2XVHA

Crystal structure of bacterial flavin containing monooxygenase in complex with nadp
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 161
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA02
4TM0A 5M0ZA 1D7LA 3CGEA 3QVPA 4JY3A 5CQFA 2CULA 1H6VA 4OPUA 5JCKA 2OLOA 4B66A 1S2YA 4H4QA 4AT2A 2GAGB 4NEVA 3M13A 2X8CA 3DK8A 3SGLA 1FL2A 2WU2A 3UOZA 4CRTA 4X4JA 3D1CA 5JCMA 2YVFA 4BURA 1LQUA 5HXIA 4EMJA 3DH9A 1Q1RA 3BHFA 4Z2RA 4A9WA 2GR3A 4X9NA 1OJAA 3UTHA 4A79A 5KOWA 4EQWA 2A89A 1NHSA 2VRMA 2RGOA 4NTEA 2GQFA 1GT8A 2BA9A 4Y4MA 2VQBA 3BI4A 3OC4A 5LV9A 4YTMA 1H7XA 3KD9A 3AYIA 3L8KA 3UCLA 1DOBA 3IHGA 5BULA 1IUTA 2OA1A 2QA2A 1CHUA 4WCTA 2VVMA 2FJEA 2X8GA 5FMHA 4LU6A 2BYBA 2IIDA 2RGJA 2C67A 1JRYA 3UKFA 1NHPA 1LJ1A 3UKAA 2YLRA 3UTGA 1O95A 4ADWA 4BJZA 2YVGA 1E1LA 2XLRA 1PDHA 1H81A 1NEKA 3ALJA 2WETA 2VVLA 3LADA 3ZYXA 2VVLG 2C75A 4EQXA 1B8SA 4B1BA 1KSSA 2XYOA 2ZBWA 3G5SA 3CGBA 4EM4A 2C66A 2NPXA 3DGZA 1XPQA 3NTAA 3VRDB 3ZDNA 3C96A 4ECHA 3AD9B 3NHOX 4O5QA 1TYTA 3DGHA 2H89A 2EQ8A 2FJBA 1UKVG 5HHFA 2RGHA 3KU9A 3BI5A 2YLZA 4X9MA 4GRTA 4Y4NA 3B3RA 2YG6A 4ZN0A 5J60A 2C3CA 5BUKA 2YVJA 1BKWA 1CJCA 1GTEA 1V59A 1CJ3A 1OJTA 1XANA 3AEGA 3M0OA 4J56A 4JNAA 1F8WA 2Y6QA 2YG4A 4J33A 4WX1A 4DSGA 3AD7B 3DMEA 2J3NA 3G5QA 1B37A 1LPFA 1M6IA 3NK1X 3AE3A 4CY8A 5JCLA 2GR2A 2GVCA 2TMDA 1F6MA 4IVMB 3QVRA 3AE6A 2WHDA 2VQ7A 4CCRA 4CNKA 4YTPA 1E7PA 2XLUA 4H4TA 1GV4A 2XFOA 3CNTA 4K5SA 1L9EA 4H7UA 4H2QA 4NZHA 4UDQA 4USRA 4D03A 2YQUA 3CIRA 2BXRA 1Q1WA 4JDRA 1D5TA 1PBFA 1L0VA 3AE1A 3UTEA 2JKCA 2F5ZA 3AEDA 2A8XA 2R0PA 3NH3X 1PBDA 2X3NA 5KRQA 4U2SA 3IF9A 2YR6A 1H86A 3AE4A 4YXDA 4I58A 2FJDA 2R4EA 1ZDLA 2GF3A 3DJJA 1F8SA 4RG3A 2XVFA 1PBCA 4YSYA 3ICSA 5KWFA 1VDCA 1GTHA 4LIIA 5J7XA 1N1PA 1YQ4A 2WPCA 1GRFA 4I59A 2WU5A 3DA1A 4YKGA 4J36A 2XLTA 1PXAA 4H4UA 3KLJA 3LZWA 1L9CA 1IUWA 2GMHA 4Z2TA 3EPTA 4JN9A 3UKLA 4CBQA 4OPIA 1X31B 4P9SA 2A87A 3RP7A 4DNAA 1K0IA 2YWLA 1H83A 3REDA 3H4KA 2PYXA 4E0VA 2IVDA 3AYLA 1YQZA 1F8RA 3NT6A 1ZX9A 4YSZA 3IWAA 1ZOYA 2Z5YA 4K7ZA 4PAAA 1IUUA 2APGA 3NYCA 1PBBA 2GR1A 3QJ4A 2E4GA 1LTXR 1KSUA 5JCIA 5GSNA 4FX9A 4Z2UA 1H82A 1Y0PA 2C72A 1KNRA 1GERA 4REKA 5FS9A 3CGDA 1MO9A 3JSKA 4GCMA 3UOYA 1FEAA 1ONFA 3RNMA 3ALMA 5FS8A 1CF3A 4B65A 3S61A 1Z6LA 1IUXA 2B9WA 2YG7A 3AD8B 3K30A 3NIXA 3P4RA 5EB4A 3GDPA 3ICRA 3S5WA 2BS3A 1CC4A 3CPIG 3PS9A 3QFAA 4GR1A 4ZCCA 4Z43A 1JRXA 2EQ7A 3Q6JA 4RG4A 2OAMA 3SFDA 3I3LA 4OPLA 2R45A 1PHHA 2CVJA 3ITJA 4NEWA 2H88A 2GRTA 4KPRA 1KNPA 2EQ6A 1GPEA 2E5VA 3WE0A 1QJDA 2WPEA 2WP5A 3ABVA 2DKHA 4H4SA 5DBJA 2V6OA 4J57A 2JB1A 1DOCA 2CFYA 3I6DA 2WQYA 4IA6A 3UKQA 2WBAA 2JB3A 1YQ3A 2WP6A 4FK1A 4GDEA 2X8HA 1FOHA 2BCGG 2UZZA 4H2PA 4U8JA 5KVHA 4NTDA 4IV9A 1ZY8A 3M12A 5EOWA 4APNA 2XVEA 3QSSA 1SEZA 2YLXA 4B68A 1GETA 1VG0A 2WDQA 2YG5A 2BS2A 2GV8A 2BACA 4U8KA 2XFQA 3P4SA 1YKJA 2WEUA 1ZK7A 2AR8A 2JK6A 4M52A 3Q9TA 4USQA 2YR4A 1P2EA 4C3YA 1PJ6A 1TDKA 4HA6A 4UDPA 3P4PA 2B76A 4U2LA 4Y4LA 2BXSA 3C4AA 4ZCDA 1IUSA 3K7QX 4TM3A 2GR0A 3C4NA 5JCNA 3CGCA 3GSIA 4XWZA 5KXJA 1O94A 4H4YA 1LQTA 4OCGA 3EAOA 4OPGA 1CJ4A 1GRTA 1Y56A 3UP5A 3IHMA 4GF7A 3L1RA 4JY2A 4H4VA 1O5WA 4H4RA 1GALA 2X99A 1EL7A 3GYJA 1K0LA 4J31A 2E1MA 3EF6A 2Z5XA 1MXTA 1H84A 4K2XA 5CKUA 1E39A 2HQMA 3GRSA 3GDNA 2ACZA 1NHRA 3V76A 5M10A 3PVCA 3UKHA 2GH5A 4OVIA 3KKJA 4TM4A 1PXCA 2XLSA 2GMJA 4KX6A 1NPXA 2GAHB 4EM3A 4U2TA 5ER0A 4C74A 1JU2A 1QLBA 3K7TA 1FECA 4YTNA 2WDVA 3P4QA 2GB0A 4XXGA 1NG4A 2JAEA 4A99A 4YT0A 4H2RA 3VRAA 3BNMA 4A6NA 2XFPA 2XDOA 4AP3A 4BJYA 1BF3A 4BK1A 2C65A 5FS6A 4NTCA 4A65A 3AEEA 3LXDA 3FMWA 3COXA 4FDCB 3FBSA 5GRTA 2QA1A 2V60A 2BC1A 3T37A 2QAEA 3LB8A 1E1KA 3F8RA 1RSGA 1GXFA 4HB9A 2C73A 2YM2A 3D8XA 3FPZA 3DJEA 1DJNA 2PHHA 1P2HA 1PS9A 4U8LA 4AT0A 4DSHA 2B7SA 4EMWA 4A5LA 2W0HA 3NG7X 3CPJG 4OPTA 3VQRA 2Y6RA 1HYUA 1RYIA 3H8LA 2BK4A 5L46A 2YM1A 1KFYA 2XLPA 4U8PA 5IQ1A 2OLNA 3AE2A 2XVJA 1JRZA 1H7WA 3CNJA 4C3XA 2WOWA 4FK1C 4D04A 4U8MA 2BABA 3AWIA 4YSXA 4EMIA 3AE9A 3BI2A 3QSMA 4C77A 2R46A 1N4UA 3F8DA 4H4PA 3VR9A 4TLZA 4Z24A 1GRGA 1DJQA 2WESA 2IVEA 1TDFA 3AECA 1ELIA 3B6DA 3CPHG 3ISHA 1GREA 1B4VA 1EBDA 1DOEA 1ZMCA 1GRHA 2EQ9A 2V3AA 4J34A 5IQ4A 3UKPA 3DJGX 4DGKA 1K4QA 1REOA 1GOSA 1NHQA 1B5QA 3NGCX 1TDOA 2C3DA 3AYJA 4CCQA 1OJDA 2XFNA 1IUVA 3ADAB 1FCDA 3GMCA 4XWRA 1E1NA 4EIQA 1TYPA 4H4XA 3RHAA 2I0ZA 4PABA 1NDAA 1GESA 2VOUA 1GRAA 5IPYA 1PJ7A 3NK2X 3G5RA 3RP6A 2XVIA 5C2TA 5U1OA 1PN0A 1DNCA 4K22A 4OPDA 1VQWA 3O0HA 3R9UA 5EBKA 1KF6A 1DODA 2BS4A 1EL8A 2GEWA 3UKKA 2X50A 3AE7A 1ZP0A 1E6EA 1VRQB 3P1WA 2R0GA 2C7GA 4U8IA 3KPFA 3GD4A 1TRBA 1VG9A 2QCUA 3AEAA 4AOSA 2Q7VA 1NAAA 2OALA 1GSNA 3FG2P 4AOXA 3NK0X 3ATRA 5C3JA 1JOAA 1OJ9A 1KDGA 4U8NA 4YKFA 2Q0KA 5BRTA 2VZ2A 1TDNA 3NKSA 3P9UA 1DXLA 1COYA 2YLTA 4UP3A 3URHA 3FIMB 1AOGA 3AEFA 4K5RA 1S2QA 2FJAA 1BGNA 4YWOA 5TR3A 5KVIA 1EL5A 1CL0A 4J2WA 1OJCA 3UOVA 4BK2A 2XFUA 3HZLA 2BC0A 3AE5A 1PXBA 4GDPA 3DJDA 3CNPA 1ZOVA 1CC2A 1EL9A 1JNZA 4H4ZA 3RP8A 2WS3A 1GEUA 3GYIA 4TLXA 4B63A 3KA7A 3GWFA 4JNQA 3GMBA 1YY5A 2NVKX 4A7AA 5BVAA 3V3NA 4AP1A 4EQSA 1QO8A 3AB1A 2WOIA 2WP9A 3CNSA 5U63A 3E1TA 1RP0A 2B9XA 2WOVA 4U8OA 3ALLA 2AQJA 4JQ9A 2R0CA 3NRNA 3OZ2A 3BHKA 3SM8A 2GQWA 2RABA 3VR8A 1N4VA 3NYFA 2ZZ0A 4RSLA 2C64A 2YLWA 2Q6UA 1D7YA 4TM1A 3GD3A 4B64A 5HY5A 2B7RA 2VRLA 3ATQA 2YAUA 1MOKA 4H2NA 1CC6A 1XHCA 4BK3A 2V3BA 2TPRA 2YLSA 1PBEA 2O9ZA 2ZZBA 4O5UA 3SQPA 1JEHA 3UP4A 3UTFA 4K8DA 1L9DA 5FS7A 1JNRA 2FBWA 4H4WA 4Z26A 3NTDA 3LOVA 2BK5A 1XDIA 2R4JA 2C76A 1CJ2A 1K0JA 2XCGA 2YR5A 1D4EA 3VRBA 1M64A 1D4DA 1NENA 2JB2A 3DK4A 4CNJA 3NYEA 4C5OA 2CDUA 4IA5A 1Y56B 3CTYA 3K7MX 3QSEA 4BV6A 3II4A 2ZZCA 3NNEA 4GUVA 3V3OA 4Z25A 2ARDA 4IVOB 3UOXA 4YSHA 5KOXA 1LV0A 3BNUA 3CN8A 3KVEA 4ICYA 4N9XA 3LZXA 1GRBA 2B9YA 4B69A 1Q9IA 3DK9A 4EQRA 2AAQA 3GWDA 3NN0X 3QFBA 4H50A 1FEBA 1CBOA 2WDRA 2V5ZA 1ZMDA 3IC9A 5EB5A 1D4CA 1PJ5A 1N4WA 1BWCA 2V61A 2JBVA 3ICTA 2DKIA 3AEBA 3GRTA 3LJPA 4LA1A 4B67A 2R9ZA 1BGJA 4UDRA 3F8PA 3H8IA 3NLCA 4CY6A 1GNDA 1LVLA 1E1MA 3AXBA 1NG3A 1F3PA 2BCPA 1TDEA 2BK3A 1IJHA 4A6NB 1W4XA 2XVHA 2YG3A 5HYMA 1ZKQA 3CNDA 3PO7A 5U25A 3SFEA 3AE8A 4Z44A 3NN6X 1S3BA 2C70A 1BZLA 4OPCA 2WPFA 3EANA 1S3EA 4MJWA 4EIPA 2Q0LA
chains in the Genus database with same CATH superfamily
4TM0A 5M0ZA 1D7LA 3CGEA 3QVPA 4JY3A 5CQFA 2CULA 1H6VA 4OPUA 5JCKA 2OLOA 4B66A 1S2YA 4H4QA 4AT2A 2GAGB 4GAVA 4NEVA 3M13A 2X8CA 3DK8A 3SGLA 1FL2A 2WU2A 3UOZA 4CRTA 4X4JA 3D1CA 5JCMA 2YVFA 4BURA 1LQUA 5HXIA 4EMJA 3DH9A 1Q1RA 3BHFA 4Z2RA 4A9WA 2GR3A 4X9NA 1OJAA 3UTHA 4A79A 5KOWA 4EQWA 2A89A 1NHSA 2VRMA 2RGOA 4NTEA 2GQFA 1GT8A 2BA9A 4Y4MA 2VQBA 3BI4A 3OC4A 5LV9A 4YTMA 1H7XA 3KD9A 3AYIA 3L8KA 3UCLA 5KNLA 1DOBA 3IHGA 5BULA 1IUTA 2OA1A 2QA2A 1CHUA 4WCTA 2VVMA 2FJEA 2X8GA 5FMHA 4LU6A 2BYBA 2IIDA 2RGJA 2C67A 1JRYA 3UKFA 1NHPA 1LJ1A 3UKAA 2YLRA 3UTGA 1O95A 4ADWA 4BJZA 2YVGA 1E1LA 2XLRA 1PDHA 1H81A 1NEKA 3ALJA 2WETA 2VVLA 3LADA 3ZYXA 2VVLG 2C75A 4EQXA 1B8SA 4B1BA 1KSSA 2XYOA 2ZBWA 3G5SA 3CGBA 4EM4A 2C66A 2NPXA 3DGZA 1XPQA 3NTAA 3VRDB 3ZDNA 3C96A 4ECHA 3AD9B 3NHOX 4O5QA 1TYTA 3DGHA 2H89A 2EQ8A 2FJBA 1UKVG 5HHFA 2RGHA 3KU9A 3BI5A 2YLZA 4X9MA 4GRTA 4Y4NA 3SYIA 3B3RA 2YG6A 4ZN0A 5J60A 2C3CA 5BUKA 2YVJA 1BKWA 1CJCA 1GTEA 1V59A 1CJ3A 1OJTA 1XANA 3AEGA 3M0OA 4J56A 4JNAA 1F8WA 2Y6QA 2YG4A 4J33A 4WX1A 4DSGA 3AD7B 3DMEA 2J3NA 3G5QA 1B37A 1LPFA 1M6IA 3NK1X 3SZFA 3HYVA 3AE3A 4CY8A 5JCLA 2GR2A 2GVCA 2TMDA 1F6MA 4IVMB 3QVRA 3AE6A 4G73A 2WHDA 2VQ7A 4CCRA 4CNKA 4YTPA 1E7PA 2XLUA 4H4TA 1GV4A 3HYWA 2XFOA 3CNTA 4K5SA 1L9EA 4H7UA 4H2QA 4NZHA 4UDQA 4USRA 4D03A 2YQUA 3CIRA 2BXRA 1Q1WA 4JDRA 1D5TA 1PBFA 1L0VA 3AE1A 3UTEA 2JKCA 2F5ZA 3AEDA 2A8XA 2R0PA 3NH3X 1PBDA 2X3NA 5KRQA 4U2SA 3IF9A 2YR6A 1H86A 3AE4A 4YXDA 4GAPA 4I58A 2FJDA 2R4EA 1ZDLA 2GF3A 3DJJA 1F8SA 4RG3A 2XVFA 1PBCA 4YSYA 3ICSA 5KWFA 1VDCA 1GTHA 4LIIA 5J7XA 1N1PA 1YQ4A 2WPCA 1GRFA 4I59A 2WU5A 3DA1A 4YKGA 2C4CA 4J36A 2XLTA 1PXAA 4G6GA 4H4UA 3KLJA 3LZWA 1L9CA 1IUWA 2GMHA 4Z2TA 3EPTA 5KMQA 4JN9A 3UKLA 4CBQA 4OPIA 1X31B 4P9SA 2A87A 3RP7A 4DNAA 1K0IA 2YWLA 1H83A 3REDA 3H4KA 2PYXA 4E0VA 2IVDA 3AYLA 1YQZA 1F8RA 3NT6A 1ZX9A 4YSZA 3IWAA 1ZOYA 2Z5YA 4K7ZA 4PAAA 1IUUA 2APGA 3NYCA 1PBBA 2GR1A 3QJ4A 2E4GA 1LTXR 1KSUA 5JCIA 5GSNA 4FX9A 4Z2UA 1H82A 1Y0PA 2C72A 1KNRA 1GERA 4REKA 5FS9A 3CGDA 1MO9A 3JSKA 4GCMA 3UOYA 1FEAA 1ONFA 3RNMA 3ALMA 5FS8A 1CF3A 4B65A 3S61A 1Z6LA 1IUXA 2B9WA 2YG7A 3AD8B 3K30A 3NIXA 3P4RA 3T31A 5EB4A 3GDPA 3ICRA 3S5WA 2BS3A 1CC4A 3CPIG 3PS9A 3QFAA 4GR1A 4ZCCA 4Z43A 1JRXA 2EQ7A 3Q6JA 4RG4A 2OAMA 3SFDA 3SY4A 3I3LA 4OPLA 2R45A 1PHHA 2CVJA 3ITJA 4NEWA 2H88A 3SZCA 2GRTA 4KPRA 1KNPA 2EQ6A 1GPEA 2E5VA 3WE0A 1QJDA 2WPEA 3T2YA 2WP5A 3ABVA 2DKHA 5KMRA 4H4SA 5DBJA 2V6OA 4J57A 2JB1A 1DOCA 2CFYA 3I6DA 2WQYA 4IA6A 3UKQA 2WBAA 2JB3A 1YQ3A 2WP6A 4FK1A 4GDEA 2X8HA 1FOHA 2BCGG 2UZZA 4H2PA 4U8JA 5KVHA 4NTDA 4IV9A 1ZY8A 3M12A 5EOWA 4APNA 2XVEA 3QSSA 1SEZA 2YLXA 4B68A 1GETA 1VG0A 2WDQA 2YG5A 2BS2A 2GV8A 2BACA 2BRYA 4U8KA 2XFQA 3P4SA 1YKJA 4G74A 2WEUA 1ZK7A 2AR8A 2JK6A 4M52A 3Q9TA 4USQA 2YR4A 1P2EA 4C3YA 1PJ6A 1TDKA 4HA6A 4UDPA 3P4PA 2B76A 4U2LA 4Y4LA 2BXSA 3C4AA 4ZCDA 1IUSA 3K7QX 4TM3A 2GR0A 3C4NA 5JCNA 3CGCA 3GSIA 4XWZA 5KXJA 1O94A 4H4YA 1LQTA 4OCGA 3EAOA 4OPGA 1CJ4A 1GRTA 1Y56A 3UP5A 3IHMA 4GF7A 3L1RA 4JY2A 4H4VA 1O5WA 4H4RA 1GALA 2X99A 1EL7A 3SZWA 3GYJA 1K0LA 4J31A 2E1MA 3EF6A 2Z5XA 1MXTA 1H84A 4K2XA 5CKUA 1E39A 2HQMA 3GRSA 3GDNA 2ACZA 1NHRA 3V76A 5M10A 3PVCA 4G6HA 2GH5A 3UKHA 4OVIA 3KKJA 4TM4A 1PXCA 2XLSA 2GMJA 4KX6A 1NPXA 2GAHB 4EM3A 4U2TA 5ER0A 4C74A 1JU2A 1QLBA 3K7TA 1FECA 4YTNA 2WDVA 3P4QA 2GB0A 4XXGA 1NG4A 2JAEA 4A99A 4YT0A 4H2RA 3VRAA 3BNMA 4A6NA 2XFPA 2XDOA 4AP3A 4BJYA 1BF3A 4BK1A 2C65A 5FS6A 4NTCA 4A65A 3AEEA 3LXDA 3FMWA 3COXA 4FDCB 3FBSA 5GRTA 2QA1A 2V60A 2BC1A 3T37A 2QAEA 3LB8A 1E1KA 3F8RA 1RSGA 1GXFA 4HB9A 2C73A 2YM2A 3D8XA 3FPZA 4II3A 3DJEA 1DJNA 2PHHA 1P2HA 1PS9A 4U8LA 4AT0A 4DSHA 5KMPA 2B7SA 4EMWA 4A5LA 2W0HA 3NG7X 3CPJG 4OPTA 3VQRA 2Y6RA 1HYUA 1RYIA 3H8LA 2BK4A 5L46A 2YM1A 1KFYA 2XLPA 4U8PA 5IQ1A 2OLNA 3AE2A 2XVJA 1JRZA 1H7WA 3CNJA 4C3XA 2WOWA 4FK1C 4D04A 4U8MA 2BABA 3T14A 3AWIA 4YSXA 4EMIA 3AE9A 3BI2A 3QSMA 4C77A 2R46A 1N4UA 3F8DA 4H4PA 3VR9A 4TLZA 4Z24A 1GRGA 1DJQA 3SZ0A 2WESA 2IVEA 1TDFA 3AECA 1ELIA 3B6DA 3CPHG 3ISHA 1GREA 1B4VA 1EBDA 1DOEA 1ZMCA 1GRHA 2EQ9A 2V3AA 4J34A 5IQ4A 3UKPA 3DJGX 4DGKA 1K4QA 1REOA 1GOSA 1NHQA 1B5QA 3NGCX 1TDOA 2C3DA 3AYJA 4CCQA 1OJDA 2XFNA 1IUVA 3ADAB 1FCDA 3GMCA 4XWRA 1E1NA 4EIQA 1TYPA 4H4XA 3RHAA 2I0ZA 4II2A 4PABA 1NDAA 1GESA 2VOUA 1GRAA 5IPYA 1PJ7A 3NK2X 3G5RA 3RP6A 2XVIA 5C2TA 5U1OA 1PN0A 1DNCA 4K22A 4OPDA 2BRAA 1VQWA 3O0HA 4G9KA 3R9UA 5EBKA 1KF6A 1DODA 2BS4A 1EL8A 2GEWA 3UKKA 2X50A 3AE7A 1ZP0A 1E6EA 1VRQB 3P1WA 3KPKA 2R0GA 2C7GA 4U8IA 3KPFA 3GD4A 1TRBA 1VG9A 2QCUA 3AEAA 4AOSA 2Q7VA 1NAAA 2OALA 1GSNA 3FG2P 4AOXA 3NK0X 3ATRA 5C3JA 1JOAA 1OJ9A 1KDGA 4U8NA 4YKFA 2Q0KA 5BRTA 2VZ2A 1TDNA 3NKSA 3P9UA 1DXLA 1COYA 2YLTA 4UP3A 3URHA 3FIMB 1AOGA 3AEFA 4K5RA 1S2QA 2FJAA 1BGNA 4YWOA 5TR3A 5KVIA 1EL5A 1CL0A 4J2WA 1OJCA 3UOVA 4BK2A 2XFUA 3HZLA 2BC0A 3AE5A 1PXBA 4GDPA 3DJDA 3CNPA 1ZOVA 1CC2A 1EL9A 1JNZA 4H4ZA 3RP8A 2WS3A 1GEUA 3GYIA 4TLXA 4B63A 3KA7A 3GWFA 4JNQA 3GMBA 1YY5A 2NVKX 4A7AA 5BVAA 3V3NA 4AP1A 4EQSA 1QO8A 3AB1A 2WOIA 2WP9A 3CNSA 5U63A 3E1TA 1RP0A 2B9XA 2WOVA 4U8OA 3ALLA 2AQJA 4JQ9A 2R0CA 3NRNA 3OZ2A 3BHKA 3SM8A 2GQWA 2RABA 3VR8A 1N4VA 3NYFA 2ZZ0A 4RSLA 2C64A 2YLWA 2Q6UA 1D7YA 4TM1A 3GD3A 4B64A 5HY5A 2B7RA 2VRLA 3ATQA 2YAUA 1MOKA 4H2NA 1CC6A 1XHCA 4BK3A 2V3BA 3HYXA 2TPRA 2YLSA 1PBEA 2O9ZA 2ZZBA 4O5UA 3SQPA 1JEHA 3UP4A 3UTFA 4K8DA 1L9DA 5FS7A 1JNRA 2FBWA 4NNJA 4H4WA 4Z26A 3NTDA 3LOVA 3T0KA 2BK5A 1XDIA 2R4JA 2C76A 1CJ2A 1K0JA 2XCGA 2YR5A 1D4EA 3VRBA 1M64A 1D4DA 1NENA 2JB2A 3DK4A 4CNJA 3NYEA 4C5OA 2CDUA 4IA5A 1Y56B 3CTYA 3K7MX 3QSEA 5KMSA 4BV6A 3II4A 2ZZCA 3NNEA 4GUVA 3V3OA 3T2KA 4Z25A 2ARDA 4IVOB 3UOXA 4YSHA 5KOXA 1LV0A 3BNUA 3CN8A 3KVEA 3GYXA 4ICYA 3LZXA 1GRBA 2B9YA 4N9XA 1Q9IA 3DK9A 4B69A 4EQRA 2AAQA 3GWDA 3NN0X 3QFBA 4H50A 1FEBA 1CBOA 2WDRA 2V5ZA 1ZMDA 3IC9A 5EB5A 1D4CA 1PJ5A 1N4WA 3CMMA 1BWCA 2V61A 3SXIA 2JBVA 3ICTA 2DKIA 3AEBA 3GRTA 3LJPA 4LA1A 4B67A 2R9ZA 1BGJA 4UDRA 3F8PA 3H8IA 3NLCA 4CY6A 1GNDA 1LVLA 1E1MA 3AXBA 1NG3A 1F3PA 2BCPA 1TDEA 2BK3A 1IJHA 4NWZA 4A6NB 1W4XA 2XVHA 2YG3A 5HYMA 1ZKQA 3SX6A 3CNDA 3PO7A 5U25A 3SFEA 3AE8A 4Z44A 3NN6X 1S3BA 2C70A 1BZLA 4OPCA 2WPFA 3T2ZA 3EANA 1S3EA 4MJWA 4EIPA 2Q0LA
chains in the Genus database with same CATH topology
4TM0A 5M0ZA 1D7LA 3CGEA 3QVPA 4JY3A 5CQFA 2CULA 1H6VA 4OPUA 5JCKA 2OLOA 4B66A 1S2YA 4H4QA 4AT2A 2GAGB 4GAVA 4NEVA 3M13A 2X8CA 3DK8A 3SGLA 1FL2A 2WU2A 3UOZA 4CRTA 4X4JA 3D1CA 5JCMA 2YVFA 4BURA 1LQUA 5HXIA 4EMJA 3DH9A 1Q1RA 3BHFA 4Z2RA 4A9WA 2GR3A 4X9NA 1OJAA 3UTHA 4A79A 5KOWA 4EQWA 2A89A 1NHSA 2VRMA 2RGOA 4NTEA 2GQFA 1GT8A 2BA9A 4Y4MA 2VQBA 3BI4A 3OC4A 5LV9A 4YTMA 1H7XA 3KD9A 3AYIA 3L8KA 3UCLA 5KNLA 1DOBA 3IHGA 5BULA 1IUTA 2OA1A 2QA2A 1CHUA 4WCTA 2VVMA 2FJEA 2X8GA 5FMHA 4LU6A 2BYBA 2IIDA 2RGJA 2C67A 1JRYA 3UKFA 1NHPA 1LJ1A 3UKAA 2YLRA 3UTGA 1O95A 4ADWA 4BJZA 2YVGA 1E1LA 2XLRA 1PDHA 1H81A 1NEKA 3ALJA 2WETA 2VVLA 3LADA 3ZYXA 2VVLG 2C75A 4EQXA 1B8SA 4B1BA 1KSSA 2XYOA 2ZBWA 3G5SA 3CGBA 4EM4A 2C66A 2NPXA 3DGZA 1XPQA 3NTAA 3VRDB 3ZDNA 3C96A 4ECHA 3AD9B 3NHOX 4O5QA 1TYTA 3DGHA 2H89A 2EQ8A 2FJBA 1UKVG 5HHFA 2RGHA 3KU9A 3BI5A 2YLZA 4X9MA 4GRTA 4Y4NA 3SYIA 3B3RA 2YG6A 4ZN0A 5J60A 2C3CA 5BUKA 2YVJA 1BKWA 1CJCA 1GTEA 1V59A 1CJ3A 1OJTA 1XANA 3AEGA 3M0OA 4J56A 4JNAA 1F8WA 2Y6QA 2YG4A 4J33A 4WX1A 4DSGA 3AD7B 3DMEA 2J3NA 3G5QA 1B37A 1LPFA 1M6IA 3NK1X 3SZFA 3HYVA 3AE3A 4CY8A 5JCLA 2GR2A 2GVCA 2TMDA 1F6MA 4IVMB 3QVRA 3AE6A 4G73A 2WHDA 2VQ7A 4CCRA 4CNKA 4YTPA 1E7PA 2XLUA 4H4TA 1GV4A 3HYWA 2XFOA 3CNTA 4K5SA 1L9EA 4H7UA 4H2QA 4NZHA 4UDQA 4USRA 4D03A 2YQUA 3CIRA 2BXRA 1Q1WA 4JDRA 1D5TA 1PBFA 1L0VA 3AE1A 3UTEA 2JKCA 2F5ZA 3AEDA 2A8XA 2R0PA 3NH3X 1PBDA 2X3NA 5KRQA 4U2SA 3IF9A 2YR6A 1H86A 3AE4A 4YXDA 4GAPA 4I58A 2FJDA 2R4EA 1ZDLA 2GF3A 3DJJA 1F8SA 4RG3A 2XVFA 1PBCA 4YSYA 3ICSA 5KWFA 1VDCA 1GTHA 4LIIA 5J7XA 1N1PA 1YQ4A 2WPCA 1GRFA 4I59A 2WU5A 3DA1A 4YKGA 2C4CA 4J36A 2XLTA 1PXAA 4G6GA 4H4UA 3KLJA 3LZWA 1L9CA 1IUWA 2GMHA 4Z2TA 3EPTA 5KMQA 4JN9A 3UKLA 4CBQA 4OPIA 1X31B 4P9SA 2A87A 3RP7A 4DNAA 1K0IA 2YWLA 1H83A 3REDA 3H4KA 2PYXA 4E0VA 2IVDA 3AYLA 1YQZA 1F8RA 3NT6A 1ZX9A 4YSZA 3IWAA 1ZOYA 2Z5YA 4K7ZA 4PAAA 1IUUA 2APGA 3NYCA 1PBBA 2GR1A 3QJ4A 2E4GA 1LTXR 1KSUA 5JCIA 5GSNA 4FX9A 4Z2UA 1H82A 1Y0PA 2C72A 1KNRA 1GERA 4REKA 5FS9A 3CGDA 1MO9A 3JSKA 4GCMA 3UOYA 1FEAA 1ONFA 3RNMA 3ALMA 5FS8A 1CF3A 4B65A 3S61A 1Z6LA 1IUXA 2B9WA 2YG7A 3AD8B 3K30A 3NIXA 3P4RA 3T31A 5EB4A 3GDPA 3ICRA 3S5WA 2BS3A 1CC4A 3CPIG 3PS9A 3QFAA 4GR1A 4ZCCA 4Z43A 1JRXA 2EQ7A 3Q6JA 4RG4A 2OAMA 3SFDA 3SY4A 3I3LA 4OPLA 2R45A 1PHHA 2CVJA 3ITJA 4NEWA 2H88A 3SZCA 2GRTA 4KPRA 1KNPA 2EQ6A 1GPEA 2E5VA 3WE0A 1QJDA 2WPEA 3T2YA 2WP5A 3ABVA 2DKHA 5KMRA 4H4SA 5DBJA 2V6OA 4J57A 2JB1A 1DOCA 2CFYA 3I6DA 2WQYA 4IA6A 3UKQA 2WBAA 2JB3A 1YQ3A 2WP6A 4FK1A 4GDEA 2X8HA 1FOHA 2BCGG 2UZZA 4H2PA 4U8JA 5KVHA 4NTDA 4IV9A 1ZY8A 3M12A 5EOWA 4APNA 2XVEA 3QSSA 1SEZA 2YLXA 4B68A 1GETA 1VG0A 2WDQA 2YG5A 2BS2A 2GV8A 2BACA 2BRYA 4U8KA 2XFQA 3P4SA 1YKJA 4G74A 2WEUA 1ZK7A 2AR8A 2JK6A 4M52A 3Q9TA 4USQA 2YR4A 1P2EA 4C3YA 1PJ6A 1TDKA 4HA6A 4UDPA 3P4PA 2B76A 4U2LA 4Y4LA 2BXSA 3C4AA 4ZCDA 1IUSA 3K7QX 4TM3A 2GR0A 3C4NA 5JCNA 3CGCA 3GSIA 4XWZA 5KXJA 1O94A 4H4YA 1LQTA 4OCGA 3EAOA 4OPGA 1CJ4A 1GRTA 1Y56A 3UP5A 3IHMA 4GF7A 3L1RA 4JY2A 4H4VA 1O5WA 4H4RA 1GALA 2X99A 1EL7A 3SZWA 3GYJA 1K0LA 4J31A 2E1MA 3EF6A 2Z5XA 1MXTA 1H84A 4K2XA 5CKUA 1E39A 2HQMA 3GRSA 3GDNA 2ACZA 1NHRA 3V76A 5M10A 3PVCA 4G6HA 2GH5A 3UKHA 4OVIA 3KKJA 4TM4A 1PXCA 2XLSA 2GMJA 4KX6A 1NPXA 2GAHB 4EM3A 4U2TA 5ER0A 4C74A 1JU2A 1QLBA 3K7TA 1FECA 4YTNA 2WDVA 3P4QA 2GB0A 4XXGA 1NG4A 2JAEA 4A99A 4YT0A 4H2RA 3VRAA 3BNMA 4A6NA 2XFPA 2XDOA 4AP3A 4BJYA 1BF3A 4BK1A 2C65A 5FS6A 4NTCA 4A65A 3AEEA 3LXDA 3FMWA 3COXA 4FDCB 3FBSA 5GRTA 2QA1A 2V60A 2BC1A 3T37A 2QAEA 3LB8A 1E1KA 3F8RA 1RSGA 1GXFA 4HB9A 2C73A 2YM2A 3D8XA 3FPZA 4II3A 3DJEA 1DJNA 2PHHA 1P2HA 1PS9A 4U8LA 4AT0A 4DSHA 5KMPA 2B7SA 4EMWA 4A5LA 2W0HA 3NG7X 3CPJG 4OPTA 3VQRA 2Y6RA 1HYUA 1RYIA 3H8LA 2BK4A 5L46A 2YM1A 1KFYA 2XLPA 4U8PA 5IQ1A 2OLNA 3AE2A 2XVJA 1JRZA 1H7WA 3CNJA 4C3XA 2WOWA 4FK1C 4D04A 4U8MA 2BABA 3T14A 3AWIA 4YSXA 4EMIA 3AE9A 3BI2A 3QSMA 4C77A 2R46A 1N4UA 3F8DA 4H4PA 3VR9A 4TLZA 4Z24A 1GRGA 1DJQA 3SZ0A 2WESA 2IVEA 1TDFA 3AECA 1ELIA 3B6DA 3CPHG 3ISHA 1GREA 1B4VA 1EBDA 1DOEA 1ZMCA 1GRHA 2EQ9A 2V3AA 4J34A 5IQ4A 3UKPA 3DJGX 4DGKA 1K4QA 1REOA 1GOSA 1NHQA 1B5QA 3NGCX 1TDOA 2C3DA 3AYJA 4CCQA 1OJDA 2XFNA 1IUVA 3ADAB 1FCDA 3GMCA 4XWRA 1E1NA 4EIQA 1TYPA 4H4XA 3RHAA 2I0ZA 4II2A 4PABA 1NDAA 1GESA 2VOUA 1GRAA 5IPYA 1PJ7A 3NK2X 3G5RA 3RP6A 2XVIA 5C2TA 5U1OA 1PN0A 1DNCA 4K22A 4OPDA 2BRAA 1VQWA 3O0HA 4G9KA 3R9UA 5EBKA 1KF6A 1DODA 2BS4A 1EL8A 2GEWA 3UKKA 2X50A 3AE7A 1ZP0A 1E6EA 1VRQB 3P1WA 3KPKA 2R0GA 2C7GA 4U8IA 3KPFA 3GD4A 1TRBA 1VG9A 2QCUA 3AEAA 4AOSA 2Q7VA 1NAAA 2OALA 1GSNA 3FG2P 4AOXA 3NK0X 3ATRA 5C3JA 1JOAA 1OJ9A 1KDGA 4U8NA 4YKFA 2Q0KA 5BRTA 2VZ2A 1TDNA 3NKSA 3P9UA 1DXLA 1COYA 2YLTA 4UP3A 3URHA 3FIMB 1AOGA 3AEFA 4K5RA 1S2QA 2FJAA 1BGNA 4YWOA 5TR3A 5KVIA 1EL5A 1CL0A 4J2WA 1OJCA 3UOVA 4BK2A 2XFUA 3HZLA 2BC0A 3AE5A 1PXBA 4GDPA 3DJDA 3CNPA 1ZOVA 1CC2A 1EL9A 1JNZA 4H4ZA 3RP8A 2WS3A 1GEUA 3GYIA 4TLXA 4B63A 3KA7A 3GWFA 4JNQA 3GMBA 1YY5A 2NVKX 4A7AA 5BVAA 3V3NA 4AP1A 4EQSA 1QO8A 3AB1A 2WOIA 2WP9A 3CNSA 5U63A 3E1TA 1RP0A 2B9XA 2WOVA 4U8OA 3ALLA 2AQJA 4JQ9A 2R0CA 3NRNA 3OZ2A 3BHKA 3SM8A 2GQWA 2RABA 3VR8A 1N4VA 3NYFA 2ZZ0A 4RSLA 2C64A 2YLWA 2Q6UA 1D7YA 4TM1A 3GD3A 4B64A 5HY5A 2B7RA 2VRLA 3ATQA 2YAUA 1MOKA 4H2NA 1CC6A 1XHCA 4BK3A 2V3BA 3HYXA 2TPRA 2YLSA 1PBEA 2O9ZA 2ZZBA 4O5UA 3SQPA 1JEHA 3UP4A 3UTFA 4K8DA 1L9DA 5FS7A 1JNRA 2FBWA 4NNJA 4H4WA 4Z26A 3NTDA 3LOVA 3T0KA 2BK5A 1XDIA 2R4JA 2C76A 1CJ2A 1K0JA 2XCGA 2YR5A 1D4EA 3VRBA 1M64A 1D4DA 1NENA 2JB2A 3DK4A 4CNJA 3NYEA 4C5OA 2CDUA 4IA5A 1Y56B 3CTYA 3K7MX 3QSEA 5KMSA 4BV6A 3II4A 2ZZCA 3NNEA 4GUVA 3V3OA 3T2KA 4Z25A 2ARDA 4IVOB 3UOXA 4YSHA 5KOXA 1LV0A 3BNUA 3CN8A 3KVEA 3GYXA 4ICYA 3LZXA 1GRBA 2B9YA 4N9XA 1Q9IA 3DK9A 4B69A 4EQRA 2AAQA 3GWDA 3NN0X 3QFBA 4H50A 1FEBA 1CBOA 2WDRA 2V5ZA 1ZMDA 3IC9A 5EB5A 1D4CA 1PJ5A 1N4WA 3CMMA 1BWCA 2V61A 3SXIA 2JBVA 3ICTA 2DKIA 3AEBA 3GRTA 3LJPA 4LA1A 4B67A 2R9ZA 1BGJA 4UDRA 3F8PA 3H8IA 3NLCA 4CY6A 1GNDA 1LVLA 1E1MA 3AXBA 1NG3A 1F3PA 2BCPA 1TDEA 2BK3A 1IJHA 4NWZA 4A6NB 1W4XA 2XVHA 2YG3A 5HYMA 1ZKQA 3SX6A 3CNDA 3PO7A 5U25A 3SFEA 3AE8A 4Z44A 3NN6X 1S3BA 2C70A 1BZLA 4OPCA 2WPFA 3T2ZA 3EANA 1S3EA 4MJWA 4EIPA 2Q0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM0 A;  5M0Z A;  1D7L A;  3CGE A;  3QVP A;  4JY3 A;  5CQF A;  2CUL A;  1H6V A;  4OPU A;  5JCK A;  2OLO A;  4B66 A;  1S2Y A;  4H4Q A;  4AT2 A;  2GAG B;  4NEV A;  3M13 A;  2X8C A;  3DK8 A;  3SGL A;  1FL2 A;  2WU2 A;  3UOZ A;  4CRT A;  4X4J A;  3D1C A;  5JCM A;  2YVF A;  4BUR A;  1LQU A;  5HXI A;  4EMJ A;  3DH9 A;  1Q1R A;  3BHF A;  4Z2R A;  4A9W A;  2GR3 A;  4X9N A;  1OJA A;  3UTH A;  4A79 A;  5KOW A;  4EQW A;  2A89 A;  1NHS A;  2VRM A;  2RGO A;  4NTE A;  2GQF A;  1GT8 A;  2BA9 A;  4Y4M A;  2VQB A;  3BI4 A;  3OC4 A;  5LV9 A;  4YTM A;  1H7X A;  3KD9 A;  3AYI A;  3L8K A;  3UCL A;  1DOB A;  3IHG A;  5BUL A;  1IUT A;  2OA1 A;  2QA2 A;  1CHU A;  4WCT A;  2VVM A;  2FJE A;  2X8G A;  5FMH A;  4LU6 A;  2BYB A;  2IID A;  2RGJ A;  2C67 A;  1JRY A;  3UKF A;  1NHP A;  1LJ1 A;  3UKA A;  2YLR A;  3UTG A;  1O95 A;  4ADW A;  4BJZ A;  2YVG A;  1E1L A;  2XLR A;  1PDH A;  1H81 A;  1NEK A;  3ALJ A;  2WET A;  2VVL A;  3LAD A;  3ZYX A;  2VVL G;  2C75 A;  4EQX A;  1B8S A;  4B1B A;  1KSS A;  2XYO A;  2ZBW A;  3G5S A;  3CGB A;  4EM4 A;  2C66 A;  2NPX A;  3DGZ A;  1XPQ A;  3NTA A;  3VRD B;  3ZDN A;  3C96 A;  4ECH A;  3AD9 B;  3NHO X;  4O5Q A;  1TYT A;  3DGH A;  2H89 A;  2EQ8 A;  2FJB A;  1UKV G;  5HHF A;  2RGH A;  3KU9 A;  3BI5 A;  2YLZ A;  4X9M A;  4GRT A;  4Y4N A;  3B3R A;  2YG6 A;  4ZN0 A;  5J60 A;  2C3C A;  5BUK A;  2YVJ A;  1BKW A;  1CJC A;  1GTE A;  1V59 A;  1CJ3 A;  1OJT A;  1XAN A;  3AEG A;  3M0O A;  4J56 A;  4JNA A;  1F8W A;  2Y6Q A;  2YG4 A;  4J33 A;  4WX1 A;  4DSG A;  3AD7 B;  3DME A;  2J3N A;  3G5Q A;  1B37 A;  1LPF A;  1M6I A;  3NK1 X;  3AE3 A;  4CY8 A;  5JCL A;  2GR2 A;  2GVC A;  2TMD A;  1F6M A;  4IVM B;  3QVR A;  3AE6 A;  2WHD A;  2VQ7 A;  4CCR A;  4CNK A;  4YTP A;  1E7P A;  2XLU A;  4H4T A;  1GV4 A;  2XFO A;  3CNT A;  4K5S A;  1L9E A;  4H7U A;  4H2Q A;  4NZH A;  4UDQ A;  4USR A;  4D03 A;  2YQU A;  3CIR A;  2BXR A;  1Q1W A;  4JDR A;  1D5T A;  1PBF A;  1L0V A;  3AE1 A;  3UTE A;  2JKC A;  2F5Z A;  3AED A;  2A8X A;  2R0P A;  3NH3 X;  1PBD A;  2X3N A;  5KRQ A;  4U2S A;  3IF9 A;  2YR6 A;  1H86 A;  3AE4 A;  4YXD A;  4I58 A;  2FJD A;  2R4E A;  1ZDL A;  2GF3 A;  3DJJ A;  1F8S A;  4RG3 A;  2XVF A;  1PBC A;  4YSY A;  3ICS A;  5KWF A;  1VDC A;  1GTH A;  4LII A;  5J7X A;  1N1P A;  1YQ4 A;  2WPC A;  1GRF A;  4I59 A;  2WU5 A;  3DA1 A;  4YKG A;  4J36 A;  2XLT A;  1PXA A;  4H4U A;  3KLJ A;  3LZW A;  1L9C A;  1IUW A;  2GMH A;  4Z2T A;  3EPT A;  4JN9 A;  3UKL A;  4CBQ A;  4OPI A;  1X31 B;  4P9S A;  2A87 A;  3RP7 A;  4DNA A;  1K0I A;  2YWL A;  1H83 A;  3RED A;  3H4K A;  2PYX A;  4E0V A;  2IVD A;  3AYL A;  1YQZ A;  1F8R A;  3NT6 A;  1ZX9 A;  4YSZ A;  3IWA A;  1ZOY A;  2Z5Y A;  4K7Z A;  4PAA A;  1IUU A;  2APG A;  3NYC A;  1PBB A;  2GR1 A;  3QJ4 A;  2E4G A;  1LTX R;  1KSU A;  5JCI A;  5GSN A;  4FX9 A;  4Z2U A;  1H82 A;  1Y0P A;  2C72 A;  1KNR A;  1GER A;  4REK A;  5FS9 A;  3CGD A;  1MO9 A;  3JSK A;  4GCM A;  3UOY A;  1FEA A;  1ONF A;  3RNM A;  3ALM A;  5FS8 A;  1CF3 A;  4B65 A;  3S61 A;  1Z6L A;  1IUX A;  2B9W A;  2YG7 A;  3AD8 B;  3K30 A;  3NIX A;  3P4R A;  5EB4 A;  3GDP A;  3ICR A;  3S5W A;  2BS3 A;  1CC4 A;  3CPI G;  3PS9 A;  3QFA A;  4GR1 A;  4ZCC A;  4Z43 A;  1JRX A;  2EQ7 A;  3Q6J A;  4RG4 A;  2OAM A;  3SFD A;  3I3L A;  4OPL A;  2R45 A;  1PHH A;  2CVJ A;  3ITJ A;  4NEW A;  2H88 A;  2GRT A;  4KPR A;  1KNP A;  2EQ6 A;  1GPE A;  2E5V A;  3WE0 A;  1QJD A;  2WPE A;  2WP5 A;  3ABV A;  2DKH A;  4H4S A;  5DBJ A;  2V6O A;  4J57 A;  2JB1 A;  1DOC A;  2CFY A;  3I6D A;  2WQY A;  4IA6 A;  3UKQ A;  2WBA A;  2JB3 A;  1YQ3 A;  2WP6 A;  4FK1 A;  4GDE A;  2X8H A;  1FOH A;  2BCG G;  2UZZ A;  4H2P A;  4U8J A;  5KVH A;  4NTD A;  4IV9 A;  1ZY8 A;  3M12 A;  5EOW A;  4APN A;  2XVE A;  3QSS A;  1SEZ A;  2YLX A;  4B68 A;  1GET A;  1VG0 A;  2WDQ A;  2YG5 A;  2BS2 A;  2GV8 A;  2BAC A;  4U8K A;  2XFQ A;  3P4S A;  1YKJ A;  2WEU A;  1ZK7 A;  2AR8 A;  2JK6 A;  4M52 A;  3Q9T A;  4USQ A;  2YR4 A;  1P2E A;  4C3Y A;  1PJ6 A;  1TDK A;  4HA6 A;  4UDP A;  3P4P A;  2B76 A;  4U2L A;  4Y4L A;  2BXS A;  3C4A A;  4ZCD A;  1IUS A;  3K7Q X;  4TM3 A;  2GR0 A;  3C4N A;  5JCN A;  3CGC A;  3GSI A;  4XWZ A;  5KXJ A;  1O94 A;  4H4Y A;  1LQT A;  4OCG A;  3EAO A;  4OPG A;  1CJ4 A;  1GRT A;  1Y56 A;  3UP5 A;  3IHM A;  4GF7 A;  3L1R A;  4JY2 A;  4H4V A;  1O5W A;  4H4R A;  1GAL A;  2X99 A;  1EL7 A;  3GYJ A;  1K0L A;  4J31 A;  2E1M A;  3EF6 A;  2Z5X A;  1MXT A;  1H84 A;  4K2X A;  5CKU A;  1E39 A;  2HQM A;  3GRS A;  3GDN A;  2ACZ A;  1NHR A;  3V76 A;  5M10 A;  3PVC A;  3UKH A;  2GH5 A;  4OVI A;  3KKJ A;  4TM4 A;  1PXC A;  2XLS A;  2GMJ A;  4KX6 A;  1NPX A;  2GAH B;  4EM3 A;  4U2T A;  5ER0 A;  4C74 A;  1JU2 A;  1QLB A;  3K7T A;  1FEC A;  4YTN A;  2WDV A;  3P4Q A;  2GB0 A;  4XXG A;  1NG4 A;  2JAE A;  4A99 A;  4YT0 A;  4H2R A;  3VRA A;  3BNM A;  4A6N A;  2XFP A;  2XDO A;  4AP3 A;  4BJY A;  1BF3 A;  4BK1 A;  2C65 A;  5FS6 A;  4NTC A;  4A65 A;  3AEE A;  3LXD A;  3FMW A;  3COX A;  4FDC B;  3FBS A;  5GRT A;  2QA1 A;  2V60 A;  2BC1 A;  3T37 A;  2QAE A;  3LB8 A;  1E1K A;  3F8R A;  1RSG A;  1GXF A;  4HB9 A;  2C73 A;  2YM2 A;  3D8X A;  3FPZ A;  3DJE A;  1DJN A;  2PHH A;  1P2H A;  1PS9 A;  4U8L A;  4AT0 A;  4DSH A;  2B7S A;  4EMW A;  4A5L A;  2W0H A;  3NG7 X;  3CPJ G;  4OPT A;  3VQR A;  2Y6R A;  1HYU A;  1RYI A;  3H8L A;  2BK4 A;  5L46 A;  2YM1 A;  1KFY A;  2XLP A;  4U8P A;  5IQ1 A;  2OLN A;  3AE2 A;  2XVJ A;  1JRZ A;  1H7W A;  3CNJ A;  4C3X A;  2WOW A;  4FK1 C;  4D04 A;  4U8M A;  2BAB A;  3AWI A;  4YSX A;  4EMI A;  3AE9 A;  3BI2 A;  3QSM A;  4C77 A;  2R46 A;  1N4U A;  3F8D A;  4H4P A;  3VR9 A;  4TLZ A;  4Z24 A;  1GRG A;  1DJQ A;  2WES A;  2IVE A;  1TDF A;  3AEC A;  1ELI A;  3B6D A;  3CPH G;  3ISH A;  1GRE A;  1B4V A;  1EBD A;  1DOE A;  1ZMC A;  1GRH A;  2EQ9 A;  2V3A A;  4J34 A;  5IQ4 A;  3UKP A;  3DJG X;  4DGK A;  1K4Q A;  1REO A;  1GOS A;  1NHQ A;  1B5Q A;  3NGC X;  1TDO A;  2C3D A;  3AYJ A;  4CCQ A;  1OJD A;  2XFN A;  1IUV A;  3ADA B;  1FCD A;  3GMC A;  4XWR A;  1E1N A;  4EIQ A;  1TYP A;  4H4X A;  3RHA A;  2I0Z A;  4PAB A;  1NDA A;  1GES A;  2VOU A;  1GRA A;  5IPY A;  1PJ7 A;  3NK2 X;  3G5R A;  3RP6 A;  2XVI A;  5C2T A;  5U1O A;  1PN0 A;  1DNC A;  4K22 A;  4OPD A;  1VQW A;  3O0H A;  3R9U A;  5EBK A;  1KF6 A;  1DOD A;  2BS4 A;  1EL8 A;  2GEW A;  3UKK A;  2X50 A;  3AE7 A;  1ZP0 A;  1E6E A;  1VRQ B;  3P1W A;  2R0G A;  2C7G A;  4U8I A;  3KPF A;  3GD4 A;  1TRB A;  1VG9 A;  2QCU A;  3AEA A;  4AOS A;  2Q7V A;  1NAA A;  2OAL A;  1GSN A;  3FG2 P;  4AOX A;  3NK0 X;  3ATR A;  5C3J A;  1JOA A;  1OJ9 A;  1KDG A;  4U8N A;  4YKF A;  2Q0K A;  5BRT A;  2VZ2 A;  1TDN A;  3NKS A;  3P9U A;  1DXL A;  1COY A;  2YLT A;  4UP3 A;  3URH A;  3FIM B;  1AOG A;  3AEF A;  4K5R A;  1S2Q A;  2FJA A;  1BGN A;  4YWO A;  5TR3 A;  5KVI A;  1EL5 A;  1CL0 A;  4J2W A;  1OJC A;  3UOV A;  4BK2 A;  2XFU A;  3HZL A;  2BC0 A;  3AE5 A;  1PXB A;  4GDP A;  3DJD A;  3CNP A;  1ZOV A;  1CC2 A;  1EL9 A;  1JNZ A;  4H4Z A;  3RP8 A;  2WS3 A;  1GEU A;  3GYI A;  4TLX A;  4B63 A;  3KA7 A;  3GWF A;  4JNQ A;  3GMB A;  1YY5 A;  2NVK X;  4A7A A;  5BVA A;  3V3N A;  4AP1 A;  4EQS A;  1QO8 A;  3AB1 A;  2WOI A;  2WP9 A;  3CNS A;  5U63 A;  3E1T A;  1RP0 A;  2B9X A;  2WOV A;  4U8O A;  3ALL A;  2AQJ A;  4JQ9 A;  2R0C A;  3NRN A;  3OZ2 A;  3BHK A;  3SM8 A;  2GQW A;  2RAB A;  3VR8 A;  1N4V A;  3NYF A;  2ZZ0 A;  4RSL A;  2C64 A;  2YLW A;  2Q6U A;  1D7Y A;  4TM1 A;  3GD3 A;  4B64 A;  5HY5 A;  2B7R A;  2VRL A;  3ATQ A;  2YAU A;  1MOK A;  4H2N A;  1CC6 A;  1XHC A;  4BK3 A;  2V3B A;  2TPR A;  2YLS A;  1PBE A;  2O9Z A;  2ZZB A;  4O5U A;  3SQP A;  1JEH A;  3UP4 A;  3UTF A;  4K8D A;  1L9D A;  5FS7 A;  1JNR A;  2FBW A;  4H4W A;  4Z26 A;  3NTD A;  3LOV A;  2BK5 A;  1XDI A;  2R4J A;  2C76 A;  1CJ2 A;  1K0J A;  2XCG A;  2YR5 A;  1D4E A;  3VRB A;  1M64 A;  1D4D A;  1NEN A;  2JB2 A;  3DK4 A;  4CNJ A;  3NYE A;  4C5O A;  2CDU A;  4IA5 A;  1Y56 B;  3CTY A;  3K7M X;  3QSE A;  4BV6 A;  3II4 A;  2ZZC A;  3NNE A;  4GUV A;  3V3O A;  4Z25 A;  2ARD A;  4IVO B;  3UOX A;  4YSH A;  5KOX A;  1LV0 A;  3BNU A;  3CN8 A;  3KVE A;  4ICY A;  4N9X A;  3LZX A;  1GRB A;  2B9Y A;  4B69 A;  1Q9I A;  3DK9 A;  4EQR A;  2AAQ A;  3GWD A;  3NN0 X;  3QFB A;  4H50 A;  1FEB A;  1CBO A;  2WDR A;  2V5Z A;  1ZMD A;  3IC9 A;  5EB5 A;  1D4C A;  1PJ5 A;  1N4W A;  1BWC A;  2V61 A;  2JBV A;  3ICT A;  2DKI A;  3AEB A;  3GRT A;  3LJP A;  4LA1 A;  4B67 A;  2R9Z A;  1BGJ A;  4UDR A;  3F8P A;  3H8I A;  3NLC A;  4CY6 A;  1GND A;  1LVL A;  1E1M A;  3AXB A;  1NG3 A;  1F3P A;  2BCP A;  1TDE A;  2BK3 A;  1IJH A;  4A6N B;  1W4X A;  2XVH A;  2YG3 A;  5HYM A;  1ZKQ A;  3CND A;  3PO7 A;  5U25 A;  3SFE A;  3AE8 A;  4Z44 A;  3NN6 X;  1S3B A;  2C70 A;  1BZL A;  4OPC A;  2WPF A;  3EAN A;  1S3E A;  4MJW A;  4EIP A;  2Q0L A; 
#chains in the Genus database with same CATH topology
 4TM0 A;  5M0Z A;  1D7L A;  3CGE A;  3QVP A;  4JY3 A;  5CQF A;  2CUL A;  1H6V A;  4OPU A;  5JCK A;  2OLO A;  4B66 A;  1S2Y A;  4H4Q A;  4AT2 A;  2GAG B;  4GAV A;  4NEV A;  3M13 A;  2X8C A;  3DK8 A;  3SGL A;  1FL2 A;  2WU2 A;  3UOZ A;  4CRT A;  4X4J A;  3D1C A;  5JCM A;  2YVF A;  4BUR A;  1LQU A;  5HXI A;  4EMJ A;  3DH9 A;  1Q1R A;  3BHF A;  4Z2R A;  4A9W A;  2GR3 A;  4X9N A;  1OJA A;  3UTH A;  4A79 A;  5KOW A;  4EQW A;  2A89 A;  1NHS A;  2VRM A;  2RGO A;  4NTE A;  2GQF A;  1GT8 A;  2BA9 A;  4Y4M A;  2VQB A;  3BI4 A;  3OC4 A;  5LV9 A;  4YTM A;  1H7X A;  3KD9 A;  3AYI A;  3L8K A;  3UCL A;  5KNL A;  1DOB A;  3IHG A;  5BUL A;  1IUT A;  2OA1 A;  2QA2 A;  1CHU A;  4WCT A;  2VVM A;  2FJE A;  2X8G A;  5FMH A;  4LU6 A;  2BYB A;  2IID A;  2RGJ A;  2C67 A;  1JRY A;  3UKF A;  1NHP A;  1LJ1 A;  3UKA A;  2YLR A;  3UTG A;  1O95 A;  4ADW A;  4BJZ A;  2YVG A;  1E1L A;  2XLR A;  1PDH A;  1H81 A;  1NEK A;  3ALJ A;  2WET A;  2VVL A;  3LAD A;  3ZYX A;  2VVL G;  2C75 A;  4EQX A;  1B8S A;  4B1B A;  1KSS A;  2XYO A;  2ZBW A;  3G5S A;  3CGB A;  4EM4 A;  2C66 A;  2NPX A;  3DGZ A;  1XPQ A;  3NTA A;  3VRD B;  3ZDN A;  3C96 A;  4ECH A;  3AD9 B;  3NHO X;  4O5Q A;  1TYT A;  3DGH A;  2H89 A;  2EQ8 A;  2FJB A;  1UKV G;  5HHF A;  2RGH A;  3KU9 A;  3BI5 A;  2YLZ A;  4X9M A;  4GRT A;  4Y4N A;  3SYI A;  3B3R A;  2YG6 A;  4ZN0 A;  5J60 A;  2C3C A;  5BUK A;  2YVJ A;  1BKW A;  1CJC A;  1GTE A;  1V59 A;  1CJ3 A;  1OJT A;  1XAN A;  3AEG A;  3M0O A;  4J56 A;  4JNA A;  1F8W A;  2Y6Q A;  2YG4 A;  4J33 A;  4WX1 A;  4DSG A;  3AD7 B;  3DME A;  2J3N A;  3G5Q A;  1B37 A;  1LPF A;  1M6I A;  3NK1 X;  3SZF A;  3HYV A;  3AE3 A;  4CY8 A;  5JCL A;  2GR2 A;  2GVC A;  2TMD A;  1F6M A;  4IVM B;  3QVR A;  3AE6 A;  4G73 A;  2WHD A;  2VQ7 A;  4CCR A;  4CNK A;  4YTP A;  1E7P A;  2XLU A;  4H4T A;  1GV4 A;  3HYW A;  2XFO A;  3CNT A;  4K5S A;  1L9E A;  4H7U A;  4H2Q A;  4NZH A;  4UDQ A;  4USR A;  4D03 A;  2YQU A;  3CIR A;  2BXR A;  1Q1W A;  4JDR A;  1D5T A;  1PBF A;  1L0V A;  3AE1 A;  3UTE A;  2JKC A;  2F5Z A;  3AED A;  2A8X A;  2R0P A;  3NH3 X;  1PBD A;  2X3N A;  5KRQ A;  4U2S A;  3IF9 A;  2YR6 A;  1H86 A;  3AE4 A;  4YXD A;  4GAP A;  4I58 A;  2FJD A;  2R4E A;  1ZDL A;  2GF3 A;  3DJJ A;  1F8S A;  4RG3 A;  2XVF A;  1PBC A;  4YSY A;  3ICS A;  5KWF A;  1VDC A;  1GTH A;  4LII A;  5J7X A;  1N1P A;  1YQ4 A;  2WPC A;  1GRF A;  4I59 A;  2WU5 A;  3DA1 A;  4YKG A;  2C4C A;  4J36 A;  2XLT A;  1PXA A;  4G6G A;  4H4U A;  3KLJ A;  3LZW A;  1L9C A;  1IUW A;  2GMH A;  4Z2T A;  3EPT A;  5KMQ A;  4JN9 A;  3UKL A;  4CBQ A;  4OPI A;  1X31 B;  4P9S A;  2A87 A;  3RP7 A;  4DNA A;  1K0I A;  2YWL A;  1H83 A;  3RED A;  3H4K A;  2PYX A;  4E0V A;  2IVD A;  3AYL A;  1YQZ A;  1F8R A;  3NT6 A;  1ZX9 A;  4YSZ A;  3IWA A;  1ZOY A;  2Z5Y A;  4K7Z A;  4PAA A;  1IUU A;  2APG A;  3NYC A;  1PBB A;  2GR1 A;  3QJ4 A;  2E4G A;  1LTX R;  1KSU A;  5JCI A;  5GSN A;  4FX9 A;  4Z2U A;  1H82 A;  1Y0P A;  2C72 A;  1KNR A;  1GER A;  4REK A;  5FS9 A;  3CGD A;  1MO9 A;  3JSK A;  4GCM A;  3UOY A;  1FEA A;  1ONF A;  3RNM A;  3ALM A;  5FS8 A;  1CF3 A;  4B65 A;  3S61 A;  1Z6L A;  1IUX A;  2B9W A;  2YG7 A;  3AD8 B;  3K30 A;  3NIX A;  3P4R A;  3T31 A;  5EB4 A;  3GDP A;  3ICR A;  3S5W A;  2BS3 A;  1CC4 A;  3CPI G;  3PS9 A;  3QFA A;  4GR1 A;  4ZCC A;  4Z43 A;  1JRX A;  2EQ7 A;  3Q6J A;  4RG4 A;  2OAM A;  3SFD A;  3SY4 A;  3I3L A;  4OPL A;  2R45 A;  1PHH A;  2CVJ A;  3ITJ A;  4NEW A;  2H88 A;  3SZC A;  2GRT A;  4KPR A;  1KNP A;  2EQ6 A;  1GPE A;  2E5V A;  3WE0 A;  1QJD A;  2WPE A;  3T2Y A;  2WP5 A;  3ABV A;  2DKH A;  5KMR A;  4H4S A;  5DBJ A;  2V6O A;  4J57 A;  2JB1 A;  1DOC A;  2CFY A;  3I6D A;  2WQY A;  4IA6 A;  3UKQ A;  2WBA A;  2JB3 A;  1YQ3 A;  2WP6 A;  4FK1 A;  4GDE A;  2X8H A;  1FOH A;  2BCG G;  2UZZ A;  4H2P A;  4U8J A;  5KVH A;  4NTD A;  4IV9 A;  1ZY8 A;  3M12 A;  5EOW A;  4APN A;  2XVE A;  3QSS A;  1SEZ A;  2YLX A;  4B68 A;  1GET A;  1VG0 A;  2WDQ A;  2YG5 A;  2BS2 A;  2GV8 A;  2BAC A;  2BRY A;  4U8K A;  2XFQ A;  3P4S A;  1YKJ A;  4G74 A;  2WEU A;  1ZK7 A;  2AR8 A;  2JK6 A;  4M52 A;  3Q9T A;  4USQ A;  2YR4 A;  1P2E A;  4C3Y A;  1PJ6 A;  1TDK A;  4HA6 A;  4UDP A;  3P4P A;  2B76 A;  4U2L A;  4Y4L A;  2BXS A;  3C4A A;  4ZCD A;  1IUS A;  3K7Q X;  4TM3 A;  2GR0 A;  3C4N A;  5JCN A;  3CGC A;  3GSI A;  4XWZ A;  5KXJ A;  1O94 A;  4H4Y A;  1LQT A;  4OCG A;  3EAO A;  4OPG A;  1CJ4 A;  1GRT A;  1Y56 A;  3UP5 A;  3IHM A;  4GF7 A;  3L1R A;  4JY2 A;  4H4V A;  1O5W A;  4H4R A;  1GAL A;  2X99 A;  1EL7 A;  3SZW A;  3GYJ A;  1K0L A;  4J31 A;  2E1M A;  3EF6 A;  2Z5X A;  1MXT A;  1H84 A;  4K2X A;  5CKU A;  1E39 A;  2HQM A;  3GRS A;  3GDN A;  2ACZ A;  1NHR A;  3V76 A;  5M10 A;  3PVC A;  4G6H A;  2GH5 A;  3UKH A;  4OVI A;  3KKJ A;  4TM4 A;  1PXC A;  2XLS A;  2GMJ A;  4KX6 A;  1NPX A;  2GAH B;  4EM3 A;  4U2T A;  5ER0 A;  4C74 A;  1JU2 A;  1QLB A;  3K7T A;  1FEC A;  4YTN A;  2WDV A;  3P4Q A;  2GB0 A;  4XXG A;  1NG4 A;  2JAE A;  4A99 A;  4YT0 A;  4H2R A;  3VRA A;  3BNM A;  4A6N A;  2XFP A;  2XDO A;  4AP3 A;  4BJY A;  1BF3 A;  4BK1 A;  2C65 A;  5FS6 A;  4NTC A;  4A65 A;  3AEE A;  3LXD A;  3FMW A;  3COX A;  4FDC B;  3FBS A;  5GRT A;  2QA1 A;  2V60 A;  2BC1 A;  3T37 A;  2QAE A;  3LB8 A;  1E1K A;  3F8R A;  1RSG A;  1GXF A;  4HB9 A;  2C73 A;  2YM2 A;  3D8X A;  3FPZ A;  4II3 A;  3DJE A;  1DJN A;  2PHH A;  1P2H A;  1PS9 A;  4U8L A;  4AT0 A;  4DSH A;  5KMP A;  2B7S A;  4EMW A;  4A5L A;  2W0H A;  3NG7 X;  3CPJ G;  4OPT A;  3VQR A;  2Y6R A;  1HYU A;  1RYI A;  3H8L A;  2BK4 A;  5L46 A;  2YM1 A;  1KFY A;  2XLP A;  4U8P A;  5IQ1 A;  2OLN A;  3AE2 A;  2XVJ A;  1JRZ A;  1H7W A;  3CNJ A;  4C3X A;  2WOW A;  4FK1 C;  4D04 A;  4U8M A;  2BAB A;  3T14 A;  3AWI A;  4YSX A;  4EMI A;  3AE9 A;  3BI2 A;  3QSM A;  4C77 A;  2R46 A;  1N4U A;  3F8D A;  4H4P A;  3VR9 A;  4TLZ A;  4Z24 A;  1GRG A;  1DJQ A;  3SZ0 A;  2WES A;  2IVE A;  1TDF A;  3AEC A;  1ELI A;  3B6D A;  3CPH G;  3ISH A;  1GRE A;  1B4V A;  1EBD A;  1DOE A;  1ZMC A;  1GRH A;  2EQ9 A;  2V3A A;  4J34 A;  5IQ4 A;  3UKP A;  3DJG X;  4DGK A;  1K4Q A;  1REO A;  1GOS A;  1NHQ A;  1B5Q A;  3NGC X;  1TDO A;  2C3D A;  3AYJ A;  4CCQ A;  1OJD A;  2XFN A;  1IUV A;  3ADA B;  1FCD A;  3GMC A;  4XWR A;  1E1N A;  4EIQ A;  1TYP A;  4H4X A;  3RHA A;  2I0Z A;  4II2 A;  4PAB A;  1NDA A;  1GES A;  2VOU A;  1GRA A;  5IPY A;  1PJ7 A;  3NK2 X;  3G5R A;  3RP6 A;  2XVI A;  5C2T A;  5U1O A;  1PN0 A;  1DNC A;  4K22 A;  4OPD A;  2BRA A;  1VQW A;  3O0H A;  4G9K A;  3R9U A;  5EBK A;  1KF6 A;  1DOD A;  2BS4 A;  1EL8 A;  2GEW A;  3UKK A;  2X50 A;  3AE7 A;  1ZP0 A;  1E6E A;  1VRQ B;  3P1W A;  3KPK A;  2R0G A;  2C7G A;  4U8I A;  3KPF A;  3GD4 A;  1TRB A;  1VG9 A;  2QCU A;  3AEA A;  4AOS A;  2Q7V A;  1NAA A;  2OAL A;  1GSN A;  3FG2 P;  4AOX A;  3NK0 X;  3ATR A;  5C3J A;  1JOA A;  1OJ9 A;  1KDG A;  4U8N A;  4YKF A;  2Q0K A;  5BRT A;  2VZ2 A;  1TDN A;  3NKS A;  3P9U A;  1DXL A;  1COY A;  2YLT A;  4UP3 A;  3URH A;  3FIM B;  1AOG A;  3AEF A;  4K5R A;  1S2Q A;  2FJA A;  1BGN A;  4YWO A;  5TR3 A;  5KVI A;  1EL5 A;  1CL0 A;  4J2W A;  1OJC A;  3UOV A;  4BK2 A;  2XFU A;  3HZL A;  2BC0 A;  3AE5 A;  1PXB A;  4GDP A;  3DJD A;  3CNP A;  1ZOV A;  1CC2 A;  1EL9 A;  1JNZ A;  4H4Z A;  3RP8 A;  2WS3 A;  1GEU A;  3GYI A;  4TLX A;  4B63 A;  3KA7 A;  3GWF A;  4JNQ A;  3GMB A;  1YY5 A;  2NVK X;  4A7A A;  5BVA A;  3V3N A;  4AP1 A;  4EQS A;  1QO8 A;  3AB1 A;  2WOI A;  2WP9 A;  3CNS A;  5U63 A;  3E1T A;  1RP0 A;  2B9X A;  2WOV A;  4U8O A;  3ALL A;  2AQJ A;  4JQ9 A;  2R0C A;  3NRN A;  3OZ2 A;  3BHK A;  3SM8 A;  2GQW A;  2RAB A;  3VR8 A;  1N4V A;  3NYF A;  2ZZ0 A;  4RSL A;  2C64 A;  2YLW A;  2Q6U A;  1D7Y A;  4TM1 A;  3GD3 A;  4B64 A;  5HY5 A;  2B7R A;  2VRL A;  3ATQ A;  2YAU A;  1MOK A;  4H2N A;  1CC6 A;  1XHC A;  4BK3 A;  2V3B A;  3HYX A;  2TPR A;  2YLS A;  1PBE A;  2O9Z A;  2ZZB A;  4O5U A;  3SQP A;  1JEH A;  3UP4 A;  3UTF A;  4K8D A;  1L9D A;  5FS7 A;  1JNR A;  2FBW A;  4NNJ A;  4H4W A;  4Z26 A;  3NTD A;  3LOV A;  3T0K A;  2BK5 A;  1XDI A;  2R4J A;  2C76 A;  1CJ2 A;  1K0J A;  2XCG A;  2YR5 A;  1D4E A;  3VRB A;  1M64 A;  1D4D A;  1NEN A;  2JB2 A;  3DK4 A;  4CNJ A;  3NYE A;  4C5O A;  2CDU A;  4IA5 A;  1Y56 B;  3CTY A;  3K7M X;  3QSE A;  5KMS A;  4BV6 A;  3II4 A;  2ZZC A;  3NNE A;  4GUV A;  3V3O A;  3T2K A;  4Z25 A;  2ARD A;  4IVO B;  3UOX A;  4YSH A;  5KOX A;  1LV0 A;  3BNU A;  3CN8 A;  3KVE A;  3GYX A;  4ICY A;  3LZX A;  1GRB A;  2B9Y A;  4N9X A;  1Q9I A;  3DK9 A;  4B69 A;  4EQR A;  2AAQ A;  3GWD A;  3NN0 X;  3QFB A;  4H50 A;  1FEB A;  1CBO A;  2WDR A;  2V5Z A;  1ZMD A;  3IC9 A;  5EB5 A;  1D4C A;  1PJ5 A;  1N4W A;  3CMM A;  1BWC A;  2V61 A;  3SXI A;  2JBV A;  3ICT A;  2DKI A;  3AEB A;  3GRT A;  3LJP A;  4LA1 A;  4B67 A;  2R9Z A;  1BGJ A;  4UDR A;  3F8P A;  3H8I A;  3NLC A;  4CY6 A;  1GND A;  1LVL A;  1E1M A;  3AXB A;  1NG3 A;  1F3P A;  2BCP A;  1TDE A;  2BK3 A;  1IJH A;  4NWZ A;  4A6N B;  1W4X A;  2XVH A;  2YG3 A;  5HYM A;  1ZKQ A;  3SX6 A;  3CND A;  3PO7 A;  5U25 A;  3SFE A;  3AE8 A;  4Z44 A;  3NN6 X;  1S3B A;  2C70 A;  1BZL A;  4OPC A;  2WPF A;  3T2Z A;  3EAN A;  1S3E A;  4MJW A;  4EIP A;  2Q0L A; 
#chains in the Genus database with same CATH homology
 4TM0 A;  5M0Z A;  1D7L A;  3CGE A;  3QVP A;  4JY3 A;  5CQF A;  2CUL A;  1H6V A;  4OPU A;  5JCK A;  2OLO A;  4B66 A;  1S2Y A;  4H4Q A;  4AT2 A;  2GAG B;  4GAV A;  4NEV A;  3M13 A;  2X8C A;  3DK8 A;  3SGL A;  1FL2 A;  2WU2 A;  3UOZ A;  4CRT A;  4X4J A;  3D1C A;  5JCM A;  2YVF A;  4BUR A;  1LQU A;  5HXI A;  4EMJ A;  3DH9 A;  1Q1R A;  3BHF A;  4Z2R A;  4A9W A;  2GR3 A;  4X9N A;  1OJA A;  3UTH A;  4A79 A;  5KOW A;  4EQW A;  2A89 A;  1NHS A;  2VRM A;  2RGO A;  4NTE A;  2GQF A;  1GT8 A;  2BA9 A;  4Y4M A;  2VQB A;  3BI4 A;  3OC4 A;  5LV9 A;  4YTM A;  1H7X A;  3KD9 A;  3AYI A;  3L8K A;  3UCL A;  5KNL A;  1DOB A;  3IHG A;  5BUL A;  1IUT A;  2OA1 A;  2QA2 A;  1CHU A;  4WCT A;  2VVM A;  2FJE A;  2X8G A;  5FMH A;  4LU6 A;  2BYB A;  2IID A;  2RGJ A;  2C67 A;  1JRY A;  3UKF A;  1NHP A;  1LJ1 A;  3UKA A;  2YLR A;  3UTG A;  1O95 A;  4ADW A;  4BJZ A;  2YVG A;  1E1L A;  2XLR A;  1PDH A;  1H81 A;  1NEK A;  3ALJ A;  2WET A;  2VVL A;  3LAD A;  3ZYX A;  2VVL G;  2C75 A;  4EQX A;  1B8S A;  4B1B A;  1KSS A;  2XYO A;  2ZBW A;  3G5S A;  3CGB A;  4EM4 A;  2C66 A;  2NPX A;  3DGZ A;  1XPQ A;  3NTA A;  3VRD B;  3ZDN A;  3C96 A;  4ECH A;  3AD9 B;  3NHO X;  4O5Q A;  1TYT A;  3DGH A;  2H89 A;  2EQ8 A;  2FJB A;  1UKV G;  5HHF A;  2RGH A;  3KU9 A;  3BI5 A;  2YLZ A;  4X9M A;  4GRT A;  4Y4N A;  3SYI A;  3B3R A;  2YG6 A;  4ZN0 A;  5J60 A;  2C3C A;  5BUK A;  2YVJ A;  1BKW A;  1CJC A;  1GTE A;  1V59 A;  1CJ3 A;  1OJT A;  1XAN A;  3AEG A;  3M0O A;  4J56 A;  4JNA A;  1F8W A;  2Y6Q A;  2YG4 A;  4J33 A;  4WX1 A;  4DSG A;  3AD7 B;  3DME A;  2J3N A;  3G5Q A;  1B37 A;  1LPF A;  1M6I A;  3NK1 X;  3SZF A;  3HYV A;  3AE3 A;  4CY8 A;  5JCL A;  2GR2 A;  2GVC A;  2TMD A;  1F6M A;  4IVM B;  3QVR A;  3AE6 A;  4G73 A;  2WHD A;  2VQ7 A;  4CCR A;  4CNK A;  4YTP A;  1E7P A;  2XLU A;  4H4T A;  1GV4 A;  3HYW A;  2XFO A;  3CNT A;  4K5S A;  1L9E A;  4H7U A;  4H2Q A;  4NZH A;  4UDQ A;  4USR A;  4D03 A;  2YQU A;  3CIR A;  2BXR A;  1Q1W A;  4JDR A;  1D5T A;  1PBF A;  1L0V A;  3AE1 A;  3UTE A;  2JKC A;  2F5Z A;  3AED A;  2A8X A;  2R0P A;  3NH3 X;  1PBD A;  2X3N A;  5KRQ A;  4U2S A;  3IF9 A;  2YR6 A;  1H86 A;  3AE4 A;  4YXD A;  4GAP A;  4I58 A;  2FJD A;  2R4E A;  1ZDL A;  2GF3 A;  3DJJ A;  1F8S A;  4RG3 A;  2XVF A;  1PBC A;  4YSY A;  3ICS A;  5KWF A;  1VDC A;  1GTH A;  4LII A;  5J7X A;  1N1P A;  1YQ4 A;  2WPC A;  1GRF A;  4I59 A;  2WU5 A;  3DA1 A;  4YKG A;  2C4C A;  4J36 A;  2XLT A;  1PXA A;  4G6G A;  4H4U A;  3KLJ A;  3LZW A;  1L9C A;  1IUW A;  2GMH A;  4Z2T A;  3EPT A;  5KMQ A;  4JN9 A;  3UKL A;  4CBQ A;  4OPI A;  1X31 B;  4P9S A;  2A87 A;  3RP7 A;  4DNA A;  1K0I A;  2YWL A;  1H83 A;  3RED A;  3H4K A;  2PYX A;  4E0V A;  2IVD A;  3AYL A;  1YQZ A;  1F8R A;  3NT6 A;  1ZX9 A;  4YSZ A;  3IWA A;  1ZOY A;  2Z5Y A;  4K7Z A;  4PAA A;  1IUU A;  2APG A;  3NYC A;  1PBB A;  2GR1 A;  3QJ4 A;  2E4G A;  1LTX R;  1KSU A;  5JCI A;  5GSN A;  4FX9 A;  4Z2U A;  1H82 A;  1Y0P A;  2C72 A;  1KNR A;  1GER A;  4REK A;  5FS9 A;  3CGD A;  1MO9 A;  3JSK A;  4GCM A;  3UOY A;  1FEA A;  1ONF A;  3RNM A;  3ALM A;  5FS8 A;  1CF3 A;  4B65 A;  3S61 A;  1Z6L A;  1IUX A;  2B9W A;  2YG7 A;  3AD8 B;  3K30 A;  3NIX A;  3P4R A;  3T31 A;  5EB4 A;  3GDP A;  3ICR A;  3S5W A;  2BS3 A;  1CC4 A;  3CPI G;  3PS9 A;  3QFA A;  4GR1 A;  4ZCC A;  4Z43 A;  1JRX A;  2EQ7 A;  3Q6J A;  4RG4 A;  2OAM A;  3SFD A;  3SY4 A;  3I3L A;  4OPL A;  2R45 A;  1PHH A;  2CVJ A;  3ITJ A;  4NEW A;  2H88 A;  3SZC A;  2GRT A;  4KPR A;  1KNP A;  2EQ6 A;  1GPE A;  2E5V A;  3WE0 A;  1QJD A;  2WPE A;  3T2Y A;  2WP5 A;  3ABV A;  2DKH A;  5KMR A;  4H4S A;  5DBJ A;  2V6O A;  4J57 A;  2JB1 A;  1DOC A;  2CFY A;  3I6D A;  2WQY A;  4IA6 A;  3UKQ A;  2WBA A;  2JB3 A;  1YQ3 A;  2WP6 A;  4FK1 A;  4GDE A;  2X8H A;  1FOH A;  2BCG G;  2UZZ A;  4H2P A;  4U8J A;  5KVH A;  4NTD A;  4IV9 A;  1ZY8 A;  3M12 A;  5EOW A;  4APN A;  2XVE A;  3QSS A;  1SEZ A;  2YLX A;  4B68 A;  1GET A;  1VG0 A;  2WDQ A;  2YG5 A;  2BS2 A;  2GV8 A;  2BAC A;  2BRY A;  4U8K A;  2XFQ A;  3P4S A;  1YKJ A;  4G74 A;  2WEU A;  1ZK7 A;  2AR8 A;  2JK6 A;  4M52 A;  3Q9T A;  4USQ A;  2YR4 A;  1P2E A;  4C3Y A;  1PJ6 A;  1TDK A;  4HA6 A;  4UDP A;  3P4P A;  2B76 A;  4U2L A;  4Y4L A;  2BXS A;  3C4A A;  4ZCD A;  1IUS A;  3K7Q X;  4TM3 A;  2GR0 A;  3C4N A;  5JCN A;  3CGC A;  3GSI A;  4XWZ A;  5KXJ A;  1O94 A;  4H4Y A;  1LQT A;  4OCG A;  3EAO A;  4OPG A;  1CJ4 A;  1GRT A;  1Y56 A;  3UP5 A;  3IHM A;  4GF7 A;  3L1R A;  4JY2 A;  4H4V A;  1O5W A;  4H4R A;  1GAL A;  2X99 A;  1EL7 A;  3SZW A;  3GYJ A;  1K0L A;  4J31 A;  2E1M A;  3EF6 A;  2Z5X A;  1MXT A;  1H84 A;  4K2X A;  5CKU A;  1E39 A;  2HQM A;  3GRS A;  3GDN A;  2ACZ A;  1NHR A;  3V76 A;  5M10 A;  3PVC A;  4G6H A;  2GH5 A;  3UKH A;  4OVI A;  3KKJ A;  4TM4 A;  1PXC A;  2XLS A;  2GMJ A;  4KX6 A;  1NPX A;  2GAH B;  4EM3 A;  4U2T A;  5ER0 A;  4C74 A;  1JU2 A;  1QLB A;  3K7T A;  1FEC A;  4YTN A;  2WDV A;  3P4Q A;  2GB0 A;  4XXG A;  1NG4 A;  2JAE A;  4A99 A;  4YT0 A;  4H2R A;  3VRA A;  3BNM A;  4A6N A;  2XFP A;  2XDO A;  4AP3 A;  4BJY A;  1BF3 A;  4BK1 A;  2C65 A;  5FS6 A;  4NTC A;  4A65 A;  3AEE A;  3LXD A;  3FMW A;  3COX A;  4FDC B;  3FBS A;  5GRT A;  2QA1 A;  2V60 A;  2BC1 A;  3T37 A;  2QAE A;  3LB8 A;  1E1K A;  3F8R A;  1RSG A;  1GXF A;  4HB9 A;  2C73 A;  2YM2 A;  3D8X A;  3FPZ A;  4II3 A;  3DJE A;  1DJN A;  2PHH A;  1P2H A;  1PS9 A;  4U8L A;  4AT0 A;  4DSH A;  5KMP A;  2B7S A;  4EMW A;  4A5L A;  2W0H A;  3NG7 X;  3CPJ G;  4OPT A;  3VQR A;  2Y6R A;  1HYU A;  1RYI A;  3H8L A;  2BK4 A;  5L46 A;  2YM1 A;  1KFY A;  2XLP A;  4U8P A;  5IQ1 A;  2OLN A;  3AE2 A;  2XVJ A;  1JRZ A;  1H7W A;  3CNJ A;  4C3X A;  2WOW A;  4FK1 C;  4D04 A;  4U8M A;  2BAB A;  3T14 A;  3AWI A;  4YSX A;  4EMI A;  3AE9 A;  3BI2 A;  3QSM A;  4C77 A;  2R46 A;  1N4U A;  3F8D A;  4H4P A;  3VR9 A;  4TLZ A;  4Z24 A;  1GRG A;  1DJQ A;  3SZ0 A;  2WES A;  2IVE A;  1TDF A;  3AEC A;  1ELI A;  3B6D A;  3CPH G;  3ISH A;  1GRE A;  1B4V A;  1EBD A;  1DOE A;  1ZMC A;  1GRH A;  2EQ9 A;  2V3A A;  4J34 A;  5IQ4 A;  3UKP A;  3DJG X;  4DGK A;  1K4Q A;  1REO A;  1GOS A;  1NHQ A;  1B5Q A;  3NGC X;  1TDO A;  2C3D A;  3AYJ A;  4CCQ A;  1OJD A;  2XFN A;  1IUV A;  3ADA B;  1FCD A;  3GMC A;  4XWR A;  1E1N A;  4EIQ A;  1TYP A;  4H4X A;  3RHA A;  2I0Z A;  4II2 A;  4PAB A;  1NDA A;  1GES A;  2VOU A;  1GRA A;  5IPY A;  1PJ7 A;  3NK2 X;  3G5R A;  3RP6 A;  2XVI A;  5C2T A;  5U1O A;  1PN0 A;  1DNC A;  4K22 A;  4OPD A;  2BRA A;  1VQW A;  3O0H A;  4G9K A;  3R9U A;  5EBK A;  1KF6 A;  1DOD A;  2BS4 A;  1EL8 A;  2GEW A;  3UKK A;  2X50 A;  3AE7 A;  1ZP0 A;  1E6E A;  1VRQ B;  3P1W A;  3KPK A;  2R0G A;  2C7G A;  4U8I A;  3KPF A;  3GD4 A;  1TRB A;  1VG9 A;  2QCU A;  3AEA A;  4AOS A;  2Q7V A;  1NAA A;  2OAL A;  1GSN A;  3FG2 P;  4AOX A;  3NK0 X;  3ATR A;  5C3J A;  1JOA A;  1OJ9 A;  1KDG A;  4U8N A;  4YKF A;  2Q0K A;  5BRT A;  2VZ2 A;  1TDN A;  3NKS A;  3P9U A;  1DXL A;  1COY A;  2YLT A;  4UP3 A;  3URH A;  3FIM B;  1AOG A;  3AEF A;  4K5R A;  1S2Q A;  2FJA A;  1BGN A;  4YWO A;  5TR3 A;  5KVI A;  1EL5 A;  1CL0 A;  4J2W A;  1OJC A;  3UOV A;  4BK2 A;  2XFU A;  3HZL A;  2BC0 A;  3AE5 A;  1PXB A;  4GDP A;  3DJD A;  3CNP A;  1ZOV A;  1CC2 A;  1EL9 A;  1JNZ A;  4H4Z A;  3RP8 A;  2WS3 A;  1GEU A;  3GYI A;  4TLX A;  4B63 A;  3KA7 A;  3GWF A;  4JNQ A;  3GMB A;  1YY5 A;  2NVK X;  4A7A A;  5BVA A;  3V3N A;  4AP1 A;  4EQS A;  1QO8 A;  3AB1 A;  2WOI A;  2WP9 A;  3CNS A;  5U63 A;  3E1T A;  1RP0 A;  2B9X A;  2WOV A;  4U8O A;  3ALL A;  2AQJ A;  4JQ9 A;  2R0C A;  3NRN A;  3OZ2 A;  3BHK A;  3SM8 A;  2GQW A;  2RAB A;  3VR8 A;  1N4V A;  3NYF A;  2ZZ0 A;  4RSL A;  2C64 A;  2YLW A;  2Q6U A;  1D7Y A;  4TM1 A;  3GD3 A;  4B64 A;  5HY5 A;  2B7R A;  2VRL A;  3ATQ A;  2YAU A;  1MOK A;  4H2N A;  1CC6 A;  1XHC A;  4BK3 A;  2V3B A;  3HYX A;  2TPR A;  2YLS A;  1PBE A;  2O9Z A;  2ZZB A;  4O5U A;  3SQP A;  1JEH A;  3UP4 A;  3UTF A;  4K8D A;  1L9D A;  5FS7 A;  1JNR A;  2FBW A;  4NNJ A;  4H4W A;  4Z26 A;  3NTD A;  3LOV A;  3T0K A;  2BK5 A;  1XDI A;  2R4J A;  2C76 A;  1CJ2 A;  1K0J A;  2XCG A;  2YR5 A;  1D4E A;  3VRB A;  1M64 A;  1D4D A;  1NEN A;  2JB2 A;  3DK4 A;  4CNJ A;  3NYE A;  4C5O A;  2CDU A;  4IA5 A;  1Y56 B;  3CTY A;  3K7M X;  3QSE A;  5KMS A;  4BV6 A;  3II4 A;  2ZZC A;  3NNE A;  4GUV A;  3V3O A;  3T2K A;  4Z25 A;  2ARD A;  4IVO B;  3UOX A;  4YSH A;  5KOX A;  1LV0 A;  3BNU A;  3CN8 A;  3KVE A;  3GYX A;  4ICY A;  3LZX A;  1GRB A;  2B9Y A;  4N9X A;  1Q9I A;  3DK9 A;  4B69 A;  4EQR A;  2AAQ A;  3GWD A;  3NN0 X;  3QFB A;  4H50 A;  1FEB A;  1CBO A;  2WDR A;  2V5Z A;  1ZMD A;  3IC9 A;  5EB5 A;  1D4C A;  1PJ5 A;  1N4W A;  3CMM A;  1BWC A;  2V61 A;  3SXI A;  2JBV A;  3ICT A;  2DKI A;  3AEB A;  3GRT A;  3LJP A;  4LA1 A;  4B67 A;  2R9Z A;  1BGJ A;  4UDR A;  3F8P A;  3H8I A;  3NLC A;  4CY6 A;  1GND A;  1LVL A;  1E1M A;  3AXB A;  1NG3 A;  1F3P A;  2BCP A;  1TDE A;  2BK3 A;  1IJH A;  4NWZ A;  4A6N B;  1W4X A;  2XVH A;  2YG3 A;  5HYM A;  1ZKQ A;  3SX6 A;  3CND A;  3PO7 A;  5U25 A;  3SFE A;  3AE8 A;  4Z44 A;  3NN6 X;  1S3B A;  2C70 A;  1BZL A;  4OPC A;  2WPF A;  3T2Z A;  3EAN A;  1S3E A;  4MJW A;  4EIP A;  2Q0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...