4G6HA

Crystal structure of ndh with nadh
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
472
structure length
472
Chain Sequence
TMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
total genus 164
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g6hA00
3T0KA 5KMQA 3T2KA 3KPKA 3SY4A 3SZ0A 3HYXA 4G9KA 3SZFA 3SYIA 4G6GA 3T2YA 4NWZA 5KMPA 4GAVA 3T2ZA 5KMSA 4G74A 4GAPA 4G73A 3T31A 3HYWA 3SXIA 3SX6A 3HYVA 3SZCA 4G6HA 3T14A 5KMRA 3SZWA
chains in the Genus database with same CATH superfamily
2AR8A 2FJEA 2JK6A 2WETA 2V3BA 2XDOA 2ZZCA 2YM1A 3AEFA 4EQSA 2YG3A 3DJJA 4K22A 2YG6A 4NEVA 1ZOVA 2Y6QA 4ADWA 2E1MA 2ZZBA 4G9KA 4UP3A 5GRTA 2GVCA 5GSNA 1H84A 3E1TA 1Q9IA 3GD4A 1XDIA 3NRNA 4H4ZA 1JRXA 1SEZA 3D8XA 3FMWA 4ZCDA 3AD8B 2FJAA 3AYLA 4GDPA 4BK3A 4GAPA 2YVGA 3KPFA 3LADA 4JN9A 4BV6A 1DOBA 3CGCA 2GAHB 4B66A 4GRTA 1Z6LA 1X31B 3UKQA 1HYUA 2FBWA 1OJCA 1N4VA 1L0VA 1S2QA 3GSIA 1Y56B 1ZKQA 4BJYA 1PHHA 1H6VA 3GMCA 1GV4A 2WESA 4YKGA 4Z26A 5JCIA 1NAAA 3AWIA 2C65A 2RABA 2B76A 4TLXA 4TM1A 2B7SA 4APNA 3SYIA 3AYIA 1DOCA 2YVJA 4II3A 4BK2A 3CTYA 3NYCA 2BC1A 3CGEA 1E6EA 3NIXA 5KMSA 4U8IA 2PHHA 3GWFA 3Q6JA 1PJ5A 2WDRA 1NHQA 5KNLA 2C75A 1F6MA 1D4EA 2XFUA 5JCLA 2BA9A 3C4AA 2WU5A 3GYIA 3CPHG 4J57A 4X4JA 2VVMA 2XVIA 4OPUA 3CNTA 1K4QA 5IQ1A 1PXCA 2JB1A 4RG3A 1OJTA 3LOVA 1RSGA 3P4QA 2Q0KA 2BS4A 4K5RA 3T2ZA 2GH5A 1QO8A 3UTGA 4H4UA 5U1OA 4II2A 1L9EA 3AEDA 1TDEA 4C77A 3AYJA 2R4JA 2BS3A 3K30A 2BACA 2B9YA 3DK4A 1E7PA 1ZX9A 2B9WA 2GMHA 4D03A 4UDQA 2XFPA 4J2WA 3PVCA 4OVIA 5FS6A 2I0ZA 1D7LA 1F8WA 3CIRA 1E1MA 3CN8A 3GRSA 1EL7A 2E5VA 5KVIA 3FG2P 4GUVA 4JDRA 2C67A 4NTEA 3VRDB 3DK9A 3SFDA 1F8RA 1YQZA 2R0PA 2X99A 1D4DA 2FJDA 4AT2A 4JNAA 1L9CA 1Q1RA 3QFAA 2H88A 3L1RA 2VQBA 1LVLA 4NTCA 4EQRA 2JB3A 1FEAA 2YG5A 1TDNA 3ALMA 3KPKA 4B65A 3SY4A 1VDCA 3UOVA 3AE7A 4C3YA 1OJAA 2YLSA 2EQ7A 3DJGX 4YT0A 1CBOA 3R9UA 1GTEA 3AEGA 4U2SA 2YR5A 2A8XA 2YAUA 3AXBA 2X50A 4XWRA 2C72A 3SFEA 4AT0A 1JRYA 1E39A 3VRBA 5L46A 3NK2X 5CKUA 1PBDA 2YLRA 3P9UA 1PXAA 2ZZ0A 2CDUA 1CC2A 1KDGA 1N1PA 1YQ4A 3HYVA 5BVAA 1FCDA 1TRBA 3BNMA 2WDVA 4IVMB 4FK1A 1CC4A 1COYA 1GESA 3H4KA 5KMQA 5ER0A 2GEWA 2WP6A 5IPYA 4OPGA 3NK0X 1DNCA 2OLNA 1JRZA 3UCLA 3AEAA 3AE1A 4LIIA 3SQPA 2XFNA 5EB4A 3VQRA 1ZDLA 1GRGA 4Z43A 4G74A 3ICRA 1KNRA 1GTHA 3AD7B 3FIMB 4AP3A 2C7GA 4B67A 3T31A 4Z2TA 1GRBA 2WBAA 3ATQA 4JY2A 2V6OA 4YTNA 1GRFA 2X8GA 3C96A 1TDFA 1EL5A 4H7UA 2YVFA 3F8RA 1EL9A 2AQJA 1FL2A 3NYFA 2C76A 3PS9A 3QFBA 4A79A 4U8MA 5BULA 3M13A 1FEBA 2BABA 4IV9A 4LU6A 4YXDA 2C73A 4Z24A 1CL0A 1NG4A 1ZOYA 2CFYA 5KWFA 5KOWA 3I3LA 4YSZA 3HZLA 3AB1A 4NWZA 3H8IA 3RNMA 3UKFA 4CY8A 2R9ZA 4USRA 1P2HA 1S3EA 3NK1X 4U8KA 4EM4A 3ALJA 3EF6A 1KSUA 4ZN0A 1XHCA 5HY5A 3CGDA 3V3NA 1ZY8A 2CVJA 1D5TA 4H2RA 4KX6A 3RP8A 4Z2UA 4K5SA 3IC9A 4GR1A 1JEHA 4EMIA 3KA7A 3RP7A 2DKIA 1GOSA 3SGLA 1H7XA 4J34A 1BKWA 4X9NA 4FK1C 4UDPA 3T0KA 3WE0A 3JSKA 2ARDA 2OALA 5HXIA 1H86A 2QAEA 3NH3X 1S2YA 3NN6X 3UKAA 3SZ0A 3C4NA 2WOWA 4U8NA 3NNEA 2CULA 4YSXA 2YLZA 2Z5XA 2BS2A 3BI5A 3GWDA 1JNRA 2AAQA 4N9XA 2WPEA 5FS8A 3RHAA 3CPJG 1CJ4A 1W4XA 3CNPA 2YLWA 3ICSA 2O9ZA 4A5LA 4CY6A 3BNUA 4OPDA 1L9DA 3AE8A 2UZZA 2DKHA 5CQFA 1NENA 1UKVG 2C66A 3KLJA 2Y6RA 3SX6A 3RP6A 2C70A 5M10A 2JAEA 1O95A 2JKCA 4H4WA 3AE5A 4ICYA 2RGOA 1DODA 1GNDA 3ITJA 3LZWA 2TMDA 4JY3A 4NTDA 1CJ3A 2FJBA 1IUUA 3CNSA 4IA5A 2QA1A 4A6NB 3UKLA 1GRTA 2ZBWA 3BI4A 4G6GA 1K0LA 1IUWA 3BHKA 4Y4LA 4DSHA 5KMPA 1JOAA 5BUKA 1GALA 2GAGB 2J3NA 3NLCA 2YWLA 1BGNA 1GERA 4U2LA 4C5OA 2VVLA 3GDPA 2R46A 3IHGA 1PBBA 4REKA 1LQUA 3S5WA 4EQXA 1IUXA 1F3PA 2BK3A 3NG7X 1M6IA 3UTEA 3CGBA 1KFYA 3CPIG 5DBJA 1TDKA 4NZHA 3KU9A 4PAAA 5KMRA 4YKFA 1O94A 3QSEA 1IUVA 4YSHA 2C64A 3EAOA 4A9WA 5JCMA 3QJ4A 1IJHA 1KF6A 2BYBA 3O0HA 5KVHA 3GRTA 1PBFA 2C3CA 3H8LA 3OZ2A 4WCTA 3LXDA 4EMWA 2YLXA 4X9MA 5BRTA 1GREA 2BRAA 4Z44A 4A7AA 1QLBA 5IQ4A 5TR3A 1FOHA 1PBEA 2GQWA 1BF3A 3CMMA 4G73A 2X3NA 1D4CA 2XLRA 4FDCB 4U2TA 1ONFA 1MOKA 2XVEA 4Z2RA 1ZP0A 2VRMA 1ZMDA 2RGJA 3GYJA 4HB9A 4M52A 4J36A 2JB2A 3LJPA 2YG7A 3DH9A 4G6HA 2WDQA 3EPTA 4KPRA 2VOUA 1H7WA 4GF7A 3AE9A 2XVJA 4NNJA 5M0ZA 4H4XA 2WP5A 3P1WA 3HYXA 2YM2A 4K7ZA 4O5QA 2GF3A 1ZK7A 4DNAA 2BCPA 2VVLG 2C3DA 1ZMCA 1S3BA 2EQ6A 1ELIA 1F8SA 1PBCA 1PS9A 1GRAA 3Q9TA 4U8LA 1CF3A 3FBSA 3IHMA 2A87A 2BRYA 1EL8A 3GDNA 2YR6A 3LZXA 2WP9A 3DJEA 1B8SA 1NDAA 1O5WA 2WPCA 3REDA 4YTPA 4AP1A 1YY5A 5JCNA 3NN0X 5FMHA 5U25A 1E1NA 3CNJA 3FPZA 5EBKA 3VR9A 1CHUA 1CJ2A 3DK8A 1B37A 3D1CA 5C2TA 2R4EA 4TM0A 1VQWA 4J31A 4OPCA 2C4CA 2V60A 1V59A 2NVKX 4H4SA 1EBDA 2GR0A 1M64A 2WQYA 2XLTA 4XXGA 3KVEA 2WOIA 2GR2A 3NYEA 4B1BA 3ABVA 1CJCA 2ACZA 4FX9A 2XLPA 2BXSA 3ALLA 1Y0PA 5HHFA 4GCMA 4E0VA 5C3JA 2GMJA 1GRHA 4OPLA 3II4A 4YWOA 3EANA 4TM3A 3IF9A 1VG0A 2XYOA 5KRQA 2VZ2A 2XVHA 5U63A 1MXTA 4IA6A 2QA2A 2WHDA 4H2QA 2X8HA 1IUTA 1GETA 1NHSA 2JBVA 2Q6UA 3F8DA 3G5RA 3K7TA 3QSSA 3UKKA 4CRTA 1XANA 3ZYXA 3BHFA 3ATRA 2RGHA 2R45A 2XLSA 1JNZA 4YTMA 4H4QA 4J56A 5J7XA 3AE3A 1MO9A 1REOA 2WEUA 2E4GA 4H50A 5KOXA 2EQ8A 3NT6A 2WPFA 2GR3A 3UKHA 3VR8A 1H81A 3ISHA 1FECA 2GRTA 4B64A 4J33A 2BK5A 1VG9A 1GXFA 3SXIA 1N4WA 3AD9B 1YQ3A 1NHRA 3QVPA 4IVOB 4BURA 1YKJA 4JQ9A 1Y56A 2Z5YA 4H4VA 3QVRA 3UP4A 2YLTA 2B9XA 3K7QX 1H83A 3UP5A 2YQUA 3PO7A 1B5QA 4B63A 2H89A 1JU2A 1PXBA 2Q7VA 4XWZA 1GT8A 3P4SA 1VRQB 3AECA 2TPRA 3B6DA 3AE2A 5FS9A 2VQ7A 3DA1A 3V3OA 3P4PA 1TYPA 3OC4A 4ECHA 1Q1WA 1P2EA 2IIDA 3COXA 1RYIA 2YG4A 4ZCCA 1D7YA 1N4UA 4AOSA 5KXJA 3GD3A 1PN0A 1E1KA 2B7RA 4H2PA 3AEBA 3HYWA 2HQMA 4UDRA 3SM8A 4BK1A 3B3RA 5FS7A 2BK4A 3URHA 3DGZA 4CCRA 2GB0A 3NTAA 4K8DA 3ZDNA 4A99A 3GYXA 5HYMA 4RSLA 2PYXA 1NEKA 4EQWA 3CNDA 3SZWA 1LPFA 2BC0A 4USQA 5EB5A 4BJZA 1XPQA 3T2KA 1CC6A 4H2NA 3DMEA 4A6NA 3SZFA 4H4PA 4HA6A 3UOXA 3T2YA 4EIQA 2X8CA 1DJNA 3V76A 3G5QA 4I59A 3P4RA 3AEEA 4RG4A 3L8KA 1K0IA 2WOVA 1DOEA 3UTHA 3LB8A 2APGA 4EIPA 1H82A 1OJDA 4NEWA 4P9SA 3BI2A 4GDEA 1GSNA 1LTXR 2OAMA 3NTDA 2NPXA 3IWAA 4LA1A 2R0CA 4TM4A 4U8JA 3T14A 2W0HA 3NKSA 3UOYA 3F8PA 1KSSA 2IVEA 1LQTA 3AE4A 1GEUA 4JNQA 4B69A 1NG3A 4K2XA 2XCGA 3KD9A 3ICTA 4U8OA 3VRAA 2WS3A 3K7MX 4OPTA 1DJQA 5LV9A 1NHPA 1QJDA 4I58A 4DSGA 3UTFA 4CBQA 3QSMA 3NGCX 4D04A 1GPEA 3M12A 2XFQA 3I6DA 2QCUA 1PJ6A 3NHOX 3ADAB 4H4TA 2XLUA 3UOZA 4CNJA 4WX1A 2V5ZA 3AE6A 1KNPA 1AOGA 2BXRA 1LV0A 1B4VA 1PDHA 3DGHA 2GV8A 4TLZA 3SZCA 4YSYA 1BWCA 2XFOA 1RP0A 2V3AA 3M0OA 2BCGG 5JCKA 1TYTA 1DXLA 1OJ9A 1TDOA 2Q0LA 4C3XA 4U8PA 1BZLA 4MJWA 4OCGA 4OPIA 4Y4NA 1PJ7A 2YR4A 4CCQA 3GMBA 2IVDA 3T37A 4AOXA 4EM3A 2A89A 1BGJA 2GQFA 4EMJA 3S61A 3KKJA 1IUSA 1NPXA 4GAVA 3G5SA 4CNKA 5EOWA 2OLOA 4Y4MA 4B68A 5J60A 1E1LA 2GR1A 2V61A 4PABA 4Z25A 2R0GA 3DJDA 4O5UA 2WU2A 4DGKA 3UKPA 4C74A 4A65A 1LJ1A 2F5ZA 2EQ9A 4H4YA 2OA1A 4H4RA 2XVFA 1K0JA 2VRLA
chains in the Genus database with same CATH topology
2AR8A 2FJEA 2JK6A 2WETA 2V3BA 2XDOA 2ZZCA 2YM1A 3AEFA 4EQSA 2YG3A 3DJJA 4K22A 2YG6A 4NEVA 1ZOVA 2Y6QA 4ADWA 2E1MA 2ZZBA 4G9KA 4UP3A 5GRTA 2GVCA 5GSNA 1H84A 3E1TA 1Q9IA 3GD4A 1XDIA 3NRNA 4H4ZA 1JRXA 1SEZA 3D8XA 3FMWA 4ZCDA 3AD8B 2FJAA 3AYLA 4GDPA 4BK3A 4GAPA 2YVGA 3KPFA 3LADA 4JN9A 4BV6A 1DOBA 3CGCA 2GAHB 4B66A 4GRTA 1Z6LA 1X31B 3UKQA 1HYUA 2FBWA 1OJCA 1N4VA 1L0VA 1S2QA 3GSIA 1Y56B 1ZKQA 4BJYA 1PHHA 1H6VA 3GMCA 1GV4A 2WESA 4YKGA 4Z26A 5JCIA 1NAAA 3AWIA 2C65A 2RABA 2B76A 4TLXA 4TM1A 2B7SA 4APNA 3SYIA 3AYIA 1DOCA 2YVJA 4II3A 4BK2A 3CTYA 3NYCA 2BC1A 3CGEA 1E6EA 3NIXA 5KMSA 4U8IA 2PHHA 3GWFA 3Q6JA 1PJ5A 2WDRA 1NHQA 5KNLA 2C75A 1F6MA 1D4EA 2XFUA 5JCLA 2BA9A 3C4AA 2WU5A 3GYIA 3CPHG 4J57A 4X4JA 2VVMA 2XVIA 4OPUA 3CNTA 1K4QA 5IQ1A 1PXCA 2JB1A 4RG3A 1OJTA 3LOVA 1RSGA 3P4QA 2Q0KA 2BS4A 4K5RA 3T2ZA 2GH5A 1QO8A 3UTGA 4H4UA 5U1OA 4II2A 1L9EA 3AEDA 1TDEA 4C77A 3AYJA 2R4JA 2BS3A 3K30A 2BACA 2B9YA 3DK4A 1E7PA 1ZX9A 2B9WA 2GMHA 4D03A 4UDQA 2XFPA 4J2WA 3PVCA 4OVIA 5FS6A 2I0ZA 1D7LA 1F8WA 3CIRA 1E1MA 3CN8A 3GRSA 1EL7A 2E5VA 5KVIA 3FG2P 4GUVA 4JDRA 2C67A 4NTEA 3VRDB 3DK9A 3SFDA 1F8RA 1YQZA 2R0PA 2X99A 1D4DA 2FJDA 4AT2A 4JNAA 1L9CA 1Q1RA 3QFAA 2H88A 3L1RA 2VQBA 1LVLA 4NTCA 4EQRA 2JB3A 1FEAA 2YG5A 1TDNA 3ALMA 3KPKA 4B65A 3SY4A 1VDCA 3UOVA 3AE7A 4C3YA 1OJAA 2YLSA 2EQ7A 3DJGX 4YT0A 1CBOA 3R9UA 1GTEA 3AEGA 4U2SA 2YR5A 2A8XA 2YAUA 3AXBA 2X50A 4XWRA 2C72A 3SFEA 4AT0A 1JRYA 1E39A 3VRBA 5L46A 3NK2X 5CKUA 1PBDA 2YLRA 3P9UA 1PXAA 2ZZ0A 2CDUA 1CC2A 1KDGA 1N1PA 1YQ4A 3HYVA 5BVAA 1FCDA 1TRBA 3BNMA 2WDVA 4IVMB 4FK1A 1CC4A 1COYA 1GESA 3H4KA 5KMQA 5ER0A 2GEWA 2WP6A 5IPYA 4OPGA 3NK0X 1DNCA 2OLNA 1JRZA 3UCLA 3AEAA 3AE1A 4LIIA 3SQPA 2XFNA 5EB4A 3VQRA 1ZDLA 1GRGA 4Z43A 4G74A 3ICRA 1KNRA 1GTHA 3AD7B 3FIMB 4AP3A 2C7GA 4B67A 3T31A 4Z2TA 1GRBA 2WBAA 3ATQA 4JY2A 2V6OA 4YTNA 1GRFA 2X8GA 3C96A 1TDFA 1EL5A 4H7UA 2YVFA 3F8RA 1EL9A 2AQJA 1FL2A 3NYFA 2C76A 3PS9A 3QFBA 4A79A 4U8MA 5BULA 3M13A 1FEBA 2BABA 4IV9A 4LU6A 4YXDA 2C73A 4Z24A 1CL0A 1NG4A 1ZOYA 2CFYA 5KWFA 5KOWA 3I3LA 4YSZA 3HZLA 3AB1A 4NWZA 3H8IA 3RNMA 3UKFA 4CY8A 2R9ZA 4USRA 1P2HA 1S3EA 3NK1X 4U8KA 4EM4A 3ALJA 3EF6A 1KSUA 4ZN0A 1XHCA 5HY5A 3CGDA 3V3NA 1ZY8A 2CVJA 1D5TA 4H2RA 4KX6A 3RP8A 4Z2UA 4K5SA 3IC9A 4GR1A 1JEHA 4EMIA 3KA7A 3RP7A 2DKIA 1GOSA 3SGLA 1H7XA 4J34A 1BKWA 4X9NA 4FK1C 4UDPA 3T0KA 3WE0A 3JSKA 2ARDA 2OALA 5HXIA 1H86A 2QAEA 3NH3X 1S2YA 3NN6X 3UKAA 3SZ0A 3C4NA 2WOWA 4U8NA 3NNEA 2CULA 4YSXA 2YLZA 2Z5XA 2BS2A 3BI5A 3GWDA 1JNRA 2AAQA 4N9XA 2WPEA 5FS8A 3RHAA 3CPJG 1CJ4A 1W4XA 3CNPA 2YLWA 3ICSA 2O9ZA 4A5LA 4CY6A 3BNUA 4OPDA 1L9DA 3AE8A 2UZZA 2DKHA 5CQFA 1NENA 1UKVG 2C66A 3KLJA 2Y6RA 3SX6A 3RP6A 2C70A 5M10A 2JAEA 1O95A 2JKCA 4H4WA 3AE5A 4ICYA 2RGOA 1DODA 1GNDA 3ITJA 3LZWA 2TMDA 4JY3A 4NTDA 1CJ3A 2FJBA 1IUUA 3CNSA 4IA5A 2QA1A 4A6NB 3UKLA 1GRTA 2ZBWA 3BI4A 4G6GA 1K0LA 1IUWA 3BHKA 4Y4LA 4DSHA 5KMPA 1JOAA 5BUKA 1GALA 2GAGB 2J3NA 3NLCA 2YWLA 1BGNA 1GERA 4U2LA 4C5OA 2VVLA 3GDPA 2R46A 3IHGA 1PBBA 4REKA 1LQUA 3S5WA 4EQXA 1IUXA 1F3PA 2BK3A 3NG7X 1M6IA 3UTEA 3CGBA 1KFYA 3CPIG 5DBJA 1TDKA 4NZHA 3KU9A 4PAAA 5KMRA 4YKFA 1O94A 3QSEA 1IUVA 4YSHA 2C64A 3EAOA 4A9WA 5JCMA 3QJ4A 1IJHA 1KF6A 2BYBA 3O0HA 5KVHA 3GRTA 1PBFA 2C3CA 3H8LA 3OZ2A 4WCTA 3LXDA 4EMWA 2YLXA 4X9MA 5BRTA 1GREA 2BRAA 4Z44A 4A7AA 1QLBA 5IQ4A 5TR3A 1FOHA 1PBEA 2GQWA 1BF3A 3CMMA 4G73A 2X3NA 1D4CA 2XLRA 4FDCB 4U2TA 1ONFA 1MOKA 2XVEA 4Z2RA 1ZP0A 2VRMA 1ZMDA 2RGJA 3GYJA 4HB9A 4M52A 4J36A 2JB2A 3LJPA 2YG7A 3DH9A 4G6HA 2WDQA 3EPTA 4KPRA 2VOUA 1H7WA 4GF7A 3AE9A 2XVJA 4NNJA 5M0ZA 4H4XA 2WP5A 3P1WA 3HYXA 2YM2A 4K7ZA 4O5QA 2GF3A 1ZK7A 4DNAA 2BCPA 2VVLG 2C3DA 1ZMCA 1S3BA 2EQ6A 1ELIA 1F8SA 1PBCA 1PS9A 1GRAA 3Q9TA 4U8LA 1CF3A 3FBSA 3IHMA 2A87A 2BRYA 1EL8A 3GDNA 2YR6A 3LZXA 2WP9A 3DJEA 1B8SA 1NDAA 1O5WA 2WPCA 3REDA 4YTPA 4AP1A 1YY5A 5JCNA 3NN0X 5FMHA 5U25A 1E1NA 3CNJA 3FPZA 5EBKA 3VR9A 1CHUA 1CJ2A 3DK8A 1B37A 3D1CA 5C2TA 2R4EA 4TM0A 1VQWA 4J31A 4OPCA 2C4CA 2V60A 1V59A 2NVKX 4H4SA 1EBDA 2GR0A 1M64A 2WQYA 2XLTA 4XXGA 3KVEA 2WOIA 2GR2A 3NYEA 4B1BA 3ABVA 1CJCA 2ACZA 4FX9A 2XLPA 2BXSA 3ALLA 1Y0PA 5HHFA 4GCMA 4E0VA 5C3JA 2GMJA 1GRHA 4OPLA 3II4A 4YWOA 3EANA 4TM3A 3IF9A 1VG0A 2XYOA 5KRQA 2VZ2A 2XVHA 5U63A 1MXTA 4IA6A 2QA2A 2WHDA 4H2QA 2X8HA 1IUTA 1GETA 1NHSA 2JBVA 2Q6UA 3F8DA 3G5RA 3K7TA 3QSSA 3UKKA 4CRTA 1XANA 3ZYXA 3BHFA 3ATRA 2RGHA 2R45A 2XLSA 1JNZA 4YTMA 4H4QA 4J56A 5J7XA 3AE3A 1MO9A 1REOA 2WEUA 2E4GA 4H50A 5KOXA 2EQ8A 3NT6A 2WPFA 2GR3A 3UKHA 3VR8A 1H81A 3ISHA 1FECA 2GRTA 4B64A 4J33A 2BK5A 1VG9A 1GXFA 3SXIA 1N4WA 3AD9B 1YQ3A 1NHRA 3QVPA 4IVOB 4BURA 1YKJA 4JQ9A 1Y56A 2Z5YA 4H4VA 3QVRA 3UP4A 2YLTA 2B9XA 3K7QX 1H83A 3UP5A 2YQUA 3PO7A 1B5QA 4B63A 2H89A 1JU2A 1PXBA 2Q7VA 4XWZA 1GT8A 3P4SA 1VRQB 3AECA 2TPRA 3B6DA 3AE2A 5FS9A 2VQ7A 3DA1A 3V3OA 3P4PA 1TYPA 3OC4A 4ECHA 1Q1WA 1P2EA 2IIDA 3COXA 1RYIA 2YG4A 4ZCCA 1D7YA 1N4UA 4AOSA 5KXJA 3GD3A 1PN0A 1E1KA 2B7RA 4H2PA 3AEBA 3HYWA 2HQMA 4UDRA 3SM8A 4BK1A 3B3RA 5FS7A 2BK4A 3URHA 3DGZA 4CCRA 2GB0A 3NTAA 4K8DA 3ZDNA 4A99A 3GYXA 5HYMA 4RSLA 2PYXA 1NEKA 4EQWA 3CNDA 3SZWA 1LPFA 2BC0A 4USQA 5EB5A 4BJZA 1XPQA 3T2KA 1CC6A 4H2NA 3DMEA 4A6NA 3SZFA 4H4PA 4HA6A 3UOXA 3T2YA 4EIQA 2X8CA 1DJNA 3V76A 3G5QA 4I59A 3P4RA 3AEEA 4RG4A 3L8KA 1K0IA 2WOVA 1DOEA 3UTHA 3LB8A 2APGA 4EIPA 1H82A 1OJDA 4NEWA 4P9SA 3BI2A 4GDEA 1GSNA 1LTXR 2OAMA 3NTDA 2NPXA 3IWAA 4LA1A 2R0CA 4TM4A 4U8JA 3T14A 2W0HA 3NKSA 3UOYA 3F8PA 1KSSA 2IVEA 1LQTA 3AE4A 1GEUA 4JNQA 4B69A 1NG3A 4K2XA 2XCGA 3KD9A 3ICTA 4U8OA 3VRAA 2WS3A 3K7MX 4OPTA 1DJQA 5LV9A 1NHPA 1QJDA 4I58A 4DSGA 3UTFA 4CBQA 3QSMA 3NGCX 4D04A 1GPEA 3M12A 2XFQA 3I6DA 2QCUA 1PJ6A 3NHOX 3ADAB 4H4TA 2XLUA 3UOZA 4CNJA 4WX1A 2V5ZA 3AE6A 1KNPA 1AOGA 2BXRA 1LV0A 1B4VA 1PDHA 3DGHA 2GV8A 4TLZA 3SZCA 4YSYA 1BWCA 2XFOA 1RP0A 2V3AA 3M0OA 2BCGG 5JCKA 1TYTA 1DXLA 1OJ9A 1TDOA 2Q0LA 4C3XA 4U8PA 1BZLA 4MJWA 4OCGA 4OPIA 4Y4NA 1PJ7A 2YR4A 4CCQA 3GMBA 2IVDA 3T37A 4AOXA 4EM3A 2A89A 1BGJA 2GQFA 4EMJA 3S61A 3KKJA 1IUSA 1NPXA 4GAVA 3G5SA 4CNKA 5EOWA 2OLOA 4Y4MA 4B68A 5J60A 1E1LA 2GR1A 2V61A 4PABA 4Z25A 2R0GA 3DJDA 4O5UA 2WU2A 4DGKA 3UKPA 4C74A 4A65A 1LJ1A 2F5ZA 2EQ9A 4H4YA 2OA1A 4H4RA 2XVFA 1K0JA 2VRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0K A;  5KMQ A;  3T2K A;  3KPK A;  3SY4 A;  3SZ0 A;  3HYX A;  4G9K A;  3SZF A;  3SYI A;  4G6G A;  3T2Y A;  4NWZ A;  5KMP A;  4GAV A;  3T2Z A;  5KMS A;  4G74 A;  4GAP A;  4G73 A;  3T31 A;  3HYW A;  3SXI A;  3SX6 A;  3HYV A;  3SZC A;  4G6H A;  3T14 A;  5KMR A;  3SZW A; 
#chains in the Genus database with same CATH topology
 2AR8 A;  2FJE A;  2JK6 A;  2WET A;  2V3B A;  2XDO A;  2ZZC A;  2YM1 A;  3AEF A;  4EQS A;  2YG3 A;  3DJJ A;  4K22 A;  2YG6 A;  4NEV A;  1ZOV A;  2Y6Q A;  4ADW A;  2E1M A;  2ZZB A;  4G9K A;  4UP3 A;  5GRT A;  2GVC A;  5GSN A;  1H84 A;  3E1T A;  1Q9I A;  3GD4 A;  1XDI A;  3NRN A;  4H4Z A;  1JRX A;  1SEZ A;  3D8X A;  3FMW A;  4ZCD A;  3AD8 B;  2FJA A;  3AYL A;  4GDP A;  4BK3 A;  4GAP A;  2YVG A;  3KPF A;  3LAD A;  4JN9 A;  4BV6 A;  1DOB A;  3CGC A;  2GAH B;  4B66 A;  4GRT A;  1Z6L A;  1X31 B;  3UKQ A;  1HYU A;  2FBW A;  1OJC A;  1N4V A;  1L0V A;  1S2Q A;  3GSI A;  1Y56 B;  1ZKQ A;  4BJY A;  1PHH A;  1H6V A;  3GMC A;  1GV4 A;  2WES A;  4YKG A;  4Z26 A;  5JCI A;  1NAA A;  3AWI A;  2C65 A;  2RAB A;  2B76 A;  4TLX A;  4TM1 A;  2B7S A;  4APN A;  3SYI A;  3AYI A;  1DOC A;  2YVJ A;  4II3 A;  4BK2 A;  3CTY A;  3NYC A;  2BC1 A;  3CGE A;  1E6E A;  3NIX A;  5KMS A;  4U8I A;  2PHH A;  3GWF A;  3Q6J A;  1PJ5 A;  2WDR A;  1NHQ A;  5KNL A;  2C75 A;  1F6M A;  1D4E A;  2XFU A;  5JCL A;  2BA9 A;  3C4A A;  2WU5 A;  3GYI A;  3CPH G;  4J57 A;  4X4J A;  2VVM A;  2XVI A;  4OPU A;  3CNT A;  1K4Q A;  5IQ1 A;  1PXC A;  2JB1 A;  4RG3 A;  1OJT A;  3LOV A;  1RSG A;  3P4Q A;  2Q0K A;  2BS4 A;  4K5R A;  3T2Z A;  2GH5 A;  1QO8 A;  3UTG A;  4H4U A;  5U1O A;  4II2 A;  1L9E A;  3AED A;  1TDE A;  4C77 A;  3AYJ A;  2R4J A;  2BS3 A;  3K30 A;  2BAC A;  2B9Y A;  3DK4 A;  1E7P A;  1ZX9 A;  2B9W A;  2GMH A;  4D03 A;  4UDQ A;  2XFP A;  4J2W A;  3PVC A;  4OVI A;  5FS6 A;  2I0Z A;  1D7L A;  1F8W A;  3CIR A;  1E1M A;  3CN8 A;  3GRS A;  1EL7 A;  2E5V A;  5KVI A;  3FG2 P;  4GUV A;  4JDR A;  2C67 A;  4NTE A;  3VRD B;  3DK9 A;  3SFD A;  1F8R A;  1YQZ A;  2R0P A;  2X99 A;  1D4D A;  2FJD A;  4AT2 A;  4JNA A;  1L9C A;  1Q1R A;  3QFA A;  2H88 A;  3L1R A;  2VQB A;  1LVL A;  4NTC A;  4EQR A;  2JB3 A;  1FEA A;  2YG5 A;  1TDN A;  3ALM A;  3KPK A;  4B65 A;  3SY4 A;  1VDC A;  3UOV A;  3AE7 A;  4C3Y A;  1OJA A;  2YLS A;  2EQ7 A;  3DJG X;  4YT0 A;  1CBO A;  3R9U A;  1GTE A;  3AEG A;  4U2S A;  2YR5 A;  2A8X A;  2YAU A;  3AXB A;  2X50 A;  4XWR A;  2C72 A;  3SFE A;  4AT0 A;  1JRY A;  1E39 A;  3VRB A;  5L46 A;  3NK2 X;  5CKU A;  1PBD A;  2YLR A;  3P9U A;  1PXA A;  2ZZ0 A;  2CDU A;  1CC2 A;  1KDG A;  1N1P A;  1YQ4 A;  3HYV A;  5BVA A;  1FCD A;  1TRB A;  3BNM A;  2WDV A;  4IVM B;  4FK1 A;  1CC4 A;  1COY A;  1GES A;  3H4K A;  5KMQ A;  5ER0 A;  2GEW A;  2WP6 A;  5IPY A;  4OPG A;  3NK0 X;  1DNC A;  2OLN A;  1JRZ A;  3UCL A;  3AEA A;  3AE1 A;  4LII A;  3SQP A;  2XFN A;  5EB4 A;  3VQR A;  1ZDL A;  1GRG A;  4Z43 A;  4G74 A;  3ICR A;  1KNR A;  1GTH A;  3AD7 B;  3FIM B;  4AP3 A;  2C7G A;  4B67 A;  3T31 A;  4Z2T A;  1GRB A;  2WBA A;  3ATQ A;  4JY2 A;  2V6O A;  4YTN A;  1GRF A;  2X8G A;  3C96 A;  1TDF A;  1EL5 A;  4H7U A;  2YVF A;  3F8R A;  1EL9 A;  2AQJ A;  1FL2 A;  3NYF A;  2C76 A;  3PS9 A;  3QFB A;  4A79 A;  4U8M A;  5BUL A;  3M13 A;  1FEB A;  2BAB A;  4IV9 A;  4LU6 A;  4YXD A;  2C73 A;  4Z24 A;  1CL0 A;  1NG4 A;  1ZOY A;  2CFY A;  5KWF A;  5KOW A;  3I3L A;  4YSZ A;  3HZL A;  3AB1 A;  4NWZ A;  3H8I A;  3RNM A;  3UKF A;  4CY8 A;  2R9Z A;  4USR A;  1P2H A;  1S3E A;  3NK1 X;  4U8K A;  4EM4 A;  3ALJ A;  3EF6 A;  1KSU A;  4ZN0 A;  1XHC A;  5HY5 A;  3CGD A;  3V3N A;  1ZY8 A;  2CVJ A;  1D5T A;  4H2R A;  4KX6 A;  3RP8 A;  4Z2U A;  4K5S A;  3IC9 A;  4GR1 A;  1JEH A;  4EMI A;  3KA7 A;  3RP7 A;  2DKI A;  1GOS A;  3SGL A;  1H7X A;  4J34 A;  1BKW A;  4X9N A;  4FK1 C;  4UDP A;  3T0K A;  3WE0 A;  3JSK A;  2ARD A;  2OAL A;  5HXI A;  1H86 A;  2QAE A;  3NH3 X;  1S2Y A;  3NN6 X;  3UKA A;  3SZ0 A;  3C4N A;  2WOW A;  4U8N A;  3NNE A;  2CUL A;  4YSX A;  2YLZ A;  2Z5X A;  2BS2 A;  3BI5 A;  3GWD A;  1JNR A;  2AAQ A;  4N9X A;  2WPE A;  5FS8 A;  3RHA A;  3CPJ G;  1CJ4 A;  1W4X A;  3CNP A;  2YLW A;  3ICS A;  2O9Z A;  4A5L A;  4CY6 A;  3BNU A;  4OPD A;  1L9D A;  3AE8 A;  2UZZ A;  2DKH A;  5CQF A;  1NEN A;  1UKV G;  2C66 A;  3KLJ A;  2Y6R A;  3SX6 A;  3RP6 A;  2C70 A;  5M10 A;  2JAE A;  1O95 A;  2JKC A;  4H4W A;  3AE5 A;  4ICY A;  2RGO A;  1DOD A;  1GND A;  3ITJ A;  3LZW A;  2TMD A;  4JY3 A;  4NTD A;  1CJ3 A;  2FJB A;  1IUU A;  3CNS A;  4IA5 A;  2QA1 A;  4A6N B;  3UKL A;  1GRT A;  2ZBW A;  3BI4 A;  4G6G A;  1K0L A;  1IUW A;  3BHK A;  4Y4L A;  4DSH A;  5KMP A;  1JOA A;  5BUK A;  1GAL A;  2GAG B;  2J3N A;  3NLC A;  2YWL A;  1BGN A;  1GER A;  4U2L A;  4C5O A;  2VVL A;  3GDP A;  2R46 A;  3IHG A;  1PBB A;  4REK A;  1LQU A;  3S5W A;  4EQX A;  1IUX A;  1F3P A;  2BK3 A;  3NG7 X;  1M6I A;  3UTE A;  3CGB A;  1KFY A;  3CPI G;  5DBJ A;  1TDK A;  4NZH A;  3KU9 A;  4PAA A;  5KMR A;  4YKF A;  1O94 A;  3QSE A;  1IUV A;  4YSH A;  2C64 A;  3EAO A;  4A9W A;  5JCM A;  3QJ4 A;  1IJH A;  1KF6 A;  2BYB A;  3O0H A;  5KVH A;  3GRT A;  1PBF A;  2C3C A;  3H8L A;  3OZ2 A;  4WCT A;  3LXD A;  4EMW A;  2YLX A;  4X9M A;  5BRT A;  1GRE A;  2BRA A;  4Z44 A;  4A7A A;  1QLB A;  5IQ4 A;  5TR3 A;  1FOH A;  1PBE A;  2GQW A;  1BF3 A;  3CMM A;  4G73 A;  2X3N A;  1D4C A;  2XLR A;  4FDC B;  4U2T A;  1ONF A;  1MOK A;  2XVE A;  4Z2R A;  1ZP0 A;  2VRM A;  1ZMD A;  2RGJ A;  3GYJ A;  4HB9 A;  4M52 A;  4J36 A;  2JB2 A;  3LJP A;  2YG7 A;  3DH9 A;  4G6H A;  2WDQ A;  3EPT A;  4KPR A;  2VOU A;  1H7W A;  4GF7 A;  3AE9 A;  2XVJ A;  4NNJ A;  5M0Z A;  4H4X A;  2WP5 A;  3P1W A;  3HYX A;  2YM2 A;  4K7Z A;  4O5Q A;  2GF3 A;  1ZK7 A;  4DNA A;  2BCP A;  2VVL G;  2C3D A;  1ZMC A;  1S3B A;  2EQ6 A;  1ELI A;  1F8S A;  1PBC A;  1PS9 A;  1GRA A;  3Q9T A;  4U8L A;  1CF3 A;  3FBS A;  3IHM A;  2A87 A;  2BRY A;  1EL8 A;  3GDN A;  2YR6 A;  3LZX A;  2WP9 A;  3DJE A;  1B8S A;  1NDA A;  1O5W A;  2WPC A;  3RED A;  4YTP A;  4AP1 A;  1YY5 A;  5JCN A;  3NN0 X;  5FMH A;  5U25 A;  1E1N A;  3CNJ A;  3FPZ A;  5EBK A;  3VR9 A;  1CHU A;  1CJ2 A;  3DK8 A;  1B37 A;  3D1C A;  5C2T A;  2R4E A;  4TM0 A;  1VQW A;  4J31 A;  4OPC A;  2C4C A;  2V60 A;  1V59 A;  2NVK X;  4H4S A;  1EBD A;  2GR0 A;  1M64 A;  2WQY A;  2XLT A;  4XXG A;  3KVE A;  2WOI A;  2GR2 A;  3NYE A;  4B1B A;  3ABV A;  1CJC A;  2ACZ A;  4FX9 A;  2XLP A;  2BXS A;  3ALL A;  1Y0P A;  5HHF A;  4GCM A;  4E0V A;  5C3J A;  2GMJ A;  1GRH A;  4OPL A;  3II4 A;  4YWO A;  3EAN A;  4TM3 A;  3IF9 A;  1VG0 A;  2XYO A;  5KRQ A;  2VZ2 A;  2XVH A;  5U63 A;  1MXT A;  4IA6 A;  2QA2 A;  2WHD A;  4H2Q A;  2X8H A;  1IUT A;  1GET A;  1NHS A;  2JBV A;  2Q6U A;  3F8D A;  3G5R A;  3K7T A;  3QSS A;  3UKK A;  4CRT A;  1XAN A;  3ZYX A;  3BHF A;  3ATR A;  2RGH A;  2R45 A;  2XLS A;  1JNZ A;  4YTM A;  4H4Q A;  4J56 A;  5J7X A;  3AE3 A;  1MO9 A;  1REO A;  2WEU A;  2E4G A;  4H50 A;  5KOX A;  2EQ8 A;  3NT6 A;  2WPF A;  2GR3 A;  3UKH A;  3VR8 A;  1H81 A;  3ISH A;  1FEC A;  2GRT A;  4B64 A;  4J33 A;  2BK5 A;  1VG9 A;  1GXF A;  3SXI A;  1N4W A;  3AD9 B;  1YQ3 A;  1NHR A;  3QVP A;  4IVO B;  4BUR A;  1YKJ A;  4JQ9 A;  1Y56 A;  2Z5Y A;  4H4V A;  3QVR A;  3UP4 A;  2YLT A;  2B9X A;  3K7Q X;  1H83 A;  3UP5 A;  2YQU A;  3PO7 A;  1B5Q A;  4B63 A;  2H89 A;  1JU2 A;  1PXB A;  2Q7V A;  4XWZ A;  1GT8 A;  3P4S A;  1VRQ B;  3AEC A;  2TPR A;  3B6D A;  3AE2 A;  5FS9 A;  2VQ7 A;  3DA1 A;  3V3O A;  3P4P A;  1TYP A;  3OC4 A;  4ECH A;  1Q1W A;  1P2E A;  2IID A;  3COX A;  1RYI A;  2YG4 A;  4ZCC A;  1D7Y A;  1N4U A;  4AOS A;  5KXJ A;  3GD3 A;  1PN0 A;  1E1K A;  2B7R A;  4H2P A;  3AEB A;  3HYW A;  2HQM A;  4UDR A;  3SM8 A;  4BK1 A;  3B3R A;  5FS7 A;  2BK4 A;  3URH A;  3DGZ A;  4CCR A;  2GB0 A;  3NTA A;  4K8D A;  3ZDN A;  4A99 A;  3GYX A;  5HYM A;  4RSL A;  2PYX A;  1NEK A;  4EQW A;  3CND A;  3SZW A;  1LPF A;  2BC0 A;  4USQ A;  5EB5 A;  4BJZ A;  1XPQ A;  3T2K A;  1CC6 A;  4H2N A;  3DME A;  4A6N A;  3SZF A;  4H4P A;  4HA6 A;  3UOX A;  3T2Y A;  4EIQ A;  2X8C A;  1DJN A;  3V76 A;  3G5Q A;  4I59 A;  3P4R A;  3AEE A;  4RG4 A;  3L8K A;  1K0I A;  2WOV A;  1DOE A;  3UTH A;  3LB8 A;  2APG A;  4EIP A;  1H82 A;  1OJD A;  4NEW A;  4P9S A;  3BI2 A;  4GDE A;  1GSN A;  1LTX R;  2OAM A;  3NTD A;  2NPX A;  3IWA A;  4LA1 A;  2R0C A;  4TM4 A;  4U8J A;  3T14 A;  2W0H A;  3NKS A;  3UOY A;  3F8P A;  1KSS A;  2IVE A;  1LQT A;  3AE4 A;  1GEU A;  4JNQ A;  4B69 A;  1NG3 A;  4K2X A;  2XCG A;  3KD9 A;  3ICT A;  4U8O A;  3VRA A;  2WS3 A;  3K7M X;  4OPT A;  1DJQ A;  5LV9 A;  1NHP A;  1QJD A;  4I58 A;  4DSG A;  3UTF A;  4CBQ A;  3QSM A;  3NGC X;  4D04 A;  1GPE A;  3M12 A;  2XFQ A;  3I6D A;  2QCU A;  1PJ6 A;  3NHO X;  3ADA B;  4H4T A;  2XLU A;  3UOZ A;  4CNJ A;  4WX1 A;  2V5Z A;  3AE6 A;  1KNP A;  1AOG A;  2BXR A;  1LV0 A;  1B4V A;  1PDH A;  3DGH A;  2GV8 A;  4TLZ A;  3SZC A;  4YSY A;  1BWC A;  2XFO A;  1RP0 A;  2V3A A;  3M0O A;  2BCG G;  5JCK A;  1TYT A;  1DXL A;  1OJ9 A;  1TDO A;  2Q0L A;  4C3X A;  4U8P A;  1BZL A;  4MJW A;  4OCG A;  4OPI A;  4Y4N A;  1PJ7 A;  2YR4 A;  4CCQ A;  3GMB A;  2IVD A;  3T37 A;  4AOX A;  4EM3 A;  2A89 A;  1BGJ A;  2GQF A;  4EMJ A;  3S61 A;  3KKJ A;  1IUS A;  1NPX A;  4GAV A;  3G5S A;  4CNK A;  5EOW A;  2OLO A;  4Y4M A;  4B68 A;  5J60 A;  1E1L A;  2GR1 A;  2V61 A;  4PAB A;  4Z25 A;  2R0G A;  3DJD A;  4O5U A;  2WU2 A;  4DGK A;  3UKP A;  4C74 A;  4A65 A;  1LJ1 A;  2F5Z A;  2EQ9 A;  4H4Y A;  2OA1 A;  4H4R A;  2XVF A;  1K0J A;  2VRL A; 
#chains in the Genus database with same CATH homology
 2AR8 A;  2FJE A;  2JK6 A;  2WET A;  2V3B A;  2XDO A;  2ZZC A;  2YM1 A;  3AEF A;  4EQS A;  2YG3 A;  3DJJ A;  4K22 A;  2YG6 A;  4NEV A;  1ZOV A;  2Y6Q A;  4ADW A;  2E1M A;  2ZZB A;  4G9K A;  4UP3 A;  5GRT A;  2GVC A;  5GSN A;  1H84 A;  3E1T A;  1Q9I A;  3GD4 A;  1XDI A;  3NRN A;  4H4Z A;  1JRX A;  1SEZ A;  3D8X A;  3FMW A;  4ZCD A;  3AD8 B;  2FJA A;  3AYL A;  4GDP A;  4BK3 A;  4GAP A;  2YVG A;  3KPF A;  3LAD A;  4JN9 A;  4BV6 A;  1DOB A;  3CGC A;  2GAH B;  4B66 A;  4GRT A;  1Z6L A;  1X31 B;  3UKQ A;  1HYU A;  2FBW A;  1OJC A;  1N4V A;  1L0V A;  1S2Q A;  3GSI A;  1Y56 B;  1ZKQ A;  4BJY A;  1PHH A;  1H6V A;  3GMC A;  1GV4 A;  2WES A;  4YKG A;  4Z26 A;  5JCI A;  1NAA A;  3AWI A;  2C65 A;  2RAB A;  2B76 A;  4TLX A;  4TM1 A;  2B7S A;  4APN A;  3SYI A;  3AYI A;  1DOC A;  2YVJ A;  4II3 A;  4BK2 A;  3CTY A;  3NYC A;  2BC1 A;  3CGE A;  1E6E A;  3NIX A;  5KMS A;  4U8I A;  2PHH A;  3GWF A;  3Q6J A;  1PJ5 A;  2WDR A;  1NHQ A;  5KNL A;  2C75 A;  1F6M A;  1D4E A;  2XFU A;  5JCL A;  2BA9 A;  3C4A A;  2WU5 A;  3GYI A;  3CPH G;  4J57 A;  4X4J A;  2VVM A;  2XVI A;  4OPU A;  3CNT A;  1K4Q A;  5IQ1 A;  1PXC A;  2JB1 A;  4RG3 A;  1OJT A;  3LOV A;  1RSG A;  3P4Q A;  2Q0K A;  2BS4 A;  4K5R A;  3T2Z A;  2GH5 A;  1QO8 A;  3UTG A;  4H4U A;  5U1O A;  4II2 A;  1L9E A;  3AED A;  1TDE A;  4C77 A;  3AYJ A;  2R4J A;  2BS3 A;  3K30 A;  2BAC A;  2B9Y A;  3DK4 A;  1E7P A;  1ZX9 A;  2B9W A;  2GMH A;  4D03 A;  4UDQ A;  2XFP A;  4J2W A;  3PVC A;  4OVI A;  5FS6 A;  2I0Z A;  1D7L A;  1F8W A;  3CIR A;  1E1M A;  3CN8 A;  3GRS A;  1EL7 A;  2E5V A;  5KVI A;  3FG2 P;  4GUV A;  4JDR A;  2C67 A;  4NTE A;  3VRD B;  3DK9 A;  3SFD A;  1F8R A;  1YQZ A;  2R0P A;  2X99 A;  1D4D A;  2FJD A;  4AT2 A;  4JNA A;  1L9C A;  1Q1R A;  3QFA A;  2H88 A;  3L1R A;  2VQB A;  1LVL A;  4NTC A;  4EQR A;  2JB3 A;  1FEA A;  2YG5 A;  1TDN A;  3ALM A;  3KPK A;  4B65 A;  3SY4 A;  1VDC A;  3UOV A;  3AE7 A;  4C3Y A;  1OJA A;  2YLS A;  2EQ7 A;  3DJG X;  4YT0 A;  1CBO A;  3R9U A;  1GTE A;  3AEG A;  4U2S A;  2YR5 A;  2A8X A;  2YAU A;  3AXB A;  2X50 A;  4XWR A;  2C72 A;  3SFE A;  4AT0 A;  1JRY A;  1E39 A;  3VRB A;  5L46 A;  3NK2 X;  5CKU A;  1PBD A;  2YLR A;  3P9U A;  1PXA A;  2ZZ0 A;  2CDU A;  1CC2 A;  1KDG A;  1N1P A;  1YQ4 A;  3HYV A;  5BVA A;  1FCD A;  1TRB A;  3BNM A;  2WDV A;  4IVM B;  4FK1 A;  1CC4 A;  1COY A;  1GES A;  3H4K A;  5KMQ A;  5ER0 A;  2GEW A;  2WP6 A;  5IPY A;  4OPG A;  3NK0 X;  1DNC A;  2OLN A;  1JRZ A;  3UCL A;  3AEA A;  3AE1 A;  4LII A;  3SQP A;  2XFN A;  5EB4 A;  3VQR A;  1ZDL A;  1GRG A;  4Z43 A;  4G74 A;  3ICR A;  1KNR A;  1GTH A;  3AD7 B;  3FIM B;  4AP3 A;  2C7G A;  4B67 A;  3T31 A;  4Z2T A;  1GRB A;  2WBA A;  3ATQ A;  4JY2 A;  2V6O A;  4YTN A;  1GRF A;  2X8G A;  3C96 A;  1TDF A;  1EL5 A;  4H7U A;  2YVF A;  3F8R A;  1EL9 A;  2AQJ A;  1FL2 A;  3NYF A;  2C76 A;  3PS9 A;  3QFB A;  4A79 A;  4U8M A;  5BUL A;  3M13 A;  1FEB A;  2BAB A;  4IV9 A;  4LU6 A;  4YXD A;  2C73 A;  4Z24 A;  1CL0 A;  1NG4 A;  1ZOY A;  2CFY A;  5KWF A;  5KOW A;  3I3L A;  4YSZ A;  3HZL A;  3AB1 A;  4NWZ A;  3H8I A;  3RNM A;  3UKF A;  4CY8 A;  2R9Z A;  4USR A;  1P2H A;  1S3E A;  3NK1 X;  4U8K A;  4EM4 A;  3ALJ A;  3EF6 A;  1KSU A;  4ZN0 A;  1XHC A;  5HY5 A;  3CGD A;  3V3N A;  1ZY8 A;  2CVJ A;  1D5T A;  4H2R A;  4KX6 A;  3RP8 A;  4Z2U A;  4K5S A;  3IC9 A;  4GR1 A;  1JEH A;  4EMI A;  3KA7 A;  3RP7 A;  2DKI A;  1GOS A;  3SGL A;  1H7X A;  4J34 A;  1BKW A;  4X9N A;  4FK1 C;  4UDP A;  3T0K A;  3WE0 A;  3JSK A;  2ARD A;  2OAL A;  5HXI A;  1H86 A;  2QAE A;  3NH3 X;  1S2Y A;  3NN6 X;  3UKA A;  3SZ0 A;  3C4N A;  2WOW A;  4U8N A;  3NNE A;  2CUL A;  4YSX A;  2YLZ A;  2Z5X A;  2BS2 A;  3BI5 A;  3GWD A;  1JNR A;  2AAQ A;  4N9X A;  2WPE A;  5FS8 A;  3RHA A;  3CPJ G;  1CJ4 A;  1W4X A;  3CNP A;  2YLW A;  3ICS A;  2O9Z A;  4A5L A;  4CY6 A;  3BNU A;  4OPD A;  1L9D A;  3AE8 A;  2UZZ A;  2DKH A;  5CQF A;  1NEN A;  1UKV G;  2C66 A;  3KLJ A;  2Y6R A;  3SX6 A;  3RP6 A;  2C70 A;  5M10 A;  2JAE A;  1O95 A;  2JKC A;  4H4W A;  3AE5 A;  4ICY A;  2RGO A;  1DOD A;  1GND A;  3ITJ A;  3LZW A;  2TMD A;  4JY3 A;  4NTD A;  1CJ3 A;  2FJB A;  1IUU A;  3CNS A;  4IA5 A;  2QA1 A;  4A6N B;  3UKL A;  1GRT A;  2ZBW A;  3BI4 A;  4G6G A;  1K0L A;  1IUW A;  3BHK A;  4Y4L A;  4DSH A;  5KMP A;  1JOA A;  5BUK A;  1GAL A;  2GAG B;  2J3N A;  3NLC A;  2YWL A;  1BGN A;  1GER A;  4U2L A;  4C5O A;  2VVL A;  3GDP A;  2R46 A;  3IHG A;  1PBB A;  4REK A;  1LQU A;  3S5W A;  4EQX A;  1IUX A;  1F3P A;  2BK3 A;  3NG7 X;  1M6I A;  3UTE A;  3CGB A;  1KFY A;  3CPI G;  5DBJ A;  1TDK A;  4NZH A;  3KU9 A;  4PAA A;  5KMR A;  4YKF A;  1O94 A;  3QSE A;  1IUV A;  4YSH A;  2C64 A;  3EAO A;  4A9W A;  5JCM A;  3QJ4 A;  1IJH A;  1KF6 A;  2BYB A;  3O0H A;  5KVH A;  3GRT A;  1PBF A;  2C3C A;  3H8L A;  3OZ2 A;  4WCT A;  3LXD A;  4EMW A;  2YLX A;  4X9M A;  5BRT A;  1GRE A;  2BRA A;  4Z44 A;  4A7A A;  1QLB A;  5IQ4 A;  5TR3 A;  1FOH A;  1PBE A;  2GQW A;  1BF3 A;  3CMM A;  4G73 A;  2X3N A;  1D4C A;  2XLR A;  4FDC B;  4U2T A;  1ONF A;  1MOK A;  2XVE A;  4Z2R A;  1ZP0 A;  2VRM A;  1ZMD A;  2RGJ A;  3GYJ A;  4HB9 A;  4M52 A;  4J36 A;  2JB2 A;  3LJP A;  2YG7 A;  3DH9 A;  4G6H A;  2WDQ A;  3EPT A;  4KPR A;  2VOU A;  1H7W A;  4GF7 A;  3AE9 A;  2XVJ A;  4NNJ A;  5M0Z A;  4H4X A;  2WP5 A;  3P1W A;  3HYX A;  2YM2 A;  4K7Z A;  4O5Q A;  2GF3 A;  1ZK7 A;  4DNA A;  2BCP A;  2VVL G;  2C3D A;  1ZMC A;  1S3B A;  2EQ6 A;  1ELI A;  1F8S A;  1PBC A;  1PS9 A;  1GRA A;  3Q9T A;  4U8L A;  1CF3 A;  3FBS A;  3IHM A;  2A87 A;  2BRY A;  1EL8 A;  3GDN A;  2YR6 A;  3LZX A;  2WP9 A;  3DJE A;  1B8S A;  1NDA A;  1O5W A;  2WPC A;  3RED A;  4YTP A;  4AP1 A;  1YY5 A;  5JCN A;  3NN0 X;  5FMH A;  5U25 A;  1E1N A;  3CNJ A;  3FPZ A;  5EBK A;  3VR9 A;  1CHU A;  1CJ2 A;  3DK8 A;  1B37 A;  3D1C A;  5C2T A;  2R4E A;  4TM0 A;  1VQW A;  4J31 A;  4OPC A;  2C4C A;  2V60 A;  1V59 A;  2NVK X;  4H4S A;  1EBD A;  2GR0 A;  1M64 A;  2WQY A;  2XLT A;  4XXG A;  3KVE A;  2WOI A;  2GR2 A;  3NYE A;  4B1B A;  3ABV A;  1CJC A;  2ACZ A;  4FX9 A;  2XLP A;  2BXS A;  3ALL A;  1Y0P A;  5HHF A;  4GCM A;  4E0V A;  5C3J A;  2GMJ A;  1GRH A;  4OPL A;  3II4 A;  4YWO A;  3EAN A;  4TM3 A;  3IF9 A;  1VG0 A;  2XYO A;  5KRQ A;  2VZ2 A;  2XVH A;  5U63 A;  1MXT A;  4IA6 A;  2QA2 A;  2WHD A;  4H2Q A;  2X8H A;  1IUT A;  1GET A;  1NHS A;  2JBV A;  2Q6U A;  3F8D A;  3G5R A;  3K7T A;  3QSS A;  3UKK A;  4CRT A;  1XAN A;  3ZYX A;  3BHF A;  3ATR A;  2RGH A;  2R45 A;  2XLS A;  1JNZ A;  4YTM A;  4H4Q A;  4J56 A;  5J7X A;  3AE3 A;  1MO9 A;  1REO A;  2WEU A;  2E4G A;  4H50 A;  5KOX A;  2EQ8 A;  3NT6 A;  2WPF A;  2GR3 A;  3UKH A;  3VR8 A;  1H81 A;  3ISH A;  1FEC A;  2GRT A;  4B64 A;  4J33 A;  2BK5 A;  1VG9 A;  1GXF A;  3SXI A;  1N4W A;  3AD9 B;  1YQ3 A;  1NHR A;  3QVP A;  4IVO B;  4BUR A;  1YKJ A;  4JQ9 A;  1Y56 A;  2Z5Y A;  4H4V A;  3QVR A;  3UP4 A;  2YLT A;  2B9X A;  3K7Q X;  1H83 A;  3UP5 A;  2YQU A;  3PO7 A;  1B5Q A;  4B63 A;  2H89 A;  1JU2 A;  1PXB A;  2Q7V A;  4XWZ A;  1GT8 A;  3P4S A;  1VRQ B;  3AEC A;  2TPR A;  3B6D A;  3AE2 A;  5FS9 A;  2VQ7 A;  3DA1 A;  3V3O A;  3P4P A;  1TYP A;  3OC4 A;  4ECH A;  1Q1W A;  1P2E A;  2IID A;  3COX A;  1RYI A;  2YG4 A;  4ZCC A;  1D7Y A;  1N4U A;  4AOS A;  5KXJ A;  3GD3 A;  1PN0 A;  1E1K A;  2B7R A;  4H2P A;  3AEB A;  3HYW A;  2HQM A;  4UDR A;  3SM8 A;  4BK1 A;  3B3R A;  5FS7 A;  2BK4 A;  3URH A;  3DGZ A;  4CCR A;  2GB0 A;  3NTA A;  4K8D A;  3ZDN A;  4A99 A;  3GYX A;  5HYM A;  4RSL A;  2PYX A;  1NEK A;  4EQW A;  3CND A;  3SZW A;  1LPF A;  2BC0 A;  4USQ A;  5EB5 A;  4BJZ A;  1XPQ A;  3T2K A;  1CC6 A;  4H2N A;  3DME A;  4A6N A;  3SZF A;  4H4P A;  4HA6 A;  3UOX A;  3T2Y A;  4EIQ A;  2X8C A;  1DJN A;  3V76 A;  3G5Q A;  4I59 A;  3P4R A;  3AEE A;  4RG4 A;  3L8K A;  1K0I A;  2WOV A;  1DOE A;  3UTH A;  3LB8 A;  2APG A;  4EIP A;  1H82 A;  1OJD A;  4NEW A;  4P9S A;  3BI2 A;  4GDE A;  1GSN A;  1LTX R;  2OAM A;  3NTD A;  2NPX A;  3IWA A;  4LA1 A;  2R0C A;  4TM4 A;  4U8J A;  3T14 A;  2W0H A;  3NKS A;  3UOY A;  3F8P A;  1KSS A;  2IVE A;  1LQT A;  3AE4 A;  1GEU A;  4JNQ A;  4B69 A;  1NG3 A;  4K2X A;  2XCG A;  3KD9 A;  3ICT A;  4U8O A;  3VRA A;  2WS3 A;  3K7M X;  4OPT A;  1DJQ A;  5LV9 A;  1NHP A;  1QJD A;  4I58 A;  4DSG A;  3UTF A;  4CBQ A;  3QSM A;  3NGC X;  4D04 A;  1GPE A;  3M12 A;  2XFQ A;  3I6D A;  2QCU A;  1PJ6 A;  3NHO X;  3ADA B;  4H4T A;  2XLU A;  3UOZ A;  4CNJ A;  4WX1 A;  2V5Z A;  3AE6 A;  1KNP A;  1AOG A;  2BXR A;  1LV0 A;  1B4V A;  1PDH A;  3DGH A;  2GV8 A;  4TLZ A;  3SZC A;  4YSY A;  1BWC A;  2XFO A;  1RP0 A;  2V3A A;  3M0O A;  2BCG G;  5JCK A;  1TYT A;  1DXL A;  1OJ9 A;  1TDO A;  2Q0L A;  4C3X A;  4U8P A;  1BZL A;  4MJW A;  4OCG A;  4OPI A;  4Y4N A;  1PJ7 A;  2YR4 A;  4CCQ A;  3GMB A;  2IVD A;  3T37 A;  4AOX A;  4EM3 A;  2A89 A;  1BGJ A;  2GQF A;  4EMJ A;  3S61 A;  3KKJ A;  1IUS A;  1NPX A;  4GAV A;  3G5S A;  4CNK A;  5EOW A;  2OLO A;  4Y4M A;  4B68 A;  5J60 A;  1E1L A;  2GR1 A;  2V61 A;  4PAB A;  4Z25 A;  2R0G A;  3DJD A;  4O5U A;  2WU2 A;  4DGK A;  3UKP A;  4C74 A;  4A65 A;  1LJ1 A;  2F5Z A;  2EQ9 A;  4H4Y A;  2OA1 A;  4H4R A;  2XVF A;  1K0J A;  2VRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...