4G6HA

Crystal structure of ndh with nadh
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
472
structure length
472
Chain Sequence
TMKVIDPQHSDKPNVLILGSGWGAISFLKHIDTKKYNVSIISPRSYFLFTPLLPSAPVGTVDEKSIIEPIVNFALKKKGNVTYYEAEATSINPDRNTVTIKSLSAVSQLYQPENHLGLHQAEPAEIKYDYLISAVGAEPNTFGIPGVTDYGHFLKEIPNSLEIRRTFAANLEKANLLPKGDPERRRLLSIVVVGGGPTGVEAAGELQDYVHQDLRKFLPALAEEVQIHLVEALPIVLNMFEKKLSSYAQSHLENTSIKVHLRTAVAKVEEKQLLAKTKHEDGKITEETIPYGTLIWATGNKARPVITDLFKKIPEQNSSKRGLAVNDFLQVKGSNNIFAIGDNAFAGLPPTAQVAHQEAEYLAKNFDKMAQIPNFQKNLSSRKDKIDLLFEENNFKPFKYNDLGALAYLGSERAIATIRSGKRTFYTGGGLMTFYLWRILYLSMILSARSRLKVFFDWIKLAFFKRDFFKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insight into the type-II mitochondrial NADH dehydrogenases.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitocho
total genus 164
structure length 472
sequence length 472
chains with identical sequence B
ec nomenclature ec 1.6.5.9: NADH:ubiquinone reductase (non-electrogenic).
pdb deposition date 2012-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4g6hA00
3SYIA 4G9KA 3SY4A 4G6HA 3SZWA 5KMSA 3KPKA 3T0KA 3SZFA 3T2ZA 4NWZA 4GAVA 4G6GA 3T2YA 3SXIA 4GAPA 3SX6A 3T31A 3T2KA 3HYXA 5KMRA 5KMPA 4G74A 4G73A 3HYVA 3SZ0A 3T14A 5KMQA 3HYWA 3SZCA
chains in the Genus database with same CATH superfamily
4CBQA 1NDAA 2PYXA 1JNZA 2GMHA 3SY4A 3EANA 3EPTA 2VVLA 3VRDB 2XFPA 1OJ9A 4KX6A 4NNJA 2IIDA 2FBWA 3DK9A 4GDPA 3S5WA 3CN8A 3JSKA 2RGOA 3CIRA 1GREA 3NT6A 1D4CA 1PDHA 2GMJA 4G6GA 4Y4LA 2XFQA 4OVIA 1NG4A 1ONFA 3RP7A 4KPRA 3RP6A 5BVAA 2QA2A 3UKLA 3BI5A 1M6IA 2ZBWA 2GF3A 4UDPA 4B64A 3VR9A 4O5UA 5LV9A 1LQUA 4YT0A 3FIMB 1CJ3A 1GXFA 2WDRA 3KPFA 3P9UA 3ATRA 3CGDA 3S61A 3H8IA 2GAHB 4A99A 4ADWA 3CPHG 3GMCA 2TPRA 1GESA 1YQ4A 4CCRA 2X99A 2JAEA 3FPZA 1CC6A 3UTHA 1DOCA 4BURA 1O95A 1LJ1A 5M10A 4NWZA 3FBSA 5KOWA 2GQFA 2GR3A 2ZZBA 3IHMA 4OPLA 4TLXA 2IVDA 3GDPA 1ZX9A 3CTYA 2B9WA 4H4UA 4I59A 1QLBA 4CCQA 4JNAA 3GWFA 5JCIA 4J2WA 2YG4A 1GNDA 3KVEA 2XVIA 3I6DA 3AE4A 1TDNA 1REOA 2X8GA 4YXDA 3AYJA 1GRFA 3ALMA 3O0HA 5BRTA 4FK1C 1Y0PA 2GH5A 2JB3A 2Q6UA 4EQWA 3NH3X 4II3A 1EL9A 1MO9A 1N4WA 1NAAA 3BHFA 1JEHA 1IUXA 2R45A 3OC4A 1EL7A 5JCKA 3VR8A 3UCLA 4C3XA 2AR8A 2QA1A 1E1LA 2XLSA 3DGZA 3K30A 3QSMA 1B8SA 4JN9A 1DOBA 2V60A 3T31A 4IVOB 1LTXR 2WQYA 3AYLA 3NTDA 4H4RA 4ZCDA 3VQRA 2FJDA 3WE0A 3BI2A 1Q1RA 5KRQA 3BNUA 2C3CA 1NG3A 1H86A 4H7UA 3Q9TA 4G73A 3UTFA 1GRAA 1VG9A 4FK1A 2HQMA 1Q1WA 4GR1A 1COYA 1F8SA 5FS6A 3P4QA 3UOZA 2OAMA 1HYUA 2X50A 3AYIA 2EQ8A 3B3RA 2VQBA 3AD7B 1PBEA 3NIXA 4E0VA 5ER0A 3L1RA 2BC1A 3VRBA 1FL2A 3T0KA 2YVJA 3ATQA 4MJWA 2WPFA 5HHFA 1BWCA 3SZFA 4OPCA 1PJ5A 1H84A 1JRXA 2X8HA 3SGLA 1BGNA 3NTAA 2BCPA 4YWOA 1N1PA 3QVPA 2YLRA 4UDQA 1F3PA 1ZK7A 4WX1A 1D4EA 4TM4A 2WBAA 4YKGA 3T14A 4B68A 3SQPA 2NPXA 4EM4A 3SZCA 4H4XA 1MXTA 2YVFA 3R9UA 5FS8A 1P2HA 4JY2A 3K7MX 2YQUA 4Z25A 4AP1A 1LQTA 3M12A 3AB1A 4EIPA 3DH9A 2B7SA 2E4GA 2RABA 1GT8A 1GRBA 1EBDA 1CJCA 3AEBA 4I58A 4IVMB 3AE6A 2ARDA 3IC9A 2WOWA 4Z2TA 1ZMCA 4PABA 4A6NA 1KNPA 3NYFA 1E1NA 4D03A 2ACZA 4J31A 5EBKA 2YM1A 2YR5A 1E39A 4IV9A 4ZCCA 3GD4A 2WP9A 3OZ2A 2C7GA 5FMHA 2O9ZA 1CBOA 2BABA 3HYWA 5J7XA 5KVIA 3CPIG 2Z5XA 2BS3A 4IA6A 4BV6A 4CNKA 2GR0A 3AEFA 4JY3A 4DNAA 5KWFA 2YAUA 1VQWA 4AP3A 1CC2A 1FEBA 3UOYA 2CDUA 2WP6A 2YLZA 4XWZA 4P9SA 4Y4MA 4UDRA 2XFNA 1ZOVA 1D4DA 2VRMA 4B66A 4H4QA 4EMWA 2V5ZA 3EF6A 1PBFA 1IUWA 3NKSA 2WU5A 3GYXA 1M64A 1H6VA 2FJAA 2VVMA 4IA5A 3HYXA 4X4JA 2V6OA 4A7AA 2RGHA 3PS9A 4CRTA 3BI4A 1IUUA 1TYTA 1ZDLA 2R0GA 4A65A 2R0CA 4LIIA 4H4SA 5EB5A 4EMIA 3I3LA 1DJNA 2EQ9A 4H4PA 3DGHA 1JRYA 2B76A 1GERA 1L0VA 1K0LA 2PHHA 1XHCA 1LVLA 4B67A 4YTPA 1BF3A 2AQJA 4U8KA 3EAOA 3C4AA 4WCTA 5DBJA 1CF3A 4C77A 2BS2A 3CNJA 3UKQA 3H4KA 4YSXA 5JCLA 1DOEA 1FOHA 4OPDA 1KSUA 1KDGA 2A87A 4GAVA 3K7TA 5EB4A 2WP5A 5TR3A 3T2YA 4OPTA 1CJ4A 4FDCB 4TM0A 3SXIA 1QJDA 4U2TA 1BZLA 3LADA 4ECHA 2YLXA 3AE1A 4K22A 1TDKA 3G5RA 4Z24A 4YSHA 5BULA 3AE7A 4U8NA 2DKIA 3GYIA 4Z43A 3GSIA 4JQ9A 4A5LA 4J56A 1YQ3A 1OJAA 3SYIA 3D1CA 3QFBA 3CPJG 3LZWA 1Q9IA 3AD8B 4NZHA 3ZYXA 2BACA 1V59A 3IF9A 4J36A 3UP4A 2QCUA 1GOSA 2VZ2A 3ICRA 4GRTA 2BCGG 2BRYA 1GRHA 4LU6A 4A9WA 5C2TA 3LB8A 2GR1A 5IQ4A 4USQA 4JNQA 1DODA 4YSZA 2B9XA 1TYPA 4GF7A 5M0ZA 1S2QA 2Z5YA 2YVGA 5JCMA 2B9YA 3T37A 2XLRA 4X9MA 5IQ1A 1PBDA 3GDNA 1TDOA 3VRAA 4EM3A 1NHPA 2GR2A 1F8RA 5JCNA 1LPFA 1L9DA 1CJ2A 4G9KA 4J57A 2YG5A 3CNSA 4TLZA 5GRTA 2FJBA 3UKAA 2ZZ0A 3AEAA 2Q0LA 5HXIA 1NEKA 3V76A 3AE2A 3ALJA 3GYJA 4A79A 1H81A 1K4QA 3F8DA 3CGCA 1ZY8A 3C96A 2VRLA 2XFOA 3F8RA 4HB9A 1PS9A 5KNLA 5J60A 1JOAA 2XVFA 3AE5A 1S3EA 1TDEA 3AXBA 1ZMDA 1JRZA 1YQZA 2C72A 2X3NA 1K0JA 1L9CA 4U8OA 2XDOA 2Y6QA 2GVCA 5KOXA 2WDVA 4EIQA 4NTCA 2FJEA 1B5QA 4OPGA 3UKPA 3NK2X 4NTEA 4H2PA 5EOWA 4A6NB 5C3JA 4C5OA 5CQFA 3RNMA 1NHRA 4NTDA 4U8IA 1MOKA 1B37A 1ZP0A 4J33A 3C4NA 3DK8A 4DSGA 4J34A 4G6HA 1PXCA 5U25A 2W0HA 3KPKA 4Z44A 2RGJA 4GUVA 2BK3A 4N9XA 2CULA 3V3OA 1NHQA 2A89A 2R46A 3V3NA 3UP5A 1QO8A 2UZZA 3G5SA 1D5TA 1DXLA 2VOUA 1E7PA 4K7ZA 2ZZCA 2YM2A 1LV0A 4RSLA 2E5VA 3SM8A 1ZOYA 3NYEA 4EQXA 2GB0A 3UKKA 4NEWA 3ABVA 3FG2P 4BK1A 4OPUA 4REKA 1EL8A 2E1MA 4Z26A 1E1MA 4TM1A 1OJDA 4AT0A 3GD3A 3SZ0A 3E1TA 1RYIA 4USRA 2JB2A 1GTEA 1CC4A 4X9NA 4H4ZA 3KA7A 3AECA 5KXJA 2BXRA 4U2SA 3NYCA 2DKHA 2YR4A 3NLCA 1CL0A 3CMMA 4C74A 2WHDA 1OJTA 4TM3A 1KSSA 3REDA 4YTMA 2C65A 3KU9A 4C3YA 5IPYA 2AAQA 4BK2A 4CNJA 1XANA 1RSGA 3LXDA 3DA1A 3RHAA 2F5ZA 3SX6A 1KF6A 3AE3A 3CNPA 3IWAA 3T2KA 3UTEA 3GMBA 1PXBA 4H4TA 3BNMA 4EQRA 1P2EA 2CVJA 3AWIA 4GDEA 3HYVA 1F8WA 4M52A 2GAGB 4ZN0A 3AE9A 2CFYA 5KVHA 1S3BA 2XVJA 2WU2A 4U8MA 3NHOX 3UKFA 2GEWA 4XXGA 2WEUA 3F8PA 3NG7X 4ICYA 3SZWA 1YKJA 1X31B 1GRGA 4EMJA 5KMSA 3H8LA 1L9EA 3UOVA 1UKVG 2QAEA 3T2ZA 2WS3A 2OLOA 2BRAA 4DSHA 1RP0A 1FECA 3ISHA 1FCDA 3QFAA 4YKFA 4H4VA 3SFDA 2V3AA 4Z2UA 2BK4A 1H83A 2C3DA 2OALA 2BA9A 4PAAA 3P4SA 4O5QA 5KMPA 4G74A 3ITJA 4U8LA 4FX9A 3D8XA 1D7LA 4K5RA 1PBCA 1AOGA 2XVEA 3DJDA 1GPEA 1OJCA 2X8CA 3IHGA 4HA6A 4XWRA 1F6MA 1K0IA 1E1KA 3QSSA 2YWLA 1EL5A 2WPEA 2OLNA 1YY5A 1VDCA 1PHHA 3DJEA 1NHSA 2NVKX 4H2NA 1Z6LA 4K5SA 2XVHA 2TMDA 2YG6A 2APGA 4GAPA 1VRQB 3UOXA 2WOVA 3NK0X 1DJQA 3DJJA 4II2A 4K2XA 2VQ7A 2R9ZA 3PVCA 4OPIA 2GQWA 1NPXA 3LZXA 1PJ6A 5HY5A 3ZDNA 5KMQA 2EQ7A 3AEEA 3AEDA 3URHA 4CY8A 2XLUA 5U63A 3DMEA 4LA1A 4BJYA 3ICSA 2I0ZA 2Q7VA 1GV4A 1SEZA 2BS4A 1N4VA 1O5WA 2C64A 1GTHA 3CNDA 3GRSA 4GCMA 5GSNA 5U1OA 2Y6RA 1Y56B 3ALLA 1B4VA 2A8XA 2C73A 2YLTA 3DJGX 3FMWA 4H2QA 4APNA 1H7WA 2C4CA 4H2RA 4RG3A 4UP3A 2YG7A 2XYOA 2GRTA 2WETA 2R4JA 1PJ7A 2BYBA 3BHKA 3CGEA 3DK4A 3HZLA 4H50A 5CKUA 2YLWA 2V61A 2V3BA 3NNEA 4U8JA 1GEUA 3GRTA 4U2LA 1Y56A 1TRBA 3NGCX 5BUKA 2JB1A 5FS7A 2BXSA 4BK3A 3II4A 1H7XA 4YTNA 1GALA 4JDRA 2B7RA 4B1BA 2WOIA 2WESA 2YG3A 3QVRA 4OCGA 3P1WA 1GETA 2C67A 3PO7A 2JK6A 2GV8A 5HYMA 1DNCA 3P4PA 1IUTA 3SFEA 2R4EA 3ADAB 1FEAA 1IUSA 1KFYA 3G5QA 3CGBA 2C75A 1CHUA 1TDFA 2C76A 3KKJA 3M0OA 3NN6X 4U8PA 3NK1X 5FS9A 3P4RA 3UKHA 4BJZA 4Z2RA 3L8KA 5L46A 2XLTA 4D04A 2C66A 4AT2A 2XFUA 3KLJA 1GSNA 2BK5A 2IVEA 3NRNA 3Q6JA 2JKCA 1ZKQA 3CNTA 4B69A 1ELIA 1E6EA 1D7YA 4EQSA 2Q0KA 2R0PA 3K7QX 1JU2A 2YR6A 2C70A 2H88A 1XPQA 2H89A 3LOVA 3M13A 1IJHA 1NENA 3KD9A 4RG4A 1H82A 2YLSA 3QJ4A 1PN0A 1XDIA 4H4WA 2J3NA 2JBVA 3GWDA 2VVLG 1IUVA 3COXA 1VG0A 2XLPA 2XCGA 3AD9B 4K8DA 3RP8A 2WPCA 1BGJA 4H4YA 4AOSA 4Y4NA 2EQ6A 2OA1A 3AEGA 1W4XA 1N4UA 3ICTA 3AE8A 3UTGA 1PXAA 3LJPA 5KMRA 3QSEA 3NN0X 4AOXA 1O94A 4B63A 4CY6A 4YSYA 1PBBA 2WDQA 1GRTA 3B6DA 1KNRA 4NEVA 4DGKA 1S2YA 1JNRA 2BC0A 4B65A 1BKWA
chains in the Genus database with same CATH topology
4CBQA 1NDAA 2PYXA 1JNZA 2GMHA 3SY4A 3EANA 3EPTA 2VVLA 3VRDB 2XFPA 1OJ9A 4KX6A 4NNJA 2IIDA 2FBWA 3DK9A 4GDPA 3S5WA 3CN8A 3JSKA 2RGOA 3CIRA 1GREA 3NT6A 1D4CA 1PDHA 2GMJA 4G6GA 4Y4LA 2XFQA 4OVIA 1NG4A 1ONFA 3RP7A 4KPRA 3RP6A 5BVAA 2QA2A 3UKLA 3BI5A 1M6IA 2ZBWA 2GF3A 4UDPA 4B64A 3VR9A 4O5UA 5LV9A 1LQUA 4YT0A 3FIMB 1CJ3A 1GXFA 2WDRA 3KPFA 3P9UA 3ATRA 3CGDA 3S61A 3H8IA 2GAHB 4A99A 4ADWA 3CPHG 3GMCA 2TPRA 1GESA 1YQ4A 4CCRA 2X99A 2JAEA 3FPZA 1CC6A 3UTHA 1DOCA 4BURA 1O95A 1LJ1A 5M10A 4NWZA 3FBSA 5KOWA 2GQFA 2GR3A 2ZZBA 3IHMA 4OPLA 4TLXA 2IVDA 3GDPA 1ZX9A 3CTYA 2B9WA 4H4UA 4I59A 1QLBA 4CCQA 4JNAA 3GWFA 5JCIA 4J2WA 2YG4A 1GNDA 3KVEA 2XVIA 3I6DA 3AE4A 1TDNA 1REOA 2X8GA 4YXDA 3AYJA 1GRFA 3ALMA 3O0HA 5BRTA 4FK1C 1Y0PA 2GH5A 2JB3A 2Q6UA 4EQWA 3NH3X 4II3A 1EL9A 1MO9A 1N4WA 1NAAA 3BHFA 1JEHA 1IUXA 2R45A 3OC4A 1EL7A 5JCKA 3VR8A 3UCLA 4C3XA 2AR8A 2QA1A 1E1LA 2XLSA 3DGZA 3K30A 3QSMA 1B8SA 4JN9A 1DOBA 2V60A 3T31A 4IVOB 1LTXR 2WQYA 3AYLA 3NTDA 4H4RA 4ZCDA 3VQRA 2FJDA 3WE0A 3BI2A 1Q1RA 5KRQA 3BNUA 2C3CA 1NG3A 1H86A 4H7UA 3Q9TA 4G73A 3UTFA 1GRAA 1VG9A 4FK1A 2HQMA 1Q1WA 4GR1A 1COYA 1F8SA 5FS6A 3P4QA 3UOZA 2OAMA 1HYUA 2X50A 3AYIA 2EQ8A 3B3RA 2VQBA 3AD7B 1PBEA 3NIXA 4E0VA 5ER0A 3L1RA 2BC1A 3VRBA 1FL2A 3T0KA 2YVJA 3ATQA 4MJWA 2WPFA 5HHFA 1BWCA 3SZFA 4OPCA 1PJ5A 1H84A 1JRXA 2X8HA 3SGLA 1BGNA 3NTAA 2BCPA 4YWOA 1N1PA 3QVPA 2YLRA 4UDQA 1F3PA 1ZK7A 4WX1A 1D4EA 4TM4A 2WBAA 4YKGA 3T14A 4B68A 3SQPA 2NPXA 4EM4A 3SZCA 4H4XA 1MXTA 2YVFA 3R9UA 5FS8A 1P2HA 4JY2A 3K7MX 2YQUA 4Z25A 4AP1A 1LQTA 3M12A 3AB1A 4EIPA 3DH9A 2B7SA 2E4GA 2RABA 1GT8A 1GRBA 1EBDA 1CJCA 3AEBA 4I58A 4IVMB 3AE6A 2ARDA 3IC9A 2WOWA 4Z2TA 1ZMCA 4PABA 4A6NA 1KNPA 3NYFA 1E1NA 4D03A 2ACZA 4J31A 5EBKA 2YM1A 2YR5A 1E39A 4IV9A 4ZCCA 3GD4A 2WP9A 3OZ2A 2C7GA 5FMHA 2O9ZA 1CBOA 2BABA 3HYWA 5J7XA 5KVIA 3CPIG 2Z5XA 2BS3A 4IA6A 4BV6A 4CNKA 2GR0A 3AEFA 4JY3A 4DNAA 5KWFA 2YAUA 1VQWA 4AP3A 1CC2A 1FEBA 3UOYA 2CDUA 2WP6A 2YLZA 4XWZA 4P9SA 4Y4MA 4UDRA 2XFNA 1ZOVA 1D4DA 2VRMA 4B66A 4H4QA 4EMWA 2V5ZA 3EF6A 1PBFA 1IUWA 3NKSA 2WU5A 3GYXA 1M64A 1H6VA 2FJAA 2VVMA 4IA5A 3HYXA 4X4JA 2V6OA 4A7AA 2RGHA 3PS9A 4CRTA 3BI4A 1IUUA 1TYTA 1ZDLA 2R0GA 4A65A 2R0CA 4LIIA 4H4SA 5EB5A 4EMIA 3I3LA 1DJNA 2EQ9A 4H4PA 3DGHA 1JRYA 2B76A 1GERA 1L0VA 1K0LA 2PHHA 1XHCA 1LVLA 4B67A 4YTPA 1BF3A 2AQJA 4U8KA 3EAOA 3C4AA 4WCTA 5DBJA 1CF3A 4C77A 2BS2A 3CNJA 3UKQA 3H4KA 4YSXA 5JCLA 1DOEA 1FOHA 4OPDA 1KSUA 1KDGA 2A87A 4GAVA 3K7TA 5EB4A 2WP5A 5TR3A 3T2YA 4OPTA 1CJ4A 4FDCB 4TM0A 3SXIA 1QJDA 4U2TA 1BZLA 3LADA 4ECHA 2YLXA 3AE1A 4K22A 1TDKA 3G5RA 4Z24A 4YSHA 5BULA 3AE7A 4U8NA 2DKIA 3GYIA 4Z43A 3GSIA 4JQ9A 4A5LA 4J56A 1YQ3A 1OJAA 3SYIA 3D1CA 3QFBA 3CPJG 3LZWA 1Q9IA 3AD8B 4NZHA 3ZYXA 2BACA 1V59A 3IF9A 4J36A 3UP4A 2QCUA 1GOSA 2VZ2A 3ICRA 4GRTA 2BCGG 2BRYA 1GRHA 4LU6A 4A9WA 5C2TA 3LB8A 2GR1A 5IQ4A 4USQA 4JNQA 1DODA 4YSZA 2B9XA 1TYPA 4GF7A 5M0ZA 1S2QA 2Z5YA 2YVGA 5JCMA 2B9YA 3T37A 2XLRA 4X9MA 5IQ1A 1PBDA 3GDNA 1TDOA 3VRAA 4EM3A 1NHPA 2GR2A 1F8RA 5JCNA 1LPFA 1L9DA 1CJ2A 4G9KA 4J57A 2YG5A 3CNSA 4TLZA 5GRTA 2FJBA 3UKAA 2ZZ0A 3AEAA 2Q0LA 5HXIA 1NEKA 3V76A 3AE2A 3ALJA 3GYJA 4A79A 1H81A 1K4QA 3F8DA 3CGCA 1ZY8A 3C96A 2VRLA 2XFOA 3F8RA 4HB9A 1PS9A 5KNLA 5J60A 1JOAA 2XVFA 3AE5A 1S3EA 1TDEA 3AXBA 1ZMDA 1JRZA 1YQZA 2C72A 2X3NA 1K0JA 1L9CA 4U8OA 2XDOA 2Y6QA 2GVCA 5KOXA 2WDVA 4EIQA 4NTCA 2FJEA 1B5QA 4OPGA 3UKPA 3NK2X 4NTEA 4H2PA 5EOWA 4A6NB 5C3JA 4C5OA 5CQFA 3RNMA 1NHRA 4NTDA 4U8IA 1MOKA 1B37A 1ZP0A 4J33A 3C4NA 3DK8A 4DSGA 4J34A 4G6HA 1PXCA 5U25A 2W0HA 3KPKA 4Z44A 2RGJA 4GUVA 2BK3A 4N9XA 2CULA 3V3OA 1NHQA 2A89A 2R46A 3V3NA 3UP5A 1QO8A 2UZZA 3G5SA 1D5TA 1DXLA 2VOUA 1E7PA 4K7ZA 2ZZCA 2YM2A 1LV0A 4RSLA 2E5VA 3SM8A 1ZOYA 3NYEA 4EQXA 2GB0A 3UKKA 4NEWA 3ABVA 3FG2P 4BK1A 4OPUA 4REKA 1EL8A 2E1MA 4Z26A 1E1MA 4TM1A 1OJDA 4AT0A 3GD3A 3SZ0A 3E1TA 1RYIA 4USRA 2JB2A 1GTEA 1CC4A 4X9NA 4H4ZA 3KA7A 3AECA 5KXJA 2BXRA 4U2SA 3NYCA 2DKHA 2YR4A 3NLCA 1CL0A 3CMMA 4C74A 2WHDA 1OJTA 4TM3A 1KSSA 3REDA 4YTMA 2C65A 3KU9A 4C3YA 5IPYA 2AAQA 4BK2A 4CNJA 1XANA 1RSGA 3LXDA 3DA1A 3RHAA 2F5ZA 3SX6A 1KF6A 3AE3A 3CNPA 3IWAA 3T2KA 3UTEA 3GMBA 1PXBA 4H4TA 3BNMA 4EQRA 1P2EA 2CVJA 3AWIA 4GDEA 3HYVA 1F8WA 4M52A 2GAGB 4ZN0A 3AE9A 2CFYA 5KVHA 1S3BA 2XVJA 2WU2A 4U8MA 3NHOX 3UKFA 2GEWA 4XXGA 2WEUA 3F8PA 3NG7X 4ICYA 3SZWA 1YKJA 1X31B 1GRGA 4EMJA 5KMSA 3H8LA 1L9EA 3UOVA 1UKVG 2QAEA 3T2ZA 2WS3A 2OLOA 2BRAA 4DSHA 1RP0A 1FECA 3ISHA 1FCDA 3QFAA 4YKFA 4H4VA 3SFDA 2V3AA 4Z2UA 2BK4A 1H83A 2C3DA 2OALA 2BA9A 4PAAA 3P4SA 4O5QA 5KMPA 4G74A 3ITJA 4U8LA 4FX9A 3D8XA 1D7LA 4K5RA 1PBCA 1AOGA 2XVEA 3DJDA 1GPEA 1OJCA 2X8CA 3IHGA 4HA6A 4XWRA 1F6MA 1K0IA 1E1KA 3QSSA 2YWLA 1EL5A 2WPEA 2OLNA 1YY5A 1VDCA 1PHHA 3DJEA 1NHSA 2NVKX 4H2NA 1Z6LA 4K5SA 2XVHA 2TMDA 2YG6A 2APGA 4GAPA 1VRQB 3UOXA 2WOVA 3NK0X 1DJQA 3DJJA 4II2A 4K2XA 2VQ7A 2R9ZA 3PVCA 4OPIA 2GQWA 1NPXA 3LZXA 1PJ6A 5HY5A 3ZDNA 5KMQA 2EQ7A 3AEEA 3AEDA 3URHA 4CY8A 2XLUA 5U63A 3DMEA 4LA1A 4BJYA 3ICSA 2I0ZA 2Q7VA 1GV4A 1SEZA 2BS4A 1N4VA 1O5WA 2C64A 1GTHA 3CNDA 3GRSA 4GCMA 5GSNA 5U1OA 2Y6RA 1Y56B 3ALLA 1B4VA 2A8XA 2C73A 2YLTA 3DJGX 3FMWA 4H2QA 4APNA 1H7WA 2C4CA 4H2RA 4RG3A 4UP3A 2YG7A 2XYOA 2GRTA 2WETA 2R4JA 1PJ7A 2BYBA 3BHKA 3CGEA 3DK4A 3HZLA 4H50A 5CKUA 2YLWA 2V61A 2V3BA 3NNEA 4U8JA 1GEUA 3GRTA 4U2LA 1Y56A 1TRBA 3NGCX 5BUKA 2JB1A 5FS7A 2BXSA 4BK3A 3II4A 1H7XA 4YTNA 1GALA 4JDRA 2B7RA 4B1BA 2WOIA 2WESA 2YG3A 3QVRA 4OCGA 3P1WA 1GETA 2C67A 3PO7A 2JK6A 2GV8A 5HYMA 1DNCA 3P4PA 1IUTA 3SFEA 2R4EA 3ADAB 1FEAA 1IUSA 1KFYA 3G5QA 3CGBA 2C75A 1CHUA 1TDFA 2C76A 3KKJA 3M0OA 3NN6X 4U8PA 3NK1X 5FS9A 3P4RA 3UKHA 4BJZA 4Z2RA 3L8KA 5L46A 2XLTA 4D04A 2C66A 4AT2A 2XFUA 3KLJA 1GSNA 2BK5A 2IVEA 3NRNA 3Q6JA 2JKCA 1ZKQA 3CNTA 4B69A 1ELIA 1E6EA 1D7YA 4EQSA 2Q0KA 2R0PA 3K7QX 1JU2A 2YR6A 2C70A 2H88A 1XPQA 2H89A 3LOVA 3M13A 1IJHA 1NENA 3KD9A 4RG4A 1H82A 2YLSA 3QJ4A 1PN0A 1XDIA 4H4WA 2J3NA 2JBVA 3GWDA 2VVLG 1IUVA 3COXA 1VG0A 2XLPA 2XCGA 3AD9B 4K8DA 3RP8A 2WPCA 1BGJA 4H4YA 4AOSA 4Y4NA 2EQ6A 2OA1A 3AEGA 1W4XA 1N4UA 3ICTA 3AE8A 3UTGA 1PXAA 3LJPA 5KMRA 3QSEA 3NN0X 4AOXA 1O94A 4B63A 4CY6A 4YSYA 1PBBA 2WDQA 1GRTA 3B6DA 1KNRA 4NEVA 4DGKA 1S2YA 1JNRA 2BC0A 4B65A 1BKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SYI A;  4G9K A;  3SY4 A;  4G6H A;  3SZW A;  5KMS A;  3KPK A;  3T0K A;  3SZF A;  3T2Z A;  4NWZ A;  4GAV A;  4G6G A;  3T2Y A;  3SXI A;  4GAP A;  3SX6 A;  3T31 A;  3T2K A;  3HYX A;  5KMR A;  5KMP A;  4G74 A;  4G73 A;  3HYV A;  3SZ0 A;  3T14 A;  5KMQ A;  3HYW A;  3SZC A; 
#chains in the Genus database with same CATH topology
 4CBQ A;  1NDA A;  2PYX A;  1JNZ A;  2GMH A;  3SY4 A;  3EAN A;  3EPT A;  2VVL A;  3VRD B;  2XFP A;  1OJ9 A;  4KX6 A;  4NNJ A;  2IID A;  2FBW A;  3DK9 A;  4GDP A;  3S5W A;  3CN8 A;  3JSK A;  2RGO A;  3CIR A;  1GRE A;  3NT6 A;  1D4C A;  1PDH A;  2GMJ A;  4G6G A;  4Y4L A;  2XFQ A;  4OVI A;  1NG4 A;  1ONF A;  3RP7 A;  4KPR A;  3RP6 A;  5BVA A;  2QA2 A;  3UKL A;  3BI5 A;  1M6I A;  2ZBW A;  2GF3 A;  4UDP A;  4B64 A;  3VR9 A;  4O5U A;  5LV9 A;  1LQU A;  4YT0 A;  3FIM B;  1CJ3 A;  1GXF A;  2WDR A;  3KPF A;  3P9U A;  3ATR A;  3CGD A;  3S61 A;  3H8I A;  2GAH B;  4A99 A;  4ADW A;  3CPH G;  3GMC A;  2TPR A;  1GES A;  1YQ4 A;  4CCR A;  2X99 A;  2JAE A;  3FPZ A;  1CC6 A;  3UTH A;  1DOC A;  4BUR A;  1O95 A;  1LJ1 A;  5M10 A;  4NWZ A;  3FBS A;  5KOW A;  2GQF A;  2GR3 A;  2ZZB A;  3IHM A;  4OPL A;  4TLX A;  2IVD A;  3GDP A;  1ZX9 A;  3CTY A;  2B9W A;  4H4U A;  4I59 A;  1QLB A;  4CCQ A;  4JNA A;  3GWF A;  5JCI A;  4J2W A;  2YG4 A;  1GND A;  3KVE A;  2XVI A;  3I6D A;  3AE4 A;  1TDN A;  1REO A;  2X8G A;  4YXD A;  3AYJ A;  1GRF A;  3ALM A;  3O0H A;  5BRT A;  4FK1 C;  1Y0P A;  2GH5 A;  2JB3 A;  2Q6U A;  4EQW A;  3NH3 X;  4II3 A;  1EL9 A;  1MO9 A;  1N4W A;  1NAA A;  3BHF A;  1JEH A;  1IUX A;  2R45 A;  3OC4 A;  1EL7 A;  5JCK A;  3VR8 A;  3UCL A;  4C3X A;  2AR8 A;  2QA1 A;  1E1L A;  2XLS A;  3DGZ A;  3K30 A;  3QSM A;  1B8S A;  4JN9 A;  1DOB A;  2V60 A;  3T31 A;  4IVO B;  1LTX R;  2WQY A;  3AYL A;  3NTD A;  4H4R A;  4ZCD A;  3VQR A;  2FJD A;  3WE0 A;  3BI2 A;  1Q1R A;  5KRQ A;  3BNU A;  2C3C A;  1NG3 A;  1H86 A;  4H7U A;  3Q9T A;  4G73 A;  3UTF A;  1GRA A;  1VG9 A;  4FK1 A;  2HQM A;  1Q1W A;  4GR1 A;  1COY A;  1F8S A;  5FS6 A;  3P4Q A;  3UOZ A;  2OAM A;  1HYU A;  2X50 A;  3AYI A;  2EQ8 A;  3B3R A;  2VQB A;  3AD7 B;  1PBE A;  3NIX A;  4E0V A;  5ER0 A;  3L1R A;  2BC1 A;  3VRB A;  1FL2 A;  3T0K A;  2YVJ A;  3ATQ A;  4MJW A;  2WPF A;  5HHF A;  1BWC A;  3SZF A;  4OPC A;  1PJ5 A;  1H84 A;  1JRX A;  2X8H A;  3SGL A;  1BGN A;  3NTA A;  2BCP A;  4YWO A;  1N1P A;  3QVP A;  2YLR A;  4UDQ A;  1F3P A;  1ZK7 A;  4WX1 A;  1D4E A;  4TM4 A;  2WBA A;  4YKG A;  3T14 A;  4B68 A;  3SQP A;  2NPX A;  4EM4 A;  3SZC A;  4H4X A;  1MXT A;  2YVF A;  3R9U A;  5FS8 A;  1P2H A;  4JY2 A;  3K7M X;  2YQU A;  4Z25 A;  4AP1 A;  1LQT A;  3M12 A;  3AB1 A;  4EIP A;  3DH9 A;  2B7S A;  2E4G A;  2RAB A;  1GT8 A;  1GRB A;  1EBD A;  1CJC A;  3AEB A;  4I58 A;  4IVM B;  3AE6 A;  2ARD A;  3IC9 A;  2WOW A;  4Z2T A;  1ZMC A;  4PAB A;  4A6N A;  1KNP A;  3NYF A;  1E1N A;  4D03 A;  2ACZ A;  4J31 A;  5EBK A;  2YM1 A;  2YR5 A;  1E39 A;  4IV9 A;  4ZCC A;  3GD4 A;  2WP9 A;  3OZ2 A;  2C7G A;  5FMH A;  2O9Z A;  1CBO A;  2BAB A;  3HYW A;  5J7X A;  5KVI A;  3CPI G;  2Z5X A;  2BS3 A;  4IA6 A;  4BV6 A;  4CNK A;  2GR0 A;  3AEF A;  4JY3 A;  4DNA A;  5KWF A;  2YAU A;  1VQW A;  4AP3 A;  1CC2 A;  1FEB A;  3UOY A;  2CDU A;  2WP6 A;  2YLZ A;  4XWZ A;  4P9S A;  4Y4M A;  4UDR A;  2XFN A;  1ZOV A;  1D4D A;  2VRM A;  4B66 A;  4H4Q A;  4EMW A;  2V5Z A;  3EF6 A;  1PBF A;  1IUW A;  3NKS A;  2WU5 A;  3GYX A;  1M64 A;  1H6V A;  2FJA A;  2VVM A;  4IA5 A;  3HYX A;  4X4J A;  2V6O A;  4A7A A;  2RGH A;  3PS9 A;  4CRT A;  3BI4 A;  1IUU A;  1TYT A;  1ZDL A;  2R0G A;  4A65 A;  2R0C A;  4LII A;  4H4S A;  5EB5 A;  4EMI A;  3I3L A;  1DJN A;  2EQ9 A;  4H4P A;  3DGH A;  1JRY A;  2B76 A;  1GER A;  1L0V A;  1K0L A;  2PHH A;  1XHC A;  1LVL A;  4B67 A;  4YTP A;  1BF3 A;  2AQJ A;  4U8K A;  3EAO A;  3C4A A;  4WCT A;  5DBJ A;  1CF3 A;  4C77 A;  2BS2 A;  3CNJ A;  3UKQ A;  3H4K A;  4YSX A;  5JCL A;  1DOE A;  1FOH A;  4OPD A;  1KSU A;  1KDG A;  2A87 A;  4GAV A;  3K7T A;  5EB4 A;  2WP5 A;  5TR3 A;  3T2Y A;  4OPT A;  1CJ4 A;  4FDC B;  4TM0 A;  3SXI A;  1QJD A;  4U2T A;  1BZL A;  3LAD A;  4ECH A;  2YLX A;  3AE1 A;  4K22 A;  1TDK A;  3G5R A;  4Z24 A;  4YSH A;  5BUL A;  3AE7 A;  4U8N A;  2DKI A;  3GYI A;  4Z43 A;  3GSI A;  4JQ9 A;  4A5L A;  4J56 A;  1YQ3 A;  1OJA A;  3SYI A;  3D1C A;  3QFB A;  3CPJ G;  3LZW A;  1Q9I A;  3AD8 B;  4NZH A;  3ZYX A;  2BAC A;  1V59 A;  3IF9 A;  4J36 A;  3UP4 A;  2QCU A;  1GOS A;  2VZ2 A;  3ICR A;  4GRT A;  2BCG G;  2BRY A;  1GRH A;  4LU6 A;  4A9W A;  5C2T A;  3LB8 A;  2GR1 A;  5IQ4 A;  4USQ A;  4JNQ A;  1DOD A;  4YSZ A;  2B9X A;  1TYP A;  4GF7 A;  5M0Z A;  1S2Q A;  2Z5Y A;  2YVG A;  5JCM A;  2B9Y A;  3T37 A;  2XLR A;  4X9M A;  5IQ1 A;  1PBD A;  3GDN A;  1TDO A;  3VRA A;  4EM3 A;  1NHP A;  2GR2 A;  1F8R A;  5JCN A;  1LPF A;  1L9D A;  1CJ2 A;  4G9K A;  4J57 A;  2YG5 A;  3CNS A;  4TLZ A;  5GRT A;  2FJB A;  3UKA A;  2ZZ0 A;  3AEA A;  2Q0L A;  5HXI A;  1NEK A;  3V76 A;  3AE2 A;  3ALJ A;  3GYJ A;  4A79 A;  1H81 A;  1K4Q A;  3F8D A;  3CGC A;  1ZY8 A;  3C96 A;  2VRL A;  2XFO A;  3F8R A;  4HB9 A;  1PS9 A;  5KNL A;  5J60 A;  1JOA A;  2XVF A;  3AE5 A;  1S3E A;  1TDE A;  3AXB A;  1ZMD A;  1JRZ A;  1YQZ A;  2C72 A;  2X3N A;  1K0J A;  1L9C A;  4U8O A;  2XDO A;  2Y6Q A;  2GVC A;  5KOX A;  2WDV A;  4EIQ A;  4NTC A;  2FJE A;  1B5Q A;  4OPG A;  3UKP A;  3NK2 X;  4NTE A;  4H2P A;  5EOW A;  4A6N B;  5C3J A;  4C5O A;  5CQF A;  3RNM A;  1NHR A;  4NTD A;  4U8I A;  1MOK A;  1B37 A;  1ZP0 A;  4J33 A;  3C4N A;  3DK8 A;  4DSG A;  4J34 A;  4G6H A;  1PXC A;  5U25 A;  2W0H A;  3KPK A;  4Z44 A;  2RGJ A;  4GUV A;  2BK3 A;  4N9X A;  2CUL A;  3V3O A;  1NHQ A;  2A89 A;  2R46 A;  3V3N A;  3UP5 A;  1QO8 A;  2UZZ A;  3G5S A;  1D5T A;  1DXL A;  2VOU A;  1E7P A;  4K7Z A;  2ZZC A;  2YM2 A;  1LV0 A;  4RSL A;  2E5V A;  3SM8 A;  1ZOY A;  3NYE A;  4EQX A;  2GB0 A;  3UKK A;  4NEW A;  3ABV A;  3FG2 P;  4BK1 A;  4OPU A;  4REK A;  1EL8 A;  2E1M A;  4Z26 A;  1E1M A;  4TM1 A;  1OJD A;  4AT0 A;  3GD3 A;  3SZ0 A;  3E1T A;  1RYI A;  4USR A;  2JB2 A;  1GTE A;  1CC4 A;  4X9N A;  4H4Z A;  3KA7 A;  3AEC A;  5KXJ A;  2BXR A;  4U2S A;  3NYC A;  2DKH A;  2YR4 A;  3NLC A;  1CL0 A;  3CMM A;  4C74 A;  2WHD A;  1OJT A;  4TM3 A;  1KSS A;  3RED A;  4YTM A;  2C65 A;  3KU9 A;  4C3Y A;  5IPY A;  2AAQ A;  4BK2 A;  4CNJ A;  1XAN A;  1RSG A;  3LXD A;  3DA1 A;  3RHA A;  2F5Z A;  3SX6 A;  1KF6 A;  3AE3 A;  3CNP A;  3IWA A;  3T2K A;  3UTE A;  3GMB A;  1PXB A;  4H4T A;  3BNM A;  4EQR A;  1P2E A;  2CVJ A;  3AWI A;  4GDE A;  3HYV A;  1F8W A;  4M52 A;  2GAG B;  4ZN0 A;  3AE9 A;  2CFY A;  5KVH A;  1S3B A;  2XVJ A;  2WU2 A;  4U8M A;  3NHO X;  3UKF A;  2GEW A;  4XXG A;  2WEU A;  3F8P A;  3NG7 X;  4ICY A;  3SZW A;  1YKJ A;  1X31 B;  1GRG A;  4EMJ A;  5KMS A;  3H8L A;  1L9E A;  3UOV A;  1UKV G;  2QAE A;  3T2Z A;  2WS3 A;  2OLO A;  2BRA A;  4DSH A;  1RP0 A;  1FEC A;  3ISH A;  1FCD A;  3QFA A;  4YKF A;  4H4V A;  3SFD A;  2V3A A;  4Z2U A;  2BK4 A;  1H83 A;  2C3D A;  2OAL A;  2BA9 A;  4PAA A;  3P4S A;  4O5Q A;  5KMP A;  4G74 A;  3ITJ A;  4U8L A;  4FX9 A;  3D8X A;  1D7L A;  4K5R A;  1PBC A;  1AOG A;  2XVE A;  3DJD A;  1GPE A;  1OJC A;  2X8C A;  3IHG A;  4HA6 A;  4XWR A;  1F6M A;  1K0I A;  1E1K A;  3QSS A;  2YWL A;  1EL5 A;  2WPE A;  2OLN A;  1YY5 A;  1VDC A;  1PHH A;  3DJE A;  1NHS A;  2NVK X;  4H2N A;  1Z6L A;  4K5S A;  2XVH A;  2TMD A;  2YG6 A;  2APG A;  4GAP A;  1VRQ B;  3UOX A;  2WOV A;  3NK0 X;  1DJQ A;  3DJJ A;  4II2 A;  4K2X A;  2VQ7 A;  2R9Z A;  3PVC A;  4OPI A;  2GQW A;  1NPX A;  3LZX A;  1PJ6 A;  5HY5 A;  3ZDN A;  5KMQ A;  2EQ7 A;  3AEE A;  3AED A;  3URH A;  4CY8 A;  2XLU A;  5U63 A;  3DME A;  4LA1 A;  4BJY A;  3ICS A;  2I0Z A;  2Q7V A;  1GV4 A;  1SEZ A;  2BS4 A;  1N4V A;  1O5W A;  2C64 A;  1GTH A;  3CND A;  3GRS A;  4GCM A;  5GSN A;  5U1O A;  2Y6R A;  1Y56 B;  3ALL A;  1B4V A;  2A8X A;  2C73 A;  2YLT A;  3DJG X;  3FMW A;  4H2Q A;  4APN A;  1H7W A;  2C4C A;  4H2R A;  4RG3 A;  4UP3 A;  2YG7 A;  2XYO A;  2GRT A;  2WET A;  2R4J A;  1PJ7 A;  2BYB A;  3BHK A;  3CGE A;  3DK4 A;  3HZL A;  4H50 A;  5CKU A;  2YLW A;  2V61 A;  2V3B A;  3NNE A;  4U8J A;  1GEU A;  3GRT A;  4U2L A;  1Y56 A;  1TRB A;  3NGC X;  5BUK A;  2JB1 A;  5FS7 A;  2BXS A;  4BK3 A;  3II4 A;  1H7X A;  4YTN A;  1GAL A;  4JDR A;  2B7R A;  4B1B A;  2WOI A;  2WES A;  2YG3 A;  3QVR A;  4OCG A;  3P1W A;  1GET A;  2C67 A;  3PO7 A;  2JK6 A;  2GV8 A;  5HYM A;  1DNC A;  3P4P A;  1IUT A;  3SFE A;  2R4E A;  3ADA B;  1FEA A;  1IUS A;  1KFY A;  3G5Q A;  3CGB A;  2C75 A;  1CHU A;  1TDF A;  2C76 A;  3KKJ A;  3M0O A;  3NN6 X;  4U8P A;  3NK1 X;  5FS9 A;  3P4R A;  3UKH A;  4BJZ A;  4Z2R A;  3L8K A;  5L46 A;  2XLT A;  4D04 A;  2C66 A;  4AT2 A;  2XFU A;  3KLJ A;  1GSN A;  2BK5 A;  2IVE A;  3NRN A;  3Q6J A;  2JKC A;  1ZKQ A;  3CNT A;  4B69 A;  1ELI A;  1E6E A;  1D7Y A;  4EQS A;  2Q0K A;  2R0P A;  3K7Q X;  1JU2 A;  2YR6 A;  2C70 A;  2H88 A;  1XPQ A;  2H89 A;  3LOV A;  3M13 A;  1IJH A;  1NEN A;  3KD9 A;  4RG4 A;  1H82 A;  2YLS A;  3QJ4 A;  1PN0 A;  1XDI A;  4H4W A;  2J3N A;  2JBV A;  3GWD A;  2VVL G;  1IUV A;  3COX A;  1VG0 A;  2XLP A;  2XCG A;  3AD9 B;  4K8D A;  3RP8 A;  2WPC A;  1BGJ A;  4H4Y A;  4AOS A;  4Y4N A;  2EQ6 A;  2OA1 A;  3AEG A;  1W4X A;  1N4U A;  3ICT A;  3AE8 A;  3UTG A;  1PXA A;  3LJP A;  5KMR A;  3QSE A;  3NN0 X;  4AOX A;  1O94 A;  4B63 A;  4CY6 A;  4YSY A;  1PBB A;  2WDQ A;  1GRT A;  3B6D A;  1KNR A;  4NEV A;  4DGK A;  1S2Y A;  1JNR A;  2BC0 A;  4B65 A;  1BKW A; 
#chains in the Genus database with same CATH homology
 4CBQ A;  1NDA A;  2PYX A;  1JNZ A;  2GMH A;  3SY4 A;  3EAN A;  3EPT A;  2VVL A;  3VRD B;  2XFP A;  1OJ9 A;  4KX6 A;  4NNJ A;  2IID A;  2FBW A;  3DK9 A;  4GDP A;  3S5W A;  3CN8 A;  3JSK A;  2RGO A;  3CIR A;  1GRE A;  3NT6 A;  1D4C A;  1PDH A;  2GMJ A;  4G6G A;  4Y4L A;  2XFQ A;  4OVI A;  1NG4 A;  1ONF A;  3RP7 A;  4KPR A;  3RP6 A;  5BVA A;  2QA2 A;  3UKL A;  3BI5 A;  1M6I A;  2ZBW A;  2GF3 A;  4UDP A;  4B64 A;  3VR9 A;  4O5U A;  5LV9 A;  1LQU A;  4YT0 A;  3FIM B;  1CJ3 A;  1GXF A;  2WDR A;  3KPF A;  3P9U A;  3ATR A;  3CGD A;  3S61 A;  3H8I A;  2GAH B;  4A99 A;  4ADW A;  3CPH G;  3GMC A;  2TPR A;  1GES A;  1YQ4 A;  4CCR A;  2X99 A;  2JAE A;  3FPZ A;  1CC6 A;  3UTH A;  1DOC A;  4BUR A;  1O95 A;  1LJ1 A;  5M10 A;  4NWZ A;  3FBS A;  5KOW A;  2GQF A;  2GR3 A;  2ZZB A;  3IHM A;  4OPL A;  4TLX A;  2IVD A;  3GDP A;  1ZX9 A;  3CTY A;  2B9W A;  4H4U A;  4I59 A;  1QLB A;  4CCQ A;  4JNA A;  3GWF A;  5JCI A;  4J2W A;  2YG4 A;  1GND A;  3KVE A;  2XVI A;  3I6D A;  3AE4 A;  1TDN A;  1REO A;  2X8G A;  4YXD A;  3AYJ A;  1GRF A;  3ALM A;  3O0H A;  5BRT A;  4FK1 C;  1Y0P A;  2GH5 A;  2JB3 A;  2Q6U A;  4EQW A;  3NH3 X;  4II3 A;  1EL9 A;  1MO9 A;  1N4W A;  1NAA A;  3BHF A;  1JEH A;  1IUX A;  2R45 A;  3OC4 A;  1EL7 A;  5JCK A;  3VR8 A;  3UCL A;  4C3X A;  2AR8 A;  2QA1 A;  1E1L A;  2XLS A;  3DGZ A;  3K30 A;  3QSM A;  1B8S A;  4JN9 A;  1DOB A;  2V60 A;  3T31 A;  4IVO B;  1LTX R;  2WQY A;  3AYL A;  3NTD A;  4H4R A;  4ZCD A;  3VQR A;  2FJD A;  3WE0 A;  3BI2 A;  1Q1R A;  5KRQ A;  3BNU A;  2C3C A;  1NG3 A;  1H86 A;  4H7U A;  3Q9T A;  4G73 A;  3UTF A;  1GRA A;  1VG9 A;  4FK1 A;  2HQM A;  1Q1W A;  4GR1 A;  1COY A;  1F8S A;  5FS6 A;  3P4Q A;  3UOZ A;  2OAM A;  1HYU A;  2X50 A;  3AYI A;  2EQ8 A;  3B3R A;  2VQB A;  3AD7 B;  1PBE A;  3NIX A;  4E0V A;  5ER0 A;  3L1R A;  2BC1 A;  3VRB A;  1FL2 A;  3T0K A;  2YVJ A;  3ATQ A;  4MJW A;  2WPF A;  5HHF A;  1BWC A;  3SZF A;  4OPC A;  1PJ5 A;  1H84 A;  1JRX A;  2X8H A;  3SGL A;  1BGN A;  3NTA A;  2BCP A;  4YWO A;  1N1P A;  3QVP A;  2YLR A;  4UDQ A;  1F3P A;  1ZK7 A;  4WX1 A;  1D4E A;  4TM4 A;  2WBA A;  4YKG A;  3T14 A;  4B68 A;  3SQP A;  2NPX A;  4EM4 A;  3SZC A;  4H4X A;  1MXT A;  2YVF A;  3R9U A;  5FS8 A;  1P2H A;  4JY2 A;  3K7M X;  2YQU A;  4Z25 A;  4AP1 A;  1LQT A;  3M12 A;  3AB1 A;  4EIP A;  3DH9 A;  2B7S A;  2E4G A;  2RAB A;  1GT8 A;  1GRB A;  1EBD A;  1CJC A;  3AEB A;  4I58 A;  4IVM B;  3AE6 A;  2ARD A;  3IC9 A;  2WOW A;  4Z2T A;  1ZMC A;  4PAB A;  4A6N A;  1KNP A;  3NYF A;  1E1N A;  4D03 A;  2ACZ A;  4J31 A;  5EBK A;  2YM1 A;  2YR5 A;  1E39 A;  4IV9 A;  4ZCC A;  3GD4 A;  2WP9 A;  3OZ2 A;  2C7G A;  5FMH A;  2O9Z A;  1CBO A;  2BAB A;  3HYW A;  5J7X A;  5KVI A;  3CPI G;  2Z5X A;  2BS3 A;  4IA6 A;  4BV6 A;  4CNK A;  2GR0 A;  3AEF A;  4JY3 A;  4DNA A;  5KWF A;  2YAU A;  1VQW A;  4AP3 A;  1CC2 A;  1FEB A;  3UOY A;  2CDU A;  2WP6 A;  2YLZ A;  4XWZ A;  4P9S A;  4Y4M A;  4UDR A;  2XFN A;  1ZOV A;  1D4D A;  2VRM A;  4B66 A;  4H4Q A;  4EMW A;  2V5Z A;  3EF6 A;  1PBF A;  1IUW A;  3NKS A;  2WU5 A;  3GYX A;  1M64 A;  1H6V A;  2FJA A;  2VVM A;  4IA5 A;  3HYX A;  4X4J A;  2V6O A;  4A7A A;  2RGH A;  3PS9 A;  4CRT A;  3BI4 A;  1IUU A;  1TYT A;  1ZDL A;  2R0G A;  4A65 A;  2R0C A;  4LII A;  4H4S A;  5EB5 A;  4EMI A;  3I3L A;  1DJN A;  2EQ9 A;  4H4P A;  3DGH A;  1JRY A;  2B76 A;  1GER A;  1L0V A;  1K0L A;  2PHH A;  1XHC A;  1LVL A;  4B67 A;  4YTP A;  1BF3 A;  2AQJ A;  4U8K A;  3EAO A;  3C4A A;  4WCT A;  5DBJ A;  1CF3 A;  4C77 A;  2BS2 A;  3CNJ A;  3UKQ A;  3H4K A;  4YSX A;  5JCL A;  1DOE A;  1FOH A;  4OPD A;  1KSU A;  1KDG A;  2A87 A;  4GAV A;  3K7T A;  5EB4 A;  2WP5 A;  5TR3 A;  3T2Y A;  4OPT A;  1CJ4 A;  4FDC B;  4TM0 A;  3SXI A;  1QJD A;  4U2T A;  1BZL A;  3LAD A;  4ECH A;  2YLX A;  3AE1 A;  4K22 A;  1TDK A;  3G5R A;  4Z24 A;  4YSH A;  5BUL A;  3AE7 A;  4U8N A;  2DKI A;  3GYI A;  4Z43 A;  3GSI A;  4JQ9 A;  4A5L A;  4J56 A;  1YQ3 A;  1OJA A;  3SYI A;  3D1C A;  3QFB A;  3CPJ G;  3LZW A;  1Q9I A;  3AD8 B;  4NZH A;  3ZYX A;  2BAC A;  1V59 A;  3IF9 A;  4J36 A;  3UP4 A;  2QCU A;  1GOS A;  2VZ2 A;  3ICR A;  4GRT A;  2BCG G;  2BRY A;  1GRH A;  4LU6 A;  4A9W A;  5C2T A;  3LB8 A;  2GR1 A;  5IQ4 A;  4USQ A;  4JNQ A;  1DOD A;  4YSZ A;  2B9X A;  1TYP A;  4GF7 A;  5M0Z A;  1S2Q A;  2Z5Y A;  2YVG A;  5JCM A;  2B9Y A;  3T37 A;  2XLR A;  4X9M A;  5IQ1 A;  1PBD A;  3GDN A;  1TDO A;  3VRA A;  4EM3 A;  1NHP A;  2GR2 A;  1F8R A;  5JCN A;  1LPF A;  1L9D A;  1CJ2 A;  4G9K A;  4J57 A;  2YG5 A;  3CNS A;  4TLZ A;  5GRT A;  2FJB A;  3UKA A;  2ZZ0 A;  3AEA A;  2Q0L A;  5HXI A;  1NEK A;  3V76 A;  3AE2 A;  3ALJ A;  3GYJ A;  4A79 A;  1H81 A;  1K4Q A;  3F8D A;  3CGC A;  1ZY8 A;  3C96 A;  2VRL A;  2XFO A;  3F8R A;  4HB9 A;  1PS9 A;  5KNL A;  5J60 A;  1JOA A;  2XVF A;  3AE5 A;  1S3E A;  1TDE A;  3AXB A;  1ZMD A;  1JRZ A;  1YQZ A;  2C72 A;  2X3N A;  1K0J A;  1L9C A;  4U8O A;  2XDO A;  2Y6Q A;  2GVC A;  5KOX A;  2WDV A;  4EIQ A;  4NTC A;  2FJE A;  1B5Q A;  4OPG A;  3UKP A;  3NK2 X;  4NTE A;  4H2P A;  5EOW A;  4A6N B;  5C3J A;  4C5O A;  5CQF A;  3RNM A;  1NHR A;  4NTD A;  4U8I A;  1MOK A;  1B37 A;  1ZP0 A;  4J33 A;  3C4N A;  3DK8 A;  4DSG A;  4J34 A;  4G6H A;  1PXC A;  5U25 A;  2W0H A;  3KPK A;  4Z44 A;  2RGJ A;  4GUV A;  2BK3 A;  4N9X A;  2CUL A;  3V3O A;  1NHQ A;  2A89 A;  2R46 A;  3V3N A;  3UP5 A;  1QO8 A;  2UZZ A;  3G5S A;  1D5T A;  1DXL A;  2VOU A;  1E7P A;  4K7Z A;  2ZZC A;  2YM2 A;  1LV0 A;  4RSL A;  2E5V A;  3SM8 A;  1ZOY A;  3NYE A;  4EQX A;  2GB0 A;  3UKK A;  4NEW A;  3ABV A;  3FG2 P;  4BK1 A;  4OPU A;  4REK A;  1EL8 A;  2E1M A;  4Z26 A;  1E1M A;  4TM1 A;  1OJD A;  4AT0 A;  3GD3 A;  3SZ0 A;  3E1T A;  1RYI A;  4USR A;  2JB2 A;  1GTE A;  1CC4 A;  4X9N A;  4H4Z A;  3KA7 A;  3AEC A;  5KXJ A;  2BXR A;  4U2S A;  3NYC A;  2DKH A;  2YR4 A;  3NLC A;  1CL0 A;  3CMM A;  4C74 A;  2WHD A;  1OJT A;  4TM3 A;  1KSS A;  3RED A;  4YTM A;  2C65 A;  3KU9 A;  4C3Y A;  5IPY A;  2AAQ A;  4BK2 A;  4CNJ A;  1XAN A;  1RSG A;  3LXD A;  3DA1 A;  3RHA A;  2F5Z A;  3SX6 A;  1KF6 A;  3AE3 A;  3CNP A;  3IWA A;  3T2K A;  3UTE A;  3GMB A;  1PXB A;  4H4T A;  3BNM A;  4EQR A;  1P2E A;  2CVJ A;  3AWI A;  4GDE A;  3HYV A;  1F8W A;  4M52 A;  2GAG B;  4ZN0 A;  3AE9 A;  2CFY A;  5KVH A;  1S3B A;  2XVJ A;  2WU2 A;  4U8M A;  3NHO X;  3UKF A;  2GEW A;  4XXG A;  2WEU A;  3F8P A;  3NG7 X;  4ICY A;  3SZW A;  1YKJ A;  1X31 B;  1GRG A;  4EMJ A;  5KMS A;  3H8L A;  1L9E A;  3UOV A;  1UKV G;  2QAE A;  3T2Z A;  2WS3 A;  2OLO A;  2BRA A;  4DSH A;  1RP0 A;  1FEC A;  3ISH A;  1FCD A;  3QFA A;  4YKF A;  4H4V A;  3SFD A;  2V3A A;  4Z2U A;  2BK4 A;  1H83 A;  2C3D A;  2OAL A;  2BA9 A;  4PAA A;  3P4S A;  4O5Q A;  5KMP A;  4G74 A;  3ITJ A;  4U8L A;  4FX9 A;  3D8X A;  1D7L A;  4K5R A;  1PBC A;  1AOG A;  2XVE A;  3DJD A;  1GPE A;  1OJC A;  2X8C A;  3IHG A;  4HA6 A;  4XWR A;  1F6M A;  1K0I A;  1E1K A;  3QSS A;  2YWL A;  1EL5 A;  2WPE A;  2OLN A;  1YY5 A;  1VDC A;  1PHH A;  3DJE A;  1NHS A;  2NVK X;  4H2N A;  1Z6L A;  4K5S A;  2XVH A;  2TMD A;  2YG6 A;  2APG A;  4GAP A;  1VRQ B;  3UOX A;  2WOV A;  3NK0 X;  1DJQ A;  3DJJ A;  4II2 A;  4K2X A;  2VQ7 A;  2R9Z A;  3PVC A;  4OPI A;  2GQW A;  1NPX A;  3LZX A;  1PJ6 A;  5HY5 A;  3ZDN A;  5KMQ A;  2EQ7 A;  3AEE A;  3AED A;  3URH A;  4CY8 A;  2XLU A;  5U63 A;  3DME A;  4LA1 A;  4BJY A;  3ICS A;  2I0Z A;  2Q7V A;  1GV4 A;  1SEZ A;  2BS4 A;  1N4V A;  1O5W A;  2C64 A;  1GTH A;  3CND A;  3GRS A;  4GCM A;  5GSN A;  5U1O A;  2Y6R A;  1Y56 B;  3ALL A;  1B4V A;  2A8X A;  2C73 A;  2YLT A;  3DJG X;  3FMW A;  4H2Q A;  4APN A;  1H7W A;  2C4C A;  4H2R A;  4RG3 A;  4UP3 A;  2YG7 A;  2XYO A;  2GRT A;  2WET A;  2R4J A;  1PJ7 A;  2BYB A;  3BHK A;  3CGE A;  3DK4 A;  3HZL A;  4H50 A;  5CKU A;  2YLW A;  2V61 A;  2V3B A;  3NNE A;  4U8J A;  1GEU A;  3GRT A;  4U2L A;  1Y56 A;  1TRB A;  3NGC X;  5BUK A;  2JB1 A;  5FS7 A;  2BXS A;  4BK3 A;  3II4 A;  1H7X A;  4YTN A;  1GAL A;  4JDR A;  2B7R A;  4B1B A;  2WOI A;  2WES A;  2YG3 A;  3QVR A;  4OCG A;  3P1W A;  1GET A;  2C67 A;  3PO7 A;  2JK6 A;  2GV8 A;  5HYM A;  1DNC A;  3P4P A;  1IUT A;  3SFE A;  2R4E A;  3ADA B;  1FEA A;  1IUS A;  1KFY A;  3G5Q A;  3CGB A;  2C75 A;  1CHU A;  1TDF A;  2C76 A;  3KKJ A;  3M0O A;  3NN6 X;  4U8P A;  3NK1 X;  5FS9 A;  3P4R A;  3UKH A;  4BJZ A;  4Z2R A;  3L8K A;  5L46 A;  2XLT A;  4D04 A;  2C66 A;  4AT2 A;  2XFU A;  3KLJ A;  1GSN A;  2BK5 A;  2IVE A;  3NRN A;  3Q6J A;  2JKC A;  1ZKQ A;  3CNT A;  4B69 A;  1ELI A;  1E6E A;  1D7Y A;  4EQS A;  2Q0K A;  2R0P A;  3K7Q X;  1JU2 A;  2YR6 A;  2C70 A;  2H88 A;  1XPQ A;  2H89 A;  3LOV A;  3M13 A;  1IJH A;  1NEN A;  3KD9 A;  4RG4 A;  1H82 A;  2YLS A;  3QJ4 A;  1PN0 A;  1XDI A;  4H4W A;  2J3N A;  2JBV A;  3GWD A;  2VVL G;  1IUV A;  3COX A;  1VG0 A;  2XLP A;  2XCG A;  3AD9 B;  4K8D A;  3RP8 A;  2WPC A;  1BGJ A;  4H4Y A;  4AOS A;  4Y4N A;  2EQ6 A;  2OA1 A;  3AEG A;  1W4X A;  1N4U A;  3ICT A;  3AE8 A;  3UTG A;  1PXA A;  3LJP A;  5KMR A;  3QSE A;  3NN0 X;  4AOX A;  1O94 A;  4B63 A;  4CY6 A;  4YSY A;  1PBB A;  2WDQ A;  1GRT A;  3B6D A;  1KNR A;  4NEV A;  4DGK A;  1S2Y A;  1JNR A;  2BC0 A;  4B65 A;  1BKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...