4G6HA

Crystal structure of ndh with nadh
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
472
structure length
472
Chain Sequence
TMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 164
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g6hA00
5KMRA 4G6HA 3SZCA 3SZWA 3SZFA 3T2KA 3KPKA 4G9KA 3T31A 3T2YA 4GAPA 3SX6A 3T2ZA 3HYXA 4G6GA 3HYWA 4G74A 4NWZA 5KMPA 5KMSA 3SZ0A 3SYIA 3T14A 3SXIA 4GAVA 3SY4A 5KMQA 3HYVA 4G73A 3T0KA
chains in the Genus database with same CATH superfamily
2QA2A 4J57A 3C96A 2H88A 1GNDA 3BI4A 2GAGB 3UTFA 3CNPA 5EB5A 2EQ8A 1XHCA 5KVIA 1F8RA 4EMJA 4ZCDA 2CULA 1GRHA 4UDRA 2OAMA 4G6GA 4ADWA 1PBDA 3UKQA 3UOXA 4H4QA 2XVIA 2RGJA 1MXTA 3KU9A 4A99A 1DJNA 1O94A 2YLTA 2V5ZA 2IIDA 2TPRA 4NZHA 4U8PA 4CY8A 4A9WA 3LADA 2WEUA 1H83A 1TDKA 4Z44A 5M0ZA 1VQWA 3NT6A 4I59A 3HYVA 4APNA 1RP0A 2WOWA 5FS9A 3DGHA 4Z24A 3VR9A 1DODA 2GMHA 2VRMA 1GERA 1IUVA 3UKKA 1NPXA 2R0GA 1REOA 2B7RA 1VRQB 4G6HA 3QVRA 1IJHA 3SZCA 1Z6LA 3PS9A 5EB4A 4NTDA 3UKFA 1NG4A 4NTEA 3ICTA 2C3DA 3QFBA 1PBFA 2E5VA 4H2RA 4G9KA 4P9SA 4TM3A 2E1MA 4YKGA 1IUXA 1CC4A 4OPCA 3HYWA 2BXRA 2OLNA 1OJCA 4YSZA 1ZMDA 4AOSA 1PBCA 3CNSA 2JB2A 4H4VA 3FPZA 3P9UA 4Y4NA 4Z25A 3CGBA 1RSGA 2WPFA 2Q0KA 2AR8A 3CNTA 1DOEA 3ICSA 3ITJA 2OA1A 4JY3A 3HZLA 3GWDA 3FG2P 4U2TA 4EMIA 2GV8A 4J33A 3ABVA 1CBOA 2YR4A 1H6VA 1CC2A 3H8LA 1F8WA 3URHA 3CPJG 3NYEA 4X9NA 1KFYA 2C70A 1GRGA 2ZZ0A 2WDVA 3UKHA 3SX6A 3UP5A 3K7QX 2YG3A 4GDEA 1TRBA 5JCKA 4EQRA 1OJ9A 4U8LA 2Z5YA 3DA1A 3VRAA 1QO8A 1KSUA 4PABA 5IQ1A 3M13A 3F8RA 5KOXA 5L46A 2BC1A 2DKIA 2QCUA 3ZDNA 3GRSA 4CCRA 3I3LA 4LIIA 2WDQA 4B67A 2GQFA 3RHAA 3BHFA 4C77A 4DNAA 1LVLA 1VDCA 3P4SA 3LB8A 2FJEA 1S3BA 4REKA 4UDPA 1JRYA 5KMRA 1PJ6A 3DJJA 1H7WA 3D8XA 2YLRA 1K0JA 1NHPA 2BCPA 2JAEA 2XLTA 2JB3A 3T2YA 2X3NA 4OPDA 3QSSA 2PYXA 3GWFA 2E4GA 4U8KA 3PO7A 4CY6A 2RGOA 3AB1A 3L1RA 4LU6A 4J31A 3K7TA 3SQPA 2FJBA 1DOBA 2WOVA 3EAOA 3UOYA 4ECHA 4Y4LA 3AE8A 1COYA 4B66A 5KWFA 4C74A 1PXAA 4U2LA 5KMQA 4GCMA 2ARDA 4NTCA 1VG0A 2A89A 4Z2UA 3CN8A 2GRTA 1JOAA 3QJ4A 3DJEA 3AE9A 3D1CA 1FEAA 4B65A 2XLPA 5IQ4A 1UKVG 4H2PA 1GOSA 1Y0PA 2QA1A 1OJAA 3JSKA 2Z5XA 4X9MA 4H4WA 4NEWA 4TLXA 4U2SA 4A65A 1H84A 1H82A 3NN0X 2R9ZA 2YQUA 2X8CA 2AQJA 2X8HA 3LJPA 3LZWA 2VRLA 2YM1A 3CPHG 3SM8A 4YTPA 1GRBA 4FK1A 3DH9A 2YM2A 1PN0A 1BGNA 1YQZA 3NGCX 2BACA 1OJTA 3G5QA 4B63A 4U8JA 1BGJA 2NPXA 1VG9A 2WP9A 1D4DA 1TDFA 3DK9A 4D03A 2XVJA 3GDNA 4BJYA 2HQMA 2WOIA 2YVFA 5KNLA 1CHUA 3GDPA 4GR1A 3SZWA 3UOZA 1KNPA 1E7PA 4TM4A 3UKLA 1TYPA 1D7YA 3C4AA 1FL2A 2XFPA 5GSNA 5JCLA 3GRTA 2GR0A 1ZDLA 1ZY8A 3QSMA 5JCNA 2A8XA 2BK4A 5M10A 2R45A 3AE4A 2YG7A 1NAAA 1TYTA 1V59A 2V3BA 2NVKX 4OPTA 1K0IA 3P1WA 1CJ4A 3GD4A 3FBSA 1FEBA 1NDAA 2VVLA 3KPFA 3RP7A 5KMSA 3NK0X 1FOHA 2YR6A 3NTDA 2C72A 4M52A 3RP8A 1L9DA 1E39A 1NHSA 5C3JA 4A7AA 3AYLA 3LXDA 4YTMA 2V60A 1KF6A 4J36A 2IVDA 2FBWA 5BUKA 5JCMA 1ZP0A 3BHKA 3P4PA 4Z26A 3EF6A 2GF3A 3KD9A 2GB0A 3BI5A 2GQWA 1S2YA 2ZZCA 1YKJA 5EBKA 4A5LA 4II3A 3AE2A 3II4A 2YG6A 1GREA 4X4JA 2RABA 3NNEA 3SFDA 3AD7B 2VZ2A 4H4PA 3RNMA 4MJWA 4TLZA 3QFAA 1IUSA 5CQFA 1FECA 3NN6X 4H4RA 4K2XA 4II2A 2EQ9A 4RG4A 4EM3A 2XLUA 1KNRA 2VOUA 3OZ2A 5BVAA 4OVIA 3VRDB 1ZOYA 3NK1X 2Q7VA 4U8IA 4GDPA 1CL0A 1NG3A 2B9WA 1XDIA 1GTEA 3LZXA 4WX1A 2V3AA 3AYJA 4YSXA 4EIPA 1Y56B 2YLXA 1L9CA 2BABA 4JN9A 3UP4A 3NG7X 2I0ZA 3KPKA 2UZZA 4EMWA 1CJCA 1ZMCA 3QVPA 3M0OA 2BXSA 3T2ZA 1EL9A 1PXBA 3ZYXA 4ZN0A 2B76A 4AP3A 4B64A 2BRYA 1CC6A 4CCQA 5J7XA 2VVLG 4BV6A 3ISHA 2V61A 3AEAA 2ZZBA 3CNDA 1NHRA 2GEWA 3UTEA 3DMEA 3K30A 3IHMA 3NH3X 5HY5A 3UKPA 3CGDA 3ATQA 3ALLA 2C65A 4TM0A 1L9EA 2BS3A 2VVMA 4XWZA 1IUUA 4H2QA 1FCDA 3B6DA 3T0KA 3EPTA 3G5SA 2GR3A 3VR8A 1N4WA 1TDOA 2C64A 2RGHA 2WU5A 4A79A 5KRQA 2CVJA 1K0LA 2GR1A 4K22A 3H4KA 3OC4A 3T2KA 1OJDA 1F8SA 5U1OA 1N4VA 3O0HA 4AOXA 2R4JA 2Y6RA 1PS9A 4GAPA 4H4TA 4PAAA 3NRNA 4USRA 3UOVA 1GRTA 1CJ2A 2C4CA 3IWAA 3KA7A 2YLZA 3QSEA 4GRTA 3GD3A 5HYMA 5KMPA 2BCGG 3DGZA 3C4NA 5BULA 4GF7A 2CDUA 2YVJA 1GRAA 2O9ZA 4AP1A 1Q1WA 2X50A 4BK2A 2WPEA 1MOKA 1LTXR 1NHQA 4BK1A 2AAQA 4DSHA 1D5TA 1XANA 2WHDA 3CGCA 2FJAA 2XCGA 3IC9A 2QAEA 4HB9A 4N9XA 4YWOA 3SZFA 4OPIA 1H86A 3AEFA 4H7UA 1JNRA 4YKFA 5HXIA 2IVEA 2C73A 1AOGA 2JBVA 5EOWA 3AECA 4IVOB 1NENA 2YWLA 4RSLA 1ZK7A 1E1KA 4A6NB 3ATRA 2WP6A 4WCTA 3NLCA 3LOVA 3T14A 2BRAA 3NHOX 2EQ7A 1JRXA 1L0VA 2WQYA 2Y6QA 2C76A 5C2TA 3GMBA 4K7ZA 1HYUA 4Z2TA 4H2NA 4H4XA 1B37A 4IV9A 3CMMA 4FX9A 4IA6A 1EBDA 2X8GA 1W4XA 2YVGA 3NYCA 3P4QA 2R0PA 1EL5A 2BK3A 1Y56A 4TM1A 2JK6A 4EQWA 2W0HA 1P2EA 1K4QA 4GUVA 4B1BA 1PXCA 1PJ5A 1BKWA 3E1TA 1GXFA 4NEVA 3CIRA 5FMHA 1LJ1A 1D4CA 1IUTA 5GRTA 4H50A 4LA1A 3F8DA 1S2QA 4G74A 4NWZA 2WETA 3SYIA 3SXIA 3GYJA 4HA6A 3AEDA 1LQUA 3R9UA 2X99A 1GTHA 2GVCA 1X31B 1GSNA 1P2HA 3UKAA 4YSYA 3NYFA 3DJDA 4YT0A 4O5QA 3WE0A 3NIXA 3RP6A 1ZKQA 4JDRA 1F6MA 4H4ZA 4E0VA 1E1LA 2XVHA 4ZCCA 1Q9IA 2BS2A 2B9XA 4U8NA 1YY5A 3AWIA 3T31A 2Q6UA 1GETA 1B5QA 1S3EA 2DKHA 1ELIA 5U63A 1JEHA 3G5RA 3GSIA 4AT2A 3VRBA 1M64A 1GRFA 2XFOA 2XVEA 3NK2X 4CNJA 5HHFA 3IF9A 3UTHA 3Q6JA 3NKSA 5ER0A 1CF3A 3AD8B 3GYXA 2BA9A 3DJGX 4JQ9A 5TR3A 2JKCA 2J3NA 3DK8A 3COXA 3SFEA 1N4UA 3CPIG 1Q1RA 2PHHA 3F8PA 1ZOVA 4G73A 1PHHA 3V76A 4D04A 1E6EA 2OLOA 2WPCA 4H4SA 1QJDA 5FS6A 2WESA 2YG4A 2YG5A 3BNUA 4BK3A 4DGKA 4BJZA 4EQXA 2XDOA 1IUWA 4J2WA 4JNAA 1DNCA 2APGA 2TMDA 2BC0A 2R46A 4I58A 5CKUA 4B69A 4IVMB 5J60A 5JCIA 1GEUA 2OALA 3AE3A 3DK4A 4A6NA 4UP3A 3KVEA 3K7MX 4B68A 2XYOA 2C7GA 3CGEA 2XLSA 3SY4A 1CJ3A 1D7LA 1GV4A 1ONFA 2BS4A 2WU2A 2BYBA 3AE6A 2JB1A 1N1PA 1PJ7A 4OPUA 4Y4MA 1NEKA 3AE1A 4DSGA 4K5SA 1DJQA 4RG3A 2XFNA 4FDCB 3V3OA 2GMJA 1B8SA 2YR5A 4Z43A 1RYIA 1F3PA 3AE5A 3AEEA 4C3YA 1BZLA 1O5WA 3UCLA 4BURA 4YSHA 3M12A 1H7XA 2GH5A 4JY2A 3ICRA 3L8KA 3GMCA 1JRZA 3T37A 3IHGA 4U8OA 3Q9TA 4C5OA 5KOWA 3SZ0A 1DXLA 5FS7A 2C67A 1KSSA 4H4YA 5DBJA 1BF3A 3I6DA 4OPLA 3P4RA 2FJDA 3H8IA 5BRTA 2VQBA 1GPEA 3AEGA 1PBBA 3UTGA 4AT0A 1B4VA 3FMWA 1TDNA 2F5ZA 2C66A 4KX6A 2H89A 3REDA 3FIMB 1KDGA 2B7SA 3SGLA 2XFUA 2A87A 3GYIA 2XFQA 3KLJA 4ICYA 4FK1C 1LQTA 3PVCA 4NNJA 2YLWA 5U25A 4EQSA 2ZBWA 1PBEA 2CFYA 4J56A 3AXBA 1QLBA 2WS3A 3B3RA 5IPYA 5FS8A 5LV9A 2WBAA 2YAUA 1GESA 4CRTA 1D4EA 4Z2RA 1ZX9A 1GALA 1SEZA 4IA5A 2VQ7A 1LPFA 4OPGA 4JNQA 3AD9B 1E1MA 1MO9A 4UDQA 3VQRA 3AE7A 1DOCA 4EM4A 2WDRA 1XPQA 3CNJA 4O5UA 4OCGA 2V6OA 2XLRA 3ALMA 1H81A 1E1NA 4CNKA 1YQ4A 1LV0A 4CBQA 2R0CA 3S5WA 4YTNA 3ADAB 4USQA 1O95A 4XWRA 4C3XA 3ALJA 3CTYA 3HYXA 2YLSA 4H4UA 2C3CA 2R4EA 1PDHA 1M6IA 1JNZA 2WP5A 4J34A 2GR2A 3EANA 4K8DA 1YQ3A 1EL8A 2EQ6A 2GAHB 4XXGA 2B9YA 3AEBA 1JU2A 1EL7A 2BK5A 2XVFA 3AYIA 3V3NA 3BI2A 4GAVA 3BNMA 2ACZA 2Q0LA 1TDEA 4YXDA 3KKJA 2C75A 4K5RA 3NTAA 1GT8A 4U8MA 5KXJA 3S61A 4EIQA 5KVHA 4KPRA 1BWCA
chains in the Genus database with same CATH topology
2QA2A 4J57A 3C96A 2H88A 1GNDA 3BI4A 2GAGB 3UTFA 3CNPA 5EB5A 2EQ8A 1XHCA 5KVIA 1F8RA 4EMJA 4ZCDA 2CULA 1GRHA 4UDRA 2OAMA 4G6GA 4ADWA 1PBDA 3UKQA 3UOXA 4H4QA 2XVIA 2RGJA 1MXTA 3KU9A 4A99A 1DJNA 1O94A 2YLTA 2V5ZA 2IIDA 2TPRA 4NZHA 4U8PA 4CY8A 4A9WA 3LADA 2WEUA 1H83A 1TDKA 4Z44A 5M0ZA 1VQWA 3NT6A 4I59A 3HYVA 4APNA 1RP0A 2WOWA 5FS9A 3DGHA 4Z24A 3VR9A 1DODA 2GMHA 2VRMA 1GERA 1IUVA 3UKKA 1NPXA 2R0GA 1REOA 2B7RA 1VRQB 4G6HA 3QVRA 1IJHA 3SZCA 1Z6LA 3PS9A 5EB4A 4NTDA 3UKFA 1NG4A 4NTEA 3ICTA 2C3DA 3QFBA 1PBFA 2E5VA 4H2RA 4G9KA 4P9SA 4TM3A 2E1MA 4YKGA 1IUXA 1CC4A 4OPCA 3HYWA 2BXRA 2OLNA 1OJCA 4YSZA 1ZMDA 4AOSA 1PBCA 3CNSA 2JB2A 4H4VA 3FPZA 3P9UA 4Y4NA 4Z25A 3CGBA 1RSGA 2WPFA 2Q0KA 2AR8A 3CNTA 1DOEA 3ICSA 3ITJA 2OA1A 4JY3A 3HZLA 3GWDA 3FG2P 4U2TA 4EMIA 2GV8A 4J33A 3ABVA 1CBOA 2YR4A 1H6VA 1CC2A 3H8LA 1F8WA 3URHA 3CPJG 3NYEA 4X9NA 1KFYA 2C70A 1GRGA 2ZZ0A 2WDVA 3UKHA 3SX6A 3UP5A 3K7QX 2YG3A 4GDEA 1TRBA 5JCKA 4EQRA 1OJ9A 4U8LA 2Z5YA 3DA1A 3VRAA 1QO8A 1KSUA 4PABA 5IQ1A 3M13A 3F8RA 5KOXA 5L46A 2BC1A 2DKIA 2QCUA 3ZDNA 3GRSA 4CCRA 3I3LA 4LIIA 2WDQA 4B67A 2GQFA 3RHAA 3BHFA 4C77A 4DNAA 1LVLA 1VDCA 3P4SA 3LB8A 2FJEA 1S3BA 4REKA 4UDPA 1JRYA 5KMRA 1PJ6A 3DJJA 1H7WA 3D8XA 2YLRA 1K0JA 1NHPA 2BCPA 2JAEA 2XLTA 2JB3A 3T2YA 2X3NA 4OPDA 3QSSA 2PYXA 3GWFA 2E4GA 4U8KA 3PO7A 4CY6A 2RGOA 3AB1A 3L1RA 4LU6A 4J31A 3K7TA 3SQPA 2FJBA 1DOBA 2WOVA 3EAOA 3UOYA 4ECHA 4Y4LA 3AE8A 1COYA 4B66A 5KWFA 4C74A 1PXAA 4U2LA 5KMQA 4GCMA 2ARDA 4NTCA 1VG0A 2A89A 4Z2UA 3CN8A 2GRTA 1JOAA 3QJ4A 3DJEA 3AE9A 3D1CA 1FEAA 4B65A 2XLPA 5IQ4A 1UKVG 4H2PA 1GOSA 1Y0PA 2QA1A 1OJAA 3JSKA 2Z5XA 4X9MA 4H4WA 4NEWA 4TLXA 4U2SA 4A65A 1H84A 1H82A 3NN0X 2R9ZA 2YQUA 2X8CA 2AQJA 2X8HA 3LJPA 3LZWA 2VRLA 2YM1A 3CPHG 3SM8A 4YTPA 1GRBA 4FK1A 3DH9A 2YM2A 1PN0A 1BGNA 1YQZA 3NGCX 2BACA 1OJTA 3G5QA 4B63A 4U8JA 1BGJA 2NPXA 1VG9A 2WP9A 1D4DA 1TDFA 3DK9A 4D03A 2XVJA 3GDNA 4BJYA 2HQMA 2WOIA 2YVFA 5KNLA 1CHUA 3GDPA 4GR1A 3SZWA 3UOZA 1KNPA 1E7PA 4TM4A 3UKLA 1TYPA 1D7YA 3C4AA 1FL2A 2XFPA 5GSNA 5JCLA 3GRTA 2GR0A 1ZDLA 1ZY8A 3QSMA 5JCNA 2A8XA 2BK4A 5M10A 2R45A 3AE4A 2YG7A 1NAAA 1TYTA 1V59A 2V3BA 2NVKX 4OPTA 1K0IA 3P1WA 1CJ4A 3GD4A 3FBSA 1FEBA 1NDAA 2VVLA 3KPFA 3RP7A 5KMSA 3NK0X 1FOHA 2YR6A 3NTDA 2C72A 4M52A 3RP8A 1L9DA 1E39A 1NHSA 5C3JA 4A7AA 3AYLA 3LXDA 4YTMA 2V60A 1KF6A 4J36A 2IVDA 2FBWA 5BUKA 5JCMA 1ZP0A 3BHKA 3P4PA 4Z26A 3EF6A 2GF3A 3KD9A 2GB0A 3BI5A 2GQWA 1S2YA 2ZZCA 1YKJA 5EBKA 4A5LA 4II3A 3AE2A 3II4A 2YG6A 1GREA 4X4JA 2RABA 3NNEA 3SFDA 3AD7B 2VZ2A 4H4PA 3RNMA 4MJWA 4TLZA 3QFAA 1IUSA 5CQFA 1FECA 3NN6X 4H4RA 4K2XA 4II2A 2EQ9A 4RG4A 4EM3A 2XLUA 1KNRA 2VOUA 3OZ2A 5BVAA 4OVIA 3VRDB 1ZOYA 3NK1X 2Q7VA 4U8IA 4GDPA 1CL0A 1NG3A 2B9WA 1XDIA 1GTEA 3LZXA 4WX1A 2V3AA 3AYJA 4YSXA 4EIPA 1Y56B 2YLXA 1L9CA 2BABA 4JN9A 3UP4A 3NG7X 2I0ZA 3KPKA 2UZZA 4EMWA 1CJCA 1ZMCA 3QVPA 3M0OA 2BXSA 3T2ZA 1EL9A 1PXBA 3ZYXA 4ZN0A 2B76A 4AP3A 4B64A 2BRYA 1CC6A 4CCQA 5J7XA 2VVLG 4BV6A 3ISHA 2V61A 3AEAA 2ZZBA 3CNDA 1NHRA 2GEWA 3UTEA 3DMEA 3K30A 3IHMA 3NH3X 5HY5A 3UKPA 3CGDA 3ATQA 3ALLA 2C65A 4TM0A 1L9EA 2BS3A 2VVMA 4XWZA 1IUUA 4H2QA 1FCDA 3B6DA 3T0KA 3EPTA 3G5SA 2GR3A 3VR8A 1N4WA 1TDOA 2C64A 2RGHA 2WU5A 4A79A 5KRQA 2CVJA 1K0LA 2GR1A 4K22A 3H4KA 3OC4A 3T2KA 1OJDA 1F8SA 5U1OA 1N4VA 3O0HA 4AOXA 2R4JA 2Y6RA 1PS9A 4GAPA 4H4TA 4PAAA 3NRNA 4USRA 3UOVA 1GRTA 1CJ2A 2C4CA 3IWAA 3KA7A 2YLZA 3QSEA 4GRTA 3GD3A 5HYMA 5KMPA 2BCGG 3DGZA 3C4NA 5BULA 4GF7A 2CDUA 2YVJA 1GRAA 2O9ZA 4AP1A 1Q1WA 2X50A 4BK2A 2WPEA 1MOKA 1LTXR 1NHQA 4BK1A 2AAQA 4DSHA 1D5TA 1XANA 2WHDA 3CGCA 2FJAA 2XCGA 3IC9A 2QAEA 4HB9A 4N9XA 4YWOA 3SZFA 4OPIA 1H86A 3AEFA 4H7UA 1JNRA 4YKFA 5HXIA 2IVEA 2C73A 1AOGA 2JBVA 5EOWA 3AECA 4IVOB 1NENA 2YWLA 4RSLA 1ZK7A 1E1KA 4A6NB 3ATRA 2WP6A 4WCTA 3NLCA 3LOVA 3T14A 2BRAA 3NHOX 2EQ7A 1JRXA 1L0VA 2WQYA 2Y6QA 2C76A 5C2TA 3GMBA 4K7ZA 1HYUA 4Z2TA 4H2NA 4H4XA 1B37A 4IV9A 3CMMA 4FX9A 4IA6A 1EBDA 2X8GA 1W4XA 2YVGA 3NYCA 3P4QA 2R0PA 1EL5A 2BK3A 1Y56A 4TM1A 2JK6A 4EQWA 2W0HA 1P2EA 1K4QA 4GUVA 4B1BA 1PXCA 1PJ5A 1BKWA 3E1TA 1GXFA 4NEVA 3CIRA 5FMHA 1LJ1A 1D4CA 1IUTA 5GRTA 4H50A 4LA1A 3F8DA 1S2QA 4G74A 4NWZA 2WETA 3SYIA 3SXIA 3GYJA 4HA6A 3AEDA 1LQUA 3R9UA 2X99A 1GTHA 2GVCA 1X31B 1GSNA 1P2HA 3UKAA 4YSYA 3NYFA 3DJDA 4YT0A 4O5QA 3WE0A 3NIXA 3RP6A 1ZKQA 4JDRA 1F6MA 4H4ZA 4E0VA 1E1LA 2XVHA 4ZCCA 1Q9IA 2BS2A 2B9XA 4U8NA 1YY5A 3AWIA 3T31A 2Q6UA 1GETA 1B5QA 1S3EA 2DKHA 1ELIA 5U63A 1JEHA 3G5RA 3GSIA 4AT2A 3VRBA 1M64A 1GRFA 2XFOA 2XVEA 3NK2X 4CNJA 5HHFA 3IF9A 3UTHA 3Q6JA 3NKSA 5ER0A 1CF3A 3AD8B 3GYXA 2BA9A 3DJGX 4JQ9A 5TR3A 2JKCA 2J3NA 3DK8A 3COXA 3SFEA 1N4UA 3CPIG 1Q1RA 2PHHA 3F8PA 1ZOVA 4G73A 1PHHA 3V76A 4D04A 1E6EA 2OLOA 2WPCA 4H4SA 1QJDA 5FS6A 2WESA 2YG4A 2YG5A 3BNUA 4BK3A 4DGKA 4BJZA 4EQXA 2XDOA 1IUWA 4J2WA 4JNAA 1DNCA 2APGA 2TMDA 2BC0A 2R46A 4I58A 5CKUA 4B69A 4IVMB 5J60A 5JCIA 1GEUA 2OALA 3AE3A 3DK4A 4A6NA 4UP3A 3KVEA 3K7MX 4B68A 2XYOA 2C7GA 3CGEA 2XLSA 3SY4A 1CJ3A 1D7LA 1GV4A 1ONFA 2BS4A 2WU2A 2BYBA 3AE6A 2JB1A 1N1PA 1PJ7A 4OPUA 4Y4MA 1NEKA 3AE1A 4DSGA 4K5SA 1DJQA 4RG3A 2XFNA 4FDCB 3V3OA 2GMJA 1B8SA 2YR5A 4Z43A 1RYIA 1F3PA 3AE5A 3AEEA 4C3YA 1BZLA 1O5WA 3UCLA 4BURA 4YSHA 3M12A 1H7XA 2GH5A 4JY2A 3ICRA 3L8KA 3GMCA 1JRZA 3T37A 3IHGA 4U8OA 3Q9TA 4C5OA 5KOWA 3SZ0A 1DXLA 5FS7A 2C67A 1KSSA 4H4YA 5DBJA 1BF3A 3I6DA 4OPLA 3P4RA 2FJDA 3H8IA 5BRTA 2VQBA 1GPEA 3AEGA 1PBBA 3UTGA 4AT0A 1B4VA 3FMWA 1TDNA 2F5ZA 2C66A 4KX6A 2H89A 3REDA 3FIMB 1KDGA 2B7SA 3SGLA 2XFUA 2A87A 3GYIA 2XFQA 3KLJA 4ICYA 4FK1C 1LQTA 3PVCA 4NNJA 2YLWA 5U25A 4EQSA 2ZBWA 1PBEA 2CFYA 4J56A 3AXBA 1QLBA 2WS3A 3B3RA 5IPYA 5FS8A 5LV9A 2WBAA 2YAUA 1GESA 4CRTA 1D4EA 4Z2RA 1ZX9A 1GALA 1SEZA 4IA5A 2VQ7A 1LPFA 4OPGA 4JNQA 3AD9B 1E1MA 1MO9A 4UDQA 3VQRA 3AE7A 1DOCA 4EM4A 2WDRA 1XPQA 3CNJA 4O5UA 4OCGA 2V6OA 2XLRA 3ALMA 1H81A 1E1NA 4CNKA 1YQ4A 1LV0A 4CBQA 2R0CA 3S5WA 4YTNA 3ADAB 4USQA 1O95A 4XWRA 4C3XA 3ALJA 3CTYA 3HYXA 2YLSA 4H4UA 2C3CA 2R4EA 1PDHA 1M6IA 1JNZA 2WP5A 4J34A 2GR2A 3EANA 4K8DA 1YQ3A 1EL8A 2EQ6A 2GAHB 4XXGA 2B9YA 3AEBA 1JU2A 1EL7A 2BK5A 2XVFA 3AYIA 3V3NA 3BI2A 4GAVA 3BNMA 2ACZA 2Q0LA 1TDEA 4YXDA 3KKJA 2C75A 4K5RA 3NTAA 1GT8A 4U8MA 5KXJA 3S61A 4EIQA 5KVHA 4KPRA 1BWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KMR A;  4G6H A;  3SZC A;  3SZW A;  3SZF A;  3T2K A;  3KPK A;  4G9K A;  3T31 A;  3T2Y A;  4GAP A;  3SX6 A;  3T2Z A;  3HYX A;  4G6G A;  3HYW A;  4G74 A;  4NWZ A;  5KMP A;  5KMS A;  3SZ0 A;  3SYI A;  3T14 A;  3SXI A;  4GAV A;  3SY4 A;  5KMQ A;  3HYV A;  4G73 A;  3T0K A; 
#chains in the Genus database with same CATH topology
 2QA2 A;  4J57 A;  3C96 A;  2H88 A;  1GND A;  3BI4 A;  2GAG B;  3UTF A;  3CNP A;  5EB5 A;  2EQ8 A;  1XHC A;  5KVI A;  1F8R A;  4EMJ A;  4ZCD A;  2CUL A;  1GRH A;  4UDR A;  2OAM A;  4G6G A;  4ADW A;  1PBD A;  3UKQ A;  3UOX A;  4H4Q A;  2XVI A;  2RGJ A;  1MXT A;  3KU9 A;  4A99 A;  1DJN A;  1O94 A;  2YLT A;  2V5Z A;  2IID A;  2TPR A;  4NZH A;  4U8P A;  4CY8 A;  4A9W A;  3LAD A;  2WEU A;  1H83 A;  1TDK A;  4Z44 A;  5M0Z A;  1VQW A;  3NT6 A;  4I59 A;  3HYV A;  4APN A;  1RP0 A;  2WOW A;  5FS9 A;  3DGH A;  4Z24 A;  3VR9 A;  1DOD A;  2GMH A;  2VRM A;  1GER A;  1IUV A;  3UKK A;  1NPX A;  2R0G A;  1REO A;  2B7R A;  1VRQ B;  4G6H A;  3QVR A;  1IJH A;  3SZC A;  1Z6L A;  3PS9 A;  5EB4 A;  4NTD A;  3UKF A;  1NG4 A;  4NTE A;  3ICT A;  2C3D A;  3QFB A;  1PBF A;  2E5V A;  4H2R A;  4G9K A;  4P9S A;  4TM3 A;  2E1M A;  4YKG A;  1IUX A;  1CC4 A;  4OPC A;  3HYW A;  2BXR A;  2OLN A;  1OJC A;  4YSZ A;  1ZMD A;  4AOS A;  1PBC A;  3CNS A;  2JB2 A;  4H4V A;  3FPZ A;  3P9U A;  4Y4N A;  4Z25 A;  3CGB A;  1RSG A;  2WPF A;  2Q0K A;  2AR8 A;  3CNT A;  1DOE A;  3ICS A;  3ITJ A;  2OA1 A;  4JY3 A;  3HZL A;  3GWD A;  3FG2 P;  4U2T A;  4EMI A;  2GV8 A;  4J33 A;  3ABV A;  1CBO A;  2YR4 A;  1H6V A;  1CC2 A;  3H8L A;  1F8W A;  3URH A;  3CPJ G;  3NYE A;  4X9N A;  1KFY A;  2C70 A;  1GRG A;  2ZZ0 A;  2WDV A;  3UKH A;  3SX6 A;  3UP5 A;  3K7Q X;  2YG3 A;  4GDE A;  1TRB A;  5JCK A;  4EQR A;  1OJ9 A;  4U8L A;  2Z5Y A;  3DA1 A;  3VRA A;  1QO8 A;  1KSU A;  4PAB A;  5IQ1 A;  3M13 A;  3F8R A;  5KOX A;  5L46 A;  2BC1 A;  2DKI A;  2QCU A;  3ZDN A;  3GRS A;  4CCR A;  3I3L A;  4LII A;  2WDQ A;  4B67 A;  2GQF A;  3RHA A;  3BHF A;  4C77 A;  4DNA A;  1LVL A;  1VDC A;  3P4S A;  3LB8 A;  2FJE A;  1S3B A;  4REK A;  4UDP A;  1JRY A;  5KMR A;  1PJ6 A;  3DJJ A;  1H7W A;  3D8X A;  2YLR A;  1K0J A;  1NHP A;  2BCP A;  2JAE A;  2XLT A;  2JB3 A;  3T2Y A;  2X3N A;  4OPD A;  3QSS A;  2PYX A;  3GWF A;  2E4G A;  4U8K A;  3PO7 A;  4CY6 A;  2RGO A;  3AB1 A;  3L1R A;  4LU6 A;  4J31 A;  3K7T A;  3SQP A;  2FJB A;  1DOB A;  2WOV A;  3EAO A;  3UOY A;  4ECH A;  4Y4L A;  3AE8 A;  1COY A;  4B66 A;  5KWF A;  4C74 A;  1PXA A;  4U2L A;  5KMQ A;  4GCM A;  2ARD A;  4NTC A;  1VG0 A;  2A89 A;  4Z2U A;  3CN8 A;  2GRT A;  1JOA A;  3QJ4 A;  3DJE A;  3AE9 A;  3D1C A;  1FEA A;  4B65 A;  2XLP A;  5IQ4 A;  1UKV G;  4H2P A;  1GOS A;  1Y0P A;  2QA1 A;  1OJA A;  3JSK A;  2Z5X A;  4X9M A;  4H4W A;  4NEW A;  4TLX A;  4U2S A;  4A65 A;  1H84 A;  1H82 A;  3NN0 X;  2R9Z A;  2YQU A;  2X8C A;  2AQJ A;  2X8H A;  3LJP A;  3LZW A;  2VRL A;  2YM1 A;  3CPH G;  3SM8 A;  4YTP A;  1GRB A;  4FK1 A;  3DH9 A;  2YM2 A;  1PN0 A;  1BGN A;  1YQZ A;  3NGC X;  2BAC A;  1OJT A;  3G5Q A;  4B63 A;  4U8J A;  1BGJ A;  2NPX A;  1VG9 A;  2WP9 A;  1D4D A;  1TDF A;  3DK9 A;  4D03 A;  2XVJ A;  3GDN A;  4BJY A;  2HQM A;  2WOI A;  2YVF A;  5KNL A;  1CHU A;  3GDP A;  4GR1 A;  3SZW A;  3UOZ A;  1KNP A;  1E7P A;  4TM4 A;  3UKL A;  1TYP A;  1D7Y A;  3C4A A;  1FL2 A;  2XFP A;  5GSN A;  5JCL A;  3GRT A;  2GR0 A;  1ZDL A;  1ZY8 A;  3QSM A;  5JCN A;  2A8X A;  2BK4 A;  5M10 A;  2R45 A;  3AE4 A;  2YG7 A;  1NAA A;  1TYT A;  1V59 A;  2V3B A;  2NVK X;  4OPT A;  1K0I A;  3P1W A;  1CJ4 A;  3GD4 A;  3FBS A;  1FEB A;  1NDA A;  2VVL A;  3KPF A;  3RP7 A;  5KMS A;  3NK0 X;  1FOH A;  2YR6 A;  3NTD A;  2C72 A;  4M52 A;  3RP8 A;  1L9D A;  1E39 A;  1NHS A;  5C3J A;  4A7A A;  3AYL A;  3LXD A;  4YTM A;  2V60 A;  1KF6 A;  4J36 A;  2IVD A;  2FBW A;  5BUK A;  5JCM A;  1ZP0 A;  3BHK A;  3P4P A;  4Z26 A;  3EF6 A;  2GF3 A;  3KD9 A;  2GB0 A;  3BI5 A;  2GQW A;  1S2Y A;  2ZZC A;  1YKJ A;  5EBK A;  4A5L A;  4II3 A;  3AE2 A;  3II4 A;  2YG6 A;  1GRE A;  4X4J A;  2RAB A;  3NNE A;  3SFD A;  3AD7 B;  2VZ2 A;  4H4P A;  3RNM A;  4MJW A;  4TLZ A;  3QFA A;  1IUS A;  5CQF A;  1FEC A;  3NN6 X;  4H4R A;  4K2X A;  4II2 A;  2EQ9 A;  4RG4 A;  4EM3 A;  2XLU A;  1KNR A;  2VOU A;  3OZ2 A;  5BVA A;  4OVI A;  3VRD B;  1ZOY A;  3NK1 X;  2Q7V A;  4U8I A;  4GDP A;  1CL0 A;  1NG3 A;  2B9W A;  1XDI A;  1GTE A;  3LZX A;  4WX1 A;  2V3A A;  3AYJ A;  4YSX A;  4EIP A;  1Y56 B;  2YLX A;  1L9C A;  2BAB A;  4JN9 A;  3UP4 A;  3NG7 X;  2I0Z A;  3KPK A;  2UZZ A;  4EMW A;  1CJC A;  1ZMC A;  3QVP A;  3M0O A;  2BXS A;  3T2Z A;  1EL9 A;  1PXB A;  3ZYX A;  4ZN0 A;  2B76 A;  4AP3 A;  4B64 A;  2BRY A;  1CC6 A;  4CCQ A;  5J7X A;  2VVL G;  4BV6 A;  3ISH A;  2V61 A;  3AEA A;  2ZZB A;  3CND A;  1NHR A;  2GEW A;  3UTE A;  3DME A;  3K30 A;  3IHM A;  3NH3 X;  5HY5 A;  3UKP A;  3CGD A;  3ATQ A;  3ALL A;  2C65 A;  4TM0 A;  1L9E A;  2BS3 A;  2VVM A;  4XWZ A;  1IUU A;  4H2Q A;  1FCD A;  3B6D A;  3T0K A;  3EPT A;  3G5S A;  2GR3 A;  3VR8 A;  1N4W A;  1TDO A;  2C64 A;  2RGH A;  2WU5 A;  4A79 A;  5KRQ A;  2CVJ A;  1K0L A;  2GR1 A;  4K22 A;  3H4K A;  3OC4 A;  3T2K A;  1OJD A;  1F8S A;  5U1O A;  1N4V A;  3O0H A;  4AOX A;  2R4J A;  2Y6R A;  1PS9 A;  4GAP A;  4H4T A;  4PAA A;  3NRN A;  4USR A;  3UOV A;  1GRT A;  1CJ2 A;  2C4C A;  3IWA A;  3KA7 A;  2YLZ A;  3QSE A;  4GRT A;  3GD3 A;  5HYM A;  5KMP A;  2BCG G;  3DGZ A;  3C4N A;  5BUL A;  4GF7 A;  2CDU A;  2YVJ A;  1GRA A;  2O9Z A;  4AP1 A;  1Q1W A;  2X50 A;  4BK2 A;  2WPE A;  1MOK A;  1LTX R;  1NHQ A;  4BK1 A;  2AAQ A;  4DSH A;  1D5T A;  1XAN A;  2WHD A;  3CGC A;  2FJA A;  2XCG A;  3IC9 A;  2QAE A;  4HB9 A;  4N9X A;  4YWO A;  3SZF A;  4OPI A;  1H86 A;  3AEF A;  4H7U A;  1JNR A;  4YKF A;  5HXI A;  2IVE A;  2C73 A;  1AOG A;  2JBV A;  5EOW A;  3AEC A;  4IVO B;  1NEN A;  2YWL A;  4RSL A;  1ZK7 A;  1E1K A;  4A6N B;  3ATR A;  2WP6 A;  4WCT A;  3NLC A;  3LOV A;  3T14 A;  2BRA A;  3NHO X;  2EQ7 A;  1JRX A;  1L0V A;  2WQY A;  2Y6Q A;  2C76 A;  5C2T A;  3GMB A;  4K7Z A;  1HYU A;  4Z2T A;  4H2N A;  4H4X A;  1B37 A;  4IV9 A;  3CMM A;  4FX9 A;  4IA6 A;  1EBD A;  2X8G A;  1W4X A;  2YVG A;  3NYC A;  3P4Q A;  2R0P A;  1EL5 A;  2BK3 A;  1Y56 A;  4TM1 A;  2JK6 A;  4EQW A;  2W0H A;  1P2E A;  1K4Q A;  4GUV A;  4B1B A;  1PXC A;  1PJ5 A;  1BKW A;  3E1T A;  1GXF A;  4NEV A;  3CIR A;  5FMH A;  1LJ1 A;  1D4C A;  1IUT A;  5GRT A;  4H50 A;  4LA1 A;  3F8D A;  1S2Q A;  4G74 A;  4NWZ A;  2WET A;  3SYI A;  3SXI A;  3GYJ A;  4HA6 A;  3AED A;  1LQU A;  3R9U A;  2X99 A;  1GTH A;  2GVC A;  1X31 B;  1GSN A;  1P2H A;  3UKA A;  4YSY A;  3NYF A;  3DJD A;  4YT0 A;  4O5Q A;  3WE0 A;  3NIX A;  3RP6 A;  1ZKQ A;  4JDR A;  1F6M A;  4H4Z A;  4E0V A;  1E1L A;  2XVH A;  4ZCC A;  1Q9I A;  2BS2 A;  2B9X A;  4U8N A;  1YY5 A;  3AWI A;  3T31 A;  2Q6U A;  1GET A;  1B5Q A;  1S3E A;  2DKH A;  1ELI A;  5U63 A;  1JEH A;  3G5R A;  3GSI A;  4AT2 A;  3VRB A;  1M64 A;  1GRF A;  2XFO A;  2XVE A;  3NK2 X;  4CNJ A;  5HHF A;  3IF9 A;  3UTH A;  3Q6J A;  3NKS A;  5ER0 A;  1CF3 A;  3AD8 B;  3GYX A;  2BA9 A;  3DJG X;  4JQ9 A;  5TR3 A;  2JKC A;  2J3N A;  3DK8 A;  3COX A;  3SFE A;  1N4U A;  3CPI G;  1Q1R A;  2PHH A;  3F8P A;  1ZOV A;  4G73 A;  1PHH A;  3V76 A;  4D04 A;  1E6E A;  2OLO A;  2WPC A;  4H4S A;  1QJD A;  5FS6 A;  2WES A;  2YG4 A;  2YG5 A;  3BNU A;  4BK3 A;  4DGK A;  4BJZ A;  4EQX A;  2XDO A;  1IUW A;  4J2W A;  4JNA A;  1DNC A;  2APG A;  2TMD A;  2BC0 A;  2R46 A;  4I58 A;  5CKU A;  4B69 A;  4IVM B;  5J60 A;  5JCI A;  1GEU A;  2OAL A;  3AE3 A;  3DK4 A;  4A6N A;  4UP3 A;  3KVE A;  3K7M X;  4B68 A;  2XYO A;  2C7G A;  3CGE A;  2XLS A;  3SY4 A;  1CJ3 A;  1D7L A;  1GV4 A;  1ONF A;  2BS4 A;  2WU2 A;  2BYB A;  3AE6 A;  2JB1 A;  1N1P A;  1PJ7 A;  4OPU A;  4Y4M A;  1NEK A;  3AE1 A;  4DSG A;  4K5S A;  1DJQ A;  4RG3 A;  2XFN A;  4FDC B;  3V3O A;  2GMJ A;  1B8S A;  2YR5 A;  4Z43 A;  1RYI A;  1F3P A;  3AE5 A;  3AEE A;  4C3Y A;  1BZL A;  1O5W A;  3UCL A;  4BUR A;  4YSH A;  3M12 A;  1H7X A;  2GH5 A;  4JY2 A;  3ICR A;  3L8K A;  3GMC A;  1JRZ A;  3T37 A;  3IHG A;  4U8O A;  3Q9T A;  4C5O A;  5KOW A;  3SZ0 A;  1DXL A;  5FS7 A;  2C67 A;  1KSS A;  4H4Y A;  5DBJ A;  1BF3 A;  3I6D A;  4OPL A;  3P4R A;  2FJD A;  3H8I A;  5BRT A;  2VQB A;  1GPE A;  3AEG A;  1PBB A;  3UTG A;  4AT0 A;  1B4V A;  3FMW A;  1TDN A;  2F5Z A;  2C66 A;  4KX6 A;  2H89 A;  3RED A;  3FIM B;  1KDG A;  2B7S A;  3SGL A;  2XFU A;  2A87 A;  3GYI A;  2XFQ A;  3KLJ A;  4ICY A;  4FK1 C;  1LQT A;  3PVC A;  4NNJ A;  2YLW A;  5U25 A;  4EQS A;  2ZBW A;  1PBE A;  2CFY A;  4J56 A;  3AXB A;  1QLB A;  2WS3 A;  3B3R A;  5IPY A;  5FS8 A;  5LV9 A;  2WBA A;  2YAU A;  1GES A;  4CRT A;  1D4E A;  4Z2R A;  1ZX9 A;  1GAL A;  1SEZ A;  4IA5 A;  2VQ7 A;  1LPF A;  4OPG A;  4JNQ A;  3AD9 B;  1E1M A;  1MO9 A;  4UDQ A;  3VQR A;  3AE7 A;  1DOC A;  4EM4 A;  2WDR A;  1XPQ A;  3CNJ A;  4O5U A;  4OCG A;  2V6O A;  2XLR A;  3ALM A;  1H81 A;  1E1N A;  4CNK A;  1YQ4 A;  1LV0 A;  4CBQ A;  2R0C A;  3S5W A;  4YTN A;  3ADA B;  4USQ A;  1O95 A;  4XWR A;  4C3X A;  3ALJ A;  3CTY A;  3HYX A;  2YLS A;  4H4U A;  2C3C A;  2R4E A;  1PDH A;  1M6I A;  1JNZ A;  2WP5 A;  4J34 A;  2GR2 A;  3EAN A;  4K8D A;  1YQ3 A;  1EL8 A;  2EQ6 A;  2GAH B;  4XXG A;  2B9Y A;  3AEB A;  1JU2 A;  1EL7 A;  2BK5 A;  2XVF A;  3AYI A;  3V3N A;  3BI2 A;  4GAV A;  3BNM A;  2ACZ A;  2Q0L A;  1TDE A;  4YXD A;  3KKJ A;  2C75 A;  4K5R A;  3NTA A;  1GT8 A;  4U8M A;  5KXJ A;  3S61 A;  4EIQ A;  5KVH A;  4KPR A;  1BWC A; 
#chains in the Genus database with same CATH homology
 2QA2 A;  4J57 A;  3C96 A;  2H88 A;  1GND A;  3BI4 A;  2GAG B;  3UTF A;  3CNP A;  5EB5 A;  2EQ8 A;  1XHC A;  5KVI A;  1F8R A;  4EMJ A;  4ZCD A;  2CUL A;  1GRH A;  4UDR A;  2OAM A;  4G6G A;  4ADW A;  1PBD A;  3UKQ A;  3UOX A;  4H4Q A;  2XVI A;  2RGJ A;  1MXT A;  3KU9 A;  4A99 A;  1DJN A;  1O94 A;  2YLT A;  2V5Z A;  2IID A;  2TPR A;  4NZH A;  4U8P A;  4CY8 A;  4A9W A;  3LAD A;  2WEU A;  1H83 A;  1TDK A;  4Z44 A;  5M0Z A;  1VQW A;  3NT6 A;  4I59 A;  3HYV A;  4APN A;  1RP0 A;  2WOW A;  5FS9 A;  3DGH A;  4Z24 A;  3VR9 A;  1DOD A;  2GMH A;  2VRM A;  1GER A;  1IUV A;  3UKK A;  1NPX A;  2R0G A;  1REO A;  2B7R A;  1VRQ B;  4G6H A;  3QVR A;  1IJH A;  3SZC A;  1Z6L A;  3PS9 A;  5EB4 A;  4NTD A;  3UKF A;  1NG4 A;  4NTE A;  3ICT A;  2C3D A;  3QFB A;  1PBF A;  2E5V A;  4H2R A;  4G9K A;  4P9S A;  4TM3 A;  2E1M A;  4YKG A;  1IUX A;  1CC4 A;  4OPC A;  3HYW A;  2BXR A;  2OLN A;  1OJC A;  4YSZ A;  1ZMD A;  4AOS A;  1PBC A;  3CNS A;  2JB2 A;  4H4V A;  3FPZ A;  3P9U A;  4Y4N A;  4Z25 A;  3CGB A;  1RSG A;  2WPF A;  2Q0K A;  2AR8 A;  3CNT A;  1DOE A;  3ICS A;  3ITJ A;  2OA1 A;  4JY3 A;  3HZL A;  3GWD A;  3FG2 P;  4U2T A;  4EMI A;  2GV8 A;  4J33 A;  3ABV A;  1CBO A;  2YR4 A;  1H6V A;  1CC2 A;  3H8L A;  1F8W A;  3URH A;  3CPJ G;  3NYE A;  4X9N A;  1KFY A;  2C70 A;  1GRG A;  2ZZ0 A;  2WDV A;  3UKH A;  3SX6 A;  3UP5 A;  3K7Q X;  2YG3 A;  4GDE A;  1TRB A;  5JCK A;  4EQR A;  1OJ9 A;  4U8L A;  2Z5Y A;  3DA1 A;  3VRA A;  1QO8 A;  1KSU A;  4PAB A;  5IQ1 A;  3M13 A;  3F8R A;  5KOX A;  5L46 A;  2BC1 A;  2DKI A;  2QCU A;  3ZDN A;  3GRS A;  4CCR A;  3I3L A;  4LII A;  2WDQ A;  4B67 A;  2GQF A;  3RHA A;  3BHF A;  4C77 A;  4DNA A;  1LVL A;  1VDC A;  3P4S A;  3LB8 A;  2FJE A;  1S3B A;  4REK A;  4UDP A;  1JRY A;  5KMR A;  1PJ6 A;  3DJJ A;  1H7W A;  3D8X A;  2YLR A;  1K0J A;  1NHP A;  2BCP A;  2JAE A;  2XLT A;  2JB3 A;  3T2Y A;  2X3N A;  4OPD A;  3QSS A;  2PYX A;  3GWF A;  2E4G A;  4U8K A;  3PO7 A;  4CY6 A;  2RGO A;  3AB1 A;  3L1R A;  4LU6 A;  4J31 A;  3K7T A;  3SQP A;  2FJB A;  1DOB A;  2WOV A;  3EAO A;  3UOY A;  4ECH A;  4Y4L A;  3AE8 A;  1COY A;  4B66 A;  5KWF A;  4C74 A;  1PXA A;  4U2L A;  5KMQ A;  4GCM A;  2ARD A;  4NTC A;  1VG0 A;  2A89 A;  4Z2U A;  3CN8 A;  2GRT A;  1JOA A;  3QJ4 A;  3DJE A;  3AE9 A;  3D1C A;  1FEA A;  4B65 A;  2XLP A;  5IQ4 A;  1UKV G;  4H2P A;  1GOS A;  1Y0P A;  2QA1 A;  1OJA A;  3JSK A;  2Z5X A;  4X9M A;  4H4W A;  4NEW A;  4TLX A;  4U2S A;  4A65 A;  1H84 A;  1H82 A;  3NN0 X;  2R9Z A;  2YQU A;  2X8C A;  2AQJ A;  2X8H A;  3LJP A;  3LZW A;  2VRL A;  2YM1 A;  3CPH G;  3SM8 A;  4YTP A;  1GRB A;  4FK1 A;  3DH9 A;  2YM2 A;  1PN0 A;  1BGN A;  1YQZ A;  3NGC X;  2BAC A;  1OJT A;  3G5Q A;  4B63 A;  4U8J A;  1BGJ A;  2NPX A;  1VG9 A;  2WP9 A;  1D4D A;  1TDF A;  3DK9 A;  4D03 A;  2XVJ A;  3GDN A;  4BJY A;  2HQM A;  2WOI A;  2YVF A;  5KNL A;  1CHU A;  3GDP A;  4GR1 A;  3SZW A;  3UOZ A;  1KNP A;  1E7P A;  4TM4 A;  3UKL A;  1TYP A;  1D7Y A;  3C4A A;  1FL2 A;  2XFP A;  5GSN A;  5JCL A;  3GRT A;  2GR0 A;  1ZDL A;  1ZY8 A;  3QSM A;  5JCN A;  2A8X A;  2BK4 A;  5M10 A;  2R45 A;  3AE4 A;  2YG7 A;  1NAA A;  1TYT A;  1V59 A;  2V3B A;  2NVK X;  4OPT A;  1K0I A;  3P1W A;  1CJ4 A;  3GD4 A;  3FBS A;  1FEB A;  1NDA A;  2VVL A;  3KPF A;  3RP7 A;  5KMS A;  3NK0 X;  1FOH A;  2YR6 A;  3NTD A;  2C72 A;  4M52 A;  3RP8 A;  1L9D A;  1E39 A;  1NHS A;  5C3J A;  4A7A A;  3AYL A;  3LXD A;  4YTM A;  2V60 A;  1KF6 A;  4J36 A;  2IVD A;  2FBW A;  5BUK A;  5JCM A;  1ZP0 A;  3BHK A;  3P4P A;  4Z26 A;  3EF6 A;  2GF3 A;  3KD9 A;  2GB0 A;  3BI5 A;  2GQW A;  1S2Y A;  2ZZC A;  1YKJ A;  5EBK A;  4A5L A;  4II3 A;  3AE2 A;  3II4 A;  2YG6 A;  1GRE A;  4X4J A;  2RAB A;  3NNE A;  3SFD A;  3AD7 B;  2VZ2 A;  4H4P A;  3RNM A;  4MJW A;  4TLZ A;  3QFA A;  1IUS A;  5CQF A;  1FEC A;  3NN6 X;  4H4R A;  4K2X A;  4II2 A;  2EQ9 A;  4RG4 A;  4EM3 A;  2XLU A;  1KNR A;  2VOU A;  3OZ2 A;  5BVA A;  4OVI A;  3VRD B;  1ZOY A;  3NK1 X;  2Q7V A;  4U8I A;  4GDP A;  1CL0 A;  1NG3 A;  2B9W A;  1XDI A;  1GTE A;  3LZX A;  4WX1 A;  2V3A A;  3AYJ A;  4YSX A;  4EIP A;  1Y56 B;  2YLX A;  1L9C A;  2BAB A;  4JN9 A;  3UP4 A;  3NG7 X;  2I0Z A;  3KPK A;  2UZZ A;  4EMW A;  1CJC A;  1ZMC A;  3QVP A;  3M0O A;  2BXS A;  3T2Z A;  1EL9 A;  1PXB A;  3ZYX A;  4ZN0 A;  2B76 A;  4AP3 A;  4B64 A;  2BRY A;  1CC6 A;  4CCQ A;  5J7X A;  2VVL G;  4BV6 A;  3ISH A;  2V61 A;  3AEA A;  2ZZB A;  3CND A;  1NHR A;  2GEW A;  3UTE A;  3DME A;  3K30 A;  3IHM A;  3NH3 X;  5HY5 A;  3UKP A;  3CGD A;  3ATQ A;  3ALL A;  2C65 A;  4TM0 A;  1L9E A;  2BS3 A;  2VVM A;  4XWZ A;  1IUU A;  4H2Q A;  1FCD A;  3B6D A;  3T0K A;  3EPT A;  3G5S A;  2GR3 A;  3VR8 A;  1N4W A;  1TDO A;  2C64 A;  2RGH A;  2WU5 A;  4A79 A;  5KRQ A;  2CVJ A;  1K0L A;  2GR1 A;  4K22 A;  3H4K A;  3OC4 A;  3T2K A;  1OJD A;  1F8S A;  5U1O A;  1N4V A;  3O0H A;  4AOX A;  2R4J A;  2Y6R A;  1PS9 A;  4GAP A;  4H4T A;  4PAA A;  3NRN A;  4USR A;  3UOV A;  1GRT A;  1CJ2 A;  2C4C A;  3IWA A;  3KA7 A;  2YLZ A;  3QSE A;  4GRT A;  3GD3 A;  5HYM A;  5KMP A;  2BCG G;  3DGZ A;  3C4N A;  5BUL A;  4GF7 A;  2CDU A;  2YVJ A;  1GRA A;  2O9Z A;  4AP1 A;  1Q1W A;  2X50 A;  4BK2 A;  2WPE A;  1MOK A;  1LTX R;  1NHQ A;  4BK1 A;  2AAQ A;  4DSH A;  1D5T A;  1XAN A;  2WHD A;  3CGC A;  2FJA A;  2XCG A;  3IC9 A;  2QAE A;  4HB9 A;  4N9X A;  4YWO A;  3SZF A;  4OPI A;  1H86 A;  3AEF A;  4H7U A;  1JNR A;  4YKF A;  5HXI A;  2IVE A;  2C73 A;  1AOG A;  2JBV A;  5EOW A;  3AEC A;  4IVO B;  1NEN A;  2YWL A;  4RSL A;  1ZK7 A;  1E1K A;  4A6N B;  3ATR A;  2WP6 A;  4WCT A;  3NLC A;  3LOV A;  3T14 A;  2BRA A;  3NHO X;  2EQ7 A;  1JRX A;  1L0V A;  2WQY A;  2Y6Q A;  2C76 A;  5C2T A;  3GMB A;  4K7Z A;  1HYU A;  4Z2T A;  4H2N A;  4H4X A;  1B37 A;  4IV9 A;  3CMM A;  4FX9 A;  4IA6 A;  1EBD A;  2X8G A;  1W4X A;  2YVG A;  3NYC A;  3P4Q A;  2R0P A;  1EL5 A;  2BK3 A;  1Y56 A;  4TM1 A;  2JK6 A;  4EQW A;  2W0H A;  1P2E A;  1K4Q A;  4GUV A;  4B1B A;  1PXC A;  1PJ5 A;  1BKW A;  3E1T A;  1GXF A;  4NEV A;  3CIR A;  5FMH A;  1LJ1 A;  1D4C A;  1IUT A;  5GRT A;  4H50 A;  4LA1 A;  3F8D A;  1S2Q A;  4G74 A;  4NWZ A;  2WET A;  3SYI A;  3SXI A;  3GYJ A;  4HA6 A;  3AED A;  1LQU A;  3R9U A;  2X99 A;  1GTH A;  2GVC A;  1X31 B;  1GSN A;  1P2H A;  3UKA A;  4YSY A;  3NYF A;  3DJD A;  4YT0 A;  4O5Q A;  3WE0 A;  3NIX A;  3RP6 A;  1ZKQ A;  4JDR A;  1F6M A;  4H4Z A;  4E0V A;  1E1L A;  2XVH A;  4ZCC A;  1Q9I A;  2BS2 A;  2B9X A;  4U8N A;  1YY5 A;  3AWI A;  3T31 A;  2Q6U A;  1GET A;  1B5Q A;  1S3E A;  2DKH A;  1ELI A;  5U63 A;  1JEH A;  3G5R A;  3GSI A;  4AT2 A;  3VRB A;  1M64 A;  1GRF A;  2XFO A;  2XVE A;  3NK2 X;  4CNJ A;  5HHF A;  3IF9 A;  3UTH A;  3Q6J A;  3NKS A;  5ER0 A;  1CF3 A;  3AD8 B;  3GYX A;  2BA9 A;  3DJG X;  4JQ9 A;  5TR3 A;  2JKC A;  2J3N A;  3DK8 A;  3COX A;  3SFE A;  1N4U A;  3CPI G;  1Q1R A;  2PHH A;  3F8P A;  1ZOV A;  4G73 A;  1PHH A;  3V76 A;  4D04 A;  1E6E A;  2OLO A;  2WPC A;  4H4S A;  1QJD A;  5FS6 A;  2WES A;  2YG4 A;  2YG5 A;  3BNU A;  4BK3 A;  4DGK A;  4BJZ A;  4EQX A;  2XDO A;  1IUW A;  4J2W A;  4JNA A;  1DNC A;  2APG A;  2TMD A;  2BC0 A;  2R46 A;  4I58 A;  5CKU A;  4B69 A;  4IVM B;  5J60 A;  5JCI A;  1GEU A;  2OAL A;  3AE3 A;  3DK4 A;  4A6N A;  4UP3 A;  3KVE A;  3K7M X;  4B68 A;  2XYO A;  2C7G A;  3CGE A;  2XLS A;  3SY4 A;  1CJ3 A;  1D7L A;  1GV4 A;  1ONF A;  2BS4 A;  2WU2 A;  2BYB A;  3AE6 A;  2JB1 A;  1N1P A;  1PJ7 A;  4OPU A;  4Y4M A;  1NEK A;  3AE1 A;  4DSG A;  4K5S A;  1DJQ A;  4RG3 A;  2XFN A;  4FDC B;  3V3O A;  2GMJ A;  1B8S A;  2YR5 A;  4Z43 A;  1RYI A;  1F3P A;  3AE5 A;  3AEE A;  4C3Y A;  1BZL A;  1O5W A;  3UCL A;  4BUR A;  4YSH A;  3M12 A;  1H7X A;  2GH5 A;  4JY2 A;  3ICR A;  3L8K A;  3GMC A;  1JRZ A;  3T37 A;  3IHG A;  4U8O A;  3Q9T A;  4C5O A;  5KOW A;  3SZ0 A;  1DXL A;  5FS7 A;  2C67 A;  1KSS A;  4H4Y A;  5DBJ A;  1BF3 A;  3I6D A;  4OPL A;  3P4R A;  2FJD A;  3H8I A;  5BRT A;  2VQB A;  1GPE A;  3AEG A;  1PBB A;  3UTG A;  4AT0 A;  1B4V A;  3FMW A;  1TDN A;  2F5Z A;  2C66 A;  4KX6 A;  2H89 A;  3RED A;  3FIM B;  1KDG A;  2B7S A;  3SGL A;  2XFU A;  2A87 A;  3GYI A;  2XFQ A;  3KLJ A;  4ICY A;  4FK1 C;  1LQT A;  3PVC A;  4NNJ A;  2YLW A;  5U25 A;  4EQS A;  2ZBW A;  1PBE A;  2CFY A;  4J56 A;  3AXB A;  1QLB A;  2WS3 A;  3B3R A;  5IPY A;  5FS8 A;  5LV9 A;  2WBA A;  2YAU A;  1GES A;  4CRT A;  1D4E A;  4Z2R A;  1ZX9 A;  1GAL A;  1SEZ A;  4IA5 A;  2VQ7 A;  1LPF A;  4OPG A;  4JNQ A;  3AD9 B;  1E1M A;  1MO9 A;  4UDQ A;  3VQR A;  3AE7 A;  1DOC A;  4EM4 A;  2WDR A;  1XPQ A;  3CNJ A;  4O5U A;  4OCG A;  2V6O A;  2XLR A;  3ALM A;  1H81 A;  1E1N A;  4CNK A;  1YQ4 A;  1LV0 A;  4CBQ A;  2R0C A;  3S5W A;  4YTN A;  3ADA B;  4USQ A;  1O95 A;  4XWR A;  4C3X A;  3ALJ A;  3CTY A;  3HYX A;  2YLS A;  4H4U A;  2C3C A;  2R4E A;  1PDH A;  1M6I A;  1JNZ A;  2WP5 A;  4J34 A;  2GR2 A;  3EAN A;  4K8D A;  1YQ3 A;  1EL8 A;  2EQ6 A;  2GAH B;  4XXG A;  2B9Y A;  3AEB A;  1JU2 A;  1EL7 A;  2BK5 A;  2XVF A;  3AYI A;  3V3N A;  3BI2 A;  4GAV A;  3BNM A;  2ACZ A;  2Q0L A;  1TDE A;  4YXD A;  3KKJ A;  2C75 A;  4K5R A;  3NTA A;  1GT8 A;  4U8M A;  5KXJ A;  3S61 A;  4EIQ A;  5KVH A;  4KPR A;  1BWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...