2XVHA

Crystal structure of bacterial flavin containing monooxygenase in complex with nadp
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 161
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA02
1NG4A 1QLBA 5KVHA 4CCQA 1Y0PA 3UKAA 3URHA 4JN9A 3AD9B 3AYLA 2XLTA 3UKPA 2H89A 3BHFA 3NN0X 3II4A 1PDHA 3V76A 1VG0A 3SFDA 1GV4A 4Z2UA 3QSMA 3IWAA 1ONFA 2JB2A 3E1TA 2B7SA 5FS8A 4H4XA 4J34A 3ALJA 2WHDA 2JAEA 4NTDA 3FBSA 1D7YA 1V59A 3CPIG 4JNQA 1E1LA 2BK5A 1KSUA 1E1KA 2YG5A 1S2QA 3OC4A 3M13A 4Z2TA 4RG4A 1N1PA 2YVJA 4J36A 4H4RA 3UCLA 2C67A 2AR8A 3NK1X 4CRTA 3LOVA 3DK8A 4JNAA 4YWOA 4U8IA 1GREA 4EMIA 1CBOA 1L0VA 5JCNA 2O9ZA 4A6NA 1YQZA 1PXBA 2PHHA 3BI4A 1PBFA 4H4TA 3Q6JA 4MJWA 3Q9TA 3UP4A 1FEBA 1L9CA 3KPFA 2YVGA 3FIMB 3OZ2A 4ICYA 3C4AA 4M52A 4BK2A 1FCDA 2WBAA 4JY2A 3ICTA 1H82A 1TDEA 3CNPA 3D1CA 3AE4A 2C66A 2X8CA 2YG7A 2YR4A 3ATRA 2R0CA 1H7XA 1ZMCA 2JB1A 4XWRA 2X50A 2DKIA 3FG2P 3REDA 1GRFA 2RGOA 4A7AA 4GRTA 3GD4A 3AEEA 4YTNA 2EQ6A 3AWIA 4C77A 1PJ7A 3ABVA 1OJAA 2X3NA 2C76A 4C74A 1LTXR 3DH9A 3DJGX 2VVMA 2QA1A 4J33A 1ZY8A 2F5ZA 4DNAA 3GMCA 5HXIA 2GQFA 4D04A 3KD9A 4NTCA 4J2WA 3SM8A 2YR5A 3IF9A 4FX9A 4JY3A 1ZOYA 3LZXA 1UKVG 2C65A 3UKKA 1F6MA 1VRQB 4YTMA 3LZWA 4UDRA 5M0ZA 5JCKA 3EAOA 3GDNA 4USQA 1GTEA 1N4WA 2ZZBA 3GDPA 3UKQA 4YSHA 4Y4LA 2GF3A 2WOVA 3AE2A 1D4EA 1PS9A 4K7ZA 5IQ4A 3ISHA 3F8PA 5U63A 2XLPA 4EM4A 2FJDA 1PBCA 5J7XA 1Y56A 4H4WA 3NH3X 1NDAA 1F3PA 3RP6A 4Z26A 2YLZA 4AP3A 3AD7B 1CC6A 4EMWA 1GRGA 1S2YA 5HY5A 1CC2A 1CHUA 4B1BA 2OAMA 2WESA 1OJTA 4B69A 5CKUA 1NHSA 1IUUA 1CJCA 2R4JA 4B67A 1TDFA 3P4RA 1GSNA 2V60A 1DODA 1EL7A 2BYBA 2XLUA 1LV0A 1H84A 2JKCA 1GOSA 2BABA 2APGA 2Q0LA 2UZZA 2E5VA 3AE5A 2PYXA 3LXDA 1W4XA 3UOVA 4IVOB 4U2SA 4H4YA 3QJ4A 2R45A 3GYIA 3NN6X 2QA2A 4BURA 3AXBA 3QFBA 1GRHA 2WS3A 4DSHA 1DJQA 1CJ3A 4YSZA 2Z5YA 4K5SA 1O94A 4USRA 5CQFA 2GVCA 2EQ8A 1XPQA 3VRDB 2C72A 4RSLA 1K0IA 4GR1A 4U8JA 2ACZA 3ZYXA 2WEUA 4Z25A 3AEGA 3WE0A 2GR1A 4OPDA 3P4PA 2VQ7A 2YM2A 1ZMDA 3VRBA 3NYFA 1B8SA 1FEAA 2XFNA 3AE6A 4ZCCA 2BK4A 5HYMA 2QAEA 4U8LA 3NGCX 1CJ4A 3FPZA 3QVPA 4Z43A 2V61A 3COXA 4IA6A 1NHPA 3ALLA 3NTDA 3EF6A 3QVRA 1N4UA 1PXCA 2YG3A 3NYCA 4DSGA 1B5QA 2B9YA 1EL8A 3EPTA 1KDGA 3ITJA 1IJHA 1DOCA 4ZCDA 2YM1A 2CULA 1K4QA 1YKJA 4EMJA 1AOGA 1BGNA 1PJ6A 2GAHB 2YAUA 2XFQA 3HZLA 3NKSA 3P4QA 5KXJA 2EQ9A 3UTHA 4YT0A 5J60A 2BS4A 3NYEA 5LV9A 1BWCA 2XCGA 1PHHA 3VQRA 2WETA 2YQUA 4OVIA 3CGEA 2OA1A 4H2RA 2E1MA 1CJ2A 2EQ7A 2NVKX 1IUVA 1F8WA 2FJAA 2YVFA 3I3LA 3V3NA 2R46A 3DJDA 4OPGA 2B9WA 4TM1A 1Q1WA 1D7LA 1TYPA 1NHQA 2IIDA 4NEWA 1EL9A 4P9SA 4GDPA 3GSIA 3M12A 1OJDA 3O0HA 5FS7A 3RP8A 2GR3A 1LPFA 4FDCB 4C5OA 1CF3A 3I6DA 4AOSA 2XVEA 1BZLA 3S5WA 3UKLA 2Q6UA 4J31A 4NEVA 2YLRA 1Q1RA 3H8IA 2R9ZA 5IPYA 3FMWA 4FK1C 1NG3A 1LVLA 2C7GA 4X9MA 2VRMA 1K0LA 4LIIA 1LJ1A 4U8OA 2XDOA 4HA6A 2WU5A 1DJNA 2VVLA 4H4VA 3CN8A 4ECHA 4U8PA 2R0PA 2OALA 2ARDA 2XYOA 3G5RA 2WQYA 3CIRA 1P2HA 4O5UA 2WDRA 4BJZA 1GRAA 2V6OA 4A99A 1JRXA 4CNJA 1RYIA 4H4QA 2XLRA 3GRTA 3NG7X 2BK3A 1FECA 1REOA 3VR9A 5ER0A 3NT6A 3EANA 5KVIA 1DOBA 5BRTA 2WPFA 5FMHA 3QSSA 4X9NA 4Z2RA 1FL2A 1ZOVA 3DK4A 1L9EA 1JEHA 1GESA 2WU2A 3NLCA 4CCRA 4EIQA 1TRBA 2YLTA 1ELIA 4K8DA 2DKHA 2BCPA 4DGKA 1OJCA 2GMJA 3UTEA 3P1WA 4I59A 1JNZA 4IVMB 2C73A 2IVDA 3AE7A 4EQWA 3BI5A 5FS6A 3DGHA 2XFOA 4U8NA 4ADWA 4APNA 4IV9A 2GR2A 2C75A 1ZKQA 3CGBA 2BXSA 2VRLA 3DJJA 4YKGA 4B64A 4X4JA 3UOZA 1DOEA 4GUVA 1GALA 2E4GA 5L46A 1IUWA 2GB0A 2VVLG 3AYIA 3B6DA 3CPHG 3SQPA 2YLXA 4OPLA 2BC0A 2TMDA 3CPJG 3UKFA 2A87A 4AP1A 4GCMA 2I0ZA 1ZDLA 4J57A 1GERA 4WX1A 4CBQA 3NTAA 1N4VA 3KVEA 3GMBA 3LB8A 5IQ1A 3UP5A 1O95A 4U2TA 3H8LA 1F8RA 3LJPA 2WDQA 4A79A 2H88A 3S61A 1GRBA 1JRZA 4GF7A 1B37A 1QJDA 2FJBA 1M64A 2WP5A 2XVJA 4N9XA 2X99A 3BHKA 2BXRA 4TLZA 3IHGA 1QO8A 4OPUA 1O5WA 4PAAA 5BUKA 3PVCA 4Z24A 1F8SA 2WPCA 2A89A 4GDEA 4AOXA 2OLNA 3SGLA 2R0GA 2WOIA 1BGJA 3CGCA 3GRSA 4UP3A 4BK1A 3ICRA 4EQRA 2QCUA 4KPRA 3ALMA 3DA1A 1PBDA 3CTYA 1JNRA 3DMEA 1E1MA 4TLXA 3B3RA 4J56A 5JCLA 4WCTA 5U1OA 3JSKA 3QSEA 4OPIA 5GSNA 5KWFA 1P2EA 4BK3A 1IUSA 3AE8A 3P4SA 4K22A 3G5QA 3VR8A 3AE1A 5C3JA 4JDRA 2ZZCA 1H83A 3UOXA 2B9XA 1E1NA 1X31B 4U2LA 4YXDA 2XVFA 3C96A 3CNDA 1PBBA 1NAAA 2NPXA 1JU2A 1ZX9A 3GWFA 3SFEA 2W0HA 3NRNA 3C4NA 3UKHA 2Q0KA 4XXGA 3KKJA 4C3XA 3CNJA 2YG4A 1PXAA 2Q7VA 1ZK7A 3P9UA 3AE3A 3NIXA 4H4PA 2YLWA 5JCIA 3KA7A 4H4ZA 1JRYA 2JB3A 3K7MX 1FOHA 1H6VA 5M10A 4H2PA 3ZDNA 2X8GA 3VRAA 1GPEA 5BVAA 1XDIA 4AT2A 4UDPA 1VQWA 2GMHA 5EB5A 2GEWA 2C64A 1EL5A 3ICSA 2AQJA 1BF3A 3ATQA 4IA5A 1PN0A 4ZN0A 3R9UA 4EIPA 4YSXA 2GAGB 4H4UA 1KNRA 5KOWA 3DK9A 3T37A 2R4EA 3NHOX 2GRTA 3BNMA 5KRQA 3UTGA 3NK2X 2Y6RA 1E39A 1YQ3A 3RP7A 1H7WA 1DNCA 3IC9A 1VG9A 1DXLA 1PJ5A 5EB4A 1D4CA 4Y4MA 3LADA 4Z44A 4B66A 4B68A 2AAQA 3K7QX 4TM4A 4BJYA 2C70A 4NTEA 5C2TA 2XVHA 4LA1A 3L1RA 1NHRA 2B76A 5KOXA 5EBKA 1CL0A 1HYUA 4B65A 3AD8B 4FK1A 1NENA 1D4DA 1E7PA 1EBDA 1XANA 3G5SA 2OLOA 1JOAA 3AE9A 3AYJA 1RP0A 3KLJA 2YG6A 3CNTA 1IUTA 4YSYA 2BACA 2VOUA 1CC4A 1XHCA 4RG3A 3RNMA 5GRTA 2CDUA 2V3BA 3DJEA 2FJEA 3AB1A 2ZBWA 1GNDA 1MXTA 1ZP0A 4NZHA 4BV6A 4EM3A 1GTHA 4YTPA 2BC1A 4K2XA 2BCGG 1BKWA 1COYA 1VDCA 1D5TA 1H81A 3CGDA 5U25A 2WP6A 3AEDA 3UOYA 2YLSA 2YWLA 1GT8A 4TM3A 1S3EA 3RHAA 2GH5A 2GQWA 5TR3A 5EOWA 3BNUA 1OJ9A 4O5QA 1Q9IA 2GR0A 3PS9A 4OPTA 2V5ZA 4CNKA 1KSSA 1YQ4A 2BS3A 4XWZA 4AT0A 1TDKA 1KNPA 2J3NA 1E6EA 4A6NB 2WP9A 1GRTA 1H86A 1NPXA 2WOWA 4REKA 3V3OA 2A8XA 4EQXA 3AEFA 2BS2A 5BULA 5JCMA 4K5RA 4HB9A 2C3DA 1L9DA 2VZ2A 4U8KA 4KX6A 4PABA 2RGJA 2B7RA 3GYJA 5DBJA 2YR6A 3K30A 4Y4NA 1LQUA 4A5LA 1YY5A 3L8KA 2HQMA 4H50A 3DGZA 2WDVA 3AEAA 1KF6A 4CY6A 3KU9A 3D8XA 2Z5XA 1MOKA 1LQTA 3M0OA 3IHMA 2GV8A 3K7TA 3H4KA 1Z6LA 3F8RA 3UTFA 1KFYA 2WPEA 4TM0A 4H4SA 2XVIA 2BA9A 2X8HA 4YKFA 2VQBA 4I58A 4B63A 1TYTA 2XFPA 1IUXA 4LU6A 2FBWA 5FS9A 1M6IA 1K0JA 4H2NA 4JQ9A 1NEKA 1RSGA 1TDNA 1GXFA 2RGHA 4A65A 1S3BA 1GEUA 2V3AA 2CFYA 4H7UA 1TDOA 4U8MA 1MO9A 1PBEA 4OPCA 2Y6QA 2TPRA 1SEZA 2C3CA 2CVJA 3AECA 3AEBA 3GD3A 3NK0X 4CY8A 3ADAB 2IVEA 2JBVA 3F8DA 4UDQA 4C3YA 4D03A 2ZZ0A 4H2QA 4E0VA 4EQSA 1B4VA 4OCGA 3QFAA 4A9WA 1Y56B 3NNEA 2XLSA 1GETA 2JK6A 5HHFA 3PO7A 3BI2A 2RABA 2XFUA 3GWDA 3CNSA
chains in the Genus database with same CATH superfamily
1NG4A 1QLBA 5KVHA 4CCQA 1Y0PA 3UKAA 3URHA 4JN9A 3AD9B 3AYLA 2XLTA 3UKPA 2H89A 3BHFA 3NN0X 3II4A 1PDHA 3V76A 1VG0A 3SFDA 1GV4A 4Z2UA 3QSMA 3IWAA 1ONFA 2JB2A 3E1TA 2B7SA 5FS8A 4H4XA 4J34A 3ALJA 2WHDA 2JAEA 4NTDA 3FBSA 1D7YA 1V59A 3CPIG 4JNQA 1E1LA 2BK5A 1KSUA 1E1KA 2YG5A 1S2QA 3OC4A 3M13A 4Z2TA 4RG4A 1N1PA 2YVJA 4J36A 4H4RA 3UCLA 2C67A 2AR8A 3NK1X 4CRTA 3LOVA 3DK8A 4JNAA 4YWOA 4U8IA 1GREA 3T0KA 1CBOA 1L0VA 4EMIA 2O9ZA 5JCNA 4A6NA 1YQZA 1PXBA 2PHHA 3BI4A 1PBFA 4H4TA 3Q6JA 4MJWA 3Q9TA 3UP4A 1FEBA 1L9CA 3KPFA 2YVGA 3FIMB 3OZ2A 4ICYA 3C4AA 4M52A 4BK2A 1FCDA 2WBAA 4JY2A 3ICTA 1H82A 1TDEA 3CNPA 3D1CA 3AE4A 3SZWA 2C66A 3SYIA 2X8CA 2YG7A 2YR4A 3ATRA 2R0CA 1H7XA 1ZMCA 2JB1A 4XWRA 2X50A 2DKIA 3FG2P 3REDA 1GRFA 2RGOA 4A7AA 4GRTA 3GD4A 3AEEA 4YTNA 2EQ6A 3AWIA 4G74A 4C77A 1PJ7A 3ABVA 1OJAA 2X3NA 2C76A 4C74A 1LTXR 3DH9A 3DJGX 2VVMA 2QA1A 4J33A 1ZY8A 2F5ZA 4DNAA 3GMCA 5HXIA 2GQFA 4D04A 3KD9A 4NTCA 4J2WA 3SM8A 2YR5A 3IF9A 4FX9A 4JY3A 1ZOYA 3LZXA 1UKVG 2C65A 3UKKA 1F6MA 1VRQB 4YTMA 3LZWA 4UDRA 5M0ZA 5JCKA 3EAOA 3GDNA 4USQA 1GTEA 1N4WA 2ZZBA 3GDPA 3UKQA 4YSHA 4Y4LA 2GF3A 2WOVA 3AE2A 1D4EA 1PS9A 3CMMA 4K7ZA 5IQ4A 3ISHA 3F8PA 5U63A 3SZ0A 2XLPA 4EM4A 2FJDA 1PBCA 5J7XA 1Y56A 4H4WA 3NH3X 1NDAA 1F3PA 3RP6A 4Z26A 2YLZA 4GAVA 4AP3A 3AD7B 1CC6A 4EMWA 1GRGA 1S2YA 5HY5A 1CC2A 1CHUA 4B1BA 2OAMA 2WESA 1OJTA 4B69A 5CKUA 1NHSA 1IUUA 1CJCA 2R4JA 4B67A 1TDFA 3P4RA 4G73A 1GSNA 2V60A 1DODA 1EL7A 2BYBA 2XLUA 1LV0A 1H84A 2JKCA 1GOSA 2BABA 2APGA 2Q0LA 2UZZA 2E5VA 3AE5A 2PYXA 3LXDA 1W4XA 3UOVA 4IVOB 4U2SA 4H4YA 3QJ4A 2R45A 3GYIA 3NN6X 2QA2A 4BURA 3AXBA 3QFBA 1GRHA 2WS3A 4DSHA 1DJQA 1CJ3A 4YSZA 2Z5YA 4K5SA 1O94A 4USRA 5CQFA 2GVCA 2EQ8A 1XPQA 3VRDB 2C72A 4RSLA 1K0IA 4GR1A 4II2A 4U8JA 2ACZA 3ZYXA 2WEUA 4Z25A 3AEGA 3WE0A 2GR1A 4OPDA 3P4PA 2VQ7A 2YM2A 1ZMDA 3VRBA 3NYFA 1B8SA 1FEAA 2XFNA 3AE6A 4ZCCA 2BK4A 5HYMA 2QAEA 4U8LA 3NGCX 1CJ4A 3FPZA 3QVPA 4Z43A 2V61A 3COXA 4IA6A 1NHPA 3ALLA 3NTDA 3EF6A 3QVRA 1N4UA 3SXIA 1PXCA 2YG3A 3NYCA 4DSGA 1B5QA 2BRYA 2B9YA 1EL8A 3EPTA 1KDGA 3ITJA 1IJHA 1DOCA 4ZCDA 5KMPA 2YM1A 2CULA 1K4QA 1YKJA 4EMJA 1AOGA 1BGNA 1PJ6A 2GAHB 2YAUA 2XFQA 3HZLA 3NKSA 3P4QA 5KXJA 2EQ9A 3UTHA 4YT0A 5J60A 2BS4A 3NYEA 5LV9A 1BWCA 2XCGA 1PHHA 3VQRA 2WETA 2YQUA 4OVIA 3CGEA 2OA1A 4H2RA 2E1MA 1CJ2A 2EQ7A 2NVKX 1IUVA 1F8WA 2FJAA 2YVFA 3I3LA 3V3NA 2R46A 3DJDA 4OPGA 2B9WA 3HYWA 4TM1A 1Q1WA 1D7LA 1TYPA 1NHQA 2IIDA 4NEWA 1EL9A 4P9SA 4GDPA 3GSIA 3M12A 1OJDA 3O0HA 5FS7A 3RP8A 2GR3A 1LPFA 4FDCB 4C5OA 1CF3A 3I6DA 4AOSA 2XVEA 1BZLA 3S5WA 3UKLA 2Q6UA 4J31A 4NEVA 2YLRA 1Q1RA 3SZFA 3H8IA 2R9ZA 5IPYA 3FMWA 4FK1C 1NG3A 1LVLA 2C7GA 4X9MA 2VRMA 1K0LA 4LIIA 1LJ1A 4U8OA 2XDOA 4HA6A 2WU5A 1DJNA 2VVLA 4H4VA 3CN8A 3T2ZA 4ECHA 4U8PA 2R0PA 2OALA 2ARDA 2XYOA 3G5RA 2WQYA 3CIRA 1P2HA 4O5UA 2WDRA 4BJZA 1GRAA 2V6OA 4A99A 1JRXA 4CNJA 1RYIA 4H4QA 2XLRA 3GRTA 3NG7X 2BK3A 1FECA 1REOA 3VR9A 5ER0A 3NT6A 3EANA 5KVIA 1DOBA 5BRTA 2WPFA 5FMHA 3QSSA 4X9NA 4Z2RA 1FL2A 1ZOVA 3DK4A 1L9EA 1JEHA 1GESA 2WU2A 3NLCA 4CCRA 4EIQA 1TRBA 2YLTA 1ELIA 4K8DA 2DKHA 2BCPA 4DGKA 1OJCA 2GMJA 3UTEA 3T31A 3P1WA 4GAPA 4I59A 1JNZA 4IVMB 2C73A 2IVDA 3AE7A 4EQWA 3BI5A 5FS6A 3DGHA 2XFOA 4U8NA 4ADWA 4APNA 4IV9A 2GR2A 2C75A 1ZKQA 3CGBA 2BXSA 2VRLA 3DJJA 4YKGA 4B64A 4X4JA 3UOZA 1DOEA 4GUVA 1GALA 2E4GA 5L46A 1IUWA 2GB0A 2VVLG 3AYIA 3B6DA 3CPHG 3SQPA 4G6HA 2YLXA 4OPLA 2BC0A 2TMDA 3CPJG 3UKFA 2A87A 4AP1A 4GCMA 2I0ZA 1ZDLA 4NNJA 4J57A 1GERA 4WX1A 4CBQA 3NTAA 1N4VA 3KVEA 3GMBA 3LB8A 5IQ1A 3UP5A 1O95A 4U2TA 3H8LA 1F8RA 3LJPA 2WDQA 4A79A 2H88A 3S61A 1GRBA 1JRZA 4GF7A 1B37A 1QJDA 2FJBA 1M64A 2WP5A 2XVJA 4N9XA 2X99A 3BHKA 2BXRA 4TLZA 3IHGA 1QO8A 4OPUA 1O5WA 4PAAA 5BUKA 3PVCA 4Z24A 1F8SA 2WPCA 2A89A 4GDEA 4AOXA 2OLNA 3SGLA 2R0GA 2WOIA 1BGJA 3CGCA 3GRSA 4NWZA 4UP3A 3ICRA 4BK1A 4EQRA 2QCUA 4KPRA 3ALMA 3DA1A 1PBDA 3CTYA 1JNRA 3DMEA 3SY4A 1E1MA 4TLXA 3B3RA 4J56A 5JCLA 4WCTA 5U1OA 3JSKA 3QSEA 4OPIA 5GSNA 5KWFA 1P2EA 4BK3A 1IUSA 3AE8A 3P4SA 4K22A 3G5QA 3VR8A 3AE1A 5C3JA 3HYXA 2ZZCA 4JDRA 1H83A 3UOXA 2B9XA 1E1NA 1X31B 5KNLA 4U2LA 3SX6A 4YXDA 2XVFA 3C96A 3CNDA 1PBBA 1NAAA 2NPXA 1JU2A 1ZX9A 3GWFA 3SFEA 2W0HA 3NRNA 3C4NA 3UKHA 2Q0KA 4XXGA 3KKJA 4C3XA 3CNJA 2YG4A 1PXAA 2Q7VA 1ZK7A 3P9UA 3AE3A 3NIXA 4H4PA 2YLWA 5JCIA 3KA7A 4H4ZA 1JRYA 2JB3A 3K7MX 1FOHA 1H6VA 5KMSA 5M10A 4H2PA 3ZDNA 2X8GA 3VRAA 1GPEA 5BVAA 1XDIA 4AT2A 4UDPA 1VQWA 3GYXA 2GMHA 5EB5A 2GEWA 2C64A 1EL5A 3ICSA 2AQJA 1BF3A 3ATQA 4IA5A 1PN0A 4ZN0A 5KMRA 3R9UA 4EIPA 4YSXA 2GAGB 4H4UA 1KNRA 5KOWA 3DK9A 3T37A 2R4EA 3NHOX 2GRTA 3BNMA 5KRQA 3SZCA 3UTGA 3NK2X 2Y6RA 1E39A 1YQ3A 3RP7A 1H7WA 1DNCA 3IC9A 1VG9A 1DXLA 1PJ5A 5EB4A 1D4CA 4Y4MA 3LADA 4Z44A 4B66A 4B68A 2AAQA 3K7QX 4TM4A 4BJYA 2C70A 4NTEA 5C2TA 2XVHA 4LA1A 3L1RA 4G9KA 1NHRA 2B76A 5KOXA 5EBKA 1CL0A 1HYUA 4B65A 3AD8B 4FK1A 1NENA 1D4DA 1E7PA 1EBDA 1XANA 3G5SA 2OLOA 1JOAA 3AE9A 3AYJA 1RP0A 3KLJA 2YG6A 3CNTA 1IUTA 4YSYA 2BACA 2VOUA 1CC4A 1XHCA 4RG3A 3RNMA 5GRTA 2CDUA 2V3BA 3DJEA 2FJEA 3AB1A 2ZBWA 1GNDA 1MXTA 1ZP0A 4NZHA 4BV6A 4EM3A 1GTHA 4YTPA 2BC1A 4K2XA 2BCGG 1BKWA 1COYA 1VDCA 1D5TA 1H81A 3CGDA 5U25A 2WP6A 3AEDA 3UOYA 2YLSA 2YWLA 1GT8A 4TM3A 1S3EA 3RHAA 2GH5A 2GQWA 5TR3A 5EOWA 3BNUA 3KPKA 1OJ9A 4O5QA 1Q9IA 2GR0A 3PS9A 4OPTA 2V5ZA 4CNKA 1KSSA 1YQ4A 2BS3A 4XWZA 4AT0A 1TDKA 1KNPA 2J3NA 1E6EA 4A6NB 2WP9A 1GRTA 1H86A 1NPXA 2WOWA 4REKA 3V3OA 2A8XA 4EQXA 3AEFA 2BS2A 5BULA 5JCMA 4K5RA 2C4CA 4HB9A 2C3DA 1L9DA 2VZ2A 4U8KA 4KX6A 4PABA 2RGJA 2B7RA 3GYJA 5DBJA 2YR6A 3K30A 4Y4NA 1LQUA 4A5LA 1YY5A 3T2YA 3L8KA 2HQMA 4H50A 3DGZA 2WDVA 3AEAA 1KF6A 4CY6A 3KU9A 3D8XA 2Z5XA 1MOKA 1LQTA 3M0OA 3IHMA 2GV8A 3K7TA 3H4KA 5KMQA 1Z6LA 3F8RA 3UTFA 1KFYA 2WPEA 4II3A 4TM0A 4H4SA 2XVIA 2BA9A 2X8HA 4YKFA 2VQBA 4I58A 4B63A 1TYTA 3HYVA 2XFPA 1IUXA 4LU6A 3T2KA 2FBWA 5FS9A 1M6IA 1K0JA 4H2NA 4JQ9A 1NEKA 1RSGA 1TDNA 1GXFA 2RGHA 4A65A 1S3BA 1GEUA 2V3AA 2CFYA 4H7UA 4G6GA 1TDOA 4U8MA 3T14A 1MO9A 1PBEA 2BRAA 4OPCA 2Y6QA 2TPRA 1SEZA 2C3CA 2CVJA 3AECA 3AEBA 3GD3A 3NK0X 4CY8A 3ADAB 2IVEA 2JBVA 3F8DA 4UDQA 4C3YA 4D03A 2ZZ0A 4H2QA 4E0VA 4EQSA 1B4VA 4OCGA 3QFAA 4A9WA 1Y56B 3NNEA 2XLSA 1GETA 2JK6A 5HHFA 3PO7A 3BI2A 2RABA 2XFUA 3GWDA 3CNSA
chains in the Genus database with same CATH topology
1NG4A 1QLBA 5KVHA 4CCQA 1Y0PA 3UKAA 3URHA 4JN9A 3AD9B 3AYLA 2XLTA 3UKPA 2H89A 3BHFA 3NN0X 3II4A 1PDHA 3V76A 1VG0A 3SFDA 1GV4A 4Z2UA 3QSMA 3IWAA 1ONFA 2JB2A 3E1TA 2B7SA 5FS8A 4H4XA 4J34A 3ALJA 2WHDA 2JAEA 4NTDA 3FBSA 1D7YA 1V59A 3CPIG 4JNQA 1E1LA 2BK5A 1KSUA 1E1KA 2YG5A 1S2QA 3OC4A 3M13A 4Z2TA 4RG4A 1N1PA 2YVJA 4J36A 4H4RA 3UCLA 2C67A 2AR8A 3NK1X 4CRTA 3LOVA 3DK8A 4JNAA 4YWOA 4U8IA 1GREA 3T0KA 1CBOA 1L0VA 4EMIA 2O9ZA 5JCNA 4A6NA 1YQZA 1PXBA 2PHHA 3BI4A 1PBFA 4H4TA 3Q6JA 4MJWA 3Q9TA 3UP4A 1FEBA 1L9CA 3KPFA 2YVGA 3FIMB 3OZ2A 4ICYA 3C4AA 4M52A 4BK2A 1FCDA 2WBAA 4JY2A 3ICTA 1H82A 1TDEA 3CNPA 3D1CA 3AE4A 3SZWA 2C66A 3SYIA 2X8CA 2YG7A 2YR4A 3ATRA 2R0CA 1H7XA 1ZMCA 2JB1A 4XWRA 2X50A 2DKIA 3FG2P 3REDA 1GRFA 2RGOA 4A7AA 4GRTA 3GD4A 3AEEA 4YTNA 2EQ6A 3AWIA 4G74A 4C77A 1PJ7A 3ABVA 1OJAA 2X3NA 2C76A 4C74A 1LTXR 3DH9A 3DJGX 2VVMA 2QA1A 4J33A 1ZY8A 2F5ZA 4DNAA 3GMCA 5HXIA 2GQFA 4D04A 3KD9A 4NTCA 4J2WA 3SM8A 2YR5A 3IF9A 4FX9A 4JY3A 1ZOYA 3LZXA 1UKVG 2C65A 3UKKA 1F6MA 1VRQB 4YTMA 3LZWA 4UDRA 5M0ZA 5JCKA 3EAOA 3GDNA 4USQA 1GTEA 1N4WA 2ZZBA 3GDPA 3UKQA 4YSHA 4Y4LA 2GF3A 2WOVA 3AE2A 1D4EA 1PS9A 3CMMA 4K7ZA 5IQ4A 3ISHA 3F8PA 5U63A 3SZ0A 2XLPA 4EM4A 2FJDA 1PBCA 5J7XA 1Y56A 4H4WA 3NH3X 1NDAA 1F3PA 3RP6A 4Z26A 2YLZA 4GAVA 4AP3A 3AD7B 1CC6A 4EMWA 1GRGA 1S2YA 5HY5A 1CC2A 1CHUA 4B1BA 2OAMA 2WESA 1OJTA 4B69A 5CKUA 1NHSA 1IUUA 1CJCA 2R4JA 4B67A 1TDFA 3P4RA 4G73A 1GSNA 2V60A 1DODA 1EL7A 2BYBA 2XLUA 1LV0A 1H84A 2JKCA 1GOSA 2BABA 2APGA 2Q0LA 2UZZA 2E5VA 3AE5A 2PYXA 3LXDA 1W4XA 3UOVA 4IVOB 4U2SA 4H4YA 3QJ4A 2R45A 3GYIA 3NN6X 2QA2A 4BURA 3AXBA 3QFBA 1GRHA 2WS3A 4DSHA 1DJQA 1CJ3A 4YSZA 2Z5YA 4K5SA 1O94A 4USRA 5CQFA 2GVCA 2EQ8A 1XPQA 3VRDB 2C72A 4RSLA 1K0IA 4GR1A 4II2A 4U8JA 2ACZA 3ZYXA 2WEUA 4Z25A 3AEGA 3WE0A 2GR1A 4OPDA 3P4PA 2VQ7A 2YM2A 1ZMDA 3VRBA 3NYFA 1B8SA 1FEAA 2XFNA 3AE6A 4ZCCA 2BK4A 5HYMA 2QAEA 4U8LA 3NGCX 1CJ4A 3FPZA 3QVPA 4Z43A 2V61A 3COXA 4IA6A 1NHPA 3ALLA 3NTDA 3EF6A 3QVRA 1N4UA 3SXIA 1PXCA 2YG3A 3NYCA 4DSGA 1B5QA 2BRYA 2B9YA 1EL8A 3EPTA 1KDGA 3ITJA 1IJHA 1DOCA 4ZCDA 5KMPA 2YM1A 2CULA 1K4QA 1YKJA 4EMJA 1AOGA 1BGNA 1PJ6A 2GAHB 2YAUA 2XFQA 3HZLA 3NKSA 3P4QA 5KXJA 2EQ9A 3UTHA 4YT0A 5J60A 2BS4A 3NYEA 5LV9A 1BWCA 2XCGA 1PHHA 3VQRA 2WETA 2YQUA 4OVIA 3CGEA 2OA1A 4H2RA 2E1MA 1CJ2A 2EQ7A 2NVKX 1IUVA 1F8WA 2FJAA 2YVFA 3I3LA 3V3NA 2R46A 3DJDA 4OPGA 2B9WA 3HYWA 4TM1A 1Q1WA 1D7LA 1TYPA 1NHQA 2IIDA 4NEWA 1EL9A 4P9SA 4GDPA 3GSIA 3M12A 1OJDA 3O0HA 5FS7A 3RP8A 2GR3A 1LPFA 4FDCB 4C5OA 1CF3A 3I6DA 4AOSA 2XVEA 1BZLA 3S5WA 3UKLA 2Q6UA 4J31A 4NEVA 2YLRA 1Q1RA 3SZFA 3H8IA 2R9ZA 5IPYA 3FMWA 4FK1C 1NG3A 1LVLA 2C7GA 4X9MA 2VRMA 1K0LA 4LIIA 1LJ1A 4U8OA 2XDOA 4HA6A 2WU5A 1DJNA 2VVLA 4H4VA 3CN8A 3T2ZA 4ECHA 4U8PA 2R0PA 2OALA 2ARDA 2XYOA 3G5RA 2WQYA 3CIRA 1P2HA 4O5UA 2WDRA 4BJZA 1GRAA 2V6OA 4A99A 1JRXA 4CNJA 1RYIA 4H4QA 2XLRA 3GRTA 3NG7X 2BK3A 1FECA 1REOA 3VR9A 5ER0A 3NT6A 3EANA 5KVIA 1DOBA 5BRTA 2WPFA 5FMHA 3QSSA 4X9NA 4Z2RA 1FL2A 1ZOVA 3DK4A 1L9EA 1JEHA 1GESA 2WU2A 3NLCA 4CCRA 4EIQA 1TRBA 2YLTA 1ELIA 4K8DA 2DKHA 2BCPA 4DGKA 1OJCA 2GMJA 3UTEA 3T31A 3P1WA 4GAPA 4I59A 1JNZA 4IVMB 2C73A 2IVDA 3AE7A 4EQWA 3BI5A 5FS6A 3DGHA 2XFOA 4U8NA 4ADWA 4APNA 4IV9A 2GR2A 2C75A 1ZKQA 3CGBA 2BXSA 2VRLA 3DJJA 4YKGA 4B64A 4X4JA 3UOZA 1DOEA 4GUVA 1GALA 2E4GA 5L46A 1IUWA 2GB0A 2VVLG 3AYIA 3B6DA 3CPHG 3SQPA 4G6HA 2YLXA 4OPLA 2BC0A 2TMDA 3CPJG 3UKFA 2A87A 4AP1A 4GCMA 2I0ZA 1ZDLA 4NNJA 4J57A 1GERA 4WX1A 4CBQA 3NTAA 1N4VA 3KVEA 3GMBA 3LB8A 5IQ1A 3UP5A 1O95A 4U2TA 3H8LA 1F8RA 3LJPA 2WDQA 4A79A 2H88A 3S61A 1GRBA 1JRZA 4GF7A 1B37A 1QJDA 2FJBA 1M64A 2WP5A 2XVJA 4N9XA 2X99A 3BHKA 2BXRA 4TLZA 3IHGA 1QO8A 4OPUA 1O5WA 4PAAA 5BUKA 3PVCA 4Z24A 1F8SA 2WPCA 2A89A 4GDEA 4AOXA 2OLNA 3SGLA 2R0GA 2WOIA 1BGJA 3CGCA 3GRSA 4NWZA 4UP3A 3ICRA 4BK1A 4EQRA 2QCUA 4KPRA 3ALMA 3DA1A 1PBDA 3CTYA 1JNRA 3DMEA 3SY4A 1E1MA 4TLXA 3B3RA 4J56A 5JCLA 4WCTA 5U1OA 3JSKA 3QSEA 4OPIA 5GSNA 5KWFA 1P2EA 4BK3A 1IUSA 3AE8A 3P4SA 4K22A 3G5QA 3VR8A 3AE1A 5C3JA 3HYXA 2ZZCA 4JDRA 1H83A 3UOXA 2B9XA 1E1NA 1X31B 5KNLA 4U2LA 3SX6A 4YXDA 2XVFA 3C96A 3CNDA 1PBBA 1NAAA 2NPXA 1JU2A 1ZX9A 3GWFA 3SFEA 2W0HA 3NRNA 3C4NA 3UKHA 2Q0KA 4XXGA 3KKJA 4C3XA 3CNJA 2YG4A 1PXAA 2Q7VA 1ZK7A 3P9UA 3AE3A 3NIXA 4H4PA 2YLWA 5JCIA 3KA7A 4H4ZA 1JRYA 2JB3A 3K7MX 1FOHA 1H6VA 5KMSA 5M10A 4H2PA 3ZDNA 2X8GA 3VRAA 1GPEA 5BVAA 1XDIA 4AT2A 4UDPA 1VQWA 3GYXA 2GMHA 5EB5A 2GEWA 2C64A 1EL5A 3ICSA 2AQJA 1BF3A 3ATQA 4IA5A 1PN0A 4ZN0A 5KMRA 3R9UA 4EIPA 4YSXA 2GAGB 4H4UA 1KNRA 5KOWA 3DK9A 3T37A 2R4EA 3NHOX 2GRTA 3BNMA 5KRQA 3SZCA 3UTGA 3NK2X 2Y6RA 1E39A 1YQ3A 3RP7A 1H7WA 1DNCA 3IC9A 1VG9A 1DXLA 1PJ5A 5EB4A 1D4CA 4Y4MA 3LADA 4Z44A 4B66A 4B68A 2AAQA 3K7QX 4TM4A 4BJYA 2C70A 4NTEA 5C2TA 2XVHA 4LA1A 3L1RA 4G9KA 1NHRA 2B76A 5KOXA 5EBKA 1CL0A 1HYUA 4B65A 3AD8B 4FK1A 1NENA 1D4DA 1E7PA 1EBDA 1XANA 3G5SA 2OLOA 1JOAA 3AE9A 3AYJA 1RP0A 3KLJA 2YG6A 3CNTA 1IUTA 4YSYA 2BACA 2VOUA 1CC4A 1XHCA 4RG3A 3RNMA 5GRTA 2CDUA 2V3BA 3DJEA 2FJEA 3AB1A 2ZBWA 1GNDA 1MXTA 1ZP0A 4NZHA 4BV6A 4EM3A 1GTHA 4YTPA 2BC1A 4K2XA 2BCGG 1BKWA 1COYA 1VDCA 1D5TA 1H81A 3CGDA 5U25A 2WP6A 3AEDA 3UOYA 2YLSA 2YWLA 1GT8A 4TM3A 1S3EA 3RHAA 2GH5A 2GQWA 5TR3A 5EOWA 3BNUA 3KPKA 1OJ9A 4O5QA 1Q9IA 2GR0A 3PS9A 4OPTA 2V5ZA 4CNKA 1KSSA 1YQ4A 2BS3A 4XWZA 4AT0A 1TDKA 1KNPA 2J3NA 1E6EA 4A6NB 2WP9A 1GRTA 1H86A 1NPXA 2WOWA 4REKA 3V3OA 2A8XA 4EQXA 3AEFA 2BS2A 5BULA 5JCMA 4K5RA 2C4CA 4HB9A 2C3DA 1L9DA 2VZ2A 4U8KA 4KX6A 4PABA 2RGJA 2B7RA 3GYJA 5DBJA 2YR6A 3K30A 4Y4NA 1LQUA 4A5LA 1YY5A 3T2YA 3L8KA 2HQMA 4H50A 3DGZA 2WDVA 3AEAA 1KF6A 4CY6A 3KU9A 3D8XA 2Z5XA 1MOKA 1LQTA 3M0OA 3IHMA 2GV8A 3K7TA 3H4KA 5KMQA 1Z6LA 3F8RA 3UTFA 1KFYA 2WPEA 4II3A 4TM0A 4H4SA 2XVIA 2BA9A 2X8HA 4YKFA 2VQBA 4I58A 4B63A 1TYTA 3HYVA 2XFPA 1IUXA 4LU6A 3T2KA 2FBWA 5FS9A 1M6IA 1K0JA 4H2NA 4JQ9A 1NEKA 1RSGA 1TDNA 1GXFA 2RGHA 4A65A 1S3BA 1GEUA 2V3AA 2CFYA 4H7UA 4G6GA 1TDOA 4U8MA 3T14A 1MO9A 1PBEA 2BRAA 4OPCA 2Y6QA 2TPRA 1SEZA 2C3CA 2CVJA 3AECA 3AEBA 3GD3A 3NK0X 4CY8A 3ADAB 2IVEA 2JBVA 3F8DA 4UDQA 4C3YA 4D03A 2ZZ0A 4H2QA 4E0VA 4EQSA 1B4VA 4OCGA 3QFAA 4A9WA 1Y56B 3NNEA 2XLSA 1GETA 2JK6A 5HHFA 3PO7A 3BI2A 2RABA 2XFUA 3GWDA 3CNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG4 A;  1QLB A;  5KVH A;  4CCQ A;  1Y0P A;  3UKA A;  3URH A;  4JN9 A;  3AD9 B;  3AYL A;  2XLT A;  3UKP A;  2H89 A;  3BHF A;  3NN0 X;  3II4 A;  1PDH A;  3V76 A;  1VG0 A;  3SFD A;  1GV4 A;  4Z2U A;  3QSM A;  3IWA A;  1ONF A;  2JB2 A;  3E1T A;  2B7S A;  5FS8 A;  4H4X A;  4J34 A;  3ALJ A;  2WHD A;  2JAE A;  4NTD A;  3FBS A;  1D7Y A;  1V59 A;  3CPI G;  4JNQ A;  1E1L A;  2BK5 A;  1KSU A;  1E1K A;  2YG5 A;  1S2Q A;  3OC4 A;  3M13 A;  4Z2T A;  4RG4 A;  1N1P A;  2YVJ A;  4J36 A;  4H4R A;  3UCL A;  2C67 A;  2AR8 A;  3NK1 X;  4CRT A;  3LOV A;  3DK8 A;  4JNA A;  4YWO A;  4U8I A;  1GRE A;  4EMI A;  1CBO A;  1L0V A;  5JCN A;  2O9Z A;  4A6N A;  1YQZ A;  1PXB A;  2PHH A;  3BI4 A;  1PBF A;  4H4T A;  3Q6J A;  4MJW A;  3Q9T A;  3UP4 A;  1FEB A;  1L9C A;  3KPF A;  2YVG A;  3FIM B;  3OZ2 A;  4ICY A;  3C4A A;  4M52 A;  4BK2 A;  1FCD A;  2WBA A;  4JY2 A;  3ICT A;  1H82 A;  1TDE A;  3CNP A;  3D1C A;  3AE4 A;  2C66 A;  2X8C A;  2YG7 A;  2YR4 A;  3ATR A;  2R0C A;  1H7X A;  1ZMC A;  2JB1 A;  4XWR A;  2X50 A;  2DKI A;  3FG2 P;  3RED A;  1GRF A;  2RGO A;  4A7A A;  4GRT A;  3GD4 A;  3AEE A;  4YTN A;  2EQ6 A;  3AWI A;  4C77 A;  1PJ7 A;  3ABV A;  1OJA A;  2X3N A;  2C76 A;  4C74 A;  1LTX R;  3DH9 A;  3DJG X;  2VVM A;  2QA1 A;  4J33 A;  1ZY8 A;  2F5Z A;  4DNA A;  3GMC A;  5HXI A;  2GQF A;  4D04 A;  3KD9 A;  4NTC A;  4J2W A;  3SM8 A;  2YR5 A;  3IF9 A;  4FX9 A;  4JY3 A;  1ZOY A;  3LZX A;  1UKV G;  2C65 A;  3UKK A;  1F6M A;  1VRQ B;  4YTM A;  3LZW A;  4UDR A;  5M0Z A;  5JCK A;  3EAO A;  3GDN A;  4USQ A;  1GTE A;  1N4W A;  2ZZB A;  3GDP A;  3UKQ A;  4YSH A;  4Y4L A;  2GF3 A;  2WOV A;  3AE2 A;  1D4E A;  1PS9 A;  4K7Z A;  5IQ4 A;  3ISH A;  3F8P A;  5U63 A;  2XLP A;  4EM4 A;  2FJD A;  1PBC A;  5J7X A;  1Y56 A;  4H4W A;  3NH3 X;  1NDA A;  1F3P A;  3RP6 A;  4Z26 A;  2YLZ A;  4AP3 A;  3AD7 B;  1CC6 A;  4EMW A;  1GRG A;  1S2Y A;  5HY5 A;  1CC2 A;  1CHU A;  4B1B A;  2OAM A;  2WES A;  1OJT A;  4B69 A;  5CKU A;  1NHS A;  1IUU A;  1CJC A;  2R4J A;  4B67 A;  1TDF A;  3P4R A;  1GSN A;  2V60 A;  1DOD A;  1EL7 A;  2BYB A;  2XLU A;  1LV0 A;  1H84 A;  2JKC A;  1GOS A;  2BAB A;  2APG A;  2Q0L A;  2UZZ A;  2E5V A;  3AE5 A;  2PYX A;  3LXD A;  1W4X A;  3UOV A;  4IVO B;  4U2S A;  4H4Y A;  3QJ4 A;  2R45 A;  3GYI A;  3NN6 X;  2QA2 A;  4BUR A;  3AXB A;  3QFB A;  1GRH A;  2WS3 A;  4DSH A;  1DJQ A;  1CJ3 A;  4YSZ A;  2Z5Y A;  4K5S A;  1O94 A;  4USR A;  5CQF A;  2GVC A;  2EQ8 A;  1XPQ A;  3VRD B;  2C72 A;  4RSL A;  1K0I A;  4GR1 A;  4U8J A;  2ACZ A;  3ZYX A;  2WEU A;  4Z25 A;  3AEG A;  3WE0 A;  2GR1 A;  4OPD A;  3P4P A;  2VQ7 A;  2YM2 A;  1ZMD A;  3VRB A;  3NYF A;  1B8S A;  1FEA A;  2XFN A;  3AE6 A;  4ZCC A;  2BK4 A;  5HYM A;  2QAE A;  4U8L A;  3NGC X;  1CJ4 A;  3FPZ A;  3QVP A;  4Z43 A;  2V61 A;  3COX A;  4IA6 A;  1NHP A;  3ALL A;  3NTD A;  3EF6 A;  3QVR A;  1N4U A;  1PXC A;  2YG3 A;  3NYC A;  4DSG A;  1B5Q A;  2B9Y A;  1EL8 A;  3EPT A;  1KDG A;  3ITJ A;  1IJH A;  1DOC A;  4ZCD A;  2YM1 A;  2CUL A;  1K4Q A;  1YKJ A;  4EMJ A;  1AOG A;  1BGN A;  1PJ6 A;  2GAH B;  2YAU A;  2XFQ A;  3HZL A;  3NKS A;  3P4Q A;  5KXJ A;  2EQ9 A;  3UTH A;  4YT0 A;  5J60 A;  2BS4 A;  3NYE A;  5LV9 A;  1BWC A;  2XCG A;  1PHH A;  3VQR A;  2WET A;  2YQU A;  4OVI A;  3CGE A;  2OA1 A;  4H2R A;  2E1M A;  1CJ2 A;  2EQ7 A;  2NVK X;  1IUV A;  1F8W A;  2FJA A;  2YVF A;  3I3L A;  3V3N A;  2R46 A;  3DJD A;  4OPG A;  2B9W A;  4TM1 A;  1Q1W A;  1D7L A;  1TYP A;  1NHQ A;  2IID A;  4NEW A;  1EL9 A;  4P9S A;  4GDP A;  3GSI A;  3M12 A;  1OJD A;  3O0H A;  5FS7 A;  3RP8 A;  2GR3 A;  1LPF A;  4FDC B;  4C5O A;  1CF3 A;  3I6D A;  4AOS A;  2XVE A;  1BZL A;  3S5W A;  3UKL A;  2Q6U A;  4J31 A;  4NEV A;  2YLR A;  1Q1R A;  3H8I A;  2R9Z A;  5IPY A;  3FMW A;  4FK1 C;  1NG3 A;  1LVL A;  2C7G A;  4X9M A;  2VRM A;  1K0L A;  4LII A;  1LJ1 A;  4U8O A;  2XDO A;  4HA6 A;  2WU5 A;  1DJN A;  2VVL A;  4H4V A;  3CN8 A;  4ECH A;  4U8P A;  2R0P A;  2OAL A;  2ARD A;  2XYO A;  3G5R A;  2WQY A;  3CIR A;  1P2H A;  4O5U A;  2WDR A;  4BJZ A;  1GRA A;  2V6O A;  4A99 A;  1JRX A;  4CNJ A;  1RYI A;  4H4Q A;  2XLR A;  3GRT A;  3NG7 X;  2BK3 A;  1FEC A;  1REO A;  3VR9 A;  5ER0 A;  3NT6 A;  3EAN A;  5KVI A;  1DOB A;  5BRT A;  2WPF A;  5FMH A;  3QSS A;  4X9N A;  4Z2R A;  1FL2 A;  1ZOV A;  3DK4 A;  1L9E A;  1JEH A;  1GES A;  2WU2 A;  3NLC A;  4CCR A;  4EIQ A;  1TRB A;  2YLT A;  1ELI A;  4K8D A;  2DKH A;  2BCP A;  4DGK A;  1OJC A;  2GMJ A;  3UTE A;  3P1W A;  4I59 A;  1JNZ A;  4IVM B;  2C73 A;  2IVD A;  3AE7 A;  4EQW A;  3BI5 A;  5FS6 A;  3DGH A;  2XFO A;  4U8N A;  4ADW A;  4APN A;  4IV9 A;  2GR2 A;  2C75 A;  1ZKQ A;  3CGB A;  2BXS A;  2VRL A;  3DJJ A;  4YKG A;  4B64 A;  4X4J A;  3UOZ A;  1DOE A;  4GUV A;  1GAL A;  2E4G A;  5L46 A;  1IUW A;  2GB0 A;  2VVL G;  3AYI A;  3B6D A;  3CPH G;  3SQP A;  2YLX A;  4OPL A;  2BC0 A;  2TMD A;  3CPJ G;  3UKF A;  2A87 A;  4AP1 A;  4GCM A;  2I0Z A;  1ZDL A;  4J57 A;  1GER A;  4WX1 A;  4CBQ A;  3NTA A;  1N4V A;  3KVE A;  3GMB A;  3LB8 A;  5IQ1 A;  3UP5 A;  1O95 A;  4U2T A;  3H8L A;  1F8R A;  3LJP A;  2WDQ A;  4A79 A;  2H88 A;  3S61 A;  1GRB A;  1JRZ A;  4GF7 A;  1B37 A;  1QJD A;  2FJB A;  1M64 A;  2WP5 A;  2XVJ A;  4N9X A;  2X99 A;  3BHK A;  2BXR A;  4TLZ A;  3IHG A;  1QO8 A;  4OPU A;  1O5W A;  4PAA A;  5BUK A;  3PVC A;  4Z24 A;  1F8S A;  2WPC A;  2A89 A;  4GDE A;  4AOX A;  2OLN A;  3SGL A;  2R0G A;  2WOI A;  1BGJ A;  3CGC A;  3GRS A;  4UP3 A;  4BK1 A;  3ICR A;  4EQR A;  2QCU A;  4KPR A;  3ALM A;  3DA1 A;  1PBD A;  3CTY A;  1JNR A;  3DME A;  1E1M A;  4TLX A;  3B3R A;  4J56 A;  5JCL A;  4WCT A;  5U1O A;  3JSK A;  3QSE A;  4OPI A;  5GSN A;  5KWF A;  1P2E A;  4BK3 A;  1IUS A;  3AE8 A;  3P4S A;  4K22 A;  3G5Q A;  3VR8 A;  3AE1 A;  5C3J A;  4JDR A;  2ZZC A;  1H83 A;  3UOX A;  2B9X A;  1E1N A;  1X31 B;  4U2L A;  4YXD A;  2XVF A;  3C96 A;  3CND A;  1PBB A;  1NAA A;  2NPX A;  1JU2 A;  1ZX9 A;  3GWF A;  3SFE A;  2W0H A;  3NRN A;  3C4N A;  3UKH A;  2Q0K A;  4XXG A;  3KKJ A;  4C3X A;  3CNJ A;  2YG4 A;  1PXA A;  2Q7V A;  1ZK7 A;  3P9U A;  3AE3 A;  3NIX A;  4H4P A;  2YLW A;  5JCI A;  3KA7 A;  4H4Z A;  1JRY A;  2JB3 A;  3K7M X;  1FOH A;  1H6V A;  5M10 A;  4H2P A;  3ZDN A;  2X8G A;  3VRA A;  1GPE A;  5BVA A;  1XDI A;  4AT2 A;  4UDP A;  1VQW A;  2GMH A;  5EB5 A;  2GEW A;  2C64 A;  1EL5 A;  3ICS A;  2AQJ A;  1BF3 A;  3ATQ A;  4IA5 A;  1PN0 A;  4ZN0 A;  3R9U A;  4EIP A;  4YSX A;  2GAG B;  4H4U A;  1KNR A;  5KOW A;  3DK9 A;  3T37 A;  2R4E A;  3NHO X;  2GRT A;  3BNM A;  5KRQ A;  3UTG A;  3NK2 X;  2Y6R A;  1E39 A;  1YQ3 A;  3RP7 A;  1H7W A;  1DNC A;  3IC9 A;  1VG9 A;  1DXL A;  1PJ5 A;  5EB4 A;  1D4C A;  4Y4M A;  3LAD A;  4Z44 A;  4B66 A;  4B68 A;  2AAQ A;  3K7Q X;  4TM4 A;  4BJY A;  2C70 A;  4NTE A;  5C2T A;  2XVH A;  4LA1 A;  3L1R A;  1NHR A;  2B76 A;  5KOX A;  5EBK A;  1CL0 A;  1HYU A;  4B65 A;  3AD8 B;  4FK1 A;  1NEN A;  1D4D A;  1E7P A;  1EBD A;  1XAN A;  3G5S A;  2OLO A;  1JOA A;  3AE9 A;  3AYJ A;  1RP0 A;  3KLJ A;  2YG6 A;  3CNT A;  1IUT A;  4YSY A;  2BAC A;  2VOU A;  1CC4 A;  1XHC A;  4RG3 A;  3RNM A;  5GRT A;  2CDU A;  2V3B A;  3DJE A;  2FJE A;  3AB1 A;  2ZBW A;  1GND A;  1MXT A;  1ZP0 A;  4NZH A;  4BV6 A;  4EM3 A;  1GTH A;  4YTP A;  2BC1 A;  4K2X A;  2BCG G;  1BKW A;  1COY A;  1VDC A;  1D5T A;  1H81 A;  3CGD A;  5U25 A;  2WP6 A;  3AED A;  3UOY A;  2YLS A;  2YWL A;  1GT8 A;  4TM3 A;  1S3E A;  3RHA A;  2GH5 A;  2GQW A;  5TR3 A;  5EOW A;  3BNU A;  1OJ9 A;  4O5Q A;  1Q9I A;  2GR0 A;  3PS9 A;  4OPT A;  2V5Z A;  4CNK A;  1KSS A;  1YQ4 A;  2BS3 A;  4XWZ A;  4AT0 A;  1TDK A;  1KNP A;  2J3N A;  1E6E A;  4A6N B;  2WP9 A;  1GRT A;  1H86 A;  1NPX A;  2WOW A;  4REK A;  3V3O A;  2A8X A;  4EQX A;  3AEF A;  2BS2 A;  5BUL A;  5JCM A;  4K5R A;  4HB9 A;  2C3D A;  1L9D A;  2VZ2 A;  4U8K A;  4KX6 A;  4PAB A;  2RGJ A;  2B7R A;  3GYJ A;  5DBJ A;  2YR6 A;  3K30 A;  4Y4N A;  1LQU A;  4A5L A;  1YY5 A;  3L8K A;  2HQM A;  4H50 A;  3DGZ A;  2WDV A;  3AEA A;  1KF6 A;  4CY6 A;  3KU9 A;  3D8X A;  2Z5X A;  1MOK A;  1LQT A;  3M0O A;  3IHM A;  2GV8 A;  3K7T A;  3H4K A;  1Z6L A;  3F8R A;  3UTF A;  1KFY A;  2WPE A;  4TM0 A;  4H4S A;  2XVI A;  2BA9 A;  2X8H A;  4YKF A;  2VQB A;  4I58 A;  4B63 A;  1TYT A;  2XFP A;  1IUX A;  4LU6 A;  2FBW A;  5FS9 A;  1M6I A;  1K0J A;  4H2N A;  4JQ9 A;  1NEK A;  1RSG A;  1TDN A;  1GXF A;  2RGH A;  4A65 A;  1S3B A;  1GEU A;  2V3A A;  2CFY A;  4H7U A;  1TDO A;  4U8M A;  1MO9 A;  1PBE A;  4OPC A;  2Y6Q A;  2TPR A;  1SEZ A;  2C3C A;  2CVJ A;  3AEC A;  3AEB A;  3GD3 A;  3NK0 X;  4CY8 A;  3ADA B;  2IVE A;  2JBV A;  3F8D A;  4UDQ A;  4C3Y A;  4D03 A;  2ZZ0 A;  4H2Q A;  4E0V A;  4EQS A;  1B4V A;  4OCG A;  3QFA A;  4A9W A;  1Y56 B;  3NNE A;  2XLS A;  1GET A;  2JK6 A;  5HHF A;  3PO7 A;  3BI2 A;  2RAB A;  2XFU A;  3GWD A;  3CNS A; 
#chains in the Genus database with same CATH topology
 1NG4 A;  1QLB A;  5KVH A;  4CCQ A;  1Y0P A;  3UKA A;  3URH A;  4JN9 A;  3AD9 B;  3AYL A;  2XLT A;  3UKP A;  2H89 A;  3BHF A;  3NN0 X;  3II4 A;  1PDH A;  3V76 A;  1VG0 A;  3SFD A;  1GV4 A;  4Z2U A;  3QSM A;  3IWA A;  1ONF A;  2JB2 A;  3E1T A;  2B7S A;  5FS8 A;  4H4X A;  4J34 A;  3ALJ A;  2WHD A;  2JAE A;  4NTD A;  3FBS A;  1D7Y A;  1V59 A;  3CPI G;  4JNQ A;  1E1L A;  2BK5 A;  1KSU A;  1E1K A;  2YG5 A;  1S2Q A;  3OC4 A;  3M13 A;  4Z2T A;  4RG4 A;  1N1P A;  2YVJ A;  4J36 A;  4H4R A;  3UCL A;  2C67 A;  2AR8 A;  3NK1 X;  4CRT A;  3LOV A;  3DK8 A;  4JNA A;  4YWO A;  4U8I A;  1GRE A;  3T0K A;  1CBO A;  1L0V A;  4EMI A;  2O9Z A;  5JCN A;  4A6N A;  1YQZ A;  1PXB A;  2PHH A;  3BI4 A;  1PBF A;  4H4T A;  3Q6J A;  4MJW A;  3Q9T A;  3UP4 A;  1FEB A;  1L9C A;  3KPF A;  2YVG A;  3FIM B;  3OZ2 A;  4ICY A;  3C4A A;  4M52 A;  4BK2 A;  1FCD A;  2WBA A;  4JY2 A;  3ICT A;  1H82 A;  1TDE A;  3CNP A;  3D1C A;  3AE4 A;  3SZW A;  2C66 A;  3SYI A;  2X8C A;  2YG7 A;  2YR4 A;  3ATR A;  2R0C A;  1H7X A;  1ZMC A;  2JB1 A;  4XWR A;  2X50 A;  2DKI A;  3FG2 P;  3RED A;  1GRF A;  2RGO A;  4A7A A;  4GRT A;  3GD4 A;  3AEE A;  4YTN A;  2EQ6 A;  3AWI A;  4G74 A;  4C77 A;  1PJ7 A;  3ABV A;  1OJA A;  2X3N A;  2C76 A;  4C74 A;  1LTX R;  3DH9 A;  3DJG X;  2VVM A;  2QA1 A;  4J33 A;  1ZY8 A;  2F5Z A;  4DNA A;  3GMC A;  5HXI A;  2GQF A;  4D04 A;  3KD9 A;  4NTC A;  4J2W A;  3SM8 A;  2YR5 A;  3IF9 A;  4FX9 A;  4JY3 A;  1ZOY A;  3LZX A;  1UKV G;  2C65 A;  3UKK A;  1F6M A;  1VRQ B;  4YTM A;  3LZW A;  4UDR A;  5M0Z A;  5JCK A;  3EAO A;  3GDN A;  4USQ A;  1GTE A;  1N4W A;  2ZZB A;  3GDP A;  3UKQ A;  4YSH A;  4Y4L A;  2GF3 A;  2WOV A;  3AE2 A;  1D4E A;  1PS9 A;  3CMM A;  4K7Z A;  5IQ4 A;  3ISH A;  3F8P A;  5U63 A;  3SZ0 A;  2XLP A;  4EM4 A;  2FJD A;  1PBC A;  5J7X A;  1Y56 A;  4H4W A;  3NH3 X;  1NDA A;  1F3P A;  3RP6 A;  4Z26 A;  2YLZ A;  4GAV A;  4AP3 A;  3AD7 B;  1CC6 A;  4EMW A;  1GRG A;  1S2Y A;  5HY5 A;  1CC2 A;  1CHU A;  4B1B A;  2OAM A;  2WES A;  1OJT A;  4B69 A;  5CKU A;  1NHS A;  1IUU A;  1CJC A;  2R4J A;  4B67 A;  1TDF A;  3P4R A;  4G73 A;  1GSN A;  2V60 A;  1DOD A;  1EL7 A;  2BYB A;  2XLU A;  1LV0 A;  1H84 A;  2JKC A;  1GOS A;  2BAB A;  2APG A;  2Q0L A;  2UZZ A;  2E5V A;  3AE5 A;  2PYX A;  3LXD A;  1W4X A;  3UOV A;  4IVO B;  4U2S A;  4H4Y A;  3QJ4 A;  2R45 A;  3GYI A;  3NN6 X;  2QA2 A;  4BUR A;  3AXB A;  3QFB A;  1GRH A;  2WS3 A;  4DSH A;  1DJQ A;  1CJ3 A;  4YSZ A;  2Z5Y A;  4K5S A;  1O94 A;  4USR A;  5CQF A;  2GVC A;  2EQ8 A;  1XPQ A;  3VRD B;  2C72 A;  4RSL A;  1K0I A;  4GR1 A;  4II2 A;  4U8J A;  2ACZ A;  3ZYX A;  2WEU A;  4Z25 A;  3AEG A;  3WE0 A;  2GR1 A;  4OPD A;  3P4P A;  2VQ7 A;  2YM2 A;  1ZMD A;  3VRB A;  3NYF A;  1B8S A;  1FEA A;  2XFN A;  3AE6 A;  4ZCC A;  2BK4 A;  5HYM A;  2QAE A;  4U8L A;  3NGC X;  1CJ4 A;  3FPZ A;  3QVP A;  4Z43 A;  2V61 A;  3COX A;  4IA6 A;  1NHP A;  3ALL A;  3NTD A;  3EF6 A;  3QVR A;  1N4U A;  3SXI A;  1PXC A;  2YG3 A;  3NYC A;  4DSG A;  1B5Q A;  2BRY A;  2B9Y A;  1EL8 A;  3EPT A;  1KDG A;  3ITJ A;  1IJH A;  1DOC A;  4ZCD A;  5KMP A;  2YM1 A;  2CUL A;  1K4Q A;  1YKJ A;  4EMJ A;  1AOG A;  1BGN A;  1PJ6 A;  2GAH B;  2YAU A;  2XFQ A;  3HZL A;  3NKS A;  3P4Q A;  5KXJ A;  2EQ9 A;  3UTH A;  4YT0 A;  5J60 A;  2BS4 A;  3NYE A;  5LV9 A;  1BWC A;  2XCG A;  1PHH A;  3VQR A;  2WET A;  2YQU A;  4OVI A;  3CGE A;  2OA1 A;  4H2R A;  2E1M A;  1CJ2 A;  2EQ7 A;  2NVK X;  1IUV A;  1F8W A;  2FJA A;  2YVF A;  3I3L A;  3V3N A;  2R46 A;  3DJD A;  4OPG A;  2B9W A;  3HYW A;  4TM1 A;  1Q1W A;  1D7L A;  1TYP A;  1NHQ A;  2IID A;  4NEW A;  1EL9 A;  4P9S A;  4GDP A;  3GSI A;  3M12 A;  1OJD A;  3O0H A;  5FS7 A;  3RP8 A;  2GR3 A;  1LPF A;  4FDC B;  4C5O A;  1CF3 A;  3I6D A;  4AOS A;  2XVE A;  1BZL A;  3S5W A;  3UKL A;  2Q6U A;  4J31 A;  4NEV A;  2YLR A;  1Q1R A;  3SZF A;  3H8I A;  2R9Z A;  5IPY A;  3FMW A;  4FK1 C;  1NG3 A;  1LVL A;  2C7G A;  4X9M A;  2VRM A;  1K0L A;  4LII A;  1LJ1 A;  4U8O A;  2XDO A;  4HA6 A;  2WU5 A;  1DJN A;  2VVL A;  4H4V A;  3CN8 A;  3T2Z A;  4ECH A;  4U8P A;  2R0P A;  2OAL A;  2ARD A;  2XYO A;  3G5R A;  2WQY A;  3CIR A;  1P2H A;  4O5U A;  2WDR A;  4BJZ A;  1GRA A;  2V6O A;  4A99 A;  1JRX A;  4CNJ A;  1RYI A;  4H4Q A;  2XLR A;  3GRT A;  3NG7 X;  2BK3 A;  1FEC A;  1REO A;  3VR9 A;  5ER0 A;  3NT6 A;  3EAN A;  5KVI A;  1DOB A;  5BRT A;  2WPF A;  5FMH A;  3QSS A;  4X9N A;  4Z2R A;  1FL2 A;  1ZOV A;  3DK4 A;  1L9E A;  1JEH A;  1GES A;  2WU2 A;  3NLC A;  4CCR A;  4EIQ A;  1TRB A;  2YLT A;  1ELI A;  4K8D A;  2DKH A;  2BCP A;  4DGK A;  1OJC A;  2GMJ A;  3UTE A;  3T31 A;  3P1W A;  4GAP A;  4I59 A;  1JNZ A;  4IVM B;  2C73 A;  2IVD A;  3AE7 A;  4EQW A;  3BI5 A;  5FS6 A;  3DGH A;  2XFO A;  4U8N A;  4ADW A;  4APN A;  4IV9 A;  2GR2 A;  2C75 A;  1ZKQ A;  3CGB A;  2BXS A;  2VRL A;  3DJJ A;  4YKG A;  4B64 A;  4X4J A;  3UOZ A;  1DOE A;  4GUV A;  1GAL A;  2E4G A;  5L46 A;  1IUW A;  2GB0 A;  2VVL G;  3AYI A;  3B6D A;  3CPH G;  3SQP A;  4G6H A;  2YLX A;  4OPL A;  2BC0 A;  2TMD A;  3CPJ G;  3UKF A;  2A87 A;  4AP1 A;  4GCM A;  2I0Z A;  1ZDL A;  4NNJ A;  4J57 A;  1GER A;  4WX1 A;  4CBQ A;  3NTA A;  1N4V A;  3KVE A;  3GMB A;  3LB8 A;  5IQ1 A;  3UP5 A;  1O95 A;  4U2T A;  3H8L A;  1F8R A;  3LJP A;  2WDQ A;  4A79 A;  2H88 A;  3S61 A;  1GRB A;  1JRZ A;  4GF7 A;  1B37 A;  1QJD A;  2FJB A;  1M64 A;  2WP5 A;  2XVJ A;  4N9X A;  2X99 A;  3BHK A;  2BXR A;  4TLZ A;  3IHG A;  1QO8 A;  4OPU A;  1O5W A;  4PAA A;  5BUK A;  3PVC A;  4Z24 A;  1F8S A;  2WPC A;  2A89 A;  4GDE A;  4AOX A;  2OLN A;  3SGL A;  2R0G A;  2WOI A;  1BGJ A;  3CGC A;  3GRS A;  4NWZ A;  4UP3 A;  3ICR A;  4BK1 A;  4EQR A;  2QCU A;  4KPR A;  3ALM A;  3DA1 A;  1PBD A;  3CTY A;  1JNR A;  3DME A;  3SY4 A;  1E1M A;  4TLX A;  3B3R A;  4J56 A;  5JCL A;  4WCT A;  5U1O A;  3JSK A;  3QSE A;  4OPI A;  5GSN A;  5KWF A;  1P2E A;  4BK3 A;  1IUS A;  3AE8 A;  3P4S A;  4K22 A;  3G5Q A;  3VR8 A;  3AE1 A;  5C3J A;  3HYX A;  2ZZC A;  4JDR A;  1H83 A;  3UOX A;  2B9X A;  1E1N A;  1X31 B;  5KNL A;  4U2L A;  3SX6 A;  4YXD A;  2XVF A;  3C96 A;  3CND A;  1PBB A;  1NAA A;  2NPX A;  1JU2 A;  1ZX9 A;  3GWF A;  3SFE A;  2W0H A;  3NRN A;  3C4N A;  3UKH A;  2Q0K A;  4XXG A;  3KKJ A;  4C3X A;  3CNJ A;  2YG4 A;  1PXA A;  2Q7V A;  1ZK7 A;  3P9U A;  3AE3 A;  3NIX A;  4H4P A;  2YLW A;  5JCI A;  3KA7 A;  4H4Z A;  1JRY A;  2JB3 A;  3K7M X;  1FOH A;  1H6V A;  5KMS A;  5M10 A;  4H2P A;  3ZDN A;  2X8G A;  3VRA A;  1GPE A;  5BVA A;  1XDI A;  4AT2 A;  4UDP A;  1VQW A;  3GYX A;  2GMH A;  5EB5 A;  2GEW A;  2C64 A;  1EL5 A;  3ICS A;  2AQJ A;  1BF3 A;  3ATQ A;  4IA5 A;  1PN0 A;  4ZN0 A;  5KMR A;  3R9U A;  4EIP A;  4YSX A;  2GAG B;  4H4U A;  1KNR A;  5KOW A;  3DK9 A;  3T37 A;  2R4E A;  3NHO X;  2GRT A;  3BNM A;  5KRQ A;  3SZC A;  3UTG A;  3NK2 X;  2Y6R A;  1E39 A;  1YQ3 A;  3RP7 A;  1H7W A;  1DNC A;  3IC9 A;  1VG9 A;  1DXL A;  1PJ5 A;  5EB4 A;  1D4C A;  4Y4M A;  3LAD A;  4Z44 A;  4B66 A;  4B68 A;  2AAQ A;  3K7Q X;  4TM4 A;  4BJY A;  2C70 A;  4NTE A;  5C2T A;  2XVH A;  4LA1 A;  3L1R A;  4G9K A;  1NHR A;  2B76 A;  5KOX A;  5EBK A;  1CL0 A;  1HYU A;  4B65 A;  3AD8 B;  4FK1 A;  1NEN A;  1D4D A;  1E7P A;  1EBD A;  1XAN A;  3G5S A;  2OLO A;  1JOA A;  3AE9 A;  3AYJ A;  1RP0 A;  3KLJ A;  2YG6 A;  3CNT A;  1IUT A;  4YSY A;  2BAC A;  2VOU A;  1CC4 A;  1XHC A;  4RG3 A;  3RNM A;  5GRT A;  2CDU A;  2V3B A;  3DJE A;  2FJE A;  3AB1 A;  2ZBW A;  1GND A;  1MXT A;  1ZP0 A;  4NZH A;  4BV6 A;  4EM3 A;  1GTH A;  4YTP A;  2BC1 A;  4K2X A;  2BCG G;  1BKW A;  1COY A;  1VDC A;  1D5T A;  1H81 A;  3CGD A;  5U25 A;  2WP6 A;  3AED A;  3UOY A;  2YLS A;  2YWL A;  1GT8 A;  4TM3 A;  1S3E A;  3RHA A;  2GH5 A;  2GQW A;  5TR3 A;  5EOW A;  3BNU A;  3KPK A;  1OJ9 A;  4O5Q A;  1Q9I A;  2GR0 A;  3PS9 A;  4OPT A;  2V5Z A;  4CNK A;  1KSS A;  1YQ4 A;  2BS3 A;  4XWZ A;  4AT0 A;  1TDK A;  1KNP A;  2J3N A;  1E6E A;  4A6N B;  2WP9 A;  1GRT A;  1H86 A;  1NPX A;  2WOW A;  4REK A;  3V3O A;  2A8X A;  4EQX A;  3AEF A;  2BS2 A;  5BUL A;  5JCM A;  4K5R A;  2C4C A;  4HB9 A;  2C3D A;  1L9D A;  2VZ2 A;  4U8K A;  4KX6 A;  4PAB A;  2RGJ A;  2B7R A;  3GYJ A;  5DBJ A;  2YR6 A;  3K30 A;  4Y4N A;  1LQU A;  4A5L A;  1YY5 A;  3T2Y A;  3L8K A;  2HQM A;  4H50 A;  3DGZ A;  2WDV A;  3AEA A;  1KF6 A;  4CY6 A;  3KU9 A;  3D8X A;  2Z5X A;  1MOK A;  1LQT A;  3M0O A;  3IHM A;  2GV8 A;  3K7T A;  3H4K A;  5KMQ A;  1Z6L A;  3F8R A;  3UTF A;  1KFY A;  2WPE A;  4II3 A;  4TM0 A;  4H4S A;  2XVI A;  2BA9 A;  2X8H A;  4YKF A;  2VQB A;  4I58 A;  4B63 A;  1TYT A;  3HYV A;  2XFP A;  1IUX A;  4LU6 A;  3T2K A;  2FBW A;  5FS9 A;  1M6I A;  1K0J A;  4H2N A;  4JQ9 A;  1NEK A;  1RSG A;  1TDN A;  1GXF A;  2RGH A;  4A65 A;  1S3B A;  1GEU A;  2V3A A;  2CFY A;  4H7U A;  4G6G A;  1TDO A;  4U8M A;  3T14 A;  1MO9 A;  1PBE A;  2BRA A;  4OPC A;  2Y6Q A;  2TPR A;  1SEZ A;  2C3C A;  2CVJ A;  3AEC A;  3AEB A;  3GD3 A;  3NK0 X;  4CY8 A;  3ADA B;  2IVE A;  2JBV A;  3F8D A;  4UDQ A;  4C3Y A;  4D03 A;  2ZZ0 A;  4H2Q A;  4E0V A;  4EQS A;  1B4V A;  4OCG A;  3QFA A;  4A9W A;  1Y56 B;  3NNE A;  2XLS A;  1GET A;  2JK6 A;  5HHF A;  3PO7 A;  3BI2 A;  2RAB A;  2XFU A;  3GWD A;  3CNS A; 
#chains in the Genus database with same CATH homology
 1NG4 A;  1QLB A;  5KVH A;  4CCQ A;  1Y0P A;  3UKA A;  3URH A;  4JN9 A;  3AD9 B;  3AYL A;  2XLT A;  3UKP A;  2H89 A;  3BHF A;  3NN0 X;  3II4 A;  1PDH A;  3V76 A;  1VG0 A;  3SFD A;  1GV4 A;  4Z2U A;  3QSM A;  3IWA A;  1ONF A;  2JB2 A;  3E1T A;  2B7S A;  5FS8 A;  4H4X A;  4J34 A;  3ALJ A;  2WHD A;  2JAE A;  4NTD A;  3FBS A;  1D7Y A;  1V59 A;  3CPI G;  4JNQ A;  1E1L A;  2BK5 A;  1KSU A;  1E1K A;  2YG5 A;  1S2Q A;  3OC4 A;  3M13 A;  4Z2T A;  4RG4 A;  1N1P A;  2YVJ A;  4J36 A;  4H4R A;  3UCL A;  2C67 A;  2AR8 A;  3NK1 X;  4CRT A;  3LOV A;  3DK8 A;  4JNA A;  4YWO A;  4U8I A;  1GRE A;  3T0K A;  1CBO A;  1L0V A;  4EMI A;  2O9Z A;  5JCN A;  4A6N A;  1YQZ A;  1PXB A;  2PHH A;  3BI4 A;  1PBF A;  4H4T A;  3Q6J A;  4MJW A;  3Q9T A;  3UP4 A;  1FEB A;  1L9C A;  3KPF A;  2YVG A;  3FIM B;  3OZ2 A;  4ICY A;  3C4A A;  4M52 A;  4BK2 A;  1FCD A;  2WBA A;  4JY2 A;  3ICT A;  1H82 A;  1TDE A;  3CNP A;  3D1C A;  3AE4 A;  3SZW A;  2C66 A;  3SYI A;  2X8C A;  2YG7 A;  2YR4 A;  3ATR A;  2R0C A;  1H7X A;  1ZMC A;  2JB1 A;  4XWR A;  2X50 A;  2DKI A;  3FG2 P;  3RED A;  1GRF A;  2RGO A;  4A7A A;  4GRT A;  3GD4 A;  3AEE A;  4YTN A;  2EQ6 A;  3AWI A;  4G74 A;  4C77 A;  1PJ7 A;  3ABV A;  1OJA A;  2X3N A;  2C76 A;  4C74 A;  1LTX R;  3DH9 A;  3DJG X;  2VVM A;  2QA1 A;  4J33 A;  1ZY8 A;  2F5Z A;  4DNA A;  3GMC A;  5HXI A;  2GQF A;  4D04 A;  3KD9 A;  4NTC A;  4J2W A;  3SM8 A;  2YR5 A;  3IF9 A;  4FX9 A;  4JY3 A;  1ZOY A;  3LZX A;  1UKV G;  2C65 A;  3UKK A;  1F6M A;  1VRQ B;  4YTM A;  3LZW A;  4UDR A;  5M0Z A;  5JCK A;  3EAO A;  3GDN A;  4USQ A;  1GTE A;  1N4W A;  2ZZB A;  3GDP A;  3UKQ A;  4YSH A;  4Y4L A;  2GF3 A;  2WOV A;  3AE2 A;  1D4E A;  1PS9 A;  3CMM A;  4K7Z A;  5IQ4 A;  3ISH A;  3F8P A;  5U63 A;  3SZ0 A;  2XLP A;  4EM4 A;  2FJD A;  1PBC A;  5J7X A;  1Y56 A;  4H4W A;  3NH3 X;  1NDA A;  1F3P A;  3RP6 A;  4Z26 A;  2YLZ A;  4GAV A;  4AP3 A;  3AD7 B;  1CC6 A;  4EMW A;  1GRG A;  1S2Y A;  5HY5 A;  1CC2 A;  1CHU A;  4B1B A;  2OAM A;  2WES A;  1OJT A;  4B69 A;  5CKU A;  1NHS A;  1IUU A;  1CJC A;  2R4J A;  4B67 A;  1TDF A;  3P4R A;  4G73 A;  1GSN A;  2V60 A;  1DOD A;  1EL7 A;  2BYB A;  2XLU A;  1LV0 A;  1H84 A;  2JKC A;  1GOS A;  2BAB A;  2APG A;  2Q0L A;  2UZZ A;  2E5V A;  3AE5 A;  2PYX A;  3LXD A;  1W4X A;  3UOV A;  4IVO B;  4U2S A;  4H4Y A;  3QJ4 A;  2R45 A;  3GYI A;  3NN6 X;  2QA2 A;  4BUR A;  3AXB A;  3QFB A;  1GRH A;  2WS3 A;  4DSH A;  1DJQ A;  1CJ3 A;  4YSZ A;  2Z5Y A;  4K5S A;  1O94 A;  4USR A;  5CQF A;  2GVC A;  2EQ8 A;  1XPQ A;  3VRD B;  2C72 A;  4RSL A;  1K0I A;  4GR1 A;  4II2 A;  4U8J A;  2ACZ A;  3ZYX A;  2WEU A;  4Z25 A;  3AEG A;  3WE0 A;  2GR1 A;  4OPD A;  3P4P A;  2VQ7 A;  2YM2 A;  1ZMD A;  3VRB A;  3NYF A;  1B8S A;  1FEA A;  2XFN A;  3AE6 A;  4ZCC A;  2BK4 A;  5HYM A;  2QAE A;  4U8L A;  3NGC X;  1CJ4 A;  3FPZ A;  3QVP A;  4Z43 A;  2V61 A;  3COX A;  4IA6 A;  1NHP A;  3ALL A;  3NTD A;  3EF6 A;  3QVR A;  1N4U A;  3SXI A;  1PXC A;  2YG3 A;  3NYC A;  4DSG A;  1B5Q A;  2BRY A;  2B9Y A;  1EL8 A;  3EPT A;  1KDG A;  3ITJ A;  1IJH A;  1DOC A;  4ZCD A;  5KMP A;  2YM1 A;  2CUL A;  1K4Q A;  1YKJ A;  4EMJ A;  1AOG A;  1BGN A;  1PJ6 A;  2GAH B;  2YAU A;  2XFQ A;  3HZL A;  3NKS A;  3P4Q A;  5KXJ A;  2EQ9 A;  3UTH A;  4YT0 A;  5J60 A;  2BS4 A;  3NYE A;  5LV9 A;  1BWC A;  2XCG A;  1PHH A;  3VQR A;  2WET A;  2YQU A;  4OVI A;  3CGE A;  2OA1 A;  4H2R A;  2E1M A;  1CJ2 A;  2EQ7 A;  2NVK X;  1IUV A;  1F8W A;  2FJA A;  2YVF A;  3I3L A;  3V3N A;  2R46 A;  3DJD A;  4OPG A;  2B9W A;  3HYW A;  4TM1 A;  1Q1W A;  1D7L A;  1TYP A;  1NHQ A;  2IID A;  4NEW A;  1EL9 A;  4P9S A;  4GDP A;  3GSI A;  3M12 A;  1OJD A;  3O0H A;  5FS7 A;  3RP8 A;  2GR3 A;  1LPF A;  4FDC B;  4C5O A;  1CF3 A;  3I6D A;  4AOS A;  2XVE A;  1BZL A;  3S5W A;  3UKL A;  2Q6U A;  4J31 A;  4NEV A;  2YLR A;  1Q1R A;  3SZF A;  3H8I A;  2R9Z A;  5IPY A;  3FMW A;  4FK1 C;  1NG3 A;  1LVL A;  2C7G A;  4X9M A;  2VRM A;  1K0L A;  4LII A;  1LJ1 A;  4U8O A;  2XDO A;  4HA6 A;  2WU5 A;  1DJN A;  2VVL A;  4H4V A;  3CN8 A;  3T2Z A;  4ECH A;  4U8P A;  2R0P A;  2OAL A;  2ARD A;  2XYO A;  3G5R A;  2WQY A;  3CIR A;  1P2H A;  4O5U A;  2WDR A;  4BJZ A;  1GRA A;  2V6O A;  4A99 A;  1JRX A;  4CNJ A;  1RYI A;  4H4Q A;  2XLR A;  3GRT A;  3NG7 X;  2BK3 A;  1FEC A;  1REO A;  3VR9 A;  5ER0 A;  3NT6 A;  3EAN A;  5KVI A;  1DOB A;  5BRT A;  2WPF A;  5FMH A;  3QSS A;  4X9N A;  4Z2R A;  1FL2 A;  1ZOV A;  3DK4 A;  1L9E A;  1JEH A;  1GES A;  2WU2 A;  3NLC A;  4CCR A;  4EIQ A;  1TRB A;  2YLT A;  1ELI A;  4K8D A;  2DKH A;  2BCP A;  4DGK A;  1OJC A;  2GMJ A;  3UTE A;  3T31 A;  3P1W A;  4GAP A;  4I59 A;  1JNZ A;  4IVM B;  2C73 A;  2IVD A;  3AE7 A;  4EQW A;  3BI5 A;  5FS6 A;  3DGH A;  2XFO A;  4U8N A;  4ADW A;  4APN A;  4IV9 A;  2GR2 A;  2C75 A;  1ZKQ A;  3CGB A;  2BXS A;  2VRL A;  3DJJ A;  4YKG A;  4B64 A;  4X4J A;  3UOZ A;  1DOE A;  4GUV A;  1GAL A;  2E4G A;  5L46 A;  1IUW A;  2GB0 A;  2VVL G;  3AYI A;  3B6D A;  3CPH G;  3SQP A;  4G6H A;  2YLX A;  4OPL A;  2BC0 A;  2TMD A;  3CPJ G;  3UKF A;  2A87 A;  4AP1 A;  4GCM A;  2I0Z A;  1ZDL A;  4NNJ A;  4J57 A;  1GER A;  4WX1 A;  4CBQ A;  3NTA A;  1N4V A;  3KVE A;  3GMB A;  3LB8 A;  5IQ1 A;  3UP5 A;  1O95 A;  4U2T A;  3H8L A;  1F8R A;  3LJP A;  2WDQ A;  4A79 A;  2H88 A;  3S61 A;  1GRB A;  1JRZ A;  4GF7 A;  1B37 A;  1QJD A;  2FJB A;  1M64 A;  2WP5 A;  2XVJ A;  4N9X A;  2X99 A;  3BHK A;  2BXR A;  4TLZ A;  3IHG A;  1QO8 A;  4OPU A;  1O5W A;  4PAA A;  5BUK A;  3PVC A;  4Z24 A;  1F8S A;  2WPC A;  2A89 A;  4GDE A;  4AOX A;  2OLN A;  3SGL A;  2R0G A;  2WOI A;  1BGJ A;  3CGC A;  3GRS A;  4NWZ A;  4UP3 A;  3ICR A;  4BK1 A;  4EQR A;  2QCU A;  4KPR A;  3ALM A;  3DA1 A;  1PBD A;  3CTY A;  1JNR A;  3DME A;  3SY4 A;  1E1M A;  4TLX A;  3B3R A;  4J56 A;  5JCL A;  4WCT A;  5U1O A;  3JSK A;  3QSE A;  4OPI A;  5GSN A;  5KWF A;  1P2E A;  4BK3 A;  1IUS A;  3AE8 A;  3P4S A;  4K22 A;  3G5Q A;  3VR8 A;  3AE1 A;  5C3J A;  3HYX A;  2ZZC A;  4JDR A;  1H83 A;  3UOX A;  2B9X A;  1E1N A;  1X31 B;  5KNL A;  4U2L A;  3SX6 A;  4YXD A;  2XVF A;  3C96 A;  3CND A;  1PBB A;  1NAA A;  2NPX A;  1JU2 A;  1ZX9 A;  3GWF A;  3SFE A;  2W0H A;  3NRN A;  3C4N A;  3UKH A;  2Q0K A;  4XXG A;  3KKJ A;  4C3X A;  3CNJ A;  2YG4 A;  1PXA A;  2Q7V A;  1ZK7 A;  3P9U A;  3AE3 A;  3NIX A;  4H4P A;  2YLW A;  5JCI A;  3KA7 A;  4H4Z A;  1JRY A;  2JB3 A;  3K7M X;  1FOH A;  1H6V A;  5KMS A;  5M10 A;  4H2P A;  3ZDN A;  2X8G A;  3VRA A;  1GPE A;  5BVA A;  1XDI A;  4AT2 A;  4UDP A;  1VQW A;  3GYX A;  2GMH A;  5EB5 A;  2GEW A;  2C64 A;  1EL5 A;  3ICS A;  2AQJ A;  1BF3 A;  3ATQ A;  4IA5 A;  1PN0 A;  4ZN0 A;  5KMR A;  3R9U A;  4EIP A;  4YSX A;  2GAG B;  4H4U A;  1KNR A;  5KOW A;  3DK9 A;  3T37 A;  2R4E A;  3NHO X;  2GRT A;  3BNM A;  5KRQ A;  3SZC A;  3UTG A;  3NK2 X;  2Y6R A;  1E39 A;  1YQ3 A;  3RP7 A;  1H7W A;  1DNC A;  3IC9 A;  1VG9 A;  1DXL A;  1PJ5 A;  5EB4 A;  1D4C A;  4Y4M A;  3LAD A;  4Z44 A;  4B66 A;  4B68 A;  2AAQ A;  3K7Q X;  4TM4 A;  4BJY A;  2C70 A;  4NTE A;  5C2T A;  2XVH A;  4LA1 A;  3L1R A;  4G9K A;  1NHR A;  2B76 A;  5KOX A;  5EBK A;  1CL0 A;  1HYU A;  4B65 A;  3AD8 B;  4FK1 A;  1NEN A;  1D4D A;  1E7P A;  1EBD A;  1XAN A;  3G5S A;  2OLO A;  1JOA A;  3AE9 A;  3AYJ A;  1RP0 A;  3KLJ A;  2YG6 A;  3CNT A;  1IUT A;  4YSY A;  2BAC A;  2VOU A;  1CC4 A;  1XHC A;  4RG3 A;  3RNM A;  5GRT A;  2CDU A;  2V3B A;  3DJE A;  2FJE A;  3AB1 A;  2ZBW A;  1GND A;  1MXT A;  1ZP0 A;  4NZH A;  4BV6 A;  4EM3 A;  1GTH A;  4YTP A;  2BC1 A;  4K2X A;  2BCG G;  1BKW A;  1COY A;  1VDC A;  1D5T A;  1H81 A;  3CGD A;  5U25 A;  2WP6 A;  3AED A;  3UOY A;  2YLS A;  2YWL A;  1GT8 A;  4TM3 A;  1S3E A;  3RHA A;  2GH5 A;  2GQW A;  5TR3 A;  5EOW A;  3BNU A;  3KPK A;  1OJ9 A;  4O5Q A;  1Q9I A;  2GR0 A;  3PS9 A;  4OPT A;  2V5Z A;  4CNK A;  1KSS A;  1YQ4 A;  2BS3 A;  4XWZ A;  4AT0 A;  1TDK A;  1KNP A;  2J3N A;  1E6E A;  4A6N B;  2WP9 A;  1GRT A;  1H86 A;  1NPX A;  2WOW A;  4REK A;  3V3O A;  2A8X A;  4EQX A;  3AEF A;  2BS2 A;  5BUL A;  5JCM A;  4K5R A;  2C4C A;  4HB9 A;  2C3D A;  1L9D A;  2VZ2 A;  4U8K A;  4KX6 A;  4PAB A;  2RGJ A;  2B7R A;  3GYJ A;  5DBJ A;  2YR6 A;  3K30 A;  4Y4N A;  1LQU A;  4A5L A;  1YY5 A;  3T2Y A;  3L8K A;  2HQM A;  4H50 A;  3DGZ A;  2WDV A;  3AEA A;  1KF6 A;  4CY6 A;  3KU9 A;  3D8X A;  2Z5X A;  1MOK A;  1LQT A;  3M0O A;  3IHM A;  2GV8 A;  3K7T A;  3H4K A;  5KMQ A;  1Z6L A;  3F8R A;  3UTF A;  1KFY A;  2WPE A;  4II3 A;  4TM0 A;  4H4S A;  2XVI A;  2BA9 A;  2X8H A;  4YKF A;  2VQB A;  4I58 A;  4B63 A;  1TYT A;  3HYV A;  2XFP A;  1IUX A;  4LU6 A;  3T2K A;  2FBW A;  5FS9 A;  1M6I A;  1K0J A;  4H2N A;  4JQ9 A;  1NEK A;  1RSG A;  1TDN A;  1GXF A;  2RGH A;  4A65 A;  1S3B A;  1GEU A;  2V3A A;  2CFY A;  4H7U A;  4G6G A;  1TDO A;  4U8M A;  3T14 A;  1MO9 A;  1PBE A;  2BRA A;  4OPC A;  2Y6Q A;  2TPR A;  1SEZ A;  2C3C A;  2CVJ A;  3AEC A;  3AEB A;  3GD3 A;  3NK0 X;  4CY8 A;  3ADA B;  2IVE A;  2JBV A;  3F8D A;  4UDQ A;  4C3Y A;  4D03 A;  2ZZ0 A;  4H2Q A;  4E0V A;  4EQS A;  1B4V A;  4OCG A;  3QFA A;  4A9W A;  1Y56 B;  3NNE A;  2XLS A;  1GET A;  2JK6 A;  5HHF A;  3PO7 A;  3BI2 A;  2RAB A;  2XFU A;  3GWD A;  3CNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...