HYWA 3QVRA 3T14A 4I59A 1CHUA 2F5ZA 3UCLA 4GR1A 3C96A 2V3AA 1BZLA 2GAHB 3P4RA 4M52A 3D8XA 3AYJA 2DKHA 3SY4A 2XFUA 4REKA 3F8PA 1JNZA 4NEVA 1GESA 2R46A 2YM1A 2XVJA 5HXIA 3BHFA 1GPEA 1EL8A 1LQTA 3BHKA 1FL2A 2JB1A 1CF3A 4JN9A 2R45A 4K8DA 3SZ0A 4BJYA 4EQWA 3NT6A 3ALMA 2VVLA 3KPKA 3NIXA 1B5QA 1PJ5A 4H4RA 2B9XA 3NK1X 2XVEA 4Z26A 2AQJA 3SM8A 4U8JA 2C73A 1JU2A 2V60A 2B76A 3GSIA 1FCDA 4C3YA 3BI4A 3NYEA 2HQMA 1BKWA 3UOYA 2WPCA 1Q1WA 2YR6A 3EF6A 2BXRA 1M6IA 1DOBA 1S3EA 3DJDA 3F8RA 2BRAA 3UTFA 3K7MX 4TM4A 3ADAB 3CNTA 3QFBA 4LA1A 5IQ1A 4C74A 1TDNA 4OPCA 3VQRA 5KOWA 4Y4NA 2BABA 3AE6A 2X8CA 3ZDNA 2PYXA 3JSKA 4AT0A 4AP3A 2BK5A 5GSNA 3URHA 2BCGG 3KVEA 2QA2A 2VOUA 2BK4A 3RHAA 4CCRA 5KXJA 4U2TA 4H4TA 1ZOVA 3GDNA 2GR2A 2C3CA 2V5ZA 2BC0A 1Q9IA 2EQ7A 1IUTA 2GR3A 3SFDA 4NZHA 5FS8A 2ZZCA 1S2YA 3PO7A 4FX9A 4EQSA 2C76A 2V6OA 1H83A 1PHHA 2NPXA 1GRHA 2YR4A 4CBQA 1PJ6A 4K7ZA 3CGCA 3HYXA 3QFAA 1ZDLA 1OJAA 4TLXA 2FJBA 1QJDA 2QAEA 2VRMA 4EIQA 1IUUA 3GDPA 4TM1A 3ATQA 1LPFA 5KOXA 5KWFA 3ISHA 5KRQA 4U2SA 4EQRA 2XFNA 3UKLA 5JCIA 3COXA 3V76A 3EPTA 3LB8A 4MJWA 3CNJA 3REDA 3KU9A 5KMQA 4H4ZA 3T2ZA 2JK6A 2QA1A 2RGHA 2A89A 2OA1A 3G5RA 2XVIA 3T2YA 4Y4MA 1K0JA 3H4KA 3QJ4A 5J7XA 2WBAA 4A79A 3DGZA 4CNJA 1JOAA 1GTEA 3GYJA 1P2HA 1K0LA 1KNPA 5KVIA 5KVHA 1ZOYA 3K7TA 4PAAA 1SEZA 4TM3A 4EM3A 2C3DA 4BK1A 2YQUA 3GMCA 4YKGA 1PBFA 1Y56B 4UP3A 4C77A 4HB9A 4Z2UA 3IHMA 5JCMA 3HYVA 2YVFA 4GDPA 1NPXA 4O5QA 3CN8A 3RP6A 5J60A 3AD9B 5KMSA 3DJJA 1JRZA 1GEUA 2WP5A 3FG2P 4Z44A 2BS4A 3AE2A 1CJ3A 3QSSA 1H82A 1L9CA 3H8IA 3T37A 1CBOA 3AEEA 1EL9A 4K5RA 4FK1C 1JEHA 3GRSA 3UOZA 5BRTA 2WU2A 3KLJA 4YT0A 1S2QA 2R4JA 3AE3A 3IF9A 3KPFA 2WDRA 1KNRA 2XLSA 1N4WA 1PDHA 3DK9A 1XDIA 1GNDA 2Q7VA 2J3NA 2BCPA 3NLCA 4B64A 1OJ9A 3NYCA 1IUSA 4JNQA 1CJ4A 2X8HA 5JCKA 2X3NA 1D4CA 1NG3A 3UOXA 4AT2A 5M10A 1JNRA 2ACZA 3EANA 4O5UA 3HZLA 5IQ4A 1JRYA 2WP6A 4H4UA 4X9NA 4YSZA 5GRTA 1RSGA 2EQ6A 1DOCA 2GR1A 2WHDA 4DGKA 1GRAA 1KSSA 3UTGA 3DH9A 3CIRA 4G9KA 2FJDA 3AE1A 1YQ4A 4B69A 3S5WA 3CGEA 3I3LA 3NNEA 5JCLA 2CVJA 3WE0A 3D1CA 2AAQA 2C72A 4IA5A 2CFYA 5U1OA 1M64A 3AECA 4K5SA 3M13A 4K2XA 4DNAA 1PN0A 4YSHA 3VRDB 4UDQA 4P9SA 1F3PA 1RP0A 1CC4A 2BS3A 3ALJA 3CPHG 3R9UA 3II4A 3CTYA 2XFOA 4OPUA 5EB4A 2YWLA 4NTEA 1XANA 3UTHA 2BK3A 2H89A 1B8SA 4H4WA 2APGA 2V61A 2ZBWA 4WX1A 4J33A 4Z43A 4B65A 4A5LA 2C4CA 2RABA 1GOSA 3AE9A 3AEAA 4K22A 4YTMA 3NN6X 4AOSA 3AYLA 3LADA 2X99A 1YQZA 2GMJA 3UKAA 3DK4A 3ALLA 3UOVA 4U8LA 2BS2A 2C70A 3VRAA 3KD9A 2IVEA 2EQ8A 3LOVA 2YLXA 3M12A 2CDUA 2DKIA 2Q0KA 4H50A 3L1RA 4U8NA 2WEUA 2WOIA 3DGHA 3L8KA 2GF3A 3P4QA 5FS6A 1K0IA 3G5QA 3AEGA 4YKFA 1F6MA 3K30A 2WDQA 2XFPA 3F8DA 2JAEA 4NEWA 3SX6A 1VG0A 4USQA 1NG4A 2JB3A 3LZWA 1PBCA 3CGDA 4OCGA 1O95A 2YLRA 1DJQA 1HYUA 3CNSA 3Q6JA 3QVPA 1NENA 3DK8A 1NDAA 4JQ9A 1KSUA 1LVLA 2JKCA 3IHGA 5CKUA 2GMHA 5ER0A 1DNCA 1DODA 4CCQA 5HYMA 1E1LA 1GTHA 3AE8A 1GRFA 4C5OA 3T31A 2C7GA 1BGNA 3G5SA 4XWZA 4JDRA 4B67A 4UDPA 4B66A 4LIIA 4H4PA 5EBKA 4AOXA 4ADWA 1E1KA 3IWAA 1FOHA 2OLNA 4YWOA 2R9ZA 1DJNA 3AXBA 1TDEA 2XCGA 1W4XA 2GB0A 2OALA 1FEAA 5M0ZA 3FMWA 3Q9TA 1XHCA 4J57A 4E0VA 4NWZA 3NH3X 3QSEA 2X8GA 4RSLA 1E7PA 2W0HA 4J2WA 3V3OA 2GAGB 5LV9A 3UKFA 4A99A 4OPTA 1ZKQA 1H6VA 1Y0PA 3T0KA 1H86A 1TYTA 1E39A 5C2TA 4II3A 2TPRA 3P4PA 3PVCA 1L9EA 3NRNA
chains in the Genus database with same CATH topology
3AD7B 2EQ9A 2BA9A 1CJ2A 3LZXA 4YSXA 1H84A 1VQWA 4H2RA 4H2NA 1YY5A 2AR8A 4Z2TA 1D4EA 4IVMB 3ABVA 1VG9A 2XLUA 3BI5A 4II2A 4BK3A 4G74A 3GD4A 3NTAA 1EBDA 4GF7A 5JCNA 1ZX9A 4G6HA 1VDCA 4Z25A 1BF3A 2YG6A 2E5VA 1PBEA 3OC4A 4BV6A 1QLBA 1V59A 4J36A 2B9YA 2YLWA 1DOEA 3QSMA 1OJTA 4H2PA 2ZZ0A 3BNMA 4H4XA 3SXIA 4A6NA 4G6GA 2ARDA 2GH5A 2C75A 2XDOA 1E6EA 4EM4A 3CGBA 4GCMA 1TYPA 1UKVG 2Z5XA 4IV9A 4EIPA 4GUVA 2GRTA 4YTNA 4N9XA 1AOGA 3NK2X 4U8OA 3UP5A 2YM2A 1N1PA 2BRYA 1GALA 2C64A 4Y4LA 4A6NB 3RP8A 3O0HA 3UKHA 3AWIA 1F8RA 1GXFA 1LQUA 2VVLG 4J56A 5KMRA 3UKPA 4YSYA 2UZZA 1CJCA 4B1BA 3SZWA 4Z24A 3SFEA 4ZN0A 2B7RA 4EQXA 5KMPA 1IUVA 2XLPA 2RGJA 3EAOA 1X31B 2Y6RA 5EB5A 1TDFA 2GQWA 3IC9A 3SZCA 2FJAA 2GQFA 1PXCA 3AEBA 3C4NA 1FECA 1NHQA 1ZMDA 1LV0A 2WPEA 4C3XA 4U8MA 3C4AA 3CNDA 4UDRA 5CQFA 3AB1A 3NK0X 3NHOX 2XVHA 1N4VA 1MXTA 1OJCA 2C65A 2VQBA 2C66A 4JY2A 2V3BA 2XLTA 2E4GA 4RG4A 2Y6QA 1YQ3A 1D4DA 1GREA 1CC2A 2H88A 1MOKA 2WESA 2XYOA 4YXDA 2XLRA 1D7YA 1H7WA 1ZP0A 5C3JA 3AE7A 1Y56A 4ICYA 3ICSA 1LJ1A 1KDGA 1CC6A 2JBVA 1D5TA 4U8PA 1GETA 3E1TA 1K4QA 2YVGA 4U8IA 5FS7A 2QCUA 2Q6UA 2GV8A 4IVOB 2CULA 2YG3A 4H4SA 5HY5A 1GSNA 2FBWA 2PHHA 1JRXA 3AEDA 4G73A 5U25A 4I58A 5BUKA 5KNLA 4TLZA 1LTXR 2YG4A 2YLTA 3CPJG 3GMBA 3DMEA 3NN0X 3ZYXA 1B4VA 4DSGA 4B68A 4U2LA 4RG3A 3FBSA 3CMMA 4OVIA 1EL5A 4BURA 2GVCA 2B9WA 2BXSA 5TR3A 1Q1RA 1PJ7A 4NNJA 2FJEA 2YLZA 4ZCDA 5EOWA 1PBDA 3AE5A 1GV4A 2A8XA 3M0OA 4OPIA 1VRQB 1H81A 3UKQA 4H2QA 3NG7X 1BWCA 4X9MA 4Z2RA 1DXLA 5DBJA 3VRBA 2VZ2A 3KKJA 2VRLA 1IJHA 3ICRA 2B7SA 2WOWA 1KFYA 2IVDA 3RP7A 4AP1A 4ECHA 1ZK7A 1O94A 2YR5A 1BGJA 1GERA 3ITJA 1NHSA 4CY8A 4EMJA 1PXBA 4GRTA 1QO8A 1L0VA 1NEKA 1N4UA 2X50A 3CNPA 1RYIA 3SQPA 3S61A 3H8LA 3P9UA 3ATRA 1E1NA 4J34A 4LU6A 4CRTA 2GEWA 2I0ZA 1OJDA 2GR0A 1E1MA 3LJPA 4CY6A 2YAUA 4GAVA 1Z6LA 4X4JA 3LXDA 4GAPA 2XVFA 3AD8B 2IIDA 3KA7A 1S3BA 1ZY8A 2R0GA 3BNUA 1PBBA 4TM0A 4BK2A 3I6DA 4DSHA 4KPRA 2R0PA 1GRGA 2BACA 2C67A 2WETA 1CL0A 2WDVA 1EL7A 3DJGX 3K7QX 3T2KA 3V3NA 2YG5A 3DA1A 3PS9A 4H7UA 1GRBA 4OPGA 4A9WA 1XPQA 1B37A 1REOA 3NGCX 3OZ2A 4USRA 1IUWA 3CPIG 5HHFA 3SZFA 3VR8A 4APNA 2R4EA 2Q0LA 2WOVA 1YKJA 3GRTA 4ZCCA 1O5WA 2BC1A 4KX6A 4A65A 1MO9A 2TMDA 4OPLA 3UKKA 4YTPA 3FIMB 1GRTA 1D7LA 1PXAA 5U63A 1ONFA 2WS3A 1NHRA 4GDEA 2YVJA 5L46A 2XFQA 4FK1A 3GYIA 3UTEA 3SGLA 2RGOA 1PS9A 4JY3A 4OPDA 4EMIA 1P2EA 4H4QA 2WU5A 4A7AA 1NHPA 4D03A 2WP9A 1TDOA 3BI2A 3SYIA 4CNKA 4D04A 2Z5YA 2OLOA 3RNMA 1KF6A 2VVMA 3AYIA 3AEFA 1TRBA 2YG7A 3GD3A 1FEBA 1COYA 2R0CA 3GWFA 4H4YA 4NTCA 4U8KA 4WCTA 5FMHA 3DJEA 2A87A 3B3RA 2WPFA 4NTDA 2ZZBA 3NTDA 4H4VA 4HA6A 2E1MA 3B6DA 5IPYA 3NYFA 3UP4A 3P4SA 4IA6A 4XXGA 2BYBA 2WQYA 3GWDA 2OAMA 1NAAA 5BULA 1TDKA 4BJZA 1F8WA 1GT8A 3GYXA 4FDCB 4XWRA 4PABA 1L9DA 2NVKX 4EMWA 3VR9A 4B63A 1ELIA 3ICTA 3P1WA 2VQ7A 3AE4A 2YLSA 1IUXA 3FPZA 2JB2A 2O9ZA 1F8SA 4J31A 5BVAA 3NKSA 1H7XA 5FS9A 1ZMCA 4JNAA 3HYWA 3QVRA 3T14A 4I59A 1CHUA 2F5ZA 3UCLA 4GR1A 3C96A 2V3AA 1BZLA 2GAHB 3P4RA 4M52A 3D8XA 3AYJA 2DKHA 3SY4A 2XFUA 4REKA 3F8PA 1JNZA 4NEVA 1GESA 2R46A 2YM1A 2XVJA 5HXIA 3BHFA 1GPEA 1EL8A 1LQTA 3BHKA 1FL2A 2JB1A 1CF3A 4JN9A 2R45A 4K8DA 3SZ0A 4BJYA 4EQWA 3NT6A 3ALMA 2VVLA 3KPKA 3NIXA 1B5QA 1PJ5A 4H4RA 2B9XA 3NK1X 2XVEA 4Z26A 2AQJA 3SM8A 4U8JA 2C73A 1JU2A 2V60A 2B76A 3GSIA 1FCDA 4C3YA 3BI4A 3NYEA 2HQMA 1BKWA 3UOYA 2WPCA 1Q1WA 2YR6A 3EF6A 2BXRA 1M6IA 1DOBA 1S3EA 3DJDA 3F8RA 2BRAA 3UTFA 3K7MX 4TM4A 3ADAB 3CNTA 3QFBA 4LA1A 5IQ1A 4C74A 1TDNA 4OPCA 3VQRA 5KOWA 4Y4NA 2BABA 3AE6A 2X8CA 3ZDNA 2PYXA 3JSKA 4AT0A 4AP3A 2BK5A 5GSNA 3URHA 2BCGG 3KVEA 2QA2A 2VOUA 2BK4A 3RHAA 4CCRA 5KXJA 4U2TA 4H4TA 1ZOVA 3GDNA 2GR2A 2C3CA 2V5ZA 2BC0A 1Q9IA 2EQ7A 1IUTA 2GR3A 3SFDA 4NZHA 5FS8A 2ZZCA 1S2YA 3PO7A 4FX9A 4EQSA 2C76A 2V6OA 1H83A 1PHHA 2NPXA 1GRHA 2YR4A 4CBQA 1PJ6A 4K7ZA 3CGCA 3HYXA 3QFAA 1ZDLA 1OJAA 4TLXA 2FJBA 1QJDA 2QAEA 2VRMA 4EIQA 1IUUA 3GDPA 4TM1A 3ATQA 1LPFA 5KOXA 5KWFA 3ISHA 5KRQA 4U2SA 4EQRA 2XFNA 3UKLA 5JCIA 3COXA 3V76A 3EPTA 3LB8A 4MJWA 3CNJA 3REDA 3KU9A 5KMQA 4H4ZA 3T2ZA 2JK6A 2QA1A 2RGHA 2A89A 2OA1A 3G5RA 2XVIA 3T2YA 4Y4MA 1K0JA 3H4KA 3QJ4A 5J7XA 2WBAA 4A79A 3DGZA 4CNJA 1JOAA 1GTEA 3GYJA 1P2HA 1K0LA 1KNPA 5KVIA 5KVHA 1ZOYA 3K7TA 4PAAA 1SEZA 4TM3A 4EM3A 2C3DA 4BK1A 2YQUA 3GMCA 4YKGA 1PBFA 1Y56B 4UP3A 4C77A 4HB9A 4Z2UA 3IHMA 5JCMA 3HYVA 2YVFA 4GDPA 1NPXA 4O5QA 3CN8A 3RP6A 5J60A 3AD9B 5KMSA 3DJJA 1JRZA 1GEUA 2WP5A 3FG2P 4Z44A 2BS4A 3AE2A 1CJ3A 3QSSA 1H82A 1L9CA 3H8IA 3T37A 1CBOA 3AEEA 1EL9A 4K5RA 4FK1C 1JEHA 3GRSA 3UOZA 5BRTA 2WU2A 3KLJA 4YT0A 1S2QA 2R4JA 3AE3A 3IF9A 3KPFA 2WDRA 1KNRA 2XLSA 1N4WA 1PDHA 3DK9A 1XDIA 1GNDA 2Q7VA 2J3NA 2BCPA 3NLCA 4B64A 1OJ9A 3NYCA 1IUSA 4JNQA 1CJ4A 2X8HA 5JCKA 2X3NA 1D4CA 1NG3A 3UOXA 4AT2A 5M10A 1JNRA 2ACZA 3EANA 4O5UA 3HZLA 5IQ4A 1JRYA 2WP6A 4H4UA 4X9NA 4YSZA 5GRTA 1RSGA 2EQ6A 1DOCA 2GR1A 2WHDA 4DGKA 1GRAA 1KSSA 3UTGA 3DH9A 3CIRA 4G9KA 2FJDA 3AE1A 1YQ4A 4B69A 3S5WA 3CGEA 3I3LA 3NNEA 5JCLA 2CVJA 3WE0A 3D1CA 2AAQA 2C72A 4IA5A 2CFYA 5U1OA 1M64A 3AECA 4K5SA 3M13A 4K2XA 4DNAA 1PN0A 4YSHA 3VRDB 4UDQA 4P9SA 1F3PA 1RP0A 1CC4A 2BS3A 3ALJA 3CPHG 3R9UA 3II4A 3CTYA 2XFOA 4OPUA 5EB4A 2YWLA 4NTEA 1XANA 3UTHA 2BK3A 2H89A 1B8SA 4H4WA 2APGA 2V61A 2ZBWA 4WX1A 4J33A 4Z43A 4B65A 4A5LA 2C4CA 2RABA 1GOSA 3AE9A 3AEAA 4K22A 4YTMA 3NN6X 4AOSA 3AYLA 3LADA 2X99A 1YQZA 2GMJA 3UKAA 3DK4A 3ALLA 3UOVA 4U8LA 2BS2A 2C70A 3VRAA 3KD9A 2IVEA 2EQ8A 3LOVA 2YLXA 3M12A 2CDUA 2DKIA 2Q0KA 4H50A 3L1RA 4U8NA 2WEUA 2WOIA 3DGHA 3L8KA 2GF3A 3P4QA 5FS6A 1K0IA 3G5QA 3AEGA 4YKFA 1F6MA 3K30A 2WDQA 2XFPA 3F8DA 2JAEA 4NEWA 3SX6A 1VG0A 4USQA 1NG4A 2JB3A 3LZWA 1PBCA 3CGDA 4OCGA 1O95A 2YLRA 1DJQA 1HYUA 3CNSA 3Q6JA 3QVPA 1NENA 3DK8A 1NDAA 4JQ9A 1KSUA 1LVLA 2JKCA 3IHGA 5CKUA 2GMHA 5ER0A 1DNCA 1DODA 4CCQA 5HYMA 1E1LA 1GTHA 3AE8A 1GRFA 4C5OA 3T31A 2C7GA 1BGNA 3G5SA 4XWZA 4JDRA 4B67A 4UDPA 4B66A 4LIIA 4H4PA 5EBKA 4AOXA 4ADWA 1E1KA 3IWAA 1FOHA 2OLNA 4YWOA 2R9ZA 1DJNA 3AXBA 1TDEA 2XCGA 1W4XA 2GB0A 2OALA 1FEAA 5M0ZA 3FMWA 3Q9TA 1XHCA 4J57A 4E0VA 4NWZA 3NH3X 3QSEA 2X8GA 4RSLA 1E7PA 2W0HA 4J2WA 3V3OA 2GAGB 5LV9A 3UKFA 4A99A 4OPTA 1ZKQA 1H6VA 1Y0PA 3T0KA 1H86A 1TYTA 1E39A 5C2TA 4II3A 2TPRA 3P4PA 3PVCA 1L9EA 3NRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AD7 B;  2EQ9 A;  2BA9 A;  1CJ2 A;  3LZX A;  4YSX A;  1H84 A;  1VQW A;  4H2R A;  4H2N A;  1YY5 A;  2AR8 A;  4Z2T A;  1D4E A;  4IVM B;  3ABV A;  1VG9 A;  2XLU A;  3BI5 A;  4BK3 A;  3GD4 A;  3NTA A;  1EBD A;  4GF7 A;  5JCN A;  1ZX9 A;  1VDC A;  4Z25 A;  1BF3 A;  2YG6 A;  2E5V A;  1PBE A;  3OC4 A;  4BV6 A;  1QLB A;  1V59 A;  4J36 A;  2B9Y A;  2YLW A;  1DOE A;  3QSM A;  1OJT A;  4H2P A;  2ZZ0 A;  3BNM A;  4H4X A;  4A6N A;  2ARD A;  2GH5 A;  2C75 A;  2XDO A;  1E6E A;  4EM4 A;  3CGB A;  4GCM A;  1TYP A;  1UKV G;  2Z5X A;  4IV9 A;  4EIP A;  4GUV A;  2GRT A;  4YTN A;  4N9X A;  1AOG A;  3NK2 X;  4U8O A;  3UP5 A;  2YM2 A;  1N1P A;  1GAL A;  2C64 A;  4Y4L A;  4A6N B;  3RP8 A;  3O0H A;  3UKH A;  3AWI A;  1F8R A;  1GXF A;  1LQU A;  2VVL G;  4J56 A;  3UKP A;  4YSY A;  2UZZ A;  1CJC A;  4B1B A;  4Z24 A;  3SFE A;  4ZN0 A;  2B7R A;  4EQX A;  1IUV A;  2XLP A;  2RGJ A;  3EAO A;  1X31 B;  2Y6R A;  5EB5 A;  1TDF A;  2GQW A;  3IC9 A;  2FJA A;  2GQF A;  1PXC A;  3AEB A;  3C4N A;  1FEC A;  1NHQ A;  1ZMD A;  1LV0 A;  2WPE A;  4C3X A;  4U8M A;  3C4A A;  3CND A;  4UDR A;  5CQF A;  3AB1 A;  3NK0 X;  3NHO X;  2XVH A;  1N4V A;  1MXT A;  1OJC A;  2C65 A;  2VQB A;  2C66 A;  4JY2 A;  2V3B A;  2XLT A;  2E4G A;  4RG4 A;  2Y6Q A;  1YQ3 A;  1D4D A;  1GRE A;  1CC2 A;  2H88 A;  1MOK A;  2WES A;  2XYO A;  4YXD A;  2XLR A;  1D7Y A;  1H7W A;  1ZP0 A;  5C3J A;  3AE7 A;  1Y56 A;  4ICY A;  3ICS A;  1LJ1 A;  1KDG A;  1CC6 A;  2JBV A;  1D5T A;  4U8P A;  1GET A;  3E1T A;  1K4Q A;  2YVG A;  4U8I A;  5FS7 A;  2QCU A;  2Q6U A;  2GV8 A;  4IVO B;  2CUL A;  2YG3 A;  4H4S A;  5HY5 A;  1GSN A;  2FBW A;  2PHH A;  1JRX A;  3AED A;  5BUK A;  5U25 A;  4I58 A;  4TLZ A;  1LTX R;  2YG4 A;  2YLT A;  3CPJ G;  3GMB A;  3DME A;  3NN0 X;  3ZYX A;  1B4V A;  4DSG A;  4B68 A;  4U2L A;  4RG3 A;  3FBS A;  4OVI A;  1EL5 A;  4BUR A;  2GVC A;  2B9W A;  2BXS A;  5TR3 A;  1Q1R A;  1PJ7 A;  2FJE A;  2YLZ A;  4ZCD A;  5EOW A;  1PBD A;  3AE5 A;  1GV4 A;  2A8X A;  3M0O A;  4OPI A;  1VRQ B;  1H81 A;  3UKQ A;  4H2Q A;  3NG7 X;  1BWC A;  4X9M A;  4Z2R A;  1DXL A;  5DBJ A;  3VRB A;  2VZ2 A;  3KKJ A;  2VRL A;  1IJH A;  3ICR A;  2B7S A;  2WOW A;  1KFY A;  2IVD A;  3RP7 A;  4AP1 A;  4ECH A;  1ZK7 A;  1O94 A;  2YR5 A;  1BGJ A;  1GER A;  3ITJ A;  1NHS A;  4CY8 A;  4EMJ A;  1PXB A;  4GRT A;  1QO8 A;  1L0V A;  1NEK A;  1N4U A;  2X50 A;  3CNP A;  1RYI A;  3SQP A;  3S61 A;  3H8L A;  3P9U A;  3ATR A;  1E1N A;  4J34 A;  4LU6 A;  4CRT A;  2GEW A;  2I0Z A;  1OJD A;  2GR0 A;  1E1M A;  3LJP A;  4CY6 A;  2YAU A;  1Z6L A;  4X4J A;  3LXD A;  2XVF A;  3AD8 B;  2IID A;  3KA7 A;  1S3B A;  1ZY8 A;  2R0G A;  3BNU A;  1PBB A;  4TM0 A;  4BK2 A;  3I6D A;  4DSH A;  4KPR A;  2R0P A;  1GRG A;  2BAC A;  2C67 A;  2WET A;  1CL0 A;  2WDV A;  1EL7 A;  3DJG X;  3K7Q X;  3V3N A;  2YG5 A;  3DA1 A;  3PS9 A;  4H7U A;  1GRB A;  4OPG A;  4A9W A;  1XPQ A;  1B37 A;  1REO A;  3NGC X;  3OZ2 A;  4USR A;  1IUW A;  3CPI G;  5HHF A;  3UOV A;  3VR8 A;  4APN A;  2R4E A;  2Q0L A;  2WOV A;  1YKJ A;  3GRT A;  4ZCC A;  1O5W A;  2BC1 A;  4KX6 A;  4A65 A;  1MO9 A;  2TMD A;  4OPL A;  3UKK A;  4YTP A;  3FIM B;  1GRT A;  1D7L A;  1PXA A;  5U63 A;  1ONF A;  2WS3 A;  1NHR A;  4GDE A;  2YVJ A;  5L46 A;  2XFQ A;  4FK1 A;  3GYI A;  3UTE A;  3SGL A;  2RGO A;  1PS9 A;  4JY3 A;  4OPD A;  4EMI A;  1P2E A;  4H4Q A;  2WU5 A;  4A7A A;  1NHP A;  4D03 A;  2WP9 A;  1TDO A;  3BI2 A;  4CNK A;  4D04 A;  2Z5Y A;  2OLO A;  3RNM A;  1KF6 A;  2VVM A;  3AYI A;  3AEF A;  1TRB A;  2YG7 A;  3GD3 A;  1FEB A;  1COY A;  2R0C A;  3GWF A;  4H4Y A;  4NTC A;  4U8K A;  4WCT A;  5FMH A;  3DJE A;  2A87 A;  3B3R A;  2WPF A;  4NTD A;  2ZZB A;  3NTD A;  4H4V A;  4HA6 A;  2E1M A;  3B6D A;  5IPY A;  3NYF A;  3UP4 A;  3P4S A;  4IA6 A;  4XXG A;  2BYB A;  2WQY A;  3GWD A;  2OAM A;  1NAA A;  5BUL A;  1TDK A;  4BJZ A;  1F8W A;  1GT8 A;  4FDC B;  4XWR A;  4PAB A;  1L9D A;  2NVK X;  4EMW A;  3VR9 A;  4B63 A;  1ELI A;  3ICT A;  3P1W A;  2VQ7 A;  3AE4 A;  2YLS A;  1IUX A;  3FPZ A;  2JB2 A;  2O9Z A;  1F8S A;  4J31 A;  5BVA A;  3NKS A;  1H7X A;  5FS9 A;  1ZMC A;  4JNA A;  3QVR A;  4I59 A;  1CHU A;  2F5Z A;  3UCL A;  4GR1 A;  3C96 A;  2V3A A;  1BZL A;  2GAH B;  3P4R A;  4M52 A;  3D8X A;  3AYJ A;  2DKH A;  2XFU A;  4REK A;  3F8P A;  1JNZ A;  4NEV A;  1GES A;  2R46 A;  2YM1 A;  2XVJ A;  5HXI A;  3BHF A;  1GPE A;  1EL8 A;  1LQT A;  3BHK A;  1FL2 A;  2JB1 A;  1CF3 A;  4JN9 A;  2R45 A;  4K8D A;  4BJY A;  4EQW A;  3NT6 A;  3ALM A;  2VVL A;  3NIX A;  1B5Q A;  1PJ5 A;  4H4R A;  2B9X A;  3NK1 X;  2XVE A;  4Z26 A;  2AQJ A;  3SM8 A;  4U8J A;  2C73 A;  1JU2 A;  2V60 A;  2B76 A;  3GSI A;  1FCD A;  4C3Y A;  3BI4 A;  3NYE A;  2HQM A;  1BKW A;  3UOY A;  2WPC A;  1Q1W A;  2YR6 A;  3EF6 A;  2BXR A;  1M6I A;  1DOB A;  1S3E A;  3DJD A;  3F8R A;  3UTF A;  3K7M X;  4TM4 A;  3ADA B;  3CNT A;  3QFB A;  4LA1 A;  5IQ1 A;  4C74 A;  1TDN A;  4OPC A;  3VQR A;  5KOW A;  4Y4N A;  2BAB A;  3AE6 A;  2X8C A;  3ZDN A;  2PYX A;  3JSK A;  4AT0 A;  4AP3 A;  2BK5 A;  5GSN A;  3URH A;  2BCG G;  3KVE A;  2QA2 A;  2VOU A;  2BK4 A;  3RHA A;  4CCR A;  5KXJ A;  4U2T A;  4H4T A;  1ZOV A;  3GDN A;  2GR2 A;  2C3C A;  2V5Z A;  2BC0 A;  1Q9I A;  2EQ7 A;  1IUT A;  2GR3 A;  3SFD A;  4NZH A;  5FS8 A;  2ZZC A;  1S2Y A;  3PO7 A;  4FX9 A;  4EQS A;  2C76 A;  2V6O A;  1H83 A;  1PHH A;  2NPX A;  1GRH A;  2YR4 A;  4CBQ A;  1PJ6 A;  4K7Z A;  3CGC A;  4TLX A;  3QFA A;  1ZDL A;  1OJA A;  4EIQ A;  2FJB A;  1QJD A;  2QAE A;  2VRM A;  1IUU A;  3GDP A;  4TM1 A;  3ATQ A;  1LPF A;  5KOX A;  5KWF A;  3ISH A;  5KRQ A;  4U2S A;  4EQR A;  2XFN A;  3UKL A;  5JCI A;  3COX A;  3V76 A;  3EPT A;  3LB8 A;  4MJW A;  3CNJ A;  3RED A;  3KU9 A;  4H4Z A;  2JK6 A;  2QA1 A;  2RGH A;  2A89 A;  2OA1 A;  3G5R A;  2XVI A;  4Y4M A;  1K0J A;  3H4K A;  3QJ4 A;  5J7X A;  2WBA A;  4A79 A;  3DGZ A;  4CNJ A;  1JOA A;  1GTE A;  3GYJ A;  1P2H A;  1K0L A;  1KNP A;  5KVI A;  5KVH A;  1ZOY A;  3K7T A;  4PAA A;  1SEZ A;  4TM3 A;  4EM3 A;  2C3D A;  4BK1 A;  2YQU A;  3GMC A;  4YKG A;  1PBF A;  1Y56 B;  4UP3 A;  4C77 A;  4HB9 A;  4Z2U A;  3IHM A;  5JCM A;  4GDP A;  2YVF A;  1NPX A;  4O5Q A;  3CN8 A;  3RP6 A;  5J60 A;  3AD9 B;  3DJJ A;  1JRZ A;  1GEU A;  2WP5 A;  3FG2 P;  4Z44 A;  2BS4 A;  3AE2 A;  1CJ3 A;  3QSS A;  1H82 A;  1L9C A;  3H8I A;  3T37 A;  1CBO A;  3AEE A;  1EL9 A;  4K5R A;  4FK1 C;  1JEH A;  3GRS A;  3UOZ A;  5BRT A;  2WU2 A;  3KLJ A;  4YT0 A;  1S2Q A;  2R4J A;  3AE3 A;  3IF9 A;  3KPF A;  2WDR A;  1KNR A;  2XLS A;  1N4W A;  1PDH A;  3DK9 A;  1XDI A;  1GND A;  2Q7V A;  2J3N A;  2BCP A;  3NLC A;  4B64 A;  1OJ9 A;  3NYC A;  1IUS A;  4JNQ A;  1CJ4 A;  2X8H A;  5JCK A;  2X3N A;  1D4C A;  1NG3 A;  3UOX A;  4AT2 A;  5M10 A;  1JNR A;  2ACZ A;  3EAN A;  4O5U A;  3HZL A;  5IQ4 A;  1JRY A;  2WP6 A;  4H4U A;  4X9N A;  4YSZ A;  5GRT A;  1RSG A;  2EQ6 A;  1DOC A;  2GR1 A;  2WHD A;  4DGK A;  1GRA A;  1KSS A;  3UTG A;  3DH9 A;  3CIR A;  2FJD A;  3AE1 A;  1YQ4 A;  4B69 A;  3S5W A;  3CGE A;  3I3L A;  3NNE A;  5JCL A;  2CVJ A;  3WE0 A;  3D1C A;  2AAQ A;  2C72 A;  4IA5 A;  2CFY A;  5U1O A;  1M64 A;  3AEC A;  4K5S A;  3M13 A;  4K2X A;  4DNA A;  1PN0 A;  4YSH A;  3VRD B;  4UDQ A;  4P9S A;  1F3P A;  1RP0 A;  1CC4 A;  2BS3 A;  3ALJ A;  3CPH G;  3R9U A;  3II4 A;  3CTY A;  2XFO A;  4OPU A;  5EB4 A;  2YWL A;  4NTE A;  1XAN A;  3UTH A;  2BK3 A;  2H89 A;  1B8S A;  4H4W A;  2APG A;  2V61 A;  2ZBW A;  4WX1 A;  4J33 A;  4Z43 A;  4B65 A;  4A5L A;  2RAB A;  3AEA A;  1GOS A;  3AE9 A;  4K22 A;  4AOS A;  4YTM A;  3NN6 X;  3AYL A;  3LAD A;  2X99 A;  1YQZ A;  2GMJ A;  3UKA A;  3DK4 A;  3ALL A;  4U8L A;  2BS2 A;  2C70 A;  3VRA A;  3KD9 A;  2IVE A;  2EQ8 A;  3LOV A;  2YLX A;  3M12 A;  2CDU A;  2DKI A;  2Q0K A;  4H50 A;  3L1R A;  4U8N A;  2WEU A;  2WOI A;  3DGH A;  3L8K A;  2GF3 A;  3P4Q A;  5FS6 A;  1K0I A;  3G5Q A;  3AEG A;  4YKF A;  1F6M A;  3K30 A;  2WDQ A;  2XFP A;  3F8D A;  2JAE A;  4NEW A;  1VG0 A;  4USQ A;  1NG4 A;  2JB3 A;  3LZW A;  1PBC A;  3CGD A;  4OCG A;  1O95 A;  2YLR A;  1DJQ A;  1HYU A;  3CNS A;  3Q6J A;  3QVP A;  1NEN A;  3DK8 A;  1NDA A;  4JQ9 A;  1KSU A;  1LVL A;  2JKC A;  3IHG A;  5CKU A;  2GMH A;  5ER0 A;  1DNC A;  1DOD A;  4CCQ A;  5HYM A;  1E1L A;  1GTH A;  3AE8 A;  1GRF A;  4C5O A;  2C7G A;  1BGN A;  3G5S A;  4XWZ A;  4JDR A;  4B67 A;  4UDP A;  4B66 A;  4LII A;  4H4P A;  5EBK A;  4AOX A;  4ADW A;  1E1K A;  3IWA A;  1FOH A;  2OLN A;  4YWO A;  2R9Z A;  1DJN A;  3AXB A;  1TDE A;  2XCG A;  1W4X A;  2GB0 A;  2OAL A;  1FEA A;  5M0Z A;  3FMW A;  3Q9T A;  1XHC A;  4J57 A;  4E0V A;  3NH3 X;  3QSE A;  2X8G A;  4RSL A;  1E7P A;  2W0H A;  4J2W A;  3V3O A;  2GAG B;  5LV9 A;  3UKF A;  4A99 A;  4OPT A;  1ZKQ A;  1H6V A;  1Y0P A;  1H86 A;  1TYT A;  1E39 A;  5C2T A;  2TPR A;  3P4P A;  3PVC A;  1L9E A;  3NRN A; 
#chains in the Genus database with same CATH topology
 3AD7 B;  2EQ9 A;  2BA9 A;  1CJ2 A;  3LZX A;  4YSX A;  1H84 A;  1VQW A;  4H2R A;  4H2N A;  1YY5 A;  2AR8 A;  4Z2T A;  1D4E A;  4IVM B;  3ABV A;  1VG9 A;  2XLU A;  3BI5 A;  4II2 A;  4BK3 A;  4G74 A;  3GD4 A;  3NTA A;  1EBD A;  4GF7 A;  5JCN A;  1ZX9 A;  4G6H A;  1VDC A;  4Z25 A;  1BF3 A;  2YG6 A;  2E5V A;  1PBE A;  3OC4 A;  4BV6 A;  1QLB A;  1V59 A;  4J36 A;  2B9Y A;  2YLW A;  1DOE A;  3QSM A;  1OJT A;  4H2P A;  2ZZ0 A;  3BNM A;  4H4X A;  3SXI A;  4A6N A;  4G6G A;  2ARD A;  2GH5 A;  2C75 A;  2XDO A;  1E6E A;  4EM4 A;  3CGB A;  4GCM A;  1TYP A;  1UKV G;  2Z5X A;  4IV9 A;  4EIP A;  4GUV A;  2GRT A;  4YTN A;  4N9X A;  1AOG A;  3NK2 X;  4U8O A;  3UP5 A;  2YM2 A;  1N1P A;  2BRY A;  1GAL A;  2C64 A;  4Y4L A;  4A6N B;  3RP8 A;  3O0H A;  3UKH A;  3AWI A;  1F8R A;  1GXF A;  1LQU A;  2VVL G;  4J56 A;  5KMR A;  3UKP A;  4YSY A;  2UZZ A;  1CJC A;  4B1B A;  3SZW A;  4Z24 A;  3SFE A;  4ZN0 A;  2B7R A;  4EQX A;  5KMP A;  1IUV A;  2XLP A;  2RGJ A;  3EAO A;  1X31 B;  2Y6R A;  5EB5 A;  1TDF A;  2GQW A;  3IC9 A;  3SZC A;  2FJA A;  2GQF A;  1PXC A;  3AEB A;  3C4N A;  1FEC A;  1NHQ A;  1ZMD A;  1LV0 A;  2WPE A;  4C3X A;  4U8M A;  3C4A A;  3CND A;  4UDR A;  5CQF A;  3AB1 A;  3NK0 X;  3NHO X;  2XVH A;  1N4V A;  1MXT A;  1OJC A;  2C65 A;  2VQB A;  2C66 A;  4JY2 A;  2V3B A;  2XLT A;  2E4G A;  4RG4 A;  2Y6Q A;  1YQ3 A;  1D4D A;  1GRE A;  1CC2 A;  2H88 A;  1MOK A;  2WES A;  2XYO A;  4YXD A;  2XLR A;  1D7Y A;  1H7W A;  1ZP0 A;  5C3J A;  3AE7 A;  1Y56 A;  4ICY A;  3ICS A;  1LJ1 A;  1KDG A;  1CC6 A;  2JBV A;  1D5T A;  4U8P A;  1GET A;  3E1T A;  1K4Q A;  2YVG A;  4U8I A;  5FS7 A;  2QCU A;  2Q6U A;  2GV8 A;  4IVO B;  2CUL A;  2YG3 A;  4H4S A;  5HY5 A;  1GSN A;  2FBW A;  2PHH A;  1JRX A;  3AED A;  4G73 A;  5U25 A;  4I58 A;  5BUK A;  5KNL A;  4TLZ A;  1LTX R;  2YG4 A;  2YLT A;  3CPJ G;  3GMB A;  3DME A;  3NN0 X;  3ZYX A;  1B4V A;  4DSG A;  4B68 A;  4U2L A;  4RG3 A;  3FBS A;  3CMM A;  4OVI A;  1EL5 A;  4BUR A;  2GVC A;  2B9W A;  2BXS A;  5TR3 A;  1Q1R A;  1PJ7 A;  4NNJ A;  2FJE A;  2YLZ A;  4ZCD A;  5EOW A;  1PBD A;  3AE5 A;  1GV4 A;  2A8X A;  3M0O A;  4OPI A;  1VRQ B;  1H81 A;  3UKQ A;  4H2Q A;  3NG7 X;  1BWC A;  4X9M A;  4Z2R A;  1DXL A;  5DBJ A;  3VRB A;  2VZ2 A;  3KKJ A;  2VRL A;  1IJH A;  3ICR A;  2B7S A;  2WOW A;  1KFY A;  2IVD A;  3RP7 A;  4AP1 A;  4ECH A;  1ZK7 A;  1O94 A;  2YR5 A;  1BGJ A;  1GER A;  3ITJ A;  1NHS A;  4CY8 A;  4EMJ A;  1PXB A;  4GRT A;  1QO8 A;  1L0V A;  1NEK A;  1N4U A;  2X50 A;  3CNP A;  1RYI A;  3SQP A;  3S61 A;  3H8L A;  3P9U A;  3ATR A;  1E1N A;  4J34 A;  4LU6 A;  4CRT A;  2GEW A;  2I0Z A;  1OJD A;  2GR0 A;  1E1M A;  3LJP A;  4CY6 A;  2YAU A;  4GAV A;  1Z6L A;  4X4J A;  3LXD A;  4GAP A;  2XVF A;  3AD8 B;  2IID A;  3KA7 A;  1S3B A;  1ZY8 A;  2R0G A;  3BNU A;  1PBB A;  4TM0 A;  4BK2 A;  3I6D A;  4DSH A;  4KPR A;  2R0P A;  1GRG A;  2BAC A;  2C67 A;  2WET A;  1CL0 A;  2WDV A;  1EL7 A;  3DJG X;  3K7Q X;  3T2K A;  3V3N A;  2YG5 A;  3DA1 A;  3PS9 A;  4H7U A;  1GRB A;  4OPG A;  4A9W A;  1XPQ A;  1B37 A;  1REO A;  3NGC X;  3OZ2 A;  4USR A;  1IUW A;  3CPI G;  5HHF A;  3SZF A;  3VR8 A;  4APN A;  2R4E A;  2Q0L A;  2WOV A;  1YKJ A;  3GRT A;  4ZCC A;  1O5W A;  2BC1 A;  4KX6 A;  4A65 A;  1MO9 A;  2TMD A;  4OPL A;  3UKK A;  4YTP A;  3FIM B;  1GRT A;  1D7L A;  1PXA A;  5U63 A;  1ONF A;  2WS3 A;  1NHR A;  4GDE A;  2YVJ A;  5L46 A;  2XFQ A;  4FK1 A;  3GYI A;  3UTE A;  3SGL A;  2RGO A;  1PS9 A;  4JY3 A;  4OPD A;  4EMI A;  1P2E A;  4H4Q A;  2WU5 A;  4A7A A;  1NHP A;  4D03 A;  2WP9 A;  1TDO A;  3BI2 A;  3SYI A;  4CNK A;  4D04 A;  2Z5Y A;  2OLO A;  3RNM A;  1KF6 A;  2VVM A;  3AYI A;  3AEF A;  1TRB A;  2YG7 A;  3GD3 A;  1FEB A;  1COY A;  2R0C A;  3GWF A;  4H4Y A;  4NTC A;  4U8K A;  4WCT A;  5FMH A;  3DJE A;  2A87 A;  3B3R A;  2WPF A;  4NTD A;  2ZZB A;  3NTD A;  4H4V A;  4HA6 A;  2E1M A;  3B6D A;  5IPY A;  3NYF A;  3UP4 A;  3P4S A;  4IA6 A;  4XXG A;  2BYB A;  2WQY A;  3GWD A;  2OAM A;  1NAA A;  5BUL A;  1TDK A;  4BJZ A;  1F8W A;  1GT8 A;  3GYX A;  4FDC B;  4XWR A;  4PAB A;  1L9D A;  2NVK X;  4EMW A;  3VR9 A;  4B63 A;  1ELI A;  3ICT A;  3P1W A;  2VQ7 A;  3AE4 A;  2YLS A;  1IUX A;  3FPZ A;  2JB2 A;  2O9Z A;  1F8S A;  4J31 A;  5BVA A;  3NKS A;  1H7X A;  5FS9 A;  1ZMC A;  4JNA A;  3HYW A;  3QVR A;  3T14 A;  4I59 A;  1CHU A;  2F5Z A;  3UCL A;  4GR1 A;  3C96 A;  2V3A A;  1BZL A;  2GAH B;  3P4R A;  4M52 A;  3D8X A;  3AYJ A;  2DKH A;  3SY4 A;  2XFU A;  4REK A;  3F8P A;  1JNZ A;  4NEV A;  1GES A;  2R46 A;  2YM1 A;  2XVJ A;  5HXI A;  3BHF A;  1GPE A;  1EL8 A;  1LQT A;  3BHK A;  1FL2 A;  2JB1 A;  1CF3 A;  4JN9 A;  2R45 A;  4K8D A;  3SZ0 A;  4BJY A;  4EQW A;  3NT6 A;  3ALM A;  2VVL A;  3KPK A;  3NIX A;  1B5Q A;  1PJ5 A;  4H4R A;  2B9X A;  3NK1 X;  2XVE A;  4Z26 A;  2AQJ A;  3SM8 A;  4U8J A;  2C73 A;  1JU2 A;  2V60 A;  2B76 A;  3GSI A;  1FCD A;  4C3Y A;  3BI4 A;  3NYE A;  2HQM A;  1BKW A;  3UOY A;  2WPC A;  1Q1W A;  2YR6 A;  3EF6 A;  2BXR A;  1M6I A;  1DOB A;  1S3E A;  3DJD A;  3F8R A;  2BRA A;  3UTF A;  3K7M X;  4TM4 A;  3ADA B;  3CNT A;  3QFB A;  4LA1 A;  5IQ1 A;  4C74 A;  1TDN A;  4OPC A;  3VQR A;  5KOW A;  4Y4N A;  2BAB A;  3AE6 A;  2X8C A;  3ZDN A;  2PYX A;  3JSK A;  4AT0 A;  4AP3 A;  2BK5 A;  5GSN A;  3URH A;  2BCG G;  3KVE A;  2QA2 A;  2VOU A;  2BK4 A;  3RHA A;  4CCR A;  5KXJ A;  4U2T A;  4H4T A;  1ZOV A;  3GDN A;  2GR2 A;  2C3C A;  2V5Z A;  2BC0 A;  1Q9I A;  2EQ7 A;  1IUT A;  2GR3 A;  3SFD A;  4NZH A;  5FS8 A;  2ZZC A;  1S2Y A;  3PO7 A;  4FX9 A;  4EQS A;  2C76 A;  2V6O A;  1H83 A;  1PHH A;  2NPX A;  1GRH A;  2YR4 A;  4CBQ A;  1PJ6 A;  4K7Z A;  3CGC A;  3HYX A;  3QFA A;  1ZDL A;  1OJA A;  4TLX A;  2FJB A;  1QJD A;  2QAE A;  2VRM A;  4EIQ A;  1IUU A;  3GDP A;  4TM1 A;  3ATQ A;  1LPF A;  5KOX A;  5KWF A;  3ISH A;  5KRQ A;  4U2S A;  4EQR A;  2XFN A;  3UKL A;  5JCI A;  3COX A;  3V76 A;  3EPT A;  3LB8 A;  4MJW A;  3CNJ A;  3RED A;  3KU9 A;  5KMQ A;  4H4Z A;  3T2Z A;  2JK6 A;  2QA1 A;  2RGH A;  2A89 A;  2OA1 A;  3G5R A;  2XVI A;  3T2Y A;  4Y4M A;  1K0J A;  3H4K A;  3QJ4 A;  5J7X A;  2WBA A;  4A79 A;  3DGZ A;  4CNJ A;  1JOA A;  1GTE A;  3GYJ A;  1P2H A;  1K0L A;  1KNP A;  5KVI A;  5KVH A;  1ZOY A;  3K7T A;  4PAA A;  1SEZ A;  4TM3 A;  4EM3 A;  2C3D A;  4BK1 A;  2YQU A;  3GMC A;  4YKG A;  1PBF A;  1Y56 B;  4UP3 A;  4C77 A;  4HB9 A;  4Z2U A;  3IHM A;  5JCM A;  3HYV A;  2YVF A;  4GDP A;  1NPX A;  4O5Q A;  3CN8 A;  3RP6 A;  5J60 A;  3AD9 B;  5KMS A;  3DJJ A;  1JRZ A;  1GEU A;  2WP5 A;  3FG2 P;  4Z44 A;  2BS4 A;  3AE2 A;  1CJ3 A;  3QSS A;  1H82 A;  1L9C A;  3H8I A;  3T37 A;  1CBO A;  3AEE A;  1EL9 A;  4K5R A;  4FK1 C;  1JEH A;  3GRS A;  3UOZ A;  5BRT A;  2WU2 A;  3KLJ A;  4YT0 A;  1S2Q A;  2R4J A;  3AE3 A;  3IF9 A;  3KPF A;  2WDR A;  1KNR A;  2XLS A;  1N4W A;  1PDH A;  3DK9 A;  1XDI A;  1GND A;  2Q7V A;  2J3N A;  2BCP A;  3NLC A;  4B64 A;  1OJ9 A;  3NYC A;  1IUS A;  4JNQ A;  1CJ4 A;  2X8H A;  5JCK A;  2X3N A;  1D4C A;  1NG3 A;  3UOX A;  4AT2 A;  5M10 A;  1JNR A;  2ACZ A;  3EAN A;  4O5U A;  3HZL A;  5IQ4 A;  1JRY A;  2WP6 A;  4H4U A;  4X9N A;  4YSZ A;  5GRT A;  1RSG A;  2EQ6 A;  1DOC A;  2GR1 A;  2WHD A;  4DGK A;  1GRA A;  1KSS A;  3UTG A;  3DH9 A;  3CIR A;  4G9K A;  2FJD A;  3AE1 A;  1YQ4 A;  4B69 A;  3S5W A;  3CGE A;  3I3L A;  3NNE A;  5JCL A;  2CVJ A;  3WE0 A;  3D1C A;  2AAQ A;  2C72 A;  4IA5 A;  2CFY A;  5U1O A;  1M64 A;  3AEC A;  4K5S A;  3M13 A;  4K2X A;  4DNA A;  1PN0 A;  4YSH A;  3VRD B;  4UDQ A;  4P9S A;  1F3P A;  1RP0 A;  1CC4 A;  2BS3 A;  3ALJ A;  3CPH G;  3R9U A;  3II4 A;  3CTY A;  2XFO A;  4OPU A;  5EB4 A;  2YWL A;  4NTE A;  1XAN A;  3UTH A;  2BK3 A;  2H89 A;  1B8S A;  4H4W A;  2APG A;  2V61 A;  2ZBW A;  4WX1 A;  4J33 A;  4Z43 A;  4B65 A;  4A5L A;  2C4C A;  2RAB A;  1GOS A;  3AE9 A;  3AEA A;  4K22 A;  4YTM A;  3NN6 X;  4AOS A;  3AYL A;  3LAD A;  2X99 A;  1YQZ A;  2GMJ A;  3UKA A;  3DK4 A;  3ALL A;  3UOV A;  4U8L A;  2BS2 A;  2C70 A;  3VRA A;  3KD9 A;  2IVE A;  2EQ8 A;  3LOV A;  2YLX A;  3M12 A;  2CDU A;  2DKI A;  2Q0K A;  4H50 A;  3L1R A;  4U8N A;  2WEU A;  2WOI A;  3DGH A;  3L8K A;  2GF3 A;  3P4Q A;  5FS6 A;  1K0I A;  3G5Q A;  3AEG A;  4YKF A;  1F6M A;  3K30 A;  2WDQ A;  2XFP A;  3F8D A;  2JAE A;  4NEW A;  3SX6 A;  1VG0 A;  4USQ A;  1NG4 A;  2JB3 A;  3LZW A;  1PBC A;  3CGD A;  4OCG A;  1O95 A;  2YLR A;  1DJQ A;  1HYU A;  3CNS A;  3Q6J A;  3QVP A;  1NEN A;  3DK8 A;  1NDA A;  4JQ9 A;  1KSU A;  1LVL A;  2JKC A;  3IHG A;  5CKU A;  2GMH A;  5ER0 A;  1DNC A;  1DOD A;  4CCQ A;  5HYM A;  1E1L A;  1GTH A;  3AE8 A;  1GRF A;  4C5O A;  3T31 A;  2C7G A;  1BGN A;  3G5S A;  4XWZ A;  4JDR A;  4B67 A;  4UDP A;  4B66 A;  4LII A;  4H4P A;  5EBK A;  4AOX A;  4ADW A;  1E1K A;  3IWA A;  1FOH A;  2OLN A;  4YWO A;  2R9Z A;  1DJN A;  3AXB A;  1TDE A;  2XCG A;  1W4X A;  2GB0 A;  2OAL A;  1FEA A;  5M0Z A;  3FMW A;  3Q9T A;  1XHC A;  4J57 A;  4E0V A;  4NWZ A;  3NH3 X;  3QSE A;  2X8G A;  4RSL A;  1E7P A;  2W0H A;  4J2W A;  3V3O A;  2GAG B;  5LV9 A;  3UKF A;  4A99 A;  4OPT A;  1ZKQ A;  1H6V A;  1Y0P A;  3T0K A;  1H86 A;  1TYT A;  1E39 A;  5C2T A;  4II3 A;  2TPR A;  3P4P A;  3PVC A;  1L9E A;  3NRN A; 
#chains in the Genus database with same CATH homology
 3AD7 B;  2EQ9 A;  2BA9 A;  1CJ2 A;  3LZX A;  4YSX A;  1H84 A;  1VQW A;  4H2R A;  4H2N A;  1YY5 A;  2AR8 A;  4Z2T A;  1D4E A;  4IVM B;  3ABV A;  1VG9 A;  2XLU A;  3BI5 A;  4II2 A;  4BK3 A;  4G74 A;  3GD4 A;  3NTA A;  1EBD A;  4GF7 A;  5JCN A;  1ZX9 A;  4G6H A;  1VDC A;  4Z25 A;  1BF3 A;  2YG6 A;  2E5V A;  1PBE A;  3OC4 A;  4BV6 A;  1QLB A;  1V59 A;  4J36 A;  2B9Y A;  2YLW A;  1DOE A;  3QSM A;  1OJT A;  4H2P A;  2ZZ0 A;  3BNM A;  4H4X A;  3SXI A;  4A6N A;  4G6G A;  2ARD A;  2GH5 A;  2C75 A;  2XDO A;  1E6E A;  4EM4 A;  3CGB A;  4GCM A;  1TYP A;  1UKV G;  2Z5X A;  4IV9 A;  4EIP A;  4GUV A;  2GRT A;  4YTN A;  4N9X A;  1AOG A;  3NK2 X;  4U8O A;  3UP5 A;  2YM2 A;  1N1P A;  2BRY A;  1GAL A;  2C64 A;  4Y4L A;  4A6N B;  3RP8 A;  3O0H A;  3UKH A;  3AWI A;  1F8R A;  1GXF A;  1LQU A;  2VVL G;  4J56 A;  5KMR A;  3UKP A;  4YSY A;  2UZZ A;  1CJC A;  4B1B A;  3SZW A;  4Z24 A;  3SFE A;  4ZN0 A;  2B7R A;  4EQX A;  5KMP A;  1IUV A;  2XLP A;  2RGJ A;  3EAO A;  1X31 B;  2Y6R A;  5EB5 A;  1TDF A;  2GQW A;  3IC9 A;  3SZC A;  2FJA A;  2GQF A;  1PXC A;  3AEB A;  3C4N A;  1FEC A;  1NHQ A;  1ZMD A;  1LV0 A;  2WPE A;  4C3X A;  4U8M A;  3C4A A;  3CND A;  4UDR A;  5CQF A;  3AB1 A;  3NK0 X;  3NHO X;  2XVH A;  1N4V A;  1MXT A;  1OJC A;  2C65 A;  2VQB A;  2C66 A;  4JY2 A;  2V3B A;  2XLT A;  2E4G A;  4RG4 A;  2Y6Q A;  1YQ3 A;  1D4D A;  1GRE A;  1CC2 A;  2H88 A;  1MOK A;  2WES A;  2XYO A;  4YXD A;  2XLR A;  1D7Y A;  1H7W A;  1ZP0 A;  5C3J A;  3AE7 A;  1Y56 A;  4ICY A;  3ICS A;  1LJ1 A;  1KDG A;  1CC6 A;  2JBV A;  1D5T A;  4U8P A;  1GET A;  3E1T A;  1K4Q A;  2YVG A;  4U8I A;  5FS7 A;  2QCU A;  2Q6U A;  2GV8 A;  4IVO B;  2CUL A;  2YG3 A;  4H4S A;  5HY5 A;  1GSN A;  2FBW A;  2PHH A;  1JRX A;  3AED A;  4G73 A;  5U25 A;  4I58 A;  5BUK A;  5KNL A;  4TLZ A;  1LTX R;  2YG4 A;  2YLT A;  3CPJ G;  3GMB A;  3DME A;  3NN0 X;  3ZYX A;  1B4V A;  4DSG A;  4B68 A;  4U2L A;  4RG3 A;  3FBS A;  3CMM A;  4OVI A;  1EL5 A;  4BUR A;  2GVC A;  2B9W A;  2BXS A;  5TR3 A;  1Q1R A;  1PJ7 A;  4NNJ A;  2FJE A;  2YLZ A;  4ZCD A;  5EOW A;  1PBD A;  3AE5 A;  1GV4 A;  2A8X A;  3M0O A;  4OPI A;  1VRQ B;  1H81 A;  3UKQ A;  4H2Q A;  3NG7 X;  1BWC A;  4X9M A;  4Z2R A;  1DXL A;  5DBJ A;  3VRB A;  2VZ2 A;  3KKJ A;  2VRL A;  1IJH A;  3ICR A;  2B7S A;  2WOW A;  1KFY A;  2IVD A;  3RP7 A;  4AP1 A;  4ECH A;  1ZK7 A;  1O94 A;  2YR5 A;  1BGJ A;  1GER A;  3ITJ A;  1NHS A;  4CY8 A;  4EMJ A;  1PXB A;  4GRT A;  1QO8 A;  1L0V A;  1NEK A;  1N4U A;  2X50 A;  3CNP A;  1RYI A;  3SQP A;  3S61 A;  3H8L A;  3P9U A;  3ATR A;  1E1N A;  4J34 A;  4LU6 A;  4CRT A;  2GEW A;  2I0Z A;  1OJD A;  2GR0 A;  1E1M A;  3LJP A;  4CY6 A;  2YAU A;  4GAV A;  1Z6L A;  4X4J A;  3LXD A;  4GAP A;  2XVF A;  3AD8 B;  2IID A;  3KA7 A;  1S3B A;  1ZY8 A;  2R0G A;  3BNU A;  1PBB A;  4TM0 A;  4BK2 A;  3I6D A;  4DSH A;  4KPR A;  2R0P A;  1GRG A;  2BAC A;  2C67 A;  2WET A;  1CL0 A;  2WDV A;  1EL7 A;  3DJG X;  3K7Q X;  3T2K A;  3V3N A;  2YG5 A;  3DA1 A;  3PS9 A;  4H7U A;  1GRB A;  4OPG A;  4A9W A;  1XPQ A;  1B37 A;  1REO A;  3NGC X;  3OZ2 A;  4USR A;  1IUW A;  3CPI G;  5HHF A;  3SZF A;  3VR8 A;  4APN A;  2R4E A;  2Q0L A;  2WOV A;  1YKJ A;  3GRT A;  4ZCC A;  1O5W A;  2BC1 A;  4KX6 A;  4A65 A;  1MO9 A;  2TMD A;  4OPL A;  3UKK A;  4YTP A;  3FIM B;  1GRT A;  1D7L A;  1PXA A;  5U63 A;  1ONF A;  2WS3 A;  1NHR A;  4GDE A;  2YVJ A;  5L46 A;  2XFQ A;  4FK1 A;  3GYI A;  3UTE A;  3SGL A;  2RGO A;  1PS9 A;  4JY3 A;  4OPD A;  4EMI A;  1P2E A;  4H4Q A;  2WU5 A;  4A7A A;  1NHP A;  4D03 A;  2WP9 A;  1TDO A;  3BI2 A;  3SYI A;  4CNK A;  4D04 A;  2Z5Y A;  2OLO A;  3RNM A;  1KF6 A;  2VVM A;  3AYI A;  3AEF A;  1TRB A;  2YG7 A;  3GD3 A;  1FEB A;  1COY A;  2R0C A;  3GWF A;  4H4Y A;  4NTC A;  4U8K A;  4WCT A;  5FMH A;  3DJE A;  2A87 A;  3B3R A;  2WPF A;  4NTD A;  2ZZB A;  3NTD A;  4H4V A;  4HA6 A;  2E1M A;  3B6D A;  5IPY A;  3NYF A;  3UP4 A;  3P4S A;  4IA6 A;  4XXG A;  2BYB A;  2WQY A;  3GWD A;  2OAM A;  1NAA A;  5BUL A;  1TDK A;  4BJZ A;  1F8W A;  1GT8 A;  3GYX A;  4FDC B;  4XWR A;  4PAB A;  1L9D A;  2NVK X;  4EMW A;  3VR9 A;  4B63 A;  1ELI A;  3ICT A;  3P1W A;  2VQ7 A;  3AE4 A;  2YLS A;  1IUX A;  3FPZ A;  2JB2 A;  2O9Z A;  1F8S A;  4J31 A;  5BVA A;  3NKS A;  1H7X A;  5FS9 A;  1ZMC A;  4JNA A;  3HYW A;  3QVR A;  3T14 A;  4I59 A;  1CHU A;  2F5Z A;  3UCL A;  4GR1 A;  3C96 A;  2V3A A;  1BZL A;  2GAH B;  3P4R A;  4M52 A;  3D8X A;  3AYJ A;  2DKH A;  3SY4 A;  2XFU A;  4REK A;  3F8P A;  1JNZ A;  4NEV A;  1GES A;  2R46 A;  2YM1 A;  2XVJ A;  5HXI A;  3BHF A;  1GPE A;  1EL8 A;  1LQT A;  3BHK A;  1FL2 A;  2JB1 A;  1CF3 A;  4JN9 A;  2R45 A;  4K8D A;  3SZ0 A;  4BJY A;  4EQW A;  3NT6 A;  3ALM A;  2VVL A;  3KPK A;  3NIX A;  1B5Q A;  1PJ5 A;  4H4R A;  2B9X A;  3NK1 X;  2XVE A;  4Z26 A;  2AQJ A;  3SM8 A;  4U8J A;  2C73 A;  1JU2 A;  2V60 A;  2B76 A;  3GSI A;  1FCD A;  4C3Y A;  3BI4 A;  3NYE A;  2HQM A;  1BKW A;  3UOY A;  2WPC A;  1Q1W A;  2YR6 A;  3EF6 A;  2BXR A;  1M6I A;  1DOB A;  1S3E A;  3DJD A;  3F8R A;  2BRA A;  3UTF A;  3K7M X;  4TM4 A;  3ADA B;  3CNT A;  3QFB A;  4LA1 A;  5IQ1 A;  4C74 A;  1TDN A;  4OPC A;  3VQR A;  5KOW A;  4Y4N A;  2BAB A;  3AE6 A;  2X8C A;  3ZDN A;  2PYX A;  3JSK A;  4AT0 A;  4AP3 A;  2BK5 A;  5GSN A;  3URH A;  2BCG G;  3KVE A;  2QA2 A;  2VOU A;  2BK4 A;  3RHA A;  4CCR A;  5KXJ A;  4U2T A;  4H4T A;  1ZOV A;  3GDN A;  2GR2 A;  2C3C A;  2V5Z A;  2BC0 A;  1Q9I A;  2EQ7 A;  1IUT A;  2GR3 A;  3SFD A;  4NZH A;  5FS8 A;  2ZZC A;  1S2Y A;  3PO7 A;  4FX9 A;  4EQS A;  2C76 A;  2V6O A;  1H83 A;  1PHH A;  2NPX A;  1GRH A;  2YR4 A;  4CBQ A;  1PJ6 A;  4K7Z A;  3CGC A;  3HYX A;  3QFA A;  1ZDL A;  1OJA A;  4TLX A;  2FJB A;  1QJD A;  2QAE A;  2VRM A;  4EIQ A;  1IUU A;  3GDP A;  4TM1 A;  3ATQ A;  1LPF A;  5KOX A;  5KWF A;  3ISH A;  5KRQ A;  4U2S A;  4EQR A;  2XFN A;  3UKL A;  5JCI A;  3COX A;  3V76 A;  3EPT A;  3LB8 A;  4MJW A;  3CNJ A;  3RED A;  3KU9 A;  5KMQ A;  4H4Z A;  3T2Z A;  2JK6 A;  2QA1 A;  2RGH A;  2A89 A;  2OA1 A;  3G5R A;  2XVI A;  3T2Y A;  4Y4M A;  1K0J A;  3H4K A;  3QJ4 A;  5J7X A;  2WBA A;  4A79 A;  3DGZ A;  4CNJ A;  1JOA A;  1GTE A;  3GYJ A;  1P2H A;  1K0L A;  1KNP A;  5KVI A;  5KVH A;  1ZOY A;  3K7T A;  4PAA A;  1SEZ A;  4TM3 A;  4EM3 A;  2C3D A;  4BK1 A;  2YQU A;  3GMC A;  4YKG A;  1PBF A;  1Y56 B;  4UP3 A;  4C77 A;  4HB9 A;  4Z2U A;  3IHM A;  5JCM A;  3HYV A;  2YVF A;  4GDP A;  1NPX A;  4O5Q A;  3CN8 A;  3RP6 A;  5J60 A;  3AD9 B;  5KMS A;  3DJJ A;  1JRZ A;  1GEU A;  2WP5 A;  3FG2 P;  4Z44 A;  2BS4 A;  3AE2 A;  1CJ3 A;  3QSS A;  1H82 A;  1L9C A;  3H8I A;  3T37 A;  1CBO A;  3AEE A;  1EL9 A;  4K5R A;  4FK1 C;  1JEH A;  3GRS A;  3UOZ A;  5BRT A;  2WU2 A;  3KLJ A;  4YT0 A;  1S2Q A;  2R4J A;  3AE3 A;  3IF9 A;  3KPF A;  2WDR A;  1KNR A;  2XLS A;  1N4W A;  1PDH A;  3DK9 A;  1XDI A;  1GND A;  2Q7V A;  2J3N A;  2BCP A;  3NLC A;  4B64 A;  1OJ9 A;  3NYC A;  1IUS A;  4JNQ A;  1CJ4 A;  2X8H A;  5JCK A;  2X3N A;  1D4C A;  1NG3 A;  3UOX A;  4AT2 A;  5M10 A;  1JNR A;  2ACZ A;  3EAN A;  4O5U A;  3HZL A;  5IQ4 A;  1JRY A;  2WP6 A;  4H4U A;  4X9N A;  4YSZ A;  5GRT A;  1RSG A;  2EQ6 A;  1DOC A;  2GR1 A;  2WHD A;  4DGK A;  1GRA A;  1KSS A;  3UTG A;  3DH9 A;  3CIR A;  4G9K A;  2FJD A;  3AE1 A;  1YQ4 A;  4B69 A;  3S5W A;  3CGE A;  3I3L A;  3NNE A;  5JCL A;  2CVJ A;  3WE0 A;  3D1C A;  2AAQ A;  2C72 A;  4IA5 A;  2CFY A;  5U1O A;  1M64 A;  3AEC A;  4K5S A;  3M13 A;  4K2X A;  4DNA A;  1PN0 A;  4YSH A;  3VRD B;  4UDQ A;  4P9S A;  1F3P A;  1RP0 A;  1CC4 A;  2BS3 A;  3ALJ A;  3CPH G;  3R9U A;  3II4 A;  3CTY A;  2XFO A;  4OPU A;  5EB4 A;  2YWL A;  4NTE A;  1XAN A;  3UTH A;  2BK3 A;  2H89 A;  1B8S A;  4H4W A;  2APG A;  2V61 A;  2ZBW A;  4WX1 A;  4J33 A;  4Z43 A;  4B65 A;  4A5L A;  2C4C A;  2RAB A;  1GOS A;  3AE9 A;  3AEA A;  4K22 A;  4YTM A;  3NN6 X;  4AOS A;  3AYL A;  3LAD A;  2X99 A;  1YQZ A;  2GMJ A;  3UKA A;  3DK4 A;  3ALL A;  3UOV A;  4U8L A;  2BS2 A;  2C70 A;  3VRA A;  3KD9 A;  2IVE A;  2EQ8 A;  3LOV A;  2YLX A;  3M12 A;  2CDU A;  2DKI A;  2Q0K A;  4H50 A;  3L1R A;  4U8N A;  2WEU A;  2WOI A;  3DGH A;  3L8K A;  2GF3 A;  3P4Q A;  5FS6 A;  1K0I A;  3G5Q A;  3AEG A;  4YKF A;  1F6M A;  3K30 A;  2WDQ A;  2XFP A;  3F8D A;  2JAE A;  4NEW A;  3SX6 A;  1VG0 A;  4USQ A;  1NG4 A;  2JB3 A;  3LZW A;  1PBC A;  3CGD A;  4OCG A;  1O95 A;  2YLR A;  1DJQ A;  1HYU A;  3CNS A;  3Q6J A;  3QVP A;  1NEN A;  3DK8 A;  1NDA A;  4JQ9 A;  1KSU A;  1LVL A;  2JKC A;  3IHG A;  5CKU A;  2GMH A;  5ER0 A;  1DNC A;  1DOD A;  4CCQ A;  5HYM A;  1E1L A;  1GTH A;  3AE8 A;  1GRF A;  4C5O A;  3T31 A;  2C7G A;  1BGN A;  3G5S A;  4XWZ A;  4JDR A;  4B67 A;  4UDP A;  4B66 A;  4LII A;  4H4P A;  5EBK A;  4AOX A;  4ADW A;  1E1K A;  3IWA A;  1FOH A;  2OLN A;  4YWO A;  2R9Z A;  1DJN A;  3AXB A;  1TDE A;  2XCG A;  1W4X A;  2GB0 A;  2OAL A;  1FEA A;  5M0Z A;  3FMW A;  3Q9T A;  1XHC A;  4J57 A;  4E0V A;  4NWZ A;  3NH3 X;  3QSE A;  2X8G A;  4RSL A;  1E7P A;  2W0H A;  4J2W A;  3V3O A;  2GAG B;  5LV9 A;  3UKF A;  4A99 A;  4OPT A;  1ZKQ A;  1H6V A;  1Y0P A;  3T0K A;  1H86 A;  1TYT A;  1E39 A;  5C2T A;  4II3 A;  2TPR A;  3P4P A;  3PVC A;  1L9E A;  3NRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...