4FK1C

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
298
Chain Sequence
YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
molecule keywords Putative thioredoxin reductase
total genus 89
structure length 298
sequence length 299
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C02
2Z5YA 3P1WA 1N4UA 3NHOX 2WP9A 4TM1A 4U8LA 4I59A 1BKWA 2GQFA 2WOWA 4U2LA 1H86A 3V76A 1E39A 1PJ7A 1EL8A 1GTHA 5GSNA 1OJAA 3AEGA 2FJAA 2FJDA 1MO9A 3GYJA 4DGKA 2Q7VA 1GESA 3HZLA 4CBQA 1GERA 1GNDA 1EL5A 4MJWA 3EPTA 1XDIA 1RP0A 2V3AA 3KVEA 4OPIA 2VRMA 1V59A 4U8PA 3FMWA 4XWRA 4YWOA 5HXIA 1YQZA 4HA6A 2JKCA 1O95A 3GWDA 4K7ZA 2XVEA 1O5WA 2XFQA 2XLSA 4X9NA 2YLSA 1B37A 1CF3A 2EQ8A 3EAOA 1P2EA 2YWLA 3GMBA 3UTHA 2C72A 1Q9IA 5HY5A 5ER0A 4A7AA 1AOGA 3UP4A 2XVJA 4DSHA 2C66A 1ZX9A 1GT8A 1JRXA 4A5LA 2B9XA 4H4YA 3BNUA 5FMHA 2YVGA 3V3NA 1NG4A 2GAHB 3AE9A 3SM8A 1EL7A 2BC0A 2E1MA 5U63A 3GD3A 1KF6A 1TYPA 3ABVA 3CIRA 4K2XA 4LIIA 2C7GA 2C3DA 4M52A 4AOSA 2VQ7A 2OLNA 4ZCDA 3GDNA 3AYLA 3LADA 4YT0A 1H81A 3QSEA 4OPLA 3C96A 5TR3A 2HQMA 5EOWA 2IIDA 4H4QA 4OVIA 1XHCA 2BK3A 3H4KA 2R4JA 1IUWA 2V61A 3CTYA 4Z2UA 3D8XA 4EIPA 4REKA 4EM4A 4A99A 4BK2A 3AEDA 4NEWA 3NIXA 2EQ7A 2XFNA 4PABA 3AXBA 1LV0A 1TDEA 1S2YA 4ADWA 4C3YA 1JOAA 1JU2A 1GRBA 4AT2A 1N1PA 1ZK7A 4EQXA 4B1BA 2WDVA 2C67A 3M0OA 2GVCA 3Q6JA 4B68A 3UTFA 1L9DA 3EANA 2X8HA 2R45A 3COXA 4N9XA 3WE0A 1CL0A 1REOA 4BK3A 3KPFA 3C4NA 3GD4A 2Z5XA 1TYTA 5CQFA 2VVMA 4BJZA 3ATRA 4LA1A 2E5VA 2YM2A 2ZZBA 4D04A 3GRTA 1M64A 4FK1A 3BI5A 2GH5A 4EQRA 2RGHA 4NTDA 4CNKA 2Y6RA 1W4XA 2V5ZA 1OJ9A 1LTXR 1EL9A 4UP3A 1K4QA 4C74A 5KOWA 1YQ4A 5EBKA 3H8LA 3RP7A 1CC6A 3GDPA 2WDRA 2GEWA 3IC9A 2V6OA 2X8GA 2X99A 4EM3A 1ZOVA 1VQWA 4J31A 3AE2A 2VVLG 3CGDA 3SGLA 3VRAA 2C73A 2Q0KA 1GPEA 4IVOB 5KVHA 1SEZA 1HYUA 4GDEA 1NHQA 4CRTA 1NHPA 2VRLA 4PAAA 1N4VA 1DOBA 1GTEA 2CVJA 4RG3A 1QJDA 1LJ1A 3VR8A 4CCQA 5HYMA 2Q6UA 2C65A 3IF9A 3UP5A 5BULA 3QJ4A 5LV9A 1E1NA 3OZ2A 3H8IA 2AQJA 2QA1A 1GREA 4B65A 2OAMA 2C3CA 1OJCA 2FJBA 2A8XA 2GMJA 3B6DA 3QVPA 4H4XA 2XFPA 2PHHA 2BABA 3GRSA 2YG7A 3QFBA 4YXDA 4TM0A 2CDUA 1YKJA 1EBDA 5HHFA 4IA6A 5C3JA 2R0PA 1LQUA 3AE1A 1E1KA 3FG2P 1GRTA 4DNAA 3BNMA 1GRHA 4WX1A 4NTEA 1PS9A 4USRA 4CY8A 4EQSA 1H7WA 2XDOA 1IUTA 3UKLA 2VOUA 4UDPA 4YSZA 1LPFA 4J2WA 3S61A 2V60A 3UKFA 1NHRA 3DJEA 1PJ5A 3AEBA 4C77A 3M13A 3ZYXA 2WQYA 4EMWA 3K7MX 2B7RA 3UCLA 1CJ4A 3AD7B 2WP6A 2GQWA 1IUUA 3DJGX 4H50A 4A9WA 2A87A 2ZBWA 1ZP0A 2YR6A 2VZ2A 3K7QX 1YQ3A 4JY3A 4CNJA 4H2NA 4KX6A 4Z43A 2VQBA 2BS2A 3NK0X 3NRNA 4GCMA 2JB3A 1K0IA 4NEVA 4FDCB 1CC2A 2UZZA 3CGEA 3ISHA 3KKJA 5KXJA 4J34A 2WEUA 4GUVA 4U8IA 3NG7X 3SFEA 1CHUA 1PXBA 1FL2A 1S3BA 2B7SA 4USQA 2YG3A 4UDRA 5M10A 1FOHA 3REDA 4H7UA 5FS7A 3ICSA 1D7YA 4CY6A 2ACZA 1ZMCA 3GYIA 3AE5A 3AE3A 3P9UA 1K0JA 3L8KA 4U8MA 4A6NA 3NN0X 4Y4NA 2BCPA 3VRDB 1GEUA 3QSMA 1UKVG 1GXFA 2YG6A 1DOEA 3NYFA 1NDAA 3UKAA 3AD9B 2XVFA 1FEBA 1PJ6A 2ZZ0A 4YKFA 4I58A 1D5TA 3CNPA 1ZOYA 1GRGA 2BXRA 2I0ZA 2EQ6A 3P4RA 3JSKA 5KRQA 2GR0A 4XXGA 2C75A 2EQ9A 2B9WA 4NTCA 1E6EA 1PDHA 3CGCA 3D1CA 2YQUA 4J57A 1IUXA 3F8DA 5FS6A 3RP8A 5JCIA 5L46A 4K8DA 3UTEA 4TM4A 3UKPA 2GB0A 2BK4A 2XFOA 2RGJA 1D7LA 1XANA 3DK4A 4X4JA 2GV8A 3ALJA 4APNA 3IHMA 2GF3A 4YSXA 4KPRA 1F8WA 1KSSA 4YTNA 1VG0A 3I3LA 1DJNA 4B67A 4C3XA 5IPYA 3AWIA 4OPTA 3KU9A 5C2TA 4H4ZA 4H4RA 3CNJA 2QCUA 2YVJA 2C70A 4Z24A 1CC4A 3G5RA 4NZHA 2DKIA 3NYCA 4AP1A 2WPCA 3L1RA 1ZY8A 2FJEA 1L0VA 2BC1A 4BK1A 2B9YA 1ZDLA 4OPDA 4Y4LA 2Q0LA 5EB4A 1Q1RA 1BGNA 1CJCA 3UOXA 4YSHA 1D4DA 3NNEA 2WETA 4TLZA 1DJQA 3QSSA 4H2QA 1F8RA 5DBJA 3NT6A 4OPUA 3P4SA 4E0VA 3KD9A 3CN8A 4K22A 3UOYA 1GRFA 3LJPA 4U2TA 4BJYA 4OCGA 3AECA 1QO8A 1VRQB 1VG9A 3AEFA 3K30A 3LZXA 4K5SA 2R0CA 4P9SA 3ZDNA 4WCTA 3NTAA 2QA2A 4IA5A 3AB1A 4ICYA 3PVCA 2C76A 2QAEA 4EIQA 5KOXA 2WU5A 2DKHA 3ICRA 4J33A 3B3RA 2GR2A 3R9UA 4JN9A 4YTPA 3G5QA 3NGCX 2YLXA 2JAEA 3IWAA 1GALA 2OALA 1KSUA 2BS4A 3M12A 4B69A 3CGBA 1ZKQA 2F5ZA 4JNQA 2YG4A 4Y4MA 3DGHA 1PN0A 1F8SA 3AE8A 1GSNA 1Q1WA 2XVHA 3NK1X 4U8JA 2YLRA 1MOKA 3NYEA 3AE7A 4EMJA 1TDKA 1KFYA 3URHA 4GF7A 3SQPA 3DJDA 4GRTA 4U8KA 3AYIA 1FECA 3CNTA 2XYOA 2YVFA 2BA9A 2OA1A 4H4SA 5JCLA 2X3NA 1FEAA 1NEKA 1YY5A 4CCRA 3BHKA 2R4EA 3FBSA 3OC4A 3AEAA 4GDPA 1D4EA 3BI2A 4J56A 1BWCA 2C64A 3NH3X 3K7TA 2BACA 2J3NA 1Y0PA 2WP5A 4RG4A 2WBAA 3ITJA 2R46A 5CKUA 5IQ4A 1IUVA 1F3PA 4FK1C 3GMCA 2BXSA 1CBOA 5JCKA 1FCDA 1LVLA 4AT0A 1XPQA 2YR4A 3CPHG 4C5OA 5M0ZA 1S2QA 2YLZA 1E7PA 3DA1A 1GRAA 3NK2X 2JK6A 3AD8B 4IV9A 3VRBA 4RSLA 2WHDA 4FX9A 2V3BA 2AR8A 2GR3A 1H83A 1JNRA 1O94A 4ZCCA 2X8CA 2YR5A 2XFUA 1PBEA 1NG3A 2NPXA 3FIMB 4TM3A 3DJJA 2YAUA 2JB1A 1PHHA 2GR1A 1JNZA 2H88A 3CNSA 1PXAA 1M6IA 4OPGA 3LB8A 4H4PA 1VDCA 3RHAA 4H2RA 1PBBA 5U1OA 2XLRA 3S5WA 2AAQA 2CFYA 2WS3A 1PBFA 1QLBA 3DH9A 5JCNA 1BF3A 4U8OA 1K0LA 4Z2TA 3F8PA 3QVRA 4OPCA 3QFAA 3ALLA 1CJ2A 2YLTA 4JDRA 4J36A 1JRZA 2RGOA 3F8RA 4EQWA 4ECHA 2JB2A 1Y56A 2JBVA 2NVKX 2WOVA 2IVDA 3SFDA 4B63A 1BGJA 2XLUA 1MXTA 2WU2A 5FS8A 4YSYA 1TRBA 3T37A 3LXDA 4A6NB 2WPFA 3RNMA 4DSGA 3DK9A 4B64A 4TLXA 3IHGA 1KNRA 1PBCA 1TDOA 1H7XA 3GSIA 1IJHA 3GWFA 1RYIA 4LU6A 1DOCA 3LOVA 4BURA 1OJTA 3KLJA 4XWZA 1PBDA 1B4VA 4A65A 2CULA 2R0GA 1F6MA 2A89A 1GETA 3BHFA 4U8NA 2TMDA 5GRTA 1CJ3A 4H4UA 1GV4A 1NHSA 2WOIA 2OLOA 1B8SA 2YG5A 1BZLA 4H4TA 4A79A 2GRTA 3NTDA 3ALMA 3P4PA 1E1MA 4JY2A 3FPZA 4K5RA 4U2SA 4B66A 1H82A 2WDQA 5BRTA 4O5QA 2W0HA 4JQ9A 5KVIA 4Z26A 3G5SA 3UOVA 2TPRA 2XCGA 5J60A 2BYBA 1P2HA 3ADAB 4GR1A 2APGA 3C4AA 2RABA 4HB9A 2R9ZA 4AP3A 4BV6A 1TDFA 2X50A 3I6DA 2XLPA 1N4WA 1S3EA 2WESA 3ATQA 5BVAA 2XLTA 1NPXA 2ARDA 3RP6A 1ZMDA 1L9EA 3DMEA 1LQTA 3NLCA 1KDGA 1D4CA 5J7XA 5KWFA 2YLWA 1DODA 4O5UA 3P4QA 1E1LA 4YKGA 1DXLA 1JRYA 3UKHA 3UOZA 5JCMA 1IUSA 5U25A 3Q9TA 4H4VA 5FS9A 5BUKA 3CPIG 1X31B 1L9CA 3CNDA 4H2PA 1H6VA 1KNPA 3UTGA 2YM1A 3KA7A 1COYA 3NKSA 4D03A 2H89A 4Z25A 3UKQA 1JEHA 2BK5A 3AEEA 3LZWA 1NAAA 3DGZA 5EB5A 1OJDA 2FBWA 3EF6A 5IQ1A 1NENA 3AYJA 3V3OA 3PS9A 3O0HA 2GAGB 2XVIA 4IVMB 1RSGA 4JNAA 2O9ZA 2Y6QA 4Z2RA 3UKKA 2BS3A 1ELIA 2IVEA 3DK8A 4YTMA 4H4WA 3ICTA 1Y56B 1GOSA 4AOXA 1ONFA 2PYXA 3VR9A 1PXCA 4X9MA 4UDQA 2BCGG 2ZZCA 2VVLA 3NN6X 3E1TA 3BI4A 3AE6A 2WPEA 3CPJG 3VQRA 2GMHA 1H84A 2E4GA 1TDNA 3II4A 2B76A 4EMIA 3PO7A 4Z44A 4ZN0A 1B5QA 1DNCA 1Z6LA 3AE4A
chains in the Genus database with same CATH superfamily
2Z5YA 3P1WA 1N4UA 3NHOX 2WP9A 4TM1A 4U8LA 4I59A 1BKWA 2GQFA 2WOWA 4U2LA 1H86A 3V76A 1E39A 1PJ7A 1EL8A 1GTHA 5GSNA 1OJAA 3AEGA 2FJAA 2FJDA 1MO9A 3GYJA 4DGKA 2Q7VA 4G73A 1GESA 3HZLA 4CBQA 1GERA 1GNDA 1EL5A 4MJWA 3EPTA 1XDIA 1RP0A 2V3AA 3KVEA 4OPIA 2VRMA 1V59A 4U8PA 3FMWA 4XWRA 4YWOA 5HXIA 1YQZA 4HA6A 2JKCA 1O95A 3GWDA 4K7ZA 4II3A 2XVEA 1O5WA 2XFQA 2XLSA 4X9NA 5KMSA 2YLSA 1B37A 1CF3A 2EQ8A 3EAOA 1P2EA 2YWLA 3GMBA 3UTHA 2C72A 1Q9IA 4II2A 5HY5A 5ER0A 4A7AA 1AOGA 3UP4A 2XVJA 4DSHA 2C66A 1ZX9A 1GT8A 1JRXA 4A5LA 2B9XA 4H4YA 3BNUA 5FMHA 2YVGA 3V3NA 1NG4A 2GAHB 3AE9A 3SM8A 1EL7A 2BC0A 2E1MA 5U63A 3GD3A 4G6HA 1KF6A 1TYPA 3ABVA 3CIRA 4K2XA 4LIIA 2C7GA 4NNJA 2C3DA 4M52A 4AOSA 2VQ7A 2OLNA 4ZCDA 3GDNA 3AYLA 3LADA 4YT0A 4GAPA 1H81A 3QSEA 4OPLA 3C96A 5TR3A 2HQMA 5EOWA 2IIDA 4H4QA 4NWZA 4OVIA 1XHCA 2BK3A 3H4KA 2R4JA 1IUWA 2V61A 3CTYA 4Z2UA 3D8XA 4EIPA 4REKA 4EM4A 4A99A 4BK2A 3AEDA 4NEWA 3NIXA 2EQ7A 2XFNA 4PABA 3AXBA 1LV0A 1TDEA 1S2YA 4ADWA 4C3YA 1JOAA 1JU2A 1GRBA 4AT2A 1N1PA 1ZK7A 4EQXA 4B1BA 2WDVA 2C67A 3M0OA 2GVCA 3Q6JA 4B68A 3UTFA 1L9DA 3EANA 2X8HA 2R45A 3COXA 3SX6A 4N9XA 3WE0A 1CL0A 1REOA 3T2ZA 4BK3A 3KPFA 3C4NA 3GD4A 2Z5XA 1TYTA 5CQFA 2VVMA 4BJZA 2C4CA 3ATRA 4LA1A 2E5VA 2YM2A 2ZZBA 4D04A 3GRTA 1M64A 4FK1A 3BI5A 2GH5A 4EQRA 2RGHA 4NTDA 4CNKA 2Y6RA 1W4XA 2V5ZA 1OJ9A 1LTXR 1EL9A 4UP3A 1K4QA 4C74A 5KOWA 1YQ4A 5EBKA 3H8LA 3RP7A 1CC6A 3GDPA 2WDRA 2GEWA 3IC9A 2V6OA 2X8GA 2X99A 4EM3A 1ZOVA 1VQWA 4J31A 3AE2A 2VVLG 3CGDA 3SGLA 3VRAA 2C73A 2Q0KA 1GPEA 4IVOB 5KVHA 4G6GA 1SEZA 1HYUA 4GDEA 1NHQA 4CRTA 1NHPA 2VRLA 4PAAA 1N4VA 1DOBA 1GTEA 2CVJA 4RG3A 1QJDA 1LJ1A 3VR8A 4CCQA 5HYMA 2Q6UA 2C65A 3IF9A 3UP5A 5BULA 3QJ4A 5LV9A 1E1NA 3OZ2A 3H8IA 2AQJA 2QA1A 1GREA 4B65A 2OAMA 2C3CA 1OJCA 2FJBA 2A8XA 2GMJA 3B6DA 3QVPA 4H4XA 2XFPA 2PHHA 2BABA 3GRSA 2YG7A 3QFBA 4YXDA 4TM0A 2CDUA 1YKJA 1EBDA 5HHFA 4IA6A 5C3JA 2R0PA 1LQUA 3AE1A 1E1KA 3FG2P 1GRTA 4DNAA 3BNMA 1GRHA 4WX1A 4NTEA 1PS9A 4USRA 4CY8A 4EQSA 1H7WA 2XDOA 1IUTA 3UKLA 2VOUA 4UDPA 4YSZA 1LPFA 4J2WA 3S61A 2V60A 3UKFA 1NHRA 3DJEA 1PJ5A 3AEBA 4C77A 3M13A 3ZYXA 2WQYA 4EMWA 3K7MX 2B7RA 3GYXA 3UCLA 1CJ4A 3AD7B 2WP6A 2GQWA 1IUUA 3DJGX 4H50A 4A9WA 2A87A 2ZBWA 1ZP0A 2YR6A 2VZ2A 3K7QX 1YQ3A 4JY3A 4CNJA 4H2NA 4KX6A 4Z43A 3SZCA 2VQBA 2BS2A 3NK0X 3NRNA 4GCMA 2JB3A 1K0IA 4NEVA 4FDCB 1CC2A 2UZZA 3CGEA 3ISHA 3KKJA 5KXJA 4J34A 2WEUA 4GUVA 4U8IA 3NG7X 3SFEA 1CHUA 1PXBA 1FL2A 1S3BA 2B7SA 5KMPA 4USQA 2YG3A 4UDRA 5M10A 1FOHA 3REDA 4H7UA 5FS7A 3ICSA 1D7YA 4CY6A 2ACZA 1ZMCA 3GYIA 3AE5A 3AE3A 3P9UA 1K0JA 3L8KA 4U8MA 4A6NA 3NN0X 4Y4NA 2BCPA 3VRDB 1GEUA 3QSMA 1UKVG 1GXFA 2YG6A 1DOEA 3NYFA 1NDAA 3UKAA 3AD9B 2XVFA 1FEBA 1PJ6A 2ZZ0A 4YKFA 4I58A 1D5TA 3CNPA 1ZOYA 1GRGA 2BXRA 2I0ZA 2EQ6A 3P4RA 3JSKA 5KRQA 2GR0A 4XXGA 2C75A 2EQ9A 2B9WA 4NTCA 1E6EA 1PDHA 3CGCA 3D1CA 2YQUA 4J57A 1IUXA 3F8DA 5FS6A 3RP8A 5JCIA 5L46A 4K8DA 3UTEA 4TM4A 3UKPA 2GB0A 2BK4A 2XFOA 2RGJA 1D7LA 1XANA 3DK4A 4X4JA 2GV8A 3ALJA 4APNA 3IHMA 2GF3A 4YSXA 4KPRA 1F8WA 1KSSA 4YTNA 3KPKA 1VG0A 3I3LA 1DJNA 4B67A 4C3XA 5IPYA 3AWIA 4OPTA 3KU9A 5C2TA 4H4ZA 4H4RA 3CNJA 2QCUA 2YVJA 2C70A 4Z24A 5KNLA 1CC4A 3G5RA 4NZHA 2DKIA 3NYCA 4AP1A 2WPCA 3L1RA 1ZY8A 2FJEA 1L0VA 2BC1A 4BK1A 2B9YA 1ZDLA 4OPDA 4Y4LA 2Q0LA 5EB4A 1Q1RA 1BGNA 1CJCA 3UOXA 4YSHA 1D4DA 3NNEA 2WETA 4TLZA 1DJQA 3QSSA 4H2QA 1F8RA 5DBJA 3NT6A 4OPUA 3P4SA 4E0VA 3KD9A 3CN8A 4K22A 3UOYA 1GRFA 3LJPA 4G9KA 4U2TA 4BJYA 4OCGA 3AECA 1QO8A 1VRQB 1VG9A 3AEFA 3K30A 3LZXA 4K5SA 2R0CA 4P9SA 3ZDNA 4WCTA 3NTAA 2QA2A 4IA5A 3AB1A 4ICYA 3PVCA 2C76A 2QAEA 4EIQA 5KOXA 2WU5A 2DKHA 3ICRA 4J33A 3B3RA 2GR2A 3R9UA 4JN9A 4YTPA 2BRAA 3G5QA 3NGCX 2YLXA 2JAEA 3IWAA 1GALA 2OALA 1KSUA 2BS4A 3M12A 4B69A 3CGBA 1ZKQA 2F5ZA 4JNQA 2YG4A 4Y4MA 3DGHA 1PN0A 1F8SA 3AE8A 5KMRA 1GSNA 1Q1WA 2XVHA 3NK1X 4U8JA 2YLRA 1MOKA 3NYEA 3AE7A 4EMJA 1TDKA 1KFYA 3URHA 4GF7A 3SQPA 3DJDA 4GRTA 4G74A 4U8KA 3AYIA 1FECA 3CNTA 2XYOA 2YVFA 2BA9A 2OA1A 4H4SA 2BRYA 5JCLA 2X3NA 1FEAA 1NEKA 1YY5A 5KMQA 3BHKA 2R4EA 3FBSA 3OC4A 4CCRA 3AEAA 4GDPA 1D4EA 3BI2A 4J56A 1BWCA 2C64A 3NH3X 3K7TA 2BACA 2J3NA 1Y0PA 2WP5A 4RG4A 2WBAA 3ITJA 2R46A 5CKUA 5IQ4A 1IUVA 1F3PA 4FK1C 3GMCA 2BXSA 1CBOA 5JCKA 1FCDA 1LVLA 4AT0A 1XPQA 2YR4A 3CPHG 4C5OA 5M0ZA 3SZ0A 1S2QA 2YLZA 1E7PA 3DA1A 1GRAA 3NK2X 2JK6A 3AD8B 4IV9A 3SYIA 3VRBA 4RSLA 2WHDA 4FX9A 2V3BA 2AR8A 2GR3A 1H83A 1JNRA 1O94A 4ZCCA 2X8CA 2YR5A 2XFUA 1PBEA 1NG3A 2NPXA 3FIMB 4TM3A 3DJJA 2YAUA 2JB1A 1PHHA 2GR1A 1JNZA 2H88A 3CNSA 1PXAA 1M6IA 4OPGA 3T31A 3LB8A 4H4PA 1VDCA 3RHAA 4H2RA 1PBBA 5U1OA 2XLRA 3S5WA 2AAQA 2CFYA 2WS3A 3SZFA 1PBFA 1QLBA 3DH9A 5JCNA 1BF3A 4U8OA 1K0LA 4Z2TA 3F8PA 3QVRA 4OPCA 3QFAA 3ALLA 1CJ2A 3T0KA 2YLTA 4JDRA 4J36A 1JRZA 2RGOA 3F8RA 3T2YA 4EQWA 4ECHA 2JB2A 1Y56A 2JBVA 2NVKX 2WOVA 2IVDA 3SFDA 4B63A 1BGJA 2XLUA 1MXTA 2WU2A 5FS8A 4YSYA 1TRBA 3T37A 3LXDA 4A6NB 2WPFA 3RNMA 4DSGA 3DK9A 4B64A 4TLXA 3IHGA 1KNRA 1PBCA 1TDOA 1H7XA 3GSIA 1IJHA 3GWFA 1RYIA 4LU6A 1DOCA 3LOVA 4BURA 1OJTA 3KLJA 4XWZA 1PBDA 1B4VA 4A65A 2CULA 2R0GA 1F6MA 2A89A 1GETA 3BHFA 3HYXA 4U8NA 2TMDA 5GRTA 1CJ3A 4H4UA 1GV4A 1NHSA 2WOIA 3HYVA 2OLOA 1B8SA 2YG5A 1BZLA 4H4TA 4A79A 2GRTA 3NTDA 3ALMA 3P4PA 1E1MA 4JY2A 3FPZA 3T14A 4K5RA 3SZWA 4U2SA 4B66A 1H82A 2WDQA 5BRTA 4O5QA 2W0HA 4JQ9A 5KVIA 4Z26A 3G5SA 3UOVA 2TPRA 2XCGA 5J60A 2BYBA 1P2HA 3ADAB 4GR1A 2APGA 3C4AA 2RABA 4HB9A 2R9ZA 3SY4A 4AP3A 4BV6A 1TDFA 2X50A 3I6DA 2XLPA 1N4WA 1S3EA 2WESA 3ATQA 5BVAA 2XLTA 1NPXA 2ARDA 3RP6A 1ZMDA 1L9EA 3DMEA 1LQTA 3NLCA 1KDGA 1D4CA 5J7XA 5KWFA 2YLWA 1DODA 4O5UA 3P4QA 1E1LA 4YKGA 1DXLA 1JRYA 3UKHA 3UOZA 5JCMA 1IUSA 5U25A 3Q9TA 4H4VA 5FS9A 5BUKA 3CPIG 1X31B 1L9CA 3CNDA 4H2PA 1H6VA 1KNPA 3CMMA 3UTGA 2YM1A 3KA7A 1COYA 3NKSA 4D03A 2H89A 4Z25A 3UKQA 1JEHA 2BK5A 3AEEA 3LZWA 1NAAA 3DGZA 5EB5A 1OJDA 2FBWA 3EF6A 5IQ1A 1NENA 3AYJA 3V3OA 3PS9A 3O0HA 2GAGB 2XVIA 3HYWA 4IVMB 3SXIA 1RSGA 4JNAA 2O9ZA 2Y6QA 4Z2RA 3UKKA 2BS3A 1ELIA 2IVEA 3DK8A 4YTMA 4H4WA 3ICTA 1Y56B 1GOSA 4AOXA 1ONFA 2PYXA 3VR9A 1PXCA 4X9MA 4UDQA 2BCGG 2ZZCA 2VVLA 3NN6X 3E1TA 3BI4A 3AE6A 2WPEA 3CPJG 3VQRA 2GMHA 1H84A 2E4GA 3T2KA 1TDNA 3II4A 2B76A 4EMIA 4GAVA 3PO7A 4Z44A 4ZN0A 1B5QA 1DNCA 1Z6LA 3AE4A
chains in the Genus database with same CATH topology
2Z5YA 3P1WA 1N4UA 3NHOX 2WP9A 4TM1A 4U8LA 4I59A 1BKWA 2GQFA 2WOWA 4U2LA 1H86A 3V76A 1E39A 1PJ7A 1EL8A 1GTHA 5GSNA 1OJAA 3AEGA 2FJAA 2FJDA 1MO9A 3GYJA 4DGKA 2Q7VA 4G73A 1GESA 3HZLA 4CBQA 1GERA 1GNDA 1EL5A 4MJWA 3EPTA 1XDIA 1RP0A 2V3AA 3KVEA 4OPIA 2VRMA 1V59A 4U8PA 3FMWA 4XWRA 4YWOA 5HXIA 1YQZA 4HA6A 2JKCA 1O95A 3GWDA 4K7ZA 4II3A 2XVEA 1O5WA 2XFQA 2XLSA 4X9NA 5KMSA 2YLSA 1B37A 1CF3A 2EQ8A 3EAOA 1P2EA 2YWLA 3GMBA 3UTHA 2C72A 1Q9IA 4II2A 5HY5A 5ER0A 4A7AA 1AOGA 3UP4A 2XVJA 4DSHA 2C66A 1ZX9A 1GT8A 1JRXA 4A5LA 2B9XA 4H4YA 3BNUA 5FMHA 2YVGA 3V3NA 1NG4A 2GAHB 3AE9A 3SM8A 1EL7A 2BC0A 2E1MA 5U63A 3GD3A 4G6HA 1KF6A 1TYPA 3ABVA 3CIRA 4K2XA 4LIIA 2C7GA 4NNJA 2C3DA 4M52A 4AOSA 2VQ7A 2OLNA 4ZCDA 3GDNA 3AYLA 3LADA 4YT0A 4GAPA 1H81A 3QSEA 4OPLA 3C96A 5TR3A 2HQMA 5EOWA 2IIDA 4H4QA 4NWZA 4OVIA 1XHCA 2BK3A 3H4KA 2R4JA 1IUWA 2V61A 3CTYA 4Z2UA 3D8XA 4EIPA 4REKA 4EM4A 4A99A 4BK2A 3AEDA 4NEWA 3NIXA 2EQ7A 2XFNA 4PABA 3AXBA 1LV0A 1TDEA 1S2YA 4ADWA 4C3YA 1JOAA 1JU2A 1GRBA 4AT2A 1N1PA 1ZK7A 4EQXA 4B1BA 2WDVA 2C67A 3M0OA 2GVCA 3Q6JA 4B68A 3UTFA 1L9DA 3EANA 2X8HA 2R45A 3COXA 3SX6A 4N9XA 3WE0A 1CL0A 1REOA 3T2ZA 4BK3A 3KPFA 3C4NA 3GD4A 2Z5XA 1TYTA 5CQFA 2VVMA 4BJZA 2C4CA 3ATRA 4LA1A 2E5VA 2YM2A 2ZZBA 4D04A 3GRTA 1M64A 4FK1A 3BI5A 2GH5A 4EQRA 2RGHA 4NTDA 4CNKA 2Y6RA 1W4XA 2V5ZA 1OJ9A 1LTXR 1EL9A 4UP3A 1K4QA 4C74A 5KOWA 1YQ4A 5EBKA 3H8LA 3RP7A 1CC6A 3GDPA 2WDRA 2GEWA 3IC9A 2V6OA 2X8GA 2X99A 4EM3A 1ZOVA 1VQWA 4J31A 3AE2A 2VVLG 3CGDA 3SGLA 3VRAA 2C73A 2Q0KA 1GPEA 4IVOB 5KVHA 4G6GA 1SEZA 1HYUA 4GDEA 1NHQA 4CRTA 1NHPA 2VRLA 4PAAA 1N4VA 1DOBA 1GTEA 2CVJA 4RG3A 1QJDA 1LJ1A 3VR8A 4CCQA 5HYMA 2Q6UA 2C65A 3IF9A 3UP5A 5BULA 3QJ4A 5LV9A 1E1NA 3OZ2A 3H8IA 2AQJA 2QA1A 1GREA 4B65A 2OAMA 2C3CA 1OJCA 2FJBA 2A8XA 2GMJA 3B6DA 3QVPA 4H4XA 2XFPA 2PHHA 2BABA 3GRSA 2YG7A 3QFBA 4YXDA 4TM0A 2CDUA 1YKJA 1EBDA 5HHFA 4IA6A 5C3JA 2R0PA 1LQUA 3AE1A 1E1KA 3FG2P 1GRTA 4DNAA 3BNMA 1GRHA 4WX1A 4NTEA 1PS9A 4USRA 4CY8A 4EQSA 1H7WA 2XDOA 1IUTA 3UKLA 2VOUA 4UDPA 4YSZA 1LPFA 4J2WA 3S61A 2V60A 3UKFA 1NHRA 3DJEA 1PJ5A 3AEBA 4C77A 3M13A 3ZYXA 2WQYA 4EMWA 3K7MX 2B7RA 3GYXA 3UCLA 1CJ4A 3AD7B 2WP6A 2GQWA 1IUUA 3DJGX 4H50A 4A9WA 2A87A 2ZBWA 1ZP0A 2YR6A 2VZ2A 3K7QX 1YQ3A 4JY3A 4CNJA 4H2NA 4KX6A 4Z43A 3SZCA 2VQBA 2BS2A 3NK0X 3NRNA 4GCMA 2JB3A 1K0IA 4NEVA 4FDCB 1CC2A 2UZZA 3CGEA 3ISHA 3KKJA 5KXJA 4J34A 2WEUA 4GUVA 4U8IA 3NG7X 3SFEA 1CHUA 1PXBA 1FL2A 1S3BA 2B7SA 5KMPA 4USQA 2YG3A 4UDRA 5M10A 1FOHA 3REDA 4H7UA 5FS7A 3ICSA 1D7YA 4CY6A 2ACZA 1ZMCA 3GYIA 3AE5A 3AE3A 3P9UA 1K0JA 3L8KA 4U8MA 4A6NA 3NN0X 4Y4NA 2BCPA 3VRDB 1GEUA 3QSMA 1UKVG 1GXFA 2YG6A 1DOEA 3NYFA 1NDAA 3UKAA 3AD9B 2XVFA 1FEBA 1PJ6A 2ZZ0A 4YKFA 4I58A 1D5TA 3CNPA 1ZOYA 1GRGA 2BXRA 2I0ZA 2EQ6A 3P4RA 3JSKA 5KRQA 2GR0A 4XXGA 2C75A 2EQ9A 2B9WA 4NTCA 1E6EA 1PDHA 3CGCA 3D1CA 2YQUA 4J57A 1IUXA 3F8DA 5FS6A 3RP8A 5JCIA 5L46A 4K8DA 3UTEA 4TM4A 3UKPA 2GB0A 2BK4A 2XFOA 2RGJA 1D7LA 1XANA 3DK4A 4X4JA 2GV8A 3ALJA 4APNA 3IHMA 2GF3A 4YSXA 4KPRA 1F8WA 1KSSA 4YTNA 3KPKA 1VG0A 3I3LA 1DJNA 4B67A 4C3XA 5IPYA 3AWIA 4OPTA 3KU9A 5C2TA 4H4ZA 4H4RA 3CNJA 2QCUA 2YVJA 2C70A 4Z24A 5KNLA 1CC4A 3G5RA 4NZHA 2DKIA 3NYCA 4AP1A 2WPCA 3L1RA 1ZY8A 2FJEA 1L0VA 2BC1A 4BK1A 2B9YA 1ZDLA 4OPDA 4Y4LA 2Q0LA 5EB4A 1Q1RA 1BGNA 1CJCA 3UOXA 4YSHA 1D4DA 3NNEA 2WETA 4TLZA 1DJQA 3QSSA 4H2QA 1F8RA 5DBJA 3NT6A 4OPUA 3P4SA 4E0VA 3KD9A 3CN8A 4K22A 3UOYA 1GRFA 3LJPA 4G9KA 4U2TA 4BJYA 4OCGA 3AECA 1QO8A 1VRQB 1VG9A 3AEFA 3K30A 3LZXA 4K5SA 2R0CA 4P9SA 3ZDNA 4WCTA 3NTAA 2QA2A 4IA5A 3AB1A 4ICYA 3PVCA 2C76A 2QAEA 4EIQA 5KOXA 2WU5A 2DKHA 3ICRA 4J33A 3B3RA 2GR2A 3R9UA 4JN9A 4YTPA 2BRAA 3G5QA 3NGCX 2YLXA 2JAEA 3IWAA 1GALA 2OALA 1KSUA 2BS4A 3M12A 4B69A 3CGBA 1ZKQA 2F5ZA 4JNQA 2YG4A 4Y4MA 3DGHA 1PN0A 1F8SA 3AE8A 5KMRA 1GSNA 1Q1WA 2XVHA 3NK1X 4U8JA 2YLRA 1MOKA 3NYEA 3AE7A 4EMJA 1TDKA 1KFYA 3URHA 4GF7A 3SQPA 3DJDA 4GRTA 4G74A 4U8KA 3AYIA 1FECA 3CNTA 2XYOA 2YVFA 2BA9A 2OA1A 4H4SA 2BRYA 5JCLA 2X3NA 1FEAA 1NEKA 1YY5A 5KMQA 3BHKA 2R4EA 3FBSA 3OC4A 4CCRA 3AEAA 4GDPA 1D4EA 3BI2A 4J56A 1BWCA 2C64A 3NH3X 3K7TA 2BACA 2J3NA 1Y0PA 2WP5A 4RG4A 2WBAA 3ITJA 2R46A 5CKUA 5IQ4A 1IUVA 1F3PA 4FK1C 3GMCA 2BXSA 1CBOA 5JCKA 1FCDA 1LVLA 4AT0A 1XPQA 2YR4A 3CPHG 4C5OA 5M0ZA 3SZ0A 1S2QA 2YLZA 1E7PA 3DA1A 1GRAA 3NK2X 2JK6A 3AD8B 4IV9A 3SYIA 3VRBA 4RSLA 2WHDA 4FX9A 2V3BA 2AR8A 2GR3A 1H83A 1JNRA 1O94A 4ZCCA 2X8CA 2YR5A 2XFUA 1PBEA 1NG3A 2NPXA 3FIMB 4TM3A 3DJJA 2YAUA 2JB1A 1PHHA 2GR1A 1JNZA 2H88A 3CNSA 1PXAA 1M6IA 4OPGA 3T31A 3LB8A 4H4PA 1VDCA 3RHAA 4H2RA 1PBBA 5U1OA 2XLRA 3S5WA 2AAQA 2CFYA 2WS3A 3SZFA 1PBFA 1QLBA 3DH9A 5JCNA 1BF3A 4U8OA 1K0LA 4Z2TA 3F8PA 3QVRA 4OPCA 3QFAA 3ALLA 1CJ2A 3T0KA 2YLTA 4JDRA 4J36A 1JRZA 2RGOA 3F8RA 3T2YA 4EQWA 4ECHA 2JB2A 1Y56A 2JBVA 2NVKX 2WOVA 2IVDA 3SFDA 4B63A 1BGJA 2XLUA 1MXTA 2WU2A 5FS8A 4YSYA 1TRBA 3T37A 3LXDA 4A6NB 2WPFA 3RNMA 4DSGA 3DK9A 4B64A 4TLXA 3IHGA 1KNRA 1PBCA 1TDOA 1H7XA 3GSIA 1IJHA 3GWFA 1RYIA 4LU6A 1DOCA 3LOVA 4BURA 1OJTA 3KLJA 4XWZA 1PBDA 1B4VA 4A65A 2CULA 2R0GA 1F6MA 2A89A 1GETA 3BHFA 3HYXA 4U8NA 2TMDA 5GRTA 1CJ3A 4H4UA 1GV4A 1NHSA 2WOIA 3HYVA 2OLOA 1B8SA 2YG5A 1BZLA 4H4TA 4A79A 2GRTA 3NTDA 3ALMA 3P4PA 1E1MA 4JY2A 3FPZA 3T14A 4K5RA 3SZWA 4U2SA 4B66A 1H82A 2WDQA 5BRTA 4O5QA 2W0HA 4JQ9A 5KVIA 4Z26A 3G5SA 3UOVA 2TPRA 2XCGA 5J60A 2BYBA 1P2HA 3ADAB 4GR1A 2APGA 3C4AA 2RABA 4HB9A 2R9ZA 3SY4A 4AP3A 4BV6A 1TDFA 2X50A 3I6DA 2XLPA 1N4WA 1S3EA 2WESA 3ATQA 5BVAA 2XLTA 1NPXA 2ARDA 3RP6A 1ZMDA 1L9EA 3DMEA 1LQTA 3NLCA 1KDGA 1D4CA 5J7XA 5KWFA 2YLWA 1DODA 4O5UA 3P4QA 1E1LA 4YKGA 1DXLA 1JRYA 3UKHA 3UOZA 5JCMA 1IUSA 5U25A 3Q9TA 4H4VA 5FS9A 5BUKA 3CPIG 1X31B 1L9CA 3CNDA 4H2PA 1H6VA 1KNPA 3CMMA 3UTGA 2YM1A 3KA7A 1COYA 3NKSA 4D03A 2H89A 4Z25A 3UKQA 1JEHA 2BK5A 3AEEA 3LZWA 1NAAA 3DGZA 5EB5A 1OJDA 2FBWA 3EF6A 5IQ1A 1NENA 3AYJA 3V3OA 3PS9A 3O0HA 2GAGB 2XVIA 3HYWA 4IVMB 3SXIA 1RSGA 4JNAA 2O9ZA 2Y6QA 4Z2RA 3UKKA 2BS3A 1ELIA 2IVEA 3DK8A 4YTMA 4H4WA 3ICTA 1Y56B 1GOSA 4AOXA 1ONFA 2PYXA 3VR9A 1PXCA 4X9MA 4UDQA 2BCGG 2ZZCA 2VVLA 3NN6X 3E1TA 3BI4A 3AE6A 2WPEA 3CPJG 3VQRA 2GMHA 1H84A 2E4GA 3T2KA 1TDNA 3II4A 2B76A 4EMIA 4GAVA 3PO7A 4Z44A 4ZN0A 1B5QA 1DNCA 1Z6LA 3AE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z5Y A;  3P1W A;  1N4U A;  3NHO X;  2WP9 A;  4TM1 A;  4U8L A;  4I59 A;  1BKW A;  2GQF A;  2WOW A;  4U2L A;  1H86 A;  3V76 A;  1E39 A;  1PJ7 A;  1EL8 A;  1GTH A;  5GSN A;  1OJA A;  3AEG A;  2FJA A;  2FJD A;  1MO9 A;  3GYJ A;  4DGK A;  2Q7V A;  1GES A;  3HZL A;  4CBQ A;  1GER A;  1GND A;  1EL5 A;  4MJW A;  3EPT A;  1XDI A;  1RP0 A;  2V3A A;  3KVE A;  4OPI A;  2VRM A;  1V59 A;  4U8P A;  3FMW A;  4XWR A;  4YWO A;  5HXI A;  1YQZ A;  4HA6 A;  2JKC A;  1O95 A;  3GWD A;  4K7Z A;  2XVE A;  1O5W A;  2XFQ A;  2XLS A;  4X9N A;  2YLS A;  1B37 A;  1CF3 A;  2EQ8 A;  3EAO A;  1P2E A;  2YWL A;  3GMB A;  3UTH A;  2C72 A;  1Q9I A;  5HY5 A;  5ER0 A;  4A7A A;  1AOG A;  3UP4 A;  2XVJ A;  4DSH A;  2C66 A;  1ZX9 A;  1GT8 A;  1JRX A;  4A5L A;  2B9X A;  4H4Y A;  3BNU A;  5FMH A;  2YVG A;  3V3N A;  1NG4 A;  2GAH B;  3AE9 A;  3SM8 A;  1EL7 A;  2BC0 A;  2E1M A;  5U63 A;  3GD3 A;  1KF6 A;  1TYP A;  3ABV A;  3CIR A;  4K2X A;  4LII A;  2C7G A;  2C3D A;  4M52 A;  4AOS A;  2VQ7 A;  2OLN A;  4ZCD A;  3GDN A;  3AYL A;  3LAD A;  4YT0 A;  1H81 A;  3QSE A;  4OPL A;  3C96 A;  5TR3 A;  2HQM A;  5EOW A;  2IID A;  4H4Q A;  4OVI A;  1XHC A;  2BK3 A;  3H4K A;  2R4J A;  1IUW A;  2V61 A;  3CTY A;  4Z2U A;  3D8X A;  4EIP A;  4REK A;  4EM4 A;  4A99 A;  4BK2 A;  3AED A;  4NEW A;  3NIX A;  2EQ7 A;  2XFN A;  4PAB A;  3AXB A;  1LV0 A;  1TDE A;  1S2Y A;  4ADW A;  4C3Y A;  1JOA A;  1JU2 A;  1GRB A;  4AT2 A;  1N1P A;  1ZK7 A;  4EQX A;  4B1B A;  2WDV A;  2C67 A;  3M0O A;  2GVC A;  3Q6J A;  4B68 A;  3UTF A;  1L9D A;  3EAN A;  2X8H A;  2R45 A;  3COX A;  4N9X A;  3WE0 A;  1CL0 A;  1REO A;  4BK3 A;  3KPF A;  3C4N A;  3GD4 A;  2Z5X A;  1TYT A;  5CQF A;  2VVM A;  4BJZ A;  3ATR A;  4LA1 A;  2E5V A;  2YM2 A;  2ZZB A;  4D04 A;  3GRT A;  1M64 A;  4FK1 A;  3BI5 A;  2GH5 A;  4EQR A;  2RGH A;  4NTD A;  4CNK A;  2Y6R A;  1W4X A;  2V5Z A;  1OJ9 A;  1LTX R;  1EL9 A;  4UP3 A;  1K4Q A;  4C74 A;  5KOW A;  1YQ4 A;  5EBK A;  3H8L A;  3RP7 A;  1CC6 A;  3GDP A;  2WDR A;  2GEW A;  3IC9 A;  2V6O A;  2X8G A;  2X99 A;  4EM3 A;  1ZOV A;  1VQW A;  4J31 A;  3AE2 A;  2VVL G;  3CGD A;  3SGL A;  3VRA A;  2C73 A;  2Q0K A;  1GPE A;  4IVO B;  5KVH A;  1SEZ A;  1HYU A;  4GDE A;  1NHQ A;  4CRT A;  1NHP A;  2VRL A;  4PAA A;  1N4V A;  1DOB A;  1GTE A;  2CVJ A;  4RG3 A;  1QJD A;  1LJ1 A;  3VR8 A;  4CCQ A;  5HYM A;  2Q6U A;  2C65 A;  3IF9 A;  3UP5 A;  5BUL A;  3QJ4 A;  5LV9 A;  1E1N A;  3OZ2 A;  3H8I A;  2AQJ A;  2QA1 A;  1GRE A;  4B65 A;  2OAM A;  2C3C A;  1OJC A;  2FJB A;  2A8X A;  2GMJ A;  3B6D A;  3QVP A;  4H4X A;  2XFP A;  2PHH A;  2BAB A;  3GRS A;  2YG7 A;  3QFB A;  4YXD A;  4TM0 A;  2CDU A;  1YKJ A;  1EBD A;  5HHF A;  4IA6 A;  5C3J A;  2R0P A;  1LQU A;  3AE1 A;  1E1K A;  3FG2 P;  1GRT A;  4DNA A;  3BNM A;  1GRH A;  4WX1 A;  4NTE A;  1PS9 A;  4USR A;  4CY8 A;  4EQS A;  1H7W A;  2XDO A;  1IUT A;  3UKL A;  2VOU A;  4UDP A;  4YSZ A;  1LPF A;  4J2W A;  3S61 A;  2V60 A;  3UKF A;  1NHR A;  3DJE A;  1PJ5 A;  3AEB A;  4C77 A;  3M13 A;  3ZYX A;  2WQY A;  4EMW A;  3K7M X;  2B7R A;  3UCL A;  1CJ4 A;  3AD7 B;  2WP6 A;  2GQW A;  1IUU A;  3DJG X;  4H50 A;  4A9W A;  2A87 A;  2ZBW A;  1ZP0 A;  2YR6 A;  2VZ2 A;  3K7Q X;  1YQ3 A;  4JY3 A;  4CNJ A;  4H2N A;  4KX6 A;  4Z43 A;  2VQB A;  2BS2 A;  3NK0 X;  3NRN A;  4GCM A;  2JB3 A;  1K0I A;  4NEV A;  4FDC B;  1CC2 A;  2UZZ A;  3CGE A;  3ISH A;  3KKJ A;  5KXJ A;  4J34 A;  2WEU A;  4GUV A;  4U8I A;  3NG7 X;  3SFE A;  1CHU A;  1PXB A;  1FL2 A;  1S3B A;  2B7S A;  4USQ A;  2YG3 A;  4UDR A;  5M10 A;  1FOH A;  3RED A;  4H7U A;  5FS7 A;  3ICS A;  1D7Y A;  4CY6 A;  2ACZ A;  1ZMC A;  3GYI A;  3AE5 A;  3AE3 A;  3P9U A;  1K0J A;  3L8K A;  4U8M A;  4A6N A;  3NN0 X;  4Y4N A;  2BCP A;  3VRD B;  1GEU A;  3QSM A;  1UKV G;  1GXF A;  2YG6 A;  1DOE A;  3NYF A;  1NDA A;  3UKA A;  3AD9 B;  2XVF A;  1FEB A;  1PJ6 A;  2ZZ0 A;  4YKF A;  4I58 A;  1D5T A;  3CNP A;  1ZOY A;  1GRG A;  2BXR A;  2I0Z A;  2EQ6 A;  3P4R A;  3JSK A;  5KRQ A;  2GR0 A;  4XXG A;  2C75 A;  2EQ9 A;  2B9W A;  4NTC A;  1E6E A;  1PDH A;  3CGC A;  3D1C A;  2YQU A;  4J57 A;  1IUX A;  3F8D A;  5FS6 A;  3RP8 A;  5JCI A;  5L46 A;  4K8D A;  3UTE A;  4TM4 A;  3UKP A;  2GB0 A;  2BK4 A;  2XFO A;  2RGJ A;  1D7L A;  1XAN A;  3DK4 A;  4X4J A;  2GV8 A;  3ALJ A;  4APN A;  3IHM A;  2GF3 A;  4YSX A;  4KPR A;  1F8W A;  1KSS A;  4YTN A;  1VG0 A;  3I3L A;  1DJN A;  4B67 A;  4C3X A;  5IPY A;  3AWI A;  4OPT A;  3KU9 A;  5C2T A;  4H4Z A;  4H4R A;  3CNJ A;  2QCU A;  2YVJ A;  2C70 A;  4Z24 A;  1CC4 A;  3G5R A;  4NZH A;  2DKI A;  3NYC A;  4AP1 A;  2WPC A;  3L1R A;  1ZY8 A;  2FJE A;  1L0V A;  2BC1 A;  4BK1 A;  2B9Y A;  1ZDL A;  4OPD A;  4Y4L A;  2Q0L A;  5EB4 A;  1Q1R A;  1BGN A;  1CJC A;  3UOX A;  4YSH A;  1D4D A;  3NNE A;  2WET A;  4TLZ A;  1DJQ A;  3QSS A;  4H2Q A;  1F8R A;  5DBJ A;  3NT6 A;  4OPU A;  3P4S A;  4E0V A;  3KD9 A;  3CN8 A;  4K22 A;  3UOY A;  1GRF A;  3LJP A;  4U2T A;  4BJY A;  4OCG A;  3AEC A;  1QO8 A;  1VRQ B;  1VG9 A;  3AEF A;  3K30 A;  3LZX A;  4K5S A;  2R0C A;  4P9S A;  3ZDN A;  4WCT A;  3NTA A;  2QA2 A;  4IA5 A;  3AB1 A;  4ICY A;  3PVC A;  2C76 A;  2QAE A;  4EIQ A;  5KOX A;  2WU5 A;  2DKH A;  3ICR A;  4J33 A;  3B3R A;  2GR2 A;  3R9U A;  4JN9 A;  4YTP A;  3G5Q A;  3NGC X;  2YLX A;  2JAE A;  3IWA A;  1GAL A;  2OAL A;  1KSU A;  2BS4 A;  3M12 A;  4B69 A;  3CGB A;  1ZKQ A;  2F5Z A;  4JNQ A;  2YG4 A;  4Y4M A;  3DGH A;  1PN0 A;  1F8S A;  3AE8 A;  1GSN A;  1Q1W A;  2XVH A;  3NK1 X;  4U8J A;  2YLR A;  1MOK A;  3NYE A;  3AE7 A;  4EMJ A;  1TDK A;  1KFY A;  3URH A;  4GF7 A;  3SQP A;  3DJD A;  4GRT A;  4U8K A;  3AYI A;  1FEC A;  3CNT A;  2XYO A;  2YVF A;  2BA9 A;  2OA1 A;  4H4S A;  5JCL A;  2X3N A;  1FEA A;  1NEK A;  1YY5 A;  4CCR A;  3BHK A;  2R4E A;  3FBS A;  3OC4 A;  3AEA A;  4GDP A;  1D4E A;  3BI2 A;  4J56 A;  1BWC A;  2C64 A;  3NH3 X;  3K7T A;  2BAC A;  2J3N A;  1Y0P A;  2WP5 A;  4RG4 A;  2WBA A;  3ITJ A;  2R46 A;  5CKU A;  5IQ4 A;  1IUV A;  1F3P A;  4FK1 C;  3GMC A;  2BXS A;  1CBO A;  5JCK A;  1FCD A;  1LVL A;  4AT0 A;  1XPQ A;  2YR4 A;  3CPH G;  4C5O A;  5M0Z A;  1S2Q A;  2YLZ A;  1E7P A;  3DA1 A;  1GRA A;  3NK2 X;  2JK6 A;  3AD8 B;  4IV9 A;  3VRB A;  4RSL A;  2WHD A;  4FX9 A;  2V3B A;  2AR8 A;  2GR3 A;  1H83 A;  1JNR A;  1O94 A;  4ZCC A;  2X8C A;  2YR5 A;  2XFU A;  1PBE A;  1NG3 A;  2NPX A;  3FIM B;  4TM3 A;  3DJJ A;  2YAU A;  2JB1 A;  1PHH A;  2GR1 A;  1JNZ A;  2H88 A;  3CNS A;  1PXA A;  1M6I A;  4OPG A;  3LB8 A;  4H4P A;  1VDC A;  3RHA A;  4H2R A;  1PBB A;  5U1O A;  2XLR A;  3S5W A;  2AAQ A;  2CFY A;  2WS3 A;  1PBF A;  1QLB A;  3DH9 A;  5JCN A;  1BF3 A;  4U8O A;  1K0L A;  4Z2T A;  3F8P A;  3QVR A;  4OPC A;  3QFA A;  3ALL A;  1CJ2 A;  2YLT A;  4JDR A;  4J36 A;  1JRZ A;  2RGO A;  3F8R A;  4EQW A;  4ECH A;  2JB2 A;  1Y56 A;  2JBV A;  2NVK X;  2WOV A;  2IVD A;  3SFD A;  4B63 A;  1BGJ A;  2XLU A;  1MXT A;  2WU2 A;  5FS8 A;  4YSY A;  1TRB A;  3T37 A;  3LXD A;  4A6N B;  2WPF A;  3RNM A;  4DSG A;  3DK9 A;  4B64 A;  4TLX A;  3IHG A;  1KNR A;  1PBC A;  1TDO A;  1H7X A;  3GSI A;  1IJH A;  3GWF A;  1RYI A;  4LU6 A;  1DOC A;  3LOV A;  4BUR A;  1OJT A;  3KLJ A;  4XWZ A;  1PBD A;  1B4V A;  4A65 A;  2CUL A;  2R0G A;  1F6M A;  2A89 A;  1GET A;  3BHF A;  4U8N A;  2TMD A;  5GRT A;  1CJ3 A;  4H4U A;  1GV4 A;  1NHS A;  2WOI A;  2OLO A;  1B8S A;  2YG5 A;  1BZL A;  4H4T A;  4A79 A;  2GRT A;  3NTD A;  3ALM A;  3P4P A;  1E1M A;  4JY2 A;  3FPZ A;  4K5R A;  4U2S A;  4B66 A;  1H82 A;  2WDQ A;  5BRT A;  4O5Q A;  2W0H A;  4JQ9 A;  5KVI A;  4Z26 A;  3G5S A;  3UOV A;  2TPR A;  2XCG A;  5J60 A;  2BYB A;  1P2H A;  3ADA B;  4GR1 A;  2APG A;  3C4A A;  2RAB A;  4HB9 A;  2R9Z A;  4AP3 A;  4BV6 A;  1TDF A;  2X50 A;  3I6D A;  2XLP A;  1N4W A;  1S3E A;  2WES A;  3ATQ A;  5BVA A;  2XLT A;  1NPX A;  2ARD A;  3RP6 A;  1ZMD A;  1L9E A;  3DME A;  1LQT A;  3NLC A;  1KDG A;  1D4C A;  5J7X A;  5KWF A;  2YLW A;  1DOD A;  4O5U A;  3P4Q A;  1E1L A;  4YKG A;  1DXL A;  1JRY A;  3UKH A;  3UOZ A;  5JCM A;  1IUS A;  5U25 A;  3Q9T A;  4H4V A;  5FS9 A;  5BUK A;  3CPI G;  1X31 B;  1L9C A;  3CND A;  4H2P A;  1H6V A;  1KNP A;  3UTG A;  2YM1 A;  3KA7 A;  1COY A;  3NKS A;  4D03 A;  2H89 A;  4Z25 A;  3UKQ A;  1JEH A;  2BK5 A;  3AEE A;  3LZW A;  1NAA A;  3DGZ A;  5EB5 A;  1OJD A;  2FBW A;  3EF6 A;  5IQ1 A;  1NEN A;  3AYJ A;  3V3O A;  3PS9 A;  3O0H A;  2GAG B;  2XVI A;  4IVM B;  1RSG A;  4JNA A;  2O9Z A;  2Y6Q A;  4Z2R A;  3UKK A;  2BS3 A;  1ELI A;  2IVE A;  3DK8 A;  4YTM A;  4H4W A;  3ICT A;  1Y56 B;  1GOS A;  4AOX A;  1ONF A;  2PYX A;  3VR9 A;  1PXC A;  4X9M A;  4UDQ A;  2BCG G;  2ZZC A;  2VVL A;  3NN6 X;  3E1T A;  3BI4 A;  3AE6 A;  2WPE A;  3CPJ G;  3VQR A;  2GMH A;  1H84 A;  2E4G A;  1TDN A;  3II4 A;  2B76 A;  4EMI A;  3PO7 A;  4Z44 A;  4ZN0 A;  1B5Q A;  1DNC A;  1Z6L A;  3AE4 A; 
#chains in the Genus database with same CATH topology
 2Z5Y A;  3P1W A;  1N4U A;  3NHO X;  2WP9 A;  4TM1 A;  4U8L A;  4I59 A;  1BKW A;  2GQF A;  2WOW A;  4U2L A;  1H86 A;  3V76 A;  1E39 A;  1PJ7 A;  1EL8 A;  1GTH A;  5GSN A;  1OJA A;  3AEG A;  2FJA A;  2FJD A;  1MO9 A;  3GYJ A;  4DGK A;  2Q7V A;  4G73 A;  1GES A;  3HZL A;  4CBQ A;  1GER A;  1GND A;  1EL5 A;  4MJW A;  3EPT A;  1XDI A;  1RP0 A;  2V3A A;  3KVE A;  4OPI A;  2VRM A;  1V59 A;  4U8P A;  3FMW A;  4XWR A;  4YWO A;  5HXI A;  1YQZ A;  4HA6 A;  2JKC A;  1O95 A;  3GWD A;  4K7Z A;  4II3 A;  2XVE A;  1O5W A;  2XFQ A;  2XLS A;  4X9N A;  5KMS A;  2YLS A;  1B37 A;  1CF3 A;  2EQ8 A;  3EAO A;  1P2E A;  2YWL A;  3GMB A;  3UTH A;  2C72 A;  1Q9I A;  4II2 A;  5HY5 A;  5ER0 A;  4A7A A;  1AOG A;  3UP4 A;  2XVJ A;  4DSH A;  2C66 A;  1ZX9 A;  1GT8 A;  1JRX A;  4A5L A;  2B9X A;  4H4Y A;  3BNU A;  5FMH A;  2YVG A;  3V3N A;  1NG4 A;  2GAH B;  3AE9 A;  3SM8 A;  1EL7 A;  2BC0 A;  2E1M A;  5U63 A;  3GD3 A;  4G6H A;  1KF6 A;  1TYP A;  3ABV A;  3CIR A;  4K2X A;  4LII A;  2C7G A;  4NNJ A;  2C3D A;  4M52 A;  4AOS A;  2VQ7 A;  2OLN A;  4ZCD A;  3GDN A;  3AYL A;  3LAD A;  4YT0 A;  4GAP A;  1H81 A;  3QSE A;  4OPL A;  3C96 A;  5TR3 A;  2HQM A;  5EOW A;  2IID A;  4H4Q A;  4NWZ A;  4OVI A;  1XHC A;  2BK3 A;  3H4K A;  2R4J A;  1IUW A;  2V61 A;  3CTY A;  4Z2U A;  3D8X A;  4EIP A;  4REK A;  4EM4 A;  4A99 A;  4BK2 A;  3AED A;  4NEW A;  3NIX A;  2EQ7 A;  2XFN A;  4PAB A;  3AXB A;  1LV0 A;  1TDE A;  1S2Y A;  4ADW A;  4C3Y A;  1JOA A;  1JU2 A;  1GRB A;  4AT2 A;  1N1P A;  1ZK7 A;  4EQX A;  4B1B A;  2WDV A;  2C67 A;  3M0O A;  2GVC A;  3Q6J A;  4B68 A;  3UTF A;  1L9D A;  3EAN A;  2X8H A;  2R45 A;  3COX A;  3SX6 A;  4N9X A;  3WE0 A;  1CL0 A;  1REO A;  3T2Z A;  4BK3 A;  3KPF A;  3C4N A;  3GD4 A;  2Z5X A;  1TYT A;  5CQF A;  2VVM A;  4BJZ A;  2C4C A;  3ATR A;  4LA1 A;  2E5V A;  2YM2 A;  2ZZB A;  4D04 A;  3GRT A;  1M64 A;  4FK1 A;  3BI5 A;  2GH5 A;  4EQR A;  2RGH A;  4NTD A;  4CNK A;  2Y6R A;  1W4X A;  2V5Z A;  1OJ9 A;  1LTX R;  1EL9 A;  4UP3 A;  1K4Q A;  4C74 A;  5KOW A;  1YQ4 A;  5EBK A;  3H8L A;  3RP7 A;  1CC6 A;  3GDP A;  2WDR A;  2GEW A;  3IC9 A;  2V6O A;  2X8G A;  2X99 A;  4EM3 A;  1ZOV A;  1VQW A;  4J31 A;  3AE2 A;  2VVL G;  3CGD A;  3SGL A;  3VRA A;  2C73 A;  2Q0K A;  1GPE A;  4IVO B;  5KVH A;  4G6G A;  1SEZ A;  1HYU A;  4GDE A;  1NHQ A;  4CRT A;  1NHP A;  2VRL A;  4PAA A;  1N4V A;  1DOB A;  1GTE A;  2CVJ A;  4RG3 A;  1QJD A;  1LJ1 A;  3VR8 A;  4CCQ A;  5HYM A;  2Q6U A;  2C65 A;  3IF9 A;  3UP5 A;  5BUL A;  3QJ4 A;  5LV9 A;  1E1N A;  3OZ2 A;  3H8I A;  2AQJ A;  2QA1 A;  1GRE A;  4B65 A;  2OAM A;  2C3C A;  1OJC A;  2FJB A;  2A8X A;  2GMJ A;  3B6D A;  3QVP A;  4H4X A;  2XFP A;  2PHH A;  2BAB A;  3GRS A;  2YG7 A;  3QFB A;  4YXD A;  4TM0 A;  2CDU A;  1YKJ A;  1EBD A;  5HHF A;  4IA6 A;  5C3J A;  2R0P A;  1LQU A;  3AE1 A;  1E1K A;  3FG2 P;  1GRT A;  4DNA A;  3BNM A;  1GRH A;  4WX1 A;  4NTE A;  1PS9 A;  4USR A;  4CY8 A;  4EQS A;  1H7W A;  2XDO A;  1IUT A;  3UKL A;  2VOU A;  4UDP A;  4YSZ A;  1LPF A;  4J2W A;  3S61 A;  2V60 A;  3UKF A;  1NHR A;  3DJE A;  1PJ5 A;  3AEB A;  4C77 A;  3M13 A;  3ZYX A;  2WQY A;  4EMW A;  3K7M X;  2B7R A;  3GYX A;  3UCL A;  1CJ4 A;  3AD7 B;  2WP6 A;  2GQW A;  1IUU A;  3DJG X;  4H50 A;  4A9W A;  2A87 A;  2ZBW A;  1ZP0 A;  2YR6 A;  2VZ2 A;  3K7Q X;  1YQ3 A;  4JY3 A;  4CNJ A;  4H2N A;  4KX6 A;  4Z43 A;  3SZC A;  2VQB A;  2BS2 A;  3NK0 X;  3NRN A;  4GCM A;  2JB3 A;  1K0I A;  4NEV A;  4FDC B;  1CC2 A;  2UZZ A;  3CGE A;  3ISH A;  3KKJ A;  5KXJ A;  4J34 A;  2WEU A;  4GUV A;  4U8I A;  3NG7 X;  3SFE A;  1CHU A;  1PXB A;  1FL2 A;  1S3B A;  2B7S A;  5KMP A;  4USQ A;  2YG3 A;  4UDR A;  5M10 A;  1FOH A;  3RED A;  4H7U A;  5FS7 A;  3ICS A;  1D7Y A;  4CY6 A;  2ACZ A;  1ZMC A;  3GYI A;  3AE5 A;  3AE3 A;  3P9U A;  1K0J A;  3L8K A;  4U8M A;  4A6N A;  3NN0 X;  4Y4N A;  2BCP A;  3VRD B;  1GEU A;  3QSM A;  1UKV G;  1GXF A;  2YG6 A;  1DOE A;  3NYF A;  1NDA A;  3UKA A;  3AD9 B;  2XVF A;  1FEB A;  1PJ6 A;  2ZZ0 A;  4YKF A;  4I58 A;  1D5T A;  3CNP A;  1ZOY A;  1GRG A;  2BXR A;  2I0Z A;  2EQ6 A;  3P4R A;  3JSK A;  5KRQ A;  2GR0 A;  4XXG A;  2C75 A;  2EQ9 A;  2B9W A;  4NTC A;  1E6E A;  1PDH A;  3CGC A;  3D1C A;  2YQU A;  4J57 A;  1IUX A;  3F8D A;  5FS6 A;  3RP8 A;  5JCI A;  5L46 A;  4K8D A;  3UTE A;  4TM4 A;  3UKP A;  2GB0 A;  2BK4 A;  2XFO A;  2RGJ A;  1D7L A;  1XAN A;  3DK4 A;  4X4J A;  2GV8 A;  3ALJ A;  4APN A;  3IHM A;  2GF3 A;  4YSX A;  4KPR A;  1F8W A;  1KSS A;  4YTN A;  3KPK A;  1VG0 A;  3I3L A;  1DJN A;  4B67 A;  4C3X A;  5IPY A;  3AWI A;  4OPT A;  3KU9 A;  5C2T A;  4H4Z A;  4H4R A;  3CNJ A;  2QCU A;  2YVJ A;  2C70 A;  4Z24 A;  5KNL A;  1CC4 A;  3G5R A;  4NZH A;  2DKI A;  3NYC A;  4AP1 A;  2WPC A;  3L1R A;  1ZY8 A;  2FJE A;  1L0V A;  2BC1 A;  4BK1 A;  2B9Y A;  1ZDL A;  4OPD A;  4Y4L A;  2Q0L A;  5EB4 A;  1Q1R A;  1BGN A;  1CJC A;  3UOX A;  4YSH A;  1D4D A;  3NNE A;  2WET A;  4TLZ A;  1DJQ A;  3QSS A;  4H2Q A;  1F8R A;  5DBJ A;  3NT6 A;  4OPU A;  3P4S A;  4E0V A;  3KD9 A;  3CN8 A;  4K22 A;  3UOY A;  1GRF A;  3LJP A;  4G9K A;  4U2T A;  4BJY A;  4OCG A;  3AEC A;  1QO8 A;  1VRQ B;  1VG9 A;  3AEF A;  3K30 A;  3LZX A;  4K5S A;  2R0C A;  4P9S A;  3ZDN A;  4WCT A;  3NTA A;  2QA2 A;  4IA5 A;  3AB1 A;  4ICY A;  3PVC A;  2C76 A;  2QAE A;  4EIQ A;  5KOX A;  2WU5 A;  2DKH A;  3ICR A;  4J33 A;  3B3R A;  2GR2 A;  3R9U A;  4JN9 A;  4YTP A;  2BRA A;  3G5Q A;  3NGC X;  2YLX A;  2JAE A;  3IWA A;  1GAL A;  2OAL A;  1KSU A;  2BS4 A;  3M12 A;  4B69 A;  3CGB A;  1ZKQ A;  2F5Z A;  4JNQ A;  2YG4 A;  4Y4M A;  3DGH A;  1PN0 A;  1F8S A;  3AE8 A;  5KMR A;  1GSN A;  1Q1W A;  2XVH A;  3NK1 X;  4U8J A;  2YLR A;  1MOK A;  3NYE A;  3AE7 A;  4EMJ A;  1TDK A;  1KFY A;  3URH A;  4GF7 A;  3SQP A;  3DJD A;  4GRT A;  4G74 A;  4U8K A;  3AYI A;  1FEC A;  3CNT A;  2XYO A;  2YVF A;  2BA9 A;  2OA1 A;  4H4S A;  2BRY A;  5JCL A;  2X3N A;  1FEA A;  1NEK A;  1YY5 A;  5KMQ A;  3BHK A;  2R4E A;  3FBS A;  3OC4 A;  4CCR A;  3AEA A;  4GDP A;  1D4E A;  3BI2 A;  4J56 A;  1BWC A;  2C64 A;  3NH3 X;  3K7T A;  2BAC A;  2J3N A;  1Y0P A;  2WP5 A;  4RG4 A;  2WBA A;  3ITJ A;  2R46 A;  5CKU A;  5IQ4 A;  1IUV A;  1F3P A;  4FK1 C;  3GMC A;  2BXS A;  1CBO A;  5JCK A;  1FCD A;  1LVL A;  4AT0 A;  1XPQ A;  2YR4 A;  3CPH G;  4C5O A;  5M0Z A;  3SZ0 A;  1S2Q A;  2YLZ A;  1E7P A;  3DA1 A;  1GRA A;  3NK2 X;  2JK6 A;  3AD8 B;  4IV9 A;  3SYI A;  3VRB A;  4RSL A;  2WHD A;  4FX9 A;  2V3B A;  2AR8 A;  2GR3 A;  1H83 A;  1JNR A;  1O94 A;  4ZCC A;  2X8C A;  2YR5 A;  2XFU A;  1PBE A;  1NG3 A;  2NPX A;  3FIM B;  4TM3 A;  3DJJ A;  2YAU A;  2JB1 A;  1PHH A;  2GR1 A;  1JNZ A;  2H88 A;  3CNS A;  1PXA A;  1M6I A;  4OPG A;  3T31 A;  3LB8 A;  4H4P A;  1VDC A;  3RHA A;  4H2R A;  1PBB A;  5U1O A;  2XLR A;  3S5W A;  2AAQ A;  2CFY A;  2WS3 A;  3SZF A;  1PBF A;  1QLB A;  3DH9 A;  5JCN A;  1BF3 A;  4U8O A;  1K0L A;  4Z2T A;  3F8P A;  3QVR A;  4OPC A;  3QFA A;  3ALL A;  1CJ2 A;  3T0K A;  2YLT A;  4JDR A;  4J36 A;  1JRZ A;  2RGO A;  3F8R A;  3T2Y A;  4EQW A;  4ECH A;  2JB2 A;  1Y56 A;  2JBV A;  2NVK X;  2WOV A;  2IVD A;  3SFD A;  4B63 A;  1BGJ A;  2XLU A;  1MXT A;  2WU2 A;  5FS8 A;  4YSY A;  1TRB A;  3T37 A;  3LXD A;  4A6N B;  2WPF A;  3RNM A;  4DSG A;  3DK9 A;  4B64 A;  4TLX A;  3IHG A;  1KNR A;  1PBC A;  1TDO A;  1H7X A;  3GSI A;  1IJH A;  3GWF A;  1RYI A;  4LU6 A;  1DOC A;  3LOV A;  4BUR A;  1OJT A;  3KLJ A;  4XWZ A;  1PBD A;  1B4V A;  4A65 A;  2CUL A;  2R0G A;  1F6M A;  2A89 A;  1GET A;  3BHF A;  3HYX A;  4U8N A;  2TMD A;  5GRT A;  1CJ3 A;  4H4U A;  1GV4 A;  1NHS A;  2WOI A;  3HYV A;  2OLO A;  1B8S A;  2YG5 A;  1BZL A;  4H4T A;  4A79 A;  2GRT A;  3NTD A;  3ALM A;  3P4P A;  1E1M A;  4JY2 A;  3FPZ A;  3T14 A;  4K5R A;  3SZW A;  4U2S A;  4B66 A;  1H82 A;  2WDQ A;  5BRT A;  4O5Q A;  2W0H A;  4JQ9 A;  5KVI A;  4Z26 A;  3G5S A;  3UOV A;  2TPR A;  2XCG A;  5J60 A;  2BYB A;  1P2H A;  3ADA B;  4GR1 A;  2APG A;  3C4A A;  2RAB A;  4HB9 A;  2R9Z A;  3SY4 A;  4AP3 A;  4BV6 A;  1TDF A;  2X50 A;  3I6D A;  2XLP A;  1N4W A;  1S3E A;  2WES A;  3ATQ A;  5BVA A;  2XLT A;  1NPX A;  2ARD A;  3RP6 A;  1ZMD A;  1L9E A;  3DME A;  1LQT A;  3NLC A;  1KDG A;  1D4C A;  5J7X A;  5KWF A;  2YLW A;  1DOD A;  4O5U A;  3P4Q A;  1E1L A;  4YKG A;  1DXL A;  1JRY A;  3UKH A;  3UOZ A;  5JCM A;  1IUS A;  5U25 A;  3Q9T A;  4H4V A;  5FS9 A;  5BUK A;  3CPI G;  1X31 B;  1L9C A;  3CND A;  4H2P A;  1H6V A;  1KNP A;  3CMM A;  3UTG A;  2YM1 A;  3KA7 A;  1COY A;  3NKS A;  4D03 A;  2H89 A;  4Z25 A;  3UKQ A;  1JEH A;  2BK5 A;  3AEE A;  3LZW A;  1NAA A;  3DGZ A;  5EB5 A;  1OJD A;  2FBW A;  3EF6 A;  5IQ1 A;  1NEN A;  3AYJ A;  3V3O A;  3PS9 A;  3O0H A;  2GAG B;  2XVI A;  3HYW A;  4IVM B;  3SXI A;  1RSG A;  4JNA A;  2O9Z A;  2Y6Q A;  4Z2R A;  3UKK A;  2BS3 A;  1ELI A;  2IVE A;  3DK8 A;  4YTM A;  4H4W A;  3ICT A;  1Y56 B;  1GOS A;  4AOX A;  1ONF A;  2PYX A;  3VR9 A;  1PXC A;  4X9M A;  4UDQ A;  2BCG G;  2ZZC A;  2VVL A;  3NN6 X;  3E1T A;  3BI4 A;  3AE6 A;  2WPE A;  3CPJ G;  3VQR A;  2GMH A;  1H84 A;  2E4G A;  3T2K A;  1TDN A;  3II4 A;  2B76 A;  4EMI A;  4GAV A;  3PO7 A;  4Z44 A;  4ZN0 A;  1B5Q A;  1DNC A;  1Z6L A;  3AE4 A; 
#chains in the Genus database with same CATH homology
 2Z5Y A;  3P1W A;  1N4U A;  3NHO X;  2WP9 A;  4TM1 A;  4U8L A;  4I59 A;  1BKW A;  2GQF A;  2WOW A;  4U2L A;  1H86 A;  3V76 A;  1E39 A;  1PJ7 A;  1EL8 A;  1GTH A;  5GSN A;  1OJA A;  3AEG A;  2FJA A;  2FJD A;  1MO9 A;  3GYJ A;  4DGK A;  2Q7V A;  4G73 A;  1GES A;  3HZL A;  4CBQ A;  1GER A;  1GND A;  1EL5 A;  4MJW A;  3EPT A;  1XDI A;  1RP0 A;  2V3A A;  3KVE A;  4OPI A;  2VRM A;  1V59 A;  4U8P A;  3FMW A;  4XWR A;  4YWO A;  5HXI A;  1YQZ A;  4HA6 A;  2JKC A;  1O95 A;  3GWD A;  4K7Z A;  4II3 A;  2XVE A;  1O5W A;  2XFQ A;  2XLS A;  4X9N A;  5KMS A;  2YLS A;  1B37 A;  1CF3 A;  2EQ8 A;  3EAO A;  1P2E A;  2YWL A;  3GMB A;  3UTH A;  2C72 A;  1Q9I A;  4II2 A;  5HY5 A;  5ER0 A;  4A7A A;  1AOG A;  3UP4 A;  2XVJ A;  4DSH A;  2C66 A;  1ZX9 A;  1GT8 A;  1JRX A;  4A5L A;  2B9X A;  4H4Y A;  3BNU A;  5FMH A;  2YVG A;  3V3N A;  1NG4 A;  2GAH B;  3AE9 A;  3SM8 A;  1EL7 A;  2BC0 A;  2E1M A;  5U63 A;  3GD3 A;  4G6H A;  1KF6 A;  1TYP A;  3ABV A;  3CIR A;  4K2X A;  4LII A;  2C7G A;  4NNJ A;  2C3D A;  4M52 A;  4AOS A;  2VQ7 A;  2OLN A;  4ZCD A;  3GDN A;  3AYL A;  3LAD A;  4YT0 A;  4GAP A;  1H81 A;  3QSE A;  4OPL A;  3C96 A;  5TR3 A;  2HQM A;  5EOW A;  2IID A;  4H4Q A;  4NWZ A;  4OVI A;  1XHC A;  2BK3 A;  3H4K A;  2R4J A;  1IUW A;  2V61 A;  3CTY A;  4Z2U A;  3D8X A;  4EIP A;  4REK A;  4EM4 A;  4A99 A;  4BK2 A;  3AED A;  4NEW A;  3NIX A;  2EQ7 A;  2XFN A;  4PAB A;  3AXB A;  1LV0 A;  1TDE A;  1S2Y A;  4ADW A;  4C3Y A;  1JOA A;  1JU2 A;  1GRB A;  4AT2 A;  1N1P A;  1ZK7 A;  4EQX A;  4B1B A;  2WDV A;  2C67 A;  3M0O A;  2GVC A;  3Q6J A;  4B68 A;  3UTF A;  1L9D A;  3EAN A;  2X8H A;  2R45 A;  3COX A;  3SX6 A;  4N9X A;  3WE0 A;  1CL0 A;  1REO A;  3T2Z A;  4BK3 A;  3KPF A;  3C4N A;  3GD4 A;  2Z5X A;  1TYT A;  5CQF A;  2VVM A;  4BJZ A;  2C4C A;  3ATR A;  4LA1 A;  2E5V A;  2YM2 A;  2ZZB A;  4D04 A;  3GRT A;  1M64 A;  4FK1 A;  3BI5 A;  2GH5 A;  4EQR A;  2RGH A;  4NTD A;  4CNK A;  2Y6R A;  1W4X A;  2V5Z A;  1OJ9 A;  1LTX R;  1EL9 A;  4UP3 A;  1K4Q A;  4C74 A;  5KOW A;  1YQ4 A;  5EBK A;  3H8L A;  3RP7 A;  1CC6 A;  3GDP A;  2WDR A;  2GEW A;  3IC9 A;  2V6O A;  2X8G A;  2X99 A;  4EM3 A;  1ZOV A;  1VQW A;  4J31 A;  3AE2 A;  2VVL G;  3CGD A;  3SGL A;  3VRA A;  2C73 A;  2Q0K A;  1GPE A;  4IVO B;  5KVH A;  4G6G A;  1SEZ A;  1HYU A;  4GDE A;  1NHQ A;  4CRT A;  1NHP A;  2VRL A;  4PAA A;  1N4V A;  1DOB A;  1GTE A;  2CVJ A;  4RG3 A;  1QJD A;  1LJ1 A;  3VR8 A;  4CCQ A;  5HYM A;  2Q6U A;  2C65 A;  3IF9 A;  3UP5 A;  5BUL A;  3QJ4 A;  5LV9 A;  1E1N A;  3OZ2 A;  3H8I A;  2AQJ A;  2QA1 A;  1GRE A;  4B65 A;  2OAM A;  2C3C A;  1OJC A;  2FJB A;  2A8X A;  2GMJ A;  3B6D A;  3QVP A;  4H4X A;  2XFP A;  2PHH A;  2BAB A;  3GRS A;  2YG7 A;  3QFB A;  4YXD A;  4TM0 A;  2CDU A;  1YKJ A;  1EBD A;  5HHF A;  4IA6 A;  5C3J A;  2R0P A;  1LQU A;  3AE1 A;  1E1K A;  3FG2 P;  1GRT A;  4DNA A;  3BNM A;  1GRH A;  4WX1 A;  4NTE A;  1PS9 A;  4USR A;  4CY8 A;  4EQS A;  1H7W A;  2XDO A;  1IUT A;  3UKL A;  2VOU A;  4UDP A;  4YSZ A;  1LPF A;  4J2W A;  3S61 A;  2V60 A;  3UKF A;  1NHR A;  3DJE A;  1PJ5 A;  3AEB A;  4C77 A;  3M13 A;  3ZYX A;  2WQY A;  4EMW A;  3K7M X;  2B7R A;  3GYX A;  3UCL A;  1CJ4 A;  3AD7 B;  2WP6 A;  2GQW A;  1IUU A;  3DJG X;  4H50 A;  4A9W A;  2A87 A;  2ZBW A;  1ZP0 A;  2YR6 A;  2VZ2 A;  3K7Q X;  1YQ3 A;  4JY3 A;  4CNJ A;  4H2N A;  4KX6 A;  4Z43 A;  3SZC A;  2VQB A;  2BS2 A;  3NK0 X;  3NRN A;  4GCM A;  2JB3 A;  1K0I A;  4NEV A;  4FDC B;  1CC2 A;  2UZZ A;  3CGE A;  3ISH A;  3KKJ A;  5KXJ A;  4J34 A;  2WEU A;  4GUV A;  4U8I A;  3NG7 X;  3SFE A;  1CHU A;  1PXB A;  1FL2 A;  1S3B A;  2B7S A;  5KMP A;  4USQ A;  2YG3 A;  4UDR A;  5M10 A;  1FOH A;  3RED A;  4H7U A;  5FS7 A;  3ICS A;  1D7Y A;  4CY6 A;  2ACZ A;  1ZMC A;  3GYI A;  3AE5 A;  3AE3 A;  3P9U A;  1K0J A;  3L8K A;  4U8M A;  4A6N A;  3NN0 X;  4Y4N A;  2BCP A;  3VRD B;  1GEU A;  3QSM A;  1UKV G;  1GXF A;  2YG6 A;  1DOE A;  3NYF A;  1NDA A;  3UKA A;  3AD9 B;  2XVF A;  1FEB A;  1PJ6 A;  2ZZ0 A;  4YKF A;  4I58 A;  1D5T A;  3CNP A;  1ZOY A;  1GRG A;  2BXR A;  2I0Z A;  2EQ6 A;  3P4R A;  3JSK A;  5KRQ A;  2GR0 A;  4XXG A;  2C75 A;  2EQ9 A;  2B9W A;  4NTC A;  1E6E A;  1PDH A;  3CGC A;  3D1C A;  2YQU A;  4J57 A;  1IUX A;  3F8D A;  5FS6 A;  3RP8 A;  5JCI A;  5L46 A;  4K8D A;  3UTE A;  4TM4 A;  3UKP A;  2GB0 A;  2BK4 A;  2XFO A;  2RGJ A;  1D7L A;  1XAN A;  3DK4 A;  4X4J A;  2GV8 A;  3ALJ A;  4APN A;  3IHM A;  2GF3 A;  4YSX A;  4KPR A;  1F8W A;  1KSS A;  4YTN A;  3KPK A;  1VG0 A;  3I3L A;  1DJN A;  4B67 A;  4C3X A;  5IPY A;  3AWI A;  4OPT A;  3KU9 A;  5C2T A;  4H4Z A;  4H4R A;  3CNJ A;  2QCU A;  2YVJ A;  2C70 A;  4Z24 A;  5KNL A;  1CC4 A;  3G5R A;  4NZH A;  2DKI A;  3NYC A;  4AP1 A;  2WPC A;  3L1R A;  1ZY8 A;  2FJE A;  1L0V A;  2BC1 A;  4BK1 A;  2B9Y A;  1ZDL A;  4OPD A;  4Y4L A;  2Q0L A;  5EB4 A;  1Q1R A;  1BGN A;  1CJC A;  3UOX A;  4YSH A;  1D4D A;  3NNE A;  2WET A;  4TLZ A;  1DJQ A;  3QSS A;  4H2Q A;  1F8R A;  5DBJ A;  3NT6 A;  4OPU A;  3P4S A;  4E0V A;  3KD9 A;  3CN8 A;  4K22 A;  3UOY A;  1GRF A;  3LJP A;  4G9K A;  4U2T A;  4BJY A;  4OCG A;  3AEC A;  1QO8 A;  1VRQ B;  1VG9 A;  3AEF A;  3K30 A;  3LZX A;  4K5S A;  2R0C A;  4P9S A;  3ZDN A;  4WCT A;  3NTA A;  2QA2 A;  4IA5 A;  3AB1 A;  4ICY A;  3PVC A;  2C76 A;  2QAE A;  4EIQ A;  5KOX A;  2WU5 A;  2DKH A;  3ICR A;  4J33 A;  3B3R A;  2GR2 A;  3R9U A;  4JN9 A;  4YTP A;  2BRA A;  3G5Q A;  3NGC X;  2YLX A;  2JAE A;  3IWA A;  1GAL A;  2OAL A;  1KSU A;  2BS4 A;  3M12 A;  4B69 A;  3CGB A;  1ZKQ A;  2F5Z A;  4JNQ A;  2YG4 A;  4Y4M A;  3DGH A;  1PN0 A;  1F8S A;  3AE8 A;  5KMR A;  1GSN A;  1Q1W A;  2XVH A;  3NK1 X;  4U8J A;  2YLR A;  1MOK A;  3NYE A;  3AE7 A;  4EMJ A;  1TDK A;  1KFY A;  3URH A;  4GF7 A;  3SQP A;  3DJD A;  4GRT A;  4G74 A;  4U8K A;  3AYI A;  1FEC A;  3CNT A;  2XYO A;  2YVF A;  2BA9 A;  2OA1 A;  4H4S A;  2BRY A;  5JCL A;  2X3N A;  1FEA A;  1NEK A;  1YY5 A;  5KMQ A;  3BHK A;  2R4E A;  3FBS A;  3OC4 A;  4CCR A;  3AEA A;  4GDP A;  1D4E A;  3BI2 A;  4J56 A;  1BWC A;  2C64 A;  3NH3 X;  3K7T A;  2BAC A;  2J3N A;  1Y0P A;  2WP5 A;  4RG4 A;  2WBA A;  3ITJ A;  2R46 A;  5CKU A;  5IQ4 A;  1IUV A;  1F3P A;  4FK1 C;  3GMC A;  2BXS A;  1CBO A;  5JCK A;  1FCD A;  1LVL A;  4AT0 A;  1XPQ A;  2YR4 A;  3CPH G;  4C5O A;  5M0Z A;  3SZ0 A;  1S2Q A;  2YLZ A;  1E7P A;  3DA1 A;  1GRA A;  3NK2 X;  2JK6 A;  3AD8 B;  4IV9 A;  3SYI A;  3VRB A;  4RSL A;  2WHD A;  4FX9 A;  2V3B A;  2AR8 A;  2GR3 A;  1H83 A;  1JNR A;  1O94 A;  4ZCC A;  2X8C A;  2YR5 A;  2XFU A;  1PBE A;  1NG3 A;  2NPX A;  3FIM B;  4TM3 A;  3DJJ A;  2YAU A;  2JB1 A;  1PHH A;  2GR1 A;  1JNZ A;  2H88 A;  3CNS A;  1PXA A;  1M6I A;  4OPG A;  3T31 A;  3LB8 A;  4H4P A;  1VDC A;  3RHA A;  4H2R A;  1PBB A;  5U1O A;  2XLR A;  3S5W A;  2AAQ A;  2CFY A;  2WS3 A;  3SZF A;  1PBF A;  1QLB A;  3DH9 A;  5JCN A;  1BF3 A;  4U8O A;  1K0L A;  4Z2T A;  3F8P A;  3QVR A;  4OPC A;  3QFA A;  3ALL A;  1CJ2 A;  3T0K A;  2YLT A;  4JDR A;  4J36 A;  1JRZ A;  2RGO A;  3F8R A;  3T2Y A;  4EQW A;  4ECH A;  2JB2 A;  1Y56 A;  2JBV A;  2NVK X;  2WOV A;  2IVD A;  3SFD A;  4B63 A;  1BGJ A;  2XLU A;  1MXT A;  2WU2 A;  5FS8 A;  4YSY A;  1TRB A;  3T37 A;  3LXD A;  4A6N B;  2WPF A;  3RNM A;  4DSG A;  3DK9 A;  4B64 A;  4TLX A;  3IHG A;  1KNR A;  1PBC A;  1TDO A;  1H7X A;  3GSI A;  1IJH A;  3GWF A;  1RYI A;  4LU6 A;  1DOC A;  3LOV A;  4BUR A;  1OJT A;  3KLJ A;  4XWZ A;  1PBD A;  1B4V A;  4A65 A;  2CUL A;  2R0G A;  1F6M A;  2A89 A;  1GET A;  3BHF A;  3HYX A;  4U8N A;  2TMD A;  5GRT A;  1CJ3 A;  4H4U A;  1GV4 A;  1NHS A;  2WOI A;  3HYV A;  2OLO A;  1B8S A;  2YG5 A;  1BZL A;  4H4T A;  4A79 A;  2GRT A;  3NTD A;  3ALM A;  3P4P A;  1E1M A;  4JY2 A;  3FPZ A;  3T14 A;  4K5R A;  3SZW A;  4U2S A;  4B66 A;  1H82 A;  2WDQ A;  5BRT A;  4O5Q A;  2W0H A;  4JQ9 A;  5KVI A;  4Z26 A;  3G5S A;  3UOV A;  2TPR A;  2XCG A;  5J60 A;  2BYB A;  1P2H A;  3ADA B;  4GR1 A;  2APG A;  3C4A A;  2RAB A;  4HB9 A;  2R9Z A;  3SY4 A;  4AP3 A;  4BV6 A;  1TDF A;  2X50 A;  3I6D A;  2XLP A;  1N4W A;  1S3E A;  2WES A;  3ATQ A;  5BVA A;  2XLT A;  1NPX A;  2ARD A;  3RP6 A;  1ZMD A;  1L9E A;  3DME A;  1LQT A;  3NLC A;  1KDG A;  1D4C A;  5J7X A;  5KWF A;  2YLW A;  1DOD A;  4O5U A;  3P4Q A;  1E1L A;  4YKG A;  1DXL A;  1JRY A;  3UKH A;  3UOZ A;  5JCM A;  1IUS A;  5U25 A;  3Q9T A;  4H4V A;  5FS9 A;  5BUK A;  3CPI G;  1X31 B;  1L9C A;  3CND A;  4H2P A;  1H6V A;  1KNP A;  3CMM A;  3UTG A;  2YM1 A;  3KA7 A;  1COY A;  3NKS A;  4D03 A;  2H89 A;  4Z25 A;  3UKQ A;  1JEH A;  2BK5 A;  3AEE A;  3LZW A;  1NAA A;  3DGZ A;  5EB5 A;  1OJD A;  2FBW A;  3EF6 A;  5IQ1 A;  1NEN A;  3AYJ A;  3V3O A;  3PS9 A;  3O0H A;  2GAG B;  2XVI A;  3HYW A;  4IVM B;  3SXI A;  1RSG A;  4JNA A;  2O9Z A;  2Y6Q A;  4Z2R A;  3UKK A;  2BS3 A;  1ELI A;  2IVE A;  3DK8 A;  4YTM A;  4H4W A;  3ICT A;  1Y56 B;  1GOS A;  4AOX A;  1ONF A;  2PYX A;  3VR9 A;  1PXC A;  4X9M A;  4UDQ A;  2BCG G;  2ZZC A;  2VVL A;  3NN6 X;  3E1T A;  3BI4 A;  3AE6 A;  2WPE A;  3CPJ G;  3VQR A;  2GMH A;  1H84 A;  2E4G A;  3T2K A;  1TDN A;  3II4 A;  2B76 A;  4EMI A;  4GAV A;  3PO7 A;  4Z44 A;  4ZN0 A;  1B5Q A;  1DNC A;  1Z6L A;  3AE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...