5DBJA

Crystal structure of halogenase plta
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
437
structure length
435
Chain Sequence
SDHDYDVVIIGGGPAGSTMASYLAKAGVKCAVFEKELFEREHVGESLVPATTPVLLEIGVMEKIEKANFPKKFGAAWTSADSGPEDKMGFQGLDHDFRSAEILFNERKQEGVDRDFTFHVDRGKFDRILLEHAGSLGAKVFQGVEIADVEFLSPGNVIVNAKLGKRSVEIKAKMVVDASGRNVLLGRRLGLREKDPVFNQFAIHSWFDNFDRKSATQSPDKVDYIFIHFLPMTNTWVWQIPITETITSVGVVTQKQNYTNSDLTYEEFFWEAVKTRENLHDALKASEQVRPFKKEADYSYGMKEVCGDSFVLIGDAARFVDPIFSSGVSVALNSARIASGDIIEAVKNNDFSKSSFTHYEGMIRNGIKNWYEFITLYYRLNILFTAFVQDPRYRLDILQLLQGDVYSGLEVLDKMREIIAAVESDPEHLWHKYLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Flavoprotein
molecule keywords FADH2-dependent halogenase PltA
publication title Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.
pubmed doi rcsb
source organism Pseudomonas fluorescens (strain pf-5 / atcc baa-477)
total genus 134
structure length 435
sequence length 437
chains with identical sequence B, C, D, E
ec nomenclature ec 3.8.1.1: Alkylhalidase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5dbjA00
2CFYA 1LTXR 1H7WA 2RABA 4YSYA 1CJ2A 3KVEA 2GQFA 1PXAA 1DJNA 3BI2A 3C4NA 4C5OA 3BNUA 4BK1A 1FOHA 4FX9A 1XANA 3AYIA 3CPHG 5BULA 4B69A 4JY2A 4OPIA 5ER0A 3NYEA 4ADWA 1NHRA 4K22A 4APNA 3ZYXA 2OALA 3H8LA 1VRQB 1ONFA 3DJDA 5JCIA 1KSSA 3NRNA 3H4KA 2IVEA 4X9NA 1E1KA 1N4VA 2BCPA 1HYUA 2OLNA 4EMIA 5IQ4A 2Q6UA 2YAUA 1DOBA 2R4EA 1OJTA 3KD9A 3L8KA 4OPCA 1OJCA 2YLZA 2IVDA 3WE0A 1CJ3A 3ZDNA 3NLCA 2RGOA 2YG6A 1L9CA 5GSNA 2V5ZA 4C74A 3CNDA 3LZWA 4KPRA 1M6IA 2JK6A 4JNQA 2XVHA 4EQSA 4Z2UA 4ZN0A 5BVAA 2XFPA 3R9UA 1LV0A 4D03A 4PABA 4XXGA 3NK0X 5BUKA 1FL2A 1IJHA 4GDPA 3E1TA 2OAMA 2PYXA 3S5WA 2J3NA 2YM1A 3AE2A 3HZLA 1YKJA 2UZZA 4ICYA 3RP6A 3RP7A 4AP1A 3PO7A 4TLZA 3AEBA 2BC1A 4IV9A 5GRTA 3QJ4A 3V76A 5EBKA 3CGCA 1JEHA 1GPEA 3BI4A 3CIRA 5DBJA 2X99A 2DKIA 5CKUA 2R4JA 3CNPA 3I6DA 3ATRA 1ZK7A 2XFOA 3AE7A 4FK1C 2GQWA 4HA6A 2V61A 1Y56A 2EQ8A 2XLPA 2V60A 5J7XA 1TDEA 1D7LA 3NGCX 1NHQA 4K8DA 3K30A 3OZ2A 1GRFA 2B7RA 5HHFA 3AXBA 3GRSA 2GF3A 3URHA 1DOCA 2WEUA 3GRTA 4O5QA 4OPDA 4U8LA 1KSUA 1GERA 1YQ4A 4RSLA 1JU2A 2BCGG 2X50A 3UTHA 2JB1A 1CC2A 2A8XA 3ISHA 3AEGA 3UTEA 1Q1RA 2GR0A 2XLUA 3EPTA 5U25A 1OJ9A 1PBFA 5KRQA 1XHCA 2YQUA 3JSKA 1CC6A 1E1NA 1L9DA 4Y4NA 2Z5YA 3DK8A 3UP4A 3SGLA 2VVMA 3B6DA 5HY5A 2XFNA 2EQ7A 2EQ6A 3AD9B 2C73A 1GEUA 4USRA 3UKAA 4P9SA 3F8RA 2BYBA 2ZBWA 5M0ZA 2APGA 4CNJA 2BA9A 2EQ9A 2WDVA 2XFQA 3II4A 4NTCA 4O5UA 2WPFA 2YVJA 3AEFA 4A9WA 4CCRA 1JNZA 2E1MA 5BRTA 2CVJA 5J60A 2B9XA 5JCMA 3UKKA 3LADA 4Y4MA 3ICTA 2FJAA 3P4PA 4YT0A 3ADAB 4CBQA 1P2EA 3AE9A 1MXTA 1YQZA 4CCQA 2NVKX 3LXDA 3VR8A 4C3YA 4TLXA 2JB2A 2ZZ0A 2DKHA 3ALJA 3Q9TA 1S3BA 2C67A 4BURA 5FS7A 3UKQA 2XVEA 4CNKA 3L1RA 1TYPA 3IWAA 5KVIA 4WX1A 1K0JA 4A6NA 2R0CA 3DJEA 4M52A 5U1OA 4YXDA 2F5ZA 1S2YA 4DGKA 2BK3A 2C70A 4BV6A 3NKSA 1B37A 2AQJA 4Z44A 3BNMA 4J2WA 1JRZA 1K0LA 1W4XA 5KXJA 2CULA 1GREA 4H4ZA 1ZOYA 5L46A 3GWDA 1LQUA 2BXRA 4AP3A 4Y4LA 2A87A 1ELIA 1KF6A 2JBVA 3GWFA 1BKWA 4B67A 3PVCA 3FMWA 1ZMDA 3DJJA 4OPGA 4H4WA 3AEEA 1PS9A 4C3XA 1Y0PA 4IVMB 4U8KA 5IQ1A 3UKLA 1VQWA 2W0HA 4J56A 4TM4A 5C2TA 4U8NA 3VRBA 4H4UA 2C65A 3RNMA 1E6EA 2WQYA 4EM3A 2WU2A 1GRAA 1DXLA 3BI5A 3DH9A 4GCMA 3AE5A 1H7XA 2GMJA 2YR6A 3NIXA 5JCKA 1PDHA 5IPYA 1N4UA 5FS6A 4Z26A 1GETA 2WP6A 1EL5A 1PBDA 4EQRA 4YKGA 1LVLA 1O5WA 2IIDA 2VRMA 4JDRA 1GALA 1E39A 2GV8A 3ABVA 3O0HA 3M0OA 4LU6A 1BGJA 2E4GA 3G5RA 2WBAA 4D04A 4B66A 3VQRA 2BK4A 2X8HA 3NG7X 2A89A 3F8PA 3KA7A 2GMHA 1KDGA 3CPJG 3QFBA 5C3JA 1ZMCA 2WDRA 4EMJA 4ECHA 3AYLA 1OJDA 2C7GA 2H88A 3PS9A 2XCGA 3GDNA 4A7AA 2ARDA 3C96A 2R9ZA 3IC9A 4H4SA 3AECA 3UP5A 3ALMA 3S61A 4H2PA 5M10A 1NENA 1O94A 2ZZCA 1N1PA 1JRXA 2QA1A 1PJ7A 3UOYA 3GMBA 2QAEA 3G5SA 3NTAA 4JN9A 4EM4A 3ICRA 2C72A 1BF3A 4PAAA 1E1LA 1GOSA 1CJ4A 2BK5A 3COXA 2GB0A 4H4VA 2NPXA 1TDFA 3GD3A 3K7QX 1IUSA 2C3CA 3EANA 3P4SA 4X4JA 3P1WA 1S3EA 2R0PA 3EF6A 2YLXA 3KPFA 1E7PA 1PXCA 2RGHA 4B1BA 2WESA 1FEAA 1JOAA 4AT2A 1LQTA 2FJDA 2BACA 2VQ7A 2WOVA 2WOIA 4I58A 1V59A 4OCGA 3AD8B 2RGJA 2FBWA 2YG5A 4Z43A 5FMHA 2V3AA 1BGNA 1K4QA 1TDKA 4H2NA 1TDOA 1RYIA 2B9YA 4NZHA 4YSZA 4LA1A 4UDPA 3CGBA 4UDQA 2GVCA 4DSHA 2WP5A 3D8XA 2YLSA 3NH3X 1MOKA 2JB3A 1D7YA 2YVFA 4FK1A 5KOXA 2H89A 1UKVG 2XVJA 1QLBA 1PBBA 1LJ1A 5FS9A 1L0VA 1H6VA 1ZP0A 4CY6A 2XFUA 4ZCCA 3UTFA 3P4RA 4H4TA 1EL7A 2VZ2A 3V3NA 1IUTA 3H8IA 3Q6JA 2C75A 1EL9A 2E5VA 2R46A 2YVGA 3FBSA 4BK3A 3FIMB 1DJQA 3KKJA 3AB1A 3AYJA 1TRBA 5JCNA 3M12A 4J36A 2XLSA 2GAGB 4YSXA 1PN0A 3ICSA 4WCTA 3SFDA 3SFEA 2BXSA 3AEDA 1H83A 4H2RA 3QFAA 4AT0A 4K5SA 1EBDA 4KX6A 1IUWA 1OJAA 2B7SA 1H81A 2C66A 2WP9A 2XVFA 1NDAA 4YSHA 3LJPA 3LOVA 3F8DA 5FS8A 4NTDA 3DJGX 1RSGA 4EIPA 4NTEA 1B8SA 1NEKA 4LIIA 3ITJA 1JRYA 3NTDA 3DGZA 4H2QA 1JNRA 1GT8A 4U8JA 4U2LA 5EOWA 5KWFA 1CJCA 1X31B 2AR8A 4IA6A 3RP8A 3AE3A 1PBEA 2QCUA 1QO8A 1F3PA 4I59A 4N9XA 4OVIA 2CDUA 4U8MA 1BWCA 5KOWA 2YR5A 3FPZA 4EQXA 1VG0A 4H4RA 1ZOVA 4H4QA 2BS4A 3AEAA 2WDQA 3CGDA 3M13A 4CRTA 4BJYA 1K0IA 1D4CA 3FG2P 3QSEA 1BZLA 3EAOA 4TM1A 1SEZA 3ATQA 2WOWA 4H7UA 4B68A 1YY5A 4U2SA 2ZZBA 2X8GA 1VG9A 1ZKQA 1B5QA 2VRLA 1Z6LA 2XVIA 2C3DA 2R0GA 4U8IA 1MO9A 4E0VA 3KLJA 1DOEA 3NK1X 3NYFA 3UKFA 1GV4A 3DK9A 3NNEA 3QVRA 4U8PA 5EB4A 3G5QA 3QVPA 3KU9A 4MJWA 2ACZA 3AE8A 2VOUA 3AWIA 3BHKA 3GYJA 4K2XA 3VR9A 1NPXA 1H82A 2BC0A 3GD4A 4IA5A 1GTEA 1XPQA 3UCLA 1P2HA 3UOXA 1GSNA 1NHSA 4H50A 2OA1A 2YLRA 3BHFA 2YR4A 2V6OA 3UTGA 2GH5A 4XWZA 4AOXA 5LV9A 2AAQA 1S2QA 2WETA 1GRBA 1D4EA 1O95A 2BABA 1KNRA 4GRTA 1KFYA 2WPEA 3CTYA 1PBCA 1CBOA 4HB9A 4OPUA 3GYIA 4H4XA 1IUVA 3OC4A 2GR3A 1RP0A 1ZDLA 4J57A 1COYA 4H4YA 1PHHA 3NYCA 4XWRA 3CGEA 1F8RA 1H84A 2X8CA 2HQMA 1KNPA 1Q1WA 1PJ6A 3CNTA 4TM0A 1Y56B 1CL0A 4EQWA 1LPFA 4J33A 4EMWA 1GRTA 3SQPA 3CN8A 2BS2A 4GUVA 3AE6A 4JY3A 4AOSA 3K7MX 4GF7A 2C64A 3P4QA 1XDIA 3C4AA 4EIQA 1H86A 2B9WA 2YWLA 3NN0X 2WPCA 2Y6QA 1ZY8A 1CC4A 4USQA 2Q0LA 2VVLG 3DGHA 3DK4A 3DMEA 4Z2TA 2GR2A 4Z24A 2XDOA 2I0ZA 2XLRA 4UP3A 4FDCB 2FJEA 2JAEA 3UOZA 2GEWA 3IF9A 4OPLA 4RG3A 2BS3A 2WHDA 2Q0KA 2PHHA 4A99A 1D4DA 4CY8A 5HYMA 1CHUA 1CF3A 2Z5XA 4JQ9A 4Z25A 1TDNA 3QSSA 2OLOA 2YG3A 4ZCDA 4A5LA 3RHAA 4DSGA 3I3LA 2GR1A 2B76A 3UKHA 4Z2RA 5TR3A 4B64A 4UDRA 5KVHA 4JNAA 4K7ZA 1NG4A 1B4VA 3LB8A 3CPIG 1ZX9A 1FCDA 2YG4A 4U2TA 4U8OA 5HXIA 4K5RA 3CNSA 2GRTA 4GR1A 4YKFA 1F8WA 1GRHA 2VVLA 3IHGA 4A79A 4BK2A 1F6MA 4GDEA 1Q9IA 2C76A 2TPRA 1L9EA 2V3BA 1EL8A 2XLTA 2O9ZA 3DA1A 1GESA 3LZXA 2Y6RA 1NAAA 1IUXA 3GMCA 2YM2A 3AE4A 3GDPA 3V3OA 3VRDB 1FECA 3GSIA 3VRAA 2X3NA 1GXFA 4A6NB 4B65A 2WS3A 3NHOX 2R45A 2YLWA 1NG3A 4REKA 2TMDA 1IUUA 4TM3A 3K7TA 1DODA 3NN6X 3REDA 3SM8A 2FJBA 3P9UA 3NK2X 4YTPA 4J34A 5U63A 2QA2A 2GAHB 4IVOB 4RG4A 3CNJA 3B3RA 1GTHA 1GNDA 3UOVA 2YG7A 1PJ5A 4OPTA 4B63A 1N4WA 5CQFA 3QSMA 3D1CA 3IHMA 2YLTA 1D5TA 1AOGA 4YTNA 2Q7VA 4YWOA 1DNCA 1M64A 1QJDA 4J31A 3AE1A 4NEWA 2JKCA 1REOA 1YQ3A 3AD7B 4H4PA 1GRGA 1TYTA 2VQBA 3NT6A 4C77A 4NEVA 4DNAA 1VDCA 1PXBA 4X9MA 4YTMA 4A65A 3ALLA 3T37A 4BJZA 2XYOA 5JCLA 1FEBA 1NHPA 5EB5A 1E1MA 3UKPA 2WU5A 1F8SA
chains in the Genus database with same CATH superfamily
2CFYA 1LTXR 1H7WA 2RABA 4YSYA 1CJ2A 3KVEA 2GQFA 1PXAA 1DJNA 3BI2A 3C4NA 2BRAA 4C5OA 2BRYA 3BNUA 4BK1A 1FOHA 4FX9A 1XANA 3AYIA 3CPHG 5BULA 4B69A 4JY2A 4OPIA 5ER0A 3NYEA 4ADWA 1NHRA 4K22A 3T2ZA 4APNA 3ZYXA 2OALA 3H8LA 1VRQB 1ONFA 3DJDA 5JCIA 1KSSA 3NRNA 3H4KA 2IVEA 4X9NA 1E1KA 1N4VA 2BCPA 1HYUA 2OLNA 4EMIA 5IQ4A 2Q6UA 2YAUA 1DOBA 2R4EA 1OJTA 3KD9A 3L8KA 4OPCA 1OJCA 2YLZA 2IVDA 3WE0A 1CJ3A 3ZDNA 3NLCA 2RGOA 2YG6A 1L9CA 5GSNA 2V5ZA 4C74A 3CNDA 3LZWA 4KPRA 1M6IA 2JK6A 4JNQA 2XVHA 3T14A 3T2KA 4EQSA 4Z2UA 2XFPA 4ZN0A 5BVAA 3R9UA 1LV0A 4D03A 4PABA 4G74A 3NK0X 4XXGA 5BUKA 1FL2A 1IJHA 4GDPA 3E1TA 2OAMA 2PYXA 3S5WA 3KPKA 2J3NA 2YM1A 3AE2A 3HZLA 1YKJA 2UZZA 4ICYA 3RP6A 3RP7A 4AP1A 5KNLA 3PO7A 4TLZA 3AEBA 2BC1A 4IV9A 5GRTA 3QJ4A 3V76A 5EBKA 3CGCA 1JEHA 1GPEA 3BI4A 3CIRA 5DBJA 2X99A 2DKIA 5CKUA 2R4JA 3CNPA 3I6DA 3ATRA 1ZK7A 2XFOA 3AE7A 4FK1C 2GQWA 4HA6A 2V61A 1Y56A 2EQ8A 2XLPA 2V60A 5J7XA 1TDEA 1D7LA 3NGCX 1NHQA 4K8DA 3K30A 4II2A 3OZ2A 1GRFA 2B7RA 5HHFA 3AXBA 3GRSA 4GAPA 2GF3A 3URHA 1DOCA 2WEUA 3GRTA 4O5QA 4OPDA 4U8LA 1KSUA 1GERA 1YQ4A 4RSLA 1JU2A 2C4CA 2BCGG 2X50A 3UTHA 2JB1A 1CC2A 2A8XA 3ISHA 3AEGA 3UTEA 1Q1RA 2GR0A 5KMSA 2XLUA 3EPTA 5U25A 1OJ9A 1PBFA 5KRQA 3SZCA 1XHCA 2YQUA 3JSKA 1CC6A 1E1NA 1L9DA 4Y4NA 2Z5YA 3DK8A 3UP4A 3SGLA 2VVMA 3B6DA 5HY5A 2XFNA 2EQ7A 2EQ6A 3AD9B 2C73A 1GEUA 4USRA 3UKAA 4P9SA 3F8RA 2BYBA 2ZBWA 5M0ZA 2APGA 4CNJA 2BA9A 2EQ9A 2WDVA 2XFQA 3II4A 4GAVA 4NTCA 4O5UA 2WPFA 2YVJA 3AEFA 4A9WA 4CCRA 1JNZA 2E1MA 5BRTA 2CVJA 5J60A 2B9XA 5JCMA 3UKKA 5KMQA 3LADA 4Y4MA 3ICTA 2FJAA 3P4PA 4YT0A 3ADAB 4CBQA 1P2EA 4NNJA 3AE9A 3SXIA 1MXTA 5KMPA 1YQZA 4CCQA 2NVKX 3LXDA 3VR8A 4C3YA 4TLXA 2JB2A 2ZZ0A 2DKHA 3ALJA 3Q9TA 1S3BA 2C67A 4BURA 5FS7A 3T0KA 3UKQA 2XVEA 4CNKA 3L1RA 1TYPA 3IWAA 5KVIA 4WX1A 1K0JA 4A6NA 2R0CA 3DJEA 4M52A 5U1OA 4YXDA 2F5ZA 1S2YA 4DGKA 2BK3A 2C70A 4BV6A 3NKSA 1B37A 2AQJA 4Z44A 3BNMA 4J2WA 1JRZA 1K0LA 1W4XA 5KXJA 2CULA 1GREA 4H4ZA 1ZOYA 5L46A 3GWDA 1LQUA 2BXRA 4AP3A 4Y4LA 2A87A 1ELIA 1KF6A 2JBVA 3GWFA 1BKWA 4B67A 3PVCA 3FMWA 1ZMDA 3DJJA 4OPGA 4H4WA 3AEEA 1PS9A 4C3XA 1Y0PA 4IVMB 4U8KA 5IQ1A 3UKLA 1VQWA 2W0HA 4J56A 4TM4A 5C2TA 4U8NA 3VRBA 4H4UA 2C65A 3RNMA 1E6EA 2WQYA 4EM3A 2WU2A 1GRAA 4II3A 1DXLA 3BI5A 3DH9A 4GCMA 3AE5A 1H7XA 2GMJA 2YR6A 3NIXA 5JCKA 1PDHA 5IPYA 1N4UA 5FS6A 4Z26A 1GETA 2WP6A 1EL5A 1PBDA 4EQRA 4YKGA 1LVLA 1O5WA 2IIDA 2VRMA 4JDRA 1GALA 1E39A 2GV8A 3ABVA 3O0HA 3M0OA 4LU6A 1BGJA 2E4GA 3G5RA 2WBAA 4D04A 4B66A 3SZ0A 3VQRA 2BK4A 3T31A 2X8HA 3NG7X 2A89A 3F8PA 3KA7A 2GMHA 1KDGA 3CPJG 3QFBA 5C3JA 1ZMCA 2WDRA 4EMJA 4ECHA 3AYLA 1OJDA 2C7GA 2H88A 3PS9A 2XCGA 3GDNA 4A7AA 2ARDA 3C96A 2R9ZA 3IC9A 4H4SA 3AECA 3UP5A 3ALMA 3S61A 4H2PA 5M10A 1NENA 1O94A 2ZZCA 1N1PA 1JRXA 2QA1A 1PJ7A 3UOYA 3GMBA 2QAEA 3G5SA 3NTAA 4JN9A 4EM4A 3ICRA 2C72A 1BF3A 4PAAA 3T2YA 1E1LA 1GOSA 1CJ4A 2BK5A 3COXA 2GB0A 4H4VA 2NPXA 1TDFA 3GD3A 3K7QX 1IUSA 2C3CA 3EANA 3P4SA 4X4JA 3P1WA 1S3EA 2R0PA 3EF6A 2YLXA 3KPFA 1E7PA 1PXCA 2RGHA 4B1BA 2WESA 1FEAA 1JOAA 4AT2A 1LQTA 2FJDA 2BACA 2VQ7A 2WOVA 2WOIA 4I58A 1V59A 4OCGA 3AD8B 2RGJA 2FBWA 2YG5A 4Z43A 4G6HA 5FMHA 2V3AA 4G6GA 1BGNA 1K4QA 1TDKA 4H2NA 1TDOA 1RYIA 2B9YA 4NZHA 4YSZA 4LA1A 4UDPA 3CGBA 4UDQA 3HYVA 2GVCA 4DSHA 2WP5A 3D8XA 2YLSA 3NH3X 1MOKA 2JB3A 1D7YA 2YVFA 4FK1A 5KOXA 2H89A 1UKVG 2XVJA 1QLBA 1PBBA 1LJ1A 5FS9A 1L0VA 1H6VA 1ZP0A 4CY6A 2XFUA 4ZCCA 3UTFA 3P4RA 4H4TA 1EL7A 2VZ2A 3V3NA 1IUTA 3H8IA 3Q6JA 2C75A 1EL9A 2E5VA 2R46A 2YVGA 3FBSA 4BK3A 3FIMB 1DJQA 3KKJA 3AB1A 3AYJA 3HYXA 1TRBA 5JCNA 3M12A 4J36A 2XLSA 2GAGB 4YSXA 1PN0A 3ICSA 4WCTA 3SFDA 3SFEA 2BXSA 3AEDA 1H83A 4H2RA 3QFAA 4AT0A 4K5SA 1EBDA 4KX6A 1IUWA 1OJAA 2B7SA 1H81A 2C66A 2WP9A 2XVFA 1NDAA 4YSHA 3LJPA 3LOVA 3F8DA 5FS8A 4NTDA 3DJGX 1RSGA 4EIPA 4NTEA 1B8SA 1NEKA 4LIIA 3ITJA 1JRYA 3NTDA 3DGZA 4H2QA 1JNRA 1GT8A 4U8JA 4U2LA 5EOWA 5KWFA 1CJCA 1X31B 2AR8A 4IA6A 3RP8A 3AE3A 1PBEA 2QCUA 1QO8A 1F3PA 4I59A 4N9XA 4OVIA 2CDUA 4U8MA 1BWCA 5KOWA 2YR5A 3FPZA 4EQXA 1VG0A 4H4RA 1ZOVA 4H4QA 2BS4A 3AEAA 2WDQA 3CGDA 3M13A 4CRTA 4BJYA 1K0IA 1D4CA 3FG2P 3QSEA 1BZLA 3EAOA 4TM1A 1SEZA 3ATQA 2WOWA 4H7UA 4B68A 1YY5A 4U2SA 2ZZBA 2X8GA 1VG9A 1ZKQA 1B5QA 2VRLA 1Z6LA 2XVIA 2C3DA 2R0GA 4U8IA 1MO9A 4E0VA 3KLJA 1DOEA 3NK1X 3NYFA 3UKFA 1GV4A 3DK9A 3NNEA 3QVRA 4U8PA 5EB4A 3G5QA 3QVPA 3KU9A 4MJWA 2ACZA 3AE8A 2VOUA 3AWIA 3BHKA 3GYJA 4K2XA 3VR9A 1NPXA 1H82A 2BC0A 3GD4A 4IA5A 1GTEA 1XPQA 3UCLA 1P2HA 3UOXA 1GSNA 1NHSA 3SYIA 4H50A 2OA1A 2YLRA 3BHFA 2YR4A 2V6OA 3UTGA 2GH5A 4XWZA 4AOXA 5LV9A 2AAQA 1S2QA 4NWZA 3HYWA 2WETA 1GRBA 1D4EA 1O95A 2BABA 1KNRA 4GRTA 1KFYA 2WPEA 3CTYA 1PBCA 1CBOA 4HB9A 4OPUA 3GYIA 4H4XA 1IUVA 3OC4A 2GR3A 1RP0A 1ZDLA 4J57A 1COYA 4H4YA 1PHHA 3NYCA 4XWRA 3CGEA 1F8RA 1H84A 2X8CA 2HQMA 1KNPA 1Q1WA 1PJ6A 3CNTA 4TM0A 1Y56B 1CL0A 4EQWA 1LPFA 4J33A 3GYXA 4EMWA 1GRTA 3SQPA 3CN8A 2BS2A 4GUVA 3AE6A 4JY3A 4AOSA 3K7MX 4GF7A 2C64A 3P4QA 1XDIA 3C4AA 4EIQA 1H86A 2B9WA 2YWLA 3NN0X 2WPCA 2Y6QA 1ZY8A 1CC4A 4USQA 2Q0LA 2VVLG 3DGHA 3DK4A 3DMEA 4Z2TA 2GR2A 4Z24A 3SZFA 2XDOA 2I0ZA 2XLRA 4UP3A 4FDCB 2FJEA 2JAEA 3UOZA 2GEWA 3IF9A 4OPLA 4RG3A 2BS3A 2WHDA 2Q0KA 2PHHA 4A99A 1D4DA 4CY8A 5HYMA 1CHUA 1CF3A 2Z5XA 4JQ9A 4Z25A 1TDNA 3QSSA 2OLOA 5KMRA 4G73A 2YG3A 4ZCDA 4A5LA 3RHAA 4DSGA 3I3LA 2GR1A 2B76A 3UKHA 4Z2RA 3SX6A 5TR3A 4B64A 4UDRA 5KVHA 4JNAA 4K7ZA 1NG4A 1B4VA 3LB8A 3CPIG 1ZX9A 1FCDA 2YG4A 4U2TA 4U8OA 5HXIA 4K5RA 3CNSA 2GRTA 4GR1A 4YKFA 1F8WA 1GRHA 2VVLA 3IHGA 4A79A 4BK2A 1F6MA 4GDEA 1Q9IA 2C76A 2TPRA 1L9EA 2V3BA 1EL8A 2XLTA 2O9ZA 3DA1A 1GESA 3LZXA 2Y6RA 1NAAA 1IUXA 3GMCA 2YM2A 3AE4A 3GDPA 3V3OA 3VRDB 1FECA 3GSIA 3VRAA 2X3NA 1GXFA 4A6NB 4B65A 2WS3A 3NHOX 2R45A 2YLWA 1NG3A 3CMMA 2TMDA 1IUUA 4REKA 4G9KA 4TM3A 3K7TA 1DODA 3NN6X 3REDA 3SM8A 2FJBA 3P9UA 3NK2X 4YTPA 4J34A 5U63A 2QA2A 2GAHB 4IVOB 4RG4A 3CNJA 3B3RA 1GTHA 1GNDA 3UOVA 2YG7A 1PJ5A 4OPTA 4B63A 1N4WA 5CQFA 3QSMA 3D1CA 3IHMA 2YLTA 1D5TA 3SY4A 4YTNA 1AOGA 2Q7VA 4YWOA 1DNCA 1M64A 1QJDA 4J31A 3AE1A 4NEWA 2JKCA 1REOA 1YQ3A 3AD7B 4H4PA 1GRGA 1TYTA 2VQBA 3NT6A 4C77A 4NEVA 4DNAA 1VDCA 1PXBA 4X9MA 4YTMA 4A65A 3ALLA 3T37A 4BJZA 2XYOA 3SZWA 5JCLA 1FEBA 1NHPA 5EB5A 1E1MA 3UKPA 2WU5A 1F8SA
chains in the Genus database with same CATH topology
2CFYA 1LTXR 1H7WA 2RABA 4YSYA 1CJ2A 3KVEA 2GQFA 1PXAA 1DJNA 3BI2A 3C4NA 2BRAA 4C5OA 2BRYA 3BNUA 4BK1A 1FOHA 4FX9A 1XANA 3AYIA 3CPHG 5BULA 4B69A 4JY2A 4OPIA 5ER0A 3NYEA 4ADWA 1NHRA 4K22A 3T2ZA 4APNA 3ZYXA 2OALA 3H8LA 1VRQB 1ONFA 3DJDA 5JCIA 1KSSA 3NRNA 3H4KA 2IVEA 4X9NA 1E1KA 1N4VA 2BCPA 1HYUA 2OLNA 4EMIA 5IQ4A 2Q6UA 2YAUA 1DOBA 2R4EA 1OJTA 3KD9A 3L8KA 4OPCA 1OJCA 2YLZA 2IVDA 3WE0A 1CJ3A 3ZDNA 3NLCA 2RGOA 2YG6A 1L9CA 5GSNA 2V5ZA 4C74A 3CNDA 3LZWA 4KPRA 1M6IA 2JK6A 4JNQA 2XVHA 3T14A 3T2KA 4EQSA 4Z2UA 2XFPA 4ZN0A 5BVAA 3R9UA 1LV0A 4D03A 4PABA 4G74A 3NK0X 4XXGA 5BUKA 1FL2A 1IJHA 4GDPA 3E1TA 2OAMA 2PYXA 3S5WA 3KPKA 2J3NA 2YM1A 3AE2A 3HZLA 1YKJA 2UZZA 4ICYA 3RP6A 3RP7A 4AP1A 5KNLA 3PO7A 4TLZA 3AEBA 2BC1A 4IV9A 5GRTA 3QJ4A 3V76A 5EBKA 3CGCA 1JEHA 1GPEA 3BI4A 3CIRA 5DBJA 2X99A 2DKIA 5CKUA 2R4JA 3CNPA 3I6DA 3ATRA 1ZK7A 2XFOA 3AE7A 4FK1C 2GQWA 4HA6A 2V61A 1Y56A 2EQ8A 2XLPA 2V60A 5J7XA 1TDEA 1D7LA 3NGCX 1NHQA 4K8DA 3K30A 4II2A 3OZ2A 1GRFA 2B7RA 5HHFA 3AXBA 3GRSA 4GAPA 2GF3A 3URHA 1DOCA 2WEUA 3GRTA 4O5QA 4OPDA 4U8LA 1KSUA 1GERA 1YQ4A 4RSLA 1JU2A 2C4CA 2BCGG 2X50A 3UTHA 2JB1A 1CC2A 2A8XA 3ISHA 3AEGA 3UTEA 1Q1RA 2GR0A 5KMSA 2XLUA 3EPTA 5U25A 1OJ9A 1PBFA 5KRQA 3SZCA 1XHCA 2YQUA 3JSKA 1CC6A 1E1NA 1L9DA 4Y4NA 2Z5YA 3DK8A 3UP4A 3SGLA 2VVMA 3B6DA 5HY5A 2XFNA 2EQ7A 2EQ6A 3AD9B 2C73A 1GEUA 4USRA 3UKAA 4P9SA 3F8RA 2BYBA 2ZBWA 5M0ZA 2APGA 4CNJA 2BA9A 2EQ9A 2WDVA 2XFQA 3II4A 4GAVA 4NTCA 4O5UA 2WPFA 2YVJA 3AEFA 4A9WA 4CCRA 1JNZA 2E1MA 5BRTA 2CVJA 5J60A 2B9XA 5JCMA 3UKKA 5KMQA 3LADA 4Y4MA 3ICTA 2FJAA 3P4PA 4YT0A 3ADAB 4CBQA 1P2EA 4NNJA 3AE9A 3SXIA 1MXTA 5KMPA 1YQZA 4CCQA 2NVKX 3LXDA 3VR8A 4C3YA 4TLXA 2JB2A 2ZZ0A 2DKHA 3ALJA 3Q9TA 1S3BA 2C67A 4BURA 5FS7A 3T0KA 3UKQA 2XVEA 4CNKA 3L1RA 1TYPA 3IWAA 5KVIA 4WX1A 1K0JA 4A6NA 2R0CA 3DJEA 4M52A 5U1OA 4YXDA 2F5ZA 1S2YA 4DGKA 2BK3A 2C70A 4BV6A 3NKSA 1B37A 2AQJA 4Z44A 3BNMA 4J2WA 1JRZA 1K0LA 1W4XA 5KXJA 2CULA 1GREA 4H4ZA 1ZOYA 5L46A 3GWDA 1LQUA 2BXRA 4AP3A 4Y4LA 2A87A 1ELIA 1KF6A 2JBVA 3GWFA 1BKWA 4B67A 3PVCA 3FMWA 1ZMDA 3DJJA 4OPGA 4H4WA 3AEEA 1PS9A 4C3XA 1Y0PA 4IVMB 4U8KA 5IQ1A 3UKLA 1VQWA 2W0HA 4J56A 4TM4A 5C2TA 4U8NA 3VRBA 4H4UA 2C65A 3RNMA 1E6EA 2WQYA 4EM3A 2WU2A 1GRAA 4II3A 1DXLA 3BI5A 3DH9A 4GCMA 3AE5A 1H7XA 2GMJA 2YR6A 3NIXA 5JCKA 1PDHA 5IPYA 1N4UA 5FS6A 4Z26A 1GETA 2WP6A 1EL5A 1PBDA 4EQRA 4YKGA 1LVLA 1O5WA 2IIDA 2VRMA 4JDRA 1GALA 1E39A 2GV8A 3ABVA 3O0HA 3M0OA 4LU6A 1BGJA 2E4GA 3G5RA 2WBAA 4D04A 4B66A 3SZ0A 3VQRA 2BK4A 3T31A 2X8HA 3NG7X 2A89A 3F8PA 3KA7A 2GMHA 1KDGA 3CPJG 3QFBA 5C3JA 1ZMCA 2WDRA 4EMJA 4ECHA 3AYLA 1OJDA 2C7GA 2H88A 3PS9A 2XCGA 3GDNA 4A7AA 2ARDA 3C96A 2R9ZA 3IC9A 4H4SA 3AECA 3UP5A 3ALMA 3S61A 4H2PA 5M10A 1NENA 1O94A 2ZZCA 1N1PA 1JRXA 2QA1A 1PJ7A 3UOYA 3GMBA 2QAEA 3G5SA 3NTAA 4JN9A 4EM4A 3ICRA 2C72A 1BF3A 4PAAA 3T2YA 1E1LA 1GOSA 1CJ4A 2BK5A 3COXA 2GB0A 4H4VA 2NPXA 1TDFA 3GD3A 3K7QX 1IUSA 2C3CA 3EANA 3P4SA 4X4JA 3P1WA 1S3EA 2R0PA 3EF6A 2YLXA 3KPFA 1E7PA 1PXCA 2RGHA 4B1BA 2WESA 1FEAA 1JOAA 4AT2A 1LQTA 2FJDA 2BACA 2VQ7A 2WOVA 2WOIA 4I58A 1V59A 4OCGA 3AD8B 2RGJA 2FBWA 2YG5A 4Z43A 4G6HA 5FMHA 2V3AA 4G6GA 1BGNA 1K4QA 1TDKA 4H2NA 1TDOA 1RYIA 2B9YA 4NZHA 4YSZA 4LA1A 4UDPA 3CGBA 4UDQA 3HYVA 2GVCA 4DSHA 2WP5A 3D8XA 2YLSA 3NH3X 1MOKA 2JB3A 1D7YA 2YVFA 4FK1A 5KOXA 2H89A 1UKVG 2XVJA 1QLBA 1PBBA 1LJ1A 5FS9A 1L0VA 1H6VA 1ZP0A 4CY6A 2XFUA 4ZCCA 3UTFA 3P4RA 4H4TA 1EL7A 2VZ2A 3V3NA 1IUTA 3H8IA 3Q6JA 2C75A 1EL9A 2E5VA 2R46A 2YVGA 3FBSA 4BK3A 3FIMB 1DJQA 3KKJA 3AB1A 3AYJA 3HYXA 1TRBA 5JCNA 3M12A 4J36A 2XLSA 2GAGB 4YSXA 1PN0A 3ICSA 4WCTA 3SFDA 3SFEA 2BXSA 3AEDA 1H83A 4H2RA 3QFAA 4AT0A 4K5SA 1EBDA 4KX6A 1IUWA 1OJAA 2B7SA 1H81A 2C66A 2WP9A 2XVFA 1NDAA 4YSHA 3LJPA 3LOVA 3F8DA 5FS8A 4NTDA 3DJGX 1RSGA 4EIPA 4NTEA 1B8SA 1NEKA 4LIIA 3ITJA 1JRYA 3NTDA 3DGZA 4H2QA 1JNRA 1GT8A 4U8JA 4U2LA 5EOWA 5KWFA 1CJCA 1X31B 2AR8A 4IA6A 3RP8A 3AE3A 1PBEA 2QCUA 1QO8A 1F3PA 4I59A 4N9XA 4OVIA 2CDUA 4U8MA 1BWCA 5KOWA 2YR5A 3FPZA 4EQXA 1VG0A 4H4RA 1ZOVA 4H4QA 2BS4A 3AEAA 2WDQA 3CGDA 3M13A 4CRTA 4BJYA 1K0IA 1D4CA 3FG2P 3QSEA 1BZLA 3EAOA 4TM1A 1SEZA 3ATQA 2WOWA 4H7UA 4B68A 1YY5A 4U2SA 2ZZBA 2X8GA 1VG9A 1ZKQA 1B5QA 2VRLA 1Z6LA 2XVIA 2C3DA 2R0GA 4U8IA 1MO9A 4E0VA 3KLJA 1DOEA 3NK1X 3NYFA 3UKFA 1GV4A 3DK9A 3NNEA 3QVRA 4U8PA 5EB4A 3G5QA 3QVPA 3KU9A 4MJWA 2ACZA 3AE8A 2VOUA 3AWIA 3BHKA 3GYJA 4K2XA 3VR9A 1NPXA 1H82A 2BC0A 3GD4A 4IA5A 1GTEA 1XPQA 3UCLA 1P2HA 3UOXA 1GSNA 1NHSA 3SYIA 4H50A 2OA1A 2YLRA 3BHFA 2YR4A 2V6OA 3UTGA 2GH5A 4XWZA 4AOXA 5LV9A 2AAQA 1S2QA 4NWZA 3HYWA 2WETA 1GRBA 1D4EA 1O95A 2BABA 1KNRA 4GRTA 1KFYA 2WPEA 3CTYA 1PBCA 1CBOA 4HB9A 4OPUA 3GYIA 4H4XA 1IUVA 3OC4A 2GR3A 1RP0A 1ZDLA 4J57A 1COYA 4H4YA 1PHHA 3NYCA 4XWRA 3CGEA 1F8RA 1H84A 2X8CA 2HQMA 1KNPA 1Q1WA 1PJ6A 3CNTA 4TM0A 1Y56B 1CL0A 4EQWA 1LPFA 4J33A 3GYXA 4EMWA 1GRTA 3SQPA 3CN8A 2BS2A 4GUVA 3AE6A 4JY3A 4AOSA 3K7MX 4GF7A 2C64A 3P4QA 1XDIA 3C4AA 4EIQA 1H86A 2B9WA 2YWLA 3NN0X 2WPCA 2Y6QA 1ZY8A 1CC4A 4USQA 2Q0LA 2VVLG 3DGHA 3DK4A 3DMEA 4Z2TA 2GR2A 4Z24A 3SZFA 2XDOA 2I0ZA 2XLRA 4UP3A 4FDCB 2FJEA 2JAEA 3UOZA 2GEWA 3IF9A 4OPLA 4RG3A 2BS3A 2WHDA 2Q0KA 2PHHA 4A99A 1D4DA 4CY8A 5HYMA 1CHUA 1CF3A 2Z5XA 4JQ9A 4Z25A 1TDNA 3QSSA 2OLOA 5KMRA 4G73A 2YG3A 4ZCDA 4A5LA 3RHAA 4DSGA 3I3LA 2GR1A 2B76A 3UKHA 4Z2RA 3SX6A 5TR3A 4B64A 4UDRA 5KVHA 4JNAA 4K7ZA 1NG4A 1B4VA 3LB8A 3CPIG 1ZX9A 1FCDA 2YG4A 4U2TA 4U8OA 5HXIA 4K5RA 3CNSA 2GRTA 4GR1A 4YKFA 1F8WA 1GRHA 2VVLA 3IHGA 4A79A 4BK2A 1F6MA 4GDEA 1Q9IA 2C76A 2TPRA 1L9EA 2V3BA 1EL8A 2XLTA 2O9ZA 3DA1A 1GESA 3LZXA 2Y6RA 1NAAA 1IUXA 3GMCA 2YM2A 3AE4A 3GDPA 3V3OA 3VRDB 1FECA 3GSIA 3VRAA 2X3NA 1GXFA 4A6NB 4B65A 2WS3A 3NHOX 2R45A 2YLWA 1NG3A 3CMMA 2TMDA 1IUUA 4REKA 4G9KA 4TM3A 3K7TA 1DODA 3NN6X 3REDA 3SM8A 2FJBA 3P9UA 3NK2X 4YTPA 4J34A 5U63A 2QA2A 2GAHB 4IVOB 4RG4A 3CNJA 3B3RA 1GTHA 1GNDA 3UOVA 2YG7A 1PJ5A 4OPTA 4B63A 1N4WA 5CQFA 3QSMA 3D1CA 3IHMA 2YLTA 1D5TA 3SY4A 4YTNA 1AOGA 2Q7VA 4YWOA 1DNCA 1M64A 1QJDA 4J31A 3AE1A 4NEWA 2JKCA 1REOA 1YQ3A 3AD7B 4H4PA 1GRGA 1TYTA 2VQBA 3NT6A 4C77A 4NEVA 4DNAA 1VDCA 1PXBA 4X9MA 4YTMA 4A65A 3ALLA 3T37A 4BJZA 2XYOA 3SZWA 5JCLA 1FEBA 1NHPA 5EB5A 1E1MA 3UKPA 2WU5A 1F8SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CFY A;  1LTX R;  1H7W A;  2RAB A;  4YSY A;  1CJ2 A;  3KVE A;  2GQF A;  1PXA A;  1DJN A;  3BI2 A;  3C4N A;  4C5O A;  3BNU A;  4BK1 A;  1FOH A;  4FX9 A;  1XAN A;  3AYI A;  3CPH G;  5BUL A;  4B69 A;  4JY2 A;  4OPI A;  5ER0 A;  3NYE A;  4ADW A;  1NHR A;  4K22 A;  4APN A;  3ZYX A;  2OAL A;  3H8L A;  1VRQ B;  1ONF A;  3DJD A;  5JCI A;  1KSS A;  3NRN A;  3H4K A;  2IVE A;  4X9N A;  1E1K A;  1N4V A;  2BCP A;  1HYU A;  2OLN A;  4EMI A;  5IQ4 A;  2Q6U A;  2YAU A;  1DOB A;  2R4E A;  1OJT A;  3KD9 A;  3L8K A;  4OPC A;  1OJC A;  2YLZ A;  2IVD A;  3WE0 A;  1CJ3 A;  3ZDN A;  3NLC A;  2RGO A;  2YG6 A;  1L9C A;  5GSN A;  2V5Z A;  4C74 A;  3CND A;  3LZW A;  4KPR A;  1M6I A;  2JK6 A;  4JNQ A;  2XVH A;  4EQS A;  4Z2U A;  4ZN0 A;  5BVA A;  2XFP A;  3R9U A;  1LV0 A;  4D03 A;  4PAB A;  4XXG A;  3NK0 X;  5BUK A;  1FL2 A;  1IJH A;  4GDP A;  3E1T A;  2OAM A;  2PYX A;  3S5W A;  2J3N A;  2YM1 A;  3AE2 A;  3HZL A;  1YKJ A;  2UZZ A;  4ICY A;  3RP6 A;  3RP7 A;  4AP1 A;  3PO7 A;  4TLZ A;  3AEB A;  2BC1 A;  4IV9 A;  5GRT A;  3QJ4 A;  3V76 A;  5EBK A;  3CGC A;  1JEH A;  1GPE A;  3BI4 A;  3CIR A;  5DBJ A;  2X99 A;  2DKI A;  5CKU A;  2R4J A;  3CNP A;  3I6D A;  3ATR A;  1ZK7 A;  2XFO A;  3AE7 A;  4FK1 C;  2GQW A;  4HA6 A;  2V61 A;  1Y56 A;  2EQ8 A;  2XLP A;  2V60 A;  5J7X A;  1TDE A;  1D7L A;  3NGC X;  1NHQ A;  4K8D A;  3K30 A;  3OZ2 A;  1GRF A;  2B7R A;  5HHF A;  3AXB A;  3GRS A;  2GF3 A;  3URH A;  1DOC A;  2WEU A;  3GRT A;  4O5Q A;  4OPD A;  4U8L A;  1KSU A;  1GER A;  1YQ4 A;  4RSL A;  1JU2 A;  2BCG G;  2X50 A;  3UTH A;  2JB1 A;  1CC2 A;  2A8X A;  3ISH A;  3AEG A;  3UTE A;  1Q1R A;  2GR0 A;  2XLU A;  3EPT A;  5U25 A;  1OJ9 A;  1PBF A;  5KRQ A;  1XHC A;  2YQU A;  3JSK A;  1CC6 A;  1E1N A;  1L9D A;  4Y4N A;  2Z5Y A;  3DK8 A;  3UP4 A;  3SGL A;  2VVM A;  3B6D A;  5HY5 A;  2XFN A;  2EQ7 A;  2EQ6 A;  3AD9 B;  2C73 A;  1GEU A;  4USR A;  3UKA A;  4P9S A;  3F8R A;  2BYB A;  2ZBW A;  5M0Z A;  2APG A;  4CNJ A;  2BA9 A;  2EQ9 A;  2WDV A;  2XFQ A;  3II4 A;  4NTC A;  4O5U A;  2WPF A;  2YVJ A;  3AEF A;  4A9W A;  4CCR A;  1JNZ A;  2E1M A;  5BRT A;  2CVJ A;  5J60 A;  2B9X A;  5JCM A;  3UKK A;  3LAD A;  4Y4M A;  3ICT A;  2FJA A;  3P4P A;  4YT0 A;  3ADA B;  4CBQ A;  1P2E A;  3AE9 A;  1MXT A;  1YQZ A;  4CCQ A;  2NVK X;  3LXD A;  3VR8 A;  4C3Y A;  4TLX A;  2JB2 A;  2ZZ0 A;  2DKH A;  3ALJ A;  3Q9T A;  1S3B A;  2C67 A;  4BUR A;  5FS7 A;  3UKQ A;  2XVE A;  4CNK A;  3L1R A;  1TYP A;  3IWA A;  5KVI A;  4WX1 A;  1K0J A;  4A6N A;  2R0C A;  3DJE A;  4M52 A;  5U1O A;  4YXD A;  2F5Z A;  1S2Y A;  4DGK A;  2BK3 A;  2C70 A;  4BV6 A;  3NKS A;  1B37 A;  2AQJ A;  4Z44 A;  3BNM A;  4J2W A;  1JRZ A;  1K0L A;  1W4X A;  5KXJ A;  2CUL A;  1GRE A;  4H4Z A;  1ZOY A;  5L46 A;  3GWD A;  1LQU A;  2BXR A;  4AP3 A;  4Y4L A;  2A87 A;  1ELI A;  1KF6 A;  2JBV A;  3GWF A;  1BKW A;  4B67 A;  3PVC A;  3FMW A;  1ZMD A;  3DJJ A;  4OPG A;  4H4W A;  3AEE A;  1PS9 A;  4C3X A;  1Y0P A;  4IVM B;  4U8K A;  5IQ1 A;  3UKL A;  1VQW A;  2W0H A;  4J56 A;  4TM4 A;  5C2T A;  4U8N A;  3VRB A;  4H4U A;  2C65 A;  3RNM A;  1E6E A;  2WQY A;  4EM3 A;  2WU2 A;  1GRA A;  1DXL A;  3BI5 A;  3DH9 A;  4GCM A;  3AE5 A;  1H7X A;  2GMJ A;  2YR6 A;  3NIX A;  5JCK A;  1PDH A;  5IPY A;  1N4U A;  5FS6 A;  4Z26 A;  1GET A;  2WP6 A;  1EL5 A;  1PBD A;  4EQR A;  4YKG A;  1LVL A;  1O5W A;  2IID A;  2VRM A;  4JDR A;  1GAL A;  1E39 A;  2GV8 A;  3ABV A;  3O0H A;  3M0O A;  4LU6 A;  1BGJ A;  2E4G A;  3G5R A;  2WBA A;  4D04 A;  4B66 A;  3VQR A;  2BK4 A;  2X8H A;  3NG7 X;  2A89 A;  3F8P A;  3KA7 A;  2GMH A;  1KDG A;  3CPJ G;  3QFB A;  5C3J A;  1ZMC A;  2WDR A;  4EMJ A;  4ECH A;  3AYL A;  1OJD A;  2C7G A;  2H88 A;  3PS9 A;  2XCG A;  3GDN A;  4A7A A;  2ARD A;  3C96 A;  2R9Z A;  3IC9 A;  4H4S A;  3AEC A;  3UP5 A;  3ALM A;  3S61 A;  4H2P A;  5M10 A;  1NEN A;  1O94 A;  2ZZC A;  1N1P A;  1JRX A;  2QA1 A;  1PJ7 A;  3UOY A;  3GMB A;  2QAE A;  3G5S A;  3NTA A;  4JN9 A;  4EM4 A;  3ICR A;  2C72 A;  1BF3 A;  4PAA A;  1E1L A;  1GOS A;  1CJ4 A;  2BK5 A;  3COX A;  2GB0 A;  4H4V A;  2NPX A;  1TDF A;  3GD3 A;  3K7Q X;  1IUS A;  2C3C A;  3EAN A;  3P4S A;  4X4J A;  3P1W A;  1S3E A;  2R0P A;  3EF6 A;  2YLX A;  3KPF A;  1E7P A;  1PXC A;  2RGH A;  4B1B A;  2WES A;  1FEA A;  1JOA A;  4AT2 A;  1LQT A;  2FJD A;  2BAC A;  2VQ7 A;  2WOV A;  2WOI A;  4I58 A;  1V59 A;  4OCG A;  3AD8 B;  2RGJ A;  2FBW A;  2YG5 A;  4Z43 A;  5FMH A;  2V3A A;  1BGN A;  1K4Q A;  1TDK A;  4H2N A;  1TDO A;  1RYI A;  2B9Y A;  4NZH A;  4YSZ A;  4LA1 A;  4UDP A;  3CGB A;  4UDQ A;  2GVC A;  4DSH A;  2WP5 A;  3D8X A;  2YLS A;  3NH3 X;  1MOK A;  2JB3 A;  1D7Y A;  2YVF A;  4FK1 A;  5KOX A;  2H89 A;  1UKV G;  2XVJ A;  1QLB A;  1PBB A;  1LJ1 A;  5FS9 A;  1L0V A;  1H6V A;  1ZP0 A;  4CY6 A;  2XFU A;  4ZCC A;  3UTF A;  3P4R A;  4H4T A;  1EL7 A;  2VZ2 A;  3V3N A;  1IUT A;  3H8I A;  3Q6J A;  2C75 A;  1EL9 A;  2E5V A;  2R46 A;  2YVG A;  3FBS A;  4BK3 A;  3FIM B;  1DJQ A;  3KKJ A;  3AB1 A;  3AYJ A;  1TRB A;  5JCN A;  3M12 A;  4J36 A;  2XLS A;  2GAG B;  4YSX A;  1PN0 A;  3ICS A;  4WCT A;  3SFD A;  3SFE A;  2BXS A;  3AED A;  1H83 A;  4H2R A;  3QFA A;  4AT0 A;  4K5S A;  1EBD A;  4KX6 A;  1IUW A;  1OJA A;  2B7S A;  1H81 A;  2C66 A;  2WP9 A;  2XVF A;  1NDA A;  4YSH A;  3LJP A;  3LOV A;  3F8D A;  5FS8 A;  4NTD A;  3DJG X;  1RSG A;  4EIP A;  4NTE A;  1B8S A;  1NEK A;  4LII A;  3ITJ A;  1JRY A;  3NTD A;  3DGZ A;  4H2Q A;  1JNR A;  1GT8 A;  4U8J A;  4U2L A;  5EOW A;  5KWF A;  1CJC A;  1X31 B;  2AR8 A;  4IA6 A;  3RP8 A;  3AE3 A;  1PBE A;  2QCU A;  1QO8 A;  1F3P A;  4I59 A;  4N9X A;  4OVI A;  2CDU A;  4U8M A;  1BWC A;  5KOW A;  2YR5 A;  3FPZ A;  4EQX A;  1VG0 A;  4H4R A;  1ZOV A;  4H4Q A;  2BS4 A;  3AEA A;  2WDQ A;  3CGD A;  3M13 A;  4CRT A;  4BJY A;  1K0I A;  1D4C A;  3FG2 P;  3QSE A;  1BZL A;  3EAO A;  4TM1 A;  1SEZ A;  3ATQ A;  2WOW A;  4H7U A;  4B68 A;  1YY5 A;  4U2S A;  2ZZB A;  2X8G A;  1VG9 A;  1ZKQ A;  1B5Q A;  2VRL A;  1Z6L A;  2XVI A;  2C3D A;  2R0G A;  4U8I A;  1MO9 A;  4E0V A;  3KLJ A;  1DOE A;  3NK1 X;  3NYF A;  3UKF A;  1GV4 A;  3DK9 A;  3NNE A;  3QVR A;  4U8P A;  5EB4 A;  3G5Q A;  3QVP A;  3KU9 A;  4MJW A;  2ACZ A;  3AE8 A;  2VOU A;  3AWI A;  3BHK A;  3GYJ A;  4K2X A;  3VR9 A;  1NPX A;  1H82 A;  2BC0 A;  3GD4 A;  4IA5 A;  1GTE A;  1XPQ A;  3UCL A;  1P2H A;  3UOX A;  1GSN A;  1NHS A;  4H50 A;  2OA1 A;  2YLR A;  3BHF A;  2YR4 A;  2V6O A;  3UTG A;  2GH5 A;  4XWZ A;  4AOX A;  5LV9 A;  2AAQ A;  1S2Q A;  2WET A;  1GRB A;  1D4E A;  1O95 A;  2BAB A;  1KNR A;  4GRT A;  1KFY A;  2WPE A;  3CTY A;  1PBC A;  1CBO A;  4HB9 A;  4OPU A;  3GYI A;  4H4X A;  1IUV A;  3OC4 A;  2GR3 A;  1RP0 A;  1ZDL A;  4J57 A;  1COY A;  4H4Y A;  1PHH A;  3NYC A;  4XWR A;  3CGE A;  1F8R A;  1H84 A;  2X8C A;  2HQM A;  1KNP A;  1Q1W A;  1PJ6 A;  3CNT A;  4TM0 A;  1Y56 B;  1CL0 A;  4EQW A;  1LPF A;  4J33 A;  4EMW A;  1GRT A;  3SQP A;  3CN8 A;  2BS2 A;  4GUV A;  3AE6 A;  4JY3 A;  4AOS A;  3K7M X;  4GF7 A;  2C64 A;  3P4Q A;  1XDI A;  3C4A A;  4EIQ A;  1H86 A;  2B9W A;  2YWL A;  3NN0 X;  2WPC A;  2Y6Q A;  1ZY8 A;  1CC4 A;  4USQ A;  2Q0L A;  2VVL G;  3DGH A;  3DK4 A;  3DME A;  4Z2T A;  2GR2 A;  4Z24 A;  2XDO A;  2I0Z A;  2XLR A;  4UP3 A;  4FDC B;  2FJE A;  2JAE A;  3UOZ A;  2GEW A;  3IF9 A;  4OPL A;  4RG3 A;  2BS3 A;  2WHD A;  2Q0K A;  2PHH A;  4A99 A;  1D4D A;  4CY8 A;  5HYM A;  1CHU A;  1CF3 A;  2Z5X A;  4JQ9 A;  4Z25 A;  1TDN A;  3QSS A;  2OLO A;  2YG3 A;  4ZCD A;  4A5L A;  3RHA A;  4DSG A;  3I3L A;  2GR1 A;  2B76 A;  3UKH A;  4Z2R A;  5TR3 A;  4B64 A;  4UDR A;  5KVH A;  4JNA A;  4K7Z A;  1NG4 A;  1B4V A;  3LB8 A;  3CPI G;  1ZX9 A;  1FCD A;  2YG4 A;  4U2T A;  4U8O A;  5HXI A;  4K5R A;  3CNS A;  2GRT A;  4GR1 A;  4YKF A;  1F8W A;  1GRH A;  2VVL A;  3IHG A;  4A79 A;  4BK2 A;  1F6M A;  4GDE A;  1Q9I A;  2C76 A;  2TPR A;  1L9E A;  2V3B A;  1EL8 A;  2XLT A;  2O9Z A;  3DA1 A;  1GES A;  3LZX A;  2Y6R A;  1NAA A;  1IUX A;  3GMC A;  2YM2 A;  3AE4 A;  3GDP A;  3V3O A;  3VRD B;  1FEC A;  3GSI A;  3VRA A;  2X3N A;  1GXF A;  4A6N B;  4B65 A;  2WS3 A;  3NHO X;  2R45 A;  2YLW A;  1NG3 A;  4REK A;  2TMD A;  1IUU A;  4TM3 A;  3K7T A;  1DOD A;  3NN6 X;  3RED A;  3SM8 A;  2FJB A;  3P9U A;  3NK2 X;  4YTP A;  4J34 A;  5U63 A;  2QA2 A;  2GAH B;  4IVO B;  4RG4 A;  3CNJ A;  3B3R A;  1GTH A;  1GND A;  3UOV A;  2YG7 A;  1PJ5 A;  4OPT A;  4B63 A;  1N4W A;  5CQF A;  3QSM A;  3D1C A;  3IHM A;  2YLT A;  1D5T A;  1AOG A;  4YTN A;  2Q7V A;  4YWO A;  1DNC A;  1M64 A;  1QJD A;  4J31 A;  3AE1 A;  4NEW A;  2JKC A;  1REO A;  1YQ3 A;  3AD7 B;  4H4P A;  1GRG A;  1TYT A;  2VQB A;  3NT6 A;  4C77 A;  4NEV A;  4DNA A;  1VDC A;  1PXB A;  4X9M A;  4YTM A;  4A65 A;  3ALL A;  3T37 A;  4BJZ A;  2XYO A;  5JCL A;  1FEB A;  1NHP A;  5EB5 A;  1E1M A;  3UKP A;  2WU5 A;  1F8S A; 
#chains in the Genus database with same CATH topology
 2CFY A;  1LTX R;  1H7W A;  2RAB A;  4YSY A;  1CJ2 A;  3KVE A;  2GQF A;  1PXA A;  1DJN A;  3BI2 A;  3C4N A;  2BRA A;  4C5O A;  2BRY A;  3BNU A;  4BK1 A;  1FOH A;  4FX9 A;  1XAN A;  3AYI A;  3CPH G;  5BUL A;  4B69 A;  4JY2 A;  4OPI A;  5ER0 A;  3NYE A;  4ADW A;  1NHR A;  4K22 A;  3T2Z A;  4APN A;  3ZYX A;  2OAL A;  3H8L A;  1VRQ B;  1ONF A;  3DJD A;  5JCI A;  1KSS A;  3NRN A;  3H4K A;  2IVE A;  4X9N A;  1E1K A;  1N4V A;  2BCP A;  1HYU A;  2OLN A;  4EMI A;  5IQ4 A;  2Q6U A;  2YAU A;  1DOB A;  2R4E A;  1OJT A;  3KD9 A;  3L8K A;  4OPC A;  1OJC A;  2YLZ A;  2IVD A;  3WE0 A;  1CJ3 A;  3ZDN A;  3NLC A;  2RGO A;  2YG6 A;  1L9C A;  5GSN A;  2V5Z A;  4C74 A;  3CND A;  3LZW A;  4KPR A;  1M6I A;  2JK6 A;  4JNQ A;  2XVH A;  3T14 A;  3T2K A;  4EQS A;  4Z2U A;  2XFP A;  4ZN0 A;  5BVA A;  3R9U A;  1LV0 A;  4D03 A;  4PAB A;  4G74 A;  3NK0 X;  4XXG A;  5BUK A;  1FL2 A;  1IJH A;  4GDP A;  3E1T A;  2OAM A;  2PYX A;  3S5W A;  3KPK A;  2J3N A;  2YM1 A;  3AE2 A;  3HZL A;  1YKJ A;  2UZZ A;  4ICY A;  3RP6 A;  3RP7 A;  4AP1 A;  5KNL A;  3PO7 A;  4TLZ A;  3AEB A;  2BC1 A;  4IV9 A;  5GRT A;  3QJ4 A;  3V76 A;  5EBK A;  3CGC A;  1JEH A;  1GPE A;  3BI4 A;  3CIR A;  5DBJ A;  2X99 A;  2DKI A;  5CKU A;  2R4J A;  3CNP A;  3I6D A;  3ATR A;  1ZK7 A;  2XFO A;  3AE7 A;  4FK1 C;  2GQW A;  4HA6 A;  2V61 A;  1Y56 A;  2EQ8 A;  2XLP A;  2V60 A;  5J7X A;  1TDE A;  1D7L A;  3NGC X;  1NHQ A;  4K8D A;  3K30 A;  4II2 A;  3OZ2 A;  1GRF A;  2B7R A;  5HHF A;  3AXB A;  3GRS A;  4GAP A;  2GF3 A;  3URH A;  1DOC A;  2WEU A;  3GRT A;  4O5Q A;  4OPD A;  4U8L A;  1KSU A;  1GER A;  1YQ4 A;  4RSL A;  1JU2 A;  2C4C A;  2BCG G;  2X50 A;  3UTH A;  2JB1 A;  1CC2 A;  2A8X A;  3ISH A;  3AEG A;  3UTE A;  1Q1R A;  2GR0 A;  5KMS A;  2XLU A;  3EPT A;  5U25 A;  1OJ9 A;  1PBF A;  5KRQ A;  3SZC A;  1XHC A;  2YQU A;  3JSK A;  1CC6 A;  1E1N A;  1L9D A;  4Y4N A;  2Z5Y A;  3DK8 A;  3UP4 A;  3SGL A;  2VVM A;  3B6D A;  5HY5 A;  2XFN A;  2EQ7 A;  2EQ6 A;  3AD9 B;  2C73 A;  1GEU A;  4USR A;  3UKA A;  4P9S A;  3F8R A;  2BYB A;  2ZBW A;  5M0Z A;  2APG A;  4CNJ A;  2BA9 A;  2EQ9 A;  2WDV A;  2XFQ A;  3II4 A;  4GAV A;  4NTC A;  4O5U A;  2WPF A;  2YVJ A;  3AEF A;  4A9W A;  4CCR A;  1JNZ A;  2E1M A;  5BRT A;  2CVJ A;  5J60 A;  2B9X A;  5JCM A;  3UKK A;  5KMQ A;  3LAD A;  4Y4M A;  3ICT A;  2FJA A;  3P4P A;  4YT0 A;  3ADA B;  4CBQ A;  1P2E A;  4NNJ A;  3AE9 A;  3SXI A;  1MXT A;  5KMP A;  1YQZ A;  4CCQ A;  2NVK X;  3LXD A;  3VR8 A;  4C3Y A;  4TLX A;  2JB2 A;  2ZZ0 A;  2DKH A;  3ALJ A;  3Q9T A;  1S3B A;  2C67 A;  4BUR A;  5FS7 A;  3T0K A;  3UKQ A;  2XVE A;  4CNK A;  3L1R A;  1TYP A;  3IWA A;  5KVI A;  4WX1 A;  1K0J A;  4A6N A;  2R0C A;  3DJE A;  4M52 A;  5U1O A;  4YXD A;  2F5Z A;  1S2Y A;  4DGK A;  2BK3 A;  2C70 A;  4BV6 A;  3NKS A;  1B37 A;  2AQJ A;  4Z44 A;  3BNM A;  4J2W A;  1JRZ A;  1K0L A;  1W4X A;  5KXJ A;  2CUL A;  1GRE A;  4H4Z A;  1ZOY A;  5L46 A;  3GWD A;  1LQU A;  2BXR A;  4AP3 A;  4Y4L A;  2A87 A;  1ELI A;  1KF6 A;  2JBV A;  3GWF A;  1BKW A;  4B67 A;  3PVC A;  3FMW A;  1ZMD A;  3DJJ A;  4OPG A;  4H4W A;  3AEE A;  1PS9 A;  4C3X A;  1Y0P A;  4IVM B;  4U8K A;  5IQ1 A;  3UKL A;  1VQW A;  2W0H A;  4J56 A;  4TM4 A;  5C2T A;  4U8N A;  3VRB A;  4H4U A;  2C65 A;  3RNM A;  1E6E A;  2WQY A;  4EM3 A;  2WU2 A;  1GRA A;  4II3 A;  1DXL A;  3BI5 A;  3DH9 A;  4GCM A;  3AE5 A;  1H7X A;  2GMJ A;  2YR6 A;  3NIX A;  5JCK A;  1PDH A;  5IPY A;  1N4U A;  5FS6 A;  4Z26 A;  1GET A;  2WP6 A;  1EL5 A;  1PBD A;  4EQR A;  4YKG A;  1LVL A;  1O5W A;  2IID A;  2VRM A;  4JDR A;  1GAL A;  1E39 A;  2GV8 A;  3ABV A;  3O0H A;  3M0O A;  4LU6 A;  1BGJ A;  2E4G A;  3G5R A;  2WBA A;  4D04 A;  4B66 A;  3SZ0 A;  3VQR A;  2BK4 A;  3T31 A;  2X8H A;  3NG7 X;  2A89 A;  3F8P A;  3KA7 A;  2GMH A;  1KDG A;  3CPJ G;  3QFB A;  5C3J A;  1ZMC A;  2WDR A;  4EMJ A;  4ECH A;  3AYL A;  1OJD A;  2C7G A;  2H88 A;  3PS9 A;  2XCG A;  3GDN A;  4A7A A;  2ARD A;  3C96 A;  2R9Z A;  3IC9 A;  4H4S A;  3AEC A;  3UP5 A;  3ALM A;  3S61 A;  4H2P A;  5M10 A;  1NEN A;  1O94 A;  2ZZC A;  1N1P A;  1JRX A;  2QA1 A;  1PJ7 A;  3UOY A;  3GMB A;  2QAE A;  3G5S A;  3NTA A;  4JN9 A;  4EM4 A;  3ICR A;  2C72 A;  1BF3 A;  4PAA A;  3T2Y A;  1E1L A;  1GOS A;  1CJ4 A;  2BK5 A;  3COX A;  2GB0 A;  4H4V A;  2NPX A;  1TDF A;  3GD3 A;  3K7Q X;  1IUS A;  2C3C A;  3EAN A;  3P4S A;  4X4J A;  3P1W A;  1S3E A;  2R0P A;  3EF6 A;  2YLX A;  3KPF A;  1E7P A;  1PXC A;  2RGH A;  4B1B A;  2WES A;  1FEA A;  1JOA A;  4AT2 A;  1LQT A;  2FJD A;  2BAC A;  2VQ7 A;  2WOV A;  2WOI A;  4I58 A;  1V59 A;  4OCG A;  3AD8 B;  2RGJ A;  2FBW A;  2YG5 A;  4Z43 A;  4G6H A;  5FMH A;  2V3A A;  4G6G A;  1BGN A;  1K4Q A;  1TDK A;  4H2N A;  1TDO A;  1RYI A;  2B9Y A;  4NZH A;  4YSZ A;  4LA1 A;  4UDP A;  3CGB A;  4UDQ A;  3HYV A;  2GVC A;  4DSH A;  2WP5 A;  3D8X A;  2YLS A;  3NH3 X;  1MOK A;  2JB3 A;  1D7Y A;  2YVF A;  4FK1 A;  5KOX A;  2H89 A;  1UKV G;  2XVJ A;  1QLB A;  1PBB A;  1LJ1 A;  5FS9 A;  1L0V A;  1H6V A;  1ZP0 A;  4CY6 A;  2XFU A;  4ZCC A;  3UTF A;  3P4R A;  4H4T A;  1EL7 A;  2VZ2 A;  3V3N A;  1IUT A;  3H8I A;  3Q6J A;  2C75 A;  1EL9 A;  2E5V A;  2R46 A;  2YVG A;  3FBS A;  4BK3 A;  3FIM B;  1DJQ A;  3KKJ A;  3AB1 A;  3AYJ A;  3HYX A;  1TRB A;  5JCN A;  3M12 A;  4J36 A;  2XLS A;  2GAG B;  4YSX A;  1PN0 A;  3ICS A;  4WCT A;  3SFD A;  3SFE A;  2BXS A;  3AED A;  1H83 A;  4H2R A;  3QFA A;  4AT0 A;  4K5S A;  1EBD A;  4KX6 A;  1IUW A;  1OJA A;  2B7S A;  1H81 A;  2C66 A;  2WP9 A;  2XVF A;  1NDA A;  4YSH A;  3LJP A;  3LOV A;  3F8D A;  5FS8 A;  4NTD A;  3DJG X;  1RSG A;  4EIP A;  4NTE A;  1B8S A;  1NEK A;  4LII A;  3ITJ A;  1JRY A;  3NTD A;  3DGZ A;  4H2Q A;  1JNR A;  1GT8 A;  4U8J A;  4U2L A;  5EOW A;  5KWF A;  1CJC A;  1X31 B;  2AR8 A;  4IA6 A;  3RP8 A;  3AE3 A;  1PBE A;  2QCU A;  1QO8 A;  1F3P A;  4I59 A;  4N9X A;  4OVI A;  2CDU A;  4U8M A;  1BWC A;  5KOW A;  2YR5 A;  3FPZ A;  4EQX A;  1VG0 A;  4H4R A;  1ZOV A;  4H4Q A;  2BS4 A;  3AEA A;  2WDQ A;  3CGD A;  3M13 A;  4CRT A;  4BJY A;  1K0I A;  1D4C A;  3FG2 P;  3QSE A;  1BZL A;  3EAO A;  4TM1 A;  1SEZ A;  3ATQ A;  2WOW A;  4H7U A;  4B68 A;  1YY5 A;  4U2S A;  2ZZB A;  2X8G A;  1VG9 A;  1ZKQ A;  1B5Q A;  2VRL A;  1Z6L A;  2XVI A;  2C3D A;  2R0G A;  4U8I A;  1MO9 A;  4E0V A;  3KLJ A;  1DOE A;  3NK1 X;  3NYF A;  3UKF A;  1GV4 A;  3DK9 A;  3NNE A;  3QVR A;  4U8P A;  5EB4 A;  3G5Q A;  3QVP A;  3KU9 A;  4MJW A;  2ACZ A;  3AE8 A;  2VOU A;  3AWI A;  3BHK A;  3GYJ A;  4K2X A;  3VR9 A;  1NPX A;  1H82 A;  2BC0 A;  3GD4 A;  4IA5 A;  1GTE A;  1XPQ A;  3UCL A;  1P2H A;  3UOX A;  1GSN A;  1NHS A;  3SYI A;  4H50 A;  2OA1 A;  2YLR A;  3BHF A;  2YR4 A;  2V6O A;  3UTG A;  2GH5 A;  4XWZ A;  4AOX A;  5LV9 A;  2AAQ A;  1S2Q A;  4NWZ A;  3HYW A;  2WET A;  1GRB A;  1D4E A;  1O95 A;  2BAB A;  1KNR A;  4GRT A;  1KFY A;  2WPE A;  3CTY A;  1PBC A;  1CBO A;  4HB9 A;  4OPU A;  3GYI A;  4H4X A;  1IUV A;  3OC4 A;  2GR3 A;  1RP0 A;  1ZDL A;  4J57 A;  1COY A;  4H4Y A;  1PHH A;  3NYC A;  4XWR A;  3CGE A;  1F8R A;  1H84 A;  2X8C A;  2HQM A;  1KNP A;  1Q1W A;  1PJ6 A;  3CNT A;  4TM0 A;  1Y56 B;  1CL0 A;  4EQW A;  1LPF A;  4J33 A;  3GYX A;  4EMW A;  1GRT A;  3SQP A;  3CN8 A;  2BS2 A;  4GUV A;  3AE6 A;  4JY3 A;  4AOS A;  3K7M X;  4GF7 A;  2C64 A;  3P4Q A;  1XDI A;  3C4A A;  4EIQ A;  1H86 A;  2B9W A;  2YWL A;  3NN0 X;  2WPC A;  2Y6Q A;  1ZY8 A;  1CC4 A;  4USQ A;  2Q0L A;  2VVL G;  3DGH A;  3DK4 A;  3DME A;  4Z2T A;  2GR2 A;  4Z24 A;  3SZF A;  2XDO A;  2I0Z A;  2XLR A;  4UP3 A;  4FDC B;  2FJE A;  2JAE A;  3UOZ A;  2GEW A;  3IF9 A;  4OPL A;  4RG3 A;  2BS3 A;  2WHD A;  2Q0K A;  2PHH A;  4A99 A;  1D4D A;  4CY8 A;  5HYM A;  1CHU A;  1CF3 A;  2Z5X A;  4JQ9 A;  4Z25 A;  1TDN A;  3QSS A;  2OLO A;  5KMR A;  4G73 A;  2YG3 A;  4ZCD A;  4A5L A;  3RHA A;  4DSG A;  3I3L A;  2GR1 A;  2B76 A;  3UKH A;  4Z2R A;  3SX6 A;  5TR3 A;  4B64 A;  4UDR A;  5KVH A;  4JNA A;  4K7Z A;  1NG4 A;  1B4V A;  3LB8 A;  3CPI G;  1ZX9 A;  1FCD A;  2YG4 A;  4U2T A;  4U8O A;  5HXI A;  4K5R A;  3CNS A;  2GRT A;  4GR1 A;  4YKF A;  1F8W A;  1GRH A;  2VVL A;  3IHG A;  4A79 A;  4BK2 A;  1F6M A;  4GDE A;  1Q9I A;  2C76 A;  2TPR A;  1L9E A;  2V3B A;  1EL8 A;  2XLT A;  2O9Z A;  3DA1 A;  1GES A;  3LZX A;  2Y6R A;  1NAA A;  1IUX A;  3GMC A;  2YM2 A;  3AE4 A;  3GDP A;  3V3O A;  3VRD B;  1FEC A;  3GSI A;  3VRA A;  2X3N A;  1GXF A;  4A6N B;  4B65 A;  2WS3 A;  3NHO X;  2R45 A;  2YLW A;  1NG3 A;  3CMM A;  2TMD A;  1IUU A;  4REK A;  4G9K A;  4TM3 A;  3K7T A;  1DOD A;  3NN6 X;  3RED A;  3SM8 A;  2FJB A;  3P9U A;  3NK2 X;  4YTP A;  4J34 A;  5U63 A;  2QA2 A;  2GAH B;  4IVO B;  4RG4 A;  3CNJ A;  3B3R A;  1GTH A;  1GND A;  3UOV A;  2YG7 A;  1PJ5 A;  4OPT A;  4B63 A;  1N4W A;  5CQF A;  3QSM A;  3D1C A;  3IHM A;  2YLT A;  1D5T A;  3SY4 A;  4YTN A;  1AOG A;  2Q7V A;  4YWO A;  1DNC A;  1M64 A;  1QJD A;  4J31 A;  3AE1 A;  4NEW A;  2JKC A;  1REO A;  1YQ3 A;  3AD7 B;  4H4P A;  1GRG A;  1TYT A;  2VQB A;  3NT6 A;  4C77 A;  4NEV A;  4DNA A;  1VDC A;  1PXB A;  4X9M A;  4YTM A;  4A65 A;  3ALL A;  3T37 A;  4BJZ A;  2XYO A;  3SZW A;  5JCL A;  1FEB A;  1NHP A;  5EB5 A;  1E1M A;  3UKP A;  2WU5 A;  1F8S A; 
#chains in the Genus database with same CATH homology
 2CFY A;  1LTX R;  1H7W A;  2RAB A;  4YSY A;  1CJ2 A;  3KVE A;  2GQF A;  1PXA A;  1DJN A;  3BI2 A;  3C4N A;  2BRA A;  4C5O A;  2BRY A;  3BNU A;  4BK1 A;  1FOH A;  4FX9 A;  1XAN A;  3AYI A;  3CPH G;  5BUL A;  4B69 A;  4JY2 A;  4OPI A;  5ER0 A;  3NYE A;  4ADW A;  1NHR A;  4K22 A;  3T2Z A;  4APN A;  3ZYX A;  2OAL A;  3H8L A;  1VRQ B;  1ONF A;  3DJD A;  5JCI A;  1KSS A;  3NRN A;  3H4K A;  2IVE A;  4X9N A;  1E1K A;  1N4V A;  2BCP A;  1HYU A;  2OLN A;  4EMI A;  5IQ4 A;  2Q6U A;  2YAU A;  1DOB A;  2R4E A;  1OJT A;  3KD9 A;  3L8K A;  4OPC A;  1OJC A;  2YLZ A;  2IVD A;  3WE0 A;  1CJ3 A;  3ZDN A;  3NLC A;  2RGO A;  2YG6 A;  1L9C A;  5GSN A;  2V5Z A;  4C74 A;  3CND A;  3LZW A;  4KPR A;  1M6I A;  2JK6 A;  4JNQ A;  2XVH A;  3T14 A;  3T2K A;  4EQS A;  4Z2U A;  2XFP A;  4ZN0 A;  5BVA A;  3R9U A;  1LV0 A;  4D03 A;  4PAB A;  4G74 A;  3NK0 X;  4XXG A;  5BUK A;  1FL2 A;  1IJH A;  4GDP A;  3E1T A;  2OAM A;  2PYX A;  3S5W A;  3KPK A;  2J3N A;  2YM1 A;  3AE2 A;  3HZL A;  1YKJ A;  2UZZ A;  4ICY A;  3RP6 A;  3RP7 A;  4AP1 A;  5KNL A;  3PO7 A;  4TLZ A;  3AEB A;  2BC1 A;  4IV9 A;  5GRT A;  3QJ4 A;  3V76 A;  5EBK A;  3CGC A;  1JEH A;  1GPE A;  3BI4 A;  3CIR A;  5DBJ A;  2X99 A;  2DKI A;  5CKU A;  2R4J A;  3CNP A;  3I6D A;  3ATR A;  1ZK7 A;  2XFO A;  3AE7 A;  4FK1 C;  2GQW A;  4HA6 A;  2V61 A;  1Y56 A;  2EQ8 A;  2XLP A;  2V60 A;  5J7X A;  1TDE A;  1D7L A;  3NGC X;  1NHQ A;  4K8D A;  3K30 A;  4II2 A;  3OZ2 A;  1GRF A;  2B7R A;  5HHF A;  3AXB A;  3GRS A;  4GAP A;  2GF3 A;  3URH A;  1DOC A;  2WEU A;  3GRT A;  4O5Q A;  4OPD A;  4U8L A;  1KSU A;  1GER A;  1YQ4 A;  4RSL A;  1JU2 A;  2C4C A;  2BCG G;  2X50 A;  3UTH A;  2JB1 A;  1CC2 A;  2A8X A;  3ISH A;  3AEG A;  3UTE A;  1Q1R A;  2GR0 A;  5KMS A;  2XLU A;  3EPT A;  5U25 A;  1OJ9 A;  1PBF A;  5KRQ A;  3SZC A;  1XHC A;  2YQU A;  3JSK A;  1CC6 A;  1E1N A;  1L9D A;  4Y4N A;  2Z5Y A;  3DK8 A;  3UP4 A;  3SGL A;  2VVM A;  3B6D A;  5HY5 A;  2XFN A;  2EQ7 A;  2EQ6 A;  3AD9 B;  2C73 A;  1GEU A;  4USR A;  3UKA A;  4P9S A;  3F8R A;  2BYB A;  2ZBW A;  5M0Z A;  2APG A;  4CNJ A;  2BA9 A;  2EQ9 A;  2WDV A;  2XFQ A;  3II4 A;  4GAV A;  4NTC A;  4O5U A;  2WPF A;  2YVJ A;  3AEF A;  4A9W A;  4CCR A;  1JNZ A;  2E1M A;  5BRT A;  2CVJ A;  5J60 A;  2B9X A;  5JCM A;  3UKK A;  5KMQ A;  3LAD A;  4Y4M A;  3ICT A;  2FJA A;  3P4P A;  4YT0 A;  3ADA B;  4CBQ A;  1P2E A;  4NNJ A;  3AE9 A;  3SXI A;  1MXT A;  5KMP A;  1YQZ A;  4CCQ A;  2NVK X;  3LXD A;  3VR8 A;  4C3Y A;  4TLX A;  2JB2 A;  2ZZ0 A;  2DKH A;  3ALJ A;  3Q9T A;  1S3B A;  2C67 A;  4BUR A;  5FS7 A;  3T0K A;  3UKQ A;  2XVE A;  4CNK A;  3L1R A;  1TYP A;  3IWA A;  5KVI A;  4WX1 A;  1K0J A;  4A6N A;  2R0C A;  3DJE A;  4M52 A;  5U1O A;  4YXD A;  2F5Z A;  1S2Y A;  4DGK A;  2BK3 A;  2C70 A;  4BV6 A;  3NKS A;  1B37 A;  2AQJ A;  4Z44 A;  3BNM A;  4J2W A;  1JRZ A;  1K0L A;  1W4X A;  5KXJ A;  2CUL A;  1GRE A;  4H4Z A;  1ZOY A;  5L46 A;  3GWD A;  1LQU A;  2BXR A;  4AP3 A;  4Y4L A;  2A87 A;  1ELI A;  1KF6 A;  2JBV A;  3GWF A;  1BKW A;  4B67 A;  3PVC A;  3FMW A;  1ZMD A;  3DJJ A;  4OPG A;  4H4W A;  3AEE A;  1PS9 A;  4C3X A;  1Y0P A;  4IVM B;  4U8K A;  5IQ1 A;  3UKL A;  1VQW A;  2W0H A;  4J56 A;  4TM4 A;  5C2T A;  4U8N A;  3VRB A;  4H4U A;  2C65 A;  3RNM A;  1E6E A;  2WQY A;  4EM3 A;  2WU2 A;  1GRA A;  4II3 A;  1DXL A;  3BI5 A;  3DH9 A;  4GCM A;  3AE5 A;  1H7X A;  2GMJ A;  2YR6 A;  3NIX A;  5JCK A;  1PDH A;  5IPY A;  1N4U A;  5FS6 A;  4Z26 A;  1GET A;  2WP6 A;  1EL5 A;  1PBD A;  4EQR A;  4YKG A;  1LVL A;  1O5W A;  2IID A;  2VRM A;  4JDR A;  1GAL A;  1E39 A;  2GV8 A;  3ABV A;  3O0H A;  3M0O A;  4LU6 A;  1BGJ A;  2E4G A;  3G5R A;  2WBA A;  4D04 A;  4B66 A;  3SZ0 A;  3VQR A;  2BK4 A;  3T31 A;  2X8H A;  3NG7 X;  2A89 A;  3F8P A;  3KA7 A;  2GMH A;  1KDG A;  3CPJ G;  3QFB A;  5C3J A;  1ZMC A;  2WDR A;  4EMJ A;  4ECH A;  3AYL A;  1OJD A;  2C7G A;  2H88 A;  3PS9 A;  2XCG A;  3GDN A;  4A7A A;  2ARD A;  3C96 A;  2R9Z A;  3IC9 A;  4H4S A;  3AEC A;  3UP5 A;  3ALM A;  3S61 A;  4H2P A;  5M10 A;  1NEN A;  1O94 A;  2ZZC A;  1N1P A;  1JRX A;  2QA1 A;  1PJ7 A;  3UOY A;  3GMB A;  2QAE A;  3G5S A;  3NTA A;  4JN9 A;  4EM4 A;  3ICR A;  2C72 A;  1BF3 A;  4PAA A;  3T2Y A;  1E1L A;  1GOS A;  1CJ4 A;  2BK5 A;  3COX A;  2GB0 A;  4H4V A;  2NPX A;  1TDF A;  3GD3 A;  3K7Q X;  1IUS A;  2C3C A;  3EAN A;  3P4S A;  4X4J A;  3P1W A;  1S3E A;  2R0P A;  3EF6 A;  2YLX A;  3KPF A;  1E7P A;  1PXC A;  2RGH A;  4B1B A;  2WES A;  1FEA A;  1JOA A;  4AT2 A;  1LQT A;  2FJD A;  2BAC A;  2VQ7 A;  2WOV A;  2WOI A;  4I58 A;  1V59 A;  4OCG A;  3AD8 B;  2RGJ A;  2FBW A;  2YG5 A;  4Z43 A;  4G6H A;  5FMH A;  2V3A A;  4G6G A;  1BGN A;  1K4Q A;  1TDK A;  4H2N A;  1TDO A;  1RYI A;  2B9Y A;  4NZH A;  4YSZ A;  4LA1 A;  4UDP A;  3CGB A;  4UDQ A;  3HYV A;  2GVC A;  4DSH A;  2WP5 A;  3D8X A;  2YLS A;  3NH3 X;  1MOK A;  2JB3 A;  1D7Y A;  2YVF A;  4FK1 A;  5KOX A;  2H89 A;  1UKV G;  2XVJ A;  1QLB A;  1PBB A;  1LJ1 A;  5FS9 A;  1L0V A;  1H6V A;  1ZP0 A;  4CY6 A;  2XFU A;  4ZCC A;  3UTF A;  3P4R A;  4H4T A;  1EL7 A;  2VZ2 A;  3V3N A;  1IUT A;  3H8I A;  3Q6J A;  2C75 A;  1EL9 A;  2E5V A;  2R46 A;  2YVG A;  3FBS A;  4BK3 A;  3FIM B;  1DJQ A;  3KKJ A;  3AB1 A;  3AYJ A;  3HYX A;  1TRB A;  5JCN A;  3M12 A;  4J36 A;  2XLS A;  2GAG B;  4YSX A;  1PN0 A;  3ICS A;  4WCT A;  3SFD A;  3SFE A;  2BXS A;  3AED A;  1H83 A;  4H2R A;  3QFA A;  4AT0 A;  4K5S A;  1EBD A;  4KX6 A;  1IUW A;  1OJA A;  2B7S A;  1H81 A;  2C66 A;  2WP9 A;  2XVF A;  1NDA A;  4YSH A;  3LJP A;  3LOV A;  3F8D A;  5FS8 A;  4NTD A;  3DJG X;  1RSG A;  4EIP A;  4NTE A;  1B8S A;  1NEK A;  4LII A;  3ITJ A;  1JRY A;  3NTD A;  3DGZ A;  4H2Q A;  1JNR A;  1GT8 A;  4U8J A;  4U2L A;  5EOW A;  5KWF A;  1CJC A;  1X31 B;  2AR8 A;  4IA6 A;  3RP8 A;  3AE3 A;  1PBE A;  2QCU A;  1QO8 A;  1F3P A;  4I59 A;  4N9X A;  4OVI A;  2CDU A;  4U8M A;  1BWC A;  5KOW A;  2YR5 A;  3FPZ A;  4EQX A;  1VG0 A;  4H4R A;  1ZOV A;  4H4Q A;  2BS4 A;  3AEA A;  2WDQ A;  3CGD A;  3M13 A;  4CRT A;  4BJY A;  1K0I A;  1D4C A;  3FG2 P;  3QSE A;  1BZL A;  3EAO A;  4TM1 A;  1SEZ A;  3ATQ A;  2WOW A;  4H7U A;  4B68 A;  1YY5 A;  4U2S A;  2ZZB A;  2X8G A;  1VG9 A;  1ZKQ A;  1B5Q A;  2VRL A;  1Z6L A;  2XVI A;  2C3D A;  2R0G A;  4U8I A;  1MO9 A;  4E0V A;  3KLJ A;  1DOE A;  3NK1 X;  3NYF A;  3UKF A;  1GV4 A;  3DK9 A;  3NNE A;  3QVR A;  4U8P A;  5EB4 A;  3G5Q A;  3QVP A;  3KU9 A;  4MJW A;  2ACZ A;  3AE8 A;  2VOU A;  3AWI A;  3BHK A;  3GYJ A;  4K2X A;  3VR9 A;  1NPX A;  1H82 A;  2BC0 A;  3GD4 A;  4IA5 A;  1GTE A;  1XPQ A;  3UCL A;  1P2H A;  3UOX A;  1GSN A;  1NHS A;  3SYI A;  4H50 A;  2OA1 A;  2YLR A;  3BHF A;  2YR4 A;  2V6O A;  3UTG A;  2GH5 A;  4XWZ A;  4AOX A;  5LV9 A;  2AAQ A;  1S2Q A;  4NWZ A;  3HYW A;  2WET A;  1GRB A;  1D4E A;  1O95 A;  2BAB A;  1KNR A;  4GRT A;  1KFY A;  2WPE A;  3CTY A;  1PBC A;  1CBO A;  4HB9 A;  4OPU A;  3GYI A;  4H4X A;  1IUV A;  3OC4 A;  2GR3 A;  1RP0 A;  1ZDL A;  4J57 A;  1COY A;  4H4Y A;  1PHH A;  3NYC A;  4XWR A;  3CGE A;  1F8R A;  1H84 A;  2X8C A;  2HQM A;  1KNP A;  1Q1W A;  1PJ6 A;  3CNT A;  4TM0 A;  1Y56 B;  1CL0 A;  4EQW A;  1LPF A;  4J33 A;  3GYX A;  4EMW A;  1GRT A;  3SQP A;  3CN8 A;  2BS2 A;  4GUV A;  3AE6 A;  4JY3 A;  4AOS A;  3K7M X;  4GF7 A;  2C64 A;  3P4Q A;  1XDI A;  3C4A A;  4EIQ A;  1H86 A;  2B9W A;  2YWL A;  3NN0 X;  2WPC A;  2Y6Q A;  1ZY8 A;  1CC4 A;  4USQ A;  2Q0L A;  2VVL G;  3DGH A;  3DK4 A;  3DME A;  4Z2T A;  2GR2 A;  4Z24 A;  3SZF A;  2XDO A;  2I0Z A;  2XLR A;  4UP3 A;  4FDC B;  2FJE A;  2JAE A;  3UOZ A;  2GEW A;  3IF9 A;  4OPL A;  4RG3 A;  2BS3 A;  2WHD A;  2Q0K A;  2PHH A;  4A99 A;  1D4D A;  4CY8 A;  5HYM A;  1CHU A;  1CF3 A;  2Z5X A;  4JQ9 A;  4Z25 A;  1TDN A;  3QSS A;  2OLO A;  5KMR A;  4G73 A;  2YG3 A;  4ZCD A;  4A5L A;  3RHA A;  4DSG A;  3I3L A;  2GR1 A;  2B76 A;  3UKH A;  4Z2R A;  3SX6 A;  5TR3 A;  4B64 A;  4UDR A;  5KVH A;  4JNA A;  4K7Z A;  1NG4 A;  1B4V A;  3LB8 A;  3CPI G;  1ZX9 A;  1FCD A;  2YG4 A;  4U2T A;  4U8O A;  5HXI A;  4K5R A;  3CNS A;  2GRT A;  4GR1 A;  4YKF A;  1F8W A;  1GRH A;  2VVL A;  3IHG A;  4A79 A;  4BK2 A;  1F6M A;  4GDE A;  1Q9I A;  2C76 A;  2TPR A;  1L9E A;  2V3B A;  1EL8 A;  2XLT A;  2O9Z A;  3DA1 A;  1GES A;  3LZX A;  2Y6R A;  1NAA A;  1IUX A;  3GMC A;  2YM2 A;  3AE4 A;  3GDP A;  3V3O A;  3VRD B;  1FEC A;  3GSI A;  3VRA A;  2X3N A;  1GXF A;  4A6N B;  4B65 A;  2WS3 A;  3NHO X;  2R45 A;  2YLW A;  1NG3 A;  3CMM A;  2TMD A;  1IUU A;  4REK A;  4G9K A;  4TM3 A;  3K7T A;  1DOD A;  3NN6 X;  3RED A;  3SM8 A;  2FJB A;  3P9U A;  3NK2 X;  4YTP A;  4J34 A;  5U63 A;  2QA2 A;  2GAH B;  4IVO B;  4RG4 A;  3CNJ A;  3B3R A;  1GTH A;  1GND A;  3UOV A;  2YG7 A;  1PJ5 A;  4OPT A;  4B63 A;  1N4W A;  5CQF A;  3QSM A;  3D1C A;  3IHM A;  2YLT A;  1D5T A;  3SY4 A;  4YTN A;  1AOG A;  2Q7V A;  4YWO A;  1DNC A;  1M64 A;  1QJD A;  4J31 A;  3AE1 A;  4NEW A;  2JKC A;  1REO A;  1YQ3 A;  3AD7 B;  4H4P A;  1GRG A;  1TYT A;  2VQB A;  3NT6 A;  4C77 A;  4NEV A;  4DNA A;  1VDC A;  1PXB A;  4X9M A;  4YTM A;  4A65 A;  3ALL A;  3T37 A;  4BJZ A;  2XYO A;  3SZW A;  5JCL A;  1FEB A;  1NHP A;  5EB5 A;  1E1M A;  3UKP A;  2WU5 A;  1F8S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...