2XVJA

Crystal structure of the mutant bacterial flavin containing monooxygenase in complex with indole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
446
structure length
446
Chain Sequence
ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
total genus 154
structure length 446
sequence length 446
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvjA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvjA02
2YG6A 1Q1WA 1YKJA 5IQ4A 3SFDA 1F3PA 1E6EA 1CJ2A 2C66A 2V3AA 2W0HA 3VRAA 4GCMA 4IA6A 2V5ZA 1E7PA 1NHQA 1CC2A 1NENA 1IJHA 1S2QA 2YG4A 1XDIA 3PS9A 3QSMA 3GYJA 3ALLA 3P1WA 4XWZA 1L9CA 2EQ7A 3NLCA 4X4JA 2XFUA 4HA6A 4K2XA 4B65A 4NZHA 1VG0A 3ZDNA 3UCLA 3DGHA 1EL8A 3H4KA 2Q0KA 3NK2X 3NYCA 4OPGA 2YVJA 1BGJA 1IUTA 1S3BA 1NHRA 1GRBA 3CNJA 3NG7X 1DJNA 4UP3A 2RGOA 4Z25A 1BZLA 3DJGX 4GF7A 4J57A 2YM2A 1DXLA 2EQ8A 4OVIA 2VOUA 1ZOVA 3AEDA 4C5OA 4CNJA 5KXJA 1FEBA 3KU9A 3UKKA 1D7LA 3NH3X 5FMHA 3VR8A 2WP9A 2WPFA 2JK6A 3IC9A 5IQ1A 1N4UA 2ZZCA 3QFAA 4RSLA 5KOXA 3OZ2A 4DSGA 2X50A 1GESA 4OPTA 2YLRA 1B4VA 1IUVA 3SQPA 1DOEA 2XLUA 2GVCA 2WOVA 1ELIA 1JNZA 3REDA 3FBSA 4ZCDA 3NK1X 3IHGA 2NPXA 3IWAA 3Q6JA 4JNAA 4H7UA 3UKFA 3AEEA 1GRAA 1VQWA 3I3LA 3DJDA 3CGBA 4EQRA 4X9MA 4AOXA 2YAUA 3PO7A 2FJAA 4Z2UA 2GR2A 1E1NA 2C7GA 2EQ9A 5JCLA 3UOZA 4A5LA 3RNMA 3T37A 3AEFA 1LTXR 1D7YA 1N4VA 4U8PA 1GNDA 1E1KA 1NDAA 4H4UA 2GR1A 1L9EA 4USRA 2C73A 3V76A 4FK1C 1CJ4A 4Z24A 3AB1A 3ZYXA 3D1CA 1GEUA 2XVFA 3P4SA 4ZCCA 2A87A 2BXRA 4AP3A 3NYEA 3AD7B 3G5QA 2C72A 1PBDA 4TM3A 1H7WA 4CCRA 3DK4A 3KA7A 3NRNA 5CQFA 2ZZ0A 4EQSA 2WPCA 2Y6QA 3G5SA 3AEAA 4H4RA 2BABA 2WDQA 1IUWA 1KSUA 2RABA 2XVJA 4U8IA 3E1TA 1N1PA 1ONFA 4TLZA 5C2TA 1D4EA 4U8JA 2GAGB 2GH5A 4H4PA 4BK1A 3GSIA 5DBJA 3S5WA 5JCNA 2WHDA 3FPZA 2GQFA 1PXBA 5EB4A 4WX1A 5U1OA 4ADWA 2BK3A 2VVMA 2XFOA 1NHPA 3CTYA 3DGZA 5BVAA 4FDCB 4U2TA 1Q9IA 3NNEA 4EQWA 1P2HA 1NEKA 3V3NA 1DOBA 2WOIA 1GRHA 1O5WA 2X99A 4OPUA 3UTHA 3DJEA 4USQA 2EQ6A 2C67A 3GRSA 3KVEA 4BK2A 3LXDA 4EIPA 1M64A 1AOGA 4I58A 1F8SA 1PJ7A 4H2NA 5FS9A 4B66A 4CBQA 1ZX9A 2GMHA 3C4NA 5BRTA 4EMIA 3F8DA 3NTAA 1GTHA 3NIXA 1JEHA 2YG5A 1ZY8A 3AE5A 1VRQB 1GRTA 2VZ2A 1KSSA 1YY5A 3DMEA 3K7TA 3LJPA 3UOYA 3PVCA 1ZK7A 4H4QA 4LA1A 1H83A 3AECA 3ICSA 1GV4A 4KPRA 2XCGA 1TDKA 2E1MA 3AE3A 4FK1A 3UTEA 2WU2A 5JCKA 3NHOX 1Y56B 3QFBA 1GRFA 2IVEA 2OA1A 3UKPA 2JB2A 4H50A 2BK5A 1HYUA 4C3YA 2V60A 4GUVA 5HHFA 1PBBA 1Y56A 3H8IA 3UKAA 1H86A 3AYLA 1F8WA 1ZMDA 1KF6A 2V61A 4YSHA 1DJQA 4GDPA 3ALMA 3GDPA 3H8LA 4A99A 4NTEA 2WP5A 1CHUA 4EQXA 2GV8A 4JY2A 4U8LA 3BNMA 1ZOYA 2VVLG 3SFEA 1CF3A 2OLNA 5JCMA 1KNPA 1OJTA 1COYA 1CBOA 4H4TA 2XVIA 4K8DA 1QLBA 3GWFA 2WESA 5BUKA 3CPIG 1MOKA 2R0PA 4Y4NA 2YWLA 2E5VA 1K0JA 4WCTA 3NTDA 2R4JA 2YVGA 1GOSA 5BULA 1PBCA 3QSEA 4EM4A 4Z2TA 1LQUA 3EANA 1BWCA 2VQBA 2RGJA 1JRZA 2ZZBA 2R45A 3CPHG 2J3NA 2V3BA 1PBFA 3VR9A 1GETA 1LVLA 1TDOA 1NG3A 2GAHB 2QAEA 4GR1A 3UOVA 3QJ4A 4BJYA 4AP1A 3FMWA 3AYIA 3HZLA 4J2WA 4CRTA 3QVRA 1DNCA 3NKSA 4YWOA 1LQTA 4UDQA 1EL5A 1YQ4A 3CPJG 1W4XA 2XDOA 4BURA 3UKLA 1D5TA 1PBEA 2WDVA 4Y4MA 2FJDA 1E1MA 4H2RA 3GD3A 5EBKA 3LZWA 1XHCA 1Y0PA 3COXA 3LZXA 5LV9A 2Q7VA 3UP4A 2TPRA 4Z26A 4ECHA 4U8MA 2CFYA 3KD9A 2B7SA 2B7RA 2DKHA 3BHKA 4NTDA 1YQ3A 2BA9A 3AE9A 1RP0A 1X31B 2YLTA 3GWDA 1GPEA 4YTNA 5CKUA 5GSNA 1XPQA 3EAOA 2NVKX 1B8SA 3CGEA 5FS6A 2B9WA 5J60A 4YSZA 2YLXA 1KDGA 2WBAA 1Q1RA 1GXFA 2CVJA 2X3NA 2A89A 5FS8A 3IHMA 4BK3A 2YR4A 3CN8A 1GRGA 2BXSA 2V6OA 3ATQA 2Z5XA 3AYJA 2VQ7A 4EMJA 4P9SA 1PHHA 2C70A 1OJDA 2GMJA 2BACA 4NEVA 4TM1A 3UKQA 4D03A 4E0VA 3VQRA 4J56A 2QA2A 4B63A 1H82A 4NEWA 2BC0A 2JBVA 1BF3A 2H88A 2AAQA 2JKCA 1F8RA 4H4XA 2F5ZA 3CNSA 4OPDA 3RP8A 4EIQA 5KRQA 3ISHA 1PXCA 1E1LA 1NAAA 1GERA 3DJJA 1H81A 4C77A 3CNTA 2C3DA 1PDHA 3ICRA 2YR6A 4J36A 1TDFA 3M0OA 3P4QA 1CC6A 3RP6A 1XANA 3NN0X 2HQMA 3C96A 4GDEA 4PABA 4PAAA 1FCDA 1NG4A 4OPCA 3JSKA 1E39A 4ICYA 1N4WA 1S3EA 4N9XA 4EM3A 1GREA 4IA5A 1B5QA 3AE1A 2C3CA 3B3RA 2X8HA 3O0HA 2YQUA 1PS9A 1ZKQA 4HB9A 2Q0LA 1LV0A 4J33A 2YLSA 3UKHA 3BI2A 3F8RA 3M12A 1IUUA 2XFQA 3ALJA 3AWIA 1PJ6A 4A9WA 5C3JA 3AD9B 3LOVA 2Z5YA 2WS3A 3AE6A 2ZBWA 3ATRA 3K30A 1D4CA 1RYIA 2C76A 1OJ9A 2H89A 2VRLA 4O5QA 4MJWA 4YKFA 2XLRA 3QVPA 4AT0A 4XWRA 5U63A 2BCGG 4GRTA 4KX6A 3NYFA 4YSYA 1BKWA 3II4A 2ACZA 2OALA 3BI4A 2OAMA 4TM0A 4H4SA 1D4DA 1O95A 3R9UA 1B37A 3GRTA 1FECA 3ITJA 2VRMA 1MO9A 1KFYA 5KWFA 1KNRA 2GQWA 4K22A 3GYIA 3V3OA 4H4YA 4C74A 4H4ZA 1K0IA 3IF9A 4I59A 3AXBA 4U8NA 1TRBA 1S2YA 2DKIA 2QCUA 2GR0A 2C65A 2WPEA 3BNUA 2WQYA 1VDCA 3VRDB 3EPTA 1JRYA 1QO8A 2CULA 3EF6A 3K7MX 5GRTA 4JN9A 1RSGA 2XFPA 3KLJA 3S61A 2BS3A 1JOAA 4YTMA 3SGLA 2GEWA 3RP7A 1BGNA 2XYOA 4B1BA 1EL7A 3NT6A 1GT8A 2JAEA 3GMBA 3G5RA 1SEZA 1FOHA 1TYPA 4IVOB 4LIIA 2WP6A 4H2PA 3M13A 4LU6A 2GF3A 3P9UA 3AE7A 4B69A 4XXGA 2BS2A 4JNQA 3UP5A 2BYBA 5HXIA 3I6DA 4Z44A 2A8XA 1NPXA 3BI5A 3GD4A 3Q9TA 3UOXA 3CIRA 4YT0A 4IVMB 3AD8B 4REKA 5JCIA 2WDRA 5HYMA 2AR8A 2E4GA 2XFNA 3UTFA 3CGDA 3UTGA 4FX9A 5TR3A 1FEAA 4M52A 4U8KA 2B9YA 1MXTA 3QSSA 2OLOA 1ZP0A 2XVHA 3ICTA 3LB8A 2YM1A 4U8OA 5ER0A 4EMWA 4AOSA 1M6IA 2RGHA 1EBDA 1REOA 2VVLA 2B9XA 3VRBA 1H7XA 1PN0A 3KKJA 1O94A 2WEUA 2YVFA 3L1RA 4A65A 2C64A 2GRTA 2ARDA 5L46A 1CC4A 3CGCA 4J34A 4YTPA 2APGA 4A7AA 1L9DA 2R4EA 4NTCA 5FS7A 4Z43A 2QA1A 2PYXA 4RG4A 4J31A 4CNKA 4A6NB 1OJCA 2JB1A 2PHHA 2R46A 4A79A 3C4AA 4UDPA 4TM4A 4Z2RA 2IIDA 4A6NA 3CNPA 2BK4A 1K0LA 1CL0A 1TDEA 2XVEA 1PJ5A 3AEBA 1JRXA 2BC1A 2BS4A 4TLXA 3K7QX 1DOCA 4X9NA 1GTEA 2I0ZA 2R9ZA 3GMCA 2XLPA 4H2QA 4U2SA 2BCPA 2WU5A 5KVIA 2GB0A 4B64A 4BV6A 2XLTA 4U2LA 4K5SA 2YG3A 1TYTA 1IUSA 3OC4A 3URHA 2WETA 1H84A 1Z6LA 2R0CA 4YSXA 4OCGA 3P4RA 1PXAA 2CDUA 1GSNA 4D04A 2FBWA 3AEGA 4B68A 1NHSA 3GDNA 5EOWA 1JU2A 1VG9A 2Y6RA 3FIMB 1GALA 1CJCA 4K7ZA 3SM8A 2R0GA 4JDRA 3F8PA 1QJDA 3NK0X 4O5UA 1UKVG 4AT2A 3NN6X 2YR5A 2WOWA 3KPFA 1FL2A 2FJEA 4C3XA 1K4QA 5EB5A 2YLWA 2GR3A 2X8CA 4CY6A 4DGKA 3D8XA 4APNA 4UDRA 5M0ZA 4BJZA 1YQZA 2TMDA 2C75A 2X8GA 1F6MA 2JB3A 2YLZA 3AE4A 4B67A 1DODA 5KOWA 4OPIA 4ZN0A 4DSHA 4JY3A 1LJ1A 1H6VA 2O9ZA 3ADAB 3DK9A 3BHFA 4RG3A 4CY8A 3ABVA 1L0VA 4H4WA 1OJAA 5IPYA 4H4VA 4Y4LA 1ZDLA 3AE8A 3FG2P 3B6DA 2FJBA 3WE0A 4YKGA 5KVHA 3DK8A 4YXDA 4DNAA 4OPLA 3LADA 1LPFA 4IV9A 3NGCX 5J7XA 3RHAA 5U25A 3DA1A 4JQ9A 4K5RA 4CCQA 5HY5A 1P2EA 1ZMCA 2Q6UA 1CJ3A 2B76A 3CNDA 1JNRA 1EL9A 1V59A 2XLSA 3AE2A 1TDNA 2UZZA 2IVDA 2AQJA 3L8KA 3P4PA 2YG7A 3DH9A 5M10A 1IUXA
chains in the Genus database with same CATH superfamily
2YG6A 1Q1WA 1YKJA 5IQ4A 3SFDA 1F3PA 1E6EA 1CJ2A 2C66A 2V3AA 2W0HA 3VRAA 4GCMA 4IA6A 2V5ZA 1E7PA 1NHQA 1CC2A 1NENA 1IJHA 1S2QA 2YG4A 1XDIA 3PS9A 3QSMA 3GYJA 3ALLA 3P1WA 4XWZA 1L9CA 2EQ7A 3NLCA 4X4JA 2XFUA 4HA6A 4K2XA 4B65A 4NZHA 1VG0A 3ZDNA 3UCLA 3DGHA 1EL8A 3H4KA 2Q0KA 3NK2X 3NYCA 4OPGA 2YVJA 1BGJA 1IUTA 1S3BA 1NHRA 1GRBA 3CNJA 3NG7X 1DJNA 4UP3A 2RGOA 4Z25A 1BZLA 3DJGX 4GF7A 4J57A 2YM2A 1DXLA 2EQ8A 4OVIA 2VOUA 1ZOVA 3AEDA 4C5OA 4CNJA 5KXJA 1FEBA 3KU9A 3UKKA 1D7LA 3NH3X 5FMHA 3VR8A 2WP9A 2WPFA 2JK6A 3IC9A 5IQ1A 1N4UA 2ZZCA 3QFAA 4RSLA 5KOXA 3OZ2A 4DSGA 2X50A 1GESA 4OPTA 2YLRA 1B4VA 1IUVA 3SQPA 3T31A 1DOEA 2XLUA 2GVCA 2WOVA 1ELIA 1JNZA 3T2YA 3REDA 3FBSA 4ZCDA 3NK1X 3IHGA 3SX6A 2NPXA 3IWAA 3Q6JA 4JNAA 4H7UA 3UKFA 3AEEA 1GRAA 1VQWA 3I3LA 3DJDA 3CGBA 3T0KA 4EQRA 4X9MA 2C4CA 4AOXA 2YAUA 3PO7A 2FJAA 4Z2UA 2GR2A 1E1NA 2C7GA 2EQ9A 5JCLA 3UOZA 4A5LA 3RNMA 3HYWA 3T37A 3AEFA 1LTXR 1D7YA 1N4VA 4U8PA 1GNDA 1E1KA 1NDAA 4H4UA 2GR1A 1L9EA 4USRA 2C73A 3V76A 4FK1C 1CJ4A 4Z24A 3AB1A 3ZYXA 3D1CA 1GEUA 2XVFA 3P4SA 4ZCCA 2A87A 2BXRA 4AP3A 3NYEA 3AD7B 3G5QA 2C72A 1PBDA 4TM3A 1H7WA 4CCRA 3DK4A 3SZ0A 3KA7A 3SZCA 3SZWA 3NRNA 5CQFA 2ZZ0A 4EQSA 5KNLA 2WPCA 2Y6QA 3G5SA 3AEAA 4H4RA 2BABA 2WDQA 1IUWA 1KSUA 2RABA 2XVJA 4G9KA 4U8IA 3E1TA 1N1PA 1ONFA 4TLZA 5C2TA 5KMRA 1D4EA 4U8JA 2GAGB 2GH5A 4H4PA 4BK1A 3GSIA 5DBJA 3S5WA 5JCNA 2WHDA 3FPZA 3T2KA 2GQFA 1PXBA 5EB4A 4WX1A 5U1OA 4ADWA 2BK3A 2VVMA 2XFOA 1NHPA 3CTYA 3DGZA 5BVAA 4G73A 4FDCB 4U2TA 1Q9IA 3NNEA 4EQWA 1P2HA 1NEKA 3V3NA 1DOBA 2WOIA 1GRHA 1O5WA 2X99A 4OPUA 3UTHA 3T2ZA 3DJEA 4USQA 2EQ6A 2C67A 3GRSA 3KVEA 4BK2A 3LXDA 4EIPA 1M64A 1AOGA 4I58A 1F8SA 1PJ7A 4H2NA 5FS9A 4B66A 4CBQA 1ZX9A 2GMHA 3C4NA 5BRTA 4EMIA 3F8DA 3NTAA 1GTHA 3NIXA 1JEHA 2YG5A 1ZY8A 3AE5A 1VRQB 1GRTA 2VZ2A 1KSSA 1YY5A 3DMEA 3K7TA 4II2A 3LJPA 3UOYA 3PVCA 1ZK7A 4H4QA 4LA1A 5KMQA 1H83A 3AECA 3ICSA 1GV4A 4KPRA 2XCGA 1TDKA 2E1MA 3AE3A 4FK1A 3UTEA 2WU2A 5JCKA 3NHOX 1Y56B 3QFBA 1GRFA 2IVEA 2OA1A 3UKPA 2JB2A 4H50A 2BK5A 1HYUA 4C3YA 5KMPA 2V60A 4GUVA 5HHFA 1PBBA 1Y56A 3H8IA 4NNJA 3UKAA 1H86A 3AYLA 1F8WA 1ZMDA 1KF6A 2V61A 4YSHA 1DJQA 4GDPA 3ALMA 3GDPA 3H8LA 4A99A 4NTEA 2WP5A 1CHUA 4EQXA 2GV8A 4JY2A 4U8LA 3BNMA 1ZOYA 2VVLG 3SFEA 1CF3A 2OLNA 5JCMA 1KNPA 1OJTA 1COYA 1CBOA 4H4TA 2XVIA 4K8DA 1QLBA 3GWFA 2WESA 5BUKA 3SZFA 3CPIG 1MOKA 2R0PA 4Y4NA 2YWLA 2E5VA 1K0JA 4WCTA 3NTDA 2R4JA 2YVGA 1GOSA 5BULA 1PBCA 3QSEA 4EM4A 4Z2TA 1LQUA 3EANA 1BWCA 2VQBA 2RGJA 1JRZA 2ZZBA 2R45A 3CPHG 2J3NA 2V3BA 1PBFA 3VR9A 1GETA 3GYXA 1LVLA 1TDOA 1NG3A 2GAHB 2QAEA 4GR1A 3UOVA 3QJ4A 4BJYA 4AP1A 3FMWA 3AYIA 3HZLA 4J2WA 4CRTA 3QVRA 1DNCA 3NKSA 4YWOA 1LQTA 4UDQA 1EL5A 1YQ4A 3CPJG 3CMMA 1W4XA 2XDOA 4BURA 3UKLA 1D5TA 1PBEA 2WDVA 4Y4MA 2FJDA 1E1MA 4H2RA 3GD3A 5EBKA 3LZWA 1XHCA 1Y0PA 3COXA 3LZXA 5LV9A 2Q7VA 3UP4A 2TPRA 4Z26A 4ECHA 4U8MA 2CFYA 3KD9A 2B7SA 2B7RA 2DKHA 3BHKA 4NTDA 1YQ3A 2BA9A 3AE9A 1RP0A 1X31B 2YLTA 4GAPA 3SYIA 3GWDA 1GPEA 4YTNA 5CKUA 5GSNA 1XPQA 3EAOA 2NVKX 1B8SA 3CGEA 5FS6A 2B9WA 5J60A 4YSZA 2YLXA 4G6GA 1KDGA 2WBAA 1Q1RA 1GXFA 2CVJA 2X3NA 2A89A 5FS8A 3IHMA 4BK3A 2YR4A 3CN8A 1GRGA 2BXSA 2V6OA 3ATQA 2Z5XA 3AYJA 2VQ7A 4EMJA 4P9SA 1PHHA 2C70A 1OJDA 2GMJA 2BACA 4NEVA 4TM1A 3UKQA 4D03A 4E0VA 3VQRA 4J56A 2QA2A 4B63A 1H82A 4NEWA 2BC0A 2JBVA 1BF3A 2H88A 2AAQA 2JKCA 1F8RA 4H4XA 2F5ZA 3CNSA 4OPDA 3RP8A 4EIQA 5KRQA 3ISHA 1PXCA 1E1LA 1NAAA 1GERA 3DJJA 1H81A 4C77A 3CNTA 2C3DA 1PDHA 3ICRA 2YR6A 4J36A 1TDFA 3M0OA 3P4QA 1CC6A 3RP6A 3SY4A 1XANA 4II3A 3NN0X 2HQMA 3C96A 4GDEA 4PABA 4G6HA 4PAAA 1FCDA 1NG4A 4OPCA 3JSKA 1E39A 4ICYA 1N4WA 1S3EA 4N9XA 4EM3A 1GREA 4IA5A 1B5QA 3AE1A 2C3CA 3B3RA 2X8HA 3O0HA 2YQUA 1PS9A 1ZKQA 4HB9A 2Q0LA 1LV0A 4J33A 2YLSA 3UKHA 3BI2A 3F8RA 3M12A 1IUUA 2XFQA 3ALJA 3AWIA 1PJ6A 4A9WA 5C3JA 3AD9B 3LOVA 2Z5YA 2WS3A 3AE6A 2ZBWA 3ATRA 3K30A 1D4CA 1RYIA 2C76A 1OJ9A 2H89A 2VRLA 4O5QA 4MJWA 4YKFA 2XLRA 3QVPA 4AT0A 4XWRA 5U63A 4G74A 2BCGG 4GRTA 4KX6A 3NYFA 4YSYA 1BKWA 3II4A 2ACZA 2OALA 3BI4A 2OAMA 4TM0A 4H4SA 1D4DA 1O95A 3R9UA 1B37A 3GRTA 1FECA 3ITJA 2VRMA 1MO9A 1KFYA 5KWFA 1KNRA 2GQWA 4K22A 3GYIA 3V3OA 4H4YA 4C74A 3T14A 4H4ZA 1K0IA 3IF9A 4I59A 3AXBA 4U8NA 1TRBA 1S2YA 2DKIA 2QCUA 2GR0A 2C65A 2WPEA 3BNUA 2WQYA 1VDCA 3VRDB 3EPTA 1JRYA 1QO8A 2CULA 3EF6A 3K7MX 5GRTA 4JN9A 1RSGA 2XFPA 3KLJA 3S61A 2BS3A 1JOAA 4YTMA 3SGLA 2GEWA 3RP7A 1BGNA 2XYOA 4B1BA 1EL7A 3NT6A 1GT8A 2JAEA 3GMBA 3G5RA 2BRAA 1SEZA 1FOHA 1TYPA 4IVOB 4LIIA 2WP6A 4H2PA 3M13A 4LU6A 2GF3A 3P9UA 3AE7A 4GAVA 4B69A 4XXGA 2BS2A 4JNQA 3UP5A 2BYBA 5HXIA 3I6DA 4Z44A 2A8XA 1NPXA 3BI5A 3GD4A 3Q9TA 3UOXA 3CIRA 4YT0A 4IVMB 3AD8B 4REKA 5JCIA 2WDRA 5HYMA 2AR8A 2E4GA 2XFNA 3UTFA 3CGDA 3UTGA 4FX9A 5TR3A 1FEAA 4M52A 4U8KA 2B9YA 1MXTA 3QSSA 2OLOA 1ZP0A 2XVHA 3ICTA 3LB8A 2YM1A 4U8OA 5ER0A 4EMWA 4AOSA 1M6IA 2RGHA 1EBDA 1REOA 2VVLA 2B9XA 3VRBA 1H7XA 1PN0A 3KKJA 1O94A 2WEUA 2YVFA 3L1RA 4A65A 2C64A 2GRTA 2ARDA 5L46A 1CC4A 3CGCA 4J34A 4YTPA 2APGA 4A7AA 1L9DA 2R4EA 4NTCA 5FS7A 4Z43A 2QA1A 2PYXA 4RG4A 4J31A 4CNKA 4A6NB 1OJCA 2JB1A 2PHHA 2R46A 4A79A 3HYXA 3C4AA 4UDPA 4TM4A 4Z2RA 2IIDA 3SXIA 4A6NA 3CNPA 2BK4A 1K0LA 1CL0A 1TDEA 2XVEA 1PJ5A 3AEBA 1JRXA 2BC1A 2BS4A 4TLXA 3K7QX 1DOCA 4X9NA 1GTEA 2I0ZA 2R9ZA 3GMCA 2XLPA 4H2QA 4U2SA 2BCPA 2WU5A 5KVIA 2GB0A 4B64A 4BV6A 2XLTA 4U2LA 4K5SA 2YG3A 1TYTA 1IUSA 3OC4A 3URHA 2WETA 3KPKA 1H84A 1Z6LA 2R0CA 4YSXA 4OCGA 3P4RA 1PXAA 2CDUA 1GSNA 4D04A 2FBWA 3AEGA 4B68A 1NHSA 3GDNA 5EOWA 1JU2A 1VG9A 2Y6RA 3FIMB 1GALA 1CJCA 4K7ZA 3SM8A 2R0GA 4JDRA 3F8PA 1QJDA 3NK0X 4O5UA 1UKVG 4AT2A 3NN6X 2YR5A 2WOWA 3KPFA 1FL2A 2FJEA 4C3XA 1K4QA 5EB5A 2YLWA 2GR3A 2X8CA 4CY6A 4DGKA 3D8XA 4APNA 4UDRA 5M0ZA 4BJZA 5KMSA 5HY5A 1YQZA 2TMDA 2BRYA 2C75A 1F6MA 2JB3A 2X8GA 2YLZA 3AE4A 4NWZA 4B67A 1DODA 5KOWA 4OPIA 4ZN0A 4DSHA 4JY3A 1LJ1A 1H6VA 2O9ZA 3ADAB 3DK9A 3BHFA 4RG3A 4CY8A 3ABVA 1L0VA 4H4WA 1OJAA 5IPYA 4H4VA 4Y4LA 1ZDLA 3AE8A 3FG2P 3B6DA 2FJBA 3WE0A 4YKGA 5KVHA 3DK8A 4YXDA 4DNAA 4OPLA 3LADA 1LPFA 4IV9A 3NGCX 3HYVA 5J7XA 5U25A 3DA1A 4JQ9A 4K5RA 3RHAA 4CCQA 1P2EA 1ZMCA 2Q6UA 1CJ3A 2B76A 3CNDA 1JNRA 1EL9A 1V59A 2XLSA 3AE2A 1TDNA 2UZZA 2IVDA 2AQJA 3L8KA 3P4PA 2YG7A 3DH9A 5M10A 1IUXA
chains in the Genus database with same CATH topology
2YG6A 1Q1WA 1YKJA 5IQ4A 3SFDA 1F3PA 1E6EA 1CJ2A 2C66A 2V3AA 2W0HA 3VRAA 4GCMA 4IA6A 2V5ZA 1E7PA 1NHQA 1CC2A 1NENA 1IJHA 1S2QA 2YG4A 1XDIA 3PS9A 3QSMA 3GYJA 3ALLA 3P1WA 4XWZA 1L9CA 2EQ7A 3NLCA 4X4JA 2XFUA 4HA6A 4K2XA 4B65A 4NZHA 1VG0A 3ZDNA 3UCLA 3DGHA 1EL8A 3H4KA 2Q0KA 3NK2X 3NYCA 4OPGA 2YVJA 1BGJA 1IUTA 1S3BA 1NHRA 1GRBA 3CNJA 3NG7X 1DJNA 4UP3A 2RGOA 4Z25A 1BZLA 3DJGX 4GF7A 4J57A 2YM2A 1DXLA 2EQ8A 4OVIA 2VOUA 1ZOVA 3AEDA 4C5OA 4CNJA 5KXJA 1FEBA 3KU9A 3UKKA 1D7LA 3NH3X 5FMHA 3VR8A 2WP9A 2WPFA 2JK6A 3IC9A 5IQ1A 1N4UA 2ZZCA 3QFAA 4RSLA 5KOXA 3OZ2A 4DSGA 2X50A 1GESA 4OPTA 2YLRA 1B4VA 1IUVA 3SQPA 3T31A 1DOEA 2XLUA 2GVCA 2WOVA 1ELIA 1JNZA 3T2YA 3REDA 3FBSA 4ZCDA 3NK1X 3IHGA 3SX6A 2NPXA 3IWAA 3Q6JA 4JNAA 4H7UA 3UKFA 3AEEA 1GRAA 1VQWA 3I3LA 3DJDA 3CGBA 3T0KA 4EQRA 4X9MA 2C4CA 4AOXA 2YAUA 3PO7A 2FJAA 4Z2UA 2GR2A 1E1NA 2C7GA 2EQ9A 5JCLA 3UOZA 4A5LA 3RNMA 3HYWA 3T37A 3AEFA 1LTXR 1D7YA 1N4VA 4U8PA 1GNDA 1E1KA 1NDAA 4H4UA 2GR1A 1L9EA 4USRA 2C73A 3V76A 4FK1C 1CJ4A 4Z24A 3AB1A 3ZYXA 3D1CA 1GEUA 2XVFA 3P4SA 4ZCCA 2A87A 2BXRA 4AP3A 3NYEA 3AD7B 3G5QA 2C72A 1PBDA 4TM3A 1H7WA 4CCRA 3DK4A 3SZ0A 3KA7A 3SZCA 3SZWA 3NRNA 5CQFA 2ZZ0A 4EQSA 5KNLA 2WPCA 2Y6QA 3G5SA 3AEAA 4H4RA 2BABA 2WDQA 1IUWA 1KSUA 2RABA 2XVJA 4G9KA 4U8IA 3E1TA 1N1PA 1ONFA 4TLZA 5C2TA 5KMRA 1D4EA 4U8JA 2GAGB 2GH5A 4H4PA 4BK1A 3GSIA 5DBJA 3S5WA 5JCNA 2WHDA 3FPZA 3T2KA 2GQFA 1PXBA 5EB4A 4WX1A 5U1OA 4ADWA 2BK3A 2VVMA 2XFOA 1NHPA 3CTYA 3DGZA 5BVAA 4G73A 4FDCB 4U2TA 1Q9IA 3NNEA 4EQWA 1P2HA 1NEKA 3V3NA 1DOBA 2WOIA 1GRHA 1O5WA 2X99A 4OPUA 3UTHA 3T2ZA 3DJEA 4USQA 2EQ6A 2C67A 3GRSA 3KVEA 4BK2A 3LXDA 4EIPA 1M64A 1AOGA 4I58A 1F8SA 1PJ7A 4H2NA 5FS9A 4B66A 4CBQA 1ZX9A 2GMHA 3C4NA 5BRTA 4EMIA 3F8DA 3NTAA 1GTHA 3NIXA 1JEHA 2YG5A 1ZY8A 3AE5A 1VRQB 1GRTA 2VZ2A 1KSSA 1YY5A 3DMEA 3K7TA 4II2A 3LJPA 3UOYA 3PVCA 1ZK7A 4H4QA 4LA1A 5KMQA 1H83A 3AECA 3ICSA 1GV4A 4KPRA 2XCGA 1TDKA 2E1MA 3AE3A 4FK1A 3UTEA 2WU2A 5JCKA 3NHOX 1Y56B 3QFBA 1GRFA 2IVEA 2OA1A 3UKPA 2JB2A 4H50A 2BK5A 1HYUA 4C3YA 5KMPA 2V60A 4GUVA 5HHFA 1PBBA 1Y56A 3H8IA 4NNJA 3UKAA 1H86A 3AYLA 1F8WA 1ZMDA 1KF6A 2V61A 4YSHA 1DJQA 4GDPA 3ALMA 3GDPA 3H8LA 4A99A 4NTEA 2WP5A 1CHUA 4EQXA 2GV8A 4JY2A 4U8LA 3BNMA 1ZOYA 2VVLG 3SFEA 1CF3A 2OLNA 5JCMA 1KNPA 1OJTA 1COYA 1CBOA 4H4TA 2XVIA 4K8DA 1QLBA 3GWFA 2WESA 5BUKA 3SZFA 3CPIG 1MOKA 2R0PA 4Y4NA 2YWLA 2E5VA 1K0JA 4WCTA 3NTDA 2R4JA 2YVGA 1GOSA 5BULA 1PBCA 3QSEA 4EM4A 4Z2TA 1LQUA 3EANA 1BWCA 2VQBA 2RGJA 1JRZA 2ZZBA 2R45A 3CPHG 2J3NA 2V3BA 1PBFA 3VR9A 1GETA 3GYXA 1LVLA 1TDOA 1NG3A 2GAHB 2QAEA 4GR1A 3UOVA 3QJ4A 4BJYA 4AP1A 3FMWA 3AYIA 3HZLA 4J2WA 4CRTA 3QVRA 1DNCA 3NKSA 4YWOA 1LQTA 4UDQA 1EL5A 1YQ4A 3CPJG 3CMMA 1W4XA 2XDOA 4BURA 3UKLA 1D5TA 1PBEA 2WDVA 4Y4MA 2FJDA 1E1MA 4H2RA 3GD3A 5EBKA 3LZWA 1XHCA 1Y0PA 3COXA 3LZXA 5LV9A 2Q7VA 3UP4A 2TPRA 4Z26A 4ECHA 4U8MA 2CFYA 3KD9A 2B7SA 2B7RA 2DKHA 3BHKA 4NTDA 1YQ3A 2BA9A 3AE9A 1RP0A 1X31B 2YLTA 4GAPA 3SYIA 3GWDA 1GPEA 4YTNA 5CKUA 5GSNA 1XPQA 3EAOA 2NVKX 1B8SA 3CGEA 5FS6A 2B9WA 5J60A 4YSZA 2YLXA 4G6GA 1KDGA 2WBAA 1Q1RA 1GXFA 2CVJA 2X3NA 2A89A 5FS8A 3IHMA 4BK3A 2YR4A 3CN8A 1GRGA 2BXSA 2V6OA 3ATQA 2Z5XA 3AYJA 2VQ7A 4EMJA 4P9SA 1PHHA 2C70A 1OJDA 2GMJA 2BACA 4NEVA 4TM1A 3UKQA 4D03A 4E0VA 3VQRA 4J56A 2QA2A 4B63A 1H82A 4NEWA 2BC0A 2JBVA 1BF3A 2H88A 2AAQA 2JKCA 1F8RA 4H4XA 2F5ZA 3CNSA 4OPDA 3RP8A 4EIQA 5KRQA 3ISHA 1PXCA 1E1LA 1NAAA 1GERA 3DJJA 1H81A 4C77A 3CNTA 2C3DA 1PDHA 3ICRA 2YR6A 4J36A 1TDFA 3M0OA 3P4QA 1CC6A 3RP6A 3SY4A 1XANA 4II3A 3NN0X 2HQMA 3C96A 4GDEA 4PABA 4G6HA 4PAAA 1FCDA 1NG4A 4OPCA 3JSKA 1E39A 4ICYA 1N4WA 1S3EA 4N9XA 4EM3A 1GREA 4IA5A 1B5QA 3AE1A 2C3CA 3B3RA 2X8HA 3O0HA 2YQUA 1PS9A 1ZKQA 4HB9A 2Q0LA 1LV0A 4J33A 2YLSA 3UKHA 3BI2A 3F8RA 3M12A 1IUUA 2XFQA 3ALJA 3AWIA 1PJ6A 4A9WA 5C3JA 3AD9B 3LOVA 2Z5YA 2WS3A 3AE6A 2ZBWA 3ATRA 3K30A 1D4CA 1RYIA 2C76A 1OJ9A 2H89A 2VRLA 4O5QA 4MJWA 4YKFA 2XLRA 3QVPA 4AT0A 4XWRA 5U63A 4G74A 2BCGG 4GRTA 4KX6A 3NYFA 4YSYA 1BKWA 3II4A 2ACZA 2OALA 3BI4A 2OAMA 4TM0A 4H4SA 1D4DA 1O95A 3R9UA 1B37A 3GRTA 1FECA 3ITJA 2VRMA 1MO9A 1KFYA 5KWFA 1KNRA 2GQWA 4K22A 3GYIA 3V3OA 4H4YA 4C74A 3T14A 4H4ZA 1K0IA 3IF9A 4I59A 3AXBA 4U8NA 1TRBA 1S2YA 2DKIA 2QCUA 2GR0A 2C65A 2WPEA 3BNUA 2WQYA 1VDCA 3VRDB 3EPTA 1JRYA 1QO8A 2CULA 3EF6A 3K7MX 5GRTA 4JN9A 1RSGA 2XFPA 3KLJA 3S61A 2BS3A 1JOAA 4YTMA 3SGLA 2GEWA 3RP7A 1BGNA 2XYOA 4B1BA 1EL7A 3NT6A 1GT8A 2JAEA 3GMBA 3G5RA 2BRAA 1SEZA 1FOHA 1TYPA 4IVOB 4LIIA 2WP6A 4H2PA 3M13A 4LU6A 2GF3A 3P9UA 3AE7A 4GAVA 4B69A 4XXGA 2BS2A 4JNQA 3UP5A 2BYBA 5HXIA 3I6DA 4Z44A 2A8XA 1NPXA 3BI5A 3GD4A 3Q9TA 3UOXA 3CIRA 4YT0A 4IVMB 3AD8B 4REKA 5JCIA 2WDRA 5HYMA 2AR8A 2E4GA 2XFNA 3UTFA 3CGDA 3UTGA 4FX9A 5TR3A 1FEAA 4M52A 4U8KA 2B9YA 1MXTA 3QSSA 2OLOA 1ZP0A 2XVHA 3ICTA 3LB8A 2YM1A 4U8OA 5ER0A 4EMWA 4AOSA 1M6IA 2RGHA 1EBDA 1REOA 2VVLA 2B9XA 3VRBA 1H7XA 1PN0A 3KKJA 1O94A 2WEUA 2YVFA 3L1RA 4A65A 2C64A 2GRTA 2ARDA 5L46A 1CC4A 3CGCA 4J34A 4YTPA 2APGA 4A7AA 1L9DA 2R4EA 4NTCA 5FS7A 4Z43A 2QA1A 2PYXA 4RG4A 4J31A 4CNKA 4A6NB 1OJCA 2JB1A 2PHHA 2R46A 4A79A 3HYXA 3C4AA 4UDPA 4TM4A 4Z2RA 2IIDA 3SXIA 4A6NA 3CNPA 2BK4A 1K0LA 1CL0A 1TDEA 2XVEA 1PJ5A 3AEBA 1JRXA 2BC1A 2BS4A 4TLXA 3K7QX 1DOCA 4X9NA 1GTEA 2I0ZA 2R9ZA 3GMCA 2XLPA 4H2QA 4U2SA 2BCPA 2WU5A 5KVIA 2GB0A 4B64A 4BV6A 2XLTA 4U2LA 4K5SA 2YG3A 1TYTA 1IUSA 3OC4A 3URHA 2WETA 3KPKA 1H84A 1Z6LA 2R0CA 4YSXA 4OCGA 3P4RA 1PXAA 2CDUA 1GSNA 4D04A 2FBWA 3AEGA 4B68A 1NHSA 3GDNA 5EOWA 1JU2A 1VG9A 2Y6RA 3FIMB 1GALA 1CJCA 4K7ZA 3SM8A 2R0GA 4JDRA 3F8PA 1QJDA 3NK0X 4O5UA 1UKVG 4AT2A 3NN6X 2YR5A 2WOWA 3KPFA 1FL2A 2FJEA 4C3XA 1K4QA 5EB5A 2YLWA 2GR3A 2X8CA 4CY6A 4DGKA 3D8XA 4APNA 4UDRA 5M0ZA 4BJZA 5KMSA 5HY5A 1YQZA 2TMDA 2BRYA 2C75A 1F6MA 2JB3A 2X8GA 2YLZA 3AE4A 4NWZA 4B67A 1DODA 5KOWA 4OPIA 4ZN0A 4DSHA 4JY3A 1LJ1A 1H6VA 2O9ZA 3ADAB 3DK9A 3BHFA 4RG3A 4CY8A 3ABVA 1L0VA 4H4WA 1OJAA 5IPYA 4H4VA 4Y4LA 1ZDLA 3AE8A 3FG2P 3B6DA 2FJBA 3WE0A 4YKGA 5KVHA 3DK8A 4YXDA 4DNAA 4OPLA 3LADA 1LPFA 4IV9A 3NGCX 3HYVA 5J7XA 5U25A 3DA1A 4JQ9A 4K5RA 3RHAA 4CCQA 1P2EA 1ZMCA 2Q6UA 1CJ3A 2B76A 3CNDA 1JNRA 1EL9A 1V59A 2XLSA 3AE2A 1TDNA 2UZZA 2IVDA 2AQJA 3L8KA 3P4PA 2YG7A 3DH9A 5M10A 1IUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YG6 A;  1Q1W A;  1YKJ A;  5IQ4 A;  3SFD A;  1F3P A;  1E6E A;  1CJ2 A;  2C66 A;  2V3A A;  2W0H A;  3VRA A;  4GCM A;  4IA6 A;  2V5Z A;  1E7P A;  1NHQ A;  1CC2 A;  1NEN A;  1IJH A;  1S2Q A;  2YG4 A;  1XDI A;  3PS9 A;  3QSM A;  3GYJ A;  3ALL A;  3P1W A;  4XWZ A;  1L9C A;  2EQ7 A;  3NLC A;  4X4J A;  2XFU A;  4HA6 A;  4K2X A;  4B65 A;  4NZH A;  1VG0 A;  3ZDN A;  3UCL A;  3DGH A;  1EL8 A;  3H4K A;  2Q0K A;  3NK2 X;  3NYC A;  4OPG A;  2YVJ A;  1BGJ A;  1IUT A;  1S3B A;  1NHR A;  1GRB A;  3CNJ A;  3NG7 X;  1DJN A;  4UP3 A;  2RGO A;  4Z25 A;  1BZL A;  3DJG X;  4GF7 A;  4J57 A;  2YM2 A;  1DXL A;  2EQ8 A;  4OVI A;  2VOU A;  1ZOV A;  3AED A;  4C5O A;  4CNJ A;  5KXJ A;  1FEB A;  3KU9 A;  3UKK A;  1D7L A;  3NH3 X;  5FMH A;  3VR8 A;  2WP9 A;  2WPF A;  2JK6 A;  3IC9 A;  5IQ1 A;  1N4U A;  2ZZC A;  3QFA A;  4RSL A;  5KOX A;  3OZ2 A;  4DSG A;  2X50 A;  1GES A;  4OPT A;  2YLR A;  1B4V A;  1IUV A;  3SQP A;  1DOE A;  2XLU A;  2GVC A;  2WOV A;  1ELI A;  1JNZ A;  3RED A;  3FBS A;  4ZCD A;  3NK1 X;  3IHG A;  2NPX A;  3IWA A;  3Q6J A;  4JNA A;  4H7U A;  3UKF A;  3AEE A;  1GRA A;  1VQW A;  3I3L A;  3DJD A;  3CGB A;  4EQR A;  4X9M A;  4AOX A;  2YAU A;  3PO7 A;  2FJA A;  4Z2U A;  2GR2 A;  1E1N A;  2C7G A;  2EQ9 A;  5JCL A;  3UOZ A;  4A5L A;  3RNM A;  3T37 A;  3AEF A;  1LTX R;  1D7Y A;  1N4V A;  4U8P A;  1GND A;  1E1K A;  1NDA A;  4H4U A;  2GR1 A;  1L9E A;  4USR A;  2C73 A;  3V76 A;  4FK1 C;  1CJ4 A;  4Z24 A;  3AB1 A;  3ZYX A;  3D1C A;  1GEU A;  2XVF A;  3P4S A;  4ZCC A;  2A87 A;  2BXR A;  4AP3 A;  3NYE A;  3AD7 B;  3G5Q A;  2C72 A;  1PBD A;  4TM3 A;  1H7W A;  4CCR A;  3DK4 A;  3KA7 A;  3NRN A;  5CQF A;  2ZZ0 A;  4EQS A;  2WPC A;  2Y6Q A;  3G5S A;  3AEA A;  4H4R A;  2BAB A;  2WDQ A;  1IUW A;  1KSU A;  2RAB A;  2XVJ A;  4U8I A;  3E1T A;  1N1P A;  1ONF A;  4TLZ A;  5C2T A;  1D4E A;  4U8J A;  2GAG B;  2GH5 A;  4H4P A;  4BK1 A;  3GSI A;  5DBJ A;  3S5W A;  5JCN A;  2WHD A;  3FPZ A;  2GQF A;  1PXB A;  5EB4 A;  4WX1 A;  5U1O A;  4ADW A;  2BK3 A;  2VVM A;  2XFO A;  1NHP A;  3CTY A;  3DGZ A;  5BVA A;  4FDC B;  4U2T A;  1Q9I A;  3NNE A;  4EQW A;  1P2H A;  1NEK A;  3V3N A;  1DOB A;  2WOI A;  1GRH A;  1O5W A;  2X99 A;  4OPU A;  3UTH A;  3DJE A;  4USQ A;  2EQ6 A;  2C67 A;  3GRS A;  3KVE A;  4BK2 A;  3LXD A;  4EIP A;  1M64 A;  1AOG A;  4I58 A;  1F8S A;  1PJ7 A;  4H2N A;  5FS9 A;  4B66 A;  4CBQ A;  1ZX9 A;  2GMH A;  3C4N A;  5BRT A;  4EMI A;  3F8D A;  3NTA A;  1GTH A;  3NIX A;  1JEH A;  2YG5 A;  1ZY8 A;  3AE5 A;  1VRQ B;  1GRT A;  2VZ2 A;  1KSS A;  1YY5 A;  3DME A;  3K7T A;  3LJP A;  3UOY A;  3PVC A;  1ZK7 A;  4H4Q A;  4LA1 A;  1H83 A;  3AEC A;  3ICS A;  1GV4 A;  4KPR A;  2XCG A;  1TDK A;  2E1M A;  3AE3 A;  4FK1 A;  3UTE A;  2WU2 A;  5JCK A;  3NHO X;  1Y56 B;  3QFB A;  1GRF A;  2IVE A;  2OA1 A;  3UKP A;  2JB2 A;  4H50 A;  2BK5 A;  1HYU A;  4C3Y A;  2V60 A;  4GUV A;  5HHF A;  1PBB A;  1Y56 A;  3H8I A;  3UKA A;  1H86 A;  3AYL A;  1F8W A;  1ZMD A;  1KF6 A;  2V61 A;  4YSH A;  1DJQ A;  4GDP A;  3ALM A;  3GDP A;  3H8L A;  4A99 A;  4NTE A;  2WP5 A;  1CHU A;  4EQX A;  2GV8 A;  4JY2 A;  4U8L A;  3BNM A;  1ZOY A;  2VVL G;  3SFE A;  1CF3 A;  2OLN A;  5JCM A;  1KNP A;  1OJT A;  1COY A;  1CBO A;  4H4T A;  2XVI A;  4K8D A;  1QLB A;  3GWF A;  2WES A;  5BUK A;  3CPI G;  1MOK A;  2R0P A;  4Y4N A;  2YWL A;  2E5V A;  1K0J A;  4WCT A;  3NTD A;  2R4J A;  2YVG A;  1GOS A;  5BUL A;  1PBC A;  3QSE A;  4EM4 A;  4Z2T A;  1LQU A;  3EAN A;  1BWC A;  2VQB A;  2RGJ A;  1JRZ A;  2ZZB A;  2R45 A;  3CPH G;  2J3N A;  2V3B A;  1PBF A;  3VR9 A;  1GET A;  1LVL A;  1TDO A;  1NG3 A;  2GAH B;  2QAE A;  4GR1 A;  3UOV A;  3QJ4 A;  4BJY A;  4AP1 A;  3FMW A;  3AYI A;  3HZL A;  4J2W A;  4CRT A;  3QVR A;  1DNC A;  3NKS A;  4YWO A;  1LQT A;  4UDQ A;  1EL5 A;  1YQ4 A;  3CPJ G;  1W4X A;  2XDO A;  4BUR A;  3UKL A;  1D5T A;  1PBE A;  2WDV A;  4Y4M A;  2FJD A;  1E1M A;  4H2R A;  3GD3 A;  5EBK A;  3LZW A;  1XHC A;  1Y0P A;  3COX A;  3LZX A;  5LV9 A;  2Q7V A;  3UP4 A;  2TPR A;  4Z26 A;  4ECH A;  4U8M A;  2CFY A;  3KD9 A;  2B7S A;  2B7R A;  2DKH A;  3BHK A;  4NTD A;  1YQ3 A;  2BA9 A;  3AE9 A;  1RP0 A;  1X31 B;  2YLT A;  3GWD A;  1GPE A;  4YTN A;  5CKU A;  5GSN A;  1XPQ A;  3EAO A;  2NVK X;  1B8S A;  3CGE A;  5FS6 A;  2B9W A;  5J60 A;  4YSZ A;  2YLX A;  1KDG A;  2WBA A;  1Q1R A;  1GXF A;  2CVJ A;  2X3N A;  2A89 A;  5FS8 A;  3IHM A;  4BK3 A;  2YR4 A;  3CN8 A;  1GRG A;  2BXS A;  2V6O A;  3ATQ A;  2Z5X A;  3AYJ A;  2VQ7 A;  4EMJ A;  4P9S A;  1PHH A;  2C70 A;  1OJD A;  2GMJ A;  2BAC A;  4NEV A;  4TM1 A;  3UKQ A;  4D03 A;  4E0V A;  3VQR A;  4J56 A;  2QA2 A;  4B63 A;  1H82 A;  4NEW A;  2BC0 A;  2JBV A;  1BF3 A;  2H88 A;  2AAQ A;  2JKC A;  1F8R A;  4H4X A;  2F5Z A;  3CNS A;  4OPD A;  3RP8 A;  4EIQ A;  5KRQ A;  3ISH A;  1PXC A;  1E1L A;  1NAA A;  1GER A;  3DJJ A;  1H81 A;  4C77 A;  3CNT A;  2C3D A;  1PDH A;  3ICR A;  2YR6 A;  4J36 A;  1TDF A;  3M0O A;  3P4Q A;  1CC6 A;  3RP6 A;  1XAN A;  3NN0 X;  2HQM A;  3C96 A;  4GDE A;  4PAB A;  4PAA A;  1FCD A;  1NG4 A;  4OPC A;  3JSK A;  1E39 A;  4ICY A;  1N4W A;  1S3E A;  4N9X A;  4EM3 A;  1GRE A;  4IA5 A;  1B5Q A;  3AE1 A;  2C3C A;  3B3R A;  2X8H A;  3O0H A;  2YQU A;  1PS9 A;  1ZKQ A;  4HB9 A;  2Q0L A;  1LV0 A;  4J33 A;  2YLS A;  3UKH A;  3BI2 A;  3F8R A;  3M12 A;  1IUU A;  2XFQ A;  3ALJ A;  3AWI A;  1PJ6 A;  4A9W A;  5C3J A;  3AD9 B;  3LOV A;  2Z5Y A;  2WS3 A;  3AE6 A;  2ZBW A;  3ATR A;  3K30 A;  1D4C A;  1RYI A;  2C76 A;  1OJ9 A;  2H89 A;  2VRL A;  4O5Q A;  4MJW A;  4YKF A;  2XLR A;  3QVP A;  4AT0 A;  4XWR A;  5U63 A;  2BCG G;  4GRT A;  4KX6 A;  3NYF A;  4YSY A;  1BKW A;  3II4 A;  2ACZ A;  2OAL A;  3BI4 A;  2OAM A;  4TM0 A;  4H4S A;  1D4D A;  1O95 A;  3R9U A;  1B37 A;  3GRT A;  1FEC A;  3ITJ A;  2VRM A;  1MO9 A;  1KFY A;  5KWF A;  1KNR A;  2GQW A;  4K22 A;  3GYI A;  3V3O A;  4H4Y A;  4C74 A;  4H4Z A;  1K0I A;  3IF9 A;  4I59 A;  3AXB A;  4U8N A;  1TRB A;  1S2Y A;  2DKI A;  2QCU A;  2GR0 A;  2C65 A;  2WPE A;  3BNU A;  2WQY A;  1VDC A;  3VRD B;  3EPT A;  1JRY A;  1QO8 A;  2CUL A;  3EF6 A;  3K7M X;  5GRT A;  4JN9 A;  1RSG A;  2XFP A;  3KLJ A;  3S61 A;  2BS3 A;  1JOA A;  4YTM A;  3SGL A;  2GEW A;  3RP7 A;  1BGN A;  2XYO A;  4B1B A;  1EL7 A;  3NT6 A;  1GT8 A;  2JAE A;  3GMB A;  3G5R A;  1SEZ A;  1FOH A;  1TYP A;  4IVO B;  4LII A;  2WP6 A;  4H2P A;  3M13 A;  4LU6 A;  2GF3 A;  3P9U A;  3AE7 A;  4B69 A;  4XXG A;  2BS2 A;  4JNQ A;  3UP5 A;  2BYB A;  5HXI A;  3I6D A;  4Z44 A;  2A8X A;  1NPX A;  3BI5 A;  3GD4 A;  3Q9T A;  3UOX A;  3CIR A;  4YT0 A;  4IVM B;  3AD8 B;  4REK A;  5JCI A;  2WDR A;  5HYM A;  2AR8 A;  2E4G A;  2XFN A;  3UTF A;  3CGD A;  3UTG A;  4FX9 A;  5TR3 A;  1FEA A;  4M52 A;  4U8K A;  2B9Y A;  1MXT A;  3QSS A;  2OLO A;  1ZP0 A;  2XVH A;  3ICT A;  3LB8 A;  2YM1 A;  4U8O A;  5ER0 A;  4EMW A;  4AOS A;  1M6I A;  2RGH A;  1EBD A;  1REO A;  2VVL A;  2B9X A;  3VRB A;  1H7X A;  1PN0 A;  3KKJ A;  1O94 A;  2WEU A;  2YVF A;  3L1R A;  4A65 A;  2C64 A;  2GRT A;  2ARD A;  5L46 A;  1CC4 A;  3CGC A;  4J34 A;  4YTP A;  2APG A;  4A7A A;  1L9D A;  2R4E A;  4NTC A;  5FS7 A;  4Z43 A;  2QA1 A;  2PYX A;  4RG4 A;  4J31 A;  4CNK A;  4A6N B;  1OJC A;  2JB1 A;  2PHH A;  2R46 A;  4A79 A;  3C4A A;  4UDP A;  4TM4 A;  4Z2R A;  2IID A;  4A6N A;  3CNP A;  2BK4 A;  1K0L A;  1CL0 A;  1TDE A;  2XVE A;  1PJ5 A;  3AEB A;  1JRX A;  2BC1 A;  2BS4 A;  4TLX A;  3K7Q X;  1DOC A;  4X9N A;  1GTE A;  2I0Z A;  2R9Z A;  3GMC A;  2XLP A;  4H2Q A;  4U2S A;  2BCP A;  2WU5 A;  5KVI A;  2GB0 A;  4B64 A;  4BV6 A;  2XLT A;  4U2L A;  4K5S A;  2YG3 A;  1TYT A;  1IUS A;  3OC4 A;  3URH A;  2WET A;  1H84 A;  1Z6L A;  2R0C A;  4YSX A;  4OCG A;  3P4R A;  1PXA A;  2CDU A;  1GSN A;  4D04 A;  2FBW A;  3AEG A;  4B68 A;  1NHS A;  3GDN A;  5EOW A;  1JU2 A;  1VG9 A;  2Y6R A;  3FIM B;  1GAL A;  1CJC A;  4K7Z A;  3SM8 A;  2R0G A;  4JDR A;  3F8P A;  1QJD A;  3NK0 X;  4O5U A;  1UKV G;  4AT2 A;  3NN6 X;  2YR5 A;  2WOW A;  3KPF A;  1FL2 A;  2FJE A;  4C3X A;  1K4Q A;  5EB5 A;  2YLW A;  2GR3 A;  2X8C A;  4CY6 A;  4DGK A;  3D8X A;  4APN A;  4UDR A;  5M0Z A;  4BJZ A;  1YQZ A;  2TMD A;  2C75 A;  2X8G A;  1F6M A;  2JB3 A;  2YLZ A;  3AE4 A;  4B67 A;  1DOD A;  5KOW A;  4OPI A;  4ZN0 A;  4DSH A;  4JY3 A;  1LJ1 A;  1H6V A;  2O9Z A;  3ADA B;  3DK9 A;  3BHF A;  4RG3 A;  4CY8 A;  3ABV A;  1L0V A;  4H4W A;  1OJA A;  5IPY A;  4H4V A;  4Y4L A;  1ZDL A;  3AE8 A;  3FG2 P;  3B6D A;  2FJB A;  3WE0 A;  4YKG A;  5KVH A;  3DK8 A;  4YXD A;  4DNA A;  4OPL A;  3LAD A;  1LPF A;  4IV9 A;  3NGC X;  5J7X A;  3RHA A;  5U25 A;  3DA1 A;  4JQ9 A;  4K5R A;  4CCQ A;  5HY5 A;  1P2E A;  1ZMC A;  2Q6U A;  1CJ3 A;  2B76 A;  3CND A;  1JNR A;  1EL9 A;  1V59 A;  2XLS A;  3AE2 A;  1TDN A;  2UZZ A;  2IVD A;  2AQJ A;  3L8K A;  3P4P A;  2YG7 A;  3DH9 A;  5M10 A;  1IUX A; 
#chains in the Genus database with same CATH topology
 2YG6 A;  1Q1W A;  1YKJ A;  5IQ4 A;  3SFD A;  1F3P A;  1E6E A;  1CJ2 A;  2C66 A;  2V3A A;  2W0H A;  3VRA A;  4GCM A;  4IA6 A;  2V5Z A;  1E7P A;  1NHQ A;  1CC2 A;  1NEN A;  1IJH A;  1S2Q A;  2YG4 A;  1XDI A;  3PS9 A;  3QSM A;  3GYJ A;  3ALL A;  3P1W A;  4XWZ A;  1L9C A;  2EQ7 A;  3NLC A;  4X4J A;  2XFU A;  4HA6 A;  4K2X A;  4B65 A;  4NZH A;  1VG0 A;  3ZDN A;  3UCL A;  3DGH A;  1EL8 A;  3H4K A;  2Q0K A;  3NK2 X;  3NYC A;  4OPG A;  2YVJ A;  1BGJ A;  1IUT A;  1S3B A;  1NHR A;  1GRB A;  3CNJ A;  3NG7 X;  1DJN A;  4UP3 A;  2RGO A;  4Z25 A;  1BZL A;  3DJG X;  4GF7 A;  4J57 A;  2YM2 A;  1DXL A;  2EQ8 A;  4OVI A;  2VOU A;  1ZOV A;  3AED A;  4C5O A;  4CNJ A;  5KXJ A;  1FEB A;  3KU9 A;  3UKK A;  1D7L A;  3NH3 X;  5FMH A;  3VR8 A;  2WP9 A;  2WPF A;  2JK6 A;  3IC9 A;  5IQ1 A;  1N4U A;  2ZZC A;  3QFA A;  4RSL A;  5KOX A;  3OZ2 A;  4DSG A;  2X50 A;  1GES A;  4OPT A;  2YLR A;  1B4V A;  1IUV A;  3SQP A;  3T31 A;  1DOE A;  2XLU A;  2GVC A;  2WOV A;  1ELI A;  1JNZ A;  3T2Y A;  3RED A;  3FBS A;  4ZCD A;  3NK1 X;  3IHG A;  3SX6 A;  2NPX A;  3IWA A;  3Q6J A;  4JNA A;  4H7U A;  3UKF A;  3AEE A;  1GRA A;  1VQW A;  3I3L A;  3DJD A;  3CGB A;  3T0K A;  4EQR A;  4X9M A;  2C4C A;  4AOX A;  2YAU A;  3PO7 A;  2FJA A;  4Z2U A;  2GR2 A;  1E1N A;  2C7G A;  2EQ9 A;  5JCL A;  3UOZ A;  4A5L A;  3RNM A;  3HYW A;  3T37 A;  3AEF A;  1LTX R;  1D7Y A;  1N4V A;  4U8P A;  1GND A;  1E1K A;  1NDA A;  4H4U A;  2GR1 A;  1L9E A;  4USR A;  2C73 A;  3V76 A;  4FK1 C;  1CJ4 A;  4Z24 A;  3AB1 A;  3ZYX A;  3D1C A;  1GEU A;  2XVF A;  3P4S A;  4ZCC A;  2A87 A;  2BXR A;  4AP3 A;  3NYE A;  3AD7 B;  3G5Q A;  2C72 A;  1PBD A;  4TM3 A;  1H7W A;  4CCR A;  3DK4 A;  3SZ0 A;  3KA7 A;  3SZC A;  3SZW A;  3NRN A;  5CQF A;  2ZZ0 A;  4EQS A;  5KNL A;  2WPC A;  2Y6Q A;  3G5S A;  3AEA A;  4H4R A;  2BAB A;  2WDQ A;  1IUW A;  1KSU A;  2RAB A;  2XVJ A;  4G9K A;  4U8I A;  3E1T A;  1N1P A;  1ONF A;  4TLZ A;  5C2T A;  5KMR A;  1D4E A;  4U8J A;  2GAG B;  2GH5 A;  4H4P A;  4BK1 A;  3GSI A;  5DBJ A;  3S5W A;  5JCN A;  2WHD A;  3FPZ A;  3T2K A;  2GQF A;  1PXB A;  5EB4 A;  4WX1 A;  5U1O A;  4ADW A;  2BK3 A;  2VVM A;  2XFO A;  1NHP A;  3CTY A;  3DGZ A;  5BVA A;  4G73 A;  4FDC B;  4U2T A;  1Q9I A;  3NNE A;  4EQW A;  1P2H A;  1NEK A;  3V3N A;  1DOB A;  2WOI A;  1GRH A;  1O5W A;  2X99 A;  4OPU A;  3UTH A;  3T2Z A;  3DJE A;  4USQ A;  2EQ6 A;  2C67 A;  3GRS A;  3KVE A;  4BK2 A;  3LXD A;  4EIP A;  1M64 A;  1AOG A;  4I58 A;  1F8S A;  1PJ7 A;  4H2N A;  5FS9 A;  4B66 A;  4CBQ A;  1ZX9 A;  2GMH A;  3C4N A;  5BRT A;  4EMI A;  3F8D A;  3NTA A;  1GTH A;  3NIX A;  1JEH A;  2YG5 A;  1ZY8 A;  3AE5 A;  1VRQ B;  1GRT A;  2VZ2 A;  1KSS A;  1YY5 A;  3DME A;  3K7T A;  4II2 A;  3LJP A;  3UOY A;  3PVC A;  1ZK7 A;  4H4Q A;  4LA1 A;  5KMQ A;  1H83 A;  3AEC A;  3ICS A;  1GV4 A;  4KPR A;  2XCG A;  1TDK A;  2E1M A;  3AE3 A;  4FK1 A;  3UTE A;  2WU2 A;  5JCK A;  3NHO X;  1Y56 B;  3QFB A;  1GRF A;  2IVE A;  2OA1 A;  3UKP A;  2JB2 A;  4H50 A;  2BK5 A;  1HYU A;  4C3Y A;  5KMP A;  2V60 A;  4GUV A;  5HHF A;  1PBB A;  1Y56 A;  3H8I A;  4NNJ A;  3UKA A;  1H86 A;  3AYL A;  1F8W A;  1ZMD A;  1KF6 A;  2V61 A;  4YSH A;  1DJQ A;  4GDP A;  3ALM A;  3GDP A;  3H8L A;  4A99 A;  4NTE A;  2WP5 A;  1CHU A;  4EQX A;  2GV8 A;  4JY2 A;  4U8L A;  3BNM A;  1ZOY A;  2VVL G;  3SFE A;  1CF3 A;  2OLN A;  5JCM A;  1KNP A;  1OJT A;  1COY A;  1CBO A;  4H4T A;  2XVI A;  4K8D A;  1QLB A;  3GWF A;  2WES A;  5BUK A;  3SZF A;  3CPI G;  1MOK A;  2R0P A;  4Y4N A;  2YWL A;  2E5V A;  1K0J A;  4WCT A;  3NTD A;  2R4J A;  2YVG A;  1GOS A;  5BUL A;  1PBC A;  3QSE A;  4EM4 A;  4Z2T A;  1LQU A;  3EAN A;  1BWC A;  2VQB A;  2RGJ A;  1JRZ A;  2ZZB A;  2R45 A;  3CPH G;  2J3N A;  2V3B A;  1PBF A;  3VR9 A;  1GET A;  3GYX A;  1LVL A;  1TDO A;  1NG3 A;  2GAH B;  2QAE A;  4GR1 A;  3UOV A;  3QJ4 A;  4BJY A;  4AP1 A;  3FMW A;  3AYI A;  3HZL A;  4J2W A;  4CRT A;  3QVR A;  1DNC A;  3NKS A;  4YWO A;  1LQT A;  4UDQ A;  1EL5 A;  1YQ4 A;  3CPJ G;  3CMM A;  1W4X A;  2XDO A;  4BUR A;  3UKL A;  1D5T A;  1PBE A;  2WDV A;  4Y4M A;  2FJD A;  1E1M A;  4H2R A;  3GD3 A;  5EBK A;  3LZW A;  1XHC A;  1Y0P A;  3COX A;  3LZX A;  5LV9 A;  2Q7V A;  3UP4 A;  2TPR A;  4Z26 A;  4ECH A;  4U8M A;  2CFY A;  3KD9 A;  2B7S A;  2B7R A;  2DKH A;  3BHK A;  4NTD A;  1YQ3 A;  2BA9 A;  3AE9 A;  1RP0 A;  1X31 B;  2YLT A;  4GAP A;  3SYI A;  3GWD A;  1GPE A;  4YTN A;  5CKU A;  5GSN A;  1XPQ A;  3EAO A;  2NVK X;  1B8S A;  3CGE A;  5FS6 A;  2B9W A;  5J60 A;  4YSZ A;  2YLX A;  4G6G A;  1KDG A;  2WBA A;  1Q1R A;  1GXF A;  2CVJ A;  2X3N A;  2A89 A;  5FS8 A;  3IHM A;  4BK3 A;  2YR4 A;  3CN8 A;  1GRG A;  2BXS A;  2V6O A;  3ATQ A;  2Z5X A;  3AYJ A;  2VQ7 A;  4EMJ A;  4P9S A;  1PHH A;  2C70 A;  1OJD A;  2GMJ A;  2BAC A;  4NEV A;  4TM1 A;  3UKQ A;  4D03 A;  4E0V A;  3VQR A;  4J56 A;  2QA2 A;  4B63 A;  1H82 A;  4NEW A;  2BC0 A;  2JBV A;  1BF3 A;  2H88 A;  2AAQ A;  2JKC A;  1F8R A;  4H4X A;  2F5Z A;  3CNS A;  4OPD A;  3RP8 A;  4EIQ A;  5KRQ A;  3ISH A;  1PXC A;  1E1L A;  1NAA A;  1GER A;  3DJJ A;  1H81 A;  4C77 A;  3CNT A;  2C3D A;  1PDH A;  3ICR A;  2YR6 A;  4J36 A;  1TDF A;  3M0O A;  3P4Q A;  1CC6 A;  3RP6 A;  3SY4 A;  1XAN A;  4II3 A;  3NN0 X;  2HQM A;  3C96 A;  4GDE A;  4PAB A;  4G6H A;  4PAA A;  1FCD A;  1NG4 A;  4OPC A;  3JSK A;  1E39 A;  4ICY A;  1N4W A;  1S3E A;  4N9X A;  4EM3 A;  1GRE A;  4IA5 A;  1B5Q A;  3AE1 A;  2C3C A;  3B3R A;  2X8H A;  3O0H A;  2YQU A;  1PS9 A;  1ZKQ A;  4HB9 A;  2Q0L A;  1LV0 A;  4J33 A;  2YLS A;  3UKH A;  3BI2 A;  3F8R A;  3M12 A;  1IUU A;  2XFQ A;  3ALJ A;  3AWI A;  1PJ6 A;  4A9W A;  5C3J A;  3AD9 B;  3LOV A;  2Z5Y A;  2WS3 A;  3AE6 A;  2ZBW A;  3ATR A;  3K30 A;  1D4C A;  1RYI A;  2C76 A;  1OJ9 A;  2H89 A;  2VRL A;  4O5Q A;  4MJW A;  4YKF A;  2XLR A;  3QVP A;  4AT0 A;  4XWR A;  5U63 A;  4G74 A;  2BCG G;  4GRT A;  4KX6 A;  3NYF A;  4YSY A;  1BKW A;  3II4 A;  2ACZ A;  2OAL A;  3BI4 A;  2OAM A;  4TM0 A;  4H4S A;  1D4D A;  1O95 A;  3R9U A;  1B37 A;  3GRT A;  1FEC A;  3ITJ A;  2VRM A;  1MO9 A;  1KFY A;  5KWF A;  1KNR A;  2GQW A;  4K22 A;  3GYI A;  3V3O A;  4H4Y A;  4C74 A;  3T14 A;  4H4Z A;  1K0I A;  3IF9 A;  4I59 A;  3AXB A;  4U8N A;  1TRB A;  1S2Y A;  2DKI A;  2QCU A;  2GR0 A;  2C65 A;  2WPE A;  3BNU A;  2WQY A;  1VDC A;  3VRD B;  3EPT A;  1JRY A;  1QO8 A;  2CUL A;  3EF6 A;  3K7M X;  5GRT A;  4JN9 A;  1RSG A;  2XFP A;  3KLJ A;  3S61 A;  2BS3 A;  1JOA A;  4YTM A;  3SGL A;  2GEW A;  3RP7 A;  1BGN A;  2XYO A;  4B1B A;  1EL7 A;  3NT6 A;  1GT8 A;  2JAE A;  3GMB A;  3G5R A;  2BRA A;  1SEZ A;  1FOH A;  1TYP A;  4IVO B;  4LII A;  2WP6 A;  4H2P A;  3M13 A;  4LU6 A;  2GF3 A;  3P9U A;  3AE7 A;  4GAV A;  4B69 A;  4XXG A;  2BS2 A;  4JNQ A;  3UP5 A;  2BYB A;  5HXI A;  3I6D A;  4Z44 A;  2A8X A;  1NPX A;  3BI5 A;  3GD4 A;  3Q9T A;  3UOX A;  3CIR A;  4YT0 A;  4IVM B;  3AD8 B;  4REK A;  5JCI A;  2WDR A;  5HYM A;  2AR8 A;  2E4G A;  2XFN A;  3UTF A;  3CGD A;  3UTG A;  4FX9 A;  5TR3 A;  1FEA A;  4M52 A;  4U8K A;  2B9Y A;  1MXT A;  3QSS A;  2OLO A;  1ZP0 A;  2XVH A;  3ICT A;  3LB8 A;  2YM1 A;  4U8O A;  5ER0 A;  4EMW A;  4AOS A;  1M6I A;  2RGH A;  1EBD A;  1REO A;  2VVL A;  2B9X A;  3VRB A;  1H7X A;  1PN0 A;  3KKJ A;  1O94 A;  2WEU A;  2YVF A;  3L1R A;  4A65 A;  2C64 A;  2GRT A;  2ARD A;  5L46 A;  1CC4 A;  3CGC A;  4J34 A;  4YTP A;  2APG A;  4A7A A;  1L9D A;  2R4E A;  4NTC A;  5FS7 A;  4Z43 A;  2QA1 A;  2PYX A;  4RG4 A;  4J31 A;  4CNK A;  4A6N B;  1OJC A;  2JB1 A;  2PHH A;  2R46 A;  4A79 A;  3HYX A;  3C4A A;  4UDP A;  4TM4 A;  4Z2R A;  2IID A;  3SXI A;  4A6N A;  3CNP A;  2BK4 A;  1K0L A;  1CL0 A;  1TDE A;  2XVE A;  1PJ5 A;  3AEB A;  1JRX A;  2BC1 A;  2BS4 A;  4TLX A;  3K7Q X;  1DOC A;  4X9N A;  1GTE A;  2I0Z A;  2R9Z A;  3GMC A;  2XLP A;  4H2Q A;  4U2S A;  2BCP A;  2WU5 A;  5KVI A;  2GB0 A;  4B64 A;  4BV6 A;  2XLT A;  4U2L A;  4K5S A;  2YG3 A;  1TYT A;  1IUS A;  3OC4 A;  3URH A;  2WET A;  3KPK A;  1H84 A;  1Z6L A;  2R0C A;  4YSX A;  4OCG A;  3P4R A;  1PXA A;  2CDU A;  1GSN A;  4D04 A;  2FBW A;  3AEG A;  4B68 A;  1NHS A;  3GDN A;  5EOW A;  1JU2 A;  1VG9 A;  2Y6R A;  3FIM B;  1GAL A;  1CJC A;  4K7Z A;  3SM8 A;  2R0G A;  4JDR A;  3F8P A;  1QJD A;  3NK0 X;  4O5U A;  1UKV G;  4AT2 A;  3NN6 X;  2YR5 A;  2WOW A;  3KPF A;  1FL2 A;  2FJE A;  4C3X A;  1K4Q A;  5EB5 A;  2YLW A;  2GR3 A;  2X8C A;  4CY6 A;  4DGK A;  3D8X A;  4APN A;  4UDR A;  5M0Z A;  4BJZ A;  5KMS A;  5HY5 A;  1YQZ A;  2TMD A;  2BRY A;  2C75 A;  1F6M A;  2JB3 A;  2X8G A;  2YLZ A;  3AE4 A;  4NWZ A;  4B67 A;  1DOD A;  5KOW A;  4OPI A;  4ZN0 A;  4DSH A;  4JY3 A;  1LJ1 A;  1H6V A;  2O9Z A;  3ADA B;  3DK9 A;  3BHF A;  4RG3 A;  4CY8 A;  3ABV A;  1L0V A;  4H4W A;  1OJA A;  5IPY A;  4H4V A;  4Y4L A;  1ZDL A;  3AE8 A;  3FG2 P;  3B6D A;  2FJB A;  3WE0 A;  4YKG A;  5KVH A;  3DK8 A;  4YXD A;  4DNA A;  4OPL A;  3LAD A;  1LPF A;  4IV9 A;  3NGC X;  3HYV A;  5J7X A;  5U25 A;  3DA1 A;  4JQ9 A;  4K5R A;  3RHA A;  4CCQ A;  1P2E A;  1ZMC A;  2Q6U A;  1CJ3 A;  2B76 A;  3CND A;  1JNR A;  1EL9 A;  1V59 A;  2XLS A;  3AE2 A;  1TDN A;  2UZZ A;  2IVD A;  2AQJ A;  3L8K A;  3P4P A;  2YG7 A;  3DH9 A;  5M10 A;  1IUX A; 
#chains in the Genus database with same CATH homology
 2YG6 A;  1Q1W A;  1YKJ A;  5IQ4 A;  3SFD A;  1F3P A;  1E6E A;  1CJ2 A;  2C66 A;  2V3A A;  2W0H A;  3VRA A;  4GCM A;  4IA6 A;  2V5Z A;  1E7P A;  1NHQ A;  1CC2 A;  1NEN A;  1IJH A;  1S2Q A;  2YG4 A;  1XDI A;  3PS9 A;  3QSM A;  3GYJ A;  3ALL A;  3P1W A;  4XWZ A;  1L9C A;  2EQ7 A;  3NLC A;  4X4J A;  2XFU A;  4HA6 A;  4K2X A;  4B65 A;  4NZH A;  1VG0 A;  3ZDN A;  3UCL A;  3DGH A;  1EL8 A;  3H4K A;  2Q0K A;  3NK2 X;  3NYC A;  4OPG A;  2YVJ A;  1BGJ A;  1IUT A;  1S3B A;  1NHR A;  1GRB A;  3CNJ A;  3NG7 X;  1DJN A;  4UP3 A;  2RGO A;  4Z25 A;  1BZL A;  3DJG X;  4GF7 A;  4J57 A;  2YM2 A;  1DXL A;  2EQ8 A;  4OVI A;  2VOU A;  1ZOV A;  3AED A;  4C5O A;  4CNJ A;  5KXJ A;  1FEB A;  3KU9 A;  3UKK A;  1D7L A;  3NH3 X;  5FMH A;  3VR8 A;  2WP9 A;  2WPF A;  2JK6 A;  3IC9 A;  5IQ1 A;  1N4U A;  2ZZC A;  3QFA A;  4RSL A;  5KOX A;  3OZ2 A;  4DSG A;  2X50 A;  1GES A;  4OPT A;  2YLR A;  1B4V A;  1IUV A;  3SQP A;  3T31 A;  1DOE A;  2XLU A;  2GVC A;  2WOV A;  1ELI A;  1JNZ A;  3T2Y A;  3RED A;  3FBS A;  4ZCD A;  3NK1 X;  3IHG A;  3SX6 A;  2NPX A;  3IWA A;  3Q6J A;  4JNA A;  4H7U A;  3UKF A;  3AEE A;  1GRA A;  1VQW A;  3I3L A;  3DJD A;  3CGB A;  3T0K A;  4EQR A;  4X9M A;  2C4C A;  4AOX A;  2YAU A;  3PO7 A;  2FJA A;  4Z2U A;  2GR2 A;  1E1N A;  2C7G A;  2EQ9 A;  5JCL A;  3UOZ A;  4A5L A;  3RNM A;  3HYW A;  3T37 A;  3AEF A;  1LTX R;  1D7Y A;  1N4V A;  4U8P A;  1GND A;  1E1K A;  1NDA A;  4H4U A;  2GR1 A;  1L9E A;  4USR A;  2C73 A;  3V76 A;  4FK1 C;  1CJ4 A;  4Z24 A;  3AB1 A;  3ZYX A;  3D1C A;  1GEU A;  2XVF A;  3P4S A;  4ZCC A;  2A87 A;  2BXR A;  4AP3 A;  3NYE A;  3AD7 B;  3G5Q A;  2C72 A;  1PBD A;  4TM3 A;  1H7W A;  4CCR A;  3DK4 A;  3SZ0 A;  3KA7 A;  3SZC A;  3SZW A;  3NRN A;  5CQF A;  2ZZ0 A;  4EQS A;  5KNL A;  2WPC A;  2Y6Q A;  3G5S A;  3AEA A;  4H4R A;  2BAB A;  2WDQ A;  1IUW A;  1KSU A;  2RAB A;  2XVJ A;  4G9K A;  4U8I A;  3E1T A;  1N1P A;  1ONF A;  4TLZ A;  5C2T A;  5KMR A;  1D4E A;  4U8J A;  2GAG B;  2GH5 A;  4H4P A;  4BK1 A;  3GSI A;  5DBJ A;  3S5W A;  5JCN A;  2WHD A;  3FPZ A;  3T2K A;  2GQF A;  1PXB A;  5EB4 A;  4WX1 A;  5U1O A;  4ADW A;  2BK3 A;  2VVM A;  2XFO A;  1NHP A;  3CTY A;  3DGZ A;  5BVA A;  4G73 A;  4FDC B;  4U2T A;  1Q9I A;  3NNE A;  4EQW A;  1P2H A;  1NEK A;  3V3N A;  1DOB A;  2WOI A;  1GRH A;  1O5W A;  2X99 A;  4OPU A;  3UTH A;  3T2Z A;  3DJE A;  4USQ A;  2EQ6 A;  2C67 A;  3GRS A;  3KVE A;  4BK2 A;  3LXD A;  4EIP A;  1M64 A;  1AOG A;  4I58 A;  1F8S A;  1PJ7 A;  4H2N A;  5FS9 A;  4B66 A;  4CBQ A;  1ZX9 A;  2GMH A;  3C4N A;  5BRT A;  4EMI A;  3F8D A;  3NTA A;  1GTH A;  3NIX A;  1JEH A;  2YG5 A;  1ZY8 A;  3AE5 A;  1VRQ B;  1GRT A;  2VZ2 A;  1KSS A;  1YY5 A;  3DME A;  3K7T A;  4II2 A;  3LJP A;  3UOY A;  3PVC A;  1ZK7 A;  4H4Q A;  4LA1 A;  5KMQ A;  1H83 A;  3AEC A;  3ICS A;  1GV4 A;  4KPR A;  2XCG A;  1TDK A;  2E1M A;  3AE3 A;  4FK1 A;  3UTE A;  2WU2 A;  5JCK A;  3NHO X;  1Y56 B;  3QFB A;  1GRF A;  2IVE A;  2OA1 A;  3UKP A;  2JB2 A;  4H50 A;  2BK5 A;  1HYU A;  4C3Y A;  5KMP A;  2V60 A;  4GUV A;  5HHF A;  1PBB A;  1Y56 A;  3H8I A;  4NNJ A;  3UKA A;  1H86 A;  3AYL A;  1F8W A;  1ZMD A;  1KF6 A;  2V61 A;  4YSH A;  1DJQ A;  4GDP A;  3ALM A;  3GDP A;  3H8L A;  4A99 A;  4NTE A;  2WP5 A;  1CHU A;  4EQX A;  2GV8 A;  4JY2 A;  4U8L A;  3BNM A;  1ZOY A;  2VVL G;  3SFE A;  1CF3 A;  2OLN A;  5JCM A;  1KNP A;  1OJT A;  1COY A;  1CBO A;  4H4T A;  2XVI A;  4K8D A;  1QLB A;  3GWF A;  2WES A;  5BUK A;  3SZF A;  3CPI G;  1MOK A;  2R0P A;  4Y4N A;  2YWL A;  2E5V A;  1K0J A;  4WCT A;  3NTD A;  2R4J A;  2YVG A;  1GOS A;  5BUL A;  1PBC A;  3QSE A;  4EM4 A;  4Z2T A;  1LQU A;  3EAN A;  1BWC A;  2VQB A;  2RGJ A;  1JRZ A;  2ZZB A;  2R45 A;  3CPH G;  2J3N A;  2V3B A;  1PBF A;  3VR9 A;  1GET A;  3GYX A;  1LVL A;  1TDO A;  1NG3 A;  2GAH B;  2QAE A;  4GR1 A;  3UOV A;  3QJ4 A;  4BJY A;  4AP1 A;  3FMW A;  3AYI A;  3HZL A;  4J2W A;  4CRT A;  3QVR A;  1DNC A;  3NKS A;  4YWO A;  1LQT A;  4UDQ A;  1EL5 A;  1YQ4 A;  3CPJ G;  3CMM A;  1W4X A;  2XDO A;  4BUR A;  3UKL A;  1D5T A;  1PBE A;  2WDV A;  4Y4M A;  2FJD A;  1E1M A;  4H2R A;  3GD3 A;  5EBK A;  3LZW A;  1XHC A;  1Y0P A;  3COX A;  3LZX A;  5LV9 A;  2Q7V A;  3UP4 A;  2TPR A;  4Z26 A;  4ECH A;  4U8M A;  2CFY A;  3KD9 A;  2B7S A;  2B7R A;  2DKH A;  3BHK A;  4NTD A;  1YQ3 A;  2BA9 A;  3AE9 A;  1RP0 A;  1X31 B;  2YLT A;  4GAP A;  3SYI A;  3GWD A;  1GPE A;  4YTN A;  5CKU A;  5GSN A;  1XPQ A;  3EAO A;  2NVK X;  1B8S A;  3CGE A;  5FS6 A;  2B9W A;  5J60 A;  4YSZ A;  2YLX A;  4G6G A;  1KDG A;  2WBA A;  1Q1R A;  1GXF A;  2CVJ A;  2X3N A;  2A89 A;  5FS8 A;  3IHM A;  4BK3 A;  2YR4 A;  3CN8 A;  1GRG A;  2BXS A;  2V6O A;  3ATQ A;  2Z5X A;  3AYJ A;  2VQ7 A;  4EMJ A;  4P9S A;  1PHH A;  2C70 A;  1OJD A;  2GMJ A;  2BAC A;  4NEV A;  4TM1 A;  3UKQ A;  4D03 A;  4E0V A;  3VQR A;  4J56 A;  2QA2 A;  4B63 A;  1H82 A;  4NEW A;  2BC0 A;  2JBV A;  1BF3 A;  2H88 A;  2AAQ A;  2JKC A;  1F8R A;  4H4X A;  2F5Z A;  3CNS A;  4OPD A;  3RP8 A;  4EIQ A;  5KRQ A;  3ISH A;  1PXC A;  1E1L A;  1NAA A;  1GER A;  3DJJ A;  1H81 A;  4C77 A;  3CNT A;  2C3D A;  1PDH A;  3ICR A;  2YR6 A;  4J36 A;  1TDF A;  3M0O A;  3P4Q A;  1CC6 A;  3RP6 A;  3SY4 A;  1XAN A;  4II3 A;  3NN0 X;  2HQM A;  3C96 A;  4GDE A;  4PAB A;  4G6H A;  4PAA A;  1FCD A;  1NG4 A;  4OPC A;  3JSK A;  1E39 A;  4ICY A;  1N4W A;  1S3E A;  4N9X A;  4EM3 A;  1GRE A;  4IA5 A;  1B5Q A;  3AE1 A;  2C3C A;  3B3R A;  2X8H A;  3O0H A;  2YQU A;  1PS9 A;  1ZKQ A;  4HB9 A;  2Q0L A;  1LV0 A;  4J33 A;  2YLS A;  3UKH A;  3BI2 A;  3F8R A;  3M12 A;  1IUU A;  2XFQ A;  3ALJ A;  3AWI A;  1PJ6 A;  4A9W A;  5C3J A;  3AD9 B;  3LOV A;  2Z5Y A;  2WS3 A;  3AE6 A;  2ZBW A;  3ATR A;  3K30 A;  1D4C A;  1RYI A;  2C76 A;  1OJ9 A;  2H89 A;  2VRL A;  4O5Q A;  4MJW A;  4YKF A;  2XLR A;  3QVP A;  4AT0 A;  4XWR A;  5U63 A;  4G74 A;  2BCG G;  4GRT A;  4KX6 A;  3NYF A;  4YSY A;  1BKW A;  3II4 A;  2ACZ A;  2OAL A;  3BI4 A;  2OAM A;  4TM0 A;  4H4S A;  1D4D A;  1O95 A;  3R9U A;  1B37 A;  3GRT A;  1FEC A;  3ITJ A;  2VRM A;  1MO9 A;  1KFY A;  5KWF A;  1KNR A;  2GQW A;  4K22 A;  3GYI A;  3V3O A;  4H4Y A;  4C74 A;  3T14 A;  4H4Z A;  1K0I A;  3IF9 A;  4I59 A;  3AXB A;  4U8N A;  1TRB A;  1S2Y A;  2DKI A;  2QCU A;  2GR0 A;  2C65 A;  2WPE A;  3BNU A;  2WQY A;  1VDC A;  3VRD B;  3EPT A;  1JRY A;  1QO8 A;  2CUL A;  3EF6 A;  3K7M X;  5GRT A;  4JN9 A;  1RSG A;  2XFP A;  3KLJ A;  3S61 A;  2BS3 A;  1JOA A;  4YTM A;  3SGL A;  2GEW A;  3RP7 A;  1BGN A;  2XYO A;  4B1B A;  1EL7 A;  3NT6 A;  1GT8 A;  2JAE A;  3GMB A;  3G5R A;  2BRA A;  1SEZ A;  1FOH A;  1TYP A;  4IVO B;  4LII A;  2WP6 A;  4H2P A;  3M13 A;  4LU6 A;  2GF3 A;  3P9U A;  3AE7 A;  4GAV A;  4B69 A;  4XXG A;  2BS2 A;  4JNQ A;  3UP5 A;  2BYB A;  5HXI A;  3I6D A;  4Z44 A;  2A8X A;  1NPX A;  3BI5 A;  3GD4 A;  3Q9T A;  3UOX A;  3CIR A;  4YT0 A;  4IVM B;  3AD8 B;  4REK A;  5JCI A;  2WDR A;  5HYM A;  2AR8 A;  2E4G A;  2XFN A;  3UTF A;  3CGD A;  3UTG A;  4FX9 A;  5TR3 A;  1FEA A;  4M52 A;  4U8K A;  2B9Y A;  1MXT A;  3QSS A;  2OLO A;  1ZP0 A;  2XVH A;  3ICT A;  3LB8 A;  2YM1 A;  4U8O A;  5ER0 A;  4EMW A;  4AOS A;  1M6I A;  2RGH A;  1EBD A;  1REO A;  2VVL A;  2B9X A;  3VRB A;  1H7X A;  1PN0 A;  3KKJ A;  1O94 A;  2WEU A;  2YVF A;  3L1R A;  4A65 A;  2C64 A;  2GRT A;  2ARD A;  5L46 A;  1CC4 A;  3CGC A;  4J34 A;  4YTP A;  2APG A;  4A7A A;  1L9D A;  2R4E A;  4NTC A;  5FS7 A;  4Z43 A;  2QA1 A;  2PYX A;  4RG4 A;  4J31 A;  4CNK A;  4A6N B;  1OJC A;  2JB1 A;  2PHH A;  2R46 A;  4A79 A;  3HYX A;  3C4A A;  4UDP A;  4TM4 A;  4Z2R A;  2IID A;  3SXI A;  4A6N A;  3CNP A;  2BK4 A;  1K0L A;  1CL0 A;  1TDE A;  2XVE A;  1PJ5 A;  3AEB A;  1JRX A;  2BC1 A;  2BS4 A;  4TLX A;  3K7Q X;  1DOC A;  4X9N A;  1GTE A;  2I0Z A;  2R9Z A;  3GMC A;  2XLP A;  4H2Q A;  4U2S A;  2BCP A;  2WU5 A;  5KVI A;  2GB0 A;  4B64 A;  4BV6 A;  2XLT A;  4U2L A;  4K5S A;  2YG3 A;  1TYT A;  1IUS A;  3OC4 A;  3URH A;  2WET A;  3KPK A;  1H84 A;  1Z6L A;  2R0C A;  4YSX A;  4OCG A;  3P4R A;  1PXA A;  2CDU A;  1GSN A;  4D04 A;  2FBW A;  3AEG A;  4B68 A;  1NHS A;  3GDN A;  5EOW A;  1JU2 A;  1VG9 A;  2Y6R A;  3FIM B;  1GAL A;  1CJC A;  4K7Z A;  3SM8 A;  2R0G A;  4JDR A;  3F8P A;  1QJD A;  3NK0 X;  4O5U A;  1UKV G;  4AT2 A;  3NN6 X;  2YR5 A;  2WOW A;  3KPF A;  1FL2 A;  2FJE A;  4C3X A;  1K4Q A;  5EB5 A;  2YLW A;  2GR3 A;  2X8C A;  4CY6 A;  4DGK A;  3D8X A;  4APN A;  4UDR A;  5M0Z A;  4BJZ A;  5KMS A;  5HY5 A;  1YQZ A;  2TMD A;  2BRY A;  2C75 A;  1F6M A;  2JB3 A;  2X8G A;  2YLZ A;  3AE4 A;  4NWZ A;  4B67 A;  1DOD A;  5KOW A;  4OPI A;  4ZN0 A;  4DSH A;  4JY3 A;  1LJ1 A;  1H6V A;  2O9Z A;  3ADA B;  3DK9 A;  3BHF A;  4RG3 A;  4CY8 A;  3ABV A;  1L0V A;  4H4W A;  1OJA A;  5IPY A;  4H4V A;  4Y4L A;  1ZDL A;  3AE8 A;  3FG2 P;  3B6D A;  2FJB A;  3WE0 A;  4YKG A;  5KVH A;  3DK8 A;  4YXD A;  4DNA A;  4OPL A;  3LAD A;  1LPF A;  4IV9 A;  3NGC X;  3HYV A;  5J7X A;  5U25 A;  3DA1 A;  4JQ9 A;  4K5R A;  3RHA A;  4CCQ A;  1P2E A;  1ZMC A;  2Q6U A;  1CJ3 A;  2B76 A;  3CND A;  1JNR A;  1EL9 A;  1V59 A;  2XLS A;  3AE2 A;  1TDN A;  2UZZ A;  2IVD A;  2AQJ A;  3L8K A;  3P4P A;  2YG7 A;  3DH9 A;  5M10 A;  1IUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...