5DBJA

Crystal structure of halogenase plta
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
437
structure length
435
Chain Sequence
b'SDHDYDVVIIGGGPAGSTMASYLAKAGVKCAVFEKELFEREHVGESLVPATTPVLLEIGVMEKIEKANFPKKFGAAWTSADSGPEDKMGFQGLDHDFRSAEILFNERKQEGVDRDFTFHVDRGKFDRILLEHAGSLGAKVFQGVEIADVEFLSPGNVIVNAKLGKRSVEIKAKMVVDASGRNVLLGRRLGLREKDPVFNQFAIHSWFDNFDRKSATQSPDKVDYIFIHFLPMTNTWVWQIPITETITSVGVVTQKQNYTNSDLTYEEFFWEAVKTRENLHDALKASEQVRPFKKEADYSYGMKEVCGDSFVLIGDAARFVDPIFSSGVSVALNSARIASGDIIEAVKNNDFSKSSFTHYEGMIRNGIKNWYEFITLYYRLNILFTAFVQDPRYRLDILQLLQGDVYSGLEVLDKMREIIAAVESDPEHLWHKYLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FADH2-dependent halogenase PltA
publication title Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.
pubmed doi rcsb
source organism Pseudomonas fluorescens (strain pf-5 / atcc baa-477)
molecule tags Flavoprotein
total genus 134
structure length 435
sequence length 437
chains with identical sequence B, C, D, E
ec nomenclature ec 3.8.1.1: Alkylhalidase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5dbjA00
3VQRA 4Z26A 1H7XA 2JK6A 3CNPA 2QAEA 4CY6A 4XXGA 3NIXA 2XLTA 4H4ZA 1D7LA 4TM0A 4H4XA 4PAAA 2V6OA 4FDCB 4Z2UA 1GALA 4LA1A 3UKLA 2GMJA 1BGJA 1PJ7A 1Y0PA 3IF9A 4U2LA 5GRTA 2E4GA 3UOXA 2FBWA 4B63A 2ZZ0A 2FJBA 1PBFA 3ATRA 2B9WA 1H6VA 1V59A 4CNJA 1PBBA 1OJCA 4DSGA 2DKIA 4GF7A 4YKFA 3K7TA 1GREA 3C4NA 4YKGA 1OJTA 1GTEA 3JSKA 2VOUA 3NYCA 5FS9A 2WOWA 2ZZBA 1GETA 2BS4A 3S61A 3SFEA 3AE3A 3LADA 3VR9A 1N4WA 4HA6A 1Y56B 3DK9A 2BYBA 2XYOA 1COYA 3EAOA 2R46A 3LJPA 1YQ3A 3NK0X 3VRBA 3DJDA 4A6NA 4YT0A 2EQ9A 1EL9A 5KVHA 1Q1WA 1KNRA 3ZDNA 1PBDA 2RGJA 2V60A 5M0ZA 2R0PA 2XDOA 2OALA 3UTHA 1ONFA 1D5TA 1CF3A 4NEVA 5EB5A 3NYFA 3OZ2A 2YG5A 3ICRA 1S2YA 2FJEA 2WPFA 4AT0A 4I58A 4JNAA 3UTEA 1GNDA 4U8IA 3REDA 1YY5A 3F8RA 1BZLA 4J2WA 1DNCA 5C3JA 4B66A 1CJCA 2C75A 5FMHA 2YQUA 3AEBA 1BGNA 2XLSA 2YR5A 1FCDA 4H4WA 4H4QA 3L1RA 4Y4NA 2A89A 2YVGA 4REKA 1NEKA 5HY5A 3EF6A 1F6MA 4GCMA 4WCTA 2GMHA 4TM4A 5KVIA 1E1MA 1NDAA 1NAAA 2WDQA 1O94A 5JCLA 2IIDA 2NPXA 3KU9A 4IV9A 5EOWA 4Z25A 3NGCX 4APNA 4U8OA 4GDPA 4U8NA 2YLZA 4B64A 2PYXA 3I6DA 1W4XA 1KF6A 1K4QA 3ADAB 1SEZA 5U25A 2BS2A 3GWFA 3AE5A 1GRFA 3CNDA 1GRGA 2B7RA 3FIMB 2C64A 3NN6X 5CKUA 4AOSA 3NK1X 4RG4A 2J3NA 4A5LA 2CVJA 2O9ZA 3VRAA 5BULA 3M13A 1PBEA 2GAGB 3AECA 4WX1A 2GQWA 4O5UA 2CDUA 1GEUA 1KSSA 3AE2A 1L0VA 4CCRA 2VQBA 2XVEA 4TM3A 4BJZA 1CJ3A 3AD9B 4D04A 2XVJA 3H8LA 2BXRA 4C3YA 5JCNA 2GR1A 4Z2RA 2XCGA 1ELIA 2XFOA 4H2NA 3UTFA 4C74A 2WETA 2WU5A 1EL7A 2V61A 3CPHG 4H4TA 3T37A 1D7YA 3Q9TA 1VG9A 2JAEA 2WOIA 5J7XA 4ZN0A 3O0HA 2EQ8A 2WESA 5KOXA 4J34A 3P4SA 1H82A 1LPFA 1PXBA 3ATQA 1H81A 4U8KA 4EQRA 4KPRA 2GR3A 1BF3A 1UKVG 3SGLA 3NTDA 3NNEA 1H84A 3OC4A 3UKKA 1DXLA 4OPUA 1K0LA 3FBSA 2H89A 3D1CA 4K5SA 2EQ7A 2WP6A 4H4YA 1NHQA 2BXSA 3CPJG 4Z43A 2WU2A 3UOZA 1IUWA 3UOYA 2C67A 3ISHA 2R4EA 1CC2A 4USQA 4AP1A 4OPDA 5HHFA 1EBDA 4U8PA 1DJQA 2C70A 2E5VA 1YQ4A 1GOSA 1BKWA 3HZLA 1BWCA 3AE1A 1OJ9A 3KA7A 4P9SA 5EB4A 4U8JA 5IQ4A 1DODA 2E1MA 1QJDA 2DKHA 3LZWA 3KPFA 4B68A 4C3XA 1XPQA 4UDPA 2Y6QA 1Y56A 4GRTA 3RNMA 2YM2A 4NTEA 4KX6A 4YTPA 5DBJA 1O95A 3EANA 3VR8A 4H4SA 4A99A 2RABA 2X99A 3BHKA 3DJJA 2C3CA 4B1BA 3QSEA 2WDVA 4H4RA 3QSMA 4XWZA 1D4DA 1GRAA 1JU2A 2R0CA 4HB9A 5FS8A 1DOBA 1ZP0A 1ZOYA 2C66A 2XLPA 4GDEA 3UCLA 1KFYA 1XHCA 3D8XA 2Q7VA 2WPEA 2XFUA 4J36A 3GDPA 4CCQA 2YLWA 2YLTA 3GDNA 2Q0KA 1GTHA 1GESA 1YKJA 2B9YA 2B7SA 3FG2P 3FMWA 2OLNA 2BCGG 3NH3X 2PHHA 4BK3A 3AYIA 2BC1A 3UKHA 2C65A 4CNKA 5JCMA 2BC0A 4U2SA 4B67A 2GV8A 4IA6A 4A9WA 4RSLA 4NEWA 5ER0A 1F8RA 1F8SA 3AXBA 3UP4A 3ALJA 1TDNA 4EQWA 4IA5A 3GSIA 1Z6LA 2QA2A 3NK2X 1O5WA 4H50A 1CL0A 3B6DA 2AQJA 2XFNA 2BABA 3F8DA 4EIPA 1DJNA 2OA1A 2APGA 2BA9A 3BI4A 4GUVA 5J60A 1QO8A 3RP6A 4FK1A 4BV6A 4B69A 4J57A 1JRZA 1CJ2A 1VDCA 3WE0A 4RG3A 1NG4A 3URHA 3Q6JA 3H8IA 2VZ2A 2Q6UA 4CBQA 1ZX9A 4B65A 2OLOA 1ZMCA 2W0HA 3DK8A 4JY2A 3DGZA 3IHMA 3LOVA 4FX9A 2GRTA 1B4VA 3AEAA 4K2XA 1AOGA 3EPTA 4MJWA 4UP3A 5C2TA 5M10A 2X50A 4OPGA 1M6IA 3V76A 3BHFA 2BACA 1KSUA 2Q0LA 3ABVA 2WDRA 4EM4A 5KOWA 2XVFA 2VVLG 3ICSA 2IVDA 3CNJA 4ADWA 3NN0X 4I59A 4X4JA 3CIRA 1XANA 3H4KA 1E1KA 1TDEA 4Z44A 1K0JA 5TR3A 3IHGA 4OPCA 4X9MA 2GEWA 3DH9A 1S3EA 3P9UA 4C77A 1ZDLA 4EMJA 5BRTA 3GRSA 3AE8A 2V3AA 2C73A 2YAUA 3QJ4A 1E6EA 1JNZA 1GRTA 2BS3A 2FJDA 3GMBA 1FECA 3ITJA 4H7UA 1TDFA 1N4UA 1NHSA 3RHAA 2TPRA 1L9EA 1CHUA 1FL2A 2WEUA 2BK4A 2WP5A 3II4A 4GR1A 1VRQB 2X8HA 1CBOA 2BCPA 2H88A 3AE4A 2C76A 2X8CA 3BI2A 4J56A 4A65A 1RYIA 2ZBWA 4JY3A 3P4PA 3UKQA 5CQFA 2YLSA 1EL5A 4O5QA 4YTMA 1IUTA 1FOHA 2GR0A 4YXDA 4YTNA 4OCGA 2JB3A 2UZZA 4JNQA 2YR6A 3GD4A 1E1NA 2YLXA 4UDRA 3ALLA 3K30A 3AD8B 1GPEA 2GVCA 3QSSA 1DOCA 3B3RA 3NHOX 2JB2A 2C7GA 2YLRA 4U8LA 3K7QX 2YWLA 3IC9A 2QA1A 2TMDA 2BK5A 4JDRA 2YM1A 3CPIG 1JEHA 4H2PA 2WPCA 1Q9IA 2ZZCA 3QFBA 5U63A 1GSNA 2JBVA 2XVIA 1PXCA 3GYIA 3NKSA 2YG7A 2GR2A 3I3LA 5EBKA 3AEDA 2A8XA 4NTDA 3C4AA 3V3NA 1ZY8A 2CULA 2YVFA 3G5SA 1P2HA 4A79A 4OVIA 1VQWA 4YSXA 1Q1RA 5KXJA 1B5QA 2QCUA 1DOEA 1OJAA 4K22A 3SQPA 5IQ1A 1HYUA 5KWFA 2GAHB 5JCKA 4AOXA 3CGBA 1LJ1A 1M64A 5LV9A 2XFPA 1LQTA 4BURA 4D03A 3M12A 4ICYA 4TLZA 1H7WA 4J33A 4Z24A 4E0VA 2R45A 1F8WA 3KKJA 3NLCA 5IPYA 1ZK7A 4LIIA 1IUVA 3GRTA 2CFYA 1PN0A 3G5QA 4BK2A 2WQYA 3K7MX 1NG3A 2VRMA 1PBCA 3IWAA 4YSYA 1PJ5A 1GERA 2GH5A 2OAMA 4JN9A 3ICTA 3P4RA 1E39A 1RP0A 2VVLA 4X9NA 1REOA 1K0IA 3S5WA 2JB1A 4N9XA 1S3BA 2NVKX 3KVEA 2AR8A 1XDIA 2VVMA 3ZYXA 3NTAA 2RGOA 3P1WA 4EQSA 1NENA 4IVMB 1LVLA 2Z5XA 4DSHA 3DA1A 3DGHA 3CTYA 4ZCCA 3AD7B 1EL8A 2R0GA 1IUXA 4Z2TA 1B8SA 2ACZA 3AEEA 2I0ZA 3PVCA 3P4QA 1H86A 2HQMA 1N1PA 2XLRA 3RP7A 5KRQA 2YR4A 1P2EA 1GRBA 1GT8A 3L8KA 4TM1A 1X31B 4ZCDA 3LZXA 4M52A 3COXA 4IVOB 4C5OA 3DJGX 5HXIA 2WBAA 3QFAA 4H4PA 4K5RA 1FEBA 3AB1A 5FS7A 4EM3A 2XFQA 2ARDA 1TYTA 1ZKQA 1F3PA 2XLUA 2Y6RA 4YWOA 1JRYA 1KNPA 2WS3A 3NRNA 2IVEA 1OJDA 3CGEA 1PDHA 1ZOVA 1D4CA 1L9CA 3F8PA 3GYJA 1MO9A 3CNSA 3AE6A 1IJHA 4ECHA 1MXTA 1E7PA 1L9DA 4BK1A 5L46A 3RP8A 2GQFA 3NYEA 4U8MA 4H4UA 4CY8A 3UP5A 4YSZA 1QLBA 2WP9A 4JQ9A 4LU6A 3UOVA 5U1OA 1TDKA 1IUSA 5BUKA 2EQ6A 5HYMA 3NG7X 3C96A 3CGCA 4A6NB 2GB0A 2R9ZA 2Z5YA 3PO7A 3M0OA 1PS9A 1FEAA 2B9XA 3V3OA 4NTCA 3AE7A 4OPTA 3KLJA 2VQ7A 2V5ZA 1NHPA 1ZMDA 3NT6A 2AAQA 2C3DA 2R4JA 3CGDA 2V3BA 4BJYA 5JCIA 2WHDA 1YQZA 4XWRA 1CC6A 1H83A 4DNAA 3VRDB 5BVAA 1JNRA 2RGHA 3AE9A 4H2QA 2YVJA 1S2QA 3BNMA 2XVHA 3LB8A 3BNUA 4OPLA 3DK4A 3PS9A 3UKFA 4AT2A 1N4VA 3QVPA 1IUUA 4UDQA 4TLXA 1PHHA 1TDOA 3AYLA 2YG3A 3LXDA 1GRHA 3BI5A 1LQUA 1JRXA 1JOAA 1TYPA 1CJ4A 3CNTA 4Y4LA 2WOVA 1PXAA 1KDGA 2GF3A 4PABA 4K8DA 2YG6A 4NZHA 4EIQA 1D4EA 3GD3A 4K7ZA 2JKCA 3UTGA 4A7AA 3UKPA 1MOKA 4EMIA 4H2RA 2X8GA 5GSNA 3CN8A 4J31A 1NPXA 4DGKA 1LV0A 3G5RA 3AYJA 1B37A 1CC4A 2FJAA 3UKAA 3R9UA 4EMWA 1LTXR 1PJ6A 5FS6A 3ALMA 1E1LA 4U2TA 4USRA 1GV4A 3AEFA 2X3NA 4YSHA 3KD9A 4Y4MA 1NHRA 3SFDA 3AWIA 4FK1C 3SM8A 4CRTA 2B76A 4AP3A 3E1TA 3GMCA 3DMEA 2YG4A 3GWDA 4OPIA 4EQXA 2BK3A 3DJEA 4H4VA 1VG0A 3QVRA 3FPZA 2A87A 2VRLA 1TRBA 2F5ZA 1RSGA 2C72A 3AEGA 1GXFA
chains in the Genus database with same CATH superfamily
3VQRA 4Z26A 1H7XA 2JK6A 3CNPA 2QAEA 4CY6A 4XXGA 3NIXA 2XLTA 4H4ZA 1D7LA 4TM0A 4H4XA 4PAAA 2V6OA 4FDCB 4Z2UA 3T14A 1GALA 4LA1A 3UKLA 2GMJA 1BGJA 1PJ7A 1Y0PA 3IF9A 4U2LA 5GRTA 2E4GA 3UOXA 2FBWA 5KMQA 4B63A 2ZZ0A 2FJBA 1PBFA 3ATRA 2B9WA 1H6VA 1V59A 4CNJA 1PBBA 1OJCA 4DSGA 2DKIA 4GF7A 4YKFA 3K7TA 1GREA 3C4NA 4YKGA 1OJTA 1GTEA 3JSKA 2VOUA 3NYCA 5FS9A 2WOWA 2ZZBA 1GETA 2BS4A 3S61A 3SFEA 3AE3A 3LADA 3VR9A 1N4WA 4HA6A 1Y56B 3DK9A 2BYBA 2XYOA 1COYA 3EAOA 2R46A 3LJPA 1YQ3A 3NK0X 3VRBA 3DJDA 4A6NA 4YT0A 2EQ9A 1EL9A 4II3A 5KVHA 1Q1WA 1KNRA 3ZDNA 1PBDA 2RGJA 2V60A 5M0ZA 2R0PA 2XDOA 2C4CA 2OALA 3UTHA 1ONFA 1D5TA 1CF3A 4NEVA 5EB5A 3NYFA 3OZ2A 2YG5A 3ICRA 1S2YA 2FJEA 2WPFA 4AT0A 4I58A 3SXIA 4JNAA 3UTEA 1GNDA 4U8IA 3REDA 1YY5A 3F8RA 1BZLA 4J2WA 1DNCA 3SZFA 4B66A 1CJCA 2C75A 5FMHA 2YQUA 3AEBA 5C3JA 1BGNA 2XLSA 2YR5A 1FCDA 4H4WA 4H4QA 3L1RA 4Y4NA 2A89A 2YVGA 4REKA 1NEKA 5HY5A 3EF6A 1F6MA 4GCMA 4WCTA 2GMHA 4TM4A 3HYXA 1E1MA 1NDAA 1NAAA 5KVIA 3T2YA 2WDQA 1O94A 5JCLA 2IIDA 2NPXA 3KU9A 4IV9A 5EOWA 4Z25A 3NGCX 4APNA 4U8OA 4GDPA 4U8NA 2YLZA 4B64A 2PYXA 3I6DA 1W4XA 1KF6A 1K4QA 3ADAB 1SEZA 5U25A 2BS2A 3GWFA 3AE5A 1GRFA 4GAVA 3CNDA 1GRGA 2B7RA 3FIMB 2C64A 3NN6X 5CKUA 4AOSA 3NK1X 4RG4A 2J3NA 4A5LA 2CVJA 2O9ZA 3VRAA 5BULA 3M13A 1PBEA 2GAGB 3AECA 4WX1A 2GQWA 4O5UA 2CDUA 1GEUA 1KSSA 3AE2A 1L0VA 5KMRA 4CCRA 2VQBA 2XVEA 3GYXA 4TM3A 4BJZA 1CJ3A 3AD9B 4D04A 2XVJA 3H8LA 2BXRA 4C3YA 5JCNA 2GR1A 4Z2RA 2XCGA 1ELIA 2XFOA 4H2NA 3UTFA 4C74A 2WETA 2WU5A 1EL7A 2V61A 3CPHG 4H4TA 3T37A 1D7YA 3Q9TA 1VG9A 2JAEA 2WOIA 5J7XA 4ZN0A 3O0HA 2EQ8A 2WESA 5KOXA 4J34A 3P4SA 1H82A 1LPFA 1PXBA 3ATQA 1H81A 4U8KA 4EQRA 4KPRA 2GR3A 1BF3A 1UKVG 3SGLA 3NTDA 3NNEA 1H84A 3OC4A 3UKKA 1DXLA 4OPUA 1K0LA 3FBSA 2H89A 3D1CA 4K5SA 2EQ7A 2WP6A 4H4YA 1NHQA 2BXSA 3CPJG 4Z43A 2WU2A 3UOZA 1IUWA 2BRAA 2C67A 3ISHA 3UOYA 2R4EA 1CC2A 4USQA 4AP1A 4OPDA 5HHFA 1EBDA 4U8PA 1DJQA 2C70A 2E5VA 1YQ4A 1GOSA 1BKWA 3HZLA 1BWCA 3AE1A 1OJ9A 3KA7A 4P9SA 5EB4A 4U8JA 5IQ4A 1DODA 2E1MA 1QJDA 2DKHA 3LZWA 3KPFA 3KPKA 4B68A 4C3XA 1XPQA 4UDPA 3T0KA 2Y6QA 1Y56A 4GRTA 3RNMA 3T31A 2YM2A 4NTEA 4KX6A 4YTPA 5DBJA 1O95A 3EANA 3VR8A 3SZ0A 4H4SA 4A99A 2RABA 2X99A 3BHKA 3DJJA 2C3CA 4B1BA 3QSEA 2WDVA 4H4RA 3QSMA 4XWZA 1D4DA 1GRAA 1JU2A 2R0CA 4HB9A 5FS8A 1DOBA 1ZP0A 1ZOYA 2C66A 2XLPA 4GDEA 3UCLA 1KFYA 1XHCA 3D8XA 2Q7VA 2WPEA 2XFUA 4J36A 3GDPA 4CCQA 2YLWA 2YLTA 3GDNA 2Q0KA 1GTHA 4GAPA 1GESA 1YKJA 2B9YA 2B7SA 3FG2P 3FMWA 2OLNA 2BCGG 3NH3X 2PHHA 4BK3A 3AYIA 2BC1A 3UKHA 2C65A 4CNKA 5JCMA 2BC0A 4G6GA 4U2SA 4B67A 2GV8A 4IA6A 4A9WA 4G73A 4RSLA 4NEWA 5ER0A 1F8RA 1F8SA 3AXBA 3UP4A 3ALJA 1TDNA 4EQWA 4IA5A 3GSIA 1Z6LA 2QA2A 3NK2X 1O5WA 4H50A 1CL0A 3B6DA 2AQJA 2XFNA 2BABA 3F8DA 3T2ZA 4EIPA 1DJNA 2OA1A 2APGA 2BA9A 3BI4A 4GUVA 5J60A 1QO8A 3RP6A 4FK1A 4BV6A 4B69A 4J57A 1JRZA 1CJ2A 1VDCA 3WE0A 4RG3A 1NG4A 3URHA 3Q6JA 3H8IA 2VZ2A 2Q6UA 4CBQA 1ZX9A 4B65A 2OLOA 1ZMCA 2W0HA 3DK8A 4JY2A 3DGZA 3IHMA 3LOVA 4FX9A 2GRTA 1B4VA 3AEAA 4K2XA 1AOGA 3EPTA 4MJWA 4UP3A 5C2TA 5M10A 2X50A 4OPGA 1M6IA 3V76A 3BHFA 2BACA 1KSUA 2Q0LA 3ABVA 2WDRA 4EM4A 5KOWA 2XVFA 2VVLG 3ICSA 2IVDA 3CNJA 4ADWA 3NN0X 4I59A 4X4JA 3CMMA 3SYIA 3CIRA 1XANA 3H4KA 1E1KA 1TDEA 4Z44A 1K0JA 5TR3A 3IHGA 4OPCA 4X9MA 2GEWA 3DH9A 1S3EA 3P9UA 4C77A 1ZDLA 4EMJA 5BRTA 3GRSA 3AE8A 2V3AA 2C73A 2YAUA 3QJ4A 1E6EA 1JNZA 1GRTA 2BS3A 2FJDA 3GMBA 1FECA 3HYWA 3ITJA 4H7UA 1TDFA 1N4UA 1NHSA 3RHAA 2TPRA 1L9EA 1CHUA 1FL2A 2WEUA 2BK4A 2WP5A 3II4A 4GR1A 1VRQB 2X8HA 1CBOA 2BCPA 2H88A 3AE4A 2C76A 2X8CA 3BI2A 4J56A 4A65A 1RYIA 2ZBWA 4NWZA 4JY3A 3P4PA 3UKQA 5CQFA 2YLSA 1EL5A 4O5QA 4YTMA 1IUTA 1FOHA 2GR0A 4YXDA 4YTNA 4OCGA 2JB3A 2UZZA 4JNQA 2YR6A 3GD4A 1E1NA 2YLXA 4UDRA 3ALLA 3K30A 3AD8B 1GPEA 2GVCA 3QSSA 1DOCA 3B3RA 3NHOX 2JB2A 2C7GA 2YLRA 4U8LA 3K7QX 2YWLA 3IC9A 2QA1A 2TMDA 2BK5A 4JDRA 2YM1A 3CPIG 1JEHA 4H2PA 3SZWA 2WPCA 1Q9IA 2ZZCA 3QFBA 5U63A 1GSNA 2JBVA 2XVIA 1PXCA 3GYIA 3NKSA 2YG7A 2GR2A 3I3LA 5EBKA 3AEDA 2A8XA 4NTDA 3C4AA 3V3NA 1ZY8A 2CULA 4G74A 2YVFA 3G5SA 1P2HA 4A79A 4OVIA 1VQWA 4YSXA 3SX6A 1Q1RA 5KXJA 1B5QA 2QCUA 1DOEA 1OJAA 4K22A 3SQPA 5IQ1A 1HYUA 5KWFA 2GAHB 5JCKA 4AOXA 3CGBA 1LJ1A 1M64A 5LV9A 2XFPA 1LQTA 3HYVA 4BURA 4D03A 3M12A 4ICYA 4TLZA 1H7WA 5KMPA 4J33A 4Z24A 4E0VA 2R45A 1F8WA 3KKJA 3NLCA 5IPYA 1ZK7A 4LIIA 1IUVA 3GRTA 2CFYA 1PN0A 3G5QA 4BK2A 2WQYA 3K7MX 1NG3A 2VRMA 1PBCA 3IWAA 4YSYA 1PJ5A 1GERA 2GH5A 2OAMA 4JN9A 3ICTA 3P4RA 1E39A 1RP0A 2VVLA 4X9NA 1REOA 1K0IA 3S5WA 2JB1A 4N9XA 1S3BA 2NVKX 3KVEA 2AR8A 1XDIA 2VVMA 3ZYXA 3NTAA 2RGOA 3P1WA 4EQSA 1NENA 4IVMB 1LVLA 2Z5XA 4DSHA 3DA1A 3DGHA 3CTYA 4ZCCA 3AD7B 1EL8A 2R0GA 1IUXA 4Z2TA 5KMSA 1B8SA 2ACZA 2BRYA 3AEEA 2I0ZA 3PVCA 3P4QA 1H86A 2HQMA 1N1PA 2XLRA 3RP7A 5KRQA 2YR4A 1P2EA 1GRBA 1GT8A 3L8KA 4TM1A 1X31B 4ZCDA 4NNJA 3LZXA 4M52A 3COXA 4IVOB 4C5OA 3DJGX 5HXIA 2WBAA 3QFAA 4H4PA 4K5RA 1FEBA 3AB1A 5FS7A 4EM3A 2XFQA 2ARDA 1TYTA 1ZKQA 1F3PA 2XLUA 2Y6RA 4YWOA 1JRYA 1KNPA 2WS3A 3NRNA 2IVEA 1OJDA 3CGEA 1PDHA 1ZOVA 1D4CA 1L9CA 3F8PA 3GYJA 1MO9A 3CNSA 3AE6A 1IJHA 4ECHA 1MXTA 1E7PA 1L9DA 4BK1A 5L46A 3RP8A 2GQFA 3NYEA 4U8MA 4H4UA 4CY8A 3UP5A 4YSZA 1QLBA 2WP9A 4JQ9A 4LU6A 3UOVA 5U1OA 1TDKA 1IUSA 5KNLA 5BUKA 2EQ6A 5HYMA 3NG7X 3C96A 3CGCA 4A6NB 2GB0A 2R9ZA 2Z5YA 3PO7A 3M0OA 1PS9A 1FEAA 2B9XA 3V3OA 3T2KA 4NTCA 3AE7A 4OPTA 3KLJA 2VQ7A 2V5ZA 1NHPA 3SY4A 1ZMDA 3NT6A 2AAQA 2C3DA 3SZCA 2R4JA 3CGDA 2V3BA 4BJYA 5JCIA 2WHDA 1YQZA 4XWRA 1CC6A 1H83A 4DNAA 3VRDB 5BVAA 1JNRA 2RGHA 3AE9A 4H2QA 2YVJA 1S2QA 3BNMA 2XVHA 3LB8A 3BNUA 4OPLA 3DK4A 3PS9A 3UKFA 4AT2A 1N4VA 3QVPA 1IUUA 4UDQA 4TLXA 1PHHA 1TDOA 3AYLA 2YG3A 3LXDA 1GRHA 3BI5A 1LQUA 1JRXA 1JOAA 1TYPA 1CJ4A 3CNTA 4Y4LA 2WOVA 1PXAA 1KDGA 2GF3A 4PABA 4K8DA 2YG6A 4NZHA 4EIQA 1D4EA 3GD3A 4K7ZA 2JKCA 3UTGA 4A7AA 3UKPA 1MOKA 4EMIA 4H2RA 2X8GA 5GSNA 3CN8A 4J31A 4G9KA 1NPXA 4DGKA 1LV0A 3G5RA 3AYJA 1B37A 1CC4A 2FJAA 3UKAA 3R9UA 4EMWA 1LTXR 1PJ6A 5FS6A 3ALMA 1E1LA 4U2TA 4USRA 1GV4A 3AEFA 2X3NA 4YSHA 3KD9A 4Y4MA 1NHRA 3SFDA 3AWIA 4FK1C 3SM8A 4CRTA 2B76A 4AP3A 3E1TA 4II2A 3GMCA 4G6HA 3DMEA 2YG4A 3GWDA 4OPIA 4EQXA 2BK3A 3DJEA 4H4VA 1VG0A 3QVRA 3FPZA 2A87A 2VRLA 1TRBA 2F5ZA 1RSGA 2C72A 3AEGA 1GXFA
chains in the Genus database with same CATH topology
3VQRA 4Z26A 1H7XA 2JK6A 3CNPA 2QAEA 4CY6A 4XXGA 3NIXA 2XLTA 4H4ZA 1D7LA 4TM0A 4H4XA 4PAAA 2V6OA 4FDCB 4Z2UA 3T14A 1GALA 4LA1A 3UKLA 2GMJA 1BGJA 1PJ7A 1Y0PA 3IF9A 4U2LA 5GRTA 2E4GA 3UOXA 2FBWA 5KMQA 4B63A 2ZZ0A 2FJBA 1PBFA 3ATRA 2B9WA 1H6VA 1V59A 4CNJA 1PBBA 1OJCA 4DSGA 2DKIA 4GF7A 4YKFA 3K7TA 1GREA 3C4NA 4YKGA 1OJTA 1GTEA 3JSKA 2VOUA 3NYCA 5FS9A 2WOWA 2ZZBA 1GETA 2BS4A 3S61A 3SFEA 3AE3A 3LADA 3VR9A 1N4WA 4HA6A 1Y56B 3DK9A 2BYBA 2XYOA 1COYA 3EAOA 2R46A 3LJPA 1YQ3A 3NK0X 3VRBA 3DJDA 4A6NA 4YT0A 2EQ9A 1EL9A 4II3A 5KVHA 1Q1WA 1KNRA 3ZDNA 1PBDA 2RGJA 2V60A 5M0ZA 2R0PA 2XDOA 2C4CA 2OALA 3UTHA 1ONFA 1D5TA 1CF3A 4NEVA 5EB5A 3NYFA 3OZ2A 2YG5A 3ICRA 1S2YA 2FJEA 2WPFA 4AT0A 4I58A 3SXIA 4JNAA 3UTEA 1GNDA 4U8IA 3REDA 1YY5A 3F8RA 1BZLA 4J2WA 1DNCA 3SZFA 4B66A 1CJCA 2C75A 5FMHA 2YQUA 3AEBA 5C3JA 1BGNA 2XLSA 2YR5A 1FCDA 4H4WA 4H4QA 3L1RA 4Y4NA 2A89A 2YVGA 4REKA 1NEKA 5HY5A 3EF6A 1F6MA 4GCMA 4WCTA 2GMHA 4TM4A 3HYXA 1E1MA 1NDAA 1NAAA 5KVIA 3T2YA 2WDQA 1O94A 5JCLA 2IIDA 2NPXA 3KU9A 4IV9A 5EOWA 4Z25A 3NGCX 4APNA 4U8OA 4GDPA 4U8NA 2YLZA 4B64A 2PYXA 3I6DA 1W4XA 1KF6A 1K4QA 3ADAB 1SEZA 5U25A 2BS2A 3GWFA 3AE5A 1GRFA 4GAVA 3CNDA 1GRGA 2B7RA 3FIMB 2C64A 3NN6X 5CKUA 4AOSA 3NK1X 4RG4A 2J3NA 4A5LA 2CVJA 2O9ZA 3VRAA 5BULA 3M13A 1PBEA 2GAGB 3AECA 4WX1A 2GQWA 4O5UA 2CDUA 1GEUA 1KSSA 3AE2A 1L0VA 5KMRA 4CCRA 2VQBA 2XVEA 3GYXA 4TM3A 4BJZA 1CJ3A 3AD9B 4D04A 2XVJA 3H8LA 2BXRA 4C3YA 5JCNA 2GR1A 4Z2RA 2XCGA 1ELIA 2XFOA 4H2NA 3UTFA 4C74A 2WETA 2WU5A 1EL7A 2V61A 3CPHG 4H4TA 3T37A 1D7YA 3Q9TA 1VG9A 2JAEA 2WOIA 5J7XA 4ZN0A 3O0HA 2EQ8A 2WESA 5KOXA 4J34A 3P4SA 1H82A 1LPFA 1PXBA 3ATQA 1H81A 4U8KA 4EQRA 4KPRA 2GR3A 1BF3A 1UKVG 3SGLA 3NTDA 3NNEA 1H84A 3OC4A 3UKKA 1DXLA 4OPUA 1K0LA 3FBSA 2H89A 3D1CA 4K5SA 2EQ7A 2WP6A 4H4YA 1NHQA 2BXSA 3CPJG 4Z43A 2WU2A 3UOZA 1IUWA 2BRAA 2C67A 3ISHA 3UOYA 2R4EA 1CC2A 4USQA 4AP1A 4OPDA 5HHFA 1EBDA 4U8PA 1DJQA 2C70A 2E5VA 1YQ4A 1GOSA 1BKWA 3HZLA 1BWCA 3AE1A 1OJ9A 3KA7A 4P9SA 5EB4A 4U8JA 5IQ4A 1DODA 2E1MA 1QJDA 2DKHA 3LZWA 3KPFA 3KPKA 4B68A 4C3XA 1XPQA 4UDPA 3T0KA 2Y6QA 1Y56A 4GRTA 3RNMA 3T31A 2YM2A 4NTEA 4KX6A 4YTPA 5DBJA 1O95A 3EANA 3VR8A 3SZ0A 4H4SA 4A99A 2RABA 2X99A 3BHKA 3DJJA 2C3CA 4B1BA 3QSEA 2WDVA 4H4RA 3QSMA 4XWZA 1D4DA 1GRAA 1JU2A 2R0CA 4HB9A 5FS8A 1DOBA 1ZP0A 1ZOYA 2C66A 2XLPA 4GDEA 3UCLA 1KFYA 1XHCA 3D8XA 2Q7VA 2WPEA 2XFUA 4J36A 3GDPA 4CCQA 2YLWA 2YLTA 3GDNA 2Q0KA 1GTHA 4GAPA 1GESA 1YKJA 2B9YA 2B7SA 3FG2P 3FMWA 2OLNA 2BCGG 3NH3X 2PHHA 4BK3A 3AYIA 2BC1A 3UKHA 2C65A 4CNKA 5JCMA 2BC0A 4G6GA 4U2SA 4B67A 2GV8A 4IA6A 4A9WA 4G73A 4RSLA 4NEWA 5ER0A 1F8RA 1F8SA 3AXBA 3UP4A 3ALJA 1TDNA 4EQWA 4IA5A 3GSIA 1Z6LA 2QA2A 3NK2X 1O5WA 4H50A 1CL0A 3B6DA 2AQJA 2XFNA 2BABA 3F8DA 3T2ZA 4EIPA 1DJNA 2OA1A 2APGA 2BA9A 3BI4A 4GUVA 5J60A 1QO8A 3RP6A 4FK1A 4BV6A 4B69A 4J57A 1JRZA 1CJ2A 1VDCA 3WE0A 4RG3A 1NG4A 3URHA 3Q6JA 3H8IA 2VZ2A 2Q6UA 4CBQA 1ZX9A 4B65A 2OLOA 1ZMCA 2W0HA 3DK8A 4JY2A 3DGZA 3IHMA 3LOVA 4FX9A 2GRTA 1B4VA 3AEAA 4K2XA 1AOGA 3EPTA 4MJWA 4UP3A 5C2TA 5M10A 2X50A 4OPGA 1M6IA 3V76A 3BHFA 2BACA 1KSUA 2Q0LA 3ABVA 2WDRA 4EM4A 5KOWA 2XVFA 2VVLG 3ICSA 2IVDA 3CNJA 4ADWA 3NN0X 4I59A 4X4JA 3CMMA 3SYIA 3CIRA 1XANA 3H4KA 1E1KA 1TDEA 4Z44A 1K0JA 5TR3A 3IHGA 4OPCA 4X9MA 2GEWA 3DH9A 1S3EA 3P9UA 4C77A 1ZDLA 4EMJA 5BRTA 3GRSA 3AE8A 2V3AA 2C73A 2YAUA 3QJ4A 1E6EA 1JNZA 1GRTA 2BS3A 2FJDA 3GMBA 1FECA 3HYWA 3ITJA 4H7UA 1TDFA 1N4UA 1NHSA 3RHAA 2TPRA 1L9EA 1CHUA 1FL2A 2WEUA 2BK4A 2WP5A 3II4A 4GR1A 1VRQB 2X8HA 1CBOA 2BCPA 2H88A 3AE4A 2C76A 2X8CA 3BI2A 4J56A 4A65A 1RYIA 2ZBWA 4NWZA 4JY3A 3P4PA 3UKQA 5CQFA 2YLSA 1EL5A 4O5QA 4YTMA 1IUTA 1FOHA 2GR0A 4YXDA 4YTNA 4OCGA 2JB3A 2UZZA 4JNQA 2YR6A 3GD4A 1E1NA 2YLXA 4UDRA 3ALLA 3K30A 3AD8B 1GPEA 2GVCA 3QSSA 1DOCA 3B3RA 3NHOX 2JB2A 2C7GA 2YLRA 4U8LA 3K7QX 2YWLA 3IC9A 2QA1A 2TMDA 2BK5A 4JDRA 2YM1A 3CPIG 1JEHA 4H2PA 3SZWA 2WPCA 1Q9IA 2ZZCA 3QFBA 5U63A 1GSNA 2JBVA 2XVIA 1PXCA 3GYIA 3NKSA 2YG7A 2GR2A 3I3LA 5EBKA 3AEDA 2A8XA 4NTDA 3C4AA 3V3NA 1ZY8A 2CULA 4G74A 2YVFA 3G5SA 1P2HA 4A79A 4OVIA 1VQWA 4YSXA 3SX6A 1Q1RA 5KXJA 1B5QA 2QCUA 1DOEA 1OJAA 4K22A 3SQPA 5IQ1A 1HYUA 5KWFA 2GAHB 5JCKA 4AOXA 3CGBA 1LJ1A 1M64A 5LV9A 2XFPA 1LQTA 3HYVA 4BURA 4D03A 3M12A 4ICYA 4TLZA 1H7WA 5KMPA 4J33A 4Z24A 4E0VA 2R45A 1F8WA 3KKJA 3NLCA 5IPYA 1ZK7A 4LIIA 1IUVA 3GRTA 2CFYA 1PN0A 3G5QA 4BK2A 2WQYA 3K7MX 1NG3A 2VRMA 1PBCA 3IWAA 4YSYA 1PJ5A 1GERA 2GH5A 2OAMA 4JN9A 3ICTA 3P4RA 1E39A 1RP0A 2VVLA 4X9NA 1REOA 1K0IA 3S5WA 2JB1A 4N9XA 1S3BA 2NVKX 3KVEA 2AR8A 1XDIA 2VVMA 3ZYXA 3NTAA 2RGOA 3P1WA 4EQSA 1NENA 4IVMB 1LVLA 2Z5XA 4DSHA 3DA1A 3DGHA 3CTYA 4ZCCA 3AD7B 1EL8A 2R0GA 1IUXA 4Z2TA 5KMSA 1B8SA 2ACZA 2BRYA 3AEEA 2I0ZA 3PVCA 3P4QA 1H86A 2HQMA 1N1PA 2XLRA 3RP7A 5KRQA 2YR4A 1P2EA 1GRBA 1GT8A 3L8KA 4TM1A 1X31B 4ZCDA 4NNJA 3LZXA 4M52A 3COXA 4IVOB 4C5OA 3DJGX 5HXIA 2WBAA 3QFAA 4H4PA 4K5RA 1FEBA 3AB1A 5FS7A 4EM3A 2XFQA 2ARDA 1TYTA 1ZKQA 1F3PA 2XLUA 2Y6RA 4YWOA 1JRYA 1KNPA 2WS3A 3NRNA 2IVEA 1OJDA 3CGEA 1PDHA 1ZOVA 1D4CA 1L9CA 3F8PA 3GYJA 1MO9A 3CNSA 3AE6A 1IJHA 4ECHA 1MXTA 1E7PA 1L9DA 4BK1A 5L46A 3RP8A 2GQFA 3NYEA 4U8MA 4H4UA 4CY8A 3UP5A 4YSZA 1QLBA 2WP9A 4JQ9A 4LU6A 3UOVA 5U1OA 1TDKA 1IUSA 5KNLA 5BUKA 2EQ6A 5HYMA 3NG7X 3C96A 3CGCA 4A6NB 2GB0A 2R9ZA 2Z5YA 3PO7A 3M0OA 1PS9A 1FEAA 2B9XA 3V3OA 3T2KA 4NTCA 3AE7A 4OPTA 3KLJA 2VQ7A 2V5ZA 1NHPA 3SY4A 1ZMDA 3NT6A 2AAQA 2C3DA 3SZCA 2R4JA 3CGDA 2V3BA 4BJYA 5JCIA 2WHDA 1YQZA 4XWRA 1CC6A 1H83A 4DNAA 3VRDB 5BVAA 1JNRA 2RGHA 3AE9A 4H2QA 2YVJA 1S2QA 3BNMA 2XVHA 3LB8A 3BNUA 4OPLA 3DK4A 3PS9A 3UKFA 4AT2A 1N4VA 3QVPA 1IUUA 4UDQA 4TLXA 1PHHA 1TDOA 3AYLA 2YG3A 3LXDA 1GRHA 3BI5A 1LQUA 1JRXA 1JOAA 1TYPA 1CJ4A 3CNTA 4Y4LA 2WOVA 1PXAA 1KDGA 2GF3A 4PABA 4K8DA 2YG6A 4NZHA 4EIQA 1D4EA 3GD3A 4K7ZA 2JKCA 3UTGA 4A7AA 3UKPA 1MOKA 4EMIA 4H2RA 2X8GA 5GSNA 3CN8A 4J31A 4G9KA 1NPXA 4DGKA 1LV0A 3G5RA 3AYJA 1B37A 1CC4A 2FJAA 3UKAA 3R9UA 4EMWA 1LTXR 1PJ6A 5FS6A 3ALMA 1E1LA 4U2TA 4USRA 1GV4A 3AEFA 2X3NA 4YSHA 3KD9A 4Y4MA 1NHRA 3SFDA 3AWIA 4FK1C 3SM8A 4CRTA 2B76A 4AP3A 3E1TA 4II2A 3GMCA 4G6HA 3DMEA 2YG4A 3GWDA 4OPIA 4EQXA 2BK3A 3DJEA 4H4VA 1VG0A 3QVRA 3FPZA 2A87A 2VRLA 1TRBA 2F5ZA 1RSGA 2C72A 3AEGA 1GXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQR A;  4Z26 A;  1H7X A;  2JK6 A;  3CNP A;  2QAE A;  4CY6 A;  4XXG A;  3NIX A;  2XLT A;  4H4Z A;  1D7L A;  4TM0 A;  4H4X A;  4PAA A;  2V6O A;  4FDC B;  4Z2U A;  1GAL A;  4LA1 A;  3UKL A;  2GMJ A;  1BGJ A;  1PJ7 A;  1Y0P A;  3IF9 A;  4U2L A;  5GRT A;  2E4G A;  3UOX A;  2FBW A;  4B63 A;  2ZZ0 A;  2FJB A;  1PBF A;  3ATR A;  2B9W A;  1H6V A;  1V59 A;  4CNJ A;  1PBB A;  1OJC A;  4DSG A;  2DKI A;  4GF7 A;  4YKF A;  3K7T A;  1GRE A;  3C4N A;  4YKG A;  1OJT A;  1GTE A;  3JSK A;  2VOU A;  3NYC A;  5FS9 A;  2WOW A;  2ZZB A;  1GET A;  2BS4 A;  3S61 A;  3SFE A;  3AE3 A;  3LAD A;  3VR9 A;  1N4W A;  4HA6 A;  1Y56 B;  3DK9 A;  2BYB A;  2XYO A;  1COY A;  3EAO A;  2R46 A;  3LJP A;  1YQ3 A;  3NK0 X;  3VRB A;  3DJD A;  4A6N A;  4YT0 A;  2EQ9 A;  1EL9 A;  5KVH A;  1Q1W A;  1KNR A;  3ZDN A;  1PBD A;  2RGJ A;  2V60 A;  5M0Z A;  2R0P A;  2XDO A;  2OAL A;  3UTH A;  1ONF A;  1D5T A;  1CF3 A;  4NEV A;  5EB5 A;  3NYF A;  3OZ2 A;  2YG5 A;  3ICR A;  1S2Y A;  2FJE A;  2WPF A;  4AT0 A;  4I58 A;  4JNA A;  3UTE A;  1GND A;  4U8I A;  3RED A;  1YY5 A;  3F8R A;  1BZL A;  4J2W A;  1DNC A;  5C3J A;  4B66 A;  1CJC A;  2C75 A;  5FMH A;  2YQU A;  3AEB A;  1BGN A;  2XLS A;  2YR5 A;  1FCD A;  4H4W A;  4H4Q A;  3L1R A;  4Y4N A;  2A89 A;  2YVG A;  4REK A;  1NEK A;  5HY5 A;  3EF6 A;  1F6M A;  4GCM A;  4WCT A;  2GMH A;  4TM4 A;  5KVI A;  1E1M A;  1NDA A;  1NAA A;  2WDQ A;  1O94 A;  5JCL A;  2IID A;  2NPX A;  3KU9 A;  4IV9 A;  5EOW A;  4Z25 A;  3NGC X;  4APN A;  4U8O A;  4GDP A;  4U8N A;  2YLZ A;  4B64 A;  2PYX A;  3I6D A;  1W4X A;  1KF6 A;  1K4Q A;  3ADA B;  1SEZ A;  5U25 A;  2BS2 A;  3GWF A;  3AE5 A;  1GRF A;  3CND A;  1GRG A;  2B7R A;  3FIM B;  2C64 A;  3NN6 X;  5CKU A;  4AOS A;  3NK1 X;  4RG4 A;  2J3N A;  4A5L A;  2CVJ A;  2O9Z A;  3VRA A;  5BUL A;  3M13 A;  1PBE A;  2GAG B;  3AEC A;  4WX1 A;  2GQW A;  4O5U A;  2CDU A;  1GEU A;  1KSS A;  3AE2 A;  1L0V A;  4CCR A;  2VQB A;  2XVE A;  4TM3 A;  4BJZ A;  1CJ3 A;  3AD9 B;  4D04 A;  2XVJ A;  3H8L A;  2BXR A;  4C3Y A;  5JCN A;  2GR1 A;  4Z2R A;  2XCG A;  1ELI A;  2XFO A;  4H2N A;  3UTF A;  4C74 A;  2WET A;  2WU5 A;  1EL7 A;  2V61 A;  3CPH G;  4H4T A;  3T37 A;  1D7Y A;  3Q9T A;  1VG9 A;  2JAE A;  2WOI A;  5J7X A;  4ZN0 A;  3O0H A;  2EQ8 A;  2WES A;  5KOX A;  4J34 A;  3P4S A;  1H82 A;  1LPF A;  1PXB A;  3ATQ A;  1H81 A;  4U8K A;  4EQR A;  4KPR A;  2GR3 A;  1BF3 A;  1UKV G;  3SGL A;  3NTD A;  3NNE A;  1H84 A;  3OC4 A;  3UKK A;  1DXL A;  4OPU A;  1K0L A;  3FBS A;  2H89 A;  3D1C A;  4K5S A;  2EQ7 A;  2WP6 A;  4H4Y A;  1NHQ A;  2BXS A;  3CPJ G;  4Z43 A;  2WU2 A;  3UOZ A;  1IUW A;  3UOY A;  2C67 A;  3ISH A;  2R4E A;  1CC2 A;  4USQ A;  4AP1 A;  4OPD A;  5HHF A;  1EBD A;  4U8P A;  1DJQ A;  2C70 A;  2E5V A;  1YQ4 A;  1GOS A;  1BKW A;  3HZL A;  1BWC A;  3AE1 A;  1OJ9 A;  3KA7 A;  4P9S A;  5EB4 A;  4U8J A;  5IQ4 A;  1DOD A;  2E1M A;  1QJD A;  2DKH A;  3LZW A;  3KPF A;  4B68 A;  4C3X A;  1XPQ A;  4UDP A;  2Y6Q A;  1Y56 A;  4GRT A;  3RNM A;  2YM2 A;  4NTE A;  4KX6 A;  4YTP A;  5DBJ A;  1O95 A;  3EAN A;  3VR8 A;  4H4S A;  4A99 A;  2RAB A;  2X99 A;  3BHK A;  3DJJ A;  2C3C A;  4B1B A;  3QSE A;  2WDV A;  4H4R A;  3QSM A;  4XWZ A;  1D4D A;  1GRA A;  1JU2 A;  2R0C A;  4HB9 A;  5FS8 A;  1DOB A;  1ZP0 A;  1ZOY A;  2C66 A;  2XLP A;  4GDE A;  3UCL A;  1KFY A;  1XHC A;  3D8X A;  2Q7V A;  2WPE A;  2XFU A;  4J36 A;  3GDP A;  4CCQ A;  2YLW A;  2YLT A;  3GDN A;  2Q0K A;  1GTH A;  1GES A;  1YKJ A;  2B9Y A;  2B7S A;  3FG2 P;  3FMW A;  2OLN A;  2BCG G;  3NH3 X;  2PHH A;  4BK3 A;  3AYI A;  2BC1 A;  3UKH A;  2C65 A;  4CNK A;  5JCM A;  2BC0 A;  4U2S A;  4B67 A;  2GV8 A;  4IA6 A;  4A9W A;  4RSL A;  4NEW A;  5ER0 A;  1F8R A;  1F8S A;  3AXB A;  3UP4 A;  3ALJ A;  1TDN A;  4EQW A;  4IA5 A;  3GSI A;  1Z6L A;  2QA2 A;  3NK2 X;  1O5W A;  4H50 A;  1CL0 A;  3B6D A;  2AQJ A;  2XFN A;  2BAB A;  3F8D A;  4EIP A;  1DJN A;  2OA1 A;  2APG A;  2BA9 A;  3BI4 A;  4GUV A;  5J60 A;  1QO8 A;  3RP6 A;  4FK1 A;  4BV6 A;  4B69 A;  4J57 A;  1JRZ A;  1CJ2 A;  1VDC A;  3WE0 A;  4RG3 A;  1NG4 A;  3URH A;  3Q6J A;  3H8I A;  2VZ2 A;  2Q6U A;  4CBQ A;  1ZX9 A;  4B65 A;  2OLO A;  1ZMC A;  2W0H A;  3DK8 A;  4JY2 A;  3DGZ A;  3IHM A;  3LOV A;  4FX9 A;  2GRT A;  1B4V A;  3AEA A;  4K2X A;  1AOG A;  3EPT A;  4MJW A;  4UP3 A;  5C2T A;  5M10 A;  2X50 A;  4OPG A;  1M6I A;  3V76 A;  3BHF A;  2BAC A;  1KSU A;  2Q0L A;  3ABV A;  2WDR A;  4EM4 A;  5KOW A;  2XVF A;  2VVL G;  3ICS A;  2IVD A;  3CNJ A;  4ADW A;  3NN0 X;  4I59 A;  4X4J A;  3CIR A;  1XAN A;  3H4K A;  1E1K A;  1TDE A;  4Z44 A;  1K0J A;  5TR3 A;  3IHG A;  4OPC A;  4X9M A;  2GEW A;  3DH9 A;  1S3E A;  3P9U A;  4C77 A;  1ZDL A;  4EMJ A;  5BRT A;  3GRS A;  3AE8 A;  2V3A A;  2C73 A;  2YAU A;  3QJ4 A;  1E6E A;  1JNZ A;  1GRT A;  2BS3 A;  2FJD A;  3GMB A;  1FEC A;  3ITJ A;  4H7U A;  1TDF A;  1N4U A;  1NHS A;  3RHA A;  2TPR A;  1L9E A;  1CHU A;  1FL2 A;  2WEU A;  2BK4 A;  2WP5 A;  3II4 A;  4GR1 A;  1VRQ B;  2X8H A;  1CBO A;  2BCP A;  2H88 A;  3AE4 A;  2C76 A;  2X8C A;  3BI2 A;  4J56 A;  4A65 A;  1RYI A;  2ZBW A;  4JY3 A;  3P4P A;  3UKQ A;  5CQF A;  2YLS A;  1EL5 A;  4O5Q A;  4YTM A;  1IUT A;  1FOH A;  2GR0 A;  4YXD A;  4YTN A;  4OCG A;  2JB3 A;  2UZZ A;  4JNQ A;  2YR6 A;  3GD4 A;  1E1N A;  2YLX A;  4UDR A;  3ALL A;  3K30 A;  3AD8 B;  1GPE A;  2GVC A;  3QSS A;  1DOC A;  3B3R A;  3NHO X;  2JB2 A;  2C7G A;  2YLR A;  4U8L A;  3K7Q X;  2YWL A;  3IC9 A;  2QA1 A;  2TMD A;  2BK5 A;  4JDR A;  2YM1 A;  3CPI G;  1JEH A;  4H2P A;  2WPC A;  1Q9I A;  2ZZC A;  3QFB A;  5U63 A;  1GSN A;  2JBV A;  2XVI A;  1PXC A;  3GYI A;  3NKS A;  2YG7 A;  2GR2 A;  3I3L A;  5EBK A;  3AED A;  2A8X A;  4NTD A;  3C4A A;  3V3N A;  1ZY8 A;  2CUL A;  2YVF A;  3G5S A;  1P2H A;  4A79 A;  4OVI A;  1VQW A;  4YSX A;  1Q1R A;  5KXJ A;  1B5Q A;  2QCU A;  1DOE A;  1OJA A;  4K22 A;  3SQP A;  5IQ1 A;  1HYU A;  5KWF A;  2GAH B;  5JCK A;  4AOX A;  3CGB A;  1LJ1 A;  1M64 A;  5LV9 A;  2XFP A;  1LQT A;  4BUR A;  4D03 A;  3M12 A;  4ICY A;  4TLZ A;  1H7W A;  4J33 A;  4Z24 A;  4E0V A;  2R45 A;  1F8W A;  3KKJ A;  3NLC A;  5IPY A;  1ZK7 A;  4LII A;  1IUV A;  3GRT A;  2CFY A;  1PN0 A;  3G5Q A;  4BK2 A;  2WQY A;  3K7M X;  1NG3 A;  2VRM A;  1PBC A;  3IWA A;  4YSY A;  1PJ5 A;  1GER A;  2GH5 A;  2OAM A;  4JN9 A;  3ICT A;  3P4R A;  1E39 A;  1RP0 A;  2VVL A;  4X9N A;  1REO A;  1K0I A;  3S5W A;  2JB1 A;  4N9X A;  1S3B A;  2NVK X;  3KVE A;  2AR8 A;  1XDI A;  2VVM A;  3ZYX A;  3NTA A;  2RGO A;  3P1W A;  4EQS A;  1NEN A;  4IVM B;  1LVL A;  2Z5X A;  4DSH A;  3DA1 A;  3DGH A;  3CTY A;  4ZCC A;  3AD7 B;  1EL8 A;  2R0G A;  1IUX A;  4Z2T A;  1B8S A;  2ACZ A;  3AEE A;  2I0Z A;  3PVC A;  3P4Q A;  1H86 A;  2HQM A;  1N1P A;  2XLR A;  3RP7 A;  5KRQ A;  2YR4 A;  1P2E A;  1GRB A;  1GT8 A;  3L8K A;  4TM1 A;  1X31 B;  4ZCD A;  3LZX A;  4M52 A;  3COX A;  4IVO B;  4C5O A;  3DJG X;  5HXI A;  2WBA A;  3QFA A;  4H4P A;  4K5R A;  1FEB A;  3AB1 A;  5FS7 A;  4EM3 A;  2XFQ A;  2ARD A;  1TYT A;  1ZKQ A;  1F3P A;  2XLU A;  2Y6R A;  4YWO A;  1JRY A;  1KNP A;  2WS3 A;  3NRN A;  2IVE A;  1OJD A;  3CGE A;  1PDH A;  1ZOV A;  1D4C A;  1L9C A;  3F8P A;  3GYJ A;  1MO9 A;  3CNS A;  3AE6 A;  1IJH A;  4ECH A;  1MXT A;  1E7P A;  1L9D A;  4BK1 A;  5L46 A;  3RP8 A;  2GQF A;  3NYE A;  4U8M A;  4H4U A;  4CY8 A;  3UP5 A;  4YSZ A;  1QLB A;  2WP9 A;  4JQ9 A;  4LU6 A;  3UOV A;  5U1O A;  1TDK A;  1IUS A;  5BUK A;  2EQ6 A;  5HYM A;  3NG7 X;  3C96 A;  3CGC A;  4A6N B;  2GB0 A;  2R9Z A;  2Z5Y A;  3PO7 A;  3M0O A;  1PS9 A;  1FEA A;  2B9X A;  3V3O A;  4NTC A;  3AE7 A;  4OPT A;  3KLJ A;  2VQ7 A;  2V5Z A;  1NHP A;  1ZMD A;  3NT6 A;  2AAQ A;  2C3D A;  2R4J A;  3CGD A;  2V3B A;  4BJY A;  5JCI A;  2WHD A;  1YQZ A;  4XWR A;  1CC6 A;  1H83 A;  4DNA A;  3VRD B;  5BVA A;  1JNR A;  2RGH A;  3AE9 A;  4H2Q A;  2YVJ A;  1S2Q A;  3BNM A;  2XVH A;  3LB8 A;  3BNU A;  4OPL A;  3DK4 A;  3PS9 A;  3UKF A;  4AT2 A;  1N4V A;  3QVP A;  1IUU A;  4UDQ A;  4TLX A;  1PHH A;  1TDO A;  3AYL A;  2YG3 A;  3LXD A;  1GRH A;  3BI5 A;  1LQU A;  1JRX A;  1JOA A;  1TYP A;  1CJ4 A;  3CNT A;  4Y4L A;  2WOV A;  1PXA A;  1KDG A;  2GF3 A;  4PAB A;  4K8D A;  2YG6 A;  4NZH A;  4EIQ A;  1D4E A;  3GD3 A;  4K7Z A;  2JKC A;  3UTG A;  4A7A A;  3UKP A;  1MOK A;  4EMI A;  4H2R A;  2X8G A;  5GSN A;  3CN8 A;  4J31 A;  1NPX A;  4DGK A;  1LV0 A;  3G5R A;  3AYJ A;  1B37 A;  1CC4 A;  2FJA A;  3UKA A;  3R9U A;  4EMW A;  1LTX R;  1PJ6 A;  5FS6 A;  3ALM A;  1E1L A;  4U2T A;  4USR A;  1GV4 A;  3AEF A;  2X3N A;  4YSH A;  3KD9 A;  4Y4M A;  1NHR A;  3SFD A;  3AWI A;  4FK1 C;  3SM8 A;  4CRT A;  2B76 A;  4AP3 A;  3E1T A;  3GMC A;  3DME A;  2YG4 A;  3GWD A;  4OPI A;  4EQX A;  2BK3 A;  3DJE A;  4H4V A;  1VG0 A;  3QVR A;  3FPZ A;  2A87 A;  2VRL A;  1TRB A;  2F5Z A;  1RSG A;  2C72 A;  3AEG A;  1GXF A; 
#chains in the Genus database with same CATH topology
 3VQR A;  4Z26 A;  1H7X A;  2JK6 A;  3CNP A;  2QAE A;  4CY6 A;  4XXG A;  3NIX A;  2XLT A;  4H4Z A;  1D7L A;  4TM0 A;  4H4X A;  4PAA A;  2V6O A;  4FDC B;  4Z2U A;  3T14 A;  1GAL A;  4LA1 A;  3UKL A;  2GMJ A;  1BGJ A;  1PJ7 A;  1Y0P A;  3IF9 A;  4U2L A;  5GRT A;  2E4G A;  3UOX A;  2FBW A;  5KMQ A;  4B63 A;  2ZZ0 A;  2FJB A;  1PBF A;  3ATR A;  2B9W A;  1H6V A;  1V59 A;  4CNJ A;  1PBB A;  1OJC A;  4DSG A;  2DKI A;  4GF7 A;  4YKF A;  3K7T A;  1GRE A;  3C4N A;  4YKG A;  1OJT A;  1GTE A;  3JSK A;  2VOU A;  3NYC A;  5FS9 A;  2WOW A;  2ZZB A;  1GET A;  2BS4 A;  3S61 A;  3SFE A;  3AE3 A;  3LAD A;  3VR9 A;  1N4W A;  4HA6 A;  1Y56 B;  3DK9 A;  2BYB A;  2XYO A;  1COY A;  3EAO A;  2R46 A;  3LJP A;  1YQ3 A;  3NK0 X;  3VRB A;  3DJD A;  4A6N A;  4YT0 A;  2EQ9 A;  1EL9 A;  4II3 A;  5KVH A;  1Q1W A;  1KNR A;  3ZDN A;  1PBD A;  2RGJ A;  2V60 A;  5M0Z A;  2R0P A;  2XDO A;  2C4C A;  2OAL A;  3UTH A;  1ONF A;  1D5T A;  1CF3 A;  4NEV A;  5EB5 A;  3NYF A;  3OZ2 A;  2YG5 A;  3ICR A;  1S2Y A;  2FJE A;  2WPF A;  4AT0 A;  4I58 A;  3SXI A;  4JNA A;  3UTE A;  1GND A;  4U8I A;  3RED A;  1YY5 A;  3F8R A;  1BZL A;  4J2W A;  1DNC A;  3SZF A;  4B66 A;  1CJC A;  2C75 A;  5FMH A;  2YQU A;  3AEB A;  5C3J A;  1BGN A;  2XLS A;  2YR5 A;  1FCD A;  4H4W A;  4H4Q A;  3L1R A;  4Y4N A;  2A89 A;  2YVG A;  4REK A;  1NEK A;  5HY5 A;  3EF6 A;  1F6M A;  4GCM A;  4WCT A;  2GMH A;  4TM4 A;  3HYX A;  1E1M A;  1NDA A;  1NAA A;  5KVI A;  3T2Y A;  2WDQ A;  1O94 A;  5JCL A;  2IID A;  2NPX A;  3KU9 A;  4IV9 A;  5EOW A;  4Z25 A;  3NGC X;  4APN A;  4U8O A;  4GDP A;  4U8N A;  2YLZ A;  4B64 A;  2PYX A;  3I6D A;  1W4X A;  1KF6 A;  1K4Q A;  3ADA B;  1SEZ A;  5U25 A;  2BS2 A;  3GWF A;  3AE5 A;  1GRF A;  4GAV A;  3CND A;  1GRG A;  2B7R A;  3FIM B;  2C64 A;  3NN6 X;  5CKU A;  4AOS A;  3NK1 X;  4RG4 A;  2J3N A;  4A5L A;  2CVJ A;  2O9Z A;  3VRA A;  5BUL A;  3M13 A;  1PBE A;  2GAG B;  3AEC A;  4WX1 A;  2GQW A;  4O5U A;  2CDU A;  1GEU A;  1KSS A;  3AE2 A;  1L0V A;  5KMR A;  4CCR A;  2VQB A;  2XVE A;  3GYX A;  4TM3 A;  4BJZ A;  1CJ3 A;  3AD9 B;  4D04 A;  2XVJ A;  3H8L A;  2BXR A;  4C3Y A;  5JCN A;  2GR1 A;  4Z2R A;  2XCG A;  1ELI A;  2XFO A;  4H2N A;  3UTF A;  4C74 A;  2WET A;  2WU5 A;  1EL7 A;  2V61 A;  3CPH G;  4H4T A;  3T37 A;  1D7Y A;  3Q9T A;  1VG9 A;  2JAE A;  2WOI A;  5J7X A;  4ZN0 A;  3O0H A;  2EQ8 A;  2WES A;  5KOX A;  4J34 A;  3P4S A;  1H82 A;  1LPF A;  1PXB A;  3ATQ A;  1H81 A;  4U8K A;  4EQR A;  4KPR A;  2GR3 A;  1BF3 A;  1UKV G;  3SGL A;  3NTD A;  3NNE A;  1H84 A;  3OC4 A;  3UKK A;  1DXL A;  4OPU A;  1K0L A;  3FBS A;  2H89 A;  3D1C A;  4K5S A;  2EQ7 A;  2WP6 A;  4H4Y A;  1NHQ A;  2BXS A;  3CPJ G;  4Z43 A;  2WU2 A;  3UOZ A;  1IUW A;  2BRA A;  2C67 A;  3ISH A;  3UOY A;  2R4E A;  1CC2 A;  4USQ A;  4AP1 A;  4OPD A;  5HHF A;  1EBD A;  4U8P A;  1DJQ A;  2C70 A;  2E5V A;  1YQ4 A;  1GOS A;  1BKW A;  3HZL A;  1BWC A;  3AE1 A;  1OJ9 A;  3KA7 A;  4P9S A;  5EB4 A;  4U8J A;  5IQ4 A;  1DOD A;  2E1M A;  1QJD A;  2DKH A;  3LZW A;  3KPF A;  3KPK A;  4B68 A;  4C3X A;  1XPQ A;  4UDP A;  3T0K A;  2Y6Q A;  1Y56 A;  4GRT A;  3RNM A;  3T31 A;  2YM2 A;  4NTE A;  4KX6 A;  4YTP A;  5DBJ A;  1O95 A;  3EAN A;  3VR8 A;  3SZ0 A;  4H4S A;  4A99 A;  2RAB A;  2X99 A;  3BHK A;  3DJJ A;  2C3C A;  4B1B A;  3QSE A;  2WDV A;  4H4R A;  3QSM A;  4XWZ A;  1D4D A;  1GRA A;  1JU2 A;  2R0C A;  4HB9 A;  5FS8 A;  1DOB A;  1ZP0 A;  1ZOY A;  2C66 A;  2XLP A;  4GDE A;  3UCL A;  1KFY A;  1XHC A;  3D8X A;  2Q7V A;  2WPE A;  2XFU A;  4J36 A;  3GDP A;  4CCQ A;  2YLW A;  2YLT A;  3GDN A;  2Q0K A;  1GTH A;  4GAP A;  1GES A;  1YKJ A;  2B9Y A;  2B7S A;  3FG2 P;  3FMW A;  2OLN A;  2BCG G;  3NH3 X;  2PHH A;  4BK3 A;  3AYI A;  2BC1 A;  3UKH A;  2C65 A;  4CNK A;  5JCM A;  2BC0 A;  4G6G A;  4U2S A;  4B67 A;  2GV8 A;  4IA6 A;  4A9W A;  4G73 A;  4RSL A;  4NEW A;  5ER0 A;  1F8R A;  1F8S A;  3AXB A;  3UP4 A;  3ALJ A;  1TDN A;  4EQW A;  4IA5 A;  3GSI A;  1Z6L A;  2QA2 A;  3NK2 X;  1O5W A;  4H50 A;  1CL0 A;  3B6D A;  2AQJ A;  2XFN A;  2BAB A;  3F8D A;  3T2Z A;  4EIP A;  1DJN A;  2OA1 A;  2APG A;  2BA9 A;  3BI4 A;  4GUV A;  5J60 A;  1QO8 A;  3RP6 A;  4FK1 A;  4BV6 A;  4B69 A;  4J57 A;  1JRZ A;  1CJ2 A;  1VDC A;  3WE0 A;  4RG3 A;  1NG4 A;  3URH A;  3Q6J A;  3H8I A;  2VZ2 A;  2Q6U A;  4CBQ A;  1ZX9 A;  4B65 A;  2OLO A;  1ZMC A;  2W0H A;  3DK8 A;  4JY2 A;  3DGZ A;  3IHM A;  3LOV A;  4FX9 A;  2GRT A;  1B4V A;  3AEA A;  4K2X A;  1AOG A;  3EPT A;  4MJW A;  4UP3 A;  5C2T A;  5M10 A;  2X50 A;  4OPG A;  1M6I A;  3V76 A;  3BHF A;  2BAC A;  1KSU A;  2Q0L A;  3ABV A;  2WDR A;  4EM4 A;  5KOW A;  2XVF A;  2VVL G;  3ICS A;  2IVD A;  3CNJ A;  4ADW A;  3NN0 X;  4I59 A;  4X4J A;  3CMM A;  3SYI A;  3CIR A;  1XAN A;  3H4K A;  1E1K A;  1TDE A;  4Z44 A;  1K0J A;  5TR3 A;  3IHG A;  4OPC A;  4X9M A;  2GEW A;  3DH9 A;  1S3E A;  3P9U A;  4C77 A;  1ZDL A;  4EMJ A;  5BRT A;  3GRS A;  3AE8 A;  2V3A A;  2C73 A;  2YAU A;  3QJ4 A;  1E6E A;  1JNZ A;  1GRT A;  2BS3 A;  2FJD A;  3GMB A;  1FEC A;  3HYW A;  3ITJ A;  4H7U A;  1TDF A;  1N4U A;  1NHS A;  3RHA A;  2TPR A;  1L9E A;  1CHU A;  1FL2 A;  2WEU A;  2BK4 A;  2WP5 A;  3II4 A;  4GR1 A;  1VRQ B;  2X8H A;  1CBO A;  2BCP A;  2H88 A;  3AE4 A;  2C76 A;  2X8C A;  3BI2 A;  4J56 A;  4A65 A;  1RYI A;  2ZBW A;  4NWZ A;  4JY3 A;  3P4P A;  3UKQ A;  5CQF A;  2YLS A;  1EL5 A;  4O5Q A;  4YTM A;  1IUT A;  1FOH A;  2GR0 A;  4YXD A;  4YTN A;  4OCG A;  2JB3 A;  2UZZ A;  4JNQ A;  2YR6 A;  3GD4 A;  1E1N A;  2YLX A;  4UDR A;  3ALL A;  3K30 A;  3AD8 B;  1GPE A;  2GVC A;  3QSS A;  1DOC A;  3B3R A;  3NHO X;  2JB2 A;  2C7G A;  2YLR A;  4U8L A;  3K7Q X;  2YWL A;  3IC9 A;  2QA1 A;  2TMD A;  2BK5 A;  4JDR A;  2YM1 A;  3CPI G;  1JEH A;  4H2P A;  3SZW A;  2WPC A;  1Q9I A;  2ZZC A;  3QFB A;  5U63 A;  1GSN A;  2JBV A;  2XVI A;  1PXC A;  3GYI A;  3NKS A;  2YG7 A;  2GR2 A;  3I3L A;  5EBK A;  3AED A;  2A8X A;  4NTD A;  3C4A A;  3V3N A;  1ZY8 A;  2CUL A;  4G74 A;  2YVF A;  3G5S A;  1P2H A;  4A79 A;  4OVI A;  1VQW A;  4YSX A;  3SX6 A;  1Q1R A;  5KXJ A;  1B5Q A;  2QCU A;  1DOE A;  1OJA A;  4K22 A;  3SQP A;  5IQ1 A;  1HYU A;  5KWF A;  2GAH B;  5JCK A;  4AOX A;  3CGB A;  1LJ1 A;  1M64 A;  5LV9 A;  2XFP A;  1LQT A;  3HYV A;  4BUR A;  4D03 A;  3M12 A;  4ICY A;  4TLZ A;  1H7W A;  5KMP A;  4J33 A;  4Z24 A;  4E0V A;  2R45 A;  1F8W A;  3KKJ A;  3NLC A;  5IPY A;  1ZK7 A;  4LII A;  1IUV A;  3GRT A;  2CFY A;  1PN0 A;  3G5Q A;  4BK2 A;  2WQY A;  3K7M X;  1NG3 A;  2VRM A;  1PBC A;  3IWA A;  4YSY A;  1PJ5 A;  1GER A;  2GH5 A;  2OAM A;  4JN9 A;  3ICT A;  3P4R A;  1E39 A;  1RP0 A;  2VVL A;  4X9N A;  1REO A;  1K0I A;  3S5W A;  2JB1 A;  4N9X A;  1S3B A;  2NVK X;  3KVE A;  2AR8 A;  1XDI A;  2VVM A;  3ZYX A;  3NTA A;  2RGO A;  3P1W A;  4EQS A;  1NEN A;  4IVM B;  1LVL A;  2Z5X A;  4DSH A;  3DA1 A;  3DGH A;  3CTY A;  4ZCC A;  3AD7 B;  1EL8 A;  2R0G A;  1IUX A;  4Z2T A;  5KMS A;  1B8S A;  2ACZ A;  2BRY A;  3AEE A;  2I0Z A;  3PVC A;  3P4Q A;  1H86 A;  2HQM A;  1N1P A;  2XLR A;  3RP7 A;  5KRQ A;  2YR4 A;  1P2E A;  1GRB A;  1GT8 A;  3L8K A;  4TM1 A;  1X31 B;  4ZCD A;  4NNJ A;  3LZX A;  4M52 A;  3COX A;  4IVO B;  4C5O A;  3DJG X;  5HXI A;  2WBA A;  3QFA A;  4H4P A;  4K5R A;  1FEB A;  3AB1 A;  5FS7 A;  4EM3 A;  2XFQ A;  2ARD A;  1TYT A;  1ZKQ A;  1F3P A;  2XLU A;  2Y6R A;  4YWO A;  1JRY A;  1KNP A;  2WS3 A;  3NRN A;  2IVE A;  1OJD A;  3CGE A;  1PDH A;  1ZOV A;  1D4C A;  1L9C A;  3F8P A;  3GYJ A;  1MO9 A;  3CNS A;  3AE6 A;  1IJH A;  4ECH A;  1MXT A;  1E7P A;  1L9D A;  4BK1 A;  5L46 A;  3RP8 A;  2GQF A;  3NYE A;  4U8M A;  4H4U A;  4CY8 A;  3UP5 A;  4YSZ A;  1QLB A;  2WP9 A;  4JQ9 A;  4LU6 A;  3UOV A;  5U1O A;  1TDK A;  1IUS A;  5KNL A;  5BUK A;  2EQ6 A;  5HYM A;  3NG7 X;  3C96 A;  3CGC A;  4A6N B;  2GB0 A;  2R9Z A;  2Z5Y A;  3PO7 A;  3M0O A;  1PS9 A;  1FEA A;  2B9X A;  3V3O A;  3T2K A;  4NTC A;  3AE7 A;  4OPT A;  3KLJ A;  2VQ7 A;  2V5Z A;  1NHP A;  3SY4 A;  1ZMD A;  3NT6 A;  2AAQ A;  2C3D A;  3SZC A;  2R4J A;  3CGD A;  2V3B A;  4BJY A;  5JCI A;  2WHD A;  1YQZ A;  4XWR A;  1CC6 A;  1H83 A;  4DNA A;  3VRD B;  5BVA A;  1JNR A;  2RGH A;  3AE9 A;  4H2Q A;  2YVJ A;  1S2Q A;  3BNM A;  2XVH A;  3LB8 A;  3BNU A;  4OPL A;  3DK4 A;  3PS9 A;  3UKF A;  4AT2 A;  1N4V A;  3QVP A;  1IUU A;  4UDQ A;  4TLX A;  1PHH A;  1TDO A;  3AYL A;  2YG3 A;  3LXD A;  1GRH A;  3BI5 A;  1LQU A;  1JRX A;  1JOA A;  1TYP A;  1CJ4 A;  3CNT A;  4Y4L A;  2WOV A;  1PXA A;  1KDG A;  2GF3 A;  4PAB A;  4K8D A;  2YG6 A;  4NZH A;  4EIQ A;  1D4E A;  3GD3 A;  4K7Z A;  2JKC A;  3UTG A;  4A7A A;  3UKP A;  1MOK A;  4EMI A;  4H2R A;  2X8G A;  5GSN A;  3CN8 A;  4J31 A;  4G9K A;  1NPX A;  4DGK A;  1LV0 A;  3G5R A;  3AYJ A;  1B37 A;  1CC4 A;  2FJA A;  3UKA A;  3R9U A;  4EMW A;  1LTX R;  1PJ6 A;  5FS6 A;  3ALM A;  1E1L A;  4U2T A;  4USR A;  1GV4 A;  3AEF A;  2X3N A;  4YSH A;  3KD9 A;  4Y4M A;  1NHR A;  3SFD A;  3AWI A;  4FK1 C;  3SM8 A;  4CRT A;  2B76 A;  4AP3 A;  3E1T A;  4II2 A;  3GMC A;  4G6H A;  3DME A;  2YG4 A;  3GWD A;  4OPI A;  4EQX A;  2BK3 A;  3DJE A;  4H4V A;  1VG0 A;  3QVR A;  3FPZ A;  2A87 A;  2VRL A;  1TRB A;  2F5Z A;  1RSG A;  2C72 A;  3AEG A;  1GXF A; 
#chains in the Genus database with same CATH homology
 3VQR A;  4Z26 A;  1H7X A;  2JK6 A;  3CNP A;  2QAE A;  4CY6 A;  4XXG A;  3NIX A;  2XLT A;  4H4Z A;  1D7L A;  4TM0 A;  4H4X A;  4PAA A;  2V6O A;  4FDC B;  4Z2U A;  3T14 A;  1GAL A;  4LA1 A;  3UKL A;  2GMJ A;  1BGJ A;  1PJ7 A;  1Y0P A;  3IF9 A;  4U2L A;  5GRT A;  2E4G A;  3UOX A;  2FBW A;  5KMQ A;  4B63 A;  2ZZ0 A;  2FJB A;  1PBF A;  3ATR A;  2B9W A;  1H6V A;  1V59 A;  4CNJ A;  1PBB A;  1OJC A;  4DSG A;  2DKI A;  4GF7 A;  4YKF A;  3K7T A;  1GRE A;  3C4N A;  4YKG A;  1OJT A;  1GTE A;  3JSK A;  2VOU A;  3NYC A;  5FS9 A;  2WOW A;  2ZZB A;  1GET A;  2BS4 A;  3S61 A;  3SFE A;  3AE3 A;  3LAD A;  3VR9 A;  1N4W A;  4HA6 A;  1Y56 B;  3DK9 A;  2BYB A;  2XYO A;  1COY A;  3EAO A;  2R46 A;  3LJP A;  1YQ3 A;  3NK0 X;  3VRB A;  3DJD A;  4A6N A;  4YT0 A;  2EQ9 A;  1EL9 A;  4II3 A;  5KVH A;  1Q1W A;  1KNR A;  3ZDN A;  1PBD A;  2RGJ A;  2V60 A;  5M0Z A;  2R0P A;  2XDO A;  2C4C A;  2OAL A;  3UTH A;  1ONF A;  1D5T A;  1CF3 A;  4NEV A;  5EB5 A;  3NYF A;  3OZ2 A;  2YG5 A;  3ICR A;  1S2Y A;  2FJE A;  2WPF A;  4AT0 A;  4I58 A;  3SXI A;  4JNA A;  3UTE A;  1GND A;  4U8I A;  3RED A;  1YY5 A;  3F8R A;  1BZL A;  4J2W A;  1DNC A;  3SZF A;  4B66 A;  1CJC A;  2C75 A;  5FMH A;  2YQU A;  3AEB A;  5C3J A;  1BGN A;  2XLS A;  2YR5 A;  1FCD A;  4H4W A;  4H4Q A;  3L1R A;  4Y4N A;  2A89 A;  2YVG A;  4REK A;  1NEK A;  5HY5 A;  3EF6 A;  1F6M A;  4GCM A;  4WCT A;  2GMH A;  4TM4 A;  3HYX A;  1E1M A;  1NDA A;  1NAA A;  5KVI A;  3T2Y A;  2WDQ A;  1O94 A;  5JCL A;  2IID A;  2NPX A;  3KU9 A;  4IV9 A;  5EOW A;  4Z25 A;  3NGC X;  4APN A;  4U8O A;  4GDP A;  4U8N A;  2YLZ A;  4B64 A;  2PYX A;  3I6D A;  1W4X A;  1KF6 A;  1K4Q A;  3ADA B;  1SEZ A;  5U25 A;  2BS2 A;  3GWF A;  3AE5 A;  1GRF A;  4GAV A;  3CND A;  1GRG A;  2B7R A;  3FIM B;  2C64 A;  3NN6 X;  5CKU A;  4AOS A;  3NK1 X;  4RG4 A;  2J3N A;  4A5L A;  2CVJ A;  2O9Z A;  3VRA A;  5BUL A;  3M13 A;  1PBE A;  2GAG B;  3AEC A;  4WX1 A;  2GQW A;  4O5U A;  2CDU A;  1GEU A;  1KSS A;  3AE2 A;  1L0V A;  5KMR A;  4CCR A;  2VQB A;  2XVE A;  3GYX A;  4TM3 A;  4BJZ A;  1CJ3 A;  3AD9 B;  4D04 A;  2XVJ A;  3H8L A;  2BXR A;  4C3Y A;  5JCN A;  2GR1 A;  4Z2R A;  2XCG A;  1ELI A;  2XFO A;  4H2N A;  3UTF A;  4C74 A;  2WET A;  2WU5 A;  1EL7 A;  2V61 A;  3CPH G;  4H4T A;  3T37 A;  1D7Y A;  3Q9T A;  1VG9 A;  2JAE A;  2WOI A;  5J7X A;  4ZN0 A;  3O0H A;  2EQ8 A;  2WES A;  5KOX A;  4J34 A;  3P4S A;  1H82 A;  1LPF A;  1PXB A;  3ATQ A;  1H81 A;  4U8K A;  4EQR A;  4KPR A;  2GR3 A;  1BF3 A;  1UKV G;  3SGL A;  3NTD A;  3NNE A;  1H84 A;  3OC4 A;  3UKK A;  1DXL A;  4OPU A;  1K0L A;  3FBS A;  2H89 A;  3D1C A;  4K5S A;  2EQ7 A;  2WP6 A;  4H4Y A;  1NHQ A;  2BXS A;  3CPJ G;  4Z43 A;  2WU2 A;  3UOZ A;  1IUW A;  2BRA A;  2C67 A;  3ISH A;  3UOY A;  2R4E A;  1CC2 A;  4USQ A;  4AP1 A;  4OPD A;  5HHF A;  1EBD A;  4U8P A;  1DJQ A;  2C70 A;  2E5V A;  1YQ4 A;  1GOS A;  1BKW A;  3HZL A;  1BWC A;  3AE1 A;  1OJ9 A;  3KA7 A;  4P9S A;  5EB4 A;  4U8J A;  5IQ4 A;  1DOD A;  2E1M A;  1QJD A;  2DKH A;  3LZW A;  3KPF A;  3KPK A;  4B68 A;  4C3X A;  1XPQ A;  4UDP A;  3T0K A;  2Y6Q A;  1Y56 A;  4GRT A;  3RNM A;  3T31 A;  2YM2 A;  4NTE A;  4KX6 A;  4YTP A;  5DBJ A;  1O95 A;  3EAN A;  3VR8 A;  3SZ0 A;  4H4S A;  4A99 A;  2RAB A;  2X99 A;  3BHK A;  3DJJ A;  2C3C A;  4B1B A;  3QSE A;  2WDV A;  4H4R A;  3QSM A;  4XWZ A;  1D4D A;  1GRA A;  1JU2 A;  2R0C A;  4HB9 A;  5FS8 A;  1DOB A;  1ZP0 A;  1ZOY A;  2C66 A;  2XLP A;  4GDE A;  3UCL A;  1KFY A;  1XHC A;  3D8X A;  2Q7V A;  2WPE A;  2XFU A;  4J36 A;  3GDP A;  4CCQ A;  2YLW A;  2YLT A;  3GDN A;  2Q0K A;  1GTH A;  4GAP A;  1GES A;  1YKJ A;  2B9Y A;  2B7S A;  3FG2 P;  3FMW A;  2OLN A;  2BCG G;  3NH3 X;  2PHH A;  4BK3 A;  3AYI A;  2BC1 A;  3UKH A;  2C65 A;  4CNK A;  5JCM A;  2BC0 A;  4G6G A;  4U2S A;  4B67 A;  2GV8 A;  4IA6 A;  4A9W A;  4G73 A;  4RSL A;  4NEW A;  5ER0 A;  1F8R A;  1F8S A;  3AXB A;  3UP4 A;  3ALJ A;  1TDN A;  4EQW A;  4IA5 A;  3GSI A;  1Z6L A;  2QA2 A;  3NK2 X;  1O5W A;  4H50 A;  1CL0 A;  3B6D A;  2AQJ A;  2XFN A;  2BAB A;  3F8D A;  3T2Z A;  4EIP A;  1DJN A;  2OA1 A;  2APG A;  2BA9 A;  3BI4 A;  4GUV A;  5J60 A;  1QO8 A;  3RP6 A;  4FK1 A;  4BV6 A;  4B69 A;  4J57 A;  1JRZ A;  1CJ2 A;  1VDC A;  3WE0 A;  4RG3 A;  1NG4 A;  3URH A;  3Q6J A;  3H8I A;  2VZ2 A;  2Q6U A;  4CBQ A;  1ZX9 A;  4B65 A;  2OLO A;  1ZMC A;  2W0H A;  3DK8 A;  4JY2 A;  3DGZ A;  3IHM A;  3LOV A;  4FX9 A;  2GRT A;  1B4V A;  3AEA A;  4K2X A;  1AOG A;  3EPT A;  4MJW A;  4UP3 A;  5C2T A;  5M10 A;  2X50 A;  4OPG A;  1M6I A;  3V76 A;  3BHF A;  2BAC A;  1KSU A;  2Q0L A;  3ABV A;  2WDR A;  4EM4 A;  5KOW A;  2XVF A;  2VVL G;  3ICS A;  2IVD A;  3CNJ A;  4ADW A;  3NN0 X;  4I59 A;  4X4J A;  3CMM A;  3SYI A;  3CIR A;  1XAN A;  3H4K A;  1E1K A;  1TDE A;  4Z44 A;  1K0J A;  5TR3 A;  3IHG A;  4OPC A;  4X9M A;  2GEW A;  3DH9 A;  1S3E A;  3P9U A;  4C77 A;  1ZDL A;  4EMJ A;  5BRT A;  3GRS A;  3AE8 A;  2V3A A;  2C73 A;  2YAU A;  3QJ4 A;  1E6E A;  1JNZ A;  1GRT A;  2BS3 A;  2FJD A;  3GMB A;  1FEC A;  3HYW A;  3ITJ A;  4H7U A;  1TDF A;  1N4U A;  1NHS A;  3RHA A;  2TPR A;  1L9E A;  1CHU A;  1FL2 A;  2WEU A;  2BK4 A;  2WP5 A;  3II4 A;  4GR1 A;  1VRQ B;  2X8H A;  1CBO A;  2BCP A;  2H88 A;  3AE4 A;  2C76 A;  2X8C A;  3BI2 A;  4J56 A;  4A65 A;  1RYI A;  2ZBW A;  4NWZ A;  4JY3 A;  3P4P A;  3UKQ A;  5CQF A;  2YLS A;  1EL5 A;  4O5Q A;  4YTM A;  1IUT A;  1FOH A;  2GR0 A;  4YXD A;  4YTN A;  4OCG A;  2JB3 A;  2UZZ A;  4JNQ A;  2YR6 A;  3GD4 A;  1E1N A;  2YLX A;  4UDR A;  3ALL A;  3K30 A;  3AD8 B;  1GPE A;  2GVC A;  3QSS A;  1DOC A;  3B3R A;  3NHO X;  2JB2 A;  2C7G A;  2YLR A;  4U8L A;  3K7Q X;  2YWL A;  3IC9 A;  2QA1 A;  2TMD A;  2BK5 A;  4JDR A;  2YM1 A;  3CPI G;  1JEH A;  4H2P A;  3SZW A;  2WPC A;  1Q9I A;  2ZZC A;  3QFB A;  5U63 A;  1GSN A;  2JBV A;  2XVI A;  1PXC A;  3GYI A;  3NKS A;  2YG7 A;  2GR2 A;  3I3L A;  5EBK A;  3AED A;  2A8X A;  4NTD A;  3C4A A;  3V3N A;  1ZY8 A;  2CUL A;  4G74 A;  2YVF A;  3G5S A;  1P2H A;  4A79 A;  4OVI A;  1VQW A;  4YSX A;  3SX6 A;  1Q1R A;  5KXJ A;  1B5Q A;  2QCU A;  1DOE A;  1OJA A;  4K22 A;  3SQP A;  5IQ1 A;  1HYU A;  5KWF A;  2GAH B;  5JCK A;  4AOX A;  3CGB A;  1LJ1 A;  1M64 A;  5LV9 A;  2XFP A;  1LQT A;  3HYV A;  4BUR A;  4D03 A;  3M12 A;  4ICY A;  4TLZ A;  1H7W A;  5KMP A;  4J33 A;  4Z24 A;  4E0V A;  2R45 A;  1F8W A;  3KKJ A;  3NLC A;  5IPY A;  1ZK7 A;  4LII A;  1IUV A;  3GRT A;  2CFY A;  1PN0 A;  3G5Q A;  4BK2 A;  2WQY A;  3K7M X;  1NG3 A;  2VRM A;  1PBC A;  3IWA A;  4YSY A;  1PJ5 A;  1GER A;  2GH5 A;  2OAM A;  4JN9 A;  3ICT A;  3P4R A;  1E39 A;  1RP0 A;  2VVL A;  4X9N A;  1REO A;  1K0I A;  3S5W A;  2JB1 A;  4N9X A;  1S3B A;  2NVK X;  3KVE A;  2AR8 A;  1XDI A;  2VVM A;  3ZYX A;  3NTA A;  2RGO A;  3P1W A;  4EQS A;  1NEN A;  4IVM B;  1LVL A;  2Z5X A;  4DSH A;  3DA1 A;  3DGH A;  3CTY A;  4ZCC A;  3AD7 B;  1EL8 A;  2R0G A;  1IUX A;  4Z2T A;  5KMS A;  1B8S A;  2ACZ A;  2BRY A;  3AEE A;  2I0Z A;  3PVC A;  3P4Q A;  1H86 A;  2HQM A;  1N1P A;  2XLR A;  3RP7 A;  5KRQ A;  2YR4 A;  1P2E A;  1GRB A;  1GT8 A;  3L8K A;  4TM1 A;  1X31 B;  4ZCD A;  4NNJ A;  3LZX A;  4M52 A;  3COX A;  4IVO B;  4C5O A;  3DJG X;  5HXI A;  2WBA A;  3QFA A;  4H4P A;  4K5R A;  1FEB A;  3AB1 A;  5FS7 A;  4EM3 A;  2XFQ A;  2ARD A;  1TYT A;  1ZKQ A;  1F3P A;  2XLU A;  2Y6R A;  4YWO A;  1JRY A;  1KNP A;  2WS3 A;  3NRN A;  2IVE A;  1OJD A;  3CGE A;  1PDH A;  1ZOV A;  1D4C A;  1L9C A;  3F8P A;  3GYJ A;  1MO9 A;  3CNS A;  3AE6 A;  1IJH A;  4ECH A;  1MXT A;  1E7P A;  1L9D A;  4BK1 A;  5L46 A;  3RP8 A;  2GQF A;  3NYE A;  4U8M A;  4H4U A;  4CY8 A;  3UP5 A;  4YSZ A;  1QLB A;  2WP9 A;  4JQ9 A;  4LU6 A;  3UOV A;  5U1O A;  1TDK A;  1IUS A;  5KNL A;  5BUK A;  2EQ6 A;  5HYM A;  3NG7 X;  3C96 A;  3CGC A;  4A6N B;  2GB0 A;  2R9Z A;  2Z5Y A;  3PO7 A;  3M0O A;  1PS9 A;  1FEA A;  2B9X A;  3V3O A;  3T2K A;  4NTC A;  3AE7 A;  4OPT A;  3KLJ A;  2VQ7 A;  2V5Z A;  1NHP A;  3SY4 A;  1ZMD A;  3NT6 A;  2AAQ A;  2C3D A;  3SZC A;  2R4J A;  3CGD A;  2V3B A;  4BJY A;  5JCI A;  2WHD A;  1YQZ A;  4XWR A;  1CC6 A;  1H83 A;  4DNA A;  3VRD B;  5BVA A;  1JNR A;  2RGH A;  3AE9 A;  4H2Q A;  2YVJ A;  1S2Q A;  3BNM A;  2XVH A;  3LB8 A;  3BNU A;  4OPL A;  3DK4 A;  3PS9 A;  3UKF A;  4AT2 A;  1N4V A;  3QVP A;  1IUU A;  4UDQ A;  4TLX A;  1PHH A;  1TDO A;  3AYL A;  2YG3 A;  3LXD A;  1GRH A;  3BI5 A;  1LQU A;  1JRX A;  1JOA A;  1TYP A;  1CJ4 A;  3CNT A;  4Y4L A;  2WOV A;  1PXA A;  1KDG A;  2GF3 A;  4PAB A;  4K8D A;  2YG6 A;  4NZH A;  4EIQ A;  1D4E A;  3GD3 A;  4K7Z A;  2JKC A;  3UTG A;  4A7A A;  3UKP A;  1MOK A;  4EMI A;  4H2R A;  2X8G A;  5GSN A;  3CN8 A;  4J31 A;  4G9K A;  1NPX A;  4DGK A;  1LV0 A;  3G5R A;  3AYJ A;  1B37 A;  1CC4 A;  2FJA A;  3UKA A;  3R9U A;  4EMW A;  1LTX R;  1PJ6 A;  5FS6 A;  3ALM A;  1E1L A;  4U2T A;  4USR A;  1GV4 A;  3AEF A;  2X3N A;  4YSH A;  3KD9 A;  4Y4M A;  1NHR A;  3SFD A;  3AWI A;  4FK1 C;  3SM8 A;  4CRT A;  2B76 A;  4AP3 A;  3E1T A;  4II2 A;  3GMC A;  4G6H A;  3DME A;  2YG4 A;  3GWD A;  4OPI A;  4EQX A;  2BK3 A;  3DJE A;  4H4V A;  1VG0 A;  3QVR A;  3FPZ A;  2A87 A;  2VRL A;  1TRB A;  2F5Z A;  1RSG A;  2C72 A;  3AEG A;  1GXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...