2XVJA

Crystal structure of the mutant bacterial flavin containing monooxygenase in complex with indole
Total Genus 154
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
154
sequence length
446
structure length
446
Chain Sequence
b'ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSSSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 154
structure length 446
sequence length 446
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvjA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvjA02
1DOBA 4CCRA 4OPTA 1TDKA 2RABA 3AE8A 3KLJA 1D4DA 4CBQA 1LQTA 1GETA 1GTHA 2WDVA 1OJDA 1ZDLA 3C4AA 1LV0A 2YQUA 2C76A 2E5VA 2C7GA 4H4ZA 4A5LA 1B8SA 4H2RA 5M0ZA 3BNUA 3CNPA 2WOWA 2WS3A 3KPFA 1S2YA 4J2WA 3PS9A 1ZKQA 2BYBA 2WDRA 3AE3A 5ER0A 2V3BA 1D4CA 4H7UA 1LPFA 2YG3A 3AEEA 3EANA 4U8MA 2GMJA 3UTEA 3CGBA 1XDIA 2HQMA 2YR6A 3CNTA 2BS4A 2WU2A 4U8PA 4LU6A 2YAUA 1GESA 1MXTA 2XVEA 1IUWA 1JNZA 3AEGA 4HB9A 4JY2A 1PBBA 1D7LA 1Y56B 4KPRA 3ZYXA 1KSSA 1NHRA 5HYMA 3URHA 3KA7A 5EOWA 4BJZA 4YSHA 2DKHA 4LIIA 2V3AA 2BACA 2A89A 5FS9A 1H7WA 2JKCA 1F8RA 2BA9A 2PYXA 4YTMA 1GTEA 4B66A 2ZZCA 3UOZA 5JCKA 3FMWA 3DJJA 4EMJA 2BXSA 5KOWA 3SGLA 1KNPA 2V61A 1TYPA 3Q6JA 2XFOA 1IUTA 3UKHA 2GR1A 1COYA 3NTDA 2OAMA 1E7PA 4LA1A 4APNA 5KXJA 1L0VA 2B9WA 3E1TA 3G5RA 3DMEA 4Y4NA 4Z2TA 4C5OA 1PBCA 1QLBA 4I59A 3GDNA 2C70A 2XYOA 4U8IA 4GDEA 4JNQA 1N4UA 2XFNA 4TM1A 2XDOA 4U2TA 3SQPA 4ADWA 2H89A 1CJ4A 3DA1A 1NHPA 3M0OA 1FEBA 4TM4A 1VQWA 4H2NA 1JNRA 3AD9B 3VR8A 3CPJG 4UDQA 1D5TA 3AWIA 3F8DA 4U8JA 2R9ZA 1E1LA 4K2XA 4K8DA 4B1BA 1OJ9A 3UKFA 1N4WA 1LQUA 1VDCA 4A7AA 4DGKA 4ZCCA 1B37A 3B6DA 1DXLA 1GRFA 1GRTA 4ICYA 2GQWA 5BVAA 3KD9A 1RYIA 1E6EA 4A6NA 1ELIA 2YLXA 5FS7A 4UDRA 3OZ2A 3NGCX 5TR3A 1PXBA 4CNKA 5KVHA 2CDUA 1GRAA 2ZBWA 2E1MA 1CBOA 3LJPA 3LZXA 2F5ZA 5KOXA 3CPHG 5U63A 2YLZA 4IVOB 3UCLA 3CGEA 3UOYA 3AEFA 1GNDA 1Q1RA 2Q0LA 4Z24A 2VRMA 4C3XA 2WOIA 3NG7X 3CNDA 4YSXA 4FDCB 3AB1A 1KDGA 1JEHA 1NEKA 2H88A 3UKPA 2EQ9A 4CY8A 3IHGA 3BHFA 1PJ5A 2XCGA 3AE5A 2X8HA 1F6MA 3COXA 1DOCA 2C3DA 2XFPA 3AE9A 4YWOA 4A99A 4D03A 4U8LA 5KWFA 4N9XA 3ALMA 3VRAA 4YXDA 4REKA 1P2HA 2WESA 3ITJA 1AOGA 4YKGA 3CTYA 4EMIA 3ABVA 3AE6A 4Z2RA 3NK2X 1YQ3A 3FBSA 4H4XA 4YTPA 3AD8B 3DJEA 1JRZA 4E0VA 3SFEA 4EM3A 2B76A 5HY5A 3K30A 3K7QX 1GERA 4H4TA 2R45A 1LTXR 3AE7A 3I6DA 3QVRA 4PAAA 2WP6A 1XANA 2YVJA 1IUXA 3NYCA 4YSYA 3ISHA 1W4XA 2WP5A 5LV9A 2X8CA 1TDFA 3ADAB 2YG5A 1KNRA 4CY6A 1S3BA 1E1MA 1NG4A 2B9YA 4A6NB 4EQSA 1ZX9A 1PXCA 1ZOYA 2R4JA 1JOAA 3P4RA 5EB4A 4A79A 2JB2A 1EBDA 4TLZA 4AOXA 2C75A 1DNCA 3EPTA 4NEVA 4CCQA 2XLTA 5CKUA 1GV4A 2XFQA 1OJTA 2GF3A 4J34A 3QSMA 1BZLA 4HA6A 2OA1A 3IC9A 4UDPA 3ALLA 1K4QA 3PO7A 3QJ4A 2WU5A 3CGDA 2WDQA 2YWLA 1H7XA 3FIMB 4FK1A 4JNAA 2EQ7A 2GR3A 4I58A 1PBFA 1TDEA 2PHHA 5C2TA 2CULA 3VQRA 4U2LA 2X8GA 3KU9A 3VRBA 1FEAA 4EQXA 1NG3A 2BS2A 2R4EA 3G5SA 3SM8A 4YSZA 4EIPA 2WETA 2GVCA 4D04A 1GSNA 2NPXA 4X9MA 2V60A 1H82A 1XHCA 2BK3A 4O5UA 1LJ1A 1TYTA 2XVHA 2OLNA 3AD7B 2JAEA 3BI2A 5DBJA 4H2QA 1E1KA 2XLRA 3V76A 1GEUA 3KKJA 5L46A 2CVJA 3NKSA 2XLSA 2GH5A 3ATQA 4J33A 2QA1A 2NVKX 1M64A 3F8RA 1REOA 2Y6QA 1YY5A 2Y6RA 2J3NA 4JDRA 4OVIA 1VG9A 4H4QA 5BUKA 2YM2A 1MOKA 2WPFA 4BJYA 3QSEA 2R0PA 1ZP0A 2EQ8A 3RHAA 1F8SA 1IUSA 2XVJA 2YLTA 2YM1A 3NHOX 1F3PA 4UP3A 1H86A 2JB3A 1DJQA 1GREA 1N1PA 2B7SA 2FJEA 2B7RA 2WQYA 2VVLA 4TM0A 2VRLA 2WHDA 3RP8A 4JQ9A 2XVFA 1IJHA 1SEZA 2AQJA 4OPLA 3P4PA 4NTDA 1CC4A 3DGHA 3CNJA 3RP7A 1CL0A 3NYFA 4H4VA 1NAAA 2YR5A 4IA6A 1MO9A 1NPXA 3BHKA 2XVIA 3T37A 3H4KA 3FPZA 3PVCA 2BK4A 4H50A 4IV9A 1ONFA 2TMDA 4H2PA 1BGNA 1O95A 3GMBA 2IIDA 4FX9A 3DK4A 4DNAA 5IQ4A 4J57A 1E1NA 3UTHA 4JN9A 3JSKA 3C4NA 3DK8A 4CRTA 5BRTA 2GEWA 3GRSA 4EMWA 2VOUA 3FG2P 5BULA 1GT8A 3L8KA 3UKLA 5U25A 3UKAA 4AT0A 4BK1A 1M6IA 4B64A 3UTGA 3GWFA 4ECHA 4Z44A 4Y4MA 1GPEA 4TLXA 2VZ2A 1QO8A 2RGHA 1GXFA 1DOEA 2IVDA 3AEBA 4Z43A 4A65A 5C3JA 4AP1A 1N4VA 2AR8A 1JRYA 1P2EA 2Q6UA 2W0HA 2VQ7A 2GB0A 1ZK7A 1EL8A 2C64A 4NTCA 3NNEA 3CIRA 2WP9A 1NDAA 2C3CA 2JB1A 4RG3A 4U8NA 2V5ZA 4B67A 4RG4A 3UP4A 2WPEA 3DK9A 3AE4A 2OLOA 1Y0PA 2V6OA 3BNMA 1KFYA 1YQ4A 2YLRA 2VVMA 2RGOA 2R46A 4GDPA 3IF9A 3KVEA 2BK5A 3H8IA 1QJDA 3CPIG 5HHFA 3P4SA 2YR4A 2WEUA 1VG0A 4M52A 3GMCA 4AT2A 3QVPA 1S3EA 3CN8A 5KVIA 3VRDB 1L9DA 2A8XA 1IUUA 2FBWA 4EQWA 1CHUA 2BCGG 2GAHB 3ICRA 1YQZA 3AE1A 3AECA 3AEDA 3GD4A 1K0LA 4FK1C 3RNMA 4EIQA 4Z2UA 5U1OA 4J56A 2R0GA 2Z5XA 3V3OA 1NHQA 3ICSA 1FL2A 4GF7A 1Y56A 2VVLG 2GR0A 5M10A 5GSNA 3DJGX 3EAOA 1PBEA 3NN0X 1CJ3A 2RGJA 3NLCA 4XWRA 1FOHA 1BF3A 3S5WA 3LB8A 1EL7A 3OC4A 3NT6A 2GRTA 4OCGA 1CF3A 1CC6A 1TDNA 2JBVA 3AYLA 4OPGA 3DH9A 3M13A 4C77A 1Q9IA 2ZZBA 3LZWA 4J36A 2R0CA 1NENA 2YG7A 4BK2A 1H6VA 2C73A 4H4WA 3NYEA 1DODA 4KX6A 4CNJA 4U8KA 4MJWA 2XFUA 3AYIA 4OPUA 2XLPA 3B3RA 2UZZA 2A87A 5FS8A 4H4RA 2YVFA 3NK1X 4USRA 1GALA 2YVGA 1PN0A 2EQ6A 4P9SA 2C65A 4O5QA 3V3NA 2C72A 4ZN0A 1CJ2A 1CJCA 5GRTA 3UOXA 3EF6A 4H4SA 3NRNA 2GR2A 1YKJA 4BV6A 1ZOVA 1PJ6A 1F8WA 2GQFA 2I0ZA 3D8XA 4H4YA 5FS6A 3I3LA 3ZDNA 4AP3A 4IVMB 4BURA 3BI5A 4USQA 3HZLA 3QFAA 2C66A 3UOVA 4Z26A 1BGJA 1D4EA 1PJ7A 3LXDA 1CC2A 1Q1WA 3DGZA 2YLWA 4X4JA 5FMHA 1L9CA 4OPIA 4H4UA 1E39A 1RSGA 4DSGA 5JCLA 1V59A 2BS3A 1PHHA 3AXBA 2QCUA 3REDA 4RSLA 3RP6A 4H4PA 3IHMA 2X3NA 4B68A 3CGCA 4NTEA 4YT0A 5KRQA 2Q7VA 3NN6X 2C67A 2YG4A 3SFDA 3K7MX 2E4GA 2GV8A 3DJDA 3K7TA 5IQ1A 1JU2A 2QAEA 4K5RA 1K0JA 2Q0KA 4YKFA 3R9UA 4GR1A 4K7ZA 1B4VA 2VQBA 3G5QA 3QFBA 3BI4A 1BKWA 2YLSA 1FCDA 3LOVA 2ZZ0A 4NZHA 1VRQB 2QA2A 3F8PA 3IWAA 2GMHA 5CQFA 4C3YA 2BC0A 2DKIA 3GSIA 1H83A 5HXIA 1PBDA 4TM3A 1BWCA 1B5QA 3ATRA 4GRTA 1JRXA 3AE2A 4JY3A 4OPDA 4K5SA 2TPRA 4XWZA 2BXRA 5EB5A 2XLUA 4X9NA 2OALA 1PXAA 2WOVA 1S2QA 4OPCA 3UTFA 4B63A 1ZMDA 4AOSA 1X31B 1ZMCA 5EBKA 3GRTA 3CNSA 1UKVG 2CFYA 4WCTA 2IVEA 4EM4A 1D7YA 3GWDA 1Z6LA 4DSHA 1GRHA 2O9ZA 3Q9TA 4NEWA 3UKQA 2X50A 2WPCA 3GYJA 1PDHA 3O0HA 1PS9A 2YG6A 3NIXA 4Y4LA 1XPQA 1O5WA 4J31A 2JK6A 2WBAA 1O94A 3LADA 3GYIA 1GRGA 3S61A 3GDPA 3UKKA 1L9EA 1ZY8A 3ICTA 1H81A 2FJAA 2GAGB 4XXGA 4A9WA 5JCMA 3UP5A 1KSUA 3NK0X 1LVLA 1KF6A 4WX1A 1DJNA 3AYJA 5J60A 1EL5A 2FJDA 5J7XA 3D1CA 1OJCA 4U8OA 2X99A 1H84A 3GD3A 4IA5A 3II4A 3P9UA 3NH3X 2ARDA 3QSSA 1NHSA 3C96A 4U2SA 3ALJA 4GCMA 3H8LA 1OJAA 4EQRA 2FJBA 1EL9A 4GUVA 3WE0A 4ZCDA 2ACZA 3M12A 4BK3A 2BCPA 1TDOA 4PABA 1IUVA 1TRBA 3L1RA 4YTNA 3VR9A 2APGA 3NTAA 2BC1A 4B69A 1GOSA 4B65A 5IPYA 2AAQA 5JCIA 4Z25A 1FECA 3AEAA 3P1WA 4K22A 5JCNA 1HYUA 1K0IA 1GRBA 1RP0A 2B9XA 2BABA 4C74A 2Z5YA 3P4QA
chains in the Genus database with same CATH superfamily
1DOBA 4CCRA 4OPTA 1TDKA 2RABA 3AE8A 3KLJA 1D4DA 4CBQA 1LQTA 1GETA 1GTHA 2WDVA 1OJDA 1ZDLA 4GAVA 3C4AA 1LV0A 2YQUA 2C76A 2E5VA 2C7GA 4H4ZA 4A5LA 1B8SA 4H2RA 5M0ZA 3BNUA 3CNPA 4G6HA 3T31A 2WOWA 2WS3A 3KPFA 1S2YA 4J2WA 3PS9A 1ZKQA 2BYBA 2WDRA 3AE3A 5ER0A 2V3BA 1D4CA 4H7UA 1LPFA 2YG3A 3AEEA 3EANA 4U8MA 2GMJA 3UTEA 3CGBA 1XDIA 2HQMA 2YR6A 3CNTA 2BS4A 2WU2A 4U8PA 4LU6A 2YAUA 1GESA 1MXTA 2XVEA 1IUWA 1JNZA 3AEGA 4HB9A 4JY2A 1PBBA 1D7LA 1Y56B 4KPRA 3ZYXA 1KSSA 1NHRA 5HYMA 3URHA 3KA7A 5EOWA 4BJZA 4YSHA 2DKHA 3SZWA 4LIIA 2V3AA 2BACA 2A89A 3SXIA 5FS9A 1H7WA 2JKCA 1F8RA 2BA9A 2PYXA 4YTMA 1GTEA 4B66A 2ZZCA 3UOZA 5JCKA 3FMWA 3DJJA 4EMJA 2BXSA 5KOWA 3SGLA 1KNPA 2V61A 3T2YA 1TYPA 3Q6JA 2XFOA 1IUTA 3UKHA 3HYVA 2GR1A 1COYA 3NTDA 2OAMA 1E7PA 4LA1A 4APNA 5KXJA 1L0VA 2B9WA 3E1TA 4G9KA 3G5RA 3DMEA 4Y4NA 4Z2TA 4C5OA 1PBCA 1QLBA 4I59A 3GDNA 2C70A 2XYOA 4U8IA 4GDEA 4JNQA 1N4UA 2XFNA 4TM1A 2XDOA 4U2TA 3SQPA 4ADWA 2H89A 1CJ4A 3DA1A 1NHPA 3M0OA 1FEBA 4TM4A 1VQWA 4H2NA 1JNRA 3AD9B 3VR8A 3CPJG 4UDQA 1D5TA 3AWIA 3F8DA 4U8JA 2R9ZA 1E1LA 4K2XA 4K8DA 4B1BA 1OJ9A 3UKFA 1N4WA 1LQUA 1VDCA 4A7AA 4DGKA 4ZCCA 1B37A 3B6DA 1DXLA 1GRFA 1GRTA 4ICYA 2GQWA 4GAPA 5BVAA 3KD9A 1RYIA 1E6EA 4G74A 4A6NA 1ELIA 2YLXA 5FS7A 4UDRA 3OZ2A 3SX6A 3NGCX 5TR3A 1PXBA 4CNKA 5KVHA 2CDUA 1GRAA 4NWZA 2ZBWA 2E1MA 1CBOA 3LJPA 3LZXA 2F5ZA 5KOXA 3CPHG 5U63A 2YLZA 4IVOB 3UCLA 3CGEA 3UOYA 3AEFA 1GNDA 1Q1RA 2Q0LA 4Z24A 2VRMA 4C3XA 2WOIA 3NG7X 3CNDA 4YSXA 4FDCB 3AB1A 2BRAA 1KDGA 1JEHA 1NEKA 2H88A 3UKPA 2EQ9A 4CY8A 3IHGA 3BHFA 1PJ5A 2XCGA 3AE5A 2X8HA 1F6MA 3COXA 1DOCA 2C3DA 2XFPA 3AE9A 4G6GA 4YWOA 4A99A 4U8LA 5KWFA 4N9XA 3ALMA 3VRAA 4YXDA 4REKA 1P2HA 2WESA 3ITJA 1AOGA 4YKGA 3CTYA 4EMIA 3ABVA 3AE6A 4Z2RA 3NK2X 1YQ3A 3FBSA 4H4XA 4YTPA 3AD8B 3DJEA 1JRZA 4E0VA 3SFEA 4EM3A 2B76A 5HY5A 5KMRA 3K30A 3K7QX 1GERA 4H4TA 2R45A 1LTXR 3AE7A 3I6DA 3QVRA 4PAAA 2WP6A 1XANA 2YVJA 1IUXA 3NYCA 4YSYA 3ISHA 1W4XA 2WP5A 5LV9A 2X8CA 1TDFA 3ADAB 2YG5A 1KNRA 4CY6A 1S3BA 1E1MA 1NG4A 2B9YA 4A6NB 4EQSA 1ZX9A 1PXCA 1ZOYA 2R4JA 1JOAA 3P4RA 5EB4A 4A79A 2JB2A 1EBDA 4TLZA 4AOXA 2C75A 1DNCA 3EPTA 3SZ0A 4NEVA 4CCQA 2XLTA 2C4CA 5CKUA 1GV4A 2XFQA 1OJTA 2GF3A 4G73A 4J34A 3QSMA 1BZLA 4HA6A 2OA1A 3IC9A 4UDPA 3ALLA 1K4QA 3PO7A 3QJ4A 2WU5A 3CGDA 2WDQA 2YWLA 1H7XA 3FIMB 4FK1A 4JNAA 2EQ7A 2GR3A 4I58A 1PBFA 1TDEA 2PHHA 5C2TA 2CULA 3VQRA 4U2LA 2X8GA 3KU9A 3VRBA 1FEAA 4EQXA 1NG3A 2BS2A 2R4EA 3G5SA 3SM8A 4YSZA 4EIPA 2WETA 2GVCA 4D04A 1GSNA 2NPXA 4X9MA 2V60A 1H82A 1XHCA 2BK3A 4O5UA 1LJ1A 1TYTA 2XVHA 2OLNA 3AD7B 2JAEA 3BI2A 3HYWA 5DBJA 4H2QA 1E1KA 2XLRA 3V76A 1GEUA 3KKJA 5L46A 2CVJA 3NKSA 2XLSA 2GH5A 3ATQA 4J33A 2QA1A 2NVKX 1M64A 3F8RA 1REOA 2Y6QA 1YY5A 2Y6RA 2J3NA 4JDRA 4OVIA 1VG9A 4H4QA 5BUKA 2YM2A 4II3A 1MOKA 2WPFA 4BJYA 3QSEA 2R0PA 1ZP0A 2EQ8A 3RHAA 1F8SA 1IUSA 2XVJA 2YLTA 2YM1A 3NHOX 1F3PA 4UP3A 1H86A 2JB3A 1DJQA 1GREA 1N1PA 2B7SA 2FJEA 2B7RA 2WQYA 2VVLA 4TM0A 2VRLA 2WHDA 3RP8A 4JQ9A 2XVFA 1IJHA 1SEZA 2AQJA 4OPLA 3P4PA 4NTDA 1CC4A 3DGHA 3CNJA 3RP7A 1CL0A 3NYFA 4H4VA 1NAAA 3CMMA 2YR5A 4IA6A 1MO9A 1NPXA 3BHKA 2XVIA 3T37A 3H4KA 3FPZA 3PVCA 2BK4A 5KMQA 4H50A 4IV9A 1ONFA 2TMDA 4H2PA 1BGNA 1O95A 3GMBA 2IIDA 4FX9A 3DK4A 4DNAA 5IQ4A 4J57A 1E1NA 3UTHA 4JN9A 3JSKA 3C4NA 3DK8A 4CRTA 5BRTA 2GEWA 3GRSA 4EMWA 2VOUA 3FG2P 5BULA 1GT8A 3L8KA 3UKLA 5U25A 3UKAA 4AT0A 4BK1A 1M6IA 4B64A 4II2A 3T0KA 3UTGA 3GWFA 4ECHA 4Z44A 4Y4MA 5KMSA 1GPEA 4TLXA 2VZ2A 1QO8A 2RGHA 1GXFA 1DOEA 2IVDA 3AEBA 4Z43A 4A65A 5C3JA 4AP1A 5KMPA 1N4VA 2AR8A 1JRYA 1P2EA 2Q6UA 2W0HA 2VQ7A 2GB0A 1ZK7A 1EL8A 2C64A 4NTCA 3NNEA 3CIRA 2WP9A 1NDAA 2C3CA 2JB1A 4RG3A 4U8NA 2V5ZA 4B67A 4RG4A 3UP4A 2WPEA 3DK9A 3AE4A 2OLOA 1Y0PA 2V6OA 3BNMA 1KFYA 1YQ4A 2YLRA 2VVMA 2RGOA 3SZCA 2R46A 4GDPA 3IF9A 3KVEA 2BK5A 3H8IA 1QJDA 3CPIG 5HHFA 3P4SA 2YR4A 2WEUA 1VG0A 4M52A 3GMCA 4AT2A 3QVPA 1S3EA 3CN8A 5KVIA 2BRYA 3VRDB 1L9DA 2A8XA 1IUUA 2FBWA 4EQWA 1CHUA 2BCGG 2GAHB 3ICRA 1YQZA 3AE1A 3AECA 3AEDA 3GD4A 1K0LA 4FK1C 3RNMA 4EIQA 4Z2UA 5U1OA 4J56A 2R0GA 2Z5XA 3V3OA 1NHQA 3ICSA 1FL2A 4GF7A 1Y56A 2VVLG 2GR0A 5M10A 5GSNA 3DJGX 3EAOA 1PBEA 3NN0X 1CJ3A 2RGJA 3NLCA 4XWRA 1FOHA 1BF3A 3S5WA 3LB8A 1EL7A 3OC4A 3NT6A 2GRTA 4OCGA 1CF3A 1CC6A 1TDNA 2JBVA 3AYLA 4OPGA 3DH9A 3M13A 4C77A 1Q9IA 2ZZBA 3LZWA 4J36A 2R0CA 1NENA 2YG7A 4BK2A 1H6VA 2C73A 4H4WA 3NYEA 3T2ZA 1DODA 4KX6A 4CNJA 4U8KA 4MJWA 2XFUA 3AYIA 4OPUA 2XLPA 3B3RA 2UZZA 2A87A 5FS8A 4H4RA 2YVFA 3NK1X 4USRA 1GALA 2YVGA 1PN0A 2EQ6A 4P9SA 2C65A 4O5QA 3V3NA 2C72A 4ZN0A 1CJ2A 1CJCA 5GRTA 3UOXA 3EF6A 4H4SA 3NRNA 2GR2A 1YKJA 4BV6A 1ZOVA 1PJ6A 1F8WA 2GQFA 2I0ZA 3D8XA 4H4YA 5FS6A 3I3LA 3ZDNA 4AP3A 4IVMB 4BURA 3BI5A 4USQA 3HZLA 3QFAA 2C66A 3UOVA 4Z26A 1BGJA 1D4EA 1PJ7A 3LXDA 1CC2A 1Q1WA 3DGZA 2YLWA 4X4JA 5FMHA 1L9CA 4OPIA 4H4UA 1E39A 1RSGA 4DSGA 5JCLA 1V59A 2BS3A 1PHHA 3AXBA 2QCUA 3REDA 4RSLA 3RP6A 4H4PA 3IHMA 2X3NA 4B68A 3CGCA 4NTEA 4YT0A 5KRQA 2Q7VA 3NN6X 2C67A 2YG4A 3SFDA 3K7MX 2E4GA 2GV8A 3DJDA 3K7TA 5IQ1A 3T14A 1JU2A 2QAEA 4K5RA 1K0JA 2Q0KA 4YKFA 3R9UA 4D03A 3SZFA 4GR1A 4K7ZA 1B4VA 2VQBA 3KPKA 3G5QA 3QFBA 3BI4A 1BKWA 2YLSA 1FCDA 3LOVA 2ZZ0A 4NZHA 1VRQB 2QA2A 3F8PA 3IWAA 2GMHA 5CQFA 4C3YA 5KNLA 2BC0A 2DKIA 3GSIA 1H83A 5HXIA 1PBDA 4TM3A 1BWCA 1B5QA 3ATRA 4GRTA 1JRXA 3AE2A 4JY3A 4OPDA 4K5SA 2TPRA 4XWZA 2BXRA 4NNJA 5EB5A 2XLUA 4X9NA 2OALA 3GYXA 1PXAA 2WOVA 1S2QA 4OPCA 3UTFA 4B63A 1ZMDA 4AOSA 1X31B 1ZMCA 5EBKA 3GRTA 3CNSA 1UKVG 2CFYA 4WCTA 3SYIA 2IVEA 4EM4A 1D7YA 3GWDA 1Z6LA 4DSHA 1GRHA 2O9ZA 3Q9TA 4NEWA 3UKQA 2X50A 2WPCA 3GYJA 1PDHA 3O0HA 1PS9A 2YG6A 3NIXA 4Y4LA 1XPQA 1O5WA 4J31A 2JK6A 2WBAA 1O94A 3LADA 3GYIA 1GRGA 3S61A 3GDPA 3UKKA 1L9EA 1ZY8A 3ICTA 1H81A 2FJAA 2GAGB 4XXGA 4A9WA 5JCMA 3UP5A 1KSUA 3NK0X 1LVLA 1KF6A 4WX1A 1DJNA 3AYJA 5J60A 1EL5A 2FJDA 5J7XA 3T2KA 3D1CA 1OJCA 4U8OA 2X99A 1H84A 3GD3A 4IA5A 3II4A 3P9UA 3NH3X 2ARDA 3QSSA 1NHSA 3C96A 4U2SA 3ALJA 4GCMA 3H8LA 1OJAA 4EQRA 2FJBA 1EL9A 4GUVA 3WE0A 4ZCDA 2ACZA 3M12A 4BK3A 2BCPA 1TDOA 4PABA 3HYXA 1IUVA 1TRBA 3L1RA 4YTNA 3VR9A 2APGA 3NTAA 2BC1A 4B69A 1GOSA 4B65A 5IPYA 2AAQA 3SY4A 5JCIA 4Z25A 1FECA 3AEAA 3P1WA 4K22A 5JCNA 1HYUA 1K0IA 1GRBA 1RP0A 2B9XA 2BABA 4C74A 2Z5YA 3P4QA
chains in the Genus database with same CATH topology
1DOBA 4CCRA 4OPTA 1TDKA 2RABA 3AE8A 3KLJA 1D4DA 4CBQA 1LQTA 1GETA 1GTHA 2WDVA 1OJDA 1ZDLA 4GAVA 3C4AA 1LV0A 2YQUA 2C76A 2E5VA 2C7GA 4H4ZA 4A5LA 1B8SA 4H2RA 5M0ZA 3BNUA 3CNPA 4G6HA 3T31A 2WOWA 2WS3A 3KPFA 1S2YA 4J2WA 3PS9A 1ZKQA 2BYBA 2WDRA 3AE3A 5ER0A 2V3BA 1D4CA 4H7UA 1LPFA 2YG3A 3AEEA 3EANA 4U8MA 2GMJA 3UTEA 3CGBA 1XDIA 2HQMA 2YR6A 3CNTA 2BS4A 2WU2A 4U8PA 4LU6A 2YAUA 1GESA 1MXTA 2XVEA 1IUWA 1JNZA 3AEGA 4HB9A 4JY2A 1PBBA 1D7LA 1Y56B 4KPRA 3ZYXA 1KSSA 1NHRA 5HYMA 3URHA 3KA7A 5EOWA 4BJZA 4YSHA 2DKHA 3SZWA 4LIIA 2V3AA 2BACA 2A89A 3SXIA 5FS9A 1H7WA 2JKCA 1F8RA 2BA9A 2PYXA 4YTMA 1GTEA 4B66A 2ZZCA 3UOZA 5JCKA 3FMWA 3DJJA 4EMJA 2BXSA 5KOWA 3SGLA 1KNPA 2V61A 3T2YA 1TYPA 3Q6JA 2XFOA 1IUTA 3UKHA 3HYVA 2GR1A 1COYA 3NTDA 2OAMA 1E7PA 4LA1A 4APNA 5KXJA 1L0VA 2B9WA 3E1TA 4G9KA 3G5RA 3DMEA 4Y4NA 4Z2TA 4C5OA 1PBCA 1QLBA 4I59A 3GDNA 2C70A 2XYOA 4U8IA 4GDEA 4JNQA 1N4UA 2XFNA 4TM1A 2XDOA 4U2TA 3SQPA 4ADWA 2H89A 1CJ4A 3DA1A 1NHPA 3M0OA 1FEBA 4TM4A 1VQWA 4H2NA 1JNRA 3AD9B 3VR8A 3CPJG 4UDQA 1D5TA 3AWIA 3F8DA 4U8JA 2R9ZA 1E1LA 4K2XA 4K8DA 4B1BA 1OJ9A 3UKFA 1N4WA 1LQUA 1VDCA 4A7AA 4DGKA 4ZCCA 1B37A 3B6DA 1DXLA 1GRFA 1GRTA 4ICYA 2GQWA 4GAPA 5BVAA 3KD9A 1RYIA 1E6EA 4G74A 4A6NA 1ELIA 2YLXA 5FS7A 4UDRA 3OZ2A 3SX6A 3NGCX 5TR3A 1PXBA 4CNKA 5KVHA 2CDUA 1GRAA 4NWZA 2ZBWA 2E1MA 1CBOA 3LJPA 3LZXA 2F5ZA 5KOXA 3CPHG 5U63A 2YLZA 4IVOB 3UCLA 3CGEA 3UOYA 3AEFA 1GNDA 1Q1RA 2Q0LA 4Z24A 2VRMA 4C3XA 2WOIA 3NG7X 3CNDA 4YSXA 4FDCB 3AB1A 2BRAA 1KDGA 1JEHA 1NEKA 2H88A 3UKPA 2EQ9A 4CY8A 3IHGA 3BHFA 1PJ5A 2XCGA 3AE5A 2X8HA 1F6MA 3COXA 1DOCA 2C3DA 2XFPA 3AE9A 4G6GA 4YWOA 4A99A 4U8LA 5KWFA 4N9XA 3ALMA 3VRAA 4YXDA 4REKA 1P2HA 2WESA 3ITJA 1AOGA 4YKGA 3CTYA 4EMIA 3ABVA 3AE6A 4Z2RA 3NK2X 1YQ3A 3FBSA 4H4XA 4YTPA 3AD8B 3DJEA 1JRZA 4E0VA 3SFEA 4EM3A 2B76A 5HY5A 5KMRA 3K30A 3K7QX 1GERA 4H4TA 2R45A 1LTXR 3AE7A 3I6DA 3QVRA 4PAAA 2WP6A 1XANA 2YVJA 1IUXA 3NYCA 4YSYA 3ISHA 1W4XA 2WP5A 5LV9A 2X8CA 1TDFA 3ADAB 2YG5A 1KNRA 4CY6A 1S3BA 1E1MA 1NG4A 2B9YA 4A6NB 4EQSA 1ZX9A 1PXCA 1ZOYA 2R4JA 1JOAA 3P4RA 5EB4A 4A79A 2JB2A 1EBDA 4TLZA 4AOXA 2C75A 1DNCA 3EPTA 3SZ0A 4NEVA 4CCQA 2XLTA 2C4CA 5CKUA 1GV4A 2XFQA 1OJTA 2GF3A 4G73A 4J34A 3QSMA 1BZLA 4HA6A 2OA1A 3IC9A 4UDPA 3ALLA 1K4QA 3PO7A 3QJ4A 2WU5A 3CGDA 2WDQA 2YWLA 1H7XA 3FIMB 4FK1A 4JNAA 2EQ7A 2GR3A 4I58A 1PBFA 1TDEA 2PHHA 5C2TA 2CULA 3VQRA 4U2LA 2X8GA 3KU9A 3VRBA 1FEAA 4EQXA 1NG3A 2BS2A 2R4EA 3G5SA 3SM8A 4YSZA 4EIPA 2WETA 2GVCA 4D04A 1GSNA 2NPXA 4X9MA 2V60A 1H82A 1XHCA 2BK3A 4O5UA 1LJ1A 1TYTA 2XVHA 2OLNA 3AD7B 2JAEA 3BI2A 3HYWA 5DBJA 4H2QA 1E1KA 2XLRA 3V76A 1GEUA 3KKJA 5L46A 2CVJA 3NKSA 2XLSA 2GH5A 3ATQA 4J33A 2QA1A 2NVKX 1M64A 3F8RA 1REOA 2Y6QA 1YY5A 2Y6RA 2J3NA 4JDRA 4OVIA 1VG9A 4H4QA 5BUKA 2YM2A 4II3A 1MOKA 2WPFA 4BJYA 3QSEA 2R0PA 1ZP0A 2EQ8A 3RHAA 1F8SA 1IUSA 2XVJA 2YLTA 2YM1A 3NHOX 1F3PA 4UP3A 1H86A 2JB3A 1DJQA 1GREA 1N1PA 2B7SA 2FJEA 2B7RA 2WQYA 2VVLA 4TM0A 2VRLA 2WHDA 3RP8A 4JQ9A 2XVFA 1IJHA 1SEZA 2AQJA 4OPLA 3P4PA 4NTDA 1CC4A 3DGHA 3CNJA 3RP7A 1CL0A 3NYFA 4H4VA 1NAAA 3CMMA 2YR5A 4IA6A 1MO9A 1NPXA 3BHKA 2XVIA 3T37A 3H4KA 3FPZA 3PVCA 2BK4A 5KMQA 4H50A 4IV9A 1ONFA 2TMDA 4H2PA 1BGNA 1O95A 3GMBA 2IIDA 4FX9A 3DK4A 4DNAA 5IQ4A 4J57A 1E1NA 3UTHA 4JN9A 3JSKA 3C4NA 3DK8A 4CRTA 5BRTA 2GEWA 3GRSA 4EMWA 2VOUA 3FG2P 5BULA 1GT8A 3L8KA 3UKLA 5U25A 3UKAA 4AT0A 4BK1A 1M6IA 4B64A 4II2A 3T0KA 3UTGA 3GWFA 4ECHA 4Z44A 4Y4MA 5KMSA 1GPEA 4TLXA 2VZ2A 1QO8A 2RGHA 1GXFA 1DOEA 2IVDA 3AEBA 4Z43A 4A65A 5C3JA 4AP1A 5KMPA 1N4VA 2AR8A 1JRYA 1P2EA 2Q6UA 2W0HA 2VQ7A 2GB0A 1ZK7A 1EL8A 2C64A 4NTCA 3NNEA 3CIRA 2WP9A 1NDAA 2C3CA 2JB1A 4RG3A 4U8NA 2V5ZA 4B67A 4RG4A 3UP4A 2WPEA 3DK9A 3AE4A 2OLOA 1Y0PA 2V6OA 3BNMA 1KFYA 1YQ4A 2YLRA 2VVMA 2RGOA 3SZCA 2R46A 4GDPA 3IF9A 3KVEA 2BK5A 3H8IA 1QJDA 3CPIG 5HHFA 3P4SA 2YR4A 2WEUA 1VG0A 4M52A 3GMCA 4AT2A 3QVPA 1S3EA 3CN8A 5KVIA 2BRYA 3VRDB 1L9DA 2A8XA 1IUUA 2FBWA 4EQWA 1CHUA 2BCGG 2GAHB 3ICRA 1YQZA 3AE1A 3AECA 3AEDA 3GD4A 1K0LA 4FK1C 3RNMA 4EIQA 4Z2UA 5U1OA 4J56A 2R0GA 2Z5XA 3V3OA 1NHQA 3ICSA 1FL2A 4GF7A 1Y56A 2VVLG 2GR0A 5M10A 5GSNA 3DJGX 3EAOA 1PBEA 3NN0X 1CJ3A 2RGJA 3NLCA 4XWRA 1FOHA 1BF3A 3S5WA 3LB8A 1EL7A 3OC4A 3NT6A 2GRTA 4OCGA 1CF3A 1CC6A 1TDNA 2JBVA 3AYLA 4OPGA 3DH9A 3M13A 4C77A 1Q9IA 2ZZBA 3LZWA 4J36A 2R0CA 1NENA 2YG7A 4BK2A 1H6VA 2C73A 4H4WA 3NYEA 3T2ZA 1DODA 4KX6A 4CNJA 4U8KA 4MJWA 2XFUA 3AYIA 4OPUA 2XLPA 3B3RA 2UZZA 2A87A 5FS8A 4H4RA 2YVFA 3NK1X 4USRA 1GALA 2YVGA 1PN0A 2EQ6A 4P9SA 2C65A 4O5QA 3V3NA 2C72A 4ZN0A 1CJ2A 1CJCA 5GRTA 3UOXA 3EF6A 4H4SA 3NRNA 2GR2A 1YKJA 4BV6A 1ZOVA 1PJ6A 1F8WA 2GQFA 2I0ZA 3D8XA 4H4YA 5FS6A 3I3LA 3ZDNA 4AP3A 4IVMB 4BURA 3BI5A 4USQA 3HZLA 3QFAA 2C66A 3UOVA 4Z26A 1BGJA 1D4EA 1PJ7A 3LXDA 1CC2A 1Q1WA 3DGZA 2YLWA 4X4JA 5FMHA 1L9CA 4OPIA 4H4UA 1E39A 1RSGA 4DSGA 5JCLA 1V59A 2BS3A 1PHHA 3AXBA 2QCUA 3REDA 4RSLA 3RP6A 4H4PA 3IHMA 2X3NA 4B68A 3CGCA 4NTEA 4YT0A 5KRQA 2Q7VA 3NN6X 2C67A 2YG4A 3SFDA 3K7MX 2E4GA 2GV8A 3DJDA 3K7TA 5IQ1A 3T14A 1JU2A 2QAEA 4K5RA 1K0JA 2Q0KA 4YKFA 3R9UA 4D03A 3SZFA 4GR1A 4K7ZA 1B4VA 2VQBA 3KPKA 3G5QA 3QFBA 3BI4A 1BKWA 2YLSA 1FCDA 3LOVA 2ZZ0A 4NZHA 1VRQB 2QA2A 3F8PA 3IWAA 2GMHA 5CQFA 4C3YA 5KNLA 2BC0A 2DKIA 3GSIA 1H83A 5HXIA 1PBDA 4TM3A 1BWCA 1B5QA 3ATRA 4GRTA 1JRXA 3AE2A 4JY3A 4OPDA 4K5SA 2TPRA 4XWZA 2BXRA 4NNJA 5EB5A 2XLUA 4X9NA 2OALA 3GYXA 1PXAA 2WOVA 1S2QA 4OPCA 3UTFA 4B63A 1ZMDA 4AOSA 1X31B 1ZMCA 5EBKA 3GRTA 3CNSA 1UKVG 2CFYA 4WCTA 3SYIA 2IVEA 4EM4A 1D7YA 3GWDA 1Z6LA 4DSHA 1GRHA 2O9ZA 3Q9TA 4NEWA 3UKQA 2X50A 2WPCA 3GYJA 1PDHA 3O0HA 1PS9A 2YG6A 3NIXA 4Y4LA 1XPQA 1O5WA 4J31A 2JK6A 2WBAA 1O94A 3LADA 3GYIA 1GRGA 3S61A 3GDPA 3UKKA 1L9EA 1ZY8A 3ICTA 1H81A 2FJAA 2GAGB 4XXGA 4A9WA 5JCMA 3UP5A 1KSUA 3NK0X 1LVLA 1KF6A 4WX1A 1DJNA 3AYJA 5J60A 1EL5A 2FJDA 5J7XA 3T2KA 3D1CA 1OJCA 4U8OA 2X99A 1H84A 3GD3A 4IA5A 3II4A 3P9UA 3NH3X 2ARDA 3QSSA 1NHSA 3C96A 4U2SA 3ALJA 4GCMA 3H8LA 1OJAA 4EQRA 2FJBA 1EL9A 4GUVA 3WE0A 4ZCDA 2ACZA 3M12A 4BK3A 2BCPA 1TDOA 4PABA 3HYXA 1IUVA 1TRBA 3L1RA 4YTNA 3VR9A 2APGA 3NTAA 2BC1A 4B69A 1GOSA 4B65A 5IPYA 2AAQA 3SY4A 5JCIA 4Z25A 1FECA 3AEAA 3P1WA 4K22A 5JCNA 1HYUA 1K0IA 1GRBA 1RP0A 2B9XA 2BABA 4C74A 2Z5YA 3P4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOB A;  4CCR A;  4OPT A;  1TDK A;  2RAB A;  3AE8 A;  3KLJ A;  1D4D A;  4CBQ A;  1LQT A;  1GET A;  1GTH A;  2WDV A;  1OJD A;  1ZDL A;  3C4A A;  1LV0 A;  2YQU A;  2C76 A;  2E5V A;  2C7G A;  4H4Z A;  4A5L A;  1B8S A;  4H2R A;  5M0Z A;  3BNU A;  3CNP A;  2WOW A;  2WS3 A;  3KPF A;  1S2Y A;  4J2W A;  3PS9 A;  1ZKQ A;  2BYB A;  2WDR A;  3AE3 A;  5ER0 A;  2V3B A;  1D4C A;  4H7U A;  1LPF A;  2YG3 A;  3AEE A;  3EAN A;  4U8M A;  2GMJ A;  3UTE A;  3CGB A;  1XDI A;  2HQM A;  2YR6 A;  3CNT A;  2BS4 A;  2WU2 A;  4U8P A;  4LU6 A;  2YAU A;  1GES A;  1MXT A;  2XVE A;  1IUW A;  1JNZ A;  3AEG A;  4HB9 A;  4JY2 A;  1PBB A;  1D7L A;  1Y56 B;  4KPR A;  3ZYX A;  1KSS A;  1NHR A;  5HYM A;  3URH A;  3KA7 A;  5EOW A;  4BJZ A;  4YSH A;  2DKH A;  4LII A;  2V3A A;  2BAC A;  2A89 A;  5FS9 A;  1H7W A;  2JKC A;  1F8R A;  2BA9 A;  2PYX A;  4YTM A;  1GTE A;  4B66 A;  2ZZC A;  3UOZ A;  5JCK A;  3FMW A;  3DJJ A;  4EMJ A;  2BXS A;  5KOW A;  3SGL A;  1KNP A;  2V61 A;  1TYP A;  3Q6J A;  2XFO A;  1IUT A;  3UKH A;  2GR1 A;  1COY A;  3NTD A;  2OAM A;  1E7P A;  4LA1 A;  4APN A;  5KXJ A;  1L0V A;  2B9W A;  3E1T A;  3G5R A;  3DME A;  4Y4N A;  4Z2T A;  4C5O A;  1PBC A;  1QLB A;  4I59 A;  3GDN A;  2C70 A;  2XYO A;  4U8I A;  4GDE A;  4JNQ A;  1N4U A;  2XFN A;  4TM1 A;  2XDO A;  4U2T A;  3SQP A;  4ADW A;  2H89 A;  1CJ4 A;  3DA1 A;  1NHP A;  3M0O A;  1FEB A;  4TM4 A;  1VQW A;  4H2N A;  1JNR A;  3AD9 B;  3VR8 A;  3CPJ G;  4UDQ A;  1D5T A;  3AWI A;  3F8D A;  4U8J A;  2R9Z A;  1E1L A;  4K2X A;  4K8D A;  4B1B A;  1OJ9 A;  3UKF A;  1N4W A;  1LQU A;  1VDC A;  4A7A A;  4DGK A;  4ZCC A;  1B37 A;  3B6D A;  1DXL A;  1GRF A;  1GRT A;  4ICY A;  2GQW A;  5BVA A;  3KD9 A;  1RYI A;  1E6E A;  4A6N A;  1ELI A;  2YLX A;  5FS7 A;  4UDR A;  3OZ2 A;  3NGC X;  5TR3 A;  1PXB A;  4CNK A;  5KVH A;  2CDU A;  1GRA A;  2ZBW A;  2E1M A;  1CBO A;  3LJP A;  3LZX A;  2F5Z A;  5KOX A;  3CPH G;  5U63 A;  2YLZ A;  4IVO B;  3UCL A;  3CGE A;  3UOY A;  3AEF A;  1GND A;  1Q1R A;  2Q0L A;  4Z24 A;  2VRM A;  4C3X A;  2WOI A;  3NG7 X;  3CND A;  4YSX A;  4FDC B;  3AB1 A;  1KDG A;  1JEH A;  1NEK A;  2H88 A;  3UKP A;  2EQ9 A;  4CY8 A;  3IHG A;  3BHF A;  1PJ5 A;  2XCG A;  3AE5 A;  2X8H A;  1F6M A;  3COX A;  1DOC A;  2C3D A;  2XFP A;  3AE9 A;  4YWO A;  4A99 A;  4D03 A;  4U8L A;  5KWF A;  4N9X A;  3ALM A;  3VRA A;  4YXD A;  4REK A;  1P2H A;  2WES A;  3ITJ A;  1AOG A;  4YKG A;  3CTY A;  4EMI A;  3ABV A;  3AE6 A;  4Z2R A;  3NK2 X;  1YQ3 A;  3FBS A;  4H4X A;  4YTP A;  3AD8 B;  3DJE A;  1JRZ A;  4E0V A;  3SFE A;  4EM3 A;  2B76 A;  5HY5 A;  3K30 A;  3K7Q X;  1GER A;  4H4T A;  2R45 A;  1LTX R;  3AE7 A;  3I6D A;  3QVR A;  4PAA A;  2WP6 A;  1XAN A;  2YVJ A;  1IUX A;  3NYC A;  4YSY A;  3ISH A;  1W4X A;  2WP5 A;  5LV9 A;  2X8C A;  1TDF A;  3ADA B;  2YG5 A;  1KNR A;  4CY6 A;  1S3B A;  1E1M A;  1NG4 A;  2B9Y A;  4A6N B;  4EQS A;  1ZX9 A;  1PXC A;  1ZOY A;  2R4J A;  1JOA A;  3P4R A;  5EB4 A;  4A79 A;  2JB2 A;  1EBD A;  4TLZ A;  4AOX A;  2C75 A;  1DNC A;  3EPT A;  4NEV A;  4CCQ A;  2XLT A;  5CKU A;  1GV4 A;  2XFQ A;  1OJT A;  2GF3 A;  4J34 A;  3QSM A;  1BZL A;  4HA6 A;  2OA1 A;  3IC9 A;  4UDP A;  3ALL A;  1K4Q A;  3PO7 A;  3QJ4 A;  2WU5 A;  3CGD A;  2WDQ A;  2YWL A;  1H7X A;  3FIM B;  4FK1 A;  4JNA A;  2EQ7 A;  2GR3 A;  4I58 A;  1PBF A;  1TDE A;  2PHH A;  5C2T A;  2CUL A;  3VQR A;  4U2L A;  2X8G A;  3KU9 A;  3VRB A;  1FEA A;  4EQX A;  1NG3 A;  2BS2 A;  2R4E A;  3G5S A;  3SM8 A;  4YSZ A;  4EIP A;  2WET A;  2GVC A;  4D04 A;  1GSN A;  2NPX A;  4X9M A;  2V60 A;  1H82 A;  1XHC A;  2BK3 A;  4O5U A;  1LJ1 A;  1TYT A;  2XVH A;  2OLN A;  3AD7 B;  2JAE A;  3BI2 A;  5DBJ A;  4H2Q A;  1E1K A;  2XLR A;  3V76 A;  1GEU A;  3KKJ A;  5L46 A;  2CVJ A;  3NKS A;  2XLS A;  2GH5 A;  3ATQ A;  4J33 A;  2QA1 A;  2NVK X;  1M64 A;  3F8R A;  1REO A;  2Y6Q A;  1YY5 A;  2Y6R A;  2J3N A;  4JDR A;  4OVI A;  1VG9 A;  4H4Q A;  5BUK A;  2YM2 A;  1MOK A;  2WPF A;  4BJY A;  3QSE A;  2R0P A;  1ZP0 A;  2EQ8 A;  3RHA A;  1F8S A;  1IUS A;  2XVJ A;  2YLT A;  2YM1 A;  3NHO X;  1F3P A;  4UP3 A;  1H86 A;  2JB3 A;  1DJQ A;  1GRE A;  1N1P A;  2B7S A;  2FJE A;  2B7R A;  2WQY A;  2VVL A;  4TM0 A;  2VRL A;  2WHD A;  3RP8 A;  4JQ9 A;  2XVF A;  1IJH A;  1SEZ A;  2AQJ A;  4OPL A;  3P4P A;  4NTD A;  1CC4 A;  3DGH A;  3CNJ A;  3RP7 A;  1CL0 A;  3NYF A;  4H4V A;  1NAA A;  2YR5 A;  4IA6 A;  1MO9 A;  1NPX A;  3BHK A;  2XVI A;  3T37 A;  3H4K A;  3FPZ A;  3PVC A;  2BK4 A;  4H50 A;  4IV9 A;  1ONF A;  2TMD A;  4H2P A;  1BGN A;  1O95 A;  3GMB A;  2IID A;  4FX9 A;  3DK4 A;  4DNA A;  5IQ4 A;  4J57 A;  1E1N A;  3UTH A;  4JN9 A;  3JSK A;  3C4N A;  3DK8 A;  4CRT A;  5BRT A;  2GEW A;  3GRS A;  4EMW A;  2VOU A;  3FG2 P;  5BUL A;  1GT8 A;  3L8K A;  3UKL A;  5U25 A;  3UKA A;  4AT0 A;  4BK1 A;  1M6I A;  4B64 A;  3UTG A;  3GWF A;  4ECH A;  4Z44 A;  4Y4M A;  1GPE A;  4TLX A;  2VZ2 A;  1QO8 A;  2RGH A;  1GXF A;  1DOE A;  2IVD A;  3AEB A;  4Z43 A;  4A65 A;  5C3J A;  4AP1 A;  1N4V A;  2AR8 A;  1JRY A;  1P2E A;  2Q6U A;  2W0H A;  2VQ7 A;  2GB0 A;  1ZK7 A;  1EL8 A;  2C64 A;  4NTC A;  3NNE A;  3CIR A;  2WP9 A;  1NDA A;  2C3C A;  2JB1 A;  4RG3 A;  4U8N A;  2V5Z A;  4B67 A;  4RG4 A;  3UP4 A;  2WPE A;  3DK9 A;  3AE4 A;  2OLO A;  1Y0P A;  2V6O A;  3BNM A;  1KFY A;  1YQ4 A;  2YLR A;  2VVM A;  2RGO A;  2R46 A;  4GDP A;  3IF9 A;  3KVE A;  2BK5 A;  3H8I A;  1QJD A;  3CPI G;  5HHF A;  3P4S A;  2YR4 A;  2WEU A;  1VG0 A;  4M52 A;  3GMC A;  4AT2 A;  3QVP A;  1S3E A;  3CN8 A;  5KVI A;  3VRD B;  1L9D A;  2A8X A;  1IUU A;  2FBW A;  4EQW A;  1CHU A;  2BCG G;  2GAH B;  3ICR A;  1YQZ A;  3AE1 A;  3AEC A;  3AED A;  3GD4 A;  1K0L A;  4FK1 C;  3RNM A;  4EIQ A;  4Z2U A;  5U1O A;  4J56 A;  2R0G A;  2Z5X A;  3V3O A;  1NHQ A;  3ICS A;  1FL2 A;  4GF7 A;  1Y56 A;  2VVL G;  2GR0 A;  5M10 A;  5GSN A;  3DJG X;  3EAO A;  1PBE A;  3NN0 X;  1CJ3 A;  2RGJ A;  3NLC A;  4XWR A;  1FOH A;  1BF3 A;  3S5W A;  3LB8 A;  1EL7 A;  3OC4 A;  3NT6 A;  2GRT A;  4OCG A;  1CF3 A;  1CC6 A;  1TDN A;  2JBV A;  3AYL A;  4OPG A;  3DH9 A;  3M13 A;  4C77 A;  1Q9I A;  2ZZB A;  3LZW A;  4J36 A;  2R0C A;  1NEN A;  2YG7 A;  4BK2 A;  1H6V A;  2C73 A;  4H4W A;  3NYE A;  1DOD A;  4KX6 A;  4CNJ A;  4U8K A;  4MJW A;  2XFU A;  3AYI A;  4OPU A;  2XLP A;  3B3R A;  2UZZ A;  2A87 A;  5FS8 A;  4H4R A;  2YVF A;  3NK1 X;  4USR A;  1GAL A;  2YVG A;  1PN0 A;  2EQ6 A;  4P9S A;  2C65 A;  4O5Q A;  3V3N A;  2C72 A;  4ZN0 A;  1CJ2 A;  1CJC A;  5GRT A;  3UOX A;  3EF6 A;  4H4S A;  3NRN A;  2GR2 A;  1YKJ A;  4BV6 A;  1ZOV A;  1PJ6 A;  1F8W A;  2GQF A;  2I0Z A;  3D8X A;  4H4Y A;  5FS6 A;  3I3L A;  3ZDN A;  4AP3 A;  4IVM B;  4BUR A;  3BI5 A;  4USQ A;  3HZL A;  3QFA A;  2C66 A;  3UOV A;  4Z26 A;  1BGJ A;  1D4E A;  1PJ7 A;  3LXD A;  1CC2 A;  1Q1W A;  3DGZ A;  2YLW A;  4X4J A;  5FMH A;  1L9C A;  4OPI A;  4H4U A;  1E39 A;  1RSG A;  4DSG A;  5JCL A;  1V59 A;  2BS3 A;  1PHH A;  3AXB A;  2QCU A;  3RED A;  4RSL A;  3RP6 A;  4H4P A;  3IHM A;  2X3N A;  4B68 A;  3CGC A;  4NTE A;  4YT0 A;  5KRQ A;  2Q7V A;  3NN6 X;  2C67 A;  2YG4 A;  3SFD A;  3K7M X;  2E4G A;  2GV8 A;  3DJD A;  3K7T A;  5IQ1 A;  1JU2 A;  2QAE A;  4K5R A;  1K0J A;  2Q0K A;  4YKF A;  3R9U A;  4GR1 A;  4K7Z A;  1B4V A;  2VQB A;  3G5Q A;  3QFB A;  3BI4 A;  1BKW A;  2YLS A;  1FCD A;  3LOV A;  2ZZ0 A;  4NZH A;  1VRQ B;  2QA2 A;  3F8P A;  3IWA A;  2GMH A;  5CQF A;  4C3Y A;  2BC0 A;  2DKI A;  3GSI A;  1H83 A;  5HXI A;  1PBD A;  4TM3 A;  1BWC A;  1B5Q A;  3ATR A;  4GRT A;  1JRX A;  3AE2 A;  4JY3 A;  4OPD A;  4K5S A;  2TPR A;  4XWZ A;  2BXR A;  5EB5 A;  2XLU A;  4X9N A;  2OAL A;  1PXA A;  2WOV A;  1S2Q A;  4OPC A;  3UTF A;  4B63 A;  1ZMD A;  4AOS A;  1X31 B;  1ZMC A;  5EBK A;  3GRT A;  3CNS A;  1UKV G;  2CFY A;  4WCT A;  2IVE A;  4EM4 A;  1D7Y A;  3GWD A;  1Z6L A;  4DSH A;  1GRH A;  2O9Z A;  3Q9T A;  4NEW A;  3UKQ A;  2X50 A;  2WPC A;  3GYJ A;  1PDH A;  3O0H A;  1PS9 A;  2YG6 A;  3NIX A;  4Y4L A;  1XPQ A;  1O5W A;  4J31 A;  2JK6 A;  2WBA A;  1O94 A;  3LAD A;  3GYI A;  1GRG A;  3S61 A;  3GDP A;  3UKK A;  1L9E A;  1ZY8 A;  3ICT A;  1H81 A;  2FJA A;  2GAG B;  4XXG A;  4A9W A;  5JCM A;  3UP5 A;  1KSU A;  3NK0 X;  1LVL A;  1KF6 A;  4WX1 A;  1DJN A;  3AYJ A;  5J60 A;  1EL5 A;  2FJD A;  5J7X A;  3D1C A;  1OJC A;  4U8O A;  2X99 A;  1H84 A;  3GD3 A;  4IA5 A;  3II4 A;  3P9U A;  3NH3 X;  2ARD A;  3QSS A;  1NHS A;  3C96 A;  4U2S A;  3ALJ A;  4GCM A;  3H8L A;  1OJA A;  4EQR A;  2FJB A;  1EL9 A;  4GUV A;  3WE0 A;  4ZCD A;  2ACZ A;  3M12 A;  4BK3 A;  2BCP A;  1TDO A;  4PAB A;  1IUV A;  1TRB A;  3L1R A;  4YTN A;  3VR9 A;  2APG A;  3NTA A;  2BC1 A;  4B69 A;  1GOS A;  4B65 A;  5IPY A;  2AAQ A;  5JCI A;  4Z25 A;  1FEC A;  3AEA A;  3P1W A;  4K22 A;  5JCN A;  1HYU A;  1K0I A;  1GRB A;  1RP0 A;  2B9X A;  2BAB A;  4C74 A;  2Z5Y A;  3P4Q A; 
#chains in the Genus database with same CATH topology
 1DOB A;  4CCR A;  4OPT A;  1TDK A;  2RAB A;  3AE8 A;  3KLJ A;  1D4D A;  4CBQ A;  1LQT A;  1GET A;  1GTH A;  2WDV A;  1OJD A;  1ZDL A;  4GAV A;  3C4A A;  1LV0 A;  2YQU A;  2C76 A;  2E5V A;  2C7G A;  4H4Z A;  4A5L A;  1B8S A;  4H2R A;  5M0Z A;  3BNU A;  3CNP A;  4G6H A;  3T31 A;  2WOW A;  2WS3 A;  3KPF A;  1S2Y A;  4J2W A;  3PS9 A;  1ZKQ A;  2BYB A;  2WDR A;  3AE3 A;  5ER0 A;  2V3B A;  1D4C A;  4H7U A;  1LPF A;  2YG3 A;  3AEE A;  3EAN A;  4U8M A;  2GMJ A;  3UTE A;  3CGB A;  1XDI A;  2HQM A;  2YR6 A;  3CNT A;  2BS4 A;  2WU2 A;  4U8P A;  4LU6 A;  2YAU A;  1GES A;  1MXT A;  2XVE A;  1IUW A;  1JNZ A;  3AEG A;  4HB9 A;  4JY2 A;  1PBB A;  1D7L A;  1Y56 B;  4KPR A;  3ZYX A;  1KSS A;  1NHR A;  5HYM A;  3URH A;  3KA7 A;  5EOW A;  4BJZ A;  4YSH A;  2DKH A;  3SZW A;  4LII A;  2V3A A;  2BAC A;  2A89 A;  3SXI A;  5FS9 A;  1H7W A;  2JKC A;  1F8R A;  2BA9 A;  2PYX A;  4YTM A;  1GTE A;  4B66 A;  2ZZC A;  3UOZ A;  5JCK A;  3FMW A;  3DJJ A;  4EMJ A;  2BXS A;  5KOW A;  3SGL A;  1KNP A;  2V61 A;  3T2Y A;  1TYP A;  3Q6J A;  2XFO A;  1IUT A;  3UKH A;  3HYV A;  2GR1 A;  1COY A;  3NTD A;  2OAM A;  1E7P A;  4LA1 A;  4APN A;  5KXJ A;  1L0V A;  2B9W A;  3E1T A;  4G9K A;  3G5R A;  3DME A;  4Y4N A;  4Z2T A;  4C5O A;  1PBC A;  1QLB A;  4I59 A;  3GDN A;  2C70 A;  2XYO A;  4U8I A;  4GDE A;  4JNQ A;  1N4U A;  2XFN A;  4TM1 A;  2XDO A;  4U2T A;  3SQP A;  4ADW A;  2H89 A;  1CJ4 A;  3DA1 A;  1NHP A;  3M0O A;  1FEB A;  4TM4 A;  1VQW A;  4H2N A;  1JNR A;  3AD9 B;  3VR8 A;  3CPJ G;  4UDQ A;  1D5T A;  3AWI A;  3F8D A;  4U8J A;  2R9Z A;  1E1L A;  4K2X A;  4K8D A;  4B1B A;  1OJ9 A;  3UKF A;  1N4W A;  1LQU A;  1VDC A;  4A7A A;  4DGK A;  4ZCC A;  1B37 A;  3B6D A;  1DXL A;  1GRF A;  1GRT A;  4ICY A;  2GQW A;  4GAP A;  5BVA A;  3KD9 A;  1RYI A;  1E6E A;  4G74 A;  4A6N A;  1ELI A;  2YLX A;  5FS7 A;  4UDR A;  3OZ2 A;  3SX6 A;  3NGC X;  5TR3 A;  1PXB A;  4CNK A;  5KVH A;  2CDU A;  1GRA A;  4NWZ A;  2ZBW A;  2E1M A;  1CBO A;  3LJP A;  3LZX A;  2F5Z A;  5KOX A;  3CPH G;  5U63 A;  2YLZ A;  4IVO B;  3UCL A;  3CGE A;  3UOY A;  3AEF A;  1GND A;  1Q1R A;  2Q0L A;  4Z24 A;  2VRM A;  4C3X A;  2WOI A;  3NG7 X;  3CND A;  4YSX A;  4FDC B;  3AB1 A;  2BRA A;  1KDG A;  1JEH A;  1NEK A;  2H88 A;  3UKP A;  2EQ9 A;  4CY8 A;  3IHG A;  3BHF A;  1PJ5 A;  2XCG A;  3AE5 A;  2X8H A;  1F6M A;  3COX A;  1DOC A;  2C3D A;  2XFP A;  3AE9 A;  4G6G A;  4YWO A;  4A99 A;  4U8L A;  5KWF A;  4N9X A;  3ALM A;  3VRA A;  4YXD A;  4REK A;  1P2H A;  2WES A;  3ITJ A;  1AOG A;  4YKG A;  3CTY A;  4EMI A;  3ABV A;  3AE6 A;  4Z2R A;  3NK2 X;  1YQ3 A;  3FBS A;  4H4X A;  4YTP A;  3AD8 B;  3DJE A;  1JRZ A;  4E0V A;  3SFE A;  4EM3 A;  2B76 A;  5HY5 A;  5KMR A;  3K30 A;  3K7Q X;  1GER A;  4H4T A;  2R45 A;  1LTX R;  3AE7 A;  3I6D A;  3QVR A;  4PAA A;  2WP6 A;  1XAN A;  2YVJ A;  1IUX A;  3NYC A;  4YSY A;  3ISH A;  1W4X A;  2WP5 A;  5LV9 A;  2X8C A;  1TDF A;  3ADA B;  2YG5 A;  1KNR A;  4CY6 A;  1S3B A;  1E1M A;  1NG4 A;  2B9Y A;  4A6N B;  4EQS A;  1ZX9 A;  1PXC A;  1ZOY A;  2R4J A;  1JOA A;  3P4R A;  5EB4 A;  4A79 A;  2JB2 A;  1EBD A;  4TLZ A;  4AOX A;  2C75 A;  1DNC A;  3EPT A;  3SZ0 A;  4NEV A;  4CCQ A;  2XLT A;  2C4C A;  5CKU A;  1GV4 A;  2XFQ A;  1OJT A;  2GF3 A;  4G73 A;  4J34 A;  3QSM A;  1BZL A;  4HA6 A;  2OA1 A;  3IC9 A;  4UDP A;  3ALL A;  1K4Q A;  3PO7 A;  3QJ4 A;  2WU5 A;  3CGD A;  2WDQ A;  2YWL A;  1H7X A;  3FIM B;  4FK1 A;  4JNA A;  2EQ7 A;  2GR3 A;  4I58 A;  1PBF A;  1TDE A;  2PHH A;  5C2T A;  2CUL A;  3VQR A;  4U2L A;  2X8G A;  3KU9 A;  3VRB A;  1FEA A;  4EQX A;  1NG3 A;  2BS2 A;  2R4E A;  3G5S A;  3SM8 A;  4YSZ A;  4EIP A;  2WET A;  2GVC A;  4D04 A;  1GSN A;  2NPX A;  4X9M A;  2V60 A;  1H82 A;  1XHC A;  2BK3 A;  4O5U A;  1LJ1 A;  1TYT A;  2XVH A;  2OLN A;  3AD7 B;  2JAE A;  3BI2 A;  3HYW A;  5DBJ A;  4H2Q A;  1E1K A;  2XLR A;  3V76 A;  1GEU A;  3KKJ A;  5L46 A;  2CVJ A;  3NKS A;  2XLS A;  2GH5 A;  3ATQ A;  4J33 A;  2QA1 A;  2NVK X;  1M64 A;  3F8R A;  1REO A;  2Y6Q A;  1YY5 A;  2Y6R A;  2J3N A;  4JDR A;  4OVI A;  1VG9 A;  4H4Q A;  5BUK A;  2YM2 A;  4II3 A;  1MOK A;  2WPF A;  4BJY A;  3QSE A;  2R0P A;  1ZP0 A;  2EQ8 A;  3RHA A;  1F8S A;  1IUS A;  2XVJ A;  2YLT A;  2YM1 A;  3NHO X;  1F3P A;  4UP3 A;  1H86 A;  2JB3 A;  1DJQ A;  1GRE A;  1N1P A;  2B7S A;  2FJE A;  2B7R A;  2WQY A;  2VVL A;  4TM0 A;  2VRL A;  2WHD A;  3RP8 A;  4JQ9 A;  2XVF A;  1IJH A;  1SEZ A;  2AQJ A;  4OPL A;  3P4P A;  4NTD A;  1CC4 A;  3DGH A;  3CNJ A;  3RP7 A;  1CL0 A;  3NYF A;  4H4V A;  1NAA A;  3CMM A;  2YR5 A;  4IA6 A;  1MO9 A;  1NPX A;  3BHK A;  2XVI A;  3T37 A;  3H4K A;  3FPZ A;  3PVC A;  2BK4 A;  5KMQ A;  4H50 A;  4IV9 A;  1ONF A;  2TMD A;  4H2P A;  1BGN A;  1O95 A;  3GMB A;  2IID A;  4FX9 A;  3DK4 A;  4DNA A;  5IQ4 A;  4J57 A;  1E1N A;  3UTH A;  4JN9 A;  3JSK A;  3C4N A;  3DK8 A;  4CRT A;  5BRT A;  2GEW A;  3GRS A;  4EMW A;  2VOU A;  3FG2 P;  5BUL A;  1GT8 A;  3L8K A;  3UKL A;  5U25 A;  3UKA A;  4AT0 A;  4BK1 A;  1M6I A;  4B64 A;  4II2 A;  3T0K A;  3UTG A;  3GWF A;  4ECH A;  4Z44 A;  4Y4M A;  5KMS A;  1GPE A;  4TLX A;  2VZ2 A;  1QO8 A;  2RGH A;  1GXF A;  1DOE A;  2IVD A;  3AEB A;  4Z43 A;  4A65 A;  5C3J A;  4AP1 A;  5KMP A;  1N4V A;  2AR8 A;  1JRY A;  1P2E A;  2Q6U A;  2W0H A;  2VQ7 A;  2GB0 A;  1ZK7 A;  1EL8 A;  2C64 A;  4NTC A;  3NNE A;  3CIR A;  2WP9 A;  1NDA A;  2C3C A;  2JB1 A;  4RG3 A;  4U8N A;  2V5Z A;  4B67 A;  4RG4 A;  3UP4 A;  2WPE A;  3DK9 A;  3AE4 A;  2OLO A;  1Y0P A;  2V6O A;  3BNM A;  1KFY A;  1YQ4 A;  2YLR A;  2VVM A;  2RGO A;  3SZC A;  2R46 A;  4GDP A;  3IF9 A;  3KVE A;  2BK5 A;  3H8I A;  1QJD A;  3CPI G;  5HHF A;  3P4S A;  2YR4 A;  2WEU A;  1VG0 A;  4M52 A;  3GMC A;  4AT2 A;  3QVP A;  1S3E A;  3CN8 A;  5KVI A;  2BRY A;  3VRD B;  1L9D A;  2A8X A;  1IUU A;  2FBW A;  4EQW A;  1CHU A;  2BCG G;  2GAH B;  3ICR A;  1YQZ A;  3AE1 A;  3AEC A;  3AED A;  3GD4 A;  1K0L A;  4FK1 C;  3RNM A;  4EIQ A;  4Z2U A;  5U1O A;  4J56 A;  2R0G A;  2Z5X A;  3V3O A;  1NHQ A;  3ICS A;  1FL2 A;  4GF7 A;  1Y56 A;  2VVL G;  2GR0 A;  5M10 A;  5GSN A;  3DJG X;  3EAO A;  1PBE A;  3NN0 X;  1CJ3 A;  2RGJ A;  3NLC A;  4XWR A;  1FOH A;  1BF3 A;  3S5W A;  3LB8 A;  1EL7 A;  3OC4 A;  3NT6 A;  2GRT A;  4OCG A;  1CF3 A;  1CC6 A;  1TDN A;  2JBV A;  3AYL A;  4OPG A;  3DH9 A;  3M13 A;  4C77 A;  1Q9I A;  2ZZB A;  3LZW A;  4J36 A;  2R0C A;  1NEN A;  2YG7 A;  4BK2 A;  1H6V A;  2C73 A;  4H4W A;  3NYE A;  3T2Z A;  1DOD A;  4KX6 A;  4CNJ A;  4U8K A;  4MJW A;  2XFU A;  3AYI A;  4OPU A;  2XLP A;  3B3R A;  2UZZ A;  2A87 A;  5FS8 A;  4H4R A;  2YVF A;  3NK1 X;  4USR A;  1GAL A;  2YVG A;  1PN0 A;  2EQ6 A;  4P9S A;  2C65 A;  4O5Q A;  3V3N A;  2C72 A;  4ZN0 A;  1CJ2 A;  1CJC A;  5GRT A;  3UOX A;  3EF6 A;  4H4S A;  3NRN A;  2GR2 A;  1YKJ A;  4BV6 A;  1ZOV A;  1PJ6 A;  1F8W A;  2GQF A;  2I0Z A;  3D8X A;  4H4Y A;  5FS6 A;  3I3L A;  3ZDN A;  4AP3 A;  4IVM B;  4BUR A;  3BI5 A;  4USQ A;  3HZL A;  3QFA A;  2C66 A;  3UOV A;  4Z26 A;  1BGJ A;  1D4E A;  1PJ7 A;  3LXD A;  1CC2 A;  1Q1W A;  3DGZ A;  2YLW A;  4X4J A;  5FMH A;  1L9C A;  4OPI A;  4H4U A;  1E39 A;  1RSG A;  4DSG A;  5JCL A;  1V59 A;  2BS3 A;  1PHH A;  3AXB A;  2QCU A;  3RED A;  4RSL A;  3RP6 A;  4H4P A;  3IHM A;  2X3N A;  4B68 A;  3CGC A;  4NTE A;  4YT0 A;  5KRQ A;  2Q7V A;  3NN6 X;  2C67 A;  2YG4 A;  3SFD A;  3K7M X;  2E4G A;  2GV8 A;  3DJD A;  3K7T A;  5IQ1 A;  3T14 A;  1JU2 A;  2QAE A;  4K5R A;  1K0J A;  2Q0K A;  4YKF A;  3R9U A;  4D03 A;  3SZF A;  4GR1 A;  4K7Z A;  1B4V A;  2VQB A;  3KPK A;  3G5Q A;  3QFB A;  3BI4 A;  1BKW A;  2YLS A;  1FCD A;  3LOV A;  2ZZ0 A;  4NZH A;  1VRQ B;  2QA2 A;  3F8P A;  3IWA A;  2GMH A;  5CQF A;  4C3Y A;  5KNL A;  2BC0 A;  2DKI A;  3GSI A;  1H83 A;  5HXI A;  1PBD A;  4TM3 A;  1BWC A;  1B5Q A;  3ATR A;  4GRT A;  1JRX A;  3AE2 A;  4JY3 A;  4OPD A;  4K5S A;  2TPR A;  4XWZ A;  2BXR A;  4NNJ A;  5EB5 A;  2XLU A;  4X9N A;  2OAL A;  3GYX A;  1PXA A;  2WOV A;  1S2Q A;  4OPC A;  3UTF A;  4B63 A;  1ZMD A;  4AOS A;  1X31 B;  1ZMC A;  5EBK A;  3GRT A;  3CNS A;  1UKV G;  2CFY A;  4WCT A;  3SYI A;  2IVE A;  4EM4 A;  1D7Y A;  3GWD A;  1Z6L A;  4DSH A;  1GRH A;  2O9Z A;  3Q9T A;  4NEW A;  3UKQ A;  2X50 A;  2WPC A;  3GYJ A;  1PDH A;  3O0H A;  1PS9 A;  2YG6 A;  3NIX A;  4Y4L A;  1XPQ A;  1O5W A;  4J31 A;  2JK6 A;  2WBA A;  1O94 A;  3LAD A;  3GYI A;  1GRG A;  3S61 A;  3GDP A;  3UKK A;  1L9E A;  1ZY8 A;  3ICT A;  1H81 A;  2FJA A;  2GAG B;  4XXG A;  4A9W A;  5JCM A;  3UP5 A;  1KSU A;  3NK0 X;  1LVL A;  1KF6 A;  4WX1 A;  1DJN A;  3AYJ A;  5J60 A;  1EL5 A;  2FJD A;  5J7X A;  3T2K A;  3D1C A;  1OJC A;  4U8O A;  2X99 A;  1H84 A;  3GD3 A;  4IA5 A;  3II4 A;  3P9U A;  3NH3 X;  2ARD A;  3QSS A;  1NHS A;  3C96 A;  4U2S A;  3ALJ A;  4GCM A;  3H8L A;  1OJA A;  4EQR A;  2FJB A;  1EL9 A;  4GUV A;  3WE0 A;  4ZCD A;  2ACZ A;  3M12 A;  4BK3 A;  2BCP A;  1TDO A;  4PAB A;  3HYX A;  1IUV A;  1TRB A;  3L1R A;  4YTN A;  3VR9 A;  2APG A;  3NTA A;  2BC1 A;  4B69 A;  1GOS A;  4B65 A;  5IPY A;  2AAQ A;  3SY4 A;  5JCI A;  4Z25 A;  1FEC A;  3AEA A;  3P1W A;  4K22 A;  5JCN A;  1HYU A;  1K0I A;  1GRB A;  1RP0 A;  2B9X A;  2BAB A;  4C74 A;  2Z5Y A;  3P4Q A; 
#chains in the Genus database with same CATH homology
 1DOB A;  4CCR A;  4OPT A;  1TDK A;  2RAB A;  3AE8 A;  3KLJ A;  1D4D A;  4CBQ A;  1LQT A;  1GET A;  1GTH A;  2WDV A;  1OJD A;  1ZDL A;  4GAV A;  3C4A A;  1LV0 A;  2YQU A;  2C76 A;  2E5V A;  2C7G A;  4H4Z A;  4A5L A;  1B8S A;  4H2R A;  5M0Z A;  3BNU A;  3CNP A;  4G6H A;  3T31 A;  2WOW A;  2WS3 A;  3KPF A;  1S2Y A;  4J2W A;  3PS9 A;  1ZKQ A;  2BYB A;  2WDR A;  3AE3 A;  5ER0 A;  2V3B A;  1D4C A;  4H7U A;  1LPF A;  2YG3 A;  3AEE A;  3EAN A;  4U8M A;  2GMJ A;  3UTE A;  3CGB A;  1XDI A;  2HQM A;  2YR6 A;  3CNT A;  2BS4 A;  2WU2 A;  4U8P A;  4LU6 A;  2YAU A;  1GES A;  1MXT A;  2XVE A;  1IUW A;  1JNZ A;  3AEG A;  4HB9 A;  4JY2 A;  1PBB A;  1D7L A;  1Y56 B;  4KPR A;  3ZYX A;  1KSS A;  1NHR A;  5HYM A;  3URH A;  3KA7 A;  5EOW A;  4BJZ A;  4YSH A;  2DKH A;  3SZW A;  4LII A;  2V3A A;  2BAC A;  2A89 A;  3SXI A;  5FS9 A;  1H7W A;  2JKC A;  1F8R A;  2BA9 A;  2PYX A;  4YTM A;  1GTE A;  4B66 A;  2ZZC A;  3UOZ A;  5JCK A;  3FMW A;  3DJJ A;  4EMJ A;  2BXS A;  5KOW A;  3SGL A;  1KNP A;  2V61 A;  3T2Y A;  1TYP A;  3Q6J A;  2XFO A;  1IUT A;  3UKH A;  3HYV A;  2GR1 A;  1COY A;  3NTD A;  2OAM A;  1E7P A;  4LA1 A;  4APN A;  5KXJ A;  1L0V A;  2B9W A;  3E1T A;  4G9K A;  3G5R A;  3DME A;  4Y4N A;  4Z2T A;  4C5O A;  1PBC A;  1QLB A;  4I59 A;  3GDN A;  2C70 A;  2XYO A;  4U8I A;  4GDE A;  4JNQ A;  1N4U A;  2XFN A;  4TM1 A;  2XDO A;  4U2T A;  3SQP A;  4ADW A;  2H89 A;  1CJ4 A;  3DA1 A;  1NHP A;  3M0O A;  1FEB A;  4TM4 A;  1VQW A;  4H2N A;  1JNR A;  3AD9 B;  3VR8 A;  3CPJ G;  4UDQ A;  1D5T A;  3AWI A;  3F8D A;  4U8J A;  2R9Z A;  1E1L A;  4K2X A;  4K8D A;  4B1B A;  1OJ9 A;  3UKF A;  1N4W A;  1LQU A;  1VDC A;  4A7A A;  4DGK A;  4ZCC A;  1B37 A;  3B6D A;  1DXL A;  1GRF A;  1GRT A;  4ICY A;  2GQW A;  4GAP A;  5BVA A;  3KD9 A;  1RYI A;  1E6E A;  4G74 A;  4A6N A;  1ELI A;  2YLX A;  5FS7 A;  4UDR A;  3OZ2 A;  3SX6 A;  3NGC X;  5TR3 A;  1PXB A;  4CNK A;  5KVH A;  2CDU A;  1GRA A;  4NWZ A;  2ZBW A;  2E1M A;  1CBO A;  3LJP A;  3LZX A;  2F5Z A;  5KOX A;  3CPH G;  5U63 A;  2YLZ A;  4IVO B;  3UCL A;  3CGE A;  3UOY A;  3AEF A;  1GND A;  1Q1R A;  2Q0L A;  4Z24 A;  2VRM A;  4C3X A;  2WOI A;  3NG7 X;  3CND A;  4YSX A;  4FDC B;  3AB1 A;  2BRA A;  1KDG A;  1JEH A;  1NEK A;  2H88 A;  3UKP A;  2EQ9 A;  4CY8 A;  3IHG A;  3BHF A;  1PJ5 A;  2XCG A;  3AE5 A;  2X8H A;  1F6M A;  3COX A;  1DOC A;  2C3D A;  2XFP A;  3AE9 A;  4G6G A;  4YWO A;  4A99 A;  4U8L A;  5KWF A;  4N9X A;  3ALM A;  3VRA A;  4YXD A;  4REK A;  1P2H A;  2WES A;  3ITJ A;  1AOG A;  4YKG A;  3CTY A;  4EMI A;  3ABV A;  3AE6 A;  4Z2R A;  3NK2 X;  1YQ3 A;  3FBS A;  4H4X A;  4YTP A;  3AD8 B;  3DJE A;  1JRZ A;  4E0V A;  3SFE A;  4EM3 A;  2B76 A;  5HY5 A;  5KMR A;  3K30 A;  3K7Q X;  1GER A;  4H4T A;  2R45 A;  1LTX R;  3AE7 A;  3I6D A;  3QVR A;  4PAA A;  2WP6 A;  1XAN A;  2YVJ A;  1IUX A;  3NYC A;  4YSY A;  3ISH A;  1W4X A;  2WP5 A;  5LV9 A;  2X8C A;  1TDF A;  3ADA B;  2YG5 A;  1KNR A;  4CY6 A;  1S3B A;  1E1M A;  1NG4 A;  2B9Y A;  4A6N B;  4EQS A;  1ZX9 A;  1PXC A;  1ZOY A;  2R4J A;  1JOA A;  3P4R A;  5EB4 A;  4A79 A;  2JB2 A;  1EBD A;  4TLZ A;  4AOX A;  2C75 A;  1DNC A;  3EPT A;  3SZ0 A;  4NEV A;  4CCQ A;  2XLT A;  2C4C A;  5CKU A;  1GV4 A;  2XFQ A;  1OJT A;  2GF3 A;  4G73 A;  4J34 A;  3QSM A;  1BZL A;  4HA6 A;  2OA1 A;  3IC9 A;  4UDP A;  3ALL A;  1K4Q A;  3PO7 A;  3QJ4 A;  2WU5 A;  3CGD A;  2WDQ A;  2YWL A;  1H7X A;  3FIM B;  4FK1 A;  4JNA A;  2EQ7 A;  2GR3 A;  4I58 A;  1PBF A;  1TDE A;  2PHH A;  5C2T A;  2CUL A;  3VQR A;  4U2L A;  2X8G A;  3KU9 A;  3VRB A;  1FEA A;  4EQX A;  1NG3 A;  2BS2 A;  2R4E A;  3G5S A;  3SM8 A;  4YSZ A;  4EIP A;  2WET A;  2GVC A;  4D04 A;  1GSN A;  2NPX A;  4X9M A;  2V60 A;  1H82 A;  1XHC A;  2BK3 A;  4O5U A;  1LJ1 A;  1TYT A;  2XVH A;  2OLN A;  3AD7 B;  2JAE A;  3BI2 A;  3HYW A;  5DBJ A;  4H2Q A;  1E1K A;  2XLR A;  3V76 A;  1GEU A;  3KKJ A;  5L46 A;  2CVJ A;  3NKS A;  2XLS A;  2GH5 A;  3ATQ A;  4J33 A;  2QA1 A;  2NVK X;  1M64 A;  3F8R A;  1REO A;  2Y6Q A;  1YY5 A;  2Y6R A;  2J3N A;  4JDR A;  4OVI A;  1VG9 A;  4H4Q A;  5BUK A;  2YM2 A;  4II3 A;  1MOK A;  2WPF A;  4BJY A;  3QSE A;  2R0P A;  1ZP0 A;  2EQ8 A;  3RHA A;  1F8S A;  1IUS A;  2XVJ A;  2YLT A;  2YM1 A;  3NHO X;  1F3P A;  4UP3 A;  1H86 A;  2JB3 A;  1DJQ A;  1GRE A;  1N1P A;  2B7S A;  2FJE A;  2B7R A;  2WQY A;  2VVL A;  4TM0 A;  2VRL A;  2WHD A;  3RP8 A;  4JQ9 A;  2XVF A;  1IJH A;  1SEZ A;  2AQJ A;  4OPL A;  3P4P A;  4NTD A;  1CC4 A;  3DGH A;  3CNJ A;  3RP7 A;  1CL0 A;  3NYF A;  4H4V A;  1NAA A;  3CMM A;  2YR5 A;  4IA6 A;  1MO9 A;  1NPX A;  3BHK A;  2XVI A;  3T37 A;  3H4K A;  3FPZ A;  3PVC A;  2BK4 A;  5KMQ A;  4H50 A;  4IV9 A;  1ONF A;  2TMD A;  4H2P A;  1BGN A;  1O95 A;  3GMB A;  2IID A;  4FX9 A;  3DK4 A;  4DNA A;  5IQ4 A;  4J57 A;  1E1N A;  3UTH A;  4JN9 A;  3JSK A;  3C4N A;  3DK8 A;  4CRT A;  5BRT A;  2GEW A;  3GRS A;  4EMW A;  2VOU A;  3FG2 P;  5BUL A;  1GT8 A;  3L8K A;  3UKL A;  5U25 A;  3UKA A;  4AT0 A;  4BK1 A;  1M6I A;  4B64 A;  4II2 A;  3T0K A;  3UTG A;  3GWF A;  4ECH A;  4Z44 A;  4Y4M A;  5KMS A;  1GPE A;  4TLX A;  2VZ2 A;  1QO8 A;  2RGH A;  1GXF A;  1DOE A;  2IVD A;  3AEB A;  4Z43 A;  4A65 A;  5C3J A;  4AP1 A;  5KMP A;  1N4V A;  2AR8 A;  1JRY A;  1P2E A;  2Q6U A;  2W0H A;  2VQ7 A;  2GB0 A;  1ZK7 A;  1EL8 A;  2C64 A;  4NTC A;  3NNE A;  3CIR A;  2WP9 A;  1NDA A;  2C3C A;  2JB1 A;  4RG3 A;  4U8N A;  2V5Z A;  4B67 A;  4RG4 A;  3UP4 A;  2WPE A;  3DK9 A;  3AE4 A;  2OLO A;  1Y0P A;  2V6O A;  3BNM A;  1KFY A;  1YQ4 A;  2YLR A;  2VVM A;  2RGO A;  3SZC A;  2R46 A;  4GDP A;  3IF9 A;  3KVE A;  2BK5 A;  3H8I A;  1QJD A;  3CPI G;  5HHF A;  3P4S A;  2YR4 A;  2WEU A;  1VG0 A;  4M52 A;  3GMC A;  4AT2 A;  3QVP A;  1S3E A;  3CN8 A;  5KVI A;  2BRY A;  3VRD B;  1L9D A;  2A8X A;  1IUU A;  2FBW A;  4EQW A;  1CHU A;  2BCG G;  2GAH B;  3ICR A;  1YQZ A;  3AE1 A;  3AEC A;  3AED A;  3GD4 A;  1K0L A;  4FK1 C;  3RNM A;  4EIQ A;  4Z2U A;  5U1O A;  4J56 A;  2R0G A;  2Z5X A;  3V3O A;  1NHQ A;  3ICS A;  1FL2 A;  4GF7 A;  1Y56 A;  2VVL G;  2GR0 A;  5M10 A;  5GSN A;  3DJG X;  3EAO A;  1PBE A;  3NN0 X;  1CJ3 A;  2RGJ A;  3NLC A;  4XWR A;  1FOH A;  1BF3 A;  3S5W A;  3LB8 A;  1EL7 A;  3OC4 A;  3NT6 A;  2GRT A;  4OCG A;  1CF3 A;  1CC6 A;  1TDN A;  2JBV A;  3AYL A;  4OPG A;  3DH9 A;  3M13 A;  4C77 A;  1Q9I A;  2ZZB A;  3LZW A;  4J36 A;  2R0C A;  1NEN A;  2YG7 A;  4BK2 A;  1H6V A;  2C73 A;  4H4W A;  3NYE A;  3T2Z A;  1DOD A;  4KX6 A;  4CNJ A;  4U8K A;  4MJW A;  2XFU A;  3AYI A;  4OPU A;  2XLP A;  3B3R A;  2UZZ A;  2A87 A;  5FS8 A;  4H4R A;  2YVF A;  3NK1 X;  4USR A;  1GAL A;  2YVG A;  1PN0 A;  2EQ6 A;  4P9S A;  2C65 A;  4O5Q A;  3V3N A;  2C72 A;  4ZN0 A;  1CJ2 A;  1CJC A;  5GRT A;  3UOX A;  3EF6 A;  4H4S A;  3NRN A;  2GR2 A;  1YKJ A;  4BV6 A;  1ZOV A;  1PJ6 A;  1F8W A;  2GQF A;  2I0Z A;  3D8X A;  4H4Y A;  5FS6 A;  3I3L A;  3ZDN A;  4AP3 A;  4IVM B;  4BUR A;  3BI5 A;  4USQ A;  3HZL A;  3QFA A;  2C66 A;  3UOV A;  4Z26 A;  1BGJ A;  1D4E A;  1PJ7 A;  3LXD A;  1CC2 A;  1Q1W A;  3DGZ A;  2YLW A;  4X4J A;  5FMH A;  1L9C A;  4OPI A;  4H4U A;  1E39 A;  1RSG A;  4DSG A;  5JCL A;  1V59 A;  2BS3 A;  1PHH A;  3AXB A;  2QCU A;  3RED A;  4RSL A;  3RP6 A;  4H4P A;  3IHM A;  2X3N A;  4B68 A;  3CGC A;  4NTE A;  4YT0 A;  5KRQ A;  2Q7V A;  3NN6 X;  2C67 A;  2YG4 A;  3SFD A;  3K7M X;  2E4G A;  2GV8 A;  3DJD A;  3K7T A;  5IQ1 A;  3T14 A;  1JU2 A;  2QAE A;  4K5R A;  1K0J A;  2Q0K A;  4YKF A;  3R9U A;  4D03 A;  3SZF A;  4GR1 A;  4K7Z A;  1B4V A;  2VQB A;  3KPK A;  3G5Q A;  3QFB A;  3BI4 A;  1BKW A;  2YLS A;  1FCD A;  3LOV A;  2ZZ0 A;  4NZH A;  1VRQ B;  2QA2 A;  3F8P A;  3IWA A;  2GMH A;  5CQF A;  4C3Y A;  5KNL A;  2BC0 A;  2DKI A;  3GSI A;  1H83 A;  5HXI A;  1PBD A;  4TM3 A;  1BWC A;  1B5Q A;  3ATR A;  4GRT A;  1JRX A;  3AE2 A;  4JY3 A;  4OPD A;  4K5S A;  2TPR A;  4XWZ A;  2BXR A;  4NNJ A;  5EB5 A;  2XLU A;  4X9N A;  2OAL A;  3GYX A;  1PXA A;  2WOV A;  1S2Q A;  4OPC A;  3UTF A;  4B63 A;  1ZMD A;  4AOS A;  1X31 B;  1ZMC A;  5EBK A;  3GRT A;  3CNS A;  1UKV G;  2CFY A;  4WCT A;  3SYI A;  2IVE A;  4EM4 A;  1D7Y A;  3GWD A;  1Z6L A;  4DSH A;  1GRH A;  2O9Z A;  3Q9T A;  4NEW A;  3UKQ A;  2X50 A;  2WPC A;  3GYJ A;  1PDH A;  3O0H A;  1PS9 A;  2YG6 A;  3NIX A;  4Y4L A;  1XPQ A;  1O5W A;  4J31 A;  2JK6 A;  2WBA A;  1O94 A;  3LAD A;  3GYI A;  1GRG A;  3S61 A;  3GDP A;  3UKK A;  1L9E A;  1ZY8 A;  3ICT A;  1H81 A;  2FJA A;  2GAG B;  4XXG A;  4A9W A;  5JCM A;  3UP5 A;  1KSU A;  3NK0 X;  1LVL A;  1KF6 A;  4WX1 A;  1DJN A;  3AYJ A;  5J60 A;  1EL5 A;  2FJD A;  5J7X A;  3T2K A;  3D1C A;  1OJC A;  4U8O A;  2X99 A;  1H84 A;  3GD3 A;  4IA5 A;  3II4 A;  3P9U A;  3NH3 X;  2ARD A;  3QSS A;  1NHS A;  3C96 A;  4U2S A;  3ALJ A;  4GCM A;  3H8L A;  1OJA A;  4EQR A;  2FJB A;  1EL9 A;  4GUV A;  3WE0 A;  4ZCD A;  2ACZ A;  3M12 A;  4BK3 A;  2BCP A;  1TDO A;  4PAB A;  3HYX A;  1IUV A;  1TRB A;  3L1R A;  4YTN A;  3VR9 A;  2APG A;  3NTA A;  2BC1 A;  4B69 A;  1GOS A;  4B65 A;  5IPY A;  2AAQ A;  3SY4 A;  5JCI A;  4Z25 A;  1FEC A;  3AEA A;  3P1W A;  4K22 A;  5JCN A;  1HYU A;  1K0I A;  1GRB A;  1RP0 A;  2B9X A;  2BAB A;  4C74 A;  2Z5Y A;  3P4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...