4FK1C

Crystal structure of putative thioredoxin reductase trxb from bacillus anthracis
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
299
structure length
298
Chain Sequence
YIDCAVIGAGPAGLNASLVLGRARKQIALFDNNTNRNRVTQNSHGFITRDGIKPEEFKEIGLNEVKYPSVHYYEKTVVMITKQSTGLFEIVTKDHTKYLAERVLLATGMQEEFPSIPNVREYYGKSLFSCPYCDGWELKDQPLIIISENEDHTLHMTKLVYNWSTDLVIATNGNELSQTIMDELSNKNIPVITESIRTLQGEGGYLKKVEFHSGLRIERAGGFIVPTFFRPNQFIEQLGCELQSNGTFVIDDFGRTSEKNIYLAGETTTQGPSSLIIAASQGNKAAIAINSDITDERF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thioredoxin reductase
publication title Crystal Structure of Putative Thioredoxin Reductase TrxB from Bacillus anthracis
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 89
structure length 298
sequence length 299
ec nomenclature
pdb deposition date 2012-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4fk1C02
5L46A 2ZZCA 3AE9A 2B9WA 1TDOA 2WOIA 2EQ9A 1BWCA 2B9YA 1XANA 1N4WA 1CC4A 3SGLA 1XHCA 5U25A 1GALA 5HYMA 2VOUA 4K7ZA 3IHMA 3ALMA 3H4KA 4NTDA 2PYXA 2YR5A 2IVDA 4CCRA 4EMWA 4B64A 1N1PA 2WOWA 2F5ZA 4CRTA 1TYPA 3AEDA 4Z26A 2Q7VA 1ZOYA 1BF3A 2Z5YA 3BHKA 2C72A 5KWFA 2TPRA 3Q9TA 5C2TA 2J3NA 4HB9A 3AEEA 5FS6A 5CKUA 3G5SA 3V76A 2C65A 3VRAA 3DA1A 3KKJA 3DJGX 2IVEA 1PBFA 3ZDNA 1JEHA 2OALA 3CPHG 4KPRA 1GTEA 4K8DA 3UKLA 4UDQA 4YTNA 2Z5XA 4J56A 1ZDLA 5JCIA 1QJDA 1H7WA 2XLSA 4CY6A 3BNUA 2R4EA 3AD7B 3GD4A 1NPXA 4MJWA 4BJYA 4A65A 4LIIA 2GVCA 4J36A 4X9NA 4NZHA 2VRLA 2WQYA 3CNDA 1E1KA 2EQ8A 1CC2A 1EL9A 3AE6A 4K22A 2GV8A 3K30A 4NTCA 2WETA 2WPCA 5KXJA 1D7LA 2GQWA 1IUXA 4BJZA 4UDRA 4WCTA 1NHRA 1Q1WA 2X8GA 3URHA 3QFAA 4KX6A 4Y4LA 3CGCA 3RP8A 5FMHA 3NH3X 3KA7A 2E5VA 3NTDA 4OPUA 1EL5A 2XVEA 2XVJA 3NT6A 4B66A 2TMDA 4LA1A 4H7UA 1JU2A 1DOCA 4IVMB 4EM4A 2UZZA 1F6MA 4O5UA 3NKSA 3UTHA 4A99A 3NG7X 1CL0A 2Q0LA 3G5QA 4H4TA 1LVLA 2XLTA 3UP4A 2C3DA 3EANA 1GETA 2OAMA 3NNEA 2YG5A 4IV9A 1ZKQA 3ITJA 3CNJA 2XVFA 1GT8A 3DGHA 3PO7A 2YWLA 4Z24A 4TLZA 4A6NA 4CY8A 4Z2UA 2WU2A 2YR4A 3JSKA 2ACZA 4H4PA 3V3OA 2JBVA 1Q9IA 1GESA 2GRTA 2DKHA 2Q6UA 4C3XA 1GOSA 4H4XA 3UCLA 4BURA 1OJDA 1NENA 1K0IA 2V3BA 3AB1A 3DGZA 4I59A 1N4VA 1TDNA 1KNPA 1PHHA 1L0VA 1FEAA 1JNZA 2BCGG 4HA6A 3SQPA 1D4EA 2NVKX 3D8XA 2RGJA 2VVLG 4Z25A 3KU9A 1JNRA 2YLTA 3NGCX 2VVMA 4EIQA 1P2EA 4GR1A 5KVIA 2WP6A 2V3AA 4C77A 3CNTA 2YLXA 1DJNA 3RP7A 3AEGA 1IUWA 1JOAA 4WX1A 5M0ZA 3VR8A 1PBEA 3NK2X 4U2TA 1GEUA 3M12A 5FS8A 2YVGA 1YY5A 2VVLA 2B9XA 4Z44A 2EQ6A 4C5OA 4EIPA 1CBOA 1COYA 4A9WA 3FMWA 3UP5A 1YQZA 1GNDA 2XFNA 2C7GA 2Y6QA 2R4JA 4JY3A 2A89A 2GMHA 2BC1A 3B3RA 3AE1A 2WS3A 2XCGA 1CJCA 1M64A 2YG3A 1GV4A 3P1WA 4UDPA 4RSLA 4EMIA 3ATQA 3ZYXA 4PABA 3GDPA 1H81A 1H82A 2GF3A 1FECA 2BK5A 2YLWA 4BK3A 4EQRA 3EPTA 3Q6JA 2WU5A 1E1LA 1ZY8A 3QSMA 5FS7A 4A5LA 2WP5A 4U8NA 2C64A 3CGBA 2YVFA 3DJJA 2C73A 1VG9A 2WESA 2WP9A 2C75A 2YLRA 3NYFA 1NG4A 2C3CA 2GMJA 3ICSA 4A79A 4FK1C 2JKCA 1DOBA 3BI2A 3QJ4A 2JB1A 3UOVA 1QLBA 3GYJA 1D4CA 1FL2A 5EB5A 3UKFA 3VRBA 3AE5A 2VQBA 3SM8A 3C4NA 3AE7A 1NHSA 4B69A 1ONFA 4DGKA 1L9DA 4FDCB 4Z2RA 4M52A 2Y6RA 4YWOA 2CULA 3ABVA 3UOYA 1BKWA 2BK3A 5HHFA 4DSGA 1NG3A 2X8HA 1KSUA 3II4A 2H89A 5EOWA 4OPLA 2BACA 4YSHA 3P4SA 3QFBA 2GQFA 1B8SA 4D03A 1O5WA 4YKGA 5GSNA 5J7XA 4TM4A 5HY5A 1EBDA 4J33A 2EQ7A 4B1BA 2FJEA 4H4UA 1IUUA 2GB0A 3UKHA 1PXBA 1GRFA 1ZMCA 3DJDA 3EAOA 3FPZA 3RNMA 4H2QA 4Z43A 3UTEA 4C74A 4X9MA 5JCLA 3R9UA 2X8CA 3QSSA 5KOXA 3NTAA 1GPEA 2GR3A 3F8PA 3OZ2A 1ZP0A 1BGNA 3UKKA 3GD3A 1LQTA 1Y0PA 1X31B 1TYTA 4BK1A 1ZK7A 1VG0A 3KD9A 3K7QX 1LTXR 2C70A 4YSXA 3C96A 2AAQA 2GR1A 4AOXA 4H4QA 4OVIA 4AT0A 3LZWA 4NEVA 3LJPA 3ICTA 2HQMA 1Y56A 3KLJA 1SEZA 3NN6X 3FIMB 4H2PA 1V59A 3QVPA 1F8WA 5JCNA 2V5ZA 1TDEA 2Q0KA 2BK4A 2VZ2A 1E1MA 4EM3A 2XLRA 3K7MX 2C67A 4TM3A 4H4SA 5BUKA 2BS3A 1H83A 5M10A 4APNA 2XDOA 2BXRA 3AYIA 3CN8A 3GWDA 1PJ5A 3AXBA 3AEBA 2AR8A 4Z2TA 4O5QA 1GXFA 1PBCA 1PBDA 3COXA 3DK4A 4TM1A 4DNAA 3DK9A 2QA1A 3P4PA 2R0PA 3IF9A 1GREA 1JRXA 1GRHA 4YT0A 3NN0X 2XFQA 4GDPA 3LOVA 4YSYA 3UKPA 5KRQA 3UKQA 2WDRA 1VQWA 3NK0X 4H4VA 3AEAA 3EF6A 1XDIA 3UKAA 4ZCDA 2H88A 3T37A 1PS9A 4XWRA 3L8KA 3SFEA 3PVCA 4H4WA 4B65A 1O95A 2ARDA 3ADAB 3FBSA 4YKFA 4ADWA 3L1RA 2B76A 4CBQA 1D5TA 5BVAA 2B7SA 1KSSA 1OJCA 1NAAA 1IJHA 2JB2A 3BNMA 2WPEA 3GRSA 1TRBA 3QSEA 3NYEA 4OPIA 4Y4NA 1H84A 1N4UA 3I6DA 3VQRA 3HZLA 3AECA 4TM0A 1TDKA 1E6EA 1O94A 2WPFA 2YLSA 4U8OA 2JAEA 1K4QA 1LQUA 2OA1A 1B5QA 1ZOVA 4AT2A 1RYIA 3AWIA 1F8RA 1NDAA 2R9ZA 1GRTA 1OJAA 4REKA 2OLOA 2R0GA 1TDFA 2GEWA 4XXGA 5C3JA 4U8MA 2RGOA 1JRYA 1PJ7A 3CNPA 3ICRA 4J2WA 4EMJA 1LJ1A 1NHQA 2WDQA 3P4QA 4OPTA 4FK1A 4RG3A 2CVJA 1BGJA 3NLCA 3REDA 4J34A 2QAEA 4IA5A 3ATRA 5ER0A 4H4YA 2JB3A 3LZXA 1FCDA 4IVOB 2BXSA 2WBAA 4H50A 1KNRA 2JK6A 3IWAA 2V60A 5U63A 1YQ4A 4Y4MA 1W4XA 4U8IA 1GERA 4J31A 2RGHA 3E1TA 1REOA 2BS2A 2X3NA 4AP1A 3DJEA 4GF7A 4CCQA 1D7YA 1YKJA 2NPXA 4U2SA 2W0HA 3CTYA 2CDUA 4NEWA 2BC0A 3DMEA 4XWZA 2BABA 3UOXA 2XFUA 4DSHA 4U8LA 4K2XA 1YQ3A 2YM2A 3I3LA 1DOEA 2OLNA 1H7XA 3QVRA 4P9SA 4U2LA 4U8PA 1IUTA 4H4ZA 5FS9A 4AOSA 5IPYA 4ICYA 4I58A 5BRTA 2PHHA 5J60A 4ZN0A 3G5RA 2FJAA 3NIXA 4LU6A 1PXCA 1AOGA 2VRMA 1CC6A 3KVEA 4EQWA 2X99A 1B4VA 3V3NA 1S2QA 2XYOA 5JCKA 4CNKA 2O9ZA 4U8KA 1MOKA 3GWFA 3OC4A 1FOHA 2VQ7A 1CJ2A 4OPCA 1E7PA 1E39A 4JQ9A 4U8JA 1CHUA 1CJ3A 3C4AA 3FG2P 1L9CA 1S2YA 3CGEA 4N9XA 2XLUA 3ALLA 1MXTA 2X50A 2QA2A 2WDVA 3AYLA 2V6OA 3F8RA 4X4JA 1BZLA 5EBKA 3IC9A 5LV9A 4EQXA 4GDEA 3AEFA 3CIRA 4AP3A 4USQA 2ZZ0A 3WE0A 1Y56B 1F8SA 1OJ9A 5U1OA 2YAUA 2WOVA 1EL8A 2AQJA 3AD9B 3AE2A 1VDCA 3IHGA 3KPFA 3O0HA 4JNQA 4JNAA 4CNJA 1LPFA 1GTHA 2RABA 3VRDB 3PS9A 4YTMA 1PBBA 5KOWA 4ZCCA 2IIDA 5JCMA 2APGA 5GRTA 2YG6A 3CNSA 2I0ZA 1CJ4A 1FEBA 3P4RA 2A8XA 3LXDA 4GRTA 1H6VA 1KFYA 1EL7A 1Q1RA 1RP0A 4A6NB 4C3YA 3RHAA 4OCGA 2FBWA 5BULA 3B6DA 2BS4A 3NRNA 4OPDA 1DNCA 2FJDA 3AE4A 5DBJA 2ZZBA 4GCMA 2YLZA 2GH5A 3BI5A 3UOZA 3GMCA 2R0CA 3NK1X 2E1MA 3DK8A 4PAAA 2ZBWA 2XVHA 2GR2A 1ZMDA 3M0OA 3S61A 4OPGA 4ECHA 3AE3A 3GSIA 1L9EA 4BK2A 3VR9A 5EB4A 2XLPA 3LB8A 3DH9A 3H8LA 1RSGA 3GYIA 2YQUA 1K0JA 2YR6A 1UKVG 3NHOX 2BYBA 1H86A 4A7AA 1F3PA 2WEUA 2CFYA 3K7TA 2XFOA 2BA9A 4H2NA 2C66A 3ALJA 1GSNA 1B37A 2WHDA 1DJQA 2FJBA 2GAGB 1JRZA 1XPQA 4YSZA 4K5RA 3BHFA 2YVJA 2E4GA 5HXIA 2QCUA 4YXDA 2A87A 2BCPA 4EQSA 3P9UA 4K5SA 2YG7A 3SFDA 2YG4A 1D4DA 2B7RA 3CPIG 1PJ6A 2V61A 3CPJG 1IUSA 4UP3A 5IQ4A 2XFPA 5CQFA 3AE8A 1Z6LA 4JN9A 3M13A 1KF6A 3UTFA 4IA6A 3GMBA 1PDHA 3D1CA 2R45A 3AYJA 1S3EA 4B68A 4BV6A 1KDGA 4YTPA 4H4RA 4J57A 1E1NA 3UTGA 1MO9A 1PN0A 3AD8B 4TLXA 3CGDA 1K0LA 1PXAA 5KVHA 3GDNA 2GAHB 4USRA 1DODA 2YM1A 3NYCA 4RG4A 1CF3A 4FX9A 2R46A 5IQ1A 3RP6A 1VRQB 2XVIA 3S5WA 4GUVA 1GRBA 5TR3A 3H8IA 3ISHA 1M6IA 1S3BA 4B63A 1HYUA 1GRAA 2DKIA 4E0VA 1DXLA 3GRTA 1QO8A 4D04A 4JDRA 1IUVA 1GRGA 1NEKA 2C76A 1ELIA 1OJTA 4NTEA 1P2HA 4H2RA 4B67A 1NHPA 3LADA 3F8DA 2GR0A 1LV0A 4JY2A 1ZX9A 3BI4A
chains in the Genus database with same CATH superfamily
5L46A 2ZZCA 3AE9A 2B9WA 1TDOA 2WOIA 2EQ9A 1BWCA 2B9YA 1XANA 1N4WA 1CC4A 3SGLA 1XHCA 5U25A 1GALA 5HYMA 2VOUA 4K7ZA 3IHMA 3ALMA 3H4KA 4NTDA 2PYXA 2YR5A 4G73A 2IVDA 4CCRA 4B64A 4EMWA 1N1PA 2WOWA 2F5ZA 4CRTA 1TYPA 3AEDA 3SZCA 4Z26A 2Q7VA 1ZOYA 1BF3A 2Z5YA 3BHKA 2C72A 5KWFA 2TPRA 3Q9TA 5C2TA 2J3NA 4HB9A 3AEEA 4II2A 5FS6A 5CKUA 3G5SA 3V76A 2C65A 3VRAA 3DA1A 3KKJA 3DJGX 2IVEA 1PBFA 3ZDNA 1JEHA 2BRAA 2OALA 3CPHG 4KPRA 1GTEA 3GYXA 4K8DA 3UKLA 4UDQA 4YTNA 2Z5XA 4J56A 1ZDLA 5JCIA 1QJDA 1H7WA 2XLSA 4CY6A 3BNUA 2R4EA 3AD7B 3GD4A 1NPXA 4MJWA 4BJYA 4A65A 4LIIA 2GVCA 4J36A 4X9NA 4NZHA 2VRLA 2WQYA 3CNDA 1E1KA 2EQ8A 1CC2A 1EL9A 3AE6A 4K22A 2GV8A 3K30A 4NTCA 2WETA 2WPCA 5KXJA 1D7LA 2GQWA 5KMPA 1IUXA 4BJZA 4UDRA 4WCTA 1NHRA 1Q1WA 2X8GA 3SZFA 3URHA 3QFAA 4KX6A 4Y4LA 3CGCA 3RP8A 5FMHA 3NH3X 3KA7A 2E5VA 3NTDA 4OPUA 5KMSA 3T31A 1EL5A 2XVEA 2XVJA 3NT6A 4B66A 2TMDA 4LA1A 4H7UA 1JU2A 1DOCA 4IVMB 4EM4A 2UZZA 1F6MA 3HYWA 3NKSA 4O5UA 3UTHA 4A99A 3NG7X 1CL0A 2Q0LA 3G5QA 4H4TA 1LVLA 2XLTA 3UP4A 2C3DA 3EANA 1GETA 2OAMA 3NNEA 2YG5A 4IV9A 1ZKQA 3ITJA 3CNJA 2XVFA 1GT8A 3DGHA 3PO7A 2YWLA 4Z24A 4TLZA 4A6NA 4CY8A 4Z2UA 4G6HA 2WU2A 2YR4A 3JSKA 2ACZA 4H4PA 3V3OA 2JBVA 1Q9IA 1GESA 2GRTA 2DKHA 2Q6UA 4C3XA 1GOSA 4H4XA 3UCLA 4BURA 3HYVA 1OJDA 1NENA 1K0IA 2V3BA 3AB1A 3DGZA 4I59A 1N4VA 1TDNA 1KNPA 1PHHA 1L0VA 1FEAA 1JNZA 2BCGG 4HA6A 3SQPA 1D4EA 2NVKX 3D8XA 2RGJA 2VVLG 4Z25A 3KU9A 1JNRA 2YLTA 3NGCX 2VVMA 4EIQA 1P2EA 4GR1A 5KVIA 2WP6A 2V3AA 4C77A 3CNTA 2YLXA 1DJNA 3RP7A 3AEGA 1IUWA 1JOAA 4WX1A 5M0ZA 3VR8A 1PBEA 3NK2X 4U2TA 1GEUA 3M12A 5FS8A 2YVGA 4G9KA 1YY5A 2VVLA 2B9XA 4Z44A 2EQ6A 4C5OA 4EIPA 1CBOA 1COYA 4A9WA 3FMWA 3UP5A 1YQZA 1GNDA 2XFNA 2C7GA 2Y6QA 2R4JA 4JY3A 2A89A 2GMHA 2BC1A 3B3RA 3AE1A 2WS3A 2XCGA 1CJCA 1M64A 2YG3A 1GV4A 3P1WA 4UDPA 4RSLA 4EMIA 3ATQA 3ZYXA 4PABA 3GDPA 1H81A 1H82A 2GF3A 1FECA 2BK5A 2YLWA 4BK3A 4EQRA 3EPTA 3Q6JA 2WU5A 1E1LA 1ZY8A 3QSMA 4NWZA 5FS7A 2WP5A 4A5LA 4U8NA 2C64A 3CGBA 2YVFA 3DJJA 2C73A 1VG9A 2WESA 2WP9A 2C75A 2YLRA 3NYFA 1NG4A 2C3CA 2C4CA 2GMJA 3ICSA 4FK1C 4A79A 2JKCA 1DOBA 3BI2A 3QJ4A 2JB1A 3UOVA 1QLBA 3GYJA 1D4CA 1FL2A 5EB5A 3UKFA 3VRBA 3AE5A 2VQBA 3SM8A 3C4NA 3AE7A 1NHSA 4B69A 1ONFA 4II3A 4DGKA 1L9DA 4FDCB 4Z2RA 4M52A 2Y6RA 4YWOA 2CULA 3ABVA 3UOYA 1BKWA 2BK3A 5HHFA 4DSGA 1NG3A 2X8HA 1KSUA 3II4A 2H89A 5EOWA 4OPLA 2BACA 4YSHA 3P4SA 3QFBA 2GQFA 1B8SA 4D03A 1O5WA 4YKGA 5GSNA 5J7XA 4TM4A 5HY5A 1EBDA 4J33A 2EQ7A 4B1BA 2FJEA 4H4UA 1IUUA 2GB0A 3UKHA 1PXBA 5KNLA 1GRFA 1ZMCA 3DJDA 3EAOA 3FPZA 3RNMA 4H2QA 4Z43A 3UTEA 4C74A 4X9MA 5JCLA 3R9UA 2X8CA 3QSSA 5KOXA 3NTAA 1GPEA 2GR3A 3F8PA 3OZ2A 1ZP0A 1BGNA 3UKKA 3GD3A 1LQTA 1Y0PA 1X31B 1TYTA 4BK1A 1ZK7A 1VG0A 3KD9A 3T14A 3K7QX 2BRYA 1LTXR 2C70A 4YSXA 3C96A 2AAQA 2GR1A 4AOXA 4H4QA 4OVIA 4AT0A 3LZWA 4NEVA 3LJPA 3ICTA 2HQMA 1Y56A 3KLJA 1SEZA 3NN6X 3FIMB 4H2PA 1V59A 3QVPA 1F8WA 3CMMA 5JCNA 2V5ZA 1TDEA 2Q0KA 4NNJA 2BK4A 2VZ2A 1E1MA 4G74A 4EM3A 2XLRA 3K7MX 2C67A 4TM3A 4H4SA 5BUKA 2BS3A 1H83A 5M10A 4APNA 2XDOA 2BXRA 3AYIA 3CN8A 3GWDA 1PJ5A 3AXBA 3AEBA 2AR8A 4Z2TA 4O5QA 1GXFA 1PBCA 1PBDA 3COXA 3DK4A 4TM1A 4DNAA 3DK9A 2QA1A 3P4PA 2R0PA 3IF9A 3T2ZA 3T2YA 1GREA 1JRXA 1GRHA 4YT0A 3NN0X 2XFQA 4GDPA 3LOVA 4YSYA 3UKPA 5KRQA 3UKQA 2WDRA 1VQWA 3NK0X 4G6GA 3AEAA 4H4VA 4GAVA 3EF6A 1XDIA 3UKAA 4ZCDA 2H88A 3T37A 1PS9A 4XWRA 3L8KA 3SFEA 3PVCA 4H4WA 4B65A 1O95A 2ARDA 3ADAB 3FBSA 4YKFA 4ADWA 3L1RA 2B76A 4CBQA 1D5TA 5BVAA 2B7SA 1KSSA 1OJCA 1NAAA 1IJHA 2JB2A 3BNMA 2WPEA 3GRSA 4GAPA 1TRBA 3QSEA 3NYEA 4OPIA 4Y4NA 1H84A 1N4UA 3I6DA 3VQRA 3HZLA 3AECA 4TM0A 1TDKA 1E6EA 1O94A 2WPFA 2YLSA 4U8OA 2JAEA 1K4QA 1LQUA 2OA1A 1B5QA 1ZOVA 4AT2A 1RYIA 3AWIA 1F8RA 1NDAA 2R9ZA 1GRTA 1OJAA 4REKA 2OLOA 2R0GA 1TDFA 2GEWA 4XXGA 5C3JA 4U8MA 2RGOA 1JRYA 1PJ7A 3CNPA 3ICRA 4J2WA 4EMJA 1LJ1A 1NHQA 2WDQA 3P4QA 4OPTA 4FK1A 4RG3A 2CVJA 1BGJA 3NLCA 3REDA 4J34A 2QAEA 4IA5A 3ATRA 5ER0A 4H4YA 2JB3A 3LZXA 1FCDA 4IVOB 2BXSA 2WBAA 4H50A 1KNRA 2JK6A 3IWAA 2V60A 5U63A 1YQ4A 4Y4MA 1W4XA 4U8IA 3SZ0A 1GERA 4J31A 2RGHA 3E1TA 1REOA 2BS2A 2X3NA 4AP1A 3DJEA 4GF7A 3SY4A 4CCQA 1D7YA 1YKJA 2NPXA 4U2SA 2W0HA 3CTYA 2CDUA 4NEWA 2BC0A 3DMEA 4XWZA 2BABA 3UOXA 2XFUA 4DSHA 4U8LA 4K2XA 1YQ3A 2YM2A 3I3LA 1DOEA 2OLNA 1H7XA 3QVRA 4P9SA 4U2LA 4U8PA 1IUTA 4H4ZA 5FS9A 4AOSA 5IPYA 4ICYA 4I58A 5BRTA 2PHHA 5J60A 4ZN0A 3G5RA 3SYIA 2FJAA 3NIXA 4LU6A 1PXCA 1AOGA 2VRMA 1CC6A 3KVEA 4EQWA 2X99A 1B4VA 3V3NA 1S2QA 2XYOA 5JCKA 4CNKA 2O9ZA 4U8KA 1MOKA 3GWFA 3OC4A 1FOHA 2VQ7A 1CJ2A 4OPCA 1E7PA 1E39A 4JQ9A 4U8JA 1CHUA 1CJ3A 3C4AA 3FG2P 1L9CA 1S2YA 3CGEA 4N9XA 2XLUA 3ALLA 1MXTA 2X50A 2QA2A 2WDVA 3AYLA 2V6OA 3F8RA 4X4JA 1BZLA 5EBKA 3IC9A 5LV9A 4EQXA 4GDEA 3AEFA 3CIRA 4AP3A 4USQA 2ZZ0A 3WE0A 1Y56B 1F8SA 1OJ9A 5U1OA 2YAUA 2WOVA 1EL8A 2AQJA 3AD9B 3AE2A 1VDCA 3IHGA 3KPFA 3O0HA 4JNQA 4JNAA 3HYXA 4CNJA 1LPFA 1GTHA 2RABA 3VRDB 3PS9A 4YTMA 3KPKA 1PBBA 5KOWA 4ZCCA 2IIDA 5JCMA 2APGA 5GRTA 2YG6A 3CNSA 2I0ZA 1CJ4A 1FEBA 3P4RA 2A8XA 3LXDA 4GRTA 1H6VA 1KFYA 1EL7A 1Q1RA 1RP0A 4A6NB 4C3YA 3RHAA 4OCGA 2FBWA 5BULA 3B6DA 2BS4A 3NRNA 4OPDA 1DNCA 2FJDA 3AE4A 5DBJA 2ZZBA 4GCMA 2YLZA 2GH5A 3BI5A 3UOZA 3GMCA 2R0CA 3NK1X 2E1MA 3DK8A 4PAAA 2ZBWA 2XVHA 2GR2A 1ZMDA 3M0OA 3S61A 4OPGA 3SZWA 3AE3A 4ECHA 3GSIA 3SX6A 1L9EA 4BK2A 3VR9A 5EB4A 2XLPA 3LB8A 3DH9A 3H8LA 1RSGA 3GYIA 2YQUA 1K0JA 2YR6A 1UKVG 3NHOX 2BYBA 1H86A 4A7AA 1F3PA 2WEUA 2CFYA 3K7TA 2XFOA 2BA9A 4H2NA 2C66A 3ALJA 1GSNA 1B37A 2WHDA 1DJQA 2FJBA 2GAGB 1JRZA 1XPQA 4YSZA 4K5RA 3BHFA 2YVJA 2E4GA 5HXIA 2QCUA 5KMRA 3SXIA 4YXDA 2A87A 2BCPA 4EQSA 3P9UA 4K5SA 2YG7A 3SFDA 2YG4A 1D4DA 2B7RA 3CPIG 1PJ6A 2V61A 3CPJG 1IUSA 4UP3A 5IQ4A 2XFPA 5CQFA 3AE8A 1Z6LA 4JN9A 3M13A 1KF6A 3UTFA 4IA6A 3GMBA 1PDHA 3D1CA 2R45A 3AYJA 1S3EA 3T0KA 4B68A 4BV6A 1KDGA 4YTPA 4H4RA 4J57A 1E1NA 3UTGA 1MO9A 1PN0A 3AD8B 4TLXA 3CGDA 3T2KA 1K0LA 1PXAA 5KVHA 3GDNA 2GAHB 4USRA 1DODA 2YM1A 3NYCA 4RG4A 1CF3A 4FX9A 2R46A 5IQ1A 3RP6A 5KMQA 1VRQB 2XVIA 3S5WA 4GUVA 1GRBA 5TR3A 3H8IA 3ISHA 1M6IA 1S3BA 4B63A 1HYUA 1GRAA 2DKIA 4E0VA 1DXLA 3GRTA 1QO8A 4D04A 4JDRA 1IUVA 1GRGA 1NEKA 2C76A 1ELIA 1OJTA 4NTEA 1P2HA 4H2RA 4B67A 1NHPA 3LADA 3F8DA 2GR0A 1LV0A 4JY2A 1ZX9A 3BI4A
chains in the Genus database with same CATH topology
5L46A 2ZZCA 3AE9A 2B9WA 1TDOA 2WOIA 2EQ9A 1BWCA 2B9YA 1XANA 1N4WA 1CC4A 3SGLA 1XHCA 5U25A 1GALA 5HYMA 2VOUA 4K7ZA 3IHMA 3ALMA 3H4KA 4NTDA 2PYXA 2YR5A 4G73A 2IVDA 4CCRA 4B64A 4EMWA 1N1PA 2WOWA 2F5ZA 4CRTA 1TYPA 3AEDA 3SZCA 4Z26A 2Q7VA 1ZOYA 1BF3A 2Z5YA 3BHKA 2C72A 5KWFA 2TPRA 3Q9TA 5C2TA 2J3NA 4HB9A 3AEEA 4II2A 5FS6A 5CKUA 3G5SA 3V76A 2C65A 3VRAA 3DA1A 3KKJA 3DJGX 2IVEA 1PBFA 3ZDNA 1JEHA 2BRAA 2OALA 3CPHG 4KPRA 1GTEA 3GYXA 4K8DA 3UKLA 4UDQA 4YTNA 2Z5XA 4J56A 1ZDLA 5JCIA 1QJDA 1H7WA 2XLSA 4CY6A 3BNUA 2R4EA 3AD7B 3GD4A 1NPXA 4MJWA 4BJYA 4A65A 4LIIA 2GVCA 4J36A 4X9NA 4NZHA 2VRLA 2WQYA 3CNDA 1E1KA 2EQ8A 1CC2A 1EL9A 3AE6A 4K22A 2GV8A 3K30A 4NTCA 2WETA 2WPCA 5KXJA 1D7LA 2GQWA 5KMPA 1IUXA 4BJZA 4UDRA 4WCTA 1NHRA 1Q1WA 2X8GA 3SZFA 3URHA 3QFAA 4KX6A 4Y4LA 3CGCA 3RP8A 5FMHA 3NH3X 3KA7A 2E5VA 3NTDA 4OPUA 5KMSA 3T31A 1EL5A 2XVEA 2XVJA 3NT6A 4B66A 2TMDA 4LA1A 4H7UA 1JU2A 1DOCA 4IVMB 4EM4A 2UZZA 1F6MA 3HYWA 3NKSA 4O5UA 3UTHA 4A99A 3NG7X 1CL0A 2Q0LA 3G5QA 4H4TA 1LVLA 2XLTA 3UP4A 2C3DA 3EANA 1GETA 2OAMA 3NNEA 2YG5A 4IV9A 1ZKQA 3ITJA 3CNJA 2XVFA 1GT8A 3DGHA 3PO7A 2YWLA 4Z24A 4TLZA 4A6NA 4CY8A 4Z2UA 4G6HA 2WU2A 2YR4A 3JSKA 2ACZA 4H4PA 3V3OA 2JBVA 1Q9IA 1GESA 2GRTA 2DKHA 2Q6UA 4C3XA 1GOSA 4H4XA 3UCLA 4BURA 3HYVA 1OJDA 1NENA 1K0IA 2V3BA 3AB1A 3DGZA 4I59A 1N4VA 1TDNA 1KNPA 1PHHA 1L0VA 1FEAA 1JNZA 2BCGG 4HA6A 3SQPA 1D4EA 2NVKX 3D8XA 2RGJA 2VVLG 4Z25A 3KU9A 1JNRA 2YLTA 3NGCX 2VVMA 4EIQA 1P2EA 4GR1A 5KVIA 2WP6A 2V3AA 4C77A 3CNTA 2YLXA 1DJNA 3RP7A 3AEGA 1IUWA 1JOAA 4WX1A 5M0ZA 3VR8A 1PBEA 3NK2X 4U2TA 1GEUA 3M12A 5FS8A 2YVGA 4G9KA 1YY5A 2VVLA 2B9XA 4Z44A 2EQ6A 4C5OA 4EIPA 1CBOA 1COYA 4A9WA 3FMWA 3UP5A 1YQZA 1GNDA 2XFNA 2C7GA 2Y6QA 2R4JA 4JY3A 2A89A 2GMHA 2BC1A 3B3RA 3AE1A 2WS3A 2XCGA 1CJCA 1M64A 2YG3A 1GV4A 3P1WA 4UDPA 4RSLA 4EMIA 3ATQA 3ZYXA 4PABA 3GDPA 1H81A 1H82A 2GF3A 1FECA 2BK5A 2YLWA 4BK3A 4EQRA 3EPTA 3Q6JA 2WU5A 1E1LA 1ZY8A 3QSMA 4NWZA 5FS7A 2WP5A 4A5LA 4U8NA 2C64A 3CGBA 2YVFA 3DJJA 2C73A 1VG9A 2WESA 2WP9A 2C75A 2YLRA 3NYFA 1NG4A 2C3CA 2C4CA 2GMJA 3ICSA 4FK1C 4A79A 2JKCA 1DOBA 3BI2A 3QJ4A 2JB1A 3UOVA 1QLBA 3GYJA 1D4CA 1FL2A 5EB5A 3UKFA 3VRBA 3AE5A 2VQBA 3SM8A 3C4NA 3AE7A 1NHSA 4B69A 1ONFA 4II3A 4DGKA 1L9DA 4FDCB 4Z2RA 4M52A 2Y6RA 4YWOA 2CULA 3ABVA 3UOYA 1BKWA 2BK3A 5HHFA 4DSGA 1NG3A 2X8HA 1KSUA 3II4A 2H89A 5EOWA 4OPLA 2BACA 4YSHA 3P4SA 3QFBA 2GQFA 1B8SA 4D03A 1O5WA 4YKGA 5GSNA 5J7XA 4TM4A 5HY5A 1EBDA 4J33A 2EQ7A 4B1BA 2FJEA 4H4UA 1IUUA 2GB0A 3UKHA 1PXBA 5KNLA 1GRFA 1ZMCA 3DJDA 3EAOA 3FPZA 3RNMA 4H2QA 4Z43A 3UTEA 4C74A 4X9MA 5JCLA 3R9UA 2X8CA 3QSSA 5KOXA 3NTAA 1GPEA 2GR3A 3F8PA 3OZ2A 1ZP0A 1BGNA 3UKKA 3GD3A 1LQTA 1Y0PA 1X31B 1TYTA 4BK1A 1ZK7A 1VG0A 3KD9A 3T14A 3K7QX 2BRYA 1LTXR 2C70A 4YSXA 3C96A 2AAQA 2GR1A 4AOXA 4H4QA 4OVIA 4AT0A 3LZWA 4NEVA 3LJPA 3ICTA 2HQMA 1Y56A 3KLJA 1SEZA 3NN6X 3FIMB 4H2PA 1V59A 3QVPA 1F8WA 3CMMA 5JCNA 2V5ZA 1TDEA 2Q0KA 4NNJA 2BK4A 2VZ2A 1E1MA 4G74A 4EM3A 2XLRA 3K7MX 2C67A 4TM3A 4H4SA 5BUKA 2BS3A 1H83A 5M10A 4APNA 2XDOA 2BXRA 3AYIA 3CN8A 3GWDA 1PJ5A 3AXBA 3AEBA 2AR8A 4Z2TA 4O5QA 1GXFA 1PBCA 1PBDA 3COXA 3DK4A 4TM1A 4DNAA 3DK9A 2QA1A 3P4PA 2R0PA 3IF9A 3T2ZA 3T2YA 1GREA 1JRXA 1GRHA 4YT0A 3NN0X 2XFQA 4GDPA 3LOVA 4YSYA 3UKPA 5KRQA 3UKQA 2WDRA 1VQWA 3NK0X 4G6GA 3AEAA 4H4VA 4GAVA 3EF6A 1XDIA 3UKAA 4ZCDA 2H88A 3T37A 1PS9A 4XWRA 3L8KA 3SFEA 3PVCA 4H4WA 4B65A 1O95A 2ARDA 3ADAB 3FBSA 4YKFA 4ADWA 3L1RA 2B76A 4CBQA 1D5TA 5BVAA 2B7SA 1KSSA 1OJCA 1NAAA 1IJHA 2JB2A 3BNMA 2WPEA 3GRSA 4GAPA 1TRBA 3QSEA 3NYEA 4OPIA 4Y4NA 1H84A 1N4UA 3I6DA 3VQRA 3HZLA 3AECA 4TM0A 1TDKA 1E6EA 1O94A 2WPFA 2YLSA 4U8OA 2JAEA 1K4QA 1LQUA 2OA1A 1B5QA 1ZOVA 4AT2A 1RYIA 3AWIA 1F8RA 1NDAA 2R9ZA 1GRTA 1OJAA 4REKA 2OLOA 2R0GA 1TDFA 2GEWA 4XXGA 5C3JA 4U8MA 2RGOA 1JRYA 1PJ7A 3CNPA 3ICRA 4J2WA 4EMJA 1LJ1A 1NHQA 2WDQA 3P4QA 4OPTA 4FK1A 4RG3A 2CVJA 1BGJA 3NLCA 3REDA 4J34A 2QAEA 4IA5A 3ATRA 5ER0A 4H4YA 2JB3A 3LZXA 1FCDA 4IVOB 2BXSA 2WBAA 4H50A 1KNRA 2JK6A 3IWAA 2V60A 5U63A 1YQ4A 4Y4MA 1W4XA 4U8IA 3SZ0A 1GERA 4J31A 2RGHA 3E1TA 1REOA 2BS2A 2X3NA 4AP1A 3DJEA 4GF7A 3SY4A 4CCQA 1D7YA 1YKJA 2NPXA 4U2SA 2W0HA 3CTYA 2CDUA 4NEWA 2BC0A 3DMEA 4XWZA 2BABA 3UOXA 2XFUA 4DSHA 4U8LA 4K2XA 1YQ3A 2YM2A 3I3LA 1DOEA 2OLNA 1H7XA 3QVRA 4P9SA 4U2LA 4U8PA 1IUTA 4H4ZA 5FS9A 4AOSA 5IPYA 4ICYA 4I58A 5BRTA 2PHHA 5J60A 4ZN0A 3G5RA 3SYIA 2FJAA 3NIXA 4LU6A 1PXCA 1AOGA 2VRMA 1CC6A 3KVEA 4EQWA 2X99A 1B4VA 3V3NA 1S2QA 2XYOA 5JCKA 4CNKA 2O9ZA 4U8KA 1MOKA 3GWFA 3OC4A 1FOHA 2VQ7A 1CJ2A 4OPCA 1E7PA 1E39A 4JQ9A 4U8JA 1CHUA 1CJ3A 3C4AA 3FG2P 1L9CA 1S2YA 3CGEA 4N9XA 2XLUA 3ALLA 1MXTA 2X50A 2QA2A 2WDVA 3AYLA 2V6OA 3F8RA 4X4JA 1BZLA 5EBKA 3IC9A 5LV9A 4EQXA 4GDEA 3AEFA 3CIRA 4AP3A 4USQA 2ZZ0A 3WE0A 1Y56B 1F8SA 1OJ9A 5U1OA 2YAUA 2WOVA 1EL8A 2AQJA 3AD9B 3AE2A 1VDCA 3IHGA 3KPFA 3O0HA 4JNQA 4JNAA 3HYXA 4CNJA 1LPFA 1GTHA 2RABA 3VRDB 3PS9A 4YTMA 3KPKA 1PBBA 5KOWA 4ZCCA 2IIDA 5JCMA 2APGA 5GRTA 2YG6A 3CNSA 2I0ZA 1CJ4A 1FEBA 3P4RA 2A8XA 3LXDA 4GRTA 1H6VA 1KFYA 1EL7A 1Q1RA 1RP0A 4A6NB 4C3YA 3RHAA 4OCGA 2FBWA 5BULA 3B6DA 2BS4A 3NRNA 4OPDA 1DNCA 2FJDA 3AE4A 5DBJA 2ZZBA 4GCMA 2YLZA 2GH5A 3BI5A 3UOZA 3GMCA 2R0CA 3NK1X 2E1MA 3DK8A 4PAAA 2ZBWA 2XVHA 2GR2A 1ZMDA 3M0OA 3S61A 4OPGA 3SZWA 3AE3A 4ECHA 3GSIA 3SX6A 1L9EA 4BK2A 3VR9A 5EB4A 2XLPA 3LB8A 3DH9A 3H8LA 1RSGA 3GYIA 2YQUA 1K0JA 2YR6A 1UKVG 3NHOX 2BYBA 1H86A 4A7AA 1F3PA 2WEUA 2CFYA 3K7TA 2XFOA 2BA9A 4H2NA 2C66A 3ALJA 1GSNA 1B37A 2WHDA 1DJQA 2FJBA 2GAGB 1JRZA 1XPQA 4YSZA 4K5RA 3BHFA 2YVJA 2E4GA 5HXIA 2QCUA 5KMRA 3SXIA 4YXDA 2A87A 2BCPA 4EQSA 3P9UA 4K5SA 2YG7A 3SFDA 2YG4A 1D4DA 2B7RA 3CPIG 1PJ6A 2V61A 3CPJG 1IUSA 4UP3A 5IQ4A 2XFPA 5CQFA 3AE8A 1Z6LA 4JN9A 3M13A 1KF6A 3UTFA 4IA6A 3GMBA 1PDHA 3D1CA 2R45A 3AYJA 1S3EA 3T0KA 4B68A 4BV6A 1KDGA 4YTPA 4H4RA 4J57A 1E1NA 3UTGA 1MO9A 1PN0A 3AD8B 4TLXA 3CGDA 3T2KA 1K0LA 1PXAA 5KVHA 3GDNA 2GAHB 4USRA 1DODA 2YM1A 3NYCA 4RG4A 1CF3A 4FX9A 2R46A 5IQ1A 3RP6A 5KMQA 1VRQB 2XVIA 3S5WA 4GUVA 1GRBA 5TR3A 3H8IA 3ISHA 1M6IA 1S3BA 4B63A 1HYUA 1GRAA 2DKIA 4E0VA 1DXLA 3GRTA 1QO8A 4D04A 4JDRA 1IUVA 1GRGA 1NEKA 2C76A 1ELIA 1OJTA 4NTEA 1P2HA 4H2RA 4B67A 1NHPA 3LADA 3F8DA 2GR0A 1LV0A 4JY2A 1ZX9A 3BI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L46 A;  2ZZC A;  3AE9 A;  2B9W A;  1TDO A;  2WOI A;  2EQ9 A;  1BWC A;  2B9Y A;  1XAN A;  1N4W A;  1CC4 A;  3SGL A;  1XHC A;  5U25 A;  1GAL A;  5HYM A;  2VOU A;  4K7Z A;  3IHM A;  3ALM A;  3H4K A;  4NTD A;  2PYX A;  2YR5 A;  2IVD A;  4CCR A;  4EMW A;  4B64 A;  1N1P A;  2WOW A;  2F5Z A;  4CRT A;  1TYP A;  3AED A;  4Z26 A;  2Q7V A;  1ZOY A;  1BF3 A;  2Z5Y A;  3BHK A;  2C72 A;  5KWF A;  2TPR A;  3Q9T A;  5C2T A;  2J3N A;  4HB9 A;  3AEE A;  5FS6 A;  5CKU A;  3G5S A;  3V76 A;  2C65 A;  3VRA A;  3DA1 A;  3KKJ A;  3DJG X;  2IVE A;  1PBF A;  3ZDN A;  1JEH A;  2OAL A;  3CPH G;  4KPR A;  1GTE A;  4K8D A;  3UKL A;  4UDQ A;  4YTN A;  2Z5X A;  4J56 A;  1ZDL A;  5JCI A;  1QJD A;  1H7W A;  2XLS A;  4CY6 A;  3BNU A;  2R4E A;  3AD7 B;  3GD4 A;  1NPX A;  4MJW A;  4BJY A;  4A65 A;  4LII A;  2GVC A;  4J36 A;  4X9N A;  4NZH A;  2VRL A;  2WQY A;  3CND A;  1E1K A;  2EQ8 A;  1CC2 A;  1EL9 A;  3AE6 A;  4K22 A;  2GV8 A;  3K30 A;  4NTC A;  2WET A;  2WPC A;  5KXJ A;  1D7L A;  2GQW A;  1IUX A;  4BJZ A;  4UDR A;  4WCT A;  1NHR A;  1Q1W A;  2X8G A;  3URH A;  3QFA A;  4KX6 A;  4Y4L A;  3CGC A;  3RP8 A;  5FMH A;  3NH3 X;  3KA7 A;  2E5V A;  3NTD A;  4OPU A;  1EL5 A;  2XVE A;  2XVJ A;  3NT6 A;  4B66 A;  2TMD A;  4LA1 A;  4H7U A;  1JU2 A;  1DOC A;  4IVM B;  4EM4 A;  2UZZ A;  1F6M A;  4O5U A;  3NKS A;  3UTH A;  4A99 A;  3NG7 X;  1CL0 A;  2Q0L A;  3G5Q A;  4H4T A;  1LVL A;  2XLT A;  3UP4 A;  2C3D A;  3EAN A;  1GET A;  2OAM A;  3NNE A;  2YG5 A;  4IV9 A;  1ZKQ A;  3ITJ A;  3CNJ A;  2XVF A;  1GT8 A;  3DGH A;  3PO7 A;  2YWL A;  4Z24 A;  4TLZ A;  4A6N A;  4CY8 A;  4Z2U A;  2WU2 A;  2YR4 A;  3JSK A;  2ACZ A;  4H4P A;  3V3O A;  2JBV A;  1Q9I A;  1GES A;  2GRT A;  2DKH A;  2Q6U A;  4C3X A;  1GOS A;  4H4X A;  3UCL A;  4BUR A;  1OJD A;  1NEN A;  1K0I A;  2V3B A;  3AB1 A;  3DGZ A;  4I59 A;  1N4V A;  1TDN A;  1KNP A;  1PHH A;  1L0V A;  1FEA A;  1JNZ A;  2BCG G;  4HA6 A;  3SQP A;  1D4E A;  2NVK X;  3D8X A;  2RGJ A;  2VVL G;  4Z25 A;  3KU9 A;  1JNR A;  2YLT A;  3NGC X;  2VVM A;  4EIQ A;  1P2E A;  4GR1 A;  5KVI A;  2WP6 A;  2V3A A;  4C77 A;  3CNT A;  2YLX A;  1DJN A;  3RP7 A;  3AEG A;  1IUW A;  1JOA A;  4WX1 A;  5M0Z A;  3VR8 A;  1PBE A;  3NK2 X;  4U2T A;  1GEU A;  3M12 A;  5FS8 A;  2YVG A;  1YY5 A;  2VVL A;  2B9X A;  4Z44 A;  2EQ6 A;  4C5O A;  4EIP A;  1CBO A;  1COY A;  4A9W A;  3FMW A;  3UP5 A;  1YQZ A;  1GND A;  2XFN A;  2C7G A;  2Y6Q A;  2R4J A;  4JY3 A;  2A89 A;  2GMH A;  2BC1 A;  3B3R A;  3AE1 A;  2WS3 A;  2XCG A;  1CJC A;  1M64 A;  2YG3 A;  1GV4 A;  3P1W A;  4UDP A;  4RSL A;  4EMI A;  3ATQ A;  3ZYX A;  4PAB A;  3GDP A;  1H81 A;  1H82 A;  2GF3 A;  1FEC A;  2BK5 A;  2YLW A;  4BK3 A;  4EQR A;  3EPT A;  3Q6J A;  2WU5 A;  1E1L A;  1ZY8 A;  3QSM A;  5FS7 A;  4A5L A;  2WP5 A;  4U8N A;  2C64 A;  3CGB A;  2YVF A;  3DJJ A;  2C73 A;  1VG9 A;  2WES A;  2WP9 A;  2C75 A;  2YLR A;  3NYF A;  1NG4 A;  2C3C A;  2GMJ A;  3ICS A;  4A79 A;  4FK1 C;  2JKC A;  1DOB A;  3BI2 A;  3QJ4 A;  2JB1 A;  3UOV A;  1QLB A;  3GYJ A;  1D4C A;  1FL2 A;  5EB5 A;  3UKF A;  3VRB A;  3AE5 A;  2VQB A;  3SM8 A;  3C4N A;  3AE7 A;  1NHS A;  4B69 A;  1ONF A;  4DGK A;  1L9D A;  4FDC B;  4Z2R A;  4M52 A;  2Y6R A;  4YWO A;  2CUL A;  3ABV A;  3UOY A;  1BKW A;  2BK3 A;  5HHF A;  4DSG A;  1NG3 A;  2X8H A;  1KSU A;  3II4 A;  2H89 A;  5EOW A;  4OPL A;  2BAC A;  4YSH A;  3P4S A;  3QFB A;  2GQF A;  1B8S A;  4D03 A;  1O5W A;  4YKG A;  5GSN A;  5J7X A;  4TM4 A;  5HY5 A;  1EBD A;  4J33 A;  2EQ7 A;  4B1B A;  2FJE A;  4H4U A;  1IUU A;  2GB0 A;  3UKH A;  1PXB A;  1GRF A;  1ZMC A;  3DJD A;  3EAO A;  3FPZ A;  3RNM A;  4H2Q A;  4Z43 A;  3UTE A;  4C74 A;  4X9M A;  5JCL A;  3R9U A;  2X8C A;  3QSS A;  5KOX A;  3NTA A;  1GPE A;  2GR3 A;  3F8P A;  3OZ2 A;  1ZP0 A;  1BGN A;  3UKK A;  3GD3 A;  1LQT A;  1Y0P A;  1X31 B;  1TYT A;  4BK1 A;  1ZK7 A;  1VG0 A;  3KD9 A;  3K7Q X;  1LTX R;  2C70 A;  4YSX A;  3C96 A;  2AAQ A;  2GR1 A;  4AOX A;  4H4Q A;  4OVI A;  4AT0 A;  3LZW A;  4NEV A;  3LJP A;  3ICT A;  2HQM A;  1Y56 A;  3KLJ A;  1SEZ A;  3NN6 X;  3FIM B;  4H2P A;  1V59 A;  3QVP A;  1F8W A;  5JCN A;  2V5Z A;  1TDE A;  2Q0K A;  2BK4 A;  2VZ2 A;  1E1M A;  4EM3 A;  2XLR A;  3K7M X;  2C67 A;  4TM3 A;  4H4S A;  5BUK A;  2BS3 A;  1H83 A;  5M10 A;  4APN A;  2XDO A;  2BXR A;  3AYI A;  3CN8 A;  3GWD A;  1PJ5 A;  3AXB A;  3AEB A;  2AR8 A;  4Z2T A;  4O5Q A;  1GXF A;  1PBC A;  1PBD A;  3COX A;  3DK4 A;  4TM1 A;  4DNA A;  3DK9 A;  2QA1 A;  3P4P A;  2R0P A;  3IF9 A;  1GRE A;  1JRX A;  1GRH A;  4YT0 A;  3NN0 X;  2XFQ A;  4GDP A;  3LOV A;  4YSY A;  3UKP A;  5KRQ A;  3UKQ A;  2WDR A;  1VQW A;  3NK0 X;  4H4V A;  3AEA A;  3EF6 A;  1XDI A;  3UKA A;  4ZCD A;  2H88 A;  3T37 A;  1PS9 A;  4XWR A;  3L8K A;  3SFE A;  3PVC A;  4H4W A;  4B65 A;  1O95 A;  2ARD A;  3ADA B;  3FBS A;  4YKF A;  4ADW A;  3L1R A;  2B76 A;  4CBQ A;  1D5T A;  5BVA A;  2B7S A;  1KSS A;  1OJC A;  1NAA A;  1IJH A;  2JB2 A;  3BNM A;  2WPE A;  3GRS A;  1TRB A;  3QSE A;  3NYE A;  4OPI A;  4Y4N A;  1H84 A;  1N4U A;  3I6D A;  3VQR A;  3HZL A;  3AEC A;  4TM0 A;  1TDK A;  1E6E A;  1O94 A;  2WPF A;  2YLS A;  4U8O A;  2JAE A;  1K4Q A;  1LQU A;  2OA1 A;  1B5Q A;  1ZOV A;  4AT2 A;  1RYI A;  3AWI A;  1F8R A;  1NDA A;  2R9Z A;  1GRT A;  1OJA A;  4REK A;  2OLO A;  2R0G A;  1TDF A;  2GEW A;  4XXG A;  5C3J A;  4U8M A;  2RGO A;  1JRY A;  1PJ7 A;  3CNP A;  3ICR A;  4J2W A;  4EMJ A;  1LJ1 A;  1NHQ A;  2WDQ A;  3P4Q A;  4OPT A;  4FK1 A;  4RG3 A;  2CVJ A;  1BGJ A;  3NLC A;  3RED A;  4J34 A;  2QAE A;  4IA5 A;  3ATR A;  5ER0 A;  4H4Y A;  2JB3 A;  3LZX A;  1FCD A;  4IVO B;  2BXS A;  2WBA A;  4H50 A;  1KNR A;  2JK6 A;  3IWA A;  2V60 A;  5U63 A;  1YQ4 A;  4Y4M A;  1W4X A;  4U8I A;  1GER A;  4J31 A;  2RGH A;  3E1T A;  1REO A;  2BS2 A;  2X3N A;  4AP1 A;  3DJE A;  4GF7 A;  4CCQ A;  1D7Y A;  1YKJ A;  2NPX A;  4U2S A;  2W0H A;  3CTY A;  2CDU A;  4NEW A;  2BC0 A;  3DME A;  4XWZ A;  2BAB A;  3UOX A;  2XFU A;  4DSH A;  4U8L A;  4K2X A;  1YQ3 A;  2YM2 A;  3I3L A;  1DOE A;  2OLN A;  1H7X A;  3QVR A;  4P9S A;  4U2L A;  4U8P A;  1IUT A;  4H4Z A;  5FS9 A;  4AOS A;  5IPY A;  4ICY A;  4I58 A;  5BRT A;  2PHH A;  5J60 A;  4ZN0 A;  3G5R A;  2FJA A;  3NIX A;  4LU6 A;  1PXC A;  1AOG A;  2VRM A;  1CC6 A;  3KVE A;  4EQW A;  2X99 A;  1B4V A;  3V3N A;  1S2Q A;  2XYO A;  5JCK A;  4CNK A;  2O9Z A;  4U8K A;  1MOK A;  3GWF A;  3OC4 A;  1FOH A;  2VQ7 A;  1CJ2 A;  4OPC A;  1E7P A;  1E39 A;  4JQ9 A;  4U8J A;  1CHU A;  1CJ3 A;  3C4A A;  3FG2 P;  1L9C A;  1S2Y A;  3CGE A;  4N9X A;  2XLU A;  3ALL A;  1MXT A;  2X50 A;  2QA2 A;  2WDV A;  3AYL A;  2V6O A;  3F8R A;  4X4J A;  1BZL A;  5EBK A;  3IC9 A;  5LV9 A;  4EQX A;  4GDE A;  3AEF A;  3CIR A;  4AP3 A;  4USQ A;  2ZZ0 A;  3WE0 A;  1Y56 B;  1F8S A;  1OJ9 A;  5U1O A;  2YAU A;  2WOV A;  1EL8 A;  2AQJ A;  3AD9 B;  3AE2 A;  1VDC A;  3IHG A;  3KPF A;  3O0H A;  4JNQ A;  4JNA A;  4CNJ A;  1LPF A;  1GTH A;  2RAB A;  3VRD B;  3PS9 A;  4YTM A;  1PBB A;  5KOW A;  4ZCC A;  2IID A;  5JCM A;  2APG A;  5GRT A;  2YG6 A;  3CNS A;  2I0Z A;  1CJ4 A;  1FEB A;  3P4R A;  2A8X A;  3LXD A;  4GRT A;  1H6V A;  1KFY A;  1EL7 A;  1Q1R A;  1RP0 A;  4A6N B;  4C3Y A;  3RHA A;  4OCG A;  2FBW A;  5BUL A;  3B6D A;  2BS4 A;  3NRN A;  4OPD A;  1DNC A;  2FJD A;  3AE4 A;  5DBJ A;  2ZZB A;  4GCM A;  2YLZ A;  2GH5 A;  3BI5 A;  3UOZ A;  3GMC A;  2R0C A;  3NK1 X;  2E1M A;  3DK8 A;  4PAA A;  2ZBW A;  2XVH A;  2GR2 A;  1ZMD A;  3M0O A;  3S61 A;  4OPG A;  4ECH A;  3AE3 A;  3GSI A;  1L9E A;  4BK2 A;  3VR9 A;  5EB4 A;  2XLP A;  3LB8 A;  3DH9 A;  3H8L A;  1RSG A;  3GYI A;  2YQU A;  1K0J A;  2YR6 A;  1UKV G;  3NHO X;  2BYB A;  1H86 A;  4A7A A;  1F3P A;  2WEU A;  2CFY A;  3K7T A;  2XFO A;  2BA9 A;  4H2N A;  2C66 A;  3ALJ A;  1GSN A;  1B37 A;  2WHD A;  1DJQ A;  2FJB A;  2GAG B;  1JRZ A;  1XPQ A;  4YSZ A;  4K5R A;  3BHF A;  2YVJ A;  2E4G A;  5HXI A;  2QCU A;  4YXD A;  2A87 A;  2BCP A;  4EQS A;  3P9U A;  4K5S A;  2YG7 A;  3SFD A;  2YG4 A;  1D4D A;  2B7R A;  3CPI G;  1PJ6 A;  2V61 A;  3CPJ G;  1IUS A;  4UP3 A;  5IQ4 A;  2XFP A;  5CQF A;  3AE8 A;  1Z6L A;  4JN9 A;  3M13 A;  1KF6 A;  3UTF A;  4IA6 A;  3GMB A;  1PDH A;  3D1C A;  2R45 A;  3AYJ A;  1S3E A;  4B68 A;  4BV6 A;  1KDG A;  4YTP A;  4H4R A;  4J57 A;  1E1N A;  3UTG A;  1MO9 A;  1PN0 A;  3AD8 B;  4TLX A;  3CGD A;  1K0L A;  1PXA A;  5KVH A;  3GDN A;  2GAH B;  4USR A;  1DOD A;  2YM1 A;  3NYC A;  4RG4 A;  1CF3 A;  4FX9 A;  2R46 A;  5IQ1 A;  3RP6 A;  1VRQ B;  2XVI A;  3S5W A;  4GUV A;  1GRB A;  5TR3 A;  3H8I A;  3ISH A;  1M6I A;  1S3B A;  4B63 A;  1HYU A;  1GRA A;  2DKI A;  4E0V A;  1DXL A;  3GRT A;  1QO8 A;  4D04 A;  4JDR A;  1IUV A;  1GRG A;  1NEK A;  2C76 A;  1ELI A;  1OJT A;  4NTE A;  1P2H A;  4H2R A;  4B67 A;  1NHP A;  3LAD A;  3F8D A;  2GR0 A;  1LV0 A;  4JY2 A;  1ZX9 A;  3BI4 A; 
#chains in the Genus database with same CATH topology
 5L46 A;  2ZZC A;  3AE9 A;  2B9W A;  1TDO A;  2WOI A;  2EQ9 A;  1BWC A;  2B9Y A;  1XAN A;  1N4W A;  1CC4 A;  3SGL A;  1XHC A;  5U25 A;  1GAL A;  5HYM A;  2VOU A;  4K7Z A;  3IHM A;  3ALM A;  3H4K A;  4NTD A;  2PYX A;  2YR5 A;  4G73 A;  2IVD A;  4CCR A;  4B64 A;  4EMW A;  1N1P A;  2WOW A;  2F5Z A;  4CRT A;  1TYP A;  3AED A;  3SZC A;  4Z26 A;  2Q7V A;  1ZOY A;  1BF3 A;  2Z5Y A;  3BHK A;  2C72 A;  5KWF A;  2TPR A;  3Q9T A;  5C2T A;  2J3N A;  4HB9 A;  3AEE A;  4II2 A;  5FS6 A;  5CKU A;  3G5S A;  3V76 A;  2C65 A;  3VRA A;  3DA1 A;  3KKJ A;  3DJG X;  2IVE A;  1PBF A;  3ZDN A;  1JEH A;  2BRA A;  2OAL A;  3CPH G;  4KPR A;  1GTE A;  3GYX A;  4K8D A;  3UKL A;  4UDQ A;  4YTN A;  2Z5X A;  4J56 A;  1ZDL A;  5JCI A;  1QJD A;  1H7W A;  2XLS A;  4CY6 A;  3BNU A;  2R4E A;  3AD7 B;  3GD4 A;  1NPX A;  4MJW A;  4BJY A;  4A65 A;  4LII A;  2GVC A;  4J36 A;  4X9N A;  4NZH A;  2VRL A;  2WQY A;  3CND A;  1E1K A;  2EQ8 A;  1CC2 A;  1EL9 A;  3AE6 A;  4K22 A;  2GV8 A;  3K30 A;  4NTC A;  2WET A;  2WPC A;  5KXJ A;  1D7L A;  2GQW A;  5KMP A;  1IUX A;  4BJZ A;  4UDR A;  4WCT A;  1NHR A;  1Q1W A;  2X8G A;  3SZF A;  3URH A;  3QFA A;  4KX6 A;  4Y4L A;  3CGC A;  3RP8 A;  5FMH A;  3NH3 X;  3KA7 A;  2E5V A;  3NTD A;  4OPU A;  5KMS A;  3T31 A;  1EL5 A;  2XVE A;  2XVJ A;  3NT6 A;  4B66 A;  2TMD A;  4LA1 A;  4H7U A;  1JU2 A;  1DOC A;  4IVM B;  4EM4 A;  2UZZ A;  1F6M A;  3HYW A;  3NKS A;  4O5U A;  3UTH A;  4A99 A;  3NG7 X;  1CL0 A;  2Q0L A;  3G5Q A;  4H4T A;  1LVL A;  2XLT A;  3UP4 A;  2C3D A;  3EAN A;  1GET A;  2OAM A;  3NNE A;  2YG5 A;  4IV9 A;  1ZKQ A;  3ITJ A;  3CNJ A;  2XVF A;  1GT8 A;  3DGH A;  3PO7 A;  2YWL A;  4Z24 A;  4TLZ A;  4A6N A;  4CY8 A;  4Z2U A;  4G6H A;  2WU2 A;  2YR4 A;  3JSK A;  2ACZ A;  4H4P A;  3V3O A;  2JBV A;  1Q9I A;  1GES A;  2GRT A;  2DKH A;  2Q6U A;  4C3X A;  1GOS A;  4H4X A;  3UCL A;  4BUR A;  3HYV A;  1OJD A;  1NEN A;  1K0I A;  2V3B A;  3AB1 A;  3DGZ A;  4I59 A;  1N4V A;  1TDN A;  1KNP A;  1PHH A;  1L0V A;  1FEA A;  1JNZ A;  2BCG G;  4HA6 A;  3SQP A;  1D4E A;  2NVK X;  3D8X A;  2RGJ A;  2VVL G;  4Z25 A;  3KU9 A;  1JNR A;  2YLT A;  3NGC X;  2VVM A;  4EIQ A;  1P2E A;  4GR1 A;  5KVI A;  2WP6 A;  2V3A A;  4C77 A;  3CNT A;  2YLX A;  1DJN A;  3RP7 A;  3AEG A;  1IUW A;  1JOA A;  4WX1 A;  5M0Z A;  3VR8 A;  1PBE A;  3NK2 X;  4U2T A;  1GEU A;  3M12 A;  5FS8 A;  2YVG A;  4G9K A;  1YY5 A;  2VVL A;  2B9X A;  4Z44 A;  2EQ6 A;  4C5O A;  4EIP A;  1CBO A;  1COY A;  4A9W A;  3FMW A;  3UP5 A;  1YQZ A;  1GND A;  2XFN A;  2C7G A;  2Y6Q A;  2R4J A;  4JY3 A;  2A89 A;  2GMH A;  2BC1 A;  3B3R A;  3AE1 A;  2WS3 A;  2XCG A;  1CJC A;  1M64 A;  2YG3 A;  1GV4 A;  3P1W A;  4UDP A;  4RSL A;  4EMI A;  3ATQ A;  3ZYX A;  4PAB A;  3GDP A;  1H81 A;  1H82 A;  2GF3 A;  1FEC A;  2BK5 A;  2YLW A;  4BK3 A;  4EQR A;  3EPT A;  3Q6J A;  2WU5 A;  1E1L A;  1ZY8 A;  3QSM A;  4NWZ A;  5FS7 A;  2WP5 A;  4A5L A;  4U8N A;  2C64 A;  3CGB A;  2YVF A;  3DJJ A;  2C73 A;  1VG9 A;  2WES A;  2WP9 A;  2C75 A;  2YLR A;  3NYF A;  1NG4 A;  2C3C A;  2C4C A;  2GMJ A;  3ICS A;  4FK1 C;  4A79 A;  2JKC A;  1DOB A;  3BI2 A;  3QJ4 A;  2JB1 A;  3UOV A;  1QLB A;  3GYJ A;  1D4C A;  1FL2 A;  5EB5 A;  3UKF A;  3VRB A;  3AE5 A;  2VQB A;  3SM8 A;  3C4N A;  3AE7 A;  1NHS A;  4B69 A;  1ONF A;  4II3 A;  4DGK A;  1L9D A;  4FDC B;  4Z2R A;  4M52 A;  2Y6R A;  4YWO A;  2CUL A;  3ABV A;  3UOY A;  1BKW A;  2BK3 A;  5HHF A;  4DSG A;  1NG3 A;  2X8H A;  1KSU A;  3II4 A;  2H89 A;  5EOW A;  4OPL A;  2BAC A;  4YSH A;  3P4S A;  3QFB A;  2GQF A;  1B8S A;  4D03 A;  1O5W A;  4YKG A;  5GSN A;  5J7X A;  4TM4 A;  5HY5 A;  1EBD A;  4J33 A;  2EQ7 A;  4B1B A;  2FJE A;  4H4U A;  1IUU A;  2GB0 A;  3UKH A;  1PXB A;  5KNL A;  1GRF A;  1ZMC A;  3DJD A;  3EAO A;  3FPZ A;  3RNM A;  4H2Q A;  4Z43 A;  3UTE A;  4C74 A;  4X9M A;  5JCL A;  3R9U A;  2X8C A;  3QSS A;  5KOX A;  3NTA A;  1GPE A;  2GR3 A;  3F8P A;  3OZ2 A;  1ZP0 A;  1BGN A;  3UKK A;  3GD3 A;  1LQT A;  1Y0P A;  1X31 B;  1TYT A;  4BK1 A;  1ZK7 A;  1VG0 A;  3KD9 A;  3T14 A;  3K7Q X;  2BRY A;  1LTX R;  2C70 A;  4YSX A;  3C96 A;  2AAQ A;  2GR1 A;  4AOX A;  4H4Q A;  4OVI A;  4AT0 A;  3LZW A;  4NEV A;  3LJP A;  3ICT A;  2HQM A;  1Y56 A;  3KLJ A;  1SEZ A;  3NN6 X;  3FIM B;  4H2P A;  1V59 A;  3QVP A;  1F8W A;  3CMM A;  5JCN A;  2V5Z A;  1TDE A;  2Q0K A;  4NNJ A;  2BK4 A;  2VZ2 A;  1E1M A;  4G74 A;  4EM3 A;  2XLR A;  3K7M X;  2C67 A;  4TM3 A;  4H4S A;  5BUK A;  2BS3 A;  1H83 A;  5M10 A;  4APN A;  2XDO A;  2BXR A;  3AYI A;  3CN8 A;  3GWD A;  1PJ5 A;  3AXB A;  3AEB A;  2AR8 A;  4Z2T A;  4O5Q A;  1GXF A;  1PBC A;  1PBD A;  3COX A;  3DK4 A;  4TM1 A;  4DNA A;  3DK9 A;  2QA1 A;  3P4P A;  2R0P A;  3IF9 A;  3T2Z A;  3T2Y A;  1GRE A;  1JRX A;  1GRH A;  4YT0 A;  3NN0 X;  2XFQ A;  4GDP A;  3LOV A;  4YSY A;  3UKP A;  5KRQ A;  3UKQ A;  2WDR A;  1VQW A;  3NK0 X;  4G6G A;  3AEA A;  4H4V A;  4GAV A;  3EF6 A;  1XDI A;  3UKA A;  4ZCD A;  2H88 A;  3T37 A;  1PS9 A;  4XWR A;  3L8K A;  3SFE A;  3PVC A;  4H4W A;  4B65 A;  1O95 A;  2ARD A;  3ADA B;  3FBS A;  4YKF A;  4ADW A;  3L1R A;  2B76 A;  4CBQ A;  1D5T A;  5BVA A;  2B7S A;  1KSS A;  1OJC A;  1NAA A;  1IJH A;  2JB2 A;  3BNM A;  2WPE A;  3GRS A;  4GAP A;  1TRB A;  3QSE A;  3NYE A;  4OPI A;  4Y4N A;  1H84 A;  1N4U A;  3I6D A;  3VQR A;  3HZL A;  3AEC A;  4TM0 A;  1TDK A;  1E6E A;  1O94 A;  2WPF A;  2YLS A;  4U8O A;  2JAE A;  1K4Q A;  1LQU A;  2OA1 A;  1B5Q A;  1ZOV A;  4AT2 A;  1RYI A;  3AWI A;  1F8R A;  1NDA A;  2R9Z A;  1GRT A;  1OJA A;  4REK A;  2OLO A;  2R0G A;  1TDF A;  2GEW A;  4XXG A;  5C3J A;  4U8M A;  2RGO A;  1JRY A;  1PJ7 A;  3CNP A;  3ICR A;  4J2W A;  4EMJ A;  1LJ1 A;  1NHQ A;  2WDQ A;  3P4Q A;  4OPT A;  4FK1 A;  4RG3 A;  2CVJ A;  1BGJ A;  3NLC A;  3RED A;  4J34 A;  2QAE A;  4IA5 A;  3ATR A;  5ER0 A;  4H4Y A;  2JB3 A;  3LZX A;  1FCD A;  4IVO B;  2BXS A;  2WBA A;  4H50 A;  1KNR A;  2JK6 A;  3IWA A;  2V60 A;  5U63 A;  1YQ4 A;  4Y4M A;  1W4X A;  4U8I A;  3SZ0 A;  1GER A;  4J31 A;  2RGH A;  3E1T A;  1REO A;  2BS2 A;  2X3N A;  4AP1 A;  3DJE A;  4GF7 A;  3SY4 A;  4CCQ A;  1D7Y A;  1YKJ A;  2NPX A;  4U2S A;  2W0H A;  3CTY A;  2CDU A;  4NEW A;  2BC0 A;  3DME A;  4XWZ A;  2BAB A;  3UOX A;  2XFU A;  4DSH A;  4U8L A;  4K2X A;  1YQ3 A;  2YM2 A;  3I3L A;  1DOE A;  2OLN A;  1H7X A;  3QVR A;  4P9S A;  4U2L A;  4U8P A;  1IUT A;  4H4Z A;  5FS9 A;  4AOS A;  5IPY A;  4ICY A;  4I58 A;  5BRT A;  2PHH A;  5J60 A;  4ZN0 A;  3G5R A;  3SYI A;  2FJA A;  3NIX A;  4LU6 A;  1PXC A;  1AOG A;  2VRM A;  1CC6 A;  3KVE A;  4EQW A;  2X99 A;  1B4V A;  3V3N A;  1S2Q A;  2XYO A;  5JCK A;  4CNK A;  2O9Z A;  4U8K A;  1MOK A;  3GWF A;  3OC4 A;  1FOH A;  2VQ7 A;  1CJ2 A;  4OPC A;  1E7P A;  1E39 A;  4JQ9 A;  4U8J A;  1CHU A;  1CJ3 A;  3C4A A;  3FG2 P;  1L9C A;  1S2Y A;  3CGE A;  4N9X A;  2XLU A;  3ALL A;  1MXT A;  2X50 A;  2QA2 A;  2WDV A;  3AYL A;  2V6O A;  3F8R A;  4X4J A;  1BZL A;  5EBK A;  3IC9 A;  5LV9 A;  4EQX A;  4GDE A;  3AEF A;  3CIR A;  4AP3 A;  4USQ A;  2ZZ0 A;  3WE0 A;  1Y56 B;  1F8S A;  1OJ9 A;  5U1O A;  2YAU A;  2WOV A;  1EL8 A;  2AQJ A;  3AD9 B;  3AE2 A;  1VDC A;  3IHG A;  3KPF A;  3O0H A;  4JNQ A;  4JNA A;  3HYX A;  4CNJ A;  1LPF A;  1GTH A;  2RAB A;  3VRD B;  3PS9 A;  4YTM A;  3KPK A;  1PBB A;  5KOW A;  4ZCC A;  2IID A;  5JCM A;  2APG A;  5GRT A;  2YG6 A;  3CNS A;  2I0Z A;  1CJ4 A;  1FEB A;  3P4R A;  2A8X A;  3LXD A;  4GRT A;  1H6V A;  1KFY A;  1EL7 A;  1Q1R A;  1RP0 A;  4A6N B;  4C3Y A;  3RHA A;  4OCG A;  2FBW A;  5BUL A;  3B6D A;  2BS4 A;  3NRN A;  4OPD A;  1DNC A;  2FJD A;  3AE4 A;  5DBJ A;  2ZZB A;  4GCM A;  2YLZ A;  2GH5 A;  3BI5 A;  3UOZ A;  3GMC A;  2R0C A;  3NK1 X;  2E1M A;  3DK8 A;  4PAA A;  2ZBW A;  2XVH A;  2GR2 A;  1ZMD A;  3M0O A;  3S61 A;  4OPG A;  3SZW A;  3AE3 A;  4ECH A;  3GSI A;  3SX6 A;  1L9E A;  4BK2 A;  3VR9 A;  5EB4 A;  2XLP A;  3LB8 A;  3DH9 A;  3H8L A;  1RSG A;  3GYI A;  2YQU A;  1K0J A;  2YR6 A;  1UKV G;  3NHO X;  2BYB A;  1H86 A;  4A7A A;  1F3P A;  2WEU A;  2CFY A;  3K7T A;  2XFO A;  2BA9 A;  4H2N A;  2C66 A;  3ALJ A;  1GSN A;  1B37 A;  2WHD A;  1DJQ A;  2FJB A;  2GAG B;  1JRZ A;  1XPQ A;  4YSZ A;  4K5R A;  3BHF A;  2YVJ A;  2E4G A;  5HXI A;  2QCU A;  5KMR A;  3SXI A;  4YXD A;  2A87 A;  2BCP A;  4EQS A;  3P9U A;  4K5S A;  2YG7 A;  3SFD A;  2YG4 A;  1D4D A;  2B7R A;  3CPI G;  1PJ6 A;  2V61 A;  3CPJ G;  1IUS A;  4UP3 A;  5IQ4 A;  2XFP A;  5CQF A;  3AE8 A;  1Z6L A;  4JN9 A;  3M13 A;  1KF6 A;  3UTF A;  4IA6 A;  3GMB A;  1PDH A;  3D1C A;  2R45 A;  3AYJ A;  1S3E A;  3T0K A;  4B68 A;  4BV6 A;  1KDG A;  4YTP A;  4H4R A;  4J57 A;  1E1N A;  3UTG A;  1MO9 A;  1PN0 A;  3AD8 B;  4TLX A;  3CGD A;  3T2K A;  1K0L A;  1PXA A;  5KVH A;  3GDN A;  2GAH B;  4USR A;  1DOD A;  2YM1 A;  3NYC A;  4RG4 A;  1CF3 A;  4FX9 A;  2R46 A;  5IQ1 A;  3RP6 A;  5KMQ A;  1VRQ B;  2XVI A;  3S5W A;  4GUV A;  1GRB A;  5TR3 A;  3H8I A;  3ISH A;  1M6I A;  1S3B A;  4B63 A;  1HYU A;  1GRA A;  2DKI A;  4E0V A;  1DXL A;  3GRT A;  1QO8 A;  4D04 A;  4JDR A;  1IUV A;  1GRG A;  1NEK A;  2C76 A;  1ELI A;  1OJT A;  4NTE A;  1P2H A;  4H2R A;  4B67 A;  1NHP A;  3LAD A;  3F8D A;  2GR0 A;  1LV0 A;  4JY2 A;  1ZX9 A;  3BI4 A; 
#chains in the Genus database with same CATH homology
 5L46 A;  2ZZC A;  3AE9 A;  2B9W A;  1TDO A;  2WOI A;  2EQ9 A;  1BWC A;  2B9Y A;  1XAN A;  1N4W A;  1CC4 A;  3SGL A;  1XHC A;  5U25 A;  1GAL A;  5HYM A;  2VOU A;  4K7Z A;  3IHM A;  3ALM A;  3H4K A;  4NTD A;  2PYX A;  2YR5 A;  4G73 A;  2IVD A;  4CCR A;  4B64 A;  4EMW A;  1N1P A;  2WOW A;  2F5Z A;  4CRT A;  1TYP A;  3AED A;  3SZC A;  4Z26 A;  2Q7V A;  1ZOY A;  1BF3 A;  2Z5Y A;  3BHK A;  2C72 A;  5KWF A;  2TPR A;  3Q9T A;  5C2T A;  2J3N A;  4HB9 A;  3AEE A;  4II2 A;  5FS6 A;  5CKU A;  3G5S A;  3V76 A;  2C65 A;  3VRA A;  3DA1 A;  3KKJ A;  3DJG X;  2IVE A;  1PBF A;  3ZDN A;  1JEH A;  2BRA A;  2OAL A;  3CPH G;  4KPR A;  1GTE A;  3GYX A;  4K8D A;  3UKL A;  4UDQ A;  4YTN A;  2Z5X A;  4J56 A;  1ZDL A;  5JCI A;  1QJD A;  1H7W A;  2XLS A;  4CY6 A;  3BNU A;  2R4E A;  3AD7 B;  3GD4 A;  1NPX A;  4MJW A;  4BJY A;  4A65 A;  4LII A;  2GVC A;  4J36 A;  4X9N A;  4NZH A;  2VRL A;  2WQY A;  3CND A;  1E1K A;  2EQ8 A;  1CC2 A;  1EL9 A;  3AE6 A;  4K22 A;  2GV8 A;  3K30 A;  4NTC A;  2WET A;  2WPC A;  5KXJ A;  1D7L A;  2GQW A;  5KMP A;  1IUX A;  4BJZ A;  4UDR A;  4WCT A;  1NHR A;  1Q1W A;  2X8G A;  3SZF A;  3URH A;  3QFA A;  4KX6 A;  4Y4L A;  3CGC A;  3RP8 A;  5FMH A;  3NH3 X;  3KA7 A;  2E5V A;  3NTD A;  4OPU A;  5KMS A;  3T31 A;  1EL5 A;  2XVE A;  2XVJ A;  3NT6 A;  4B66 A;  2TMD A;  4LA1 A;  4H7U A;  1JU2 A;  1DOC A;  4IVM B;  4EM4 A;  2UZZ A;  1F6M A;  3HYW A;  3NKS A;  4O5U A;  3UTH A;  4A99 A;  3NG7 X;  1CL0 A;  2Q0L A;  3G5Q A;  4H4T A;  1LVL A;  2XLT A;  3UP4 A;  2C3D A;  3EAN A;  1GET A;  2OAM A;  3NNE A;  2YG5 A;  4IV9 A;  1ZKQ A;  3ITJ A;  3CNJ A;  2XVF A;  1GT8 A;  3DGH A;  3PO7 A;  2YWL A;  4Z24 A;  4TLZ A;  4A6N A;  4CY8 A;  4Z2U A;  4G6H A;  2WU2 A;  2YR4 A;  3JSK A;  2ACZ A;  4H4P A;  3V3O A;  2JBV A;  1Q9I A;  1GES A;  2GRT A;  2DKH A;  2Q6U A;  4C3X A;  1GOS A;  4H4X A;  3UCL A;  4BUR A;  3HYV A;  1OJD A;  1NEN A;  1K0I A;  2V3B A;  3AB1 A;  3DGZ A;  4I59 A;  1N4V A;  1TDN A;  1KNP A;  1PHH A;  1L0V A;  1FEA A;  1JNZ A;  2BCG G;  4HA6 A;  3SQP A;  1D4E A;  2NVK X;  3D8X A;  2RGJ A;  2VVL G;  4Z25 A;  3KU9 A;  1JNR A;  2YLT A;  3NGC X;  2VVM A;  4EIQ A;  1P2E A;  4GR1 A;  5KVI A;  2WP6 A;  2V3A A;  4C77 A;  3CNT A;  2YLX A;  1DJN A;  3RP7 A;  3AEG A;  1IUW A;  1JOA A;  4WX1 A;  5M0Z A;  3VR8 A;  1PBE A;  3NK2 X;  4U2T A;  1GEU A;  3M12 A;  5FS8 A;  2YVG A;  4G9K A;  1YY5 A;  2VVL A;  2B9X A;  4Z44 A;  2EQ6 A;  4C5O A;  4EIP A;  1CBO A;  1COY A;  4A9W A;  3FMW A;  3UP5 A;  1YQZ A;  1GND A;  2XFN A;  2C7G A;  2Y6Q A;  2R4J A;  4JY3 A;  2A89 A;  2GMH A;  2BC1 A;  3B3R A;  3AE1 A;  2WS3 A;  2XCG A;  1CJC A;  1M64 A;  2YG3 A;  1GV4 A;  3P1W A;  4UDP A;  4RSL A;  4EMI A;  3ATQ A;  3ZYX A;  4PAB A;  3GDP A;  1H81 A;  1H82 A;  2GF3 A;  1FEC A;  2BK5 A;  2YLW A;  4BK3 A;  4EQR A;  3EPT A;  3Q6J A;  2WU5 A;  1E1L A;  1ZY8 A;  3QSM A;  4NWZ A;  5FS7 A;  2WP5 A;  4A5L A;  4U8N A;  2C64 A;  3CGB A;  2YVF A;  3DJJ A;  2C73 A;  1VG9 A;  2WES A;  2WP9 A;  2C75 A;  2YLR A;  3NYF A;  1NG4 A;  2C3C A;  2C4C A;  2GMJ A;  3ICS A;  4FK1 C;  4A79 A;  2JKC A;  1DOB A;  3BI2 A;  3QJ4 A;  2JB1 A;  3UOV A;  1QLB A;  3GYJ A;  1D4C A;  1FL2 A;  5EB5 A;  3UKF A;  3VRB A;  3AE5 A;  2VQB A;  3SM8 A;  3C4N A;  3AE7 A;  1NHS A;  4B69 A;  1ONF A;  4II3 A;  4DGK A;  1L9D A;  4FDC B;  4Z2R A;  4M52 A;  2Y6R A;  4YWO A;  2CUL A;  3ABV A;  3UOY A;  1BKW A;  2BK3 A;  5HHF A;  4DSG A;  1NG3 A;  2X8H A;  1KSU A;  3II4 A;  2H89 A;  5EOW A;  4OPL A;  2BAC A;  4YSH A;  3P4S A;  3QFB A;  2GQF A;  1B8S A;  4D03 A;  1O5W A;  4YKG A;  5GSN A;  5J7X A;  4TM4 A;  5HY5 A;  1EBD A;  4J33 A;  2EQ7 A;  4B1B A;  2FJE A;  4H4U A;  1IUU A;  2GB0 A;  3UKH A;  1PXB A;  5KNL A;  1GRF A;  1ZMC A;  3DJD A;  3EAO A;  3FPZ A;  3RNM A;  4H2Q A;  4Z43 A;  3UTE A;  4C74 A;  4X9M A;  5JCL A;  3R9U A;  2X8C A;  3QSS A;  5KOX A;  3NTA A;  1GPE A;  2GR3 A;  3F8P A;  3OZ2 A;  1ZP0 A;  1BGN A;  3UKK A;  3GD3 A;  1LQT A;  1Y0P A;  1X31 B;  1TYT A;  4BK1 A;  1ZK7 A;  1VG0 A;  3KD9 A;  3T14 A;  3K7Q X;  2BRY A;  1LTX R;  2C70 A;  4YSX A;  3C96 A;  2AAQ A;  2GR1 A;  4AOX A;  4H4Q A;  4OVI A;  4AT0 A;  3LZW A;  4NEV A;  3LJP A;  3ICT A;  2HQM A;  1Y56 A;  3KLJ A;  1SEZ A;  3NN6 X;  3FIM B;  4H2P A;  1V59 A;  3QVP A;  1F8W A;  3CMM A;  5JCN A;  2V5Z A;  1TDE A;  2Q0K A;  4NNJ A;  2BK4 A;  2VZ2 A;  1E1M A;  4G74 A;  4EM3 A;  2XLR A;  3K7M X;  2C67 A;  4TM3 A;  4H4S A;  5BUK A;  2BS3 A;  1H83 A;  5M10 A;  4APN A;  2XDO A;  2BXR A;  3AYI A;  3CN8 A;  3GWD A;  1PJ5 A;  3AXB A;  3AEB A;  2AR8 A;  4Z2T A;  4O5Q A;  1GXF A;  1PBC A;  1PBD A;  3COX A;  3DK4 A;  4TM1 A;  4DNA A;  3DK9 A;  2QA1 A;  3P4P A;  2R0P A;  3IF9 A;  3T2Z A;  3T2Y A;  1GRE A;  1JRX A;  1GRH A;  4YT0 A;  3NN0 X;  2XFQ A;  4GDP A;  3LOV A;  4YSY A;  3UKP A;  5KRQ A;  3UKQ A;  2WDR A;  1VQW A;  3NK0 X;  4G6G A;  3AEA A;  4H4V A;  4GAV A;  3EF6 A;  1XDI A;  3UKA A;  4ZCD A;  2H88 A;  3T37 A;  1PS9 A;  4XWR A;  3L8K A;  3SFE A;  3PVC A;  4H4W A;  4B65 A;  1O95 A;  2ARD A;  3ADA B;  3FBS A;  4YKF A;  4ADW A;  3L1R A;  2B76 A;  4CBQ A;  1D5T A;  5BVA A;  2B7S A;  1KSS A;  1OJC A;  1NAA A;  1IJH A;  2JB2 A;  3BNM A;  2WPE A;  3GRS A;  4GAP A;  1TRB A;  3QSE A;  3NYE A;  4OPI A;  4Y4N A;  1H84 A;  1N4U A;  3I6D A;  3VQR A;  3HZL A;  3AEC A;  4TM0 A;  1TDK A;  1E6E A;  1O94 A;  2WPF A;  2YLS A;  4U8O A;  2JAE A;  1K4Q A;  1LQU A;  2OA1 A;  1B5Q A;  1ZOV A;  4AT2 A;  1RYI A;  3AWI A;  1F8R A;  1NDA A;  2R9Z A;  1GRT A;  1OJA A;  4REK A;  2OLO A;  2R0G A;  1TDF A;  2GEW A;  4XXG A;  5C3J A;  4U8M A;  2RGO A;  1JRY A;  1PJ7 A;  3CNP A;  3ICR A;  4J2W A;  4EMJ A;  1LJ1 A;  1NHQ A;  2WDQ A;  3P4Q A;  4OPT A;  4FK1 A;  4RG3 A;  2CVJ A;  1BGJ A;  3NLC A;  3RED A;  4J34 A;  2QAE A;  4IA5 A;  3ATR A;  5ER0 A;  4H4Y A;  2JB3 A;  3LZX A;  1FCD A;  4IVO B;  2BXS A;  2WBA A;  4H50 A;  1KNR A;  2JK6 A;  3IWA A;  2V60 A;  5U63 A;  1YQ4 A;  4Y4M A;  1W4X A;  4U8I A;  3SZ0 A;  1GER A;  4J31 A;  2RGH A;  3E1T A;  1REO A;  2BS2 A;  2X3N A;  4AP1 A;  3DJE A;  4GF7 A;  3SY4 A;  4CCQ A;  1D7Y A;  1YKJ A;  2NPX A;  4U2S A;  2W0H A;  3CTY A;  2CDU A;  4NEW A;  2BC0 A;  3DME A;  4XWZ A;  2BAB A;  3UOX A;  2XFU A;  4DSH A;  4U8L A;  4K2X A;  1YQ3 A;  2YM2 A;  3I3L A;  1DOE A;  2OLN A;  1H7X A;  3QVR A;  4P9S A;  4U2L A;  4U8P A;  1IUT A;  4H4Z A;  5FS9 A;  4AOS A;  5IPY A;  4ICY A;  4I58 A;  5BRT A;  2PHH A;  5J60 A;  4ZN0 A;  3G5R A;  3SYI A;  2FJA A;  3NIX A;  4LU6 A;  1PXC A;  1AOG A;  2VRM A;  1CC6 A;  3KVE A;  4EQW A;  2X99 A;  1B4V A;  3V3N A;  1S2Q A;  2XYO A;  5JCK A;  4CNK A;  2O9Z A;  4U8K A;  1MOK A;  3GWF A;  3OC4 A;  1FOH A;  2VQ7 A;  1CJ2 A;  4OPC A;  1E7P A;  1E39 A;  4JQ9 A;  4U8J A;  1CHU A;  1CJ3 A;  3C4A A;  3FG2 P;  1L9C A;  1S2Y A;  3CGE A;  4N9X A;  2XLU A;  3ALL A;  1MXT A;  2X50 A;  2QA2 A;  2WDV A;  3AYL A;  2V6O A;  3F8R A;  4X4J A;  1BZL A;  5EBK A;  3IC9 A;  5LV9 A;  4EQX A;  4GDE A;  3AEF A;  3CIR A;  4AP3 A;  4USQ A;  2ZZ0 A;  3WE0 A;  1Y56 B;  1F8S A;  1OJ9 A;  5U1O A;  2YAU A;  2WOV A;  1EL8 A;  2AQJ A;  3AD9 B;  3AE2 A;  1VDC A;  3IHG A;  3KPF A;  3O0H A;  4JNQ A;  4JNA A;  3HYX A;  4CNJ A;  1LPF A;  1GTH A;  2RAB A;  3VRD B;  3PS9 A;  4YTM A;  3KPK A;  1PBB A;  5KOW A;  4ZCC A;  2IID A;  5JCM A;  2APG A;  5GRT A;  2YG6 A;  3CNS A;  2I0Z A;  1CJ4 A;  1FEB A;  3P4R A;  2A8X A;  3LXD A;  4GRT A;  1H6V A;  1KFY A;  1EL7 A;  1Q1R A;  1RP0 A;  4A6N B;  4C3Y A;  3RHA A;  4OCG A;  2FBW A;  5BUL A;  3B6D A;  2BS4 A;  3NRN A;  4OPD A;  1DNC A;  2FJD A;  3AE4 A;  5DBJ A;  2ZZB A;  4GCM A;  2YLZ A;  2GH5 A;  3BI5 A;  3UOZ A;  3GMC A;  2R0C A;  3NK1 X;  2E1M A;  3DK8 A;  4PAA A;  2ZBW A;  2XVH A;  2GR2 A;  1ZMD A;  3M0O A;  3S61 A;  4OPG A;  3SZW A;  3AE3 A;  4ECH A;  3GSI A;  3SX6 A;  1L9E A;  4BK2 A;  3VR9 A;  5EB4 A;  2XLP A;  3LB8 A;  3DH9 A;  3H8L A;  1RSG A;  3GYI A;  2YQU A;  1K0J A;  2YR6 A;  1UKV G;  3NHO X;  2BYB A;  1H86 A;  4A7A A;  1F3P A;  2WEU A;  2CFY A;  3K7T A;  2XFO A;  2BA9 A;  4H2N A;  2C66 A;  3ALJ A;  1GSN A;  1B37 A;  2WHD A;  1DJQ A;  2FJB A;  2GAG B;  1JRZ A;  1XPQ A;  4YSZ A;  4K5R A;  3BHF A;  2YVJ A;  2E4G A;  5HXI A;  2QCU A;  5KMR A;  3SXI A;  4YXD A;  2A87 A;  2BCP A;  4EQS A;  3P9U A;  4K5S A;  2YG7 A;  3SFD A;  2YG4 A;  1D4D A;  2B7R A;  3CPI G;  1PJ6 A;  2V61 A;  3CPJ G;  1IUS A;  4UP3 A;  5IQ4 A;  2XFP A;  5CQF A;  3AE8 A;  1Z6L A;  4JN9 A;  3M13 A;  1KF6 A;  3UTF A;  4IA6 A;  3GMB A;  1PDH A;  3D1C A;  2R45 A;  3AYJ A;  1S3E A;  3T0K A;  4B68 A;  4BV6 A;  1KDG A;  4YTP A;  4H4R A;  4J57 A;  1E1N A;  3UTG A;  1MO9 A;  1PN0 A;  3AD8 B;  4TLX A;  3CGD A;  3T2K A;  1K0L A;  1PXA A;  5KVH A;  3GDN A;  2GAH B;  4USR A;  1DOD A;  2YM1 A;  3NYC A;  4RG4 A;  1CF3 A;  4FX9 A;  2R46 A;  5IQ1 A;  3RP6 A;  5KMQ A;  1VRQ B;  2XVI A;  3S5W A;  4GUV A;  1GRB A;  5TR3 A;  3H8I A;  3ISH A;  1M6I A;  1S3B A;  4B63 A;  1HYU A;  1GRA A;  2DKI A;  4E0V A;  1DXL A;  3GRT A;  1QO8 A;  4D04 A;  4JDR A;  1IUV A;  1GRG A;  1NEK A;  2C76 A;  1ELI A;  1OJT A;  4NTE A;  1P2H A;  4H2R A;  4B67 A;  1NHP A;  3LAD A;  3F8D A;  2GR0 A;  1LV0 A;  4JY2 A;  1ZX9 A;  3BI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...