2XVJA

Crystal structure of the mutant bacterial flavin containing monooxygenase in complex with indole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
446
structure length
446
Chain Sequence
ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 154
structure length 446
sequence length 446
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvjA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvjA02
5ER0A 3NGCX 3K7TA 5EB5A 4A9WA 2C72A 2B7SA 3OZ2A 4TM4A 3EPTA 4CBQA 3NTDA 1QO8A 1S2YA 1ZOYA 3EF6A 2DKHA 2Q7VA 4GF7A 5C2TA 2WOIA 1F8WA 4USQA 4TM0A 4J57A 3S5WA 1D5TA 2C7GA 4EQWA 3S61A 2C66A 5EOWA 4U8KA 5J60A 4B1BA 3UKQA 1GNDA 1ZKQA 1MO9A 3NG7X 1N1PA 2C65A 3UTFA 2YM2A 4A7AA 2XLPA 4EMWA 4ECHA 1H82A 3NH3X 1PXAA 1LQTA 2WPCA 1N4VA 1L9CA 2XVIA 3AD7B 2X8GA 4H4SA 2XFUA 3AD9B 4IV9A 3ATQA 5LV9A 1Q1WA 4K5RA 5FS9A 3RNMA 2R0PA 3UCLA 1PBDA 1D7YA 5HY5A 2A8XA 2V5ZA 2WS3A 3I6DA 1YKJA 4MJWA 3CGCA 3CIRA 4AOXA 2BXSA 3BI2A 2QA2A 1K0IA 5BULA 3P4QA 1S3EA 3AE6A 4B68A 4YXDA 3RP7A 2YVJA 1FECA 3URHA 3CNDA 4NEWA 1PBCA 4YSHA 2WOWA 4J33A 4D03A 5M0ZA 3DJGX 1LQUA 2YG4A 1DOBA 5IQ4A 5U1OA 2B9YA 3AWIA 3DJJA 1FOHA 1ZX9A 1XDIA 2YVGA 1E39A 4UDPA 3NKSA 4H4YA 4DNAA 3ALJA 3DK8A 3GDNA 4EQSA 1PBFA 4TM3A 4Z2RA 2XLUA 2Z5YA 4J2WA 4OCGA 2OA1A 1VG0A 3ABVA 1PDHA 4ZN0A 3H8IA 1EL9A 4EMIA 3UKKA 4JNAA 2GR2A 4U8LA 3UTEA 4A6NA 1CF3A 2W0HA 4IA5A 2YLSA 2GR1A 4B64A 4B67A 4TM1A 3K7QX 4CY6A 4K22A 5JCMA 1TDOA 2XLTA 4CNJA 1ELIA 3GYJA 2Q0LA 1HYUA 4H4ZA 2XVEA 2WDVA 4J56A 1OJAA 2UZZA 4H4TA 4PAAA 2XFNA 1DNCA 3E1TA 2QCUA 3NYEA 2GR0A 4H4VA 4J34A 1N4UA 3SM8A 2WQYA 1REOA 1CBOA 3P9UA 3UKLA 1GPEA 3QVRA 3CTYA 4YSXA 3AE5A 1COYA 2BS2A 1IJHA 3IF9A 3SQPA 3DJDA 2XFPA 1CJ2A 2WP9A 4CCQA 3V76A 2GAGB 1PBEA 1ZP0A 4J31A 2VZ2A 2YG6A 1NHRA 1B4VA 1DJQA 3GWFA 2WPFA 2RGHA 2C70A 5HXIA 1Q1RA 2GEWA 3AECA 1UKVG 3L8KA 5GSNA 4XWZA 1CJ4A 2XDOA 1EBDA 3NN6X 1NENA 2X3NA 3AE9A 2OALA 1CL0A 4AT2A 3G5QA 3UKAA 5BUKA 2X99A 3P4RA 1LTXR 1D4CA 1KDGA 1Z6LA 2ZBWA 4EMJA 4GR1A 3T37A 4AP1A 3BI5A 4Y4MA 2BC1A 2V6OA 5KWFA 2WHDA 4K7ZA 1LV0A 2AR8A 1GRHA 1M64A 1PN0A 2XVHA 1PJ5A 4LA1A 4UDQA 3FMWA 1F6MA 3QSMA 1LVLA 1IUVA 3P4SA 1GEUA 1NG4A 4NTEA 4CNKA 3AE7A 4U8JA 4EIPA 2XFQA 1DJNA 3UOZA 4AOSA 2BS3A 3QFBA 4JNQA 3DGHA 4BK2A 4HB9A 5HYMA 1OJDA 1W4XA 5KVIA 3CGEA 4RG3A 3UOVA 2VRMA 4FK1A 4OVIA 3VR9A 4C3YA 2B7RA 2V3AA 1D4EA 1NEKA 1KSUA 4I59A 4D04A 2FJBA 2VQBA 2B76A 3I3LA 2C3CA 3HZLA 4YSYA 3CGBA 5FMHA 3SFEA 3KPFA 3LJPA 3PVCA 4A6NB 4NEVA 5DBJA 1VQWA 1XANA 2C75A 2BYBA 5CQFA 1NG3A 4B65A 2C76A 3IHMA 1GRFA 4N9XA 3CPHG 2R46A 2TPRA 3BI4A 4IVMB 3EANA 2CDUA 1GOSA 3BHKA 3NTAA 4Z2UA 2BS4A 2TMDA 3KD9A 4FX9A 2V61A 5HHFA 4HA6A 4P9SA 3ZYXA 4A65A 1OJTA 2JB1A 3PO7A 1BGNA 3NK1X 2BACA 4Y4LA 1JRXA 3FPZA 1E1MA 3AE2A 3IWAA 2DKIA 3AEAA 2GMJA 2FJEA 1DODA 2Y6QA 3KA7A 4H50A 4U2SA 4A79A 1GV4A 4RSLA 4DSGA 2BCGG 2BCPA 4Z43A 3BHFA 2ACZA 2YLXA 3LXDA 2R4JA 3AEDA 2VVLG 1QLBA 2YR4A 1H7XA 3CNJA 2E5VA 3P4PA 4U2LA 1PHHA 4Y4NA 4C77A 1NAAA 2GVCA 2WP6A 1YQ4A 5IQ1A 1BGJA 3LOVA 1H84A 3K7MX 4CCRA 3NN0X 1BKWA 1O5WA 3DGZA 3GRTA 4H4WA 3UTHA 2IIDA 4K2XA 3IC9A 1TDEA 3CNPA 4H2QA 5JCIA 2FJAA 4A5LA 3D8XA 2R45A 3ICRA 5KOWA 4BV6A 1M6IA 3LZWA 5CKUA 2B9WA 2GH5A 3LADA 2WESA 2V3BA 2ARDA 3COXA 4JDRA 5J7XA 4A99A 4C5OA 3L1RA 2VOUA 2XFOA 3AB1A 1P2EA 4KX6A 1PXBA 4UP3A 1OJCA 4BJZA 2XCGA 3NK0X 4EQRA 1ZOVA 3GDPA 2VVLA 3DMEA 1CHUA 2QAEA 4Z26A 1NPXA 2JAEA 5KRQA 1TDNA 1XPQA 2YLZA 3SGLA 3VRDB 2FBWA 4YTNA 1H81A 4BURA 2VRLA 4X9MA 2GF3A 3GMCA 3CNTA 4H4RA 1GTHA 1EL7A 2JK6A 5M10A 4NTCA 2R9ZA 1OJ9A 3CNSA 4U2TA 3V3OA 5C3JA 1NDAA 2HQMA 1K0LA 3CN8A 2WDQA 4B69A 5BVAA 3H4KA 4H2PA 3UKHA 4NZHA 1ZK7A 3VQRA 3VR8A 1RP0A 1BWCA 1CJCA 1H6VA 1X31B 2WP5A 3ICTA 4FK1C 3FG2P 4H7UA 3UOYA 4B63A 3CGDA 1ZMDA 4OPLA 2RGOA 5KOXA 3UP5A 2AAQA 1E7PA 2YLWA 4Z2TA 1S3BA 3AEBA 4WCTA 1L9DA 4CRTA 3GSIA 2YM1A 1ZY8A 4X4JA 1Q9IA 2GAHB 1SEZA 2XYOA 5FS7A 3R9UA 2WEUA 1AOGA 2WBAA 2GV8A 2YWLA 3ICSA 1LJ1A 3CPIG 5KVHA 1E1LA 1CJ3A 1JRZA 1PXCA 4EM3A 4YWOA 3LZXA 2BABA 2GMHA 4XWRA 1JNZA 4LU6A 3BNMA 2EQ8A 3QSSA 3JSKA 4JN9A 1TYPA 3D1CA 4Z25A 4H4UA 4JY2A 3AE3A 2H89A 3AE4A 1BZLA 1KNRA 3NHOX 3AEEA 4H4XA 3F8PA 1B37A 1H7WA 4FDCB 3F8DA 1JNRA 2GRTA 4OPTA 1YQZA 3VRBA 3NK2X 3AEGA 3KU9A 5EB4A 1IUXA 1QJDA 3GRSA 3AXBA 3C4NA 3ADAB 4DSHA 2WU5A 1JEHA 3F8RA 3NNEA 2OLOA 4ADWA 3GWDA 1IUUA 1FL2A 1JU2A 3G5RA 4H4PA 4USRA 3AE1A 1IUSA 3AYLA 1D4DA 2BK4A 3UKPA 1F8RA 2YVFA 2WPEA 3NYCA 4YTMA 1FEBA 2EQ6A 2R4EA 4K8DA 2XLRA 1N4WA 4H2RA 1GRTA 1GSNA 4U8PA 2H88A 1DOCA 3Q6JA 2NVKX 2GB0A 3RP6A 5JCLA 3NIXA 1PJ7A 1S2QA 3K30A 5BRTA 3AYIA 4GUVA 4AT0A 1GTEA 1PS9A 2XVFA 1BF3A 3M0OA 1VRQB 3DK9A 3O0HA 3ZDNA 2APGA 2E1MA 4OPGA 1L9EA 4Z24A 1MXTA 1ZDLA 2ZZBA 3C96A 1MOKA 4IA6A 4TLXA 2E4GA 2YLRA 3ATRA 3C4AA 3DK4A 3Q9TA 3GD4A 3QFAA 1TDFA 1Y56A 2A89A 4GRTA 4BK1A 1IUWA 2XLSA 2YR6A 2B9XA 3FIMB 4EQXA 3FBSA 3II4A 4TLZA 3UKFA 1FEAA 2CVJA 5U63A 3QSEA 4OPUA 1DXLA 2A87A 2EQ9A 4OPDA 4XXGA 3UP4A 1YY5A 2OAMA 1NHQA 2PYXA 2QA1A 3B3RA 2IVDA 1CC4A 2YAUA 3P1WA 1RSGA 2YR5A 3BNUA 4C3XA 4B66A 4UDRA 2C67A 4KPRA 2JBVA 2PHHA 4YTPA 4OPIA 2YG3A 2X50A 1P2HA 2WOVA 1GERA 2VVMA 1JRYA 4WX1A 2BK3A 3ITJA 3M13A 5FS6A 1GALA 1PBBA 3LB8A 4LIIA 3KLJA 4U8IA 1XHCA 2FJDA 5KXJA 3ISHA 3NYFA 4IVOB 4GCMA 4X9NA 3KVEA 3REDA 1B5QA 3GD3A 4GDPA 2Q0KA 2BC0A 1CC2A 2RGJA 1DOEA 2Q6UA 1GXFA 3GYIA 4Z44A 4H2NA 1K0JA 1NHSA 2GQWA 2YLTA 5L46A 3RHAA 1FCDA 4I58A 2ZZCA 2O9ZA 3UTGA 4EIQA 1K4QA 4YKFA 1GESA 4APNA 2RABA 3CPJG 2X8CA 4E0VA 1KF6A 3ALMA 4REKA 1E1KA 4C74A 2J3NA 3RP8A 4U8NA 1EL8A 4PABA 3AYJA 1F3PA 2WU2A 4YT0A 4EM4A 2R0GA 5GRTA 1GT8A 2ZZ0A 5FS8A 3DJEA 3PS9A 2VQ7A 1D7LA 1LPFA 1GETA 2CULA 2YG7A 3EAOA 4DGKA 2XVJA 2C73A 3KKJA 2YQUA 1ZMCA 5EBKA 4OPCA 1E1NA 3NT6A 2I0ZA 3M12A 1GRAA 1KNPA 2V60A 4O5UA 1PJ6A 4M52A 3AD8B 2WDRA 2BK5A 2F5ZA 3ALLA 1VDCA 1F8SA 2R0CA 3QJ4A 5TR3A 5IPYA 5JCKA 1JOAA 1V59A 1H83A 2CFYA 4BJYA 5JCNA 2BA9A 2NPXA 2OLNA 1VG9A 4YKGA 2C3DA 4H4QA 4ICYA 1GRGA 1Y56B 2GR3A 2IVEA 4ZCCA 3V3NA 1H86A 3GMBA 1E6EA 1Y0PA 3IHGA 3DA1A 4K5SA 3WE0A 2YG5A 1CC6A 2JB3A 1GREA 1KSSA 1TRBA 2WETA 1TDKA 4JQ9A 4GDEA 4JY3A 4RG4A 5U25A 3DH9A 3G5SA 4O5QA 3SFDA 3OC4A 1L0VA 2BXRA 1O95A 1B8SA 1KFYA 2AQJA 3UOXA 2EQ7A 2JB2A 2Z5XA 2JKCA 3QVPA 3NLCA 2GQFA 4U8OA 3H8LA 4ZCDA 1IUTA 4NTDA 1GRBA 1NHPA 3NRNA 4CY8A 1O94A 4U8MA 4BK3A 4AP3A 1YQ3A 4YSZA 3VRAA 3AE8A 3AEFA 1EL5A 1TYTA 2Y6RA 1RYIA 4J36A 3B6DA 1ONFA 2C64A 2X8HA
chains in the Genus database with same CATH superfamily
5ER0A 3NGCX 3K7TA 5EB5A 4A9WA 2C72A 2B7SA 3OZ2A 4TM4A 3EPTA 4CBQA 3NTDA 1QO8A 1S2YA 1ZOYA 3EF6A 2DKHA 2Q7VA 4GF7A 5C2TA 2WOIA 1F8WA 4USQA 4TM0A 4J57A 3S5WA 1D5TA 2C7GA 4II2A 3S61A 2C66A 5EOWA 4U8KA 4EQWA 5J60A 4B1BA 3UKQA 1GNDA 1ZKQA 1MO9A 3NG7X 1N1PA 2C65A 4G9KA 3UTFA 2YM2A 4A7AA 2XLPA 4EMWA 4ECHA 1H82A 3NH3X 1PXAA 1LQTA 2WPCA 1N4VA 1L9CA 2XVIA 3AD7B 2X8GA 4H4SA 2XFUA 3AD9B 4IV9A 3ATQA 5LV9A 1Q1WA 4K5RA 5FS9A 3RNMA 2R0PA 3UCLA 1PBDA 1D7YA 5HY5A 2A8XA 2V5ZA 2WS3A 3I6DA 1YKJA 4MJWA 3CGCA 5KMSA 3CIRA 4AOXA 2BXSA 3BI2A 2QA2A 1K0IA 5BULA 3P4QA 1S3EA 3AE6A 4B68A 4YXDA 3RP7A 2YVJA 1FECA 3URHA 3CNDA 4NEWA 1PBCA 4YSHA 2WOWA 4J33A 4D03A 5M0ZA 3DJGX 1LQUA 2YG4A 1DOBA 5IQ4A 5U1OA 2B9YA 3AWIA 3DJJA 1FOHA 1ZX9A 1XDIA 2YVGA 1E39A 4UDPA 3NKSA 4H4YA 4DNAA 3ALJA 3DK8A 3GDNA 4EQSA 1PBFA 4TM3A 4Z2RA 2XLUA 2Z5YA 4J2WA 4OCGA 2OA1A 1VG0A 2C4CA 1PDHA 3ABVA 4ZN0A 3H8IA 1EL9A 4EMIA 3UKKA 4JNAA 2GR2A 4U8LA 3UTEA 4A6NA 1CF3A 2W0HA 4IA5A 2YLSA 2GR1A 4B64A 4B67A 4TM1A 3K7QX 4CY6A 4K22A 5JCMA 1TDOA 2XLTA 4CNJA 1ELIA 3GYJA 2Q0LA 1HYUA 4H4ZA 2XVEA 2WDVA 4J56A 1OJAA 2UZZA 4H4TA 4PAAA 2XFNA 1DNCA 3E1TA 2QCUA 3NYEA 2GR0A 4H4VA 4J34A 1N4UA 3SM8A 2WQYA 1REOA 1CBOA 3P9UA 3UKLA 1GPEA 3QVRA 3CTYA 4YSXA 3AE5A 1COYA 2BS2A 1IJHA 3IF9A 3SQPA 3DJDA 2XFPA 1CJ2A 2WP9A 4CCQA 3V76A 2GAGB 1PBEA 1ZP0A 4J31A 2VZ2A 2YG6A 1NHRA 1B4VA 1DJQA 3GWFA 5KNLA 2WPFA 2RGHA 3SYIA 2C70A 5HXIA 1Q1RA 2GEWA 3AECA 3SZCA 1UKVG 3L8KA 5GSNA 3HYVA 4XWZA 1CJ4A 2XDOA 1EBDA 3NN6X 1NENA 2X3NA 3AE9A 2OALA 1CL0A 4AT2A 3G5QA 3UKAA 5BUKA 2X99A 3P4RA 1LTXR 1D4CA 1KDGA 1Z6LA 2ZBWA 4EMJA 4GR1A 3T37A 4AP1A 3BI5A 4Y4MA 2BC1A 2V6OA 5KWFA 2WHDA 4K7ZA 1LV0A 2AR8A 1GRHA 1M64A 1PN0A 2XVHA 3SY4A 1PJ5A 4LA1A 4UDQA 3FMWA 1F6MA 3QSMA 1LVLA 1IUVA 3P4SA 1GEUA 1NG4A 4NTEA 4CNKA 3AE7A 4U8JA 4EIPA 2XFQA 1DJNA 3KPKA 3UOZA 4AOSA 2BS3A 3QFBA 4JNQA 3DGHA 4BK2A 3T2KA 4HB9A 5HYMA 1OJDA 1W4XA 5KVIA 3CGEA 4RG3A 3UOVA 2VRMA 4FK1A 4OVIA 3SZ0A 3VR9A 2B7RA 4C3YA 2V3AA 1D4EA 1NEKA 1KSUA 4I59A 4D04A 2FJBA 2VQBA 2B76A 3I3LA 2C3CA 3HZLA 4YSYA 3CGBA 5FMHA 3SFEA 3KPFA 3LJPA 3PVCA 4A6NB 4NEVA 5DBJA 1VQWA 1XANA 2C75A 2BYBA 5CQFA 1NG3A 4B65A 2C76A 3IHMA 1GRFA 4N9XA 3CPHG 2R46A 2TPRA 3BI4A 4IVMB 3EANA 2CDUA 1GOSA 3BHKA 3NTAA 4Z2UA 2BS4A 2TMDA 3KD9A 4FX9A 2V61A 5HHFA 4HA6A 4P9SA 3ZYXA 4A65A 1OJTA 2JB1A 3PO7A 1BGNA 3NK1X 2BACA 4Y4LA 1JRXA 3FPZA 1E1MA 3AE2A 3IWAA 2DKIA 3AEAA 2GMJA 2FJEA 1DODA 2Y6QA 3KA7A 4H50A 4U2SA 4A79A 1GV4A 4RSLA 4DSGA 2BCGG 2BCPA 4Z43A 3BHFA 2ACZA 2YLXA 3LXDA 2R4JA 3AEDA 2VVLG 1QLBA 2YR4A 1H7XA 3T2YA 3CNJA 2E5VA 3P4PA 4U2LA 1PHHA 4Y4NA 4C77A 1NAAA 2GVCA 2WP6A 1YQ4A 5IQ1A 1BGJA 3LOVA 1H84A 3K7MX 4CCRA 3NN0X 1BKWA 1O5WA 3DGZA 3GRTA 4H4WA 3UTHA 2IIDA 4K2XA 3IC9A 1TDEA 3CNPA 4H2QA 5JCIA 2FJAA 4A5LA 3D8XA 2R45A 3ICRA 5KOWA 4BV6A 1M6IA 3LZWA 5CKUA 2B9WA 2GH5A 3LADA 2WESA 2V3BA 2ARDA 3COXA 3HYWA 4JDRA 5J7XA 4A99A 4C5OA 3L1RA 2VOUA 2XFOA 3AB1A 1P2EA 4KX6A 1PXBA 4UP3A 1OJCA 4BJZA 2XCGA 3NK0X 4EQRA 1ZOVA 3GDPA 2VVLA 3DMEA 1CHUA 2QAEA 4Z26A 1NPXA 2JAEA 5KRQA 1TDNA 1XPQA 2YLZA 3SGLA 3T2ZA 2FBWA 3VRDB 4YTNA 1H81A 4BURA 2VRLA 4X9MA 2GF3A 3GMCA 3CNTA 4H4RA 1GTHA 1EL7A 2JK6A 5M10A 4NTCA 2R9ZA 1OJ9A 3CNSA 4U2TA 3V3OA 5C3JA 1NDAA 4G6HA 2HQMA 1K0LA 3CN8A 2WDQA 4B69A 5BVAA 3H4KA 4H2PA 3UKHA 4NZHA 1ZK7A 3VQRA 3VR8A 1RP0A 1BWCA 1CJCA 1H6VA 1X31B 2WP5A 3ICTA 4FK1C 3FG2P 4H7UA 3UOYA 4B63A 3CGDA 1ZMDA 4OPLA 2RGOA 5KOXA 3UP5A 2AAQA 1E7PA 2YLWA 4Z2TA 1S3BA 3AEBA 4WCTA 1L9DA 4CRTA 5KMPA 3GSIA 2YM1A 1ZY8A 4X4JA 1Q9IA 2GAHB 1SEZA 2XYOA 5FS7A 3R9UA 2WEUA 4G6GA 1AOGA 2WBAA 2GV8A 2YWLA 3ICSA 1LJ1A 3CPIG 5KVHA 1E1LA 1CJ3A 1JRZA 1PXCA 4EM3A 4YWOA 3LZXA 2BABA 2GMHA 4XWRA 1JNZA 4LU6A 3BNMA 2EQ8A 3QSSA 3JSKA 4JN9A 1TYPA 3D1CA 4Z25A 4H4UA 4JY2A 3AE3A 2H89A 3AE4A 1BZLA 1KNRA 3NHOX 3AEEA 4H4XA 3F8PA 3T31A 1B37A 1H7WA 4FDCB 3F8DA 1JNRA 2GRTA 4OPTA 1YQZA 3VRBA 5KMRA 3NK2X 3AEGA 3KU9A 5EB4A 1IUXA 1QJDA 3GRSA 3AXBA 3C4NA 3ADAB 4DSHA 2WU5A 1JEHA 3F8RA 3HYXA 2OLOA 3NNEA 4NWZA 4ADWA 3GWDA 1IUUA 1FL2A 1JU2A 3G5RA 4H4PA 4USRA 3AE1A 1IUSA 3AYLA 1D4DA 2BK4A 3UKPA 1F8RA 2YVFA 3SX6A 2WPEA 3NYCA 4YTMA 1FEBA 2EQ6A 2R4EA 4II3A 4K8DA 4GAVA 2XLRA 1N4WA 4H2RA 1GRTA 1GSNA 4U8PA 2H88A 1DOCA 3Q6JA 2NVKX 2GB0A 3RP6A 5JCLA 3NIXA 1PJ7A 1S2QA 3K30A 5BRTA 3AYIA 4GUVA 4AT0A 1GTEA 1PS9A 2XVFA 4NNJA 1BF3A 3M0OA 1VRQB 3DK9A 3O0HA 3ZDNA 2APGA 2E1MA 4OPGA 1L9EA 4Z24A 1MXTA 1ZDLA 2ZZBA 3C96A 1MOKA 4IA6A 4TLXA 2E4GA 2YLRA 3ATRA 3C4AA 3DK4A 3Q9TA 3GD4A 3QFAA 1TDFA 1Y56A 2A89A 4GRTA 4BK1A 1IUWA 2XLSA 2YR6A 2B9XA 3FIMB 4EQXA 3FBSA 3II4A 4TLZA 3UKFA 1FEAA 2CVJA 5U63A 3QSEA 4OPUA 1DXLA 2A87A 2EQ9A 4OPDA 4XXGA 3UP4A 1YY5A 2OAMA 1NHQA 2PYXA 2QA1A 3B3RA 2IVDA 1CC4A 2YAUA 3P1WA 4GAPA 1RSGA 2YR5A 3BNUA 3SXIA 4B66A 4UDRA 4C3XA 2C67A 4KPRA 2JBVA 2PHHA 4YTPA 4OPIA 2YG3A 2X50A 1P2HA 2WOVA 1GERA 2VVMA 1JRYA 4WX1A 2BK3A 3ITJA 3M13A 5FS6A 5KMQA 1GALA 1PBBA 3LB8A 4LIIA 3KLJA 4U8IA 1XHCA 2FJDA 5KXJA 3ISHA 3NYFA 4IVOB 4GCMA 4X9NA 3KVEA 3REDA 1B5QA 3GD3A 4GDPA 2Q0KA 2BC0A 3SZWA 1CC2A 2RGJA 1DOEA 2Q6UA 1GXFA 3GYIA 4Z44A 4H2NA 1K0JA 1NHSA 2GQWA 2YLTA 5L46A 3RHAA 1FCDA 4I58A 2ZZCA 2O9ZA 3UTGA 4EIQA 1K4QA 4YKFA 1GESA 4APNA 2RABA 3GYXA 3CPJG 2X8CA 4E0VA 1KF6A 3ALMA 4REKA 1E1KA 4C74A 2J3NA 3RP8A 4U8NA 1EL8A 4PABA 3AYJA 3T14A 1F3PA 2WU2A 4YT0A 4EM4A 2R0GA 5GRTA 1GT8A 2ZZ0A 5FS8A 3T0KA 3DJEA 3PS9A 2VQ7A 1D7LA 1LPFA 1GETA 2BRAA 2CULA 2YG7A 3EAOA 4DGKA 2XVJA 2C73A 3KKJA 2YQUA 1ZMCA 5EBKA 4OPCA 1E1NA 3NT6A 2I0ZA 3M12A 1GRAA 1KNPA 2V60A 4O5UA 1PJ6A 4M52A 3AD8B 2WDRA 2BK5A 2F5ZA 3ALLA 1VDCA 1F8SA 2R0CA 3QJ4A 5TR3A 5IPYA 5JCKA 1JOAA 1V59A 1H83A 2CFYA 4BJYA 5JCNA 2BA9A 2NPXA 2OLNA 4G73A 1VG9A 4YKGA 2C3DA 4H4QA 4ICYA 1GRGA 1Y56B 2GR3A 2IVEA 4ZCCA 3V3NA 1H86A 3GMBA 1E6EA 1Y0PA 2BRYA 3DA1A 3IHGA 4K5SA 2YG5A 3WE0A 1CC6A 2JB3A 1GREA 3CMMA 1KSSA 1TRBA 2WETA 1TDKA 4JQ9A 4GDEA 4JY3A 4RG4A 5U25A 3DH9A 3G5SA 4O5QA 3SFDA 3OC4A 4G74A 1L0VA 2BXRA 1O95A 1B8SA 1KFYA 2AQJA 3UOXA 2EQ7A 2JB2A 2Z5XA 2JKCA 3QVPA 3NLCA 2GQFA 4U8OA 3H8LA 4ZCDA 1IUTA 4NTDA 1GRBA 1NHPA 3NRNA 4CY8A 1O94A 4U8MA 4BK3A 4AP3A 1YQ3A 3SZFA 4YSZA 3VRAA 3AE8A 3AEFA 1EL5A 1TYTA 2Y6RA 1RYIA 4J36A 3B6DA 1ONFA 2C64A 2X8HA
chains in the Genus database with same CATH topology
5ER0A 3NGCX 3K7TA 5EB5A 4A9WA 2C72A 2B7SA 3OZ2A 4TM4A 3EPTA 4CBQA 3NTDA 1QO8A 1S2YA 1ZOYA 3EF6A 2DKHA 2Q7VA 4GF7A 5C2TA 2WOIA 1F8WA 4USQA 4TM0A 4J57A 3S5WA 1D5TA 2C7GA 4II2A 3S61A 2C66A 5EOWA 4U8KA 4EQWA 5J60A 4B1BA 3UKQA 1GNDA 1ZKQA 1MO9A 3NG7X 1N1PA 2C65A 4G9KA 3UTFA 2YM2A 4A7AA 2XLPA 4EMWA 4ECHA 1H82A 3NH3X 1PXAA 1LQTA 2WPCA 1N4VA 1L9CA 2XVIA 3AD7B 2X8GA 4H4SA 2XFUA 3AD9B 4IV9A 3ATQA 5LV9A 1Q1WA 4K5RA 5FS9A 3RNMA 2R0PA 3UCLA 1PBDA 1D7YA 5HY5A 2A8XA 2V5ZA 2WS3A 3I6DA 1YKJA 4MJWA 3CGCA 5KMSA 3CIRA 4AOXA 2BXSA 3BI2A 2QA2A 1K0IA 5BULA 3P4QA 1S3EA 3AE6A 4B68A 4YXDA 3RP7A 2YVJA 1FECA 3URHA 3CNDA 4NEWA 1PBCA 4YSHA 2WOWA 4J33A 4D03A 5M0ZA 3DJGX 1LQUA 2YG4A 1DOBA 5IQ4A 5U1OA 2B9YA 3AWIA 3DJJA 1FOHA 1ZX9A 1XDIA 2YVGA 1E39A 4UDPA 3NKSA 4H4YA 4DNAA 3ALJA 3DK8A 3GDNA 4EQSA 1PBFA 4TM3A 4Z2RA 2XLUA 2Z5YA 4J2WA 4OCGA 2OA1A 1VG0A 2C4CA 1PDHA 3ABVA 4ZN0A 3H8IA 1EL9A 4EMIA 3UKKA 4JNAA 2GR2A 4U8LA 3UTEA 4A6NA 1CF3A 2W0HA 4IA5A 2YLSA 2GR1A 4B64A 4B67A 4TM1A 3K7QX 4CY6A 4K22A 5JCMA 1TDOA 2XLTA 4CNJA 1ELIA 3GYJA 2Q0LA 1HYUA 4H4ZA 2XVEA 2WDVA 4J56A 1OJAA 2UZZA 4H4TA 4PAAA 2XFNA 1DNCA 3E1TA 2QCUA 3NYEA 2GR0A 4H4VA 4J34A 1N4UA 3SM8A 2WQYA 1REOA 1CBOA 3P9UA 3UKLA 1GPEA 3QVRA 3CTYA 4YSXA 3AE5A 1COYA 2BS2A 1IJHA 3IF9A 3SQPA 3DJDA 2XFPA 1CJ2A 2WP9A 4CCQA 3V76A 2GAGB 1PBEA 1ZP0A 4J31A 2VZ2A 2YG6A 1NHRA 1B4VA 1DJQA 3GWFA 5KNLA 2WPFA 2RGHA 3SYIA 2C70A 5HXIA 1Q1RA 2GEWA 3AECA 3SZCA 1UKVG 3L8KA 5GSNA 3HYVA 4XWZA 1CJ4A 2XDOA 1EBDA 3NN6X 1NENA 2X3NA 3AE9A 2OALA 1CL0A 4AT2A 3G5QA 3UKAA 5BUKA 2X99A 3P4RA 1LTXR 1D4CA 1KDGA 1Z6LA 2ZBWA 4EMJA 4GR1A 3T37A 4AP1A 3BI5A 4Y4MA 2BC1A 2V6OA 5KWFA 2WHDA 4K7ZA 1LV0A 2AR8A 1GRHA 1M64A 1PN0A 2XVHA 3SY4A 1PJ5A 4LA1A 4UDQA 3FMWA 1F6MA 3QSMA 1LVLA 1IUVA 3P4SA 1GEUA 1NG4A 4NTEA 4CNKA 3AE7A 4U8JA 4EIPA 2XFQA 1DJNA 3KPKA 3UOZA 4AOSA 2BS3A 3QFBA 4JNQA 3DGHA 4BK2A 3T2KA 4HB9A 5HYMA 1OJDA 1W4XA 5KVIA 3CGEA 4RG3A 3UOVA 2VRMA 4FK1A 4OVIA 3SZ0A 3VR9A 2B7RA 4C3YA 2V3AA 1D4EA 1NEKA 1KSUA 4I59A 4D04A 2FJBA 2VQBA 2B76A 3I3LA 2C3CA 3HZLA 4YSYA 3CGBA 5FMHA 3SFEA 3KPFA 3LJPA 3PVCA 4A6NB 4NEVA 5DBJA 1VQWA 1XANA 2C75A 2BYBA 5CQFA 1NG3A 4B65A 2C76A 3IHMA 1GRFA 4N9XA 3CPHG 2R46A 2TPRA 3BI4A 4IVMB 3EANA 2CDUA 1GOSA 3BHKA 3NTAA 4Z2UA 2BS4A 2TMDA 3KD9A 4FX9A 2V61A 5HHFA 4HA6A 4P9SA 3ZYXA 4A65A 1OJTA 2JB1A 3PO7A 1BGNA 3NK1X 2BACA 4Y4LA 1JRXA 3FPZA 1E1MA 3AE2A 3IWAA 2DKIA 3AEAA 2GMJA 2FJEA 1DODA 2Y6QA 3KA7A 4H50A 4U2SA 4A79A 1GV4A 4RSLA 4DSGA 2BCGG 2BCPA 4Z43A 3BHFA 2ACZA 2YLXA 3LXDA 2R4JA 3AEDA 2VVLG 1QLBA 2YR4A 1H7XA 3T2YA 3CNJA 2E5VA 3P4PA 4U2LA 1PHHA 4Y4NA 4C77A 1NAAA 2GVCA 2WP6A 1YQ4A 5IQ1A 1BGJA 3LOVA 1H84A 3K7MX 4CCRA 3NN0X 1BKWA 1O5WA 3DGZA 3GRTA 4H4WA 3UTHA 2IIDA 4K2XA 3IC9A 1TDEA 3CNPA 4H2QA 5JCIA 2FJAA 4A5LA 3D8XA 2R45A 3ICRA 5KOWA 4BV6A 1M6IA 3LZWA 5CKUA 2B9WA 2GH5A 3LADA 2WESA 2V3BA 2ARDA 3COXA 3HYWA 4JDRA 5J7XA 4A99A 4C5OA 3L1RA 2VOUA 2XFOA 3AB1A 1P2EA 4KX6A 1PXBA 4UP3A 1OJCA 4BJZA 2XCGA 3NK0X 4EQRA 1ZOVA 3GDPA 2VVLA 3DMEA 1CHUA 2QAEA 4Z26A 1NPXA 2JAEA 5KRQA 1TDNA 1XPQA 2YLZA 3SGLA 3T2ZA 2FBWA 3VRDB 4YTNA 1H81A 4BURA 2VRLA 4X9MA 2GF3A 3GMCA 3CNTA 4H4RA 1GTHA 1EL7A 2JK6A 5M10A 4NTCA 2R9ZA 1OJ9A 3CNSA 4U2TA 3V3OA 5C3JA 1NDAA 4G6HA 2HQMA 1K0LA 3CN8A 2WDQA 4B69A 5BVAA 3H4KA 4H2PA 3UKHA 4NZHA 1ZK7A 3VQRA 3VR8A 1RP0A 1BWCA 1CJCA 1H6VA 1X31B 2WP5A 3ICTA 4FK1C 3FG2P 4H7UA 3UOYA 4B63A 3CGDA 1ZMDA 4OPLA 2RGOA 5KOXA 3UP5A 2AAQA 1E7PA 2YLWA 4Z2TA 1S3BA 3AEBA 4WCTA 1L9DA 4CRTA 5KMPA 3GSIA 2YM1A 1ZY8A 4X4JA 1Q9IA 2GAHB 1SEZA 2XYOA 5FS7A 3R9UA 2WEUA 4G6GA 1AOGA 2WBAA 2GV8A 2YWLA 3ICSA 1LJ1A 3CPIG 5KVHA 1E1LA 1CJ3A 1JRZA 1PXCA 4EM3A 4YWOA 3LZXA 2BABA 2GMHA 4XWRA 1JNZA 4LU6A 3BNMA 2EQ8A 3QSSA 3JSKA 4JN9A 1TYPA 3D1CA 4Z25A 4H4UA 4JY2A 3AE3A 2H89A 3AE4A 1BZLA 1KNRA 3NHOX 3AEEA 4H4XA 3F8PA 3T31A 1B37A 1H7WA 4FDCB 3F8DA 1JNRA 2GRTA 4OPTA 1YQZA 3VRBA 5KMRA 3NK2X 3AEGA 3KU9A 5EB4A 1IUXA 1QJDA 3GRSA 3AXBA 3C4NA 3ADAB 4DSHA 2WU5A 1JEHA 3F8RA 3HYXA 2OLOA 3NNEA 4NWZA 4ADWA 3GWDA 1IUUA 1FL2A 1JU2A 3G5RA 4H4PA 4USRA 3AE1A 1IUSA 3AYLA 1D4DA 2BK4A 3UKPA 1F8RA 2YVFA 3SX6A 2WPEA 3NYCA 4YTMA 1FEBA 2EQ6A 2R4EA 4II3A 4K8DA 4GAVA 2XLRA 1N4WA 4H2RA 1GRTA 1GSNA 4U8PA 2H88A 1DOCA 3Q6JA 2NVKX 2GB0A 3RP6A 5JCLA 3NIXA 1PJ7A 1S2QA 3K30A 5BRTA 3AYIA 4GUVA 4AT0A 1GTEA 1PS9A 2XVFA 4NNJA 1BF3A 3M0OA 1VRQB 3DK9A 3O0HA 3ZDNA 2APGA 2E1MA 4OPGA 1L9EA 4Z24A 1MXTA 1ZDLA 2ZZBA 3C96A 1MOKA 4IA6A 4TLXA 2E4GA 2YLRA 3ATRA 3C4AA 3DK4A 3Q9TA 3GD4A 3QFAA 1TDFA 1Y56A 2A89A 4GRTA 4BK1A 1IUWA 2XLSA 2YR6A 2B9XA 3FIMB 4EQXA 3FBSA 3II4A 4TLZA 3UKFA 1FEAA 2CVJA 5U63A 3QSEA 4OPUA 1DXLA 2A87A 2EQ9A 4OPDA 4XXGA 3UP4A 1YY5A 2OAMA 1NHQA 2PYXA 2QA1A 3B3RA 2IVDA 1CC4A 2YAUA 3P1WA 4GAPA 1RSGA 2YR5A 3BNUA 3SXIA 4B66A 4UDRA 4C3XA 2C67A 4KPRA 2JBVA 2PHHA 4YTPA 4OPIA 2YG3A 2X50A 1P2HA 2WOVA 1GERA 2VVMA 1JRYA 4WX1A 2BK3A 3ITJA 3M13A 5FS6A 5KMQA 1GALA 1PBBA 3LB8A 4LIIA 3KLJA 4U8IA 1XHCA 2FJDA 5KXJA 3ISHA 3NYFA 4IVOB 4GCMA 4X9NA 3KVEA 3REDA 1B5QA 3GD3A 4GDPA 2Q0KA 2BC0A 3SZWA 1CC2A 2RGJA 1DOEA 2Q6UA 1GXFA 3GYIA 4Z44A 4H2NA 1K0JA 1NHSA 2GQWA 2YLTA 5L46A 3RHAA 1FCDA 4I58A 2ZZCA 2O9ZA 3UTGA 4EIQA 1K4QA 4YKFA 1GESA 4APNA 2RABA 3GYXA 3CPJG 2X8CA 4E0VA 1KF6A 3ALMA 4REKA 1E1KA 4C74A 2J3NA 3RP8A 4U8NA 1EL8A 4PABA 3AYJA 3T14A 1F3PA 2WU2A 4YT0A 4EM4A 2R0GA 5GRTA 1GT8A 2ZZ0A 5FS8A 3T0KA 3DJEA 3PS9A 2VQ7A 1D7LA 1LPFA 1GETA 2BRAA 2CULA 2YG7A 3EAOA 4DGKA 2XVJA 2C73A 3KKJA 2YQUA 1ZMCA 5EBKA 4OPCA 1E1NA 3NT6A 2I0ZA 3M12A 1GRAA 1KNPA 2V60A 4O5UA 1PJ6A 4M52A 3AD8B 2WDRA 2BK5A 2F5ZA 3ALLA 1VDCA 1F8SA 2R0CA 3QJ4A 5TR3A 5IPYA 5JCKA 1JOAA 1V59A 1H83A 2CFYA 4BJYA 5JCNA 2BA9A 2NPXA 2OLNA 4G73A 1VG9A 4YKGA 2C3DA 4H4QA 4ICYA 1GRGA 1Y56B 2GR3A 2IVEA 4ZCCA 3V3NA 1H86A 3GMBA 1E6EA 1Y0PA 2BRYA 3DA1A 3IHGA 4K5SA 2YG5A 3WE0A 1CC6A 2JB3A 1GREA 3CMMA 1KSSA 1TRBA 2WETA 1TDKA 4JQ9A 4GDEA 4JY3A 4RG4A 5U25A 3DH9A 3G5SA 4O5QA 3SFDA 3OC4A 4G74A 1L0VA 2BXRA 1O95A 1B8SA 1KFYA 2AQJA 3UOXA 2EQ7A 2JB2A 2Z5XA 2JKCA 3QVPA 3NLCA 2GQFA 4U8OA 3H8LA 4ZCDA 1IUTA 4NTDA 1GRBA 1NHPA 3NRNA 4CY8A 1O94A 4U8MA 4BK3A 4AP3A 1YQ3A 3SZFA 4YSZA 3VRAA 3AE8A 3AEFA 1EL5A 1TYTA 2Y6RA 1RYIA 4J36A 3B6DA 1ONFA 2C64A 2X8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ER0 A;  3NGC X;  3K7T A;  5EB5 A;  4A9W A;  2C72 A;  2B7S A;  3OZ2 A;  4TM4 A;  3EPT A;  4CBQ A;  3NTD A;  1QO8 A;  1S2Y A;  1ZOY A;  3EF6 A;  2DKH A;  2Q7V A;  4GF7 A;  5C2T A;  2WOI A;  1F8W A;  4USQ A;  4TM0 A;  4J57 A;  3S5W A;  1D5T A;  2C7G A;  4EQW A;  3S61 A;  2C66 A;  5EOW A;  4U8K A;  5J60 A;  4B1B A;  3UKQ A;  1GND A;  1ZKQ A;  1MO9 A;  3NG7 X;  1N1P A;  2C65 A;  3UTF A;  2YM2 A;  4A7A A;  2XLP A;  4EMW A;  4ECH A;  1H82 A;  3NH3 X;  1PXA A;  1LQT A;  2WPC A;  1N4V A;  1L9C A;  2XVI A;  3AD7 B;  2X8G A;  4H4S A;  2XFU A;  3AD9 B;  4IV9 A;  3ATQ A;  5LV9 A;  1Q1W A;  4K5R A;  5FS9 A;  3RNM A;  2R0P A;  3UCL A;  1PBD A;  1D7Y A;  5HY5 A;  2A8X A;  2V5Z A;  2WS3 A;  3I6D A;  1YKJ A;  4MJW A;  3CGC A;  3CIR A;  4AOX A;  2BXS A;  3BI2 A;  2QA2 A;  1K0I A;  5BUL A;  3P4Q A;  1S3E A;  3AE6 A;  4B68 A;  4YXD A;  3RP7 A;  2YVJ A;  1FEC A;  3URH A;  3CND A;  4NEW A;  1PBC A;  4YSH A;  2WOW A;  4J33 A;  4D03 A;  5M0Z A;  3DJG X;  1LQU A;  2YG4 A;  1DOB A;  5IQ4 A;  5U1O A;  2B9Y A;  3AWI A;  3DJJ A;  1FOH A;  1ZX9 A;  1XDI A;  2YVG A;  1E39 A;  4UDP A;  3NKS A;  4H4Y A;  4DNA A;  3ALJ A;  3DK8 A;  3GDN A;  4EQS A;  1PBF A;  4TM3 A;  4Z2R A;  2XLU A;  2Z5Y A;  4J2W A;  4OCG A;  2OA1 A;  1VG0 A;  3ABV A;  1PDH A;  4ZN0 A;  3H8I A;  1EL9 A;  4EMI A;  3UKK A;  4JNA A;  2GR2 A;  4U8L A;  3UTE A;  4A6N A;  1CF3 A;  2W0H A;  4IA5 A;  2YLS A;  2GR1 A;  4B64 A;  4B67 A;  4TM1 A;  3K7Q X;  4CY6 A;  4K22 A;  5JCM A;  1TDO A;  2XLT A;  4CNJ A;  1ELI A;  3GYJ A;  2Q0L A;  1HYU A;  4H4Z A;  2XVE A;  2WDV A;  4J56 A;  1OJA A;  2UZZ A;  4H4T A;  4PAA A;  2XFN A;  1DNC A;  3E1T A;  2QCU A;  3NYE A;  2GR0 A;  4H4V A;  4J34 A;  1N4U A;  3SM8 A;  2WQY A;  1REO A;  1CBO A;  3P9U A;  3UKL A;  1GPE A;  3QVR A;  3CTY A;  4YSX A;  3AE5 A;  1COY A;  2BS2 A;  1IJH A;  3IF9 A;  3SQP A;  3DJD A;  2XFP A;  1CJ2 A;  2WP9 A;  4CCQ A;  3V76 A;  2GAG B;  1PBE A;  1ZP0 A;  4J31 A;  2VZ2 A;  2YG6 A;  1NHR A;  1B4V A;  1DJQ A;  3GWF A;  2WPF A;  2RGH A;  2C70 A;  5HXI A;  1Q1R A;  2GEW A;  3AEC A;  1UKV G;  3L8K A;  5GSN A;  4XWZ A;  1CJ4 A;  2XDO A;  1EBD A;  3NN6 X;  1NEN A;  2X3N A;  3AE9 A;  2OAL A;  1CL0 A;  4AT2 A;  3G5Q A;  3UKA A;  5BUK A;  2X99 A;  3P4R A;  1LTX R;  1D4C A;  1KDG A;  1Z6L A;  2ZBW A;  4EMJ A;  4GR1 A;  3T37 A;  4AP1 A;  3BI5 A;  4Y4M A;  2BC1 A;  2V6O A;  5KWF A;  2WHD A;  4K7Z A;  1LV0 A;  2AR8 A;  1GRH A;  1M64 A;  1PN0 A;  2XVH A;  1PJ5 A;  4LA1 A;  4UDQ A;  3FMW A;  1F6M A;  3QSM A;  1LVL A;  1IUV A;  3P4S A;  1GEU A;  1NG4 A;  4NTE A;  4CNK A;  3AE7 A;  4U8J A;  4EIP A;  2XFQ A;  1DJN A;  3UOZ A;  4AOS A;  2BS3 A;  3QFB A;  4JNQ A;  3DGH A;  4BK2 A;  4HB9 A;  5HYM A;  1OJD A;  1W4X A;  5KVI A;  3CGE A;  4RG3 A;  3UOV A;  2VRM A;  4FK1 A;  4OVI A;  3VR9 A;  4C3Y A;  2B7R A;  2V3A A;  1D4E A;  1NEK A;  1KSU A;  4I59 A;  4D04 A;  2FJB A;  2VQB A;  2B76 A;  3I3L A;  2C3C A;  3HZL A;  4YSY A;  3CGB A;  5FMH A;  3SFE A;  3KPF A;  3LJP A;  3PVC A;  4A6N B;  4NEV A;  5DBJ A;  1VQW A;  1XAN A;  2C75 A;  2BYB A;  5CQF A;  1NG3 A;  4B65 A;  2C76 A;  3IHM A;  1GRF A;  4N9X A;  3CPH G;  2R46 A;  2TPR A;  3BI4 A;  4IVM B;  3EAN A;  2CDU A;  1GOS A;  3BHK A;  3NTA A;  4Z2U A;  2BS4 A;  2TMD A;  3KD9 A;  4FX9 A;  2V61 A;  5HHF A;  4HA6 A;  4P9S A;  3ZYX A;  4A65 A;  1OJT A;  2JB1 A;  3PO7 A;  1BGN A;  3NK1 X;  2BAC A;  4Y4L A;  1JRX A;  3FPZ A;  1E1M A;  3AE2 A;  3IWA A;  2DKI A;  3AEA A;  2GMJ A;  2FJE A;  1DOD A;  2Y6Q A;  3KA7 A;  4H50 A;  4U2S A;  4A79 A;  1GV4 A;  4RSL A;  4DSG A;  2BCG G;  2BCP A;  4Z43 A;  3BHF A;  2ACZ A;  2YLX A;  3LXD A;  2R4J A;  3AED A;  2VVL G;  1QLB A;  2YR4 A;  1H7X A;  3CNJ A;  2E5V A;  3P4P A;  4U2L A;  1PHH A;  4Y4N A;  4C77 A;  1NAA A;  2GVC A;  2WP6 A;  1YQ4 A;  5IQ1 A;  1BGJ A;  3LOV A;  1H84 A;  3K7M X;  4CCR A;  3NN0 X;  1BKW A;  1O5W A;  3DGZ A;  3GRT A;  4H4W A;  3UTH A;  2IID A;  4K2X A;  3IC9 A;  1TDE A;  3CNP A;  4H2Q A;  5JCI A;  2FJA A;  4A5L A;  3D8X A;  2R45 A;  3ICR A;  5KOW A;  4BV6 A;  1M6I A;  3LZW A;  5CKU A;  2B9W A;  2GH5 A;  3LAD A;  2WES A;  2V3B A;  2ARD A;  3COX A;  4JDR A;  5J7X A;  4A99 A;  4C5O A;  3L1R A;  2VOU A;  2XFO A;  3AB1 A;  1P2E A;  4KX6 A;  1PXB A;  4UP3 A;  1OJC A;  4BJZ A;  2XCG A;  3NK0 X;  4EQR A;  1ZOV A;  3GDP A;  2VVL A;  3DME A;  1CHU A;  2QAE A;  4Z26 A;  1NPX A;  2JAE A;  5KRQ A;  1TDN A;  1XPQ A;  2YLZ A;  3SGL A;  3VRD B;  2FBW A;  4YTN A;  1H81 A;  4BUR A;  2VRL A;  4X9M A;  2GF3 A;  3GMC A;  3CNT A;  4H4R A;  1GTH A;  1EL7 A;  2JK6 A;  5M10 A;  4NTC A;  2R9Z A;  1OJ9 A;  3CNS A;  4U2T A;  3V3O A;  5C3J A;  1NDA A;  2HQM A;  1K0L A;  3CN8 A;  2WDQ A;  4B69 A;  5BVA A;  3H4K A;  4H2P A;  3UKH A;  4NZH A;  1ZK7 A;  3VQR A;  3VR8 A;  1RP0 A;  1BWC A;  1CJC A;  1H6V A;  1X31 B;  2WP5 A;  3ICT A;  4FK1 C;  3FG2 P;  4H7U A;  3UOY A;  4B63 A;  3CGD A;  1ZMD A;  4OPL A;  2RGO A;  5KOX A;  3UP5 A;  2AAQ A;  1E7P A;  2YLW A;  4Z2T A;  1S3B A;  3AEB A;  4WCT A;  1L9D A;  4CRT A;  3GSI A;  2YM1 A;  1ZY8 A;  4X4J A;  1Q9I A;  2GAH B;  1SEZ A;  2XYO A;  5FS7 A;  3R9U A;  2WEU A;  1AOG A;  2WBA A;  2GV8 A;  2YWL A;  3ICS A;  1LJ1 A;  3CPI G;  5KVH A;  1E1L A;  1CJ3 A;  1JRZ A;  1PXC A;  4EM3 A;  4YWO A;  3LZX A;  2BAB A;  2GMH A;  4XWR A;  1JNZ A;  4LU6 A;  3BNM A;  2EQ8 A;  3QSS A;  3JSK A;  4JN9 A;  1TYP A;  3D1C A;  4Z25 A;  4H4U A;  4JY2 A;  3AE3 A;  2H89 A;  3AE4 A;  1BZL A;  1KNR A;  3NHO X;  3AEE A;  4H4X A;  3F8P A;  1B37 A;  1H7W A;  4FDC B;  3F8D A;  1JNR A;  2GRT A;  4OPT A;  1YQZ A;  3VRB A;  3NK2 X;  3AEG A;  3KU9 A;  5EB4 A;  1IUX A;  1QJD A;  3GRS A;  3AXB A;  3C4N A;  3ADA B;  4DSH A;  2WU5 A;  1JEH A;  3F8R A;  3NNE A;  2OLO A;  4ADW A;  3GWD A;  1IUU A;  1FL2 A;  1JU2 A;  3G5R A;  4H4P A;  4USR A;  3AE1 A;  1IUS A;  3AYL A;  1D4D A;  2BK4 A;  3UKP A;  1F8R A;  2YVF A;  2WPE A;  3NYC A;  4YTM A;  1FEB A;  2EQ6 A;  2R4E A;  4K8D A;  2XLR A;  1N4W A;  4H2R A;  1GRT A;  1GSN A;  4U8P A;  2H88 A;  1DOC A;  3Q6J A;  2NVK X;  2GB0 A;  3RP6 A;  5JCL A;  3NIX A;  1PJ7 A;  1S2Q A;  3K30 A;  5BRT A;  3AYI A;  4GUV A;  4AT0 A;  1GTE A;  1PS9 A;  2XVF A;  1BF3 A;  3M0O A;  1VRQ B;  3DK9 A;  3O0H A;  3ZDN A;  2APG A;  2E1M A;  4OPG A;  1L9E A;  4Z24 A;  1MXT A;  1ZDL A;  2ZZB A;  3C96 A;  1MOK A;  4IA6 A;  4TLX A;  2E4G A;  2YLR A;  3ATR A;  3C4A A;  3DK4 A;  3Q9T A;  3GD4 A;  3QFA A;  1TDF A;  1Y56 A;  2A89 A;  4GRT A;  4BK1 A;  1IUW A;  2XLS A;  2YR6 A;  2B9X A;  3FIM B;  4EQX A;  3FBS A;  3II4 A;  4TLZ A;  3UKF A;  1FEA A;  2CVJ A;  5U63 A;  3QSE A;  4OPU A;  1DXL A;  2A87 A;  2EQ9 A;  4OPD A;  4XXG A;  3UP4 A;  1YY5 A;  2OAM A;  1NHQ A;  2PYX A;  2QA1 A;  3B3R A;  2IVD A;  1CC4 A;  2YAU A;  3P1W A;  1RSG A;  2YR5 A;  3BNU A;  4C3X A;  4B66 A;  4UDR A;  2C67 A;  4KPR A;  2JBV A;  2PHH A;  4YTP A;  4OPI A;  2YG3 A;  2X50 A;  1P2H A;  2WOV A;  1GER A;  2VVM A;  1JRY A;  4WX1 A;  2BK3 A;  3ITJ A;  3M13 A;  5FS6 A;  1GAL A;  1PBB A;  3LB8 A;  4LII A;  3KLJ A;  4U8I A;  1XHC A;  2FJD A;  5KXJ A;  3ISH A;  3NYF A;  4IVO B;  4GCM A;  4X9N A;  3KVE A;  3RED A;  1B5Q A;  3GD3 A;  4GDP A;  2Q0K A;  2BC0 A;  1CC2 A;  2RGJ A;  1DOE A;  2Q6U A;  1GXF A;  3GYI A;  4Z44 A;  4H2N A;  1K0J A;  1NHS A;  2GQW A;  2YLT A;  5L46 A;  3RHA A;  1FCD A;  4I58 A;  2ZZC A;  2O9Z A;  3UTG A;  4EIQ A;  1K4Q A;  4YKF A;  1GES A;  4APN A;  2RAB A;  3CPJ G;  2X8C A;  4E0V A;  1KF6 A;  3ALM A;  4REK A;  1E1K A;  4C74 A;  2J3N A;  3RP8 A;  4U8N A;  1EL8 A;  4PAB A;  3AYJ A;  1F3P A;  2WU2 A;  4YT0 A;  4EM4 A;  2R0G A;  5GRT A;  1GT8 A;  2ZZ0 A;  5FS8 A;  3DJE A;  3PS9 A;  2VQ7 A;  1D7L A;  1LPF A;  1GET A;  2CUL A;  2YG7 A;  3EAO A;  4DGK A;  2XVJ A;  2C73 A;  3KKJ A;  2YQU A;  1ZMC A;  5EBK A;  4OPC A;  1E1N A;  3NT6 A;  2I0Z A;  3M12 A;  1GRA A;  1KNP A;  2V60 A;  4O5U A;  1PJ6 A;  4M52 A;  3AD8 B;  2WDR A;  2BK5 A;  2F5Z A;  3ALL A;  1VDC A;  1F8S A;  2R0C A;  3QJ4 A;  5TR3 A;  5IPY A;  5JCK A;  1JOA A;  1V59 A;  1H83 A;  2CFY A;  4BJY A;  5JCN A;  2BA9 A;  2NPX A;  2OLN A;  1VG9 A;  4YKG A;  2C3D A;  4H4Q A;  4ICY A;  1GRG A;  1Y56 B;  2GR3 A;  2IVE A;  4ZCC A;  3V3N A;  1H86 A;  3GMB A;  1E6E A;  1Y0P A;  3IHG A;  3DA1 A;  4K5S A;  3WE0 A;  2YG5 A;  1CC6 A;  2JB3 A;  1GRE A;  1KSS A;  1TRB A;  2WET A;  1TDK A;  4JQ9 A;  4GDE A;  4JY3 A;  4RG4 A;  5U25 A;  3DH9 A;  3G5S A;  4O5Q A;  3SFD A;  3OC4 A;  1L0V A;  2BXR A;  1O95 A;  1B8S A;  1KFY A;  2AQJ A;  3UOX A;  2EQ7 A;  2JB2 A;  2Z5X A;  2JKC A;  3QVP A;  3NLC A;  2GQF A;  4U8O A;  3H8L A;  4ZCD A;  1IUT A;  4NTD A;  1GRB A;  1NHP A;  3NRN A;  4CY8 A;  1O94 A;  4U8M A;  4BK3 A;  4AP3 A;  1YQ3 A;  4YSZ A;  3VRA A;  3AE8 A;  3AEF A;  1EL5 A;  1TYT A;  2Y6R A;  1RYI A;  4J36 A;  3B6D A;  1ONF A;  2C64 A;  2X8H A; 
#chains in the Genus database with same CATH topology
 5ER0 A;  3NGC X;  3K7T A;  5EB5 A;  4A9W A;  2C72 A;  2B7S A;  3OZ2 A;  4TM4 A;  3EPT A;  4CBQ A;  3NTD A;  1QO8 A;  1S2Y A;  1ZOY A;  3EF6 A;  2DKH A;  2Q7V A;  4GF7 A;  5C2T A;  2WOI A;  1F8W A;  4USQ A;  4TM0 A;  4J57 A;  3S5W A;  1D5T A;  2C7G A;  4II2 A;  3S61 A;  2C66 A;  5EOW A;  4U8K A;  4EQW A;  5J60 A;  4B1B A;  3UKQ A;  1GND A;  1ZKQ A;  1MO9 A;  3NG7 X;  1N1P A;  2C65 A;  4G9K A;  3UTF A;  2YM2 A;  4A7A A;  2XLP A;  4EMW A;  4ECH A;  1H82 A;  3NH3 X;  1PXA A;  1LQT A;  2WPC A;  1N4V A;  1L9C A;  2XVI A;  3AD7 B;  2X8G A;  4H4S A;  2XFU A;  3AD9 B;  4IV9 A;  3ATQ A;  5LV9 A;  1Q1W A;  4K5R A;  5FS9 A;  3RNM A;  2R0P A;  3UCL A;  1PBD A;  1D7Y A;  5HY5 A;  2A8X A;  2V5Z A;  2WS3 A;  3I6D A;  1YKJ A;  4MJW A;  3CGC A;  5KMS A;  3CIR A;  4AOX A;  2BXS A;  3BI2 A;  2QA2 A;  1K0I A;  5BUL A;  3P4Q A;  1S3E A;  3AE6 A;  4B68 A;  4YXD A;  3RP7 A;  2YVJ A;  1FEC A;  3URH A;  3CND A;  4NEW A;  1PBC A;  4YSH A;  2WOW A;  4J33 A;  4D03 A;  5M0Z A;  3DJG X;  1LQU A;  2YG4 A;  1DOB A;  5IQ4 A;  5U1O A;  2B9Y A;  3AWI A;  3DJJ A;  1FOH A;  1ZX9 A;  1XDI A;  2YVG A;  1E39 A;  4UDP A;  3NKS A;  4H4Y A;  4DNA A;  3ALJ A;  3DK8 A;  3GDN A;  4EQS A;  1PBF A;  4TM3 A;  4Z2R A;  2XLU A;  2Z5Y A;  4J2W A;  4OCG A;  2OA1 A;  1VG0 A;  2C4C A;  1PDH A;  3ABV A;  4ZN0 A;  3H8I A;  1EL9 A;  4EMI A;  3UKK A;  4JNA A;  2GR2 A;  4U8L A;  3UTE A;  4A6N A;  1CF3 A;  2W0H A;  4IA5 A;  2YLS A;  2GR1 A;  4B64 A;  4B67 A;  4TM1 A;  3K7Q X;  4CY6 A;  4K22 A;  5JCM A;  1TDO A;  2XLT A;  4CNJ A;  1ELI A;  3GYJ A;  2Q0L A;  1HYU A;  4H4Z A;  2XVE A;  2WDV A;  4J56 A;  1OJA A;  2UZZ A;  4H4T A;  4PAA A;  2XFN A;  1DNC A;  3E1T A;  2QCU A;  3NYE A;  2GR0 A;  4H4V A;  4J34 A;  1N4U A;  3SM8 A;  2WQY A;  1REO A;  1CBO A;  3P9U A;  3UKL A;  1GPE A;  3QVR A;  3CTY A;  4YSX A;  3AE5 A;  1COY A;  2BS2 A;  1IJH A;  3IF9 A;  3SQP A;  3DJD A;  2XFP A;  1CJ2 A;  2WP9 A;  4CCQ A;  3V76 A;  2GAG B;  1PBE A;  1ZP0 A;  4J31 A;  2VZ2 A;  2YG6 A;  1NHR A;  1B4V A;  1DJQ A;  3GWF A;  5KNL A;  2WPF A;  2RGH A;  3SYI A;  2C70 A;  5HXI A;  1Q1R A;  2GEW A;  3AEC A;  3SZC A;  1UKV G;  3L8K A;  5GSN A;  3HYV A;  4XWZ A;  1CJ4 A;  2XDO A;  1EBD A;  3NN6 X;  1NEN A;  2X3N A;  3AE9 A;  2OAL A;  1CL0 A;  4AT2 A;  3G5Q A;  3UKA A;  5BUK A;  2X99 A;  3P4R A;  1LTX R;  1D4C A;  1KDG A;  1Z6L A;  2ZBW A;  4EMJ A;  4GR1 A;  3T37 A;  4AP1 A;  3BI5 A;  4Y4M A;  2BC1 A;  2V6O A;  5KWF A;  2WHD A;  4K7Z A;  1LV0 A;  2AR8 A;  1GRH A;  1M64 A;  1PN0 A;  2XVH A;  3SY4 A;  1PJ5 A;  4LA1 A;  4UDQ A;  3FMW A;  1F6M A;  3QSM A;  1LVL A;  1IUV A;  3P4S A;  1GEU A;  1NG4 A;  4NTE A;  4CNK A;  3AE7 A;  4U8J A;  4EIP A;  2XFQ A;  1DJN A;  3KPK A;  3UOZ A;  4AOS A;  2BS3 A;  3QFB A;  4JNQ A;  3DGH A;  4BK2 A;  3T2K A;  4HB9 A;  5HYM A;  1OJD A;  1W4X A;  5KVI A;  3CGE A;  4RG3 A;  3UOV A;  2VRM A;  4FK1 A;  4OVI A;  3SZ0 A;  3VR9 A;  2B7R A;  4C3Y A;  2V3A A;  1D4E A;  1NEK A;  1KSU A;  4I59 A;  4D04 A;  2FJB A;  2VQB A;  2B76 A;  3I3L A;  2C3C A;  3HZL A;  4YSY A;  3CGB A;  5FMH A;  3SFE A;  3KPF A;  3LJP A;  3PVC A;  4A6N B;  4NEV A;  5DBJ A;  1VQW A;  1XAN A;  2C75 A;  2BYB A;  5CQF A;  1NG3 A;  4B65 A;  2C76 A;  3IHM A;  1GRF A;  4N9X A;  3CPH G;  2R46 A;  2TPR A;  3BI4 A;  4IVM B;  3EAN A;  2CDU A;  1GOS A;  3BHK A;  3NTA A;  4Z2U A;  2BS4 A;  2TMD A;  3KD9 A;  4FX9 A;  2V61 A;  5HHF A;  4HA6 A;  4P9S A;  3ZYX A;  4A65 A;  1OJT A;  2JB1 A;  3PO7 A;  1BGN A;  3NK1 X;  2BAC A;  4Y4L A;  1JRX A;  3FPZ A;  1E1M A;  3AE2 A;  3IWA A;  2DKI A;  3AEA A;  2GMJ A;  2FJE A;  1DOD A;  2Y6Q A;  3KA7 A;  4H50 A;  4U2S A;  4A79 A;  1GV4 A;  4RSL A;  4DSG A;  2BCG G;  2BCP A;  4Z43 A;  3BHF A;  2ACZ A;  2YLX A;  3LXD A;  2R4J A;  3AED A;  2VVL G;  1QLB A;  2YR4 A;  1H7X A;  3T2Y A;  3CNJ A;  2E5V A;  3P4P A;  4U2L A;  1PHH A;  4Y4N A;  4C77 A;  1NAA A;  2GVC A;  2WP6 A;  1YQ4 A;  5IQ1 A;  1BGJ A;  3LOV A;  1H84 A;  3K7M X;  4CCR A;  3NN0 X;  1BKW A;  1O5W A;  3DGZ A;  3GRT A;  4H4W A;  3UTH A;  2IID A;  4K2X A;  3IC9 A;  1TDE A;  3CNP A;  4H2Q A;  5JCI A;  2FJA A;  4A5L A;  3D8X A;  2R45 A;  3ICR A;  5KOW A;  4BV6 A;  1M6I A;  3LZW A;  5CKU A;  2B9W A;  2GH5 A;  3LAD A;  2WES A;  2V3B A;  2ARD A;  3COX A;  3HYW A;  4JDR A;  5J7X A;  4A99 A;  4C5O A;  3L1R A;  2VOU A;  2XFO A;  3AB1 A;  1P2E A;  4KX6 A;  1PXB A;  4UP3 A;  1OJC A;  4BJZ A;  2XCG A;  3NK0 X;  4EQR A;  1ZOV A;  3GDP A;  2VVL A;  3DME A;  1CHU A;  2QAE A;  4Z26 A;  1NPX A;  2JAE A;  5KRQ A;  1TDN A;  1XPQ A;  2YLZ A;  3SGL A;  3T2Z A;  2FBW A;  3VRD B;  4YTN A;  1H81 A;  4BUR A;  2VRL A;  4X9M A;  2GF3 A;  3GMC A;  3CNT A;  4H4R A;  1GTH A;  1EL7 A;  2JK6 A;  5M10 A;  4NTC A;  2R9Z A;  1OJ9 A;  3CNS A;  4U2T A;  3V3O A;  5C3J A;  1NDA A;  4G6H A;  2HQM A;  1K0L A;  3CN8 A;  2WDQ A;  4B69 A;  5BVA A;  3H4K A;  4H2P A;  3UKH A;  4NZH A;  1ZK7 A;  3VQR A;  3VR8 A;  1RP0 A;  1BWC A;  1CJC A;  1H6V A;  1X31 B;  2WP5 A;  3ICT A;  4FK1 C;  3FG2 P;  4H7U A;  3UOY A;  4B63 A;  3CGD A;  1ZMD A;  4OPL A;  2RGO A;  5KOX A;  3UP5 A;  2AAQ A;  1E7P A;  2YLW A;  4Z2T A;  1S3B A;  3AEB A;  4WCT A;  1L9D A;  4CRT A;  5KMP A;  3GSI A;  2YM1 A;  1ZY8 A;  4X4J A;  1Q9I A;  2GAH B;  1SEZ A;  2XYO A;  5FS7 A;  3R9U A;  2WEU A;  4G6G A;  1AOG A;  2WBA A;  2GV8 A;  2YWL A;  3ICS A;  1LJ1 A;  3CPI G;  5KVH A;  1E1L A;  1CJ3 A;  1JRZ A;  1PXC A;  4EM3 A;  4YWO A;  3LZX A;  2BAB A;  2GMH A;  4XWR A;  1JNZ A;  4LU6 A;  3BNM A;  2EQ8 A;  3QSS A;  3JSK A;  4JN9 A;  1TYP A;  3D1C A;  4Z25 A;  4H4U A;  4JY2 A;  3AE3 A;  2H89 A;  3AE4 A;  1BZL A;  1KNR A;  3NHO X;  3AEE A;  4H4X A;  3F8P A;  3T31 A;  1B37 A;  1H7W A;  4FDC B;  3F8D A;  1JNR A;  2GRT A;  4OPT A;  1YQZ A;  3VRB A;  5KMR A;  3NK2 X;  3AEG A;  3KU9 A;  5EB4 A;  1IUX A;  1QJD A;  3GRS A;  3AXB A;  3C4N A;  3ADA B;  4DSH A;  2WU5 A;  1JEH A;  3F8R A;  3HYX A;  2OLO A;  3NNE A;  4NWZ A;  4ADW A;  3GWD A;  1IUU A;  1FL2 A;  1JU2 A;  3G5R A;  4H4P A;  4USR A;  3AE1 A;  1IUS A;  3AYL A;  1D4D A;  2BK4 A;  3UKP A;  1F8R A;  2YVF A;  3SX6 A;  2WPE A;  3NYC A;  4YTM A;  1FEB A;  2EQ6 A;  2R4E A;  4II3 A;  4K8D A;  4GAV A;  2XLR A;  1N4W A;  4H2R A;  1GRT A;  1GSN A;  4U8P A;  2H88 A;  1DOC A;  3Q6J A;  2NVK X;  2GB0 A;  3RP6 A;  5JCL A;  3NIX A;  1PJ7 A;  1S2Q A;  3K30 A;  5BRT A;  3AYI A;  4GUV A;  4AT0 A;  1GTE A;  1PS9 A;  2XVF A;  4NNJ A;  1BF3 A;  3M0O A;  1VRQ B;  3DK9 A;  3O0H A;  3ZDN A;  2APG A;  2E1M A;  4OPG A;  1L9E A;  4Z24 A;  1MXT A;  1ZDL A;  2ZZB A;  3C96 A;  1MOK A;  4IA6 A;  4TLX A;  2E4G A;  2YLR A;  3ATR A;  3C4A A;  3DK4 A;  3Q9T A;  3GD4 A;  3QFA A;  1TDF A;  1Y56 A;  2A89 A;  4GRT A;  4BK1 A;  1IUW A;  2XLS A;  2YR6 A;  2B9X A;  3FIM B;  4EQX A;  3FBS A;  3II4 A;  4TLZ A;  3UKF A;  1FEA A;  2CVJ A;  5U63 A;  3QSE A;  4OPU A;  1DXL A;  2A87 A;  2EQ9 A;  4OPD A;  4XXG A;  3UP4 A;  1YY5 A;  2OAM A;  1NHQ A;  2PYX A;  2QA1 A;  3B3R A;  2IVD A;  1CC4 A;  2YAU A;  3P1W A;  4GAP A;  1RSG A;  2YR5 A;  3BNU A;  3SXI A;  4B66 A;  4UDR A;  4C3X A;  2C67 A;  4KPR A;  2JBV A;  2PHH A;  4YTP A;  4OPI A;  2YG3 A;  2X50 A;  1P2H A;  2WOV A;  1GER A;  2VVM A;  1JRY A;  4WX1 A;  2BK3 A;  3ITJ A;  3M13 A;  5FS6 A;  5KMQ A;  1GAL A;  1PBB A;  3LB8 A;  4LII A;  3KLJ A;  4U8I A;  1XHC A;  2FJD A;  5KXJ A;  3ISH A;  3NYF A;  4IVO B;  4GCM A;  4X9N A;  3KVE A;  3RED A;  1B5Q A;  3GD3 A;  4GDP A;  2Q0K A;  2BC0 A;  3SZW A;  1CC2 A;  2RGJ A;  1DOE A;  2Q6U A;  1GXF A;  3GYI A;  4Z44 A;  4H2N A;  1K0J A;  1NHS A;  2GQW A;  2YLT A;  5L46 A;  3RHA A;  1FCD A;  4I58 A;  2ZZC A;  2O9Z A;  3UTG A;  4EIQ A;  1K4Q A;  4YKF A;  1GES A;  4APN A;  2RAB A;  3GYX A;  3CPJ G;  2X8C A;  4E0V A;  1KF6 A;  3ALM A;  4REK A;  1E1K A;  4C74 A;  2J3N A;  3RP8 A;  4U8N A;  1EL8 A;  4PAB A;  3AYJ A;  3T14 A;  1F3P A;  2WU2 A;  4YT0 A;  4EM4 A;  2R0G A;  5GRT A;  1GT8 A;  2ZZ0 A;  5FS8 A;  3T0K A;  3DJE A;  3PS9 A;  2VQ7 A;  1D7L A;  1LPF A;  1GET A;  2BRA A;  2CUL A;  2YG7 A;  3EAO A;  4DGK A;  2XVJ A;  2C73 A;  3KKJ A;  2YQU A;  1ZMC A;  5EBK A;  4OPC A;  1E1N A;  3NT6 A;  2I0Z A;  3M12 A;  1GRA A;  1KNP A;  2V60 A;  4O5U A;  1PJ6 A;  4M52 A;  3AD8 B;  2WDR A;  2BK5 A;  2F5Z A;  3ALL A;  1VDC A;  1F8S A;  2R0C A;  3QJ4 A;  5TR3 A;  5IPY A;  5JCK A;  1JOA A;  1V59 A;  1H83 A;  2CFY A;  4BJY A;  5JCN A;  2BA9 A;  2NPX A;  2OLN A;  4G73 A;  1VG9 A;  4YKG A;  2C3D A;  4H4Q A;  4ICY A;  1GRG A;  1Y56 B;  2GR3 A;  2IVE A;  4ZCC A;  3V3N A;  1H86 A;  3GMB A;  1E6E A;  1Y0P A;  2BRY A;  3DA1 A;  3IHG A;  4K5S A;  2YG5 A;  3WE0 A;  1CC6 A;  2JB3 A;  1GRE A;  3CMM A;  1KSS A;  1TRB A;  2WET A;  1TDK A;  4JQ9 A;  4GDE A;  4JY3 A;  4RG4 A;  5U25 A;  3DH9 A;  3G5S A;  4O5Q A;  3SFD A;  3OC4 A;  4G74 A;  1L0V A;  2BXR A;  1O95 A;  1B8S A;  1KFY A;  2AQJ A;  3UOX A;  2EQ7 A;  2JB2 A;  2Z5X A;  2JKC A;  3QVP A;  3NLC A;  2GQF A;  4U8O A;  3H8L A;  4ZCD A;  1IUT A;  4NTD A;  1GRB A;  1NHP A;  3NRN A;  4CY8 A;  1O94 A;  4U8M A;  4BK3 A;  4AP3 A;  1YQ3 A;  3SZF A;  4YSZ A;  3VRA A;  3AE8 A;  3AEF A;  1EL5 A;  1TYT A;  2Y6R A;  1RYI A;  4J36 A;  3B6D A;  1ONF A;  2C64 A;  2X8H A; 
#chains in the Genus database with same CATH homology
 5ER0 A;  3NGC X;  3K7T A;  5EB5 A;  4A9W A;  2C72 A;  2B7S A;  3OZ2 A;  4TM4 A;  3EPT A;  4CBQ A;  3NTD A;  1QO8 A;  1S2Y A;  1ZOY A;  3EF6 A;  2DKH A;  2Q7V A;  4GF7 A;  5C2T A;  2WOI A;  1F8W A;  4USQ A;  4TM0 A;  4J57 A;  3S5W A;  1D5T A;  2C7G A;  4II2 A;  3S61 A;  2C66 A;  5EOW A;  4U8K A;  4EQW A;  5J60 A;  4B1B A;  3UKQ A;  1GND A;  1ZKQ A;  1MO9 A;  3NG7 X;  1N1P A;  2C65 A;  4G9K A;  3UTF A;  2YM2 A;  4A7A A;  2XLP A;  4EMW A;  4ECH A;  1H82 A;  3NH3 X;  1PXA A;  1LQT A;  2WPC A;  1N4V A;  1L9C A;  2XVI A;  3AD7 B;  2X8G A;  4H4S A;  2XFU A;  3AD9 B;  4IV9 A;  3ATQ A;  5LV9 A;  1Q1W A;  4K5R A;  5FS9 A;  3RNM A;  2R0P A;  3UCL A;  1PBD A;  1D7Y A;  5HY5 A;  2A8X A;  2V5Z A;  2WS3 A;  3I6D A;  1YKJ A;  4MJW A;  3CGC A;  5KMS A;  3CIR A;  4AOX A;  2BXS A;  3BI2 A;  2QA2 A;  1K0I A;  5BUL A;  3P4Q A;  1S3E A;  3AE6 A;  4B68 A;  4YXD A;  3RP7 A;  2YVJ A;  1FEC A;  3URH A;  3CND A;  4NEW A;  1PBC A;  4YSH A;  2WOW A;  4J33 A;  4D03 A;  5M0Z A;  3DJG X;  1LQU A;  2YG4 A;  1DOB A;  5IQ4 A;  5U1O A;  2B9Y A;  3AWI A;  3DJJ A;  1FOH A;  1ZX9 A;  1XDI A;  2YVG A;  1E39 A;  4UDP A;  3NKS A;  4H4Y A;  4DNA A;  3ALJ A;  3DK8 A;  3GDN A;  4EQS A;  1PBF A;  4TM3 A;  4Z2R A;  2XLU A;  2Z5Y A;  4J2W A;  4OCG A;  2OA1 A;  1VG0 A;  2C4C A;  1PDH A;  3ABV A;  4ZN0 A;  3H8I A;  1EL9 A;  4EMI A;  3UKK A;  4JNA A;  2GR2 A;  4U8L A;  3UTE A;  4A6N A;  1CF3 A;  2W0H A;  4IA5 A;  2YLS A;  2GR1 A;  4B64 A;  4B67 A;  4TM1 A;  3K7Q X;  4CY6 A;  4K22 A;  5JCM A;  1TDO A;  2XLT A;  4CNJ A;  1ELI A;  3GYJ A;  2Q0L A;  1HYU A;  4H4Z A;  2XVE A;  2WDV A;  4J56 A;  1OJA A;  2UZZ A;  4H4T A;  4PAA A;  2XFN A;  1DNC A;  3E1T A;  2QCU A;  3NYE A;  2GR0 A;  4H4V A;  4J34 A;  1N4U A;  3SM8 A;  2WQY A;  1REO A;  1CBO A;  3P9U A;  3UKL A;  1GPE A;  3QVR A;  3CTY A;  4YSX A;  3AE5 A;  1COY A;  2BS2 A;  1IJH A;  3IF9 A;  3SQP A;  3DJD A;  2XFP A;  1CJ2 A;  2WP9 A;  4CCQ A;  3V76 A;  2GAG B;  1PBE A;  1ZP0 A;  4J31 A;  2VZ2 A;  2YG6 A;  1NHR A;  1B4V A;  1DJQ A;  3GWF A;  5KNL A;  2WPF A;  2RGH A;  3SYI A;  2C70 A;  5HXI A;  1Q1R A;  2GEW A;  3AEC A;  3SZC A;  1UKV G;  3L8K A;  5GSN A;  3HYV A;  4XWZ A;  1CJ4 A;  2XDO A;  1EBD A;  3NN6 X;  1NEN A;  2X3N A;  3AE9 A;  2OAL A;  1CL0 A;  4AT2 A;  3G5Q A;  3UKA A;  5BUK A;  2X99 A;  3P4R A;  1LTX R;  1D4C A;  1KDG A;  1Z6L A;  2ZBW A;  4EMJ A;  4GR1 A;  3T37 A;  4AP1 A;  3BI5 A;  4Y4M A;  2BC1 A;  2V6O A;  5KWF A;  2WHD A;  4K7Z A;  1LV0 A;  2AR8 A;  1GRH A;  1M64 A;  1PN0 A;  2XVH A;  3SY4 A;  1PJ5 A;  4LA1 A;  4UDQ A;  3FMW A;  1F6M A;  3QSM A;  1LVL A;  1IUV A;  3P4S A;  1GEU A;  1NG4 A;  4NTE A;  4CNK A;  3AE7 A;  4U8J A;  4EIP A;  2XFQ A;  1DJN A;  3KPK A;  3UOZ A;  4AOS A;  2BS3 A;  3QFB A;  4JNQ A;  3DGH A;  4BK2 A;  3T2K A;  4HB9 A;  5HYM A;  1OJD A;  1W4X A;  5KVI A;  3CGE A;  4RG3 A;  3UOV A;  2VRM A;  4FK1 A;  4OVI A;  3SZ0 A;  3VR9 A;  2B7R A;  4C3Y A;  2V3A A;  1D4E A;  1NEK A;  1KSU A;  4I59 A;  4D04 A;  2FJB A;  2VQB A;  2B76 A;  3I3L A;  2C3C A;  3HZL A;  4YSY A;  3CGB A;  5FMH A;  3SFE A;  3KPF A;  3LJP A;  3PVC A;  4A6N B;  4NEV A;  5DBJ A;  1VQW A;  1XAN A;  2C75 A;  2BYB A;  5CQF A;  1NG3 A;  4B65 A;  2C76 A;  3IHM A;  1GRF A;  4N9X A;  3CPH G;  2R46 A;  2TPR A;  3BI4 A;  4IVM B;  3EAN A;  2CDU A;  1GOS A;  3BHK A;  3NTA A;  4Z2U A;  2BS4 A;  2TMD A;  3KD9 A;  4FX9 A;  2V61 A;  5HHF A;  4HA6 A;  4P9S A;  3ZYX A;  4A65 A;  1OJT A;  2JB1 A;  3PO7 A;  1BGN A;  3NK1 X;  2BAC A;  4Y4L A;  1JRX A;  3FPZ A;  1E1M A;  3AE2 A;  3IWA A;  2DKI A;  3AEA A;  2GMJ A;  2FJE A;  1DOD A;  2Y6Q A;  3KA7 A;  4H50 A;  4U2S A;  4A79 A;  1GV4 A;  4RSL A;  4DSG A;  2BCG G;  2BCP A;  4Z43 A;  3BHF A;  2ACZ A;  2YLX A;  3LXD A;  2R4J A;  3AED A;  2VVL G;  1QLB A;  2YR4 A;  1H7X A;  3T2Y A;  3CNJ A;  2E5V A;  3P4P A;  4U2L A;  1PHH A;  4Y4N A;  4C77 A;  1NAA A;  2GVC A;  2WP6 A;  1YQ4 A;  5IQ1 A;  1BGJ A;  3LOV A;  1H84 A;  3K7M X;  4CCR A;  3NN0 X;  1BKW A;  1O5W A;  3DGZ A;  3GRT A;  4H4W A;  3UTH A;  2IID A;  4K2X A;  3IC9 A;  1TDE A;  3CNP A;  4H2Q A;  5JCI A;  2FJA A;  4A5L A;  3D8X A;  2R45 A;  3ICR A;  5KOW A;  4BV6 A;  1M6I A;  3LZW A;  5CKU A;  2B9W A;  2GH5 A;  3LAD A;  2WES A;  2V3B A;  2ARD A;  3COX A;  3HYW A;  4JDR A;  5J7X A;  4A99 A;  4C5O A;  3L1R A;  2VOU A;  2XFO A;  3AB1 A;  1P2E A;  4KX6 A;  1PXB A;  4UP3 A;  1OJC A;  4BJZ A;  2XCG A;  3NK0 X;  4EQR A;  1ZOV A;  3GDP A;  2VVL A;  3DME A;  1CHU A;  2QAE A;  4Z26 A;  1NPX A;  2JAE A;  5KRQ A;  1TDN A;  1XPQ A;  2YLZ A;  3SGL A;  3T2Z A;  2FBW A;  3VRD B;  4YTN A;  1H81 A;  4BUR A;  2VRL A;  4X9M A;  2GF3 A;  3GMC A;  3CNT A;  4H4R A;  1GTH A;  1EL7 A;  2JK6 A;  5M10 A;  4NTC A;  2R9Z A;  1OJ9 A;  3CNS A;  4U2T A;  3V3O A;  5C3J A;  1NDA A;  4G6H A;  2HQM A;  1K0L A;  3CN8 A;  2WDQ A;  4B69 A;  5BVA A;  3H4K A;  4H2P A;  3UKH A;  4NZH A;  1ZK7 A;  3VQR A;  3VR8 A;  1RP0 A;  1BWC A;  1CJC A;  1H6V A;  1X31 B;  2WP5 A;  3ICT A;  4FK1 C;  3FG2 P;  4H7U A;  3UOY A;  4B63 A;  3CGD A;  1ZMD A;  4OPL A;  2RGO A;  5KOX A;  3UP5 A;  2AAQ A;  1E7P A;  2YLW A;  4Z2T A;  1S3B A;  3AEB A;  4WCT A;  1L9D A;  4CRT A;  5KMP A;  3GSI A;  2YM1 A;  1ZY8 A;  4X4J A;  1Q9I A;  2GAH B;  1SEZ A;  2XYO A;  5FS7 A;  3R9U A;  2WEU A;  4G6G A;  1AOG A;  2WBA A;  2GV8 A;  2YWL A;  3ICS A;  1LJ1 A;  3CPI G;  5KVH A;  1E1L A;  1CJ3 A;  1JRZ A;  1PXC A;  4EM3 A;  4YWO A;  3LZX A;  2BAB A;  2GMH A;  4XWR A;  1JNZ A;  4LU6 A;  3BNM A;  2EQ8 A;  3QSS A;  3JSK A;  4JN9 A;  1TYP A;  3D1C A;  4Z25 A;  4H4U A;  4JY2 A;  3AE3 A;  2H89 A;  3AE4 A;  1BZL A;  1KNR A;  3NHO X;  3AEE A;  4H4X A;  3F8P A;  3T31 A;  1B37 A;  1H7W A;  4FDC B;  3F8D A;  1JNR A;  2GRT A;  4OPT A;  1YQZ A;  3VRB A;  5KMR A;  3NK2 X;  3AEG A;  3KU9 A;  5EB4 A;  1IUX A;  1QJD A;  3GRS A;  3AXB A;  3C4N A;  3ADA B;  4DSH A;  2WU5 A;  1JEH A;  3F8R A;  3HYX A;  2OLO A;  3NNE A;  4NWZ A;  4ADW A;  3GWD A;  1IUU A;  1FL2 A;  1JU2 A;  3G5R A;  4H4P A;  4USR A;  3AE1 A;  1IUS A;  3AYL A;  1D4D A;  2BK4 A;  3UKP A;  1F8R A;  2YVF A;  3SX6 A;  2WPE A;  3NYC A;  4YTM A;  1FEB A;  2EQ6 A;  2R4E A;  4II3 A;  4K8D A;  4GAV A;  2XLR A;  1N4W A;  4H2R A;  1GRT A;  1GSN A;  4U8P A;  2H88 A;  1DOC A;  3Q6J A;  2NVK X;  2GB0 A;  3RP6 A;  5JCL A;  3NIX A;  1PJ7 A;  1S2Q A;  3K30 A;  5BRT A;  3AYI A;  4GUV A;  4AT0 A;  1GTE A;  1PS9 A;  2XVF A;  4NNJ A;  1BF3 A;  3M0O A;  1VRQ B;  3DK9 A;  3O0H A;  3ZDN A;  2APG A;  2E1M A;  4OPG A;  1L9E A;  4Z24 A;  1MXT A;  1ZDL A;  2ZZB A;  3C96 A;  1MOK A;  4IA6 A;  4TLX A;  2E4G A;  2YLR A;  3ATR A;  3C4A A;  3DK4 A;  3Q9T A;  3GD4 A;  3QFA A;  1TDF A;  1Y56 A;  2A89 A;  4GRT A;  4BK1 A;  1IUW A;  2XLS A;  2YR6 A;  2B9X A;  3FIM B;  4EQX A;  3FBS A;  3II4 A;  4TLZ A;  3UKF A;  1FEA A;  2CVJ A;  5U63 A;  3QSE A;  4OPU A;  1DXL A;  2A87 A;  2EQ9 A;  4OPD A;  4XXG A;  3UP4 A;  1YY5 A;  2OAM A;  1NHQ A;  2PYX A;  2QA1 A;  3B3R A;  2IVD A;  1CC4 A;  2YAU A;  3P1W A;  4GAP A;  1RSG A;  2YR5 A;  3BNU A;  3SXI A;  4B66 A;  4UDR A;  4C3X A;  2C67 A;  4KPR A;  2JBV A;  2PHH A;  4YTP A;  4OPI A;  2YG3 A;  2X50 A;  1P2H A;  2WOV A;  1GER A;  2VVM A;  1JRY A;  4WX1 A;  2BK3 A;  3ITJ A;  3M13 A;  5FS6 A;  5KMQ A;  1GAL A;  1PBB A;  3LB8 A;  4LII A;  3KLJ A;  4U8I A;  1XHC A;  2FJD A;  5KXJ A;  3ISH A;  3NYF A;  4IVO B;  4GCM A;  4X9N A;  3KVE A;  3RED A;  1B5Q A;  3GD3 A;  4GDP A;  2Q0K A;  2BC0 A;  3SZW A;  1CC2 A;  2RGJ A;  1DOE A;  2Q6U A;  1GXF A;  3GYI A;  4Z44 A;  4H2N A;  1K0J A;  1NHS A;  2GQW A;  2YLT A;  5L46 A;  3RHA A;  1FCD A;  4I58 A;  2ZZC A;  2O9Z A;  3UTG A;  4EIQ A;  1K4Q A;  4YKF A;  1GES A;  4APN A;  2RAB A;  3GYX A;  3CPJ G;  2X8C A;  4E0V A;  1KF6 A;  3ALM A;  4REK A;  1E1K A;  4C74 A;  2J3N A;  3RP8 A;  4U8N A;  1EL8 A;  4PAB A;  3AYJ A;  3T14 A;  1F3P A;  2WU2 A;  4YT0 A;  4EM4 A;  2R0G A;  5GRT A;  1GT8 A;  2ZZ0 A;  5FS8 A;  3T0K A;  3DJE A;  3PS9 A;  2VQ7 A;  1D7L A;  1LPF A;  1GET A;  2BRA A;  2CUL A;  2YG7 A;  3EAO A;  4DGK A;  2XVJ A;  2C73 A;  3KKJ A;  2YQU A;  1ZMC A;  5EBK A;  4OPC A;  1E1N A;  3NT6 A;  2I0Z A;  3M12 A;  1GRA A;  1KNP A;  2V60 A;  4O5U A;  1PJ6 A;  4M52 A;  3AD8 B;  2WDR A;  2BK5 A;  2F5Z A;  3ALL A;  1VDC A;  1F8S A;  2R0C A;  3QJ4 A;  5TR3 A;  5IPY A;  5JCK A;  1JOA A;  1V59 A;  1H83 A;  2CFY A;  4BJY A;  5JCN A;  2BA9 A;  2NPX A;  2OLN A;  4G73 A;  1VG9 A;  4YKG A;  2C3D A;  4H4Q A;  4ICY A;  1GRG A;  1Y56 B;  2GR3 A;  2IVE A;  4ZCC A;  3V3N A;  1H86 A;  3GMB A;  1E6E A;  1Y0P A;  2BRY A;  3DA1 A;  3IHG A;  4K5S A;  2YG5 A;  3WE0 A;  1CC6 A;  2JB3 A;  1GRE A;  3CMM A;  1KSS A;  1TRB A;  2WET A;  1TDK A;  4JQ9 A;  4GDE A;  4JY3 A;  4RG4 A;  5U25 A;  3DH9 A;  3G5S A;  4O5Q A;  3SFD A;  3OC4 A;  4G74 A;  1L0V A;  2BXR A;  1O95 A;  1B8S A;  1KFY A;  2AQJ A;  3UOX A;  2EQ7 A;  2JB2 A;  2Z5X A;  2JKC A;  3QVP A;  3NLC A;  2GQF A;  4U8O A;  3H8L A;  4ZCD A;  1IUT A;  4NTD A;  1GRB A;  1NHP A;  3NRN A;  4CY8 A;  1O94 A;  4U8M A;  4BK3 A;  4AP3 A;  1YQ3 A;  3SZF A;  4YSZ A;  3VRA A;  3AE8 A;  3AEF A;  1EL5 A;  1TYT A;  2Y6R A;  1RYI A;  4J36 A;  3B6D A;  1ONF A;  2C64 A;  2X8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...