2XVHA

Crystal structure of bacterial flavin containing monooxygenase in complex with nadp
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
total genus 161
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA02
1FL2A 2QA2A 2HQMA 3NK2X 4I59A 2XVIA 4XXGA 1GALA 5DBJA 1PJ6A 1ZDLA 4CBQA 4CRTA 3B3RA 1QO8A 2EQ6A 4X9NA 4YT0A 5JCMA 3AWIA 3SFEA 1D4DA 2JB2A 3C96A 1CJ2A 1BGNA 3LADA 1GPEA 2B9YA 3GD4A 3DK4A 3HZLA 1L0VA 2QCUA 3KPFA 3I6DA 1BGJA 1OJCA 3ZYXA 3EANA 1X31B 3AEDA 3AD8B 2YG7A 3B6DA 3P4PA 4B63A 2XVEA 2WEUA 1JNRA 4Y4LA 2WU2A 1F8RA 4AOXA 3NH3X 3GYIA 1KDGA 2BYBA 3NYCA 4YTMA 3V3NA 4B66A 1S2YA 4UP3A 5EB4A 4Z2UA 2JB1A 5HXIA 1GV4A 3LJPA 2BACA 5KRQA 3V3OA 4GF7A 3VRDB 2I0ZA 4K22A 3ZDNA 4H4TA 4AOSA 2XFQA 1PS9A 4P9SA 3NYFA 1GT8A 4J36A 4TM3A 4BJZA 1ONFA 3UKKA 5GRTA 3M13A 1FCDA 1GNDA 5CQFA 4EQWA 2QAEA 2JAEA 1O95A 4USQA 4Y4NA 1QJDA 3M0OA 2VOUA 2FJEA 2JB3A 3NYEA 3QSEA 1EL8A 1FECA 4LA1A 4BURA 4EIQA 4YSXA 2C73A 4Z44A 1EL5A 2Q0KA 3GSIA 2C72A 4IA6A 2GQFA 4FK1A 4EMIA 3L1RA 3KVEA 3GMBA 1D7LA 3FMWA 4H2NA 3VRAA 2YVJA 1DJNA 1H7WA 1OJAA 2F5ZA 2V61A 1LJ1A 3DMEA 5GSNA 1OJDA 2C67A 1K0LA 1GRFA 4H2RA 4EQXA 2Q0LA 2XVJA 3GRTA 4H4UA 5LV9A 1EBDA 1Q9IA 1VRQB 2ZBWA 2GR1A 4A99A 5HY5A 1UKVG 2WOIA 3ABVA 3R9UA 1Z6LA 3P1WA 3UKLA 2GMHA 4D04A 4EMWA 3REDA 2JK6A 2ZZBA 4J31A 1LQUA 1Q1WA 3ICRA 4JDRA 1E1MA 3AE4A 3ALJA 3GMCA 3DJDA 2XCGA 1PDHA 4M52A 5EB5A 3UTEA 2E5VA 3AECA 3FIMB 3UOZA 4CY8A 3EF6A 2OA1A 1TDFA 3RP6A 1GRBA 1M6IA 1TYTA 3IHMA 1DOBA 1KNPA 1CJ4A 1CJCA 1D5TA 3AE7A 1H81A 1M64A 3ALMA 3CGBA 1V59A 4D03A 2EQ7A 1VG0A 1PHHA 3AE9A 4RG3A 4EIPA 4Z43A 1CBOA 1PBFA 2XYOA 2X8GA 3AEEA 2DKIA 4Z2TA 2YG3A 3UKPA 4B1BA 1PBBA 4I58A 2BS4A 1Y56B 2B7RA 3QFBA 2CULA 2C66A 3DH9A 4ZCCA 1JRXA 3AE1A 2X99A 4K2XA 4UDQA 4AT2A 1PJ7A 4A6NA 1JNZA 3DA1A 3QFAA 3UTGA 1B4VA 1KNRA 4CNKA 1CF3A 1MOKA 4J56A 2WBAA 1FOHA 3BHFA 3CPIG 3CNJA 2GF3A 4NTEA 1FEAA 2BK4A 2WQYA 2GR2A 4TM4A 1FEBA 1CL0A 1F8WA 2AQJA 4GDPA 5JCIA 2C3DA 1NDAA 4H4QA 3GWDA 4NZHA 3RP7A 1B37A 2GR3A 4H4SA 3UP5A 1BWCA 2VRLA 2XFUA 4YSHA 4C74A 1QLBA 3DK9A 2R45A 4B64A 1O5WA 2GRTA 5JCLA 1RYIA 5KXJA 1VDCA 3BI5A 3K30A 3II4A 4U8OA 4JQ9A 2EQ8A 3BNMA 4U2TA 2BXSA 2FBWA 2OLNA 1CC2A 4X4JA 3RP8A 3SQPA 3KA7A 1GRGA 1H86A 4IVMB 4JNQA 1N4VA 1IUXA 4U8MA 4CNJA 4C5OA 2BCPA 2GAGB 4UDRA 3QSSA 2YR6A 4GRTA 3VR8A 4B65A 4GUVA 4N9XA 3IWAA 1YY5A 2H88A 2RGOA 4OPCA 2V6OA 2IIDA 3CNPA 3ATQA 2WPEA 3CGEA 3KLJA 3NN6X 1AOGA 3NT6A 2Z5YA 3K7MX 2OAMA 1TDEA 1GERA 3URHA 4YXDA 2R46A 2WPFA 4Z24A 3EAOA 3NLCA 1DOEA 1Y56A 2OLOA 2R4JA 1ZP0A 4BK1A 5KOWA 2H89A 2FJBA 1L9DA 1GOSA 2C70A 2YLWA 5BUKA 5JCKA 2BS2A 2YQUA 1S2QA 3QJ4A 3PVCA 3S5WA 2GR0A 2VQBA 2GEWA 3C4AA 5J7XA 1XHCA 4GR1A 4Z25A 3DJGX 2YLSA 1IJHA 3G5QA 3F8RA 4YTPA 2E4GA 2XLUA 1TYPA 4TLXA 4A9WA 3AE3A 2YVGA 5BULA 2R4EA 4FDCB 3GYJA 4OPIA 1KFYA 4ZN0A 1CHUA 4PABA 1DXLA 1N4UA 4CY6A 1JRZA 4DSHA 2C7GA 1F8SA 1NPXA 3BI4A 2QA1A 3NIXA 3UOXA 4CCQA 2Z5XA 1YQZA 3JSKA 1N4WA 2FJAA 4DSGA 1ZOVA 1GRHA 2VVMA 3LZXA 5EOWA 3UOYA 4A6NB 1NG4A 1GREA 3UKHA 3AEFA 3UTHA 3DK8A 4ICYA 5BRTA 5C3JA 1GETA 4H4YA 3SFDA 2A8XA 2B9XA 4U2SA 4EM3A 1ZMDA 1DNCA 3UOVA 3AB1A 4GCMA 2V3AA 2AAQA 3AD9B 4CCRA 5IQ1A 3UTFA 1E6EA 1E7PA 3AD7B 4B68A 4BV6A 3DJJA 1GTHA 2C3CA 3GDPA 2YM2A 4YKGA 2GMJA 4RSLA 4A7AA 2BS3A 1GESA 1TDOA 2GQWA 2TMDA 2W0HA 3AYJA 4YKFA 4APNA 2JKCA 4E0VA 3G5RA 2XVHA 1KF6A 1LTXR 4A65A 4YTNA 5U63A 4Z2RA 5KVIA 2X3NA 2WP9A 2ZZ0A 2WDVA 1RP0A 1K0IA 1RSGA 4RG4A 2CVJA 3ITJA 3BHKA 4U2LA 2IVDA 4EM4A 1PBCA 1D4EA 1H83A 2ACZA 3ALLA 4WX1A 2A87A 2CDUA 4ADWA 4PAAA 5FMHA 1EL9A 3ISHA 5CKUA 4C77A 1JOAA 3CTYA 4HB9A 2XLPA 3QSMA 4OPDA 4NTDA 3AEAA 1OJTA 4TM1A 1L9CA 3T37A 2JBVA 3QVRA 1GRAA 1D4CA 4AP1A 2VRMA 2WPCA 4A79A 3IC9A 3O0HA 1TRBA 3GD3A 4B67A 5EBKA 5M10A 4LU6A 3AE5A 4OCGA 3NK1X 1PXBA 3DJEA 3DGHA 4MJWA 1F3PA 3UKQA 5KOXA 2V5ZA 1NHQA 4FX9A 4H4VA 4H4XA 1PXAA 2DKHA 3P9UA 5HYMA 4J34A 1NEKA 3V76A 1DOCA 4O5QA 3UCLA 2BCGG 2YG5A 1BZLA 2GAHB 3RNMA 1REOA 4TM0A 1KSSA 3DGZA 3BI2A 1GEUA 1F6MA 2WS3A 4H4ZA 4KPRA 2APGA 2PHHA 3FG2P 4O5UA 4TLZA 2WDRA 4AT0A 2YVFA 1Y0PA 4U8JA 2BK3A 1BF3A 1OJ9A 3RHAA 2Y6QA 2YWLA 4JN9A 3F8DA 4BK2A 4Y4MA 1LVLA 3UP4A 1B5QA 2RGJA 3K7TA 1H82A 1ZOYA 2UZZA 2V3BA 3IHGA 4C3XA 4JY3A 4H50A 4REKA 4YSYA 1ELIA 3AYIA 3KKJA 2J3NA 2YLRA 1YQ4A 4WCTA 4B69A 3C4NA 2YR4A 3CN8A 5IPYA 1H6VA 4U8IA 3LB8A 5M0ZA 1NHPA 4U8PA 4XWZA 3NN0X 5FS9A 4NTCA 4IVOB 3K7QX 4USRA 3NRNA 3ADAB 4K5SA 4GDEA 4IA5A 2PYXA 1ZX9A 4IV9A 1IUVA 3COXA 3NKSA 2XFPA 1ZKQA 3GRSA 1TDKA 2C64A 1E39A 2GV8A 1PBEA 2ARDA 2NVKX 1GSNA 3CPHG 3H4KA 3H8IA 1CC4A 3CNTA 1NAAA 3P4RA 5TR3A 3VR9A 3CPJG 2BC0A 1NG3A 2A89A 3NTAA 3F8PA 3AEGA 2BA9A 4AP3A 3NGCX 4ZCDA 2X50A 3LOVA 2C65A 4H2QA 2YM1A 4H7UA 1NENA 2WETA 5HHFA 2VZ2A 3OC4A 3S61A 2YG4A 1DODA 4UDPA 5FS6A 2XLTA 3FPZA 2C75A 2BABA 4K7ZA 1H84A 1PN0A 3P4SA 2EQ9A 2Q7VA 1EL7A 2YLXA 3D8XA 2WOVA 3GWFA 2GVCA 2XVFA 1PBDA 3NK0X 1W4XA 2CFYA 2IVEA 3E1TA 4H4RA 3VQRA 5BVAA 5KVHA 1YKJA 3KU9A 1N1PA 3GDNA 3H8LA 3M12A 4U8KA 3KD9A 3I3LA 2XFOA 3G5SA 4H4PA 2B7SA 2B9WA 2XLSA 1S3EA 2XLRA 1Q1RA 1PJ5A 4NEVA 2WP6A 3L8KA 5U1OA 4H4WA 1K0JA 3CGDA 1LPFA 2YLTA 3UKFA 5J60A 4JNAA 3OZ2A 1ZMCA 2E1MA 2GB0A 5C2TA 1GXFA 2BC1A 3EPTA 4FK1C 3D1CA 1IUWA 2TPRA 3AE2A 1NHRA 3AYLA 3LZWA 3ATRA 4DGKA 5ER0A 4K5RA 1GRTA 3PO7A 4KX6A 2O9ZA 4DNAA 3ICTA 4YSZA 1XDIA 4K8DA 1P2EA 2B76A 2WOWA 4Z26A 1PXCA 1H7XA 1MO9A 2WP5A 1VG9A 4J2WA 3NHOX 2OALA 2WESA 4J33A 4OPLA 3BNUA 4EMJA 1YQ3A 2R0GA 4BK3A 5KWFA 2ZZCA 4OPTA 4C3YA 5JCNA 1E1LA 3LXDA 2FJDA 3SGLA 2XFNA 3AXBA 4OPGA 1DJQA 1IUTA 1L9EA 2RABA 3IF9A 3AE8A 3WE0A 3CGCA 4EQSA 2V60A 4ECHA 4H2PA 1ZK7A 2YG6A 3ICSA 1JU2A 4XWRA 1IUUA 3UKAA 3AEBA 1HYUA 2BK5A 3FBSA 1KSUA 2WU5A 1XPQA 2XDOA 3PS9A 3VRBA 1P2HA 1ZY8A 5FS8A 1JRYA 4BJYA 2X8CA 3CNSA 4NEWA 2R0PA 1JEHA 5L46A 2YR5A 4X9MA 2VQ7A 3NNEA 1TDNA 1LQTA 3Q9TA 1CJ3A 3QVPA 4LIIA 1NHSA 1VQWA 1SEZA 1O94A 2BXRA 3CIRA 2AR8A 4YWOA 3CNDA 3NG7X 1BKWA 1IUSA 1K4QA 2GH5A 1LV0A 3P4QA 2X8HA 4OVIA 4U8LA 1XANA 3SM8A 4EQRA 4J57A 4JY2A 1D7YA 1MXTA 1S3BA 5IQ4A 2NPXA 1CC6A 2VVLG 5FS7A 1GTEA 4HA6A 5U25A 2YAUA 2R0CA 2WHDA 3AE6A 4OPUA 1E1KA 2R9ZA 4U8NA 1COYA 1B8SA 2RGHA 1E1NA 2Q6UA 2VVLA 2WDQA 2Y6RA 2C76A 3NTDA 4A5LA 2YLZA 3Q6JA
chains in the Genus database with same CATH superfamily
1FL2A 2QA2A 2HQMA 3NK2X 4I59A 2XVIA 4XXGA 1GALA 5DBJA 1PJ6A 1ZDLA 4CBQA 4CRTA 3B3RA 1QO8A 3SXIA 2EQ6A 4X9NA 4YT0A 5JCMA 3AWIA 3SFEA 1D4DA 2JB2A 3C96A 1CJ2A 1BGNA 3LADA 1GPEA 2B9YA 3GD4A 2BRYA 3DK4A 3HZLA 1L0VA 2QCUA 3KPFA 3I6DA 1BGJA 1OJCA 3ZYXA 3EANA 1X31B 3SZFA 3AEDA 3SZCA 3AD8B 2YG7A 3B6DA 3P4PA 4B63A 2XVEA 2WEUA 1JNRA 4Y4LA 2WU2A 1F8RA 3T0KA 4AOXA 3NH3X 3GYIA 1KDGA 2BYBA 3NYCA 4YTMA 3V3NA 4B66A 1S2YA 4UP3A 5EB4A 4Z2UA 2JB1A 5HXIA 1GV4A 3LJPA 2BACA 5KRQA 3V3OA 4GF7A 3VRDB 2I0ZA 4K22A 3ZDNA 4G6GA 4H4TA 4AOSA 2XFQA 1PS9A 4P9SA 3NYFA 1GT8A 4J36A 4TM3A 4BJZA 1ONFA 3UKKA 5GRTA 3M13A 1FCDA 1GNDA 5CQFA 4EQWA 2QAEA 2JAEA 1O95A 4USQA 4Y4NA 1QJDA 3M0OA 2VOUA 2FJEA 2JB3A 3NYEA 3QSEA 1EL8A 1FECA 4LA1A 4BURA 4EIQA 4YSXA 2C73A 4Z44A 1EL5A 2Q0KA 3GSIA 2C72A 4IA6A 2GQFA 4FK1A 4EMIA 3SZ0A 3L1RA 3KVEA 3GMBA 1D7LA 3FMWA 4G6HA 4H2NA 3SX6A 3T31A 3VRAA 2YVJA 1DJNA 1H7WA 1OJAA 2F5ZA 2V61A 1LJ1A 3DMEA 5GSNA 1OJDA 2C67A 1K0LA 1GRFA 4H2RA 4EQXA 2Q0LA 2XVJA 3GRTA 4H4UA 5LV9A 1EBDA 1Q9IA 1VRQB 2ZBWA 3SZWA 2GR1A 4A99A 5HY5A 1UKVG 2WOIA 3ABVA 3R9UA 1Z6LA 3P1WA 3HYXA 2GMHA 3UKLA 4D04A 4EMWA 3REDA 2JK6A 4II3A 2ZZBA 4J31A 4GAVA 1LQUA 1Q1WA 3ICRA 4JDRA 1E1MA 3AE4A 3ALJA 3GMCA 3DJDA 2XCGA 1PDHA 4M52A 5EB5A 3UTEA 2E5VA 3AECA 3FIMB 3UOZA 4CY8A 3EF6A 2OA1A 1TDFA 3RP6A 1GRBA 1M6IA 1TYTA 3IHMA 1DOBA 1KNPA 1CJ4A 1CJCA 1D5TA 3AE7A 1H81A 1M64A 3ALMA 3CGBA 1V59A 3T2KA 4D03A 2EQ7A 1VG0A 1PHHA 3AE9A 4RG3A 4EIPA 4Z43A 1CBOA 1PBFA 2XYOA 2X8GA 3AEEA 2DKIA 4Z2TA 2YG3A 3UKPA 4B1BA 1PBBA 4I58A 2BS4A 1Y56B 2B7RA 3QFBA 2CULA 2C66A 3DH9A 4ZCCA 1JRXA 3AE1A 2X99A 4K2XA 4UDQA 4AT2A 1PJ7A 4A6NA 1JNZA 3DA1A 3QFAA 3UTGA 1B4VA 1KNRA 4CNKA 1CF3A 1MOKA 4J56A 2WBAA 1FOHA 3BHFA 3CPIG 3CNJA 3HYVA 2GF3A 4NTEA 1FEAA 2BK4A 2WQYA 2GR2A 4TM4A 1FEBA 1CL0A 1F8WA 2AQJA 4GDPA 5JCIA 2C3DA 1NDAA 4H4QA 3GWDA 4NZHA 3RP7A 1B37A 2GR3A 4H4SA 3UP5A 1BWCA 2VRLA 2XFUA 4YSHA 4C74A 1QLBA 3DK9A 2R45A 4B64A 1O5WA 5KMRA 2GRTA 5JCLA 1RYIA 5KXJA 1VDCA 3BI5A 3K30A 3II4A 4U8OA 4JQ9A 2EQ8A 3BNMA 4U2TA 2BXSA 4NWZA 2FBWA 2OLNA 1CC2A 4X4JA 3RP8A 3SQPA 3KA7A 1GRGA 1H86A 4IVMB 4JNQA 1N4VA 1IUXA 4U8MA 4CNJA 4C5OA 2BCPA 2GAGB 4UDRA 3QSSA 3T2ZA 2YR6A 4GRTA 3VR8A 4B65A 4GUVA 4N9XA 3IWAA 1YY5A 2H88A 2RGOA 4OPCA 5KMPA 2V6OA 2IIDA 3CNPA 3ATQA 2WPEA 3CGEA 3KLJA 3NN6X 1AOGA 3NT6A 2Z5YA 3K7MX 2OAMA 1TDEA 1GERA 3URHA 4YXDA 2R46A 2WPFA 4Z24A 3EAOA 3NLCA 1DOEA 1Y56A 2OLOA 2R4JA 1ZP0A 4BK1A 5KOWA 2H89A 2FJBA 1L9DA 1GOSA 2C70A 2YLWA 5BUKA 5JCKA 2BS2A 2YQUA 1S2QA 3QJ4A 3PVCA 3S5WA 2GR0A 2VQBA 2GEWA 3C4AA 5J7XA 1XHCA 4GR1A 4Z25A 3DJGX 2YLSA 1IJHA 3G5QA 3F8RA 4YTPA 2E4GA 2XLUA 1TYPA 4TLXA 4A9WA 3AE3A 2YVGA 5BULA 2R4EA 4FDCB 3GYJA 4OPIA 1KFYA 4ZN0A 1CHUA 4PABA 1DXLA 1N4UA 4NNJA 4CY6A 1JRZA 4DSHA 2C7GA 1F8SA 1NPXA 3BI4A 2QA1A 3NIXA 3UOXA 4CCQA 2Z5XA 1YQZA 3JSKA 1N4WA 2FJAA 4DSGA 1ZOVA 1GRHA 2VVMA 3LZXA 5EOWA 3UOYA 4A6NB 1NG4A 1GREA 3UKHA 3AEFA 3UTHA 3DK8A 4ICYA 5BRTA 5C3JA 1GETA 4H4YA 3SFDA 2A8XA 2B9XA 4U2SA 4EM3A 1ZMDA 1DNCA 3UOVA 3AB1A 4GCMA 2V3AA 2AAQA 3AD9B 4CCRA 5IQ1A 3UTFA 1E6EA 1E7PA 3AD7B 4B68A 4BV6A 3DJJA 1GTHA 2C3CA 3GDPA 2YM2A 4YKGA 2GMJA 4RSLA 4A7AA 2BS3A 1GESA 1TDOA 2GQWA 2TMDA 2W0HA 3AYJA 4YKFA 4APNA 5KMSA 2JKCA 5KMQA 4E0VA 3G5RA 2XVHA 1KF6A 1LTXR 4A65A 4YTNA 5U63A 4Z2RA 5KVIA 2X3NA 2WP9A 2ZZ0A 2WDVA 1RP0A 1K0IA 1RSGA 4RG4A 2CVJA 3ITJA 3BHKA 4U2LA 2IVDA 4EM4A 1PBCA 1D4EA 1H83A 2ACZA 3ALLA 4WX1A 2A87A 2CDUA 4ADWA 4PAAA 5FMHA 1EL9A 3ISHA 5CKUA 4C77A 1JOAA 3CTYA 4HB9A 2XLPA 3QSMA 4OPDA 4NTDA 3AEAA 1OJTA 4TM1A 1L9CA 3T37A 2JBVA 3QVRA 1GRAA 1D4CA 4AP1A 3T14A 2VRMA 2WPCA 4A79A 3IC9A 3O0HA 1TRBA 3GD3A 4B67A 5EBKA 5M10A 4LU6A 3AE5A 4OCGA 3NK1X 1PXBA 3T2YA 3DJEA 3DGHA 3KPKA 1F3PA 4MJWA 3UKQA 2V5ZA 5KOXA 1NHQA 4FX9A 4H4VA 4H4XA 1PXAA 2DKHA 3P9UA 5HYMA 4J34A 1NEKA 3V76A 1DOCA 4O5QA 3UCLA 2BCGG 2YG5A 1BZLA 2GAHB 3RNMA 1REOA 4TM0A 1KSSA 3DGZA 3BI2A 1GEUA 1F6MA 2WS3A 4H4ZA 4KPRA 2APGA 2PHHA 3FG2P 4O5UA 4TLZA 2WDRA 4AT0A 2YVFA 1Y0PA 3CMMA 2BK3A 1BF3A 1OJ9A 4U8JA 2Y6QA 2YWLA 4JN9A 3F8DA 3RHAA 4BK2A 4Y4MA 1LVLA 3UP4A 1B5QA 2RGJA 3K7TA 1H82A 1ZOYA 2UZZA 2V3BA 3IHGA 4C3XA 4JY3A 4H50A 4REKA 4YSYA 1ELIA 3AYIA 3KKJA 2J3NA 2YLRA 1YQ4A 4WCTA 4B69A 3C4NA 2YR4A 3CN8A 5IPYA 1H6VA 4U8IA 3LB8A 5M0ZA 1NHPA 4U8PA 4G73A 4XWZA 3NN0X 5FS9A 4NTCA 4IVOB 3K7QX 4GAPA 4USRA 3NRNA 3ADAB 4K5SA 4GDEA 4IA5A 2PYXA 1ZX9A 4IV9A 1IUVA 3COXA 3NKSA 2XFPA 1ZKQA 3GRSA 1TDKA 2C64A 1E39A 2GV8A 1PBEA 2ARDA 2NVKX 1GSNA 3CPHG 3H4KA 3H8IA 1CC4A 3CNTA 1NAAA 3GYXA 3P4RA 5TR3A 3VR9A 3CPJG 2BC0A 1NG3A 2A89A 3NTAA 3F8PA 3AEGA 2BA9A 4AP3A 3NGCX 4ZCDA 2X50A 3LOVA 3HYWA 2C65A 4H2QA 2YM1A 4G9KA 4H7UA 1NENA 2WETA 5HHFA 2VZ2A 3OC4A 3S61A 2YG4A 1DODA 4UDPA 5FS6A 2XLTA 3FPZA 2C75A 2BABA 4K7ZA 1H84A 1PN0A 3P4SA 2EQ9A 2Q7VA 1EL7A 2YLXA 3D8XA 2WOVA 3GWFA 2GVCA 3SY4A 2XVFA 1PBDA 3NK0X 1W4XA 2CFYA 2IVEA 3E1TA 4H4RA 3VQRA 5BVAA 5KVHA 1YKJA 3KU9A 3SYIA 1N1PA 3GDNA 3H8LA 3M12A 4U8KA 3KD9A 3I3LA 2XFOA 3G5SA 4H4PA 2B7SA 2B9WA 2XLSA 1S3EA 2XLRA 1Q1RA 1PJ5A 4NEVA 2WP6A 3L8KA 5U1OA 4H4WA 1K0JA 3CGDA 1LPFA 4G74A 2YLTA 3UKFA 5J60A 4JNAA 3OZ2A 1ZMCA 2E1MA 2GB0A 5C2TA 1GXFA 2BC1A 3EPTA 4FK1C 3D1CA 1IUWA 2TPRA 3AE2A 1NHRA 3AYLA 3LZWA 3ATRA 4DGKA 5ER0A 4K5RA 1GRTA 3PO7A 4II2A 2O9ZA 4KX6A 3ICTA 4DNAA 4YSZA 1XDIA 4K8DA 1P2EA 2B76A 2WOWA 4Z26A 1PXCA 1H7XA 1MO9A 2WP5A 1VG9A 4J2WA 3NHOX 2OALA 2WESA 4J33A 4OPLA 3BNUA 4EMJA 1YQ3A 2R0GA 4BK3A 2BRAA 5KWFA 2ZZCA 4OPTA 4C3YA 5JCNA 1E1LA 3LXDA 2FJDA 3SGLA 2XFNA 3AXBA 4OPGA 1DJQA 1IUTA 1L9EA 2RABA 3IF9A 3AE8A 3WE0A 3CGCA 4EQSA 2V60A 4ECHA 4H2PA 1ZK7A 2YG6A 3ICSA 1JU2A 4XWRA 1IUUA 3UKAA 3AEBA 1HYUA 2BK5A 3FBSA 1KSUA 2WU5A 1XPQA 2XDOA 3PS9A 3VRBA 1P2HA 1ZY8A 5FS8A 1JRYA 4BJYA 2X8CA 3CNSA 4NEWA 2R0PA 1JEHA 5L46A 2YR5A 4X9MA 2VQ7A 3NNEA 1TDNA 1LQTA 3Q9TA 1CJ3A 3QVPA 4LIIA 1NHSA 1VQWA 1SEZA 1O94A 2BXRA 3CIRA 5KNLA 2AR8A 4YWOA 3CNDA 3NG7X 1BKWA 1IUSA 1K4QA 2GH5A 1LV0A 3P4QA 2X8HA 4OVIA 4U8LA 1XANA 3SM8A 4EQRA 4J57A 4JY2A 1D7YA 1MXTA 1S3BA 5IQ4A 2NPXA 1CC6A 2VVLG 2C4CA 5FS7A 1GTEA 4HA6A 5U25A 2YAUA 2R0CA 2WHDA 3AE6A 4OPUA 1E1KA 2R9ZA 4U8NA 1COYA 1B8SA 2RGHA 1E1NA 2Q6UA 2VVLA 2WDQA 2Y6RA 2C76A 3NTDA 4A5LA 2YLZA 3Q6JA
chains in the Genus database with same CATH topology
1FL2A 2QA2A 2HQMA 3NK2X 4I59A 2XVIA 4XXGA 1GALA 5DBJA 1PJ6A 1ZDLA 4CBQA 4CRTA 3B3RA 1QO8A 3SXIA 2EQ6A 4X9NA 4YT0A 5JCMA 3AWIA 3SFEA 1D4DA 2JB2A 3C96A 1CJ2A 1BGNA 3LADA 1GPEA 2B9YA 3GD4A 2BRYA 3DK4A 3HZLA 1L0VA 2QCUA 3KPFA 3I6DA 1BGJA 1OJCA 3ZYXA 3EANA 1X31B 3SZFA 3AEDA 3SZCA 3AD8B 2YG7A 3B6DA 3P4PA 4B63A 2XVEA 2WEUA 1JNRA 4Y4LA 2WU2A 1F8RA 3T0KA 4AOXA 3NH3X 3GYIA 1KDGA 2BYBA 3NYCA 4YTMA 3V3NA 4B66A 1S2YA 4UP3A 5EB4A 4Z2UA 2JB1A 5HXIA 1GV4A 3LJPA 2BACA 5KRQA 3V3OA 4GF7A 3VRDB 2I0ZA 4K22A 3ZDNA 4G6GA 4H4TA 4AOSA 2XFQA 1PS9A 4P9SA 3NYFA 1GT8A 4J36A 4TM3A 4BJZA 1ONFA 3UKKA 5GRTA 3M13A 1FCDA 1GNDA 5CQFA 4EQWA 2QAEA 2JAEA 1O95A 4USQA 4Y4NA 1QJDA 3M0OA 2VOUA 2FJEA 2JB3A 3NYEA 3QSEA 1EL8A 1FECA 4LA1A 4BURA 4EIQA 4YSXA 2C73A 4Z44A 1EL5A 2Q0KA 3GSIA 2C72A 4IA6A 2GQFA 4FK1A 4EMIA 3SZ0A 3L1RA 3KVEA 3GMBA 1D7LA 3FMWA 4G6HA 4H2NA 3SX6A 3T31A 3VRAA 2YVJA 1DJNA 1H7WA 1OJAA 2F5ZA 2V61A 1LJ1A 3DMEA 5GSNA 1OJDA 2C67A 1K0LA 1GRFA 4H2RA 4EQXA 2Q0LA 2XVJA 3GRTA 4H4UA 5LV9A 1EBDA 1Q9IA 1VRQB 2ZBWA 3SZWA 2GR1A 4A99A 5HY5A 1UKVG 2WOIA 3ABVA 3R9UA 1Z6LA 3P1WA 3HYXA 2GMHA 3UKLA 4D04A 4EMWA 3REDA 2JK6A 4II3A 2ZZBA 4J31A 4GAVA 1LQUA 1Q1WA 3ICRA 4JDRA 1E1MA 3AE4A 3ALJA 3GMCA 3DJDA 2XCGA 1PDHA 4M52A 5EB5A 3UTEA 2E5VA 3AECA 3FIMB 3UOZA 4CY8A 3EF6A 2OA1A 1TDFA 3RP6A 1GRBA 1M6IA 1TYTA 3IHMA 1DOBA 1KNPA 1CJ4A 1CJCA 1D5TA 3AE7A 1H81A 1M64A 3ALMA 3CGBA 1V59A 3T2KA 4D03A 2EQ7A 1VG0A 1PHHA 3AE9A 4RG3A 4EIPA 4Z43A 1CBOA 1PBFA 2XYOA 2X8GA 3AEEA 2DKIA 4Z2TA 2YG3A 3UKPA 4B1BA 1PBBA 4I58A 2BS4A 1Y56B 2B7RA 3QFBA 2CULA 2C66A 3DH9A 4ZCCA 1JRXA 3AE1A 2X99A 4K2XA 4UDQA 4AT2A 1PJ7A 4A6NA 1JNZA 3DA1A 3QFAA 3UTGA 1B4VA 1KNRA 4CNKA 1CF3A 1MOKA 4J56A 2WBAA 1FOHA 3BHFA 3CPIG 3CNJA 3HYVA 2GF3A 4NTEA 1FEAA 2BK4A 2WQYA 2GR2A 4TM4A 1FEBA 1CL0A 1F8WA 2AQJA 4GDPA 5JCIA 2C3DA 1NDAA 4H4QA 3GWDA 4NZHA 3RP7A 1B37A 2GR3A 4H4SA 3UP5A 1BWCA 2VRLA 2XFUA 4YSHA 4C74A 1QLBA 3DK9A 2R45A 4B64A 1O5WA 5KMRA 2GRTA 5JCLA 1RYIA 5KXJA 1VDCA 3BI5A 3K30A 3II4A 4U8OA 4JQ9A 2EQ8A 3BNMA 4U2TA 2BXSA 4NWZA 2FBWA 2OLNA 1CC2A 4X4JA 3RP8A 3SQPA 3KA7A 1GRGA 1H86A 4IVMB 4JNQA 1N4VA 1IUXA 4U8MA 4CNJA 4C5OA 2BCPA 2GAGB 4UDRA 3QSSA 3T2ZA 2YR6A 4GRTA 3VR8A 4B65A 4GUVA 4N9XA 3IWAA 1YY5A 2H88A 2RGOA 4OPCA 5KMPA 2V6OA 2IIDA 3CNPA 3ATQA 2WPEA 3CGEA 3KLJA 3NN6X 1AOGA 3NT6A 2Z5YA 3K7MX 2OAMA 1TDEA 1GERA 3URHA 4YXDA 2R46A 2WPFA 4Z24A 3EAOA 3NLCA 1DOEA 1Y56A 2OLOA 2R4JA 1ZP0A 4BK1A 5KOWA 2H89A 2FJBA 1L9DA 1GOSA 2C70A 2YLWA 5BUKA 5JCKA 2BS2A 2YQUA 1S2QA 3QJ4A 3PVCA 3S5WA 2GR0A 2VQBA 2GEWA 3C4AA 5J7XA 1XHCA 4GR1A 4Z25A 3DJGX 2YLSA 1IJHA 3G5QA 3F8RA 4YTPA 2E4GA 2XLUA 1TYPA 4TLXA 4A9WA 3AE3A 2YVGA 5BULA 2R4EA 4FDCB 3GYJA 4OPIA 1KFYA 4ZN0A 1CHUA 4PABA 1DXLA 1N4UA 4NNJA 4CY6A 1JRZA 4DSHA 2C7GA 1F8SA 1NPXA 3BI4A 2QA1A 3NIXA 3UOXA 4CCQA 2Z5XA 1YQZA 3JSKA 1N4WA 2FJAA 4DSGA 1ZOVA 1GRHA 2VVMA 3LZXA 5EOWA 3UOYA 4A6NB 1NG4A 1GREA 3UKHA 3AEFA 3UTHA 3DK8A 4ICYA 5BRTA 5C3JA 1GETA 4H4YA 3SFDA 2A8XA 2B9XA 4U2SA 4EM3A 1ZMDA 1DNCA 3UOVA 3AB1A 4GCMA 2V3AA 2AAQA 3AD9B 4CCRA 5IQ1A 3UTFA 1E6EA 1E7PA 3AD7B 4B68A 4BV6A 3DJJA 1GTHA 2C3CA 3GDPA 2YM2A 4YKGA 2GMJA 4RSLA 4A7AA 2BS3A 1GESA 1TDOA 2GQWA 2TMDA 2W0HA 3AYJA 4YKFA 4APNA 5KMSA 2JKCA 5KMQA 4E0VA 3G5RA 2XVHA 1KF6A 1LTXR 4A65A 4YTNA 5U63A 4Z2RA 5KVIA 2X3NA 2WP9A 2ZZ0A 2WDVA 1RP0A 1K0IA 1RSGA 4RG4A 2CVJA 3ITJA 3BHKA 4U2LA 2IVDA 4EM4A 1PBCA 1D4EA 1H83A 2ACZA 3ALLA 4WX1A 2A87A 2CDUA 4ADWA 4PAAA 5FMHA 1EL9A 3ISHA 5CKUA 4C77A 1JOAA 3CTYA 4HB9A 2XLPA 3QSMA 4OPDA 4NTDA 3AEAA 1OJTA 4TM1A 1L9CA 3T37A 2JBVA 3QVRA 1GRAA 1D4CA 4AP1A 3T14A 2VRMA 2WPCA 4A79A 3IC9A 3O0HA 1TRBA 3GD3A 4B67A 5EBKA 5M10A 4LU6A 3AE5A 4OCGA 3NK1X 1PXBA 3T2YA 3DJEA 3DGHA 3KPKA 1F3PA 4MJWA 3UKQA 2V5ZA 5KOXA 1NHQA 4FX9A 4H4VA 4H4XA 1PXAA 2DKHA 3P9UA 5HYMA 4J34A 1NEKA 3V76A 1DOCA 4O5QA 3UCLA 2BCGG 2YG5A 1BZLA 2GAHB 3RNMA 1REOA 4TM0A 1KSSA 3DGZA 3BI2A 1GEUA 1F6MA 2WS3A 4H4ZA 4KPRA 2APGA 2PHHA 3FG2P 4O5UA 4TLZA 2WDRA 4AT0A 2YVFA 1Y0PA 3CMMA 2BK3A 1BF3A 1OJ9A 4U8JA 2Y6QA 2YWLA 4JN9A 3F8DA 3RHAA 4BK2A 4Y4MA 1LVLA 3UP4A 1B5QA 2RGJA 3K7TA 1H82A 1ZOYA 2UZZA 2V3BA 3IHGA 4C3XA 4JY3A 4H50A 4REKA 4YSYA 1ELIA 3AYIA 3KKJA 2J3NA 2YLRA 1YQ4A 4WCTA 4B69A 3C4NA 2YR4A 3CN8A 5IPYA 1H6VA 4U8IA 3LB8A 5M0ZA 1NHPA 4U8PA 4G73A 4XWZA 3NN0X 5FS9A 4NTCA 4IVOB 3K7QX 4GAPA 4USRA 3NRNA 3ADAB 4K5SA 4GDEA 4IA5A 2PYXA 1ZX9A 4IV9A 1IUVA 3COXA 3NKSA 2XFPA 1ZKQA 3GRSA 1TDKA 2C64A 1E39A 2GV8A 1PBEA 2ARDA 2NVKX 1GSNA 3CPHG 3H4KA 3H8IA 1CC4A 3CNTA 1NAAA 3GYXA 3P4RA 5TR3A 3VR9A 3CPJG 2BC0A 1NG3A 2A89A 3NTAA 3F8PA 3AEGA 2BA9A 4AP3A 3NGCX 4ZCDA 2X50A 3LOVA 3HYWA 2C65A 4H2QA 2YM1A 4G9KA 4H7UA 1NENA 2WETA 5HHFA 2VZ2A 3OC4A 3S61A 2YG4A 1DODA 4UDPA 5FS6A 2XLTA 3FPZA 2C75A 2BABA 4K7ZA 1H84A 1PN0A 3P4SA 2EQ9A 2Q7VA 1EL7A 2YLXA 3D8XA 2WOVA 3GWFA 2GVCA 3SY4A 2XVFA 1PBDA 3NK0X 1W4XA 2CFYA 2IVEA 3E1TA 4H4RA 3VQRA 5BVAA 5KVHA 1YKJA 3KU9A 3SYIA 1N1PA 3GDNA 3H8LA 3M12A 4U8KA 3KD9A 3I3LA 2XFOA 3G5SA 4H4PA 2B7SA 2B9WA 2XLSA 1S3EA 2XLRA 1Q1RA 1PJ5A 4NEVA 2WP6A 3L8KA 5U1OA 4H4WA 1K0JA 3CGDA 1LPFA 4G74A 2YLTA 3UKFA 5J60A 4JNAA 3OZ2A 1ZMCA 2E1MA 2GB0A 5C2TA 1GXFA 2BC1A 3EPTA 4FK1C 3D1CA 1IUWA 2TPRA 3AE2A 1NHRA 3AYLA 3LZWA 3ATRA 4DGKA 5ER0A 4K5RA 1GRTA 3PO7A 4II2A 2O9ZA 4KX6A 3ICTA 4DNAA 4YSZA 1XDIA 4K8DA 1P2EA 2B76A 2WOWA 4Z26A 1PXCA 1H7XA 1MO9A 2WP5A 1VG9A 4J2WA 3NHOX 2OALA 2WESA 4J33A 4OPLA 3BNUA 4EMJA 1YQ3A 2R0GA 4BK3A 2BRAA 5KWFA 2ZZCA 4OPTA 4C3YA 5JCNA 1E1LA 3LXDA 2FJDA 3SGLA 2XFNA 3AXBA 4OPGA 1DJQA 1IUTA 1L9EA 2RABA 3IF9A 3AE8A 3WE0A 3CGCA 4EQSA 2V60A 4ECHA 4H2PA 1ZK7A 2YG6A 3ICSA 1JU2A 4XWRA 1IUUA 3UKAA 3AEBA 1HYUA 2BK5A 3FBSA 1KSUA 2WU5A 1XPQA 2XDOA 3PS9A 3VRBA 1P2HA 1ZY8A 5FS8A 1JRYA 4BJYA 2X8CA 3CNSA 4NEWA 2R0PA 1JEHA 5L46A 2YR5A 4X9MA 2VQ7A 3NNEA 1TDNA 1LQTA 3Q9TA 1CJ3A 3QVPA 4LIIA 1NHSA 1VQWA 1SEZA 1O94A 2BXRA 3CIRA 5KNLA 2AR8A 4YWOA 3CNDA 3NG7X 1BKWA 1IUSA 1K4QA 2GH5A 1LV0A 3P4QA 2X8HA 4OVIA 4U8LA 1XANA 3SM8A 4EQRA 4J57A 4JY2A 1D7YA 1MXTA 1S3BA 5IQ4A 2NPXA 1CC6A 2VVLG 2C4CA 5FS7A 1GTEA 4HA6A 5U25A 2YAUA 2R0CA 2WHDA 3AE6A 4OPUA 1E1KA 2R9ZA 4U8NA 1COYA 1B8SA 2RGHA 1E1NA 2Q6UA 2VVLA 2WDQA 2Y6RA 2C76A 3NTDA 4A5LA 2YLZA 3Q6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FL2 A;  2QA2 A;  2HQM A;  3NK2 X;  4I59 A;  2XVI A;  4XXG A;  1GAL A;  5DBJ A;  1PJ6 A;  1ZDL A;  4CBQ A;  4CRT A;  3B3R A;  1QO8 A;  2EQ6 A;  4X9N A;  4YT0 A;  5JCM A;  3AWI A;  3SFE A;  1D4D A;  2JB2 A;  3C96 A;  1CJ2 A;  1BGN A;  3LAD A;  1GPE A;  2B9Y A;  3GD4 A;  3DK4 A;  3HZL A;  1L0V A;  2QCU A;  3KPF A;  3I6D A;  1BGJ A;  1OJC A;  3ZYX A;  3EAN A;  1X31 B;  3AED A;  3AD8 B;  2YG7 A;  3B6D A;  3P4P A;  4B63 A;  2XVE A;  2WEU A;  1JNR A;  4Y4L A;  2WU2 A;  1F8R A;  4AOX A;  3NH3 X;  3GYI A;  1KDG A;  2BYB A;  3NYC A;  4YTM A;  3V3N A;  4B66 A;  1S2Y A;  4UP3 A;  5EB4 A;  4Z2U A;  2JB1 A;  5HXI A;  1GV4 A;  3LJP A;  2BAC A;  5KRQ A;  3V3O A;  4GF7 A;  3VRD B;  2I0Z A;  4K22 A;  3ZDN A;  4H4T A;  4AOS A;  2XFQ A;  1PS9 A;  4P9S A;  3NYF A;  1GT8 A;  4J36 A;  4TM3 A;  4BJZ A;  1ONF A;  3UKK A;  5GRT A;  3M13 A;  1FCD A;  1GND A;  5CQF A;  4EQW A;  2QAE A;  2JAE A;  1O95 A;  4USQ A;  4Y4N A;  1QJD A;  3M0O A;  2VOU A;  2FJE A;  2JB3 A;  3NYE A;  3QSE A;  1EL8 A;  1FEC A;  4LA1 A;  4BUR A;  4EIQ A;  4YSX A;  2C73 A;  4Z44 A;  1EL5 A;  2Q0K A;  3GSI A;  2C72 A;  4IA6 A;  2GQF A;  4FK1 A;  4EMI A;  3L1R A;  3KVE A;  3GMB A;  1D7L A;  3FMW A;  4H2N A;  3VRA A;  2YVJ A;  1DJN A;  1H7W A;  1OJA A;  2F5Z A;  2V61 A;  1LJ1 A;  3DME A;  5GSN A;  1OJD A;  2C67 A;  1K0L A;  1GRF A;  4H2R A;  4EQX A;  2Q0L A;  2XVJ A;  3GRT A;  4H4U A;  5LV9 A;  1EBD A;  1Q9I A;  1VRQ B;  2ZBW A;  2GR1 A;  4A99 A;  5HY5 A;  1UKV G;  2WOI A;  3ABV A;  3R9U A;  1Z6L A;  3P1W A;  3UKL A;  2GMH A;  4D04 A;  4EMW A;  3RED A;  2JK6 A;  2ZZB A;  4J31 A;  1LQU A;  1Q1W A;  3ICR A;  4JDR A;  1E1M A;  3AE4 A;  3ALJ A;  3GMC A;  3DJD A;  2XCG A;  1PDH A;  4M52 A;  5EB5 A;  3UTE A;  2E5V A;  3AEC A;  3FIM B;  3UOZ A;  4CY8 A;  3EF6 A;  2OA1 A;  1TDF A;  3RP6 A;  1GRB A;  1M6I A;  1TYT A;  3IHM A;  1DOB A;  1KNP A;  1CJ4 A;  1CJC A;  1D5T A;  3AE7 A;  1H81 A;  1M64 A;  3ALM A;  3CGB A;  1V59 A;  4D03 A;  2EQ7 A;  1VG0 A;  1PHH A;  3AE9 A;  4RG3 A;  4EIP A;  4Z43 A;  1CBO A;  1PBF A;  2XYO A;  2X8G A;  3AEE A;  2DKI A;  4Z2T A;  2YG3 A;  3UKP A;  4B1B A;  1PBB A;  4I58 A;  2BS4 A;  1Y56 B;  2B7R A;  3QFB A;  2CUL A;  2C66 A;  3DH9 A;  4ZCC A;  1JRX A;  3AE1 A;  2X99 A;  4K2X A;  4UDQ A;  4AT2 A;  1PJ7 A;  4A6N A;  1JNZ A;  3DA1 A;  3QFA A;  3UTG A;  1B4V A;  1KNR A;  4CNK A;  1CF3 A;  1MOK A;  4J56 A;  2WBA A;  1FOH A;  3BHF A;  3CPI G;  3CNJ A;  2GF3 A;  4NTE A;  1FEA A;  2BK4 A;  2WQY A;  2GR2 A;  4TM4 A;  1FEB A;  1CL0 A;  1F8W A;  2AQJ A;  4GDP A;  5JCI A;  2C3D A;  1NDA A;  4H4Q A;  3GWD A;  4NZH A;  3RP7 A;  1B37 A;  2GR3 A;  4H4S A;  3UP5 A;  1BWC A;  2VRL A;  2XFU A;  4YSH A;  4C74 A;  1QLB A;  3DK9 A;  2R45 A;  4B64 A;  1O5W A;  2GRT A;  5JCL A;  1RYI A;  5KXJ A;  1VDC A;  3BI5 A;  3K30 A;  3II4 A;  4U8O A;  4JQ9 A;  2EQ8 A;  3BNM A;  4U2T A;  2BXS A;  2FBW A;  2OLN A;  1CC2 A;  4X4J A;  3RP8 A;  3SQP A;  3KA7 A;  1GRG A;  1H86 A;  4IVM B;  4JNQ A;  1N4V A;  1IUX A;  4U8M A;  4CNJ A;  4C5O A;  2BCP A;  2GAG B;  4UDR A;  3QSS A;  2YR6 A;  4GRT A;  3VR8 A;  4B65 A;  4GUV A;  4N9X A;  3IWA A;  1YY5 A;  2H88 A;  2RGO A;  4OPC A;  2V6O A;  2IID A;  3CNP A;  3ATQ A;  2WPE A;  3CGE A;  3KLJ A;  3NN6 X;  1AOG A;  3NT6 A;  2Z5Y A;  3K7M X;  2OAM A;  1TDE A;  1GER A;  3URH A;  4YXD A;  2R46 A;  2WPF A;  4Z24 A;  3EAO A;  3NLC A;  1DOE A;  1Y56 A;  2OLO A;  2R4J A;  1ZP0 A;  4BK1 A;  5KOW A;  2H89 A;  2FJB A;  1L9D A;  1GOS A;  2C70 A;  2YLW A;  5BUK A;  5JCK A;  2BS2 A;  2YQU A;  1S2Q A;  3QJ4 A;  3PVC A;  3S5W A;  2GR0 A;  2VQB A;  2GEW A;  3C4A A;  5J7X A;  1XHC A;  4GR1 A;  4Z25 A;  3DJG X;  2YLS A;  1IJH A;  3G5Q A;  3F8R A;  4YTP A;  2E4G A;  2XLU A;  1TYP A;  4TLX A;  4A9W A;  3AE3 A;  2YVG A;  5BUL A;  2R4E A;  4FDC B;  3GYJ A;  4OPI A;  1KFY A;  4ZN0 A;  1CHU A;  4PAB A;  1DXL A;  1N4U A;  4CY6 A;  1JRZ A;  4DSH A;  2C7G A;  1F8S A;  1NPX A;  3BI4 A;  2QA1 A;  3NIX A;  3UOX A;  4CCQ A;  2Z5X A;  1YQZ A;  3JSK A;  1N4W A;  2FJA A;  4DSG A;  1ZOV A;  1GRH A;  2VVM A;  3LZX A;  5EOW A;  3UOY A;  4A6N B;  1NG4 A;  1GRE A;  3UKH A;  3AEF A;  3UTH A;  3DK8 A;  4ICY A;  5BRT A;  5C3J A;  1GET A;  4H4Y A;  3SFD A;  2A8X A;  2B9X A;  4U2S A;  4EM3 A;  1ZMD A;  1DNC A;  3UOV A;  3AB1 A;  4GCM A;  2V3A A;  2AAQ A;  3AD9 B;  4CCR A;  5IQ1 A;  3UTF A;  1E6E A;  1E7P A;  3AD7 B;  4B68 A;  4BV6 A;  3DJJ A;  1GTH A;  2C3C A;  3GDP A;  2YM2 A;  4YKG A;  2GMJ A;  4RSL A;  4A7A A;  2BS3 A;  1GES A;  1TDO A;  2GQW A;  2TMD A;  2W0H A;  3AYJ A;  4YKF A;  4APN A;  2JKC A;  4E0V A;  3G5R A;  2XVH A;  1KF6 A;  1LTX R;  4A65 A;  4YTN A;  5U63 A;  4Z2R A;  5KVI A;  2X3N A;  2WP9 A;  2ZZ0 A;  2WDV A;  1RP0 A;  1K0I A;  1RSG A;  4RG4 A;  2CVJ A;  3ITJ A;  3BHK A;  4U2L A;  2IVD A;  4EM4 A;  1PBC A;  1D4E A;  1H83 A;  2ACZ A;  3ALL A;  4WX1 A;  2A87 A;  2CDU A;  4ADW A;  4PAA A;  5FMH A;  1EL9 A;  3ISH A;  5CKU A;  4C77 A;  1JOA A;  3CTY A;  4HB9 A;  2XLP A;  3QSM A;  4OPD A;  4NTD A;  3AEA A;  1OJT A;  4TM1 A;  1L9C A;  3T37 A;  2JBV A;  3QVR A;  1GRA A;  1D4C A;  4AP1 A;  2VRM A;  2WPC A;  4A79 A;  3IC9 A;  3O0H A;  1TRB A;  3GD3 A;  4B67 A;  5EBK A;  5M10 A;  4LU6 A;  3AE5 A;  4OCG A;  3NK1 X;  1PXB A;  3DJE A;  3DGH A;  4MJW A;  1F3P A;  3UKQ A;  5KOX A;  2V5Z A;  1NHQ A;  4FX9 A;  4H4V A;  4H4X A;  1PXA A;  2DKH A;  3P9U A;  5HYM A;  4J34 A;  1NEK A;  3V76 A;  1DOC A;  4O5Q A;  3UCL A;  2BCG G;  2YG5 A;  1BZL A;  2GAH B;  3RNM A;  1REO A;  4TM0 A;  1KSS A;  3DGZ A;  3BI2 A;  1GEU A;  1F6M A;  2WS3 A;  4H4Z A;  4KPR A;  2APG A;  2PHH A;  3FG2 P;  4O5U A;  4TLZ A;  2WDR A;  4AT0 A;  2YVF A;  1Y0P A;  4U8J A;  2BK3 A;  1BF3 A;  1OJ9 A;  3RHA A;  2Y6Q A;  2YWL A;  4JN9 A;  3F8D A;  4BK2 A;  4Y4M A;  1LVL A;  3UP4 A;  1B5Q A;  2RGJ A;  3K7T A;  1H82 A;  1ZOY A;  2UZZ A;  2V3B A;  3IHG A;  4C3X A;  4JY3 A;  4H50 A;  4REK A;  4YSY A;  1ELI A;  3AYI A;  3KKJ A;  2J3N A;  2YLR A;  1YQ4 A;  4WCT A;  4B69 A;  3C4N A;  2YR4 A;  3CN8 A;  5IPY A;  1H6V A;  4U8I A;  3LB8 A;  5M0Z A;  1NHP A;  4U8P A;  4XWZ A;  3NN0 X;  5FS9 A;  4NTC A;  4IVO B;  3K7Q X;  4USR A;  3NRN A;  3ADA B;  4K5S A;  4GDE A;  4IA5 A;  2PYX A;  1ZX9 A;  4IV9 A;  1IUV A;  3COX A;  3NKS A;  2XFP A;  1ZKQ A;  3GRS A;  1TDK A;  2C64 A;  1E39 A;  2GV8 A;  1PBE A;  2ARD A;  2NVK X;  1GSN A;  3CPH G;  3H4K A;  3H8I A;  1CC4 A;  3CNT A;  1NAA A;  3P4R A;  5TR3 A;  3VR9 A;  3CPJ G;  2BC0 A;  1NG3 A;  2A89 A;  3NTA A;  3F8P A;  3AEG A;  2BA9 A;  4AP3 A;  3NGC X;  4ZCD A;  2X50 A;  3LOV A;  2C65 A;  4H2Q A;  2YM1 A;  4H7U A;  1NEN A;  2WET A;  5HHF A;  2VZ2 A;  3OC4 A;  3S61 A;  2YG4 A;  1DOD A;  4UDP A;  5FS6 A;  2XLT A;  3FPZ A;  2C75 A;  2BAB A;  4K7Z A;  1H84 A;  1PN0 A;  3P4S A;  2EQ9 A;  2Q7V A;  1EL7 A;  2YLX A;  3D8X A;  2WOV A;  3GWF A;  2GVC A;  2XVF A;  1PBD A;  3NK0 X;  1W4X A;  2CFY A;  2IVE A;  3E1T A;  4H4R A;  3VQR A;  5BVA A;  5KVH A;  1YKJ A;  3KU9 A;  1N1P A;  3GDN A;  3H8L A;  3M12 A;  4U8K A;  3KD9 A;  3I3L A;  2XFO A;  3G5S A;  4H4P A;  2B7S A;  2B9W A;  2XLS A;  1S3E A;  2XLR A;  1Q1R A;  1PJ5 A;  4NEV A;  2WP6 A;  3L8K A;  5U1O A;  4H4W A;  1K0J A;  3CGD A;  1LPF A;  2YLT A;  3UKF A;  5J60 A;  4JNA A;  3OZ2 A;  1ZMC A;  2E1M A;  2GB0 A;  5C2T A;  1GXF A;  2BC1 A;  3EPT A;  4FK1 C;  3D1C A;  1IUW A;  2TPR A;  3AE2 A;  1NHR A;  3AYL A;  3LZW A;  3ATR A;  4DGK A;  5ER0 A;  4K5R A;  1GRT A;  3PO7 A;  4KX6 A;  2O9Z A;  4DNA A;  3ICT A;  4YSZ A;  1XDI A;  4K8D A;  1P2E A;  2B76 A;  2WOW A;  4Z26 A;  1PXC A;  1H7X A;  1MO9 A;  2WP5 A;  1VG9 A;  4J2W A;  3NHO X;  2OAL A;  2WES A;  4J33 A;  4OPL A;  3BNU A;  4EMJ A;  1YQ3 A;  2R0G A;  4BK3 A;  5KWF A;  2ZZC A;  4OPT A;  4C3Y A;  5JCN A;  1E1L A;  3LXD A;  2FJD A;  3SGL A;  2XFN A;  3AXB A;  4OPG A;  1DJQ A;  1IUT A;  1L9E A;  2RAB A;  3IF9 A;  3AE8 A;  3WE0 A;  3CGC A;  4EQS A;  2V60 A;  4ECH A;  4H2P A;  1ZK7 A;  2YG6 A;  3ICS A;  1JU2 A;  4XWR A;  1IUU A;  3UKA A;  3AEB A;  1HYU A;  2BK5 A;  3FBS A;  1KSU A;  2WU5 A;  1XPQ A;  2XDO A;  3PS9 A;  3VRB A;  1P2H A;  1ZY8 A;  5FS8 A;  1JRY A;  4BJY A;  2X8C A;  3CNS A;  4NEW A;  2R0P A;  1JEH A;  5L46 A;  2YR5 A;  4X9M A;  2VQ7 A;  3NNE A;  1TDN A;  1LQT A;  3Q9T A;  1CJ3 A;  3QVP A;  4LII A;  1NHS A;  1VQW A;  1SEZ A;  1O94 A;  2BXR A;  3CIR A;  2AR8 A;  4YWO A;  3CND A;  3NG7 X;  1BKW A;  1IUS A;  1K4Q A;  2GH5 A;  1LV0 A;  3P4Q A;  2X8H A;  4OVI A;  4U8L A;  1XAN A;  3SM8 A;  4EQR A;  4J57 A;  4JY2 A;  1D7Y A;  1MXT A;  1S3B A;  5IQ4 A;  2NPX A;  1CC6 A;  2VVL G;  5FS7 A;  1GTE A;  4HA6 A;  5U25 A;  2YAU A;  2R0C A;  2WHD A;  3AE6 A;  4OPU A;  1E1K A;  2R9Z A;  4U8N A;  1COY A;  1B8S A;  2RGH A;  1E1N A;  2Q6U A;  2VVL A;  2WDQ A;  2Y6R A;  2C76 A;  3NTD A;  4A5L A;  2YLZ A;  3Q6J A; 
#chains in the Genus database with same CATH topology
 1FL2 A;  2QA2 A;  2HQM A;  3NK2 X;  4I59 A;  2XVI A;  4XXG A;  1GAL A;  5DBJ A;  1PJ6 A;  1ZDL A;  4CBQ A;  4CRT A;  3B3R A;  1QO8 A;  3SXI A;  2EQ6 A;  4X9N A;  4YT0 A;  5JCM A;  3AWI A;  3SFE A;  1D4D A;  2JB2 A;  3C96 A;  1CJ2 A;  1BGN A;  3LAD A;  1GPE A;  2B9Y A;  3GD4 A;  2BRY A;  3DK4 A;  3HZL A;  1L0V A;  2QCU A;  3KPF A;  3I6D A;  1BGJ A;  1OJC A;  3ZYX A;  3EAN A;  1X31 B;  3SZF A;  3AED A;  3SZC A;  3AD8 B;  2YG7 A;  3B6D A;  3P4P A;  4B63 A;  2XVE A;  2WEU A;  1JNR A;  4Y4L A;  2WU2 A;  1F8R A;  3T0K A;  4AOX A;  3NH3 X;  3GYI A;  1KDG A;  2BYB A;  3NYC A;  4YTM A;  3V3N A;  4B66 A;  1S2Y A;  4UP3 A;  5EB4 A;  4Z2U A;  2JB1 A;  5HXI A;  1GV4 A;  3LJP A;  2BAC A;  5KRQ A;  3V3O A;  4GF7 A;  3VRD B;  2I0Z A;  4K22 A;  3ZDN A;  4G6G A;  4H4T A;  4AOS A;  2XFQ A;  1PS9 A;  4P9S A;  3NYF A;  1GT8 A;  4J36 A;  4TM3 A;  4BJZ A;  1ONF A;  3UKK A;  5GRT A;  3M13 A;  1FCD A;  1GND A;  5CQF A;  4EQW A;  2QAE A;  2JAE A;  1O95 A;  4USQ A;  4Y4N A;  1QJD A;  3M0O A;  2VOU A;  2FJE A;  2JB3 A;  3NYE A;  3QSE A;  1EL8 A;  1FEC A;  4LA1 A;  4BUR A;  4EIQ A;  4YSX A;  2C73 A;  4Z44 A;  1EL5 A;  2Q0K A;  3GSI A;  2C72 A;  4IA6 A;  2GQF A;  4FK1 A;  4EMI A;  3SZ0 A;  3L1R A;  3KVE A;  3GMB A;  1D7L A;  3FMW A;  4G6H A;  4H2N A;  3SX6 A;  3T31 A;  3VRA A;  2YVJ A;  1DJN A;  1H7W A;  1OJA A;  2F5Z A;  2V61 A;  1LJ1 A;  3DME A;  5GSN A;  1OJD A;  2C67 A;  1K0L A;  1GRF A;  4H2R A;  4EQX A;  2Q0L A;  2XVJ A;  3GRT A;  4H4U A;  5LV9 A;  1EBD A;  1Q9I A;  1VRQ B;  2ZBW A;  3SZW A;  2GR1 A;  4A99 A;  5HY5 A;  1UKV G;  2WOI A;  3ABV A;  3R9U A;  1Z6L A;  3P1W A;  3HYX A;  2GMH A;  3UKL A;  4D04 A;  4EMW A;  3RED A;  2JK6 A;  4II3 A;  2ZZB A;  4J31 A;  4GAV A;  1LQU A;  1Q1W A;  3ICR A;  4JDR A;  1E1M A;  3AE4 A;  3ALJ A;  3GMC A;  3DJD A;  2XCG A;  1PDH A;  4M52 A;  5EB5 A;  3UTE A;  2E5V A;  3AEC A;  3FIM B;  3UOZ A;  4CY8 A;  3EF6 A;  2OA1 A;  1TDF A;  3RP6 A;  1GRB A;  1M6I A;  1TYT A;  3IHM A;  1DOB A;  1KNP A;  1CJ4 A;  1CJC A;  1D5T A;  3AE7 A;  1H81 A;  1M64 A;  3ALM A;  3CGB A;  1V59 A;  3T2K A;  4D03 A;  2EQ7 A;  1VG0 A;  1PHH A;  3AE9 A;  4RG3 A;  4EIP A;  4Z43 A;  1CBO A;  1PBF A;  2XYO A;  2X8G A;  3AEE A;  2DKI A;  4Z2T A;  2YG3 A;  3UKP A;  4B1B A;  1PBB A;  4I58 A;  2BS4 A;  1Y56 B;  2B7R A;  3QFB A;  2CUL A;  2C66 A;  3DH9 A;  4ZCC A;  1JRX A;  3AE1 A;  2X99 A;  4K2X A;  4UDQ A;  4AT2 A;  1PJ7 A;  4A6N A;  1JNZ A;  3DA1 A;  3QFA A;  3UTG A;  1B4V A;  1KNR A;  4CNK A;  1CF3 A;  1MOK A;  4J56 A;  2WBA A;  1FOH A;  3BHF A;  3CPI G;  3CNJ A;  3HYV A;  2GF3 A;  4NTE A;  1FEA A;  2BK4 A;  2WQY A;  2GR2 A;  4TM4 A;  1FEB A;  1CL0 A;  1F8W A;  2AQJ A;  4GDP A;  5JCI A;  2C3D A;  1NDA A;  4H4Q A;  3GWD A;  4NZH A;  3RP7 A;  1B37 A;  2GR3 A;  4H4S A;  3UP5 A;  1BWC A;  2VRL A;  2XFU A;  4YSH A;  4C74 A;  1QLB A;  3DK9 A;  2R45 A;  4B64 A;  1O5W A;  5KMR A;  2GRT A;  5JCL A;  1RYI A;  5KXJ A;  1VDC A;  3BI5 A;  3K30 A;  3II4 A;  4U8O A;  4JQ9 A;  2EQ8 A;  3BNM A;  4U2T A;  2BXS A;  4NWZ A;  2FBW A;  2OLN A;  1CC2 A;  4X4J A;  3RP8 A;  3SQP A;  3KA7 A;  1GRG A;  1H86 A;  4IVM B;  4JNQ A;  1N4V A;  1IUX A;  4U8M A;  4CNJ A;  4C5O A;  2BCP A;  2GAG B;  4UDR A;  3QSS A;  3T2Z A;  2YR6 A;  4GRT A;  3VR8 A;  4B65 A;  4GUV A;  4N9X A;  3IWA A;  1YY5 A;  2H88 A;  2RGO A;  4OPC A;  5KMP A;  2V6O A;  2IID A;  3CNP A;  3ATQ A;  2WPE A;  3CGE A;  3KLJ A;  3NN6 X;  1AOG A;  3NT6 A;  2Z5Y A;  3K7M X;  2OAM A;  1TDE A;  1GER A;  3URH A;  4YXD A;  2R46 A;  2WPF A;  4Z24 A;  3EAO A;  3NLC A;  1DOE A;  1Y56 A;  2OLO A;  2R4J A;  1ZP0 A;  4BK1 A;  5KOW A;  2H89 A;  2FJB A;  1L9D A;  1GOS A;  2C70 A;  2YLW A;  5BUK A;  5JCK A;  2BS2 A;  2YQU A;  1S2Q A;  3QJ4 A;  3PVC A;  3S5W A;  2GR0 A;  2VQB A;  2GEW A;  3C4A A;  5J7X A;  1XHC A;  4GR1 A;  4Z25 A;  3DJG X;  2YLS A;  1IJH A;  3G5Q A;  3F8R A;  4YTP A;  2E4G A;  2XLU A;  1TYP A;  4TLX A;  4A9W A;  3AE3 A;  2YVG A;  5BUL A;  2R4E A;  4FDC B;  3GYJ A;  4OPI A;  1KFY A;  4ZN0 A;  1CHU A;  4PAB A;  1DXL A;  1N4U A;  4NNJ A;  4CY6 A;  1JRZ A;  4DSH A;  2C7G A;  1F8S A;  1NPX A;  3BI4 A;  2QA1 A;  3NIX A;  3UOX A;  4CCQ A;  2Z5X A;  1YQZ A;  3JSK A;  1N4W A;  2FJA A;  4DSG A;  1ZOV A;  1GRH A;  2VVM A;  3LZX A;  5EOW A;  3UOY A;  4A6N B;  1NG4 A;  1GRE A;  3UKH A;  3AEF A;  3UTH A;  3DK8 A;  4ICY A;  5BRT A;  5C3J A;  1GET A;  4H4Y A;  3SFD A;  2A8X A;  2B9X A;  4U2S A;  4EM3 A;  1ZMD A;  1DNC A;  3UOV A;  3AB1 A;  4GCM A;  2V3A A;  2AAQ A;  3AD9 B;  4CCR A;  5IQ1 A;  3UTF A;  1E6E A;  1E7P A;  3AD7 B;  4B68 A;  4BV6 A;  3DJJ A;  1GTH A;  2C3C A;  3GDP A;  2YM2 A;  4YKG A;  2GMJ A;  4RSL A;  4A7A A;  2BS3 A;  1GES A;  1TDO A;  2GQW A;  2TMD A;  2W0H A;  3AYJ A;  4YKF A;  4APN A;  5KMS A;  2JKC A;  5KMQ A;  4E0V A;  3G5R A;  2XVH A;  1KF6 A;  1LTX R;  4A65 A;  4YTN A;  5U63 A;  4Z2R A;  5KVI A;  2X3N A;  2WP9 A;  2ZZ0 A;  2WDV A;  1RP0 A;  1K0I A;  1RSG A;  4RG4 A;  2CVJ A;  3ITJ A;  3BHK A;  4U2L A;  2IVD A;  4EM4 A;  1PBC A;  1D4E A;  1H83 A;  2ACZ A;  3ALL A;  4WX1 A;  2A87 A;  2CDU A;  4ADW A;  4PAA A;  5FMH A;  1EL9 A;  3ISH A;  5CKU A;  4C77 A;  1JOA A;  3CTY A;  4HB9 A;  2XLP A;  3QSM A;  4OPD A;  4NTD A;  3AEA A;  1OJT A;  4TM1 A;  1L9C A;  3T37 A;  2JBV A;  3QVR A;  1GRA A;  1D4C A;  4AP1 A;  3T14 A;  2VRM A;  2WPC A;  4A79 A;  3IC9 A;  3O0H A;  1TRB A;  3GD3 A;  4B67 A;  5EBK A;  5M10 A;  4LU6 A;  3AE5 A;  4OCG A;  3NK1 X;  1PXB A;  3T2Y A;  3DJE A;  3DGH A;  3KPK A;  1F3P A;  4MJW A;  3UKQ A;  2V5Z A;  5KOX A;  1NHQ A;  4FX9 A;  4H4V A;  4H4X A;  1PXA A;  2DKH A;  3P9U A;  5HYM A;  4J34 A;  1NEK A;  3V76 A;  1DOC A;  4O5Q A;  3UCL A;  2BCG G;  2YG5 A;  1BZL A;  2GAH B;  3RNM A;  1REO A;  4TM0 A;  1KSS A;  3DGZ A;  3BI2 A;  1GEU A;  1F6M A;  2WS3 A;  4H4Z A;  4KPR A;  2APG A;  2PHH A;  3FG2 P;  4O5U A;  4TLZ A;  2WDR A;  4AT0 A;  2YVF A;  1Y0P A;  3CMM A;  2BK3 A;  1BF3 A;  1OJ9 A;  4U8J A;  2Y6Q A;  2YWL A;  4JN9 A;  3F8D A;  3RHA A;  4BK2 A;  4Y4M A;  1LVL A;  3UP4 A;  1B5Q A;  2RGJ A;  3K7T A;  1H82 A;  1ZOY A;  2UZZ A;  2V3B A;  3IHG A;  4C3X A;  4JY3 A;  4H50 A;  4REK A;  4YSY A;  1ELI A;  3AYI A;  3KKJ A;  2J3N A;  2YLR A;  1YQ4 A;  4WCT A;  4B69 A;  3C4N A;  2YR4 A;  3CN8 A;  5IPY A;  1H6V A;  4U8I A;  3LB8 A;  5M0Z A;  1NHP A;  4U8P A;  4G73 A;  4XWZ A;  3NN0 X;  5FS9 A;  4NTC A;  4IVO B;  3K7Q X;  4GAP A;  4USR A;  3NRN A;  3ADA B;  4K5S A;  4GDE A;  4IA5 A;  2PYX A;  1ZX9 A;  4IV9 A;  1IUV A;  3COX A;  3NKS A;  2XFP A;  1ZKQ A;  3GRS A;  1TDK A;  2C64 A;  1E39 A;  2GV8 A;  1PBE A;  2ARD A;  2NVK X;  1GSN A;  3CPH G;  3H4K A;  3H8I A;  1CC4 A;  3CNT A;  1NAA A;  3GYX A;  3P4R A;  5TR3 A;  3VR9 A;  3CPJ G;  2BC0 A;  1NG3 A;  2A89 A;  3NTA A;  3F8P A;  3AEG A;  2BA9 A;  4AP3 A;  3NGC X;  4ZCD A;  2X50 A;  3LOV A;  3HYW A;  2C65 A;  4H2Q A;  2YM1 A;  4G9K A;  4H7U A;  1NEN A;  2WET A;  5HHF A;  2VZ2 A;  3OC4 A;  3S61 A;  2YG4 A;  1DOD A;  4UDP A;  5FS6 A;  2XLT A;  3FPZ A;  2C75 A;  2BAB A;  4K7Z A;  1H84 A;  1PN0 A;  3P4S A;  2EQ9 A;  2Q7V A;  1EL7 A;  2YLX A;  3D8X A;  2WOV A;  3GWF A;  2GVC A;  3SY4 A;  2XVF A;  1PBD A;  3NK0 X;  1W4X A;  2CFY A;  2IVE A;  3E1T A;  4H4R A;  3VQR A;  5BVA A;  5KVH A;  1YKJ A;  3KU9 A;  3SYI A;  1N1P A;  3GDN A;  3H8L A;  3M12 A;  4U8K A;  3KD9 A;  3I3L A;  2XFO A;  3G5S A;  4H4P A;  2B7S A;  2B9W A;  2XLS A;  1S3E A;  2XLR A;  1Q1R A;  1PJ5 A;  4NEV A;  2WP6 A;  3L8K A;  5U1O A;  4H4W A;  1K0J A;  3CGD A;  1LPF A;  4G74 A;  2YLT A;  3UKF A;  5J60 A;  4JNA A;  3OZ2 A;  1ZMC A;  2E1M A;  2GB0 A;  5C2T A;  1GXF A;  2BC1 A;  3EPT A;  4FK1 C;  3D1C A;  1IUW A;  2TPR A;  3AE2 A;  1NHR A;  3AYL A;  3LZW A;  3ATR A;  4DGK A;  5ER0 A;  4K5R A;  1GRT A;  3PO7 A;  4II2 A;  2O9Z A;  4KX6 A;  3ICT A;  4DNA A;  4YSZ A;  1XDI A;  4K8D A;  1P2E A;  2B76 A;  2WOW A;  4Z26 A;  1PXC A;  1H7X A;  1MO9 A;  2WP5 A;  1VG9 A;  4J2W A;  3NHO X;  2OAL A;  2WES A;  4J33 A;  4OPL A;  3BNU A;  4EMJ A;  1YQ3 A;  2R0G A;  4BK3 A;  2BRA A;  5KWF A;  2ZZC A;  4OPT A;  4C3Y A;  5JCN A;  1E1L A;  3LXD A;  2FJD A;  3SGL A;  2XFN A;  3AXB A;  4OPG A;  1DJQ A;  1IUT A;  1L9E A;  2RAB A;  3IF9 A;  3AE8 A;  3WE0 A;  3CGC A;  4EQS A;  2V60 A;  4ECH A;  4H2P A;  1ZK7 A;  2YG6 A;  3ICS A;  1JU2 A;  4XWR A;  1IUU A;  3UKA A;  3AEB A;  1HYU A;  2BK5 A;  3FBS A;  1KSU A;  2WU5 A;  1XPQ A;  2XDO A;  3PS9 A;  3VRB A;  1P2H A;  1ZY8 A;  5FS8 A;  1JRY A;  4BJY A;  2X8C A;  3CNS A;  4NEW A;  2R0P A;  1JEH A;  5L46 A;  2YR5 A;  4X9M A;  2VQ7 A;  3NNE A;  1TDN A;  1LQT A;  3Q9T A;  1CJ3 A;  3QVP A;  4LII A;  1NHS A;  1VQW A;  1SEZ A;  1O94 A;  2BXR A;  3CIR A;  5KNL A;  2AR8 A;  4YWO A;  3CND A;  3NG7 X;  1BKW A;  1IUS A;  1K4Q A;  2GH5 A;  1LV0 A;  3P4Q A;  2X8H A;  4OVI A;  4U8L A;  1XAN A;  3SM8 A;  4EQR A;  4J57 A;  4JY2 A;  1D7Y A;  1MXT A;  1S3B A;  5IQ4 A;  2NPX A;  1CC6 A;  2VVL G;  2C4C A;  5FS7 A;  1GTE A;  4HA6 A;  5U25 A;  2YAU A;  2R0C A;  2WHD A;  3AE6 A;  4OPU A;  1E1K A;  2R9Z A;  4U8N A;  1COY A;  1B8S A;  2RGH A;  1E1N A;  2Q6U A;  2VVL A;  2WDQ A;  2Y6R A;  2C76 A;  3NTD A;  4A5L A;  2YLZ A;  3Q6J A; 
#chains in the Genus database with same CATH homology
 1FL2 A;  2QA2 A;  2HQM A;  3NK2 X;  4I59 A;  2XVI A;  4XXG A;  1GAL A;  5DBJ A;  1PJ6 A;  1ZDL A;  4CBQ A;  4CRT A;  3B3R A;  1QO8 A;  3SXI A;  2EQ6 A;  4X9N A;  4YT0 A;  5JCM A;  3AWI A;  3SFE A;  1D4D A;  2JB2 A;  3C96 A;  1CJ2 A;  1BGN A;  3LAD A;  1GPE A;  2B9Y A;  3GD4 A;  2BRY A;  3DK4 A;  3HZL A;  1L0V A;  2QCU A;  3KPF A;  3I6D A;  1BGJ A;  1OJC A;  3ZYX A;  3EAN A;  1X31 B;  3SZF A;  3AED A;  3SZC A;  3AD8 B;  2YG7 A;  3B6D A;  3P4P A;  4B63 A;  2XVE A;  2WEU A;  1JNR A;  4Y4L A;  2WU2 A;  1F8R A;  3T0K A;  4AOX A;  3NH3 X;  3GYI A;  1KDG A;  2BYB A;  3NYC A;  4YTM A;  3V3N A;  4B66 A;  1S2Y A;  4UP3 A;  5EB4 A;  4Z2U A;  2JB1 A;  5HXI A;  1GV4 A;  3LJP A;  2BAC A;  5KRQ A;  3V3O A;  4GF7 A;  3VRD B;  2I0Z A;  4K22 A;  3ZDN A;  4G6G A;  4H4T A;  4AOS A;  2XFQ A;  1PS9 A;  4P9S A;  3NYF A;  1GT8 A;  4J36 A;  4TM3 A;  4BJZ A;  1ONF A;  3UKK A;  5GRT A;  3M13 A;  1FCD A;  1GND A;  5CQF A;  4EQW A;  2QAE A;  2JAE A;  1O95 A;  4USQ A;  4Y4N A;  1QJD A;  3M0O A;  2VOU A;  2FJE A;  2JB3 A;  3NYE A;  3QSE A;  1EL8 A;  1FEC A;  4LA1 A;  4BUR A;  4EIQ A;  4YSX A;  2C73 A;  4Z44 A;  1EL5 A;  2Q0K A;  3GSI A;  2C72 A;  4IA6 A;  2GQF A;  4FK1 A;  4EMI A;  3SZ0 A;  3L1R A;  3KVE A;  3GMB A;  1D7L A;  3FMW A;  4G6H A;  4H2N A;  3SX6 A;  3T31 A;  3VRA A;  2YVJ A;  1DJN A;  1H7W A;  1OJA A;  2F5Z A;  2V61 A;  1LJ1 A;  3DME A;  5GSN A;  1OJD A;  2C67 A;  1K0L A;  1GRF A;  4H2R A;  4EQX A;  2Q0L A;  2XVJ A;  3GRT A;  4H4U A;  5LV9 A;  1EBD A;  1Q9I A;  1VRQ B;  2ZBW A;  3SZW A;  2GR1 A;  4A99 A;  5HY5 A;  1UKV G;  2WOI A;  3ABV A;  3R9U A;  1Z6L A;  3P1W A;  3HYX A;  2GMH A;  3UKL A;  4D04 A;  4EMW A;  3RED A;  2JK6 A;  4II3 A;  2ZZB A;  4J31 A;  4GAV A;  1LQU A;  1Q1W A;  3ICR A;  4JDR A;  1E1M A;  3AE4 A;  3ALJ A;  3GMC A;  3DJD A;  2XCG A;  1PDH A;  4M52 A;  5EB5 A;  3UTE A;  2E5V A;  3AEC A;  3FIM B;  3UOZ A;  4CY8 A;  3EF6 A;  2OA1 A;  1TDF A;  3RP6 A;  1GRB A;  1M6I A;  1TYT A;  3IHM A;  1DOB A;  1KNP A;  1CJ4 A;  1CJC A;  1D5T A;  3AE7 A;  1H81 A;  1M64 A;  3ALM A;  3CGB A;  1V59 A;  3T2K A;  4D03 A;  2EQ7 A;  1VG0 A;  1PHH A;  3AE9 A;  4RG3 A;  4EIP A;  4Z43 A;  1CBO A;  1PBF A;  2XYO A;  2X8G A;  3AEE A;  2DKI A;  4Z2T A;  2YG3 A;  3UKP A;  4B1B A;  1PBB A;  4I58 A;  2BS4 A;  1Y56 B;  2B7R A;  3QFB A;  2CUL A;  2C66 A;  3DH9 A;  4ZCC A;  1JRX A;  3AE1 A;  2X99 A;  4K2X A;  4UDQ A;  4AT2 A;  1PJ7 A;  4A6N A;  1JNZ A;  3DA1 A;  3QFA A;  3UTG A;  1B4V A;  1KNR A;  4CNK A;  1CF3 A;  1MOK A;  4J56 A;  2WBA A;  1FOH A;  3BHF A;  3CPI G;  3CNJ A;  3HYV A;  2GF3 A;  4NTE A;  1FEA A;  2BK4 A;  2WQY A;  2GR2 A;  4TM4 A;  1FEB A;  1CL0 A;  1F8W A;  2AQJ A;  4GDP A;  5JCI A;  2C3D A;  1NDA A;  4H4Q A;  3GWD A;  4NZH A;  3RP7 A;  1B37 A;  2GR3 A;  4H4S A;  3UP5 A;  1BWC A;  2VRL A;  2XFU A;  4YSH A;  4C74 A;  1QLB A;  3DK9 A;  2R45 A;  4B64 A;  1O5W A;  5KMR A;  2GRT A;  5JCL A;  1RYI A;  5KXJ A;  1VDC A;  3BI5 A;  3K30 A;  3II4 A;  4U8O A;  4JQ9 A;  2EQ8 A;  3BNM A;  4U2T A;  2BXS A;  4NWZ A;  2FBW A;  2OLN A;  1CC2 A;  4X4J A;  3RP8 A;  3SQP A;  3KA7 A;  1GRG A;  1H86 A;  4IVM B;  4JNQ A;  1N4V A;  1IUX A;  4U8M A;  4CNJ A;  4C5O A;  2BCP A;  2GAG B;  4UDR A;  3QSS A;  3T2Z A;  2YR6 A;  4GRT A;  3VR8 A;  4B65 A;  4GUV A;  4N9X A;  3IWA A;  1YY5 A;  2H88 A;  2RGO A;  4OPC A;  5KMP A;  2V6O A;  2IID A;  3CNP A;  3ATQ A;  2WPE A;  3CGE A;  3KLJ A;  3NN6 X;  1AOG A;  3NT6 A;  2Z5Y A;  3K7M X;  2OAM A;  1TDE A;  1GER A;  3URH A;  4YXD A;  2R46 A;  2WPF A;  4Z24 A;  3EAO A;  3NLC A;  1DOE A;  1Y56 A;  2OLO A;  2R4J A;  1ZP0 A;  4BK1 A;  5KOW A;  2H89 A;  2FJB A;  1L9D A;  1GOS A;  2C70 A;  2YLW A;  5BUK A;  5JCK A;  2BS2 A;  2YQU A;  1S2Q A;  3QJ4 A;  3PVC A;  3S5W A;  2GR0 A;  2VQB A;  2GEW A;  3C4A A;  5J7X A;  1XHC A;  4GR1 A;  4Z25 A;  3DJG X;  2YLS A;  1IJH A;  3G5Q A;  3F8R A;  4YTP A;  2E4G A;  2XLU A;  1TYP A;  4TLX A;  4A9W A;  3AE3 A;  2YVG A;  5BUL A;  2R4E A;  4FDC B;  3GYJ A;  4OPI A;  1KFY A;  4ZN0 A;  1CHU A;  4PAB A;  1DXL A;  1N4U A;  4NNJ A;  4CY6 A;  1JRZ A;  4DSH A;  2C7G A;  1F8S A;  1NPX A;  3BI4 A;  2QA1 A;  3NIX A;  3UOX A;  4CCQ A;  2Z5X A;  1YQZ A;  3JSK A;  1N4W A;  2FJA A;  4DSG A;  1ZOV A;  1GRH A;  2VVM A;  3LZX A;  5EOW A;  3UOY A;  4A6N B;  1NG4 A;  1GRE A;  3UKH A;  3AEF A;  3UTH A;  3DK8 A;  4ICY A;  5BRT A;  5C3J A;  1GET A;  4H4Y A;  3SFD A;  2A8X A;  2B9X A;  4U2S A;  4EM3 A;  1ZMD A;  1DNC A;  3UOV A;  3AB1 A;  4GCM A;  2V3A A;  2AAQ A;  3AD9 B;  4CCR A;  5IQ1 A;  3UTF A;  1E6E A;  1E7P A;  3AD7 B;  4B68 A;  4BV6 A;  3DJJ A;  1GTH A;  2C3C A;  3GDP A;  2YM2 A;  4YKG A;  2GMJ A;  4RSL A;  4A7A A;  2BS3 A;  1GES A;  1TDO A;  2GQW A;  2TMD A;  2W0H A;  3AYJ A;  4YKF A;  4APN A;  5KMS A;  2JKC A;  5KMQ A;  4E0V A;  3G5R A;  2XVH A;  1KF6 A;  1LTX R;  4A65 A;  4YTN A;  5U63 A;  4Z2R A;  5KVI A;  2X3N A;  2WP9 A;  2ZZ0 A;  2WDV A;  1RP0 A;  1K0I A;  1RSG A;  4RG4 A;  2CVJ A;  3ITJ A;  3BHK A;  4U2L A;  2IVD A;  4EM4 A;  1PBC A;  1D4E A;  1H83 A;  2ACZ A;  3ALL A;  4WX1 A;  2A87 A;  2CDU A;  4ADW A;  4PAA A;  5FMH A;  1EL9 A;  3ISH A;  5CKU A;  4C77 A;  1JOA A;  3CTY A;  4HB9 A;  2XLP A;  3QSM A;  4OPD A;  4NTD A;  3AEA A;  1OJT A;  4TM1 A;  1L9C A;  3T37 A;  2JBV A;  3QVR A;  1GRA A;  1D4C A;  4AP1 A;  3T14 A;  2VRM A;  2WPC A;  4A79 A;  3IC9 A;  3O0H A;  1TRB A;  3GD3 A;  4B67 A;  5EBK A;  5M10 A;  4LU6 A;  3AE5 A;  4OCG A;  3NK1 X;  1PXB A;  3T2Y A;  3DJE A;  3DGH A;  3KPK A;  1F3P A;  4MJW A;  3UKQ A;  2V5Z A;  5KOX A;  1NHQ A;  4FX9 A;  4H4V A;  4H4X A;  1PXA A;  2DKH A;  3P9U A;  5HYM A;  4J34 A;  1NEK A;  3V76 A;  1DOC A;  4O5Q A;  3UCL A;  2BCG G;  2YG5 A;  1BZL A;  2GAH B;  3RNM A;  1REO A;  4TM0 A;  1KSS A;  3DGZ A;  3BI2 A;  1GEU A;  1F6M A;  2WS3 A;  4H4Z A;  4KPR A;  2APG A;  2PHH A;  3FG2 P;  4O5U A;  4TLZ A;  2WDR A;  4AT0 A;  2YVF A;  1Y0P A;  3CMM A;  2BK3 A;  1BF3 A;  1OJ9 A;  4U8J A;  2Y6Q A;  2YWL A;  4JN9 A;  3F8D A;  3RHA A;  4BK2 A;  4Y4M A;  1LVL A;  3UP4 A;  1B5Q A;  2RGJ A;  3K7T A;  1H82 A;  1ZOY A;  2UZZ A;  2V3B A;  3IHG A;  4C3X A;  4JY3 A;  4H50 A;  4REK A;  4YSY A;  1ELI A;  3AYI A;  3KKJ A;  2J3N A;  2YLR A;  1YQ4 A;  4WCT A;  4B69 A;  3C4N A;  2YR4 A;  3CN8 A;  5IPY A;  1H6V A;  4U8I A;  3LB8 A;  5M0Z A;  1NHP A;  4U8P A;  4G73 A;  4XWZ A;  3NN0 X;  5FS9 A;  4NTC A;  4IVO B;  3K7Q X;  4GAP A;  4USR A;  3NRN A;  3ADA B;  4K5S A;  4GDE A;  4IA5 A;  2PYX A;  1ZX9 A;  4IV9 A;  1IUV A;  3COX A;  3NKS A;  2XFP A;  1ZKQ A;  3GRS A;  1TDK A;  2C64 A;  1E39 A;  2GV8 A;  1PBE A;  2ARD A;  2NVK X;  1GSN A;  3CPH G;  3H4K A;  3H8I A;  1CC4 A;  3CNT A;  1NAA A;  3GYX A;  3P4R A;  5TR3 A;  3VR9 A;  3CPJ G;  2BC0 A;  1NG3 A;  2A89 A;  3NTA A;  3F8P A;  3AEG A;  2BA9 A;  4AP3 A;  3NGC X;  4ZCD A;  2X50 A;  3LOV A;  3HYW A;  2C65 A;  4H2Q A;  2YM1 A;  4G9K A;  4H7U A;  1NEN A;  2WET A;  5HHF A;  2VZ2 A;  3OC4 A;  3S61 A;  2YG4 A;  1DOD A;  4UDP A;  5FS6 A;  2XLT A;  3FPZ A;  2C75 A;  2BAB A;  4K7Z A;  1H84 A;  1PN0 A;  3P4S A;  2EQ9 A;  2Q7V A;  1EL7 A;  2YLX A;  3D8X A;  2WOV A;  3GWF A;  2GVC A;  3SY4 A;  2XVF A;  1PBD A;  3NK0 X;  1W4X A;  2CFY A;  2IVE A;  3E1T A;  4H4R A;  3VQR A;  5BVA A;  5KVH A;  1YKJ A;  3KU9 A;  3SYI A;  1N1P A;  3GDN A;  3H8L A;  3M12 A;  4U8K A;  3KD9 A;  3I3L A;  2XFO A;  3G5S A;  4H4P A;  2B7S A;  2B9W A;  2XLS A;  1S3E A;  2XLR A;  1Q1R A;  1PJ5 A;  4NEV A;  2WP6 A;  3L8K A;  5U1O A;  4H4W A;  1K0J A;  3CGD A;  1LPF A;  4G74 A;  2YLT A;  3UKF A;  5J60 A;  4JNA A;  3OZ2 A;  1ZMC A;  2E1M A;  2GB0 A;  5C2T A;  1GXF A;  2BC1 A;  3EPT A;  4FK1 C;  3D1C A;  1IUW A;  2TPR A;  3AE2 A;  1NHR A;  3AYL A;  3LZW A;  3ATR A;  4DGK A;  5ER0 A;  4K5R A;  1GRT A;  3PO7 A;  4II2 A;  2O9Z A;  4KX6 A;  3ICT A;  4DNA A;  4YSZ A;  1XDI A;  4K8D A;  1P2E A;  2B76 A;  2WOW A;  4Z26 A;  1PXC A;  1H7X A;  1MO9 A;  2WP5 A;  1VG9 A;  4J2W A;  3NHO X;  2OAL A;  2WES A;  4J33 A;  4OPL A;  3BNU A;  4EMJ A;  1YQ3 A;  2R0G A;  4BK3 A;  2BRA A;  5KWF A;  2ZZC A;  4OPT A;  4C3Y A;  5JCN A;  1E1L A;  3LXD A;  2FJD A;  3SGL A;  2XFN A;  3AXB A;  4OPG A;  1DJQ A;  1IUT A;  1L9E A;  2RAB A;  3IF9 A;  3AE8 A;  3WE0 A;  3CGC A;  4EQS A;  2V60 A;  4ECH A;  4H2P A;  1ZK7 A;  2YG6 A;  3ICS A;  1JU2 A;  4XWR A;  1IUU A;  3UKA A;  3AEB A;  1HYU A;  2BK5 A;  3FBS A;  1KSU A;  2WU5 A;  1XPQ A;  2XDO A;  3PS9 A;  3VRB A;  1P2H A;  1ZY8 A;  5FS8 A;  1JRY A;  4BJY A;  2X8C A;  3CNS A;  4NEW A;  2R0P A;  1JEH A;  5L46 A;  2YR5 A;  4X9M A;  2VQ7 A;  3NNE A;  1TDN A;  1LQT A;  3Q9T A;  1CJ3 A;  3QVP A;  4LII A;  1NHS A;  1VQW A;  1SEZ A;  1O94 A;  2BXR A;  3CIR A;  5KNL A;  2AR8 A;  4YWO A;  3CND A;  3NG7 X;  1BKW A;  1IUS A;  1K4Q A;  2GH5 A;  1LV0 A;  3P4Q A;  2X8H A;  4OVI A;  4U8L A;  1XAN A;  3SM8 A;  4EQR A;  4J57 A;  4JY2 A;  1D7Y A;  1MXT A;  1S3B A;  5IQ4 A;  2NPX A;  1CC6 A;  2VVL G;  2C4C A;  5FS7 A;  1GTE A;  4HA6 A;  5U25 A;  2YAU A;  2R0C A;  2WHD A;  3AE6 A;  4OPU A;  1E1K A;  2R9Z A;  4U8N A;  1COY A;  1B8S A;  2RGH A;  1E1N A;  2Q6U A;  2VVL A;  2WDQ A;  2Y6R A;  2C76 A;  3NTD A;  4A5L A;  2YLZ A;  3Q6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...