2XVHA

Crystal structure of bacterial flavin containing monooxygenase in complex with nadp
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
445
structure length
445
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSEEFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Structural and Functional Analysis of Bacterial Flavin-Containing Monooxygenase Reveals its Ping-Pong-Type Reaction Mechanism.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
total genus 161
structure length 445
sequence length 445
chains with identical sequence B, C
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xvhA02
4EQRA 3L8KA 4Z25A 4BV6A 4GUVA 3QSEA 3IWAA 2R4JA 1DXLA 2GAGB 2WP5A 3ZDNA 3HZLA 4U8JA 4J34A 1BWCA 2ACZA 3IHMA 3NK1X 2VZ2A 1GRBA 4Y4LA 4A99A 3AE2A 3UKQA 2Y6QA 4EQSA 1KNRA 2CDUA 1JOAA 4EMWA 2X99A 4EIPA 3V3NA 3CNJA 5JCNA 2B9WA 3GYIA 3QSMA 4J56A 1ZDLA 5GRTA 5C2TA 2C70A 2AAQA 1D4CA 3Q6JA 3VR8A 3H8IA 5ER0A 2YG3A 2C66A 3UKAA 3EAOA 1ZX9A 3RP8A 1PHHA 4AOXA 1F8SA 4BK1A 3Q9TA 3C96A 1E1MA 2R4EA 4YKFA 1B8SA 3P4RA 3ICTA 1TDKA 2A89A 4OPLA 2BCPA 1LJ1A 1W4XA 4Y4NA 3GDPA 1YY5A 2WEUA 3UKFA 2BXRA 2FJEA 3ICSA 1OJ9A 3KD9A 1MXTA 3P4QA 1GRAA 2PHHA 2IIDA 4EQWA 2CFYA 1D4DA 1E1KA 1CC4A 1BGNA 3FBSA 4EIQA 5KXJA 3GRTA 3AB1A 2BS3A 3PO7A 4RG3A 3VRDB 2Q0KA 3OZ2A 1JNZA 1ZMDA 4APNA 5JCKA 2WPFA 3ATRA 3QFAA 4O5QA 4TM1A 1E6EA 2BS2A 2GMJA 3KA7A 1GSNA 1Q1WA 4U8PA 2FJBA 3NHOX 3AE4A 3K7MX 4CY8A 5KOWA 2E5VA 4FDCB 1KDGA 4RSLA 4Z2UA 3E1TA 1K0LA 2X8HA 2QCUA 2CULA 1EBDA 3AYIA 3K7TA 3T37A 3AE5A 3CIRA 1GEUA 1EL8A 2GMHA 5J7XA 3M13A 1BKWA 4C74A 2WQYA 4H4PA 4CBQA 3NKSA 3QSSA 1LQUA 3L1RA 5U1OA 4CNKA 1GRTA 3ALMA 5L46A 2OA1A 5JCIA 3ICRA 1M6IA 1PXBA 3UOVA 2OLOA 4JNAA 1JNRA 1H82A 1V59A 2GH5A 4YTPA 1KSSA 1JRYA 2YAUA 5HXIA 5IPYA 4Y4MA 4A9WA 1O94A 1L9CA 1GRFA 2RGOA 4GR1A 3RP7A 2C72A 3V3OA 4TM3A 2BXSA 5DBJA 2ARDA 5FS6A 2EQ8A 4KX6A 2VRLA 4OPTA 4A6NA 4BURA 2TPRA 4A79A 1XANA 1GERA 1EL7A 3C4AA 3ADAB 4H4YA 1B5QA 2V60A 3EPTA 1MOKA 1PXCA 2BK4A 3ATQA 1DOCA 2H88A 1IUWA 3RP6A 1FECA 5KOXA 4Z2TA 3DK9A 1JRXA 2AQJA 2PYXA 2YLZA 1NAAA 2YVFA 3NRNA 1CJ2A 2WOWA 3FG2P 4XWRA 3SQPA 1AOGA 1ZP0A 4X4JA 3BNUA 4P9SA 3LZWA 3I6DA 1M64A 2VQBA 3B3RA 1NG4A 3CGDA 4GDEA 4YKGA 4YSHA 2YLXA 3VRAA 2C67A 1H6VA 4OPGA 2YLWA 3SFDA 4CRTA 2YQUA 1H84A 3M0OA 2VVLA 2ZZBA 2FJDA 3AD7B 3DGHA 3NGCX 2ZZ0A 4C3YA 2BABA 3COXA 4U2LA 1FOHA 3UOZA 5BVAA 5IQ4A 2WOIA 4J2WA 5HYMA 1ELIA 3CGCA 3NH3X 1GESA 5CKUA 1IUUA 4ICYA 2Z5YA 4IVOB 2FJAA 2C73A 2YR5A 2WDVA 3ZYXA 2R9ZA 1K0IA 3GD4A 1E7PA 4YXDA 1N4WA 3BHFA 4WCTA 5U63A 2Z5XA 2V5ZA 1E1NA 1F8RA 3GMBA 3GMCA 4H2QA 1LPFA 1GRGA 3DK4A 2VQ7A 1H81A 2XLTA 2XFNA 1O5WA 3AEGA 1NDAA 4OVIA 4USQA 3GDNA 3UKLA 4FK1C 2BK5A 2WPCA 3GRSA 1CJCA 4EM4A 1GXFA 4O5UA 4Z44A 2BCGG 5J60A 4H4SA 4BK3A 2Q7VA 4LA1A 2V3AA 3EANA 4U8KA 3CNSA 1PJ5A 4GRTA 2NVKX 3LZXA 3AEBA 2RGJA 1NPXA 2R45A 4UDRA 4UDQA 1COYA 3NIXA 2YG5A 1L9DA 1NHSA 3AEDA 5KVIA 4J31A 4EM3A 2VRMA 3SFEA 4AT0A 1CHUA 1LV0A 3CPJG 1CC2A 4AP3A 2GV8A 2AR8A 4B65A 2BYBA 2YLTA 1DJQA 3CTYA 2XLSA 4YWOA 2XLUA 3F8PA 5KVHA 5M10A 5HY5A 5JCMA 1UKVG 2HQMA 5U25A 1F8WA 1YQ4A 4JY2A 3KVEA 5EOWA 4A6NB 2O9ZA 1BF3A 2GQWA 2R0PA 4NEWA 2V61A 2WU5A 5KRQA 1VRQB 2YM2A 4D04A 2BACA 5FS8A 3KPFA 4J33A 4BJYA 4C3XA 5FMHA 1RP0A 2XFUA 4H4WA 2NPXA 3GYJA 3P1WA 2YG7A 2CVJA 4HA6A 3FPZA 2UZZA 2WETA 2DKIA 3AEEA 3CGBA 4DSGA 4UP3A 3NLCA 4YSZA 2C76A 1PDHA 2WP6A 1DJNA 2QA1A 2WESA 4NTDA 1Y56A 3AE8A 1H7XA 4K5SA 4CCQA 1Y0PA 1GNDA 2JBVA 4EMJA 4K5RA 1DOBA 3QFBA 3DJEA 4H2PA 3EF6A 5IQ1A 5M0ZA 3NNEA 1H86A 2B7RA 3LADA 1SEZA 4Z43A 5HHFA 2EQ6A 3AE3A 3ISHA 1IUXA 1MO9A 1TDOA 4JY3A 4NTEA 4DNAA 1BZLA 1ZOVA 1IJHA 2C65A 2GVCA 4I58A 5EB4A 1VG9A 1HYUA 1X31B 4U8LA 3P9UA 1OJDA 1O95A 2B76A 2C64A 3PVCA 2RGHA 3VR9A 3IHGA 1CJ4A 4GDPA 2BS4A 2BC1A 1L0VA 2XCGA 3RNMA 2YR4A 1CJ3A 1FEBA 4DGKA 2R0GA 2V3BA 1FCDA 3CPIG 4N9XA 4B1BA 4EMIA 3II4A 1D7YA 2R46A 1LVLA 5BRTA 2YVGA 2W0HA 5LV9A 2GEWA 2XLRA 2WBAA 3AD8B 1NEKA 1PBCA 4X9NA 1L9EA 2B9YA 3NTAA 4B68A 4A65A 4ZCCA 4Z26A 5KWFA 3CPHG 4H4RA 4H2RA 5EB5A 1K4QA 1RSGA 3CNPA 4K22A 1TDFA 5FS7A 2XFPA 3G5QA 3IC9A 2EQ7A 2QAEA 3NK2X 1ZOYA 4H4QA 2EQ9A 3AE9A 2JB3A 2WDQA 2C7GA 2VVMA 3BHKA 2XVFA 3AE7A 1VDCA 1B37A 1NHPA 4JQ9A 5JCLA 2XDOA 1ZY8A 5C3JA 1KNPA 3F8DA 2IVDA 4U2SA 4JNQA 3LJPA 2RABA 1JRZA 3I3LA 5BULA 3NT6A 4NZHA 3AYLA 1OJTA 2YLSA 4LIIA 3LOVA 2WS3A 1GALA 3H4KA 2XVJA 3DJJA 4H50A 4H7UA 4OPIA 2BA9A 4U8MA 3WE0A 4H4TA 4MJWA 4U8IA 1CC6A 3JSKA 3UCLA 3UOXA 1IUVA 2QA2A 3GSIA 1NHRA 1GREA 3NN6X 1PBEA 1Q1RA 3AD9B 4A7AA 3D1CA 1GPEA 4XWZA 3K30A 3NYCA 4UDPA 4B69A 1TYPA 2Q0LA 3NYEA 3K7QX 3ITJA 4FK1A 2OLNA 5TR3A 4IA6A 1GRHA 1D4EA 2GR3A 1QLBA 2J3NA 1ONFA 1ZK7A 1P2EA 4K8DA 1GTEA 3UTFA 4IV9A 3RHAA 4HB9A 1Y56B 2YM1A 3D8XA 4XXGA 4ZN0A 2YVJA 4H4ZA 4YSYA 2WDRA 2BK3A 2TMDA 2APGA 1PBBA 3BI2A 3DJGX 1D5TA 1PXAA 1PJ6A 3VQRA 2GR1A 4OCGA 4BK2A 3NN0X 3C4NA 2XVEA 4M52A 3UKKA 4JDRA 4NTCA 3DGZA 4REKA 3OC4A 4H4VA 3AWIA 3CGEA 3AXBA 4TM4A 1Z6LA 3O0HA 4B64A 2BC0A 2Y6RA 2R0CA 3UP5A 1DNCA 2ZBWA 2XVHA 2ZZCA 3DA1A 4KPRA 4E0VA 1LQTA 1PS9A 2YG6A 4H4XA 5EBKA 4CY6A 1GETA 1ZMCA 4CCRA 1XDIA 2E1MA 4PABA 2VOUA 3DK8A 3PS9A 2C75A 4X9MA 3UOYA 2YWLA 3V76A 1ZKQA 3F8RA 1LTXR 2YR6A 4EQXA 1CL0A 1TDNA 3SM8A 2X8GA 1Q9IA 2OAMA 4OPCA 4RG4A 2A8XA 3S61A 2B9XA 3AYJA 3AEAA 2GF3A 4GF7A 4YTMA 4J57A 2FBWA 2C3CA 1GT8A 1KF6A 1REOA 1S3BA 3GWDA 1NG3A 4PAAA 1GV4A 1OJCA 2DKHA 3GWFA 3M12A 1DOEA 1N1PA 1KFYA 2F5ZA 3FIMB 3KU9A 4K7ZA 3P4SA 1TRBA 3P4PA 1KSUA 3S5WA 4OPDA 1FEAA 1PN0A 4NEVA 2GQFA 1PJ7A 2OALA 1CF3A 1BGJA 2I0ZA 1E39A 4K2XA 1S2QA 3KKJA 2XFQA 3SGLA 3REDA 1JEHA 1TDEA 4TLXA 4A5LA 4BJZA 3NTDA 1GTHA 4H2NA 3G5SA 3BNMA 1GOSA 1YKJA 4U8NA 1FL2A 3DH9A 1PBDA 1XPQA 3CNTA 4ECHA 3AECA 1S2YA 2V6OA 2XLPA 3LXDA 5CQFA 2YG4A 3AE1A 4Z2RA 5GSNA 3ALLA 1NENA 5FS9A 3AEFA 3GD3A 4B67A 1EL9A 4CNJA 2WP9A 3NG7X 1YQZA 4J36A 3ALJA 2A87A 1D7LA 2WHDA 3BI4A 3NYFA 3DMEA 4WX1A 1OJAA 3AE6A 4B66A 1DODA 4LU6A 4DSHA 1IUTA 1H83A 2JB2A 3H8LA 1P2HA 1XHCA 3IF9A 4IVMB 4Z24A 1JU2A 3UTGA 1YQ3A 2E4GA 2IVEA 4JN9A 2XYOA 2GB0A 3CNDA 2YLRA 2JKCA 1CBOA 4U8OA 5BUKA 2Q6UA 1S3EA 4AOSA 2GR0A 1B4VA 3QJ4A 1PBFA 1QJDA 4H4UA 3UTHA 4B63A 4U2TA 3BI5A 4YTNA 4TM0A 4C5OA 1NHQA 2X3NA 2GRTA 1F6MA 4IA5A 3R9UA 2XFOA 3B6DA 3ABVA 3LB8A 4TLZA 3FMWA 4ZCDA 2JB1A 1VQWA 4GCMA 2B7SA 2WOVA 3QVPA 1N4VA 1VG0A 2WPEA 4OPUA 2X8CA 2XVIA 3KLJA 4ADWA 1EL5A 3QVRA 2C3DA 4AP1A 4D03A 1QO8A 4YSXA 4USRA 3UKPA 1F3PA 1IUSA 4FX9A 3URHA 3NK0X 1K0JA 2X50A 2JK6A 1N4UA 3DJDA 4C77A 4YT0A 1E1LA 3G5RA 2GAHB 3CN8A 3UTEA 2H89A 2GR2A 2VVLG 2JAEA 1TYTA 1RYIA 3UKHA 1H7WA 3UP4A 3VRBA 2WU2A 4AT2A 4I59A
chains in the Genus database with same CATH superfamily
4EQRA 3L8KA 4Z25A 4BV6A 4GUVA 3QSEA 3IWAA 2R4JA 1DXLA 2GAGB 2WP5A 4II3A 3HZLA 4U8JA 3ZDNA 4J34A 1BWCA 2ACZA 3IHMA 3NK1X 2VZ2A 1GRBA 4Y4LA 4A99A 3AE2A 3UKQA 2Y6QA 4EQSA 1KNRA 2CDUA 1JOAA 4EMWA 5KMRA 2X99A 4EIPA 3V3NA 3CNJA 5JCNA 2B9WA 3GYIA 3QSMA 4J56A 1ZDLA 5GRTA 5C2TA 2C70A 2AAQA 1D4CA 3Q6JA 3VR8A 3H8IA 5ER0A 2YG3A 2C66A 3UKAA 3EAOA 1ZX9A 3RP8A 1PHHA 4AOXA 4G73A 1F8SA 4BK1A 3Q9TA 3C96A 1E1MA 2R4EA 4YKFA 1B8SA 3P4RA 3ICTA 1TDKA 2A89A 4OPLA 2BCPA 1LJ1A 1W4XA 4Y4NA 3GDPA 1YY5A 2WEUA 3UKFA 2BXRA 2FJEA 3ICSA 1OJ9A 3KD9A 1MXTA 3P4QA 1GRAA 2PHHA 2IIDA 4II2A 4EQWA 2CFYA 1D4DA 1E1KA 1CC4A 1BGNA 3FBSA 4EIQA 5KXJA 3GRTA 3AB1A 2BS3A 3PO7A 4RG3A 3VRDB 2Q0KA 3OZ2A 1JNZA 1ZMDA 4APNA 5JCKA 2WPFA 3ATRA 3QFAA 4O5QA 4TM1A 1E6EA 3SZFA 4NNJA 3SZCA 2BS2A 2GMJA 3KA7A 1GSNA 4G6GA 1Q1WA 4U8PA 2FJBA 3NHOX 3AE4A 3K7MX 4CY8A 5KOWA 2E5VA 4FDCB 1KDGA 4RSLA 4Z2UA 3E1TA 1K0LA 2X8HA 2QCUA 2CULA 1EBDA 3AYIA 3K7TA 3T37A 3AE5A 3CIRA 1GEUA 1EL8A 2GMHA 5J7XA 3M13A 1BKWA 4C74A 2WQYA 4H4PA 4CBQA 3NKSA 3QSSA 1LQUA 3L1RA 5U1OA 4CNKA 1GRTA 3ALMA 5L46A 2OA1A 5JCIA 3ICRA 1M6IA 1PXBA 3UOVA 2OLOA 4JNAA 1JNRA 1H82A 1V59A 2BRYA 2GH5A 4YTPA 1KSSA 1JRYA 2YAUA 5HXIA 5IPYA 4Y4MA 4A9WA 1O94A 1L9CA 1GRFA 2RGOA 4GR1A 3RP7A 2C72A 3V3OA 4TM3A 2BXSA 5DBJA 2ARDA 5FS6A 2EQ8A 4KX6A 2VRLA 3KPKA 4OPTA 4A6NA 4BURA 2TPRA 4A79A 1XANA 1GERA 3T31A 1EL7A 3C4AA 3ADAB 4H4YA 1B5QA 2V60A 3EPTA 1MOKA 1PXCA 2BK4A 3ATQA 1DOCA 2H88A 1IUWA 3RP6A 1FECA 5KOXA 4Z2TA 3DK9A 1JRXA 2AQJA 2PYXA 2YLZA 1NAAA 2YVFA 3NRNA 1CJ2A 2WOWA 3FG2P 4XWRA 3SQPA 1AOGA 1ZP0A 4X4JA 3BNUA 2BRAA 3LZWA 4P9SA 3I6DA 1M64A 2VQBA 3B3RA 1NG4A 3CGDA 4GDEA 4YKGA 4YSHA 2YLXA 3VRAA 2C67A 1H6VA 4OPGA 2YLWA 3SFDA 4CRTA 2YQUA 1H84A 3M0OA 2VVLA 2ZZBA 2FJDA 3SX6A 3AD7B 3HYWA 3DGHA 3NGCX 2ZZ0A 4C3YA 2BABA 3COXA 4U2LA 1FOHA 3UOZA 5BVAA 5IQ4A 2WOIA 4J2WA 5HYMA 1ELIA 3CGCA 3NH3X 1GESA 5CKUA 1IUUA 4ICYA 2Z5YA 4IVOB 2FJAA 2C73A 2YR5A 2WDVA 3ZYXA 2R9ZA 1K0IA 3GD4A 1E7PA 4YXDA 1N4WA 3BHFA 4WCTA 5U63A 2Z5XA 2V5ZA 1E1NA 1F8RA 3GMBA 3GMCA 4H2QA 1LPFA 1GRGA 3DK4A 2VQ7A 1H81A 2XLTA 2XFNA 1O5WA 3AEGA 1NDAA 4OVIA 4USQA 3GDNA 3UKLA 4FK1C 2BK5A 2WPCA 3GRSA 1CJCA 4EM4A 1GXFA 4O5UA 4Z44A 2BCGG 5J60A 4H4SA 4BK3A 2Q7VA 4LA1A 2V3AA 3HYVA 3EANA 4U8KA 3CNSA 1PJ5A 4GRTA 2NVKX 3LZXA 3AEBA 2RGJA 1NPXA 2R45A 4UDRA 4UDQA 1COYA 3NIXA 2YG5A 1L9DA 1NHSA 3AEDA 5KVIA 4J31A 4EM3A 2VRMA 3SFEA 4AT0A 1CHUA 1LV0A 3CPJG 1CC2A 4AP3A 2GV8A 2AR8A 4B65A 2BYBA 2YLTA 1DJQA 3CTYA 2XLSA 4YWOA 2XLUA 3F8PA 5KVHA 5M10A 5HY5A 5JCMA 1UKVG 2HQMA 5U25A 1F8WA 1YQ4A 4JY2A 3KVEA 5EOWA 4A6NB 2O9ZA 1BF3A 2GQWA 2R0PA 4NEWA 2V61A 2WU5A 5KRQA 1VRQB 2YM2A 4D04A 2BACA 5FS8A 3KPFA 4J33A 4BJYA 4C3XA 5FMHA 1RP0A 2XFUA 4H4WA 2NPXA 3GYJA 3P1WA 2YG7A 2CVJA 4HA6A 3FPZA 3HYXA 4GAPA 2UZZA 2WETA 2DKIA 3AEEA 3CGBA 4DSGA 4UP3A 3NLCA 4YSZA 2C76A 1PDHA 2WP6A 1DJNA 2QA1A 2WESA 4NTDA 1Y56A 3AE8A 1H7XA 4K5SA 4CCQA 1Y0PA 1GNDA 2JBVA 4EMJA 4K5RA 1DOBA 3QFBA 3DJEA 4H2PA 3EF6A 5IQ1A 5M0ZA 3NNEA 1H86A 2B7RA 3LADA 3SY4A 3SXIA 1SEZA 4Z43A 5HHFA 2EQ6A 3AE3A 2C4CA 3ISHA 1IUXA 1MO9A 1TDOA 4JY3A 4NTEA 4DNAA 1BZLA 1ZOVA 1IJHA 2C65A 2GVCA 4I58A 5EB4A 1VG9A 1HYUA 1X31B 4U8LA 3P9UA 1OJDA 1O95A 2B76A 2C64A 3PVCA 2RGHA 3VR9A 3IHGA 1CJ4A 4GDPA 2BS4A 2BC1A 1L0VA 2XCGA 3RNMA 2YR4A 1CJ3A 1FEBA 4DGKA 2R0GA 2V3BA 1FCDA 3CPIG 4N9XA 4B1BA 5KMPA 4EMIA 3II4A 1D7YA 2R46A 1LVLA 5BRTA 2YVGA 2W0HA 5LV9A 2GEWA 2XLRA 2WBAA 3AD8B 1NEKA 1PBCA 4X9NA 1L9EA 2B9YA 3NTAA 3SZWA 4B68A 4A65A 4ZCCA 4Z26A 5KWFA 3CPHG 4H4RA 4H2RA 5EB5A 1K4QA 1RSGA 3CNPA 4K22A 1TDFA 5FS7A 2XFPA 3G5QA 5KNLA 3IC9A 2EQ7A 2QAEA 3NK2X 1ZOYA 4H4QA 2EQ9A 3AE9A 2JB3A 2WDQA 2C7GA 2VVMA 3BHKA 2XVFA 3AE7A 4GAVA 1VDCA 1B37A 1NHPA 4JQ9A 5JCLA 2XDOA 1ZY8A 5C3JA 1KNPA 3F8DA 2IVDA 4U2SA 4JNQA 3LJPA 2RABA 1JRZA 3I3LA 5BULA 3NT6A 4NZHA 3AYLA 1OJTA 2YLSA 4LIIA 3LOVA 2WS3A 1GALA 3H4KA 2XVJA 3DJJA 4H50A 4H7UA 4OPIA 2BA9A 4U8MA 3WE0A 4H4TA 4MJWA 4U8IA 5KMSA 1CC6A 3JSKA 3UCLA 3UOXA 1IUVA 2QA2A 3GSIA 1NHRA 1GREA 3NN6X 1PBEA 1Q1RA 3AD9B 4A7AA 3D1CA 1GPEA 4XWZA 3K30A 3NYCA 4UDPA 4B69A 1TYPA 2Q0LA 3NYEA 3K7QX 3ITJA 4FK1A 2OLNA 5TR3A 4IA6A 1GRHA 1D4EA 2GR3A 1QLBA 2J3NA 1ONFA 1ZK7A 1P2EA 4K8DA 1GTEA 3UTFA 4IV9A 3RHAA 4G74A 4HB9A 1Y56B 2YM1A 3D8XA 4XXGA 4ZN0A 2YVJA 4H4ZA 4YSYA 2WDRA 2BK3A 2TMDA 2APGA 1PBBA 3BI2A 3DJGX 1D5TA 1PXAA 1PJ6A 4NWZA 3VQRA 2GR1A 4OCGA 4BK2A 3NN0X 3C4NA 2XVEA 4M52A 3UKKA 4JDRA 4NTCA 3DGZA 4REKA 3OC4A 4H4VA 3AWIA 3CGEA 3AXBA 4TM4A 1Z6LA 3GYXA 3O0HA 4B64A 2BC0A 2Y6RA 2R0CA 3UP5A 1DNCA 2ZBWA 2XVHA 2ZZCA 3DA1A 4KPRA 4E0VA 1LQTA 1PS9A 2YG6A 4H4XA 5EBKA 4CY6A 1GETA 1ZMCA 4CCRA 1XDIA 2E1MA 4PABA 2VOUA 3DK8A 3PS9A 2C75A 4X9MA 3UOYA 2YWLA 3V76A 1ZKQA 3F8RA 1LTXR 2YR6A 4EQXA 1CL0A 3T2KA 1TDNA 3SM8A 2X8GA 1Q9IA 2OAMA 4OPCA 4RG4A 2A8XA 3S61A 2B9XA 3AYJA 3AEAA 2GF3A 4GF7A 4YTMA 4J57A 2FBWA 2C3CA 1GT8A 1KF6A 1REOA 1S3BA 3GWDA 1NG3A 4PAAA 1GV4A 1OJCA 2DKHA 3GWFA 3M12A 1DOEA 1N1PA 1KFYA 2F5ZA 3FIMB 3KU9A 4K7ZA 3P4SA 1TRBA 3P4PA 3SYIA 1KSUA 3S5WA 4OPDA 1FEAA 1PN0A 4NEVA 2GQFA 1PJ7A 2OALA 1CF3A 1BGJA 2I0ZA 1E39A 4K2XA 1S2QA 3KKJA 2XFQA 3SGLA 3REDA 1JEHA 1TDEA 4TLXA 4A5LA 4BJZA 3NTDA 1GTHA 4H2NA 3G5SA 3BNMA 1GOSA 1YKJA 4U8NA 1FL2A 3DH9A 1PBDA 1XPQA 3CMMA 3CNTA 4ECHA 3AECA 1S2YA 2V6OA 2XLPA 3LXDA 3SZ0A 5CQFA 2YG4A 3AE1A 4Z2RA 5GSNA 3ALLA 1NENA 5FS9A 3AEFA 3GD3A 4B67A 1EL9A 4CNJA 2WP9A 3NG7X 1YQZA 4J36A 3ALJA 2A87A 1D7LA 2WHDA 3BI4A 3NYFA 3DMEA 4WX1A 3T2YA 1OJAA 3AE6A 4B66A 1DODA 4LU6A 4DSHA 1IUTA 1H83A 2JB2A 3H8LA 1P2HA 1XHCA 3IF9A 4IVMB 4Z24A 1JU2A 3UTGA 1YQ3A 2E4GA 2IVEA 4JN9A 2XYOA 3T14A 2GB0A 3CNDA 2YLRA 2JKCA 1CBOA 4U8OA 5BUKA 2Q6UA 1S3EA 4AOSA 2GR0A 1B4VA 3QJ4A 1PBFA 1QJDA 4H4UA 3UTHA 4B63A 4U2TA 3BI5A 4YTNA 4TM0A 4C5OA 1NHQA 2X3NA 2GRTA 1F6MA 4IA5A 3R9UA 2XFOA 3B6DA 3ABVA 3T2ZA 3LB8A 4TLZA 3FMWA 4ZCDA 2JB1A 1VQWA 4GCMA 2B7SA 2WOVA 3QVPA 1N4VA 1VG0A 2WPEA 4OPUA 2X8CA 2XVIA 3KLJA 4ADWA 1EL5A 3QVRA 2C3DA 5KMQA 4AP1A 4D03A 1QO8A 4YSXA 4USRA 3UKPA 1F3PA 1IUSA 4FX9A 3URHA 3NK0X 1K0JA 2X50A 2JK6A 1N4UA 3DJDA 3T0KA 4C77A 4G6HA 4YT0A 1E1LA 3G5RA 2GAHB 3CN8A 3UTEA 2H89A 2GR2A 2VVLG 2JAEA 1TYTA 1RYIA 3UKHA 1H7WA 3UP4A 3VRBA 2WU2A 4AT2A 4I59A 4G9KA
chains in the Genus database with same CATH topology
4EQRA 3L8KA 4Z25A 4BV6A 4GUVA 3QSEA 3IWAA 2R4JA 1DXLA 2GAGB 2WP5A 4II3A 3HZLA 4U8JA 3ZDNA 4J34A 1BWCA 2ACZA 3IHMA 3NK1X 2VZ2A 1GRBA 4Y4LA 4A99A 3AE2A 3UKQA 2Y6QA 4EQSA 1KNRA 2CDUA 1JOAA 4EMWA 5KMRA 2X99A 4EIPA 3V3NA 3CNJA 5JCNA 2B9WA 3GYIA 3QSMA 4J56A 1ZDLA 5GRTA 5C2TA 2C70A 2AAQA 1D4CA 3Q6JA 3VR8A 3H8IA 5ER0A 2YG3A 2C66A 3UKAA 3EAOA 1ZX9A 3RP8A 1PHHA 4AOXA 4G73A 1F8SA 4BK1A 3Q9TA 3C96A 1E1MA 2R4EA 4YKFA 1B8SA 3P4RA 3ICTA 1TDKA 2A89A 4OPLA 2BCPA 1LJ1A 1W4XA 4Y4NA 3GDPA 1YY5A 2WEUA 3UKFA 2BXRA 2FJEA 3ICSA 1OJ9A 3KD9A 1MXTA 3P4QA 1GRAA 2PHHA 2IIDA 4II2A 4EQWA 2CFYA 1D4DA 1E1KA 1CC4A 1BGNA 3FBSA 4EIQA 5KXJA 3GRTA 3AB1A 2BS3A 3PO7A 4RG3A 3VRDB 2Q0KA 3OZ2A 1JNZA 1ZMDA 4APNA 5JCKA 2WPFA 3ATRA 3QFAA 4O5QA 4TM1A 1E6EA 3SZFA 4NNJA 3SZCA 2BS2A 2GMJA 3KA7A 1GSNA 4G6GA 1Q1WA 4U8PA 2FJBA 3NHOX 3AE4A 3K7MX 4CY8A 5KOWA 2E5VA 4FDCB 1KDGA 4RSLA 4Z2UA 3E1TA 1K0LA 2X8HA 2QCUA 2CULA 1EBDA 3AYIA 3K7TA 3T37A 3AE5A 3CIRA 1GEUA 1EL8A 2GMHA 5J7XA 3M13A 1BKWA 4C74A 2WQYA 4H4PA 4CBQA 3NKSA 3QSSA 1LQUA 3L1RA 5U1OA 4CNKA 1GRTA 3ALMA 5L46A 2OA1A 5JCIA 3ICRA 1M6IA 1PXBA 3UOVA 2OLOA 4JNAA 1JNRA 1H82A 1V59A 2BRYA 2GH5A 4YTPA 1KSSA 1JRYA 2YAUA 5HXIA 5IPYA 4Y4MA 4A9WA 1O94A 1L9CA 1GRFA 2RGOA 4GR1A 3RP7A 2C72A 3V3OA 4TM3A 2BXSA 5DBJA 2ARDA 5FS6A 2EQ8A 4KX6A 2VRLA 3KPKA 4OPTA 4A6NA 4BURA 2TPRA 4A79A 1XANA 1GERA 3T31A 1EL7A 3C4AA 3ADAB 4H4YA 1B5QA 2V60A 3EPTA 1MOKA 1PXCA 2BK4A 3ATQA 1DOCA 2H88A 1IUWA 3RP6A 1FECA 5KOXA 4Z2TA 3DK9A 1JRXA 2AQJA 2PYXA 2YLZA 1NAAA 2YVFA 3NRNA 1CJ2A 2WOWA 3FG2P 4XWRA 3SQPA 1AOGA 1ZP0A 4X4JA 3BNUA 2BRAA 3LZWA 4P9SA 3I6DA 1M64A 2VQBA 3B3RA 1NG4A 3CGDA 4GDEA 4YKGA 4YSHA 2YLXA 3VRAA 2C67A 1H6VA 4OPGA 2YLWA 3SFDA 4CRTA 2YQUA 1H84A 3M0OA 2VVLA 2ZZBA 2FJDA 3SX6A 3AD7B 3HYWA 3DGHA 3NGCX 2ZZ0A 4C3YA 2BABA 3COXA 4U2LA 1FOHA 3UOZA 5BVAA 5IQ4A 2WOIA 4J2WA 5HYMA 1ELIA 3CGCA 3NH3X 1GESA 5CKUA 1IUUA 4ICYA 2Z5YA 4IVOB 2FJAA 2C73A 2YR5A 2WDVA 3ZYXA 2R9ZA 1K0IA 3GD4A 1E7PA 4YXDA 1N4WA 3BHFA 4WCTA 5U63A 2Z5XA 2V5ZA 1E1NA 1F8RA 3GMBA 3GMCA 4H2QA 1LPFA 1GRGA 3DK4A 2VQ7A 1H81A 2XLTA 2XFNA 1O5WA 3AEGA 1NDAA 4OVIA 4USQA 3GDNA 3UKLA 4FK1C 2BK5A 2WPCA 3GRSA 1CJCA 4EM4A 1GXFA 4O5UA 4Z44A 2BCGG 5J60A 4H4SA 4BK3A 2Q7VA 4LA1A 2V3AA 3HYVA 3EANA 4U8KA 3CNSA 1PJ5A 4GRTA 2NVKX 3LZXA 3AEBA 2RGJA 1NPXA 2R45A 4UDRA 4UDQA 1COYA 3NIXA 2YG5A 1L9DA 1NHSA 3AEDA 5KVIA 4J31A 4EM3A 2VRMA 3SFEA 4AT0A 1CHUA 1LV0A 3CPJG 1CC2A 4AP3A 2GV8A 2AR8A 4B65A 2BYBA 2YLTA 1DJQA 3CTYA 2XLSA 4YWOA 2XLUA 3F8PA 5KVHA 5M10A 5HY5A 5JCMA 1UKVG 2HQMA 5U25A 1F8WA 1YQ4A 4JY2A 3KVEA 5EOWA 4A6NB 2O9ZA 1BF3A 2GQWA 2R0PA 4NEWA 2V61A 2WU5A 5KRQA 1VRQB 2YM2A 4D04A 2BACA 5FS8A 3KPFA 4J33A 4BJYA 4C3XA 5FMHA 1RP0A 2XFUA 4H4WA 2NPXA 3GYJA 3P1WA 2YG7A 2CVJA 4HA6A 3FPZA 3HYXA 4GAPA 2UZZA 2WETA 2DKIA 3AEEA 3CGBA 4DSGA 4UP3A 3NLCA 4YSZA 2C76A 1PDHA 2WP6A 1DJNA 2QA1A 2WESA 4NTDA 1Y56A 3AE8A 1H7XA 4K5SA 4CCQA 1Y0PA 1GNDA 2JBVA 4EMJA 4K5RA 1DOBA 3QFBA 3DJEA 4H2PA 3EF6A 5IQ1A 5M0ZA 3NNEA 1H86A 2B7RA 3LADA 3SY4A 3SXIA 1SEZA 4Z43A 5HHFA 2EQ6A 3AE3A 2C4CA 3ISHA 1IUXA 1MO9A 1TDOA 4JY3A 4NTEA 4DNAA 1BZLA 1ZOVA 1IJHA 2C65A 2GVCA 4I58A 5EB4A 1VG9A 1HYUA 1X31B 4U8LA 3P9UA 1OJDA 1O95A 2B76A 2C64A 3PVCA 2RGHA 3VR9A 3IHGA 1CJ4A 4GDPA 2BS4A 2BC1A 1L0VA 2XCGA 3RNMA 2YR4A 1CJ3A 1FEBA 4DGKA 2R0GA 2V3BA 1FCDA 3CPIG 4N9XA 4B1BA 5KMPA 4EMIA 3II4A 1D7YA 2R46A 1LVLA 5BRTA 2YVGA 2W0HA 5LV9A 2GEWA 2XLRA 2WBAA 3AD8B 1NEKA 1PBCA 4X9NA 1L9EA 2B9YA 3NTAA 3SZWA 4B68A 4A65A 4ZCCA 4Z26A 5KWFA 3CPHG 4H4RA 4H2RA 5EB5A 1K4QA 1RSGA 3CNPA 4K22A 1TDFA 5FS7A 2XFPA 3G5QA 5KNLA 3IC9A 2EQ7A 2QAEA 3NK2X 1ZOYA 4H4QA 2EQ9A 3AE9A 2JB3A 2WDQA 2C7GA 2VVMA 3BHKA 2XVFA 3AE7A 4GAVA 1VDCA 1B37A 1NHPA 4JQ9A 5JCLA 2XDOA 1ZY8A 5C3JA 1KNPA 3F8DA 2IVDA 4U2SA 4JNQA 3LJPA 2RABA 1JRZA 3I3LA 5BULA 3NT6A 4NZHA 3AYLA 1OJTA 2YLSA 4LIIA 3LOVA 2WS3A 1GALA 3H4KA 2XVJA 3DJJA 4H50A 4H7UA 4OPIA 2BA9A 4U8MA 3WE0A 4H4TA 4MJWA 4U8IA 5KMSA 1CC6A 3JSKA 3UCLA 3UOXA 1IUVA 2QA2A 3GSIA 1NHRA 1GREA 3NN6X 1PBEA 1Q1RA 3AD9B 4A7AA 3D1CA 1GPEA 4XWZA 3K30A 3NYCA 4UDPA 4B69A 1TYPA 2Q0LA 3NYEA 3K7QX 3ITJA 4FK1A 2OLNA 5TR3A 4IA6A 1GRHA 1D4EA 2GR3A 1QLBA 2J3NA 1ONFA 1ZK7A 1P2EA 4K8DA 1GTEA 3UTFA 4IV9A 3RHAA 4G74A 4HB9A 1Y56B 2YM1A 3D8XA 4XXGA 4ZN0A 2YVJA 4H4ZA 4YSYA 2WDRA 2BK3A 2TMDA 2APGA 1PBBA 3BI2A 3DJGX 1D5TA 1PXAA 1PJ6A 4NWZA 3VQRA 2GR1A 4OCGA 4BK2A 3NN0X 3C4NA 2XVEA 4M52A 3UKKA 4JDRA 4NTCA 3DGZA 4REKA 3OC4A 4H4VA 3AWIA 3CGEA 3AXBA 4TM4A 1Z6LA 3GYXA 3O0HA 4B64A 2BC0A 2Y6RA 2R0CA 3UP5A 1DNCA 2ZBWA 2XVHA 2ZZCA 3DA1A 4KPRA 4E0VA 1LQTA 1PS9A 2YG6A 4H4XA 5EBKA 4CY6A 1GETA 1ZMCA 4CCRA 1XDIA 2E1MA 4PABA 2VOUA 3DK8A 3PS9A 2C75A 4X9MA 3UOYA 2YWLA 3V76A 1ZKQA 3F8RA 1LTXR 2YR6A 4EQXA 1CL0A 3T2KA 1TDNA 3SM8A 2X8GA 1Q9IA 2OAMA 4OPCA 4RG4A 2A8XA 3S61A 2B9XA 3AYJA 3AEAA 2GF3A 4GF7A 4YTMA 4J57A 2FBWA 2C3CA 1GT8A 1KF6A 1REOA 1S3BA 3GWDA 1NG3A 4PAAA 1GV4A 1OJCA 2DKHA 3GWFA 3M12A 1DOEA 1N1PA 1KFYA 2F5ZA 3FIMB 3KU9A 4K7ZA 3P4SA 1TRBA 3P4PA 3SYIA 1KSUA 3S5WA 4OPDA 1FEAA 1PN0A 4NEVA 2GQFA 1PJ7A 2OALA 1CF3A 1BGJA 2I0ZA 1E39A 4K2XA 1S2QA 3KKJA 2XFQA 3SGLA 3REDA 1JEHA 1TDEA 4TLXA 4A5LA 4BJZA 3NTDA 1GTHA 4H2NA 3G5SA 3BNMA 1GOSA 1YKJA 4U8NA 1FL2A 3DH9A 1PBDA 1XPQA 3CMMA 3CNTA 4ECHA 3AECA 1S2YA 2V6OA 2XLPA 3LXDA 3SZ0A 5CQFA 2YG4A 3AE1A 4Z2RA 5GSNA 3ALLA 1NENA 5FS9A 3AEFA 3GD3A 4B67A 1EL9A 4CNJA 2WP9A 3NG7X 1YQZA 4J36A 3ALJA 2A87A 1D7LA 2WHDA 3BI4A 3NYFA 3DMEA 4WX1A 3T2YA 1OJAA 3AE6A 4B66A 1DODA 4LU6A 4DSHA 1IUTA 1H83A 2JB2A 3H8LA 1P2HA 1XHCA 3IF9A 4IVMB 4Z24A 1JU2A 3UTGA 1YQ3A 2E4GA 2IVEA 4JN9A 2XYOA 3T14A 2GB0A 3CNDA 2YLRA 2JKCA 1CBOA 4U8OA 5BUKA 2Q6UA 1S3EA 4AOSA 2GR0A 1B4VA 3QJ4A 1PBFA 1QJDA 4H4UA 3UTHA 4B63A 4U2TA 3BI5A 4YTNA 4TM0A 4C5OA 1NHQA 2X3NA 2GRTA 1F6MA 4IA5A 3R9UA 2XFOA 3B6DA 3ABVA 3T2ZA 3LB8A 4TLZA 3FMWA 4ZCDA 2JB1A 1VQWA 4GCMA 2B7SA 2WOVA 3QVPA 1N4VA 1VG0A 2WPEA 4OPUA 2X8CA 2XVIA 3KLJA 4ADWA 1EL5A 3QVRA 2C3DA 5KMQA 4AP1A 4D03A 1QO8A 4YSXA 4USRA 3UKPA 1F3PA 1IUSA 4FX9A 3URHA 3NK0X 1K0JA 2X50A 2JK6A 1N4UA 3DJDA 3T0KA 4C77A 4G6HA 4YT0A 1E1LA 3G5RA 2GAHB 3CN8A 3UTEA 2H89A 2GR2A 2VVLG 2JAEA 1TYTA 1RYIA 3UKHA 1H7WA 3UP4A 3VRBA 2WU2A 4AT2A 4I59A 4G9KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EQR A;  3L8K A;  4Z25 A;  4BV6 A;  4GUV A;  3QSE A;  3IWA A;  2R4J A;  1DXL A;  2GAG B;  2WP5 A;  3ZDN A;  3HZL A;  4U8J A;  4J34 A;  1BWC A;  2ACZ A;  3IHM A;  3NK1 X;  2VZ2 A;  1GRB A;  4Y4L A;  4A99 A;  3AE2 A;  3UKQ A;  2Y6Q A;  4EQS A;  1KNR A;  2CDU A;  1JOA A;  4EMW A;  2X99 A;  4EIP A;  3V3N A;  3CNJ A;  5JCN A;  2B9W A;  3GYI A;  3QSM A;  4J56 A;  1ZDL A;  5GRT A;  5C2T A;  2C70 A;  2AAQ A;  1D4C A;  3Q6J A;  3VR8 A;  3H8I A;  5ER0 A;  2YG3 A;  2C66 A;  3UKA A;  3EAO A;  1ZX9 A;  3RP8 A;  1PHH A;  4AOX A;  1F8S A;  4BK1 A;  3Q9T A;  3C96 A;  1E1M A;  2R4E A;  4YKF A;  1B8S A;  3P4R A;  3ICT A;  1TDK A;  2A89 A;  4OPL A;  2BCP A;  1LJ1 A;  1W4X A;  4Y4N A;  3GDP A;  1YY5 A;  2WEU A;  3UKF A;  2BXR A;  2FJE A;  3ICS A;  1OJ9 A;  3KD9 A;  1MXT A;  3P4Q A;  1GRA A;  2PHH A;  2IID A;  4EQW A;  2CFY A;  1D4D A;  1E1K A;  1CC4 A;  1BGN A;  3FBS A;  4EIQ A;  5KXJ A;  3GRT A;  3AB1 A;  2BS3 A;  3PO7 A;  4RG3 A;  3VRD B;  2Q0K A;  3OZ2 A;  1JNZ A;  1ZMD A;  4APN A;  5JCK A;  2WPF A;  3ATR A;  3QFA A;  4O5Q A;  4TM1 A;  1E6E A;  2BS2 A;  2GMJ A;  3KA7 A;  1GSN A;  1Q1W A;  4U8P A;  2FJB A;  3NHO X;  3AE4 A;  3K7M X;  4CY8 A;  5KOW A;  2E5V A;  4FDC B;  1KDG A;  4RSL A;  4Z2U A;  3E1T A;  1K0L A;  2X8H A;  2QCU A;  2CUL A;  1EBD A;  3AYI A;  3K7T A;  3T37 A;  3AE5 A;  3CIR A;  1GEU A;  1EL8 A;  2GMH A;  5J7X A;  3M13 A;  1BKW A;  4C74 A;  2WQY A;  4H4P A;  4CBQ A;  3NKS A;  3QSS A;  1LQU A;  3L1R A;  5U1O A;  4CNK A;  1GRT A;  3ALM A;  5L46 A;  2OA1 A;  5JCI A;  3ICR A;  1M6I A;  1PXB A;  3UOV A;  2OLO A;  4JNA A;  1JNR A;  1H82 A;  1V59 A;  2GH5 A;  4YTP A;  1KSS A;  1JRY A;  2YAU A;  5HXI A;  5IPY A;  4Y4M A;  4A9W A;  1O94 A;  1L9C A;  1GRF A;  2RGO A;  4GR1 A;  3RP7 A;  2C72 A;  3V3O A;  4TM3 A;  2BXS A;  5DBJ A;  2ARD A;  5FS6 A;  2EQ8 A;  4KX6 A;  2VRL A;  4OPT A;  4A6N A;  4BUR A;  2TPR A;  4A79 A;  1XAN A;  1GER A;  1EL7 A;  3C4A A;  3ADA B;  4H4Y A;  1B5Q A;  2V60 A;  3EPT A;  1MOK A;  1PXC A;  2BK4 A;  3ATQ A;  1DOC A;  2H88 A;  1IUW A;  3RP6 A;  1FEC A;  5KOX A;  4Z2T A;  3DK9 A;  1JRX A;  2AQJ A;  2PYX A;  2YLZ A;  1NAA A;  2YVF A;  3NRN A;  1CJ2 A;  2WOW A;  3FG2 P;  4XWR A;  3SQP A;  1AOG A;  1ZP0 A;  4X4J A;  3BNU A;  4P9S A;  3LZW A;  3I6D A;  1M64 A;  2VQB A;  3B3R A;  1NG4 A;  3CGD A;  4GDE A;  4YKG A;  4YSH A;  2YLX A;  3VRA A;  2C67 A;  1H6V A;  4OPG A;  2YLW A;  3SFD A;  4CRT A;  2YQU A;  1H84 A;  3M0O A;  2VVL A;  2ZZB A;  2FJD A;  3AD7 B;  3DGH A;  3NGC X;  2ZZ0 A;  4C3Y A;  2BAB A;  3COX A;  4U2L A;  1FOH A;  3UOZ A;  5BVA A;  5IQ4 A;  2WOI A;  4J2W A;  5HYM A;  1ELI A;  3CGC A;  3NH3 X;  1GES A;  5CKU A;  1IUU A;  4ICY A;  2Z5Y A;  4IVO B;  2FJA A;  2C73 A;  2YR5 A;  2WDV A;  3ZYX A;  2R9Z A;  1K0I A;  3GD4 A;  1E7P A;  4YXD A;  1N4W A;  3BHF A;  4WCT A;  5U63 A;  2Z5X A;  2V5Z A;  1E1N A;  1F8R A;  3GMB A;  3GMC A;  4H2Q A;  1LPF A;  1GRG A;  3DK4 A;  2VQ7 A;  1H81 A;  2XLT A;  2XFN A;  1O5W A;  3AEG A;  1NDA A;  4OVI A;  4USQ A;  3GDN A;  3UKL A;  4FK1 C;  2BK5 A;  2WPC A;  3GRS A;  1CJC A;  4EM4 A;  1GXF A;  4O5U A;  4Z44 A;  2BCG G;  5J60 A;  4H4S A;  4BK3 A;  2Q7V A;  4LA1 A;  2V3A A;  3EAN A;  4U8K A;  3CNS A;  1PJ5 A;  4GRT A;  2NVK X;  3LZX A;  3AEB A;  2RGJ A;  1NPX A;  2R45 A;  4UDR A;  4UDQ A;  1COY A;  3NIX A;  2YG5 A;  1L9D A;  1NHS A;  3AED A;  5KVI A;  4J31 A;  4EM3 A;  2VRM A;  3SFE A;  4AT0 A;  1CHU A;  1LV0 A;  3CPJ G;  1CC2 A;  4AP3 A;  2GV8 A;  2AR8 A;  4B65 A;  2BYB A;  2YLT A;  1DJQ A;  3CTY A;  2XLS A;  4YWO A;  2XLU A;  3F8P A;  5KVH A;  5M10 A;  5HY5 A;  5JCM A;  1UKV G;  2HQM A;  5U25 A;  1F8W A;  1YQ4 A;  4JY2 A;  3KVE A;  5EOW A;  4A6N B;  2O9Z A;  1BF3 A;  2GQW A;  2R0P A;  4NEW A;  2V61 A;  2WU5 A;  5KRQ A;  1VRQ B;  2YM2 A;  4D04 A;  2BAC A;  5FS8 A;  3KPF A;  4J33 A;  4BJY A;  4C3X A;  5FMH A;  1RP0 A;  2XFU A;  4H4W A;  2NPX A;  3GYJ A;  3P1W A;  2YG7 A;  2CVJ A;  4HA6 A;  3FPZ A;  2UZZ A;  2WET A;  2DKI A;  3AEE A;  3CGB A;  4DSG A;  4UP3 A;  3NLC A;  4YSZ A;  2C76 A;  1PDH A;  2WP6 A;  1DJN A;  2QA1 A;  2WES A;  4NTD A;  1Y56 A;  3AE8 A;  1H7X A;  4K5S A;  4CCQ A;  1Y0P A;  1GND A;  2JBV A;  4EMJ A;  4K5R A;  1DOB A;  3QFB A;  3DJE A;  4H2P A;  3EF6 A;  5IQ1 A;  5M0Z A;  3NNE A;  1H86 A;  2B7R A;  3LAD A;  1SEZ A;  4Z43 A;  5HHF A;  2EQ6 A;  3AE3 A;  3ISH A;  1IUX A;  1MO9 A;  1TDO A;  4JY3 A;  4NTE A;  4DNA A;  1BZL A;  1ZOV A;  1IJH A;  2C65 A;  2GVC A;  4I58 A;  5EB4 A;  1VG9 A;  1HYU A;  1X31 B;  4U8L A;  3P9U A;  1OJD A;  1O95 A;  2B76 A;  2C64 A;  3PVC A;  2RGH A;  3VR9 A;  3IHG A;  1CJ4 A;  4GDP A;  2BS4 A;  2BC1 A;  1L0V A;  2XCG A;  3RNM A;  2YR4 A;  1CJ3 A;  1FEB A;  4DGK A;  2R0G A;  2V3B A;  1FCD A;  3CPI G;  4N9X A;  4B1B A;  4EMI A;  3II4 A;  1D7Y A;  2R46 A;  1LVL A;  5BRT A;  2YVG A;  2W0H A;  5LV9 A;  2GEW A;  2XLR A;  2WBA A;  3AD8 B;  1NEK A;  1PBC A;  4X9N A;  1L9E A;  2B9Y A;  3NTA A;  4B68 A;  4A65 A;  4ZCC A;  4Z26 A;  5KWF A;  3CPH G;  4H4R A;  4H2R A;  5EB5 A;  1K4Q A;  1RSG A;  3CNP A;  4K22 A;  1TDF A;  5FS7 A;  2XFP A;  3G5Q A;  3IC9 A;  2EQ7 A;  2QAE A;  3NK2 X;  1ZOY A;  4H4Q A;  2EQ9 A;  3AE9 A;  2JB3 A;  2WDQ A;  2C7G A;  2VVM A;  3BHK A;  2XVF A;  3AE7 A;  1VDC A;  1B37 A;  1NHP A;  4JQ9 A;  5JCL A;  2XDO A;  1ZY8 A;  5C3J A;  1KNP A;  3F8D A;  2IVD A;  4U2S A;  4JNQ A;  3LJP A;  2RAB A;  1JRZ A;  3I3L A;  5BUL A;  3NT6 A;  4NZH A;  3AYL A;  1OJT A;  2YLS A;  4LII A;  3LOV A;  2WS3 A;  1GAL A;  3H4K A;  2XVJ A;  3DJJ A;  4H50 A;  4H7U A;  4OPI A;  2BA9 A;  4U8M A;  3WE0 A;  4H4T A;  4MJW A;  4U8I A;  1CC6 A;  3JSK A;  3UCL A;  3UOX A;  1IUV A;  2QA2 A;  3GSI A;  1NHR A;  1GRE A;  3NN6 X;  1PBE A;  1Q1R A;  3AD9 B;  4A7A A;  3D1C A;  1GPE A;  4XWZ A;  3K30 A;  3NYC A;  4UDP A;  4B69 A;  1TYP A;  2Q0L A;  3NYE A;  3K7Q X;  3ITJ A;  4FK1 A;  2OLN A;  5TR3 A;  4IA6 A;  1GRH A;  1D4E A;  2GR3 A;  1QLB A;  2J3N A;  1ONF A;  1ZK7 A;  1P2E A;  4K8D A;  1GTE A;  3UTF A;  4IV9 A;  3RHA A;  4HB9 A;  1Y56 B;  2YM1 A;  3D8X A;  4XXG A;  4ZN0 A;  2YVJ A;  4H4Z A;  4YSY A;  2WDR A;  2BK3 A;  2TMD A;  2APG A;  1PBB A;  3BI2 A;  3DJG X;  1D5T A;  1PXA A;  1PJ6 A;  3VQR A;  2GR1 A;  4OCG A;  4BK2 A;  3NN0 X;  3C4N A;  2XVE A;  4M52 A;  3UKK A;  4JDR A;  4NTC A;  3DGZ A;  4REK A;  3OC4 A;  4H4V A;  3AWI A;  3CGE A;  3AXB A;  4TM4 A;  1Z6L A;  3O0H A;  4B64 A;  2BC0 A;  2Y6R A;  2R0C A;  3UP5 A;  1DNC A;  2ZBW A;  2XVH A;  2ZZC A;  3DA1 A;  4KPR A;  4E0V A;  1LQT A;  1PS9 A;  2YG6 A;  4H4X A;  5EBK A;  4CY6 A;  1GET A;  1ZMC A;  4CCR A;  1XDI A;  2E1M A;  4PAB A;  2VOU A;  3DK8 A;  3PS9 A;  2C75 A;  4X9M A;  3UOY A;  2YWL A;  3V76 A;  1ZKQ A;  3F8R A;  1LTX R;  2YR6 A;  4EQX A;  1CL0 A;  1TDN A;  3SM8 A;  2X8G A;  1Q9I A;  2OAM A;  4OPC A;  4RG4 A;  2A8X A;  3S61 A;  2B9X A;  3AYJ A;  3AEA A;  2GF3 A;  4GF7 A;  4YTM A;  4J57 A;  2FBW A;  2C3C A;  1GT8 A;  1KF6 A;  1REO A;  1S3B A;  3GWD A;  1NG3 A;  4PAA A;  1GV4 A;  1OJC A;  2DKH A;  3GWF A;  3M12 A;  1DOE A;  1N1P A;  1KFY A;  2F5Z A;  3FIM B;  3KU9 A;  4K7Z A;  3P4S A;  1TRB A;  3P4P A;  1KSU A;  3S5W A;  4OPD A;  1FEA A;  1PN0 A;  4NEV A;  2GQF A;  1PJ7 A;  2OAL A;  1CF3 A;  1BGJ A;  2I0Z A;  1E39 A;  4K2X A;  1S2Q A;  3KKJ A;  2XFQ A;  3SGL A;  3RED A;  1JEH A;  1TDE A;  4TLX A;  4A5L A;  4BJZ A;  3NTD A;  1GTH A;  4H2N A;  3G5S A;  3BNM A;  1GOS A;  1YKJ A;  4U8N A;  1FL2 A;  3DH9 A;  1PBD A;  1XPQ A;  3CNT A;  4ECH A;  3AEC A;  1S2Y A;  2V6O A;  2XLP A;  3LXD A;  5CQF A;  2YG4 A;  3AE1 A;  4Z2R A;  5GSN A;  3ALL A;  1NEN A;  5FS9 A;  3AEF A;  3GD3 A;  4B67 A;  1EL9 A;  4CNJ A;  2WP9 A;  3NG7 X;  1YQZ A;  4J36 A;  3ALJ A;  2A87 A;  1D7L A;  2WHD A;  3BI4 A;  3NYF A;  3DME A;  4WX1 A;  1OJA A;  3AE6 A;  4B66 A;  1DOD A;  4LU6 A;  4DSH A;  1IUT A;  1H83 A;  2JB2 A;  3H8L A;  1P2H A;  1XHC A;  3IF9 A;  4IVM B;  4Z24 A;  1JU2 A;  3UTG A;  1YQ3 A;  2E4G A;  2IVE A;  4JN9 A;  2XYO A;  2GB0 A;  3CND A;  2YLR A;  2JKC A;  1CBO A;  4U8O A;  5BUK A;  2Q6U A;  1S3E A;  4AOS A;  2GR0 A;  1B4V A;  3QJ4 A;  1PBF A;  1QJD A;  4H4U A;  3UTH A;  4B63 A;  4U2T A;  3BI5 A;  4YTN A;  4TM0 A;  4C5O A;  1NHQ A;  2X3N A;  2GRT A;  1F6M A;  4IA5 A;  3R9U A;  2XFO A;  3B6D A;  3ABV A;  3LB8 A;  4TLZ A;  3FMW A;  4ZCD A;  2JB1 A;  1VQW A;  4GCM A;  2B7S A;  2WOV A;  3QVP A;  1N4V A;  1VG0 A;  2WPE A;  4OPU A;  2X8C A;  2XVI A;  3KLJ A;  4ADW A;  1EL5 A;  3QVR A;  2C3D A;  4AP1 A;  4D03 A;  1QO8 A;  4YSX A;  4USR A;  3UKP A;  1F3P A;  1IUS A;  4FX9 A;  3URH A;  3NK0 X;  1K0J A;  2X50 A;  2JK6 A;  1N4U A;  3DJD A;  4C77 A;  4YT0 A;  1E1L A;  3G5R A;  2GAH B;  3CN8 A;  3UTE A;  2H89 A;  2GR2 A;  2VVL G;  2JAE A;  1TYT A;  1RYI A;  3UKH A;  1H7W A;  3UP4 A;  3VRB A;  2WU2 A;  4AT2 A;  4I59 A; 
#chains in the Genus database with same CATH topology
 4EQR A;  3L8K A;  4Z25 A;  4BV6 A;  4GUV A;  3QSE A;  3IWA A;  2R4J A;  1DXL A;  2GAG B;  2WP5 A;  4II3 A;  3HZL A;  4U8J A;  3ZDN A;  4J34 A;  1BWC A;  2ACZ A;  3IHM A;  3NK1 X;  2VZ2 A;  1GRB A;  4Y4L A;  4A99 A;  3AE2 A;  3UKQ A;  2Y6Q A;  4EQS A;  1KNR A;  2CDU A;  1JOA A;  4EMW A;  5KMR A;  2X99 A;  4EIP A;  3V3N A;  3CNJ A;  5JCN A;  2B9W A;  3GYI A;  3QSM A;  4J56 A;  1ZDL A;  5GRT A;  5C2T A;  2C70 A;  2AAQ A;  1D4C A;  3Q6J A;  3VR8 A;  3H8I A;  5ER0 A;  2YG3 A;  2C66 A;  3UKA A;  3EAO A;  1ZX9 A;  3RP8 A;  1PHH A;  4AOX A;  4G73 A;  1F8S A;  4BK1 A;  3Q9T A;  3C96 A;  1E1M A;  2R4E A;  4YKF A;  1B8S A;  3P4R A;  3ICT A;  1TDK A;  2A89 A;  4OPL A;  2BCP A;  1LJ1 A;  1W4X A;  4Y4N A;  3GDP A;  1YY5 A;  2WEU A;  3UKF A;  2BXR A;  2FJE A;  3ICS A;  1OJ9 A;  3KD9 A;  1MXT A;  3P4Q A;  1GRA A;  2PHH A;  2IID A;  4II2 A;  4EQW A;  2CFY A;  1D4D A;  1E1K A;  1CC4 A;  1BGN A;  3FBS A;  4EIQ A;  5KXJ A;  3GRT A;  3AB1 A;  2BS3 A;  3PO7 A;  4RG3 A;  3VRD B;  2Q0K A;  3OZ2 A;  1JNZ A;  1ZMD A;  4APN A;  5JCK A;  2WPF A;  3ATR A;  3QFA A;  4O5Q A;  4TM1 A;  1E6E A;  3SZF A;  4NNJ A;  3SZC A;  2BS2 A;  2GMJ A;  3KA7 A;  1GSN A;  4G6G A;  1Q1W A;  4U8P A;  2FJB A;  3NHO X;  3AE4 A;  3K7M X;  4CY8 A;  5KOW A;  2E5V A;  4FDC B;  1KDG A;  4RSL A;  4Z2U A;  3E1T A;  1K0L A;  2X8H A;  2QCU A;  2CUL A;  1EBD A;  3AYI A;  3K7T A;  3T37 A;  3AE5 A;  3CIR A;  1GEU A;  1EL8 A;  2GMH A;  5J7X A;  3M13 A;  1BKW A;  4C74 A;  2WQY A;  4H4P A;  4CBQ A;  3NKS A;  3QSS A;  1LQU A;  3L1R A;  5U1O A;  4CNK A;  1GRT A;  3ALM A;  5L46 A;  2OA1 A;  5JCI A;  3ICR A;  1M6I A;  1PXB A;  3UOV A;  2OLO A;  4JNA A;  1JNR A;  1H82 A;  1V59 A;  2BRY A;  2GH5 A;  4YTP A;  1KSS A;  1JRY A;  2YAU A;  5HXI A;  5IPY A;  4Y4M A;  4A9W A;  1O94 A;  1L9C A;  1GRF A;  2RGO A;  4GR1 A;  3RP7 A;  2C72 A;  3V3O A;  4TM3 A;  2BXS A;  5DBJ A;  2ARD A;  5FS6 A;  2EQ8 A;  4KX6 A;  2VRL A;  3KPK A;  4OPT A;  4A6N A;  4BUR A;  2TPR A;  4A79 A;  1XAN A;  1GER A;  3T31 A;  1EL7 A;  3C4A A;  3ADA B;  4H4Y A;  1B5Q A;  2V60 A;  3EPT A;  1MOK A;  1PXC A;  2BK4 A;  3ATQ A;  1DOC A;  2H88 A;  1IUW A;  3RP6 A;  1FEC A;  5KOX A;  4Z2T A;  3DK9 A;  1JRX A;  2AQJ A;  2PYX A;  2YLZ A;  1NAA A;  2YVF A;  3NRN A;  1CJ2 A;  2WOW A;  3FG2 P;  4XWR A;  3SQP A;  1AOG A;  1ZP0 A;  4X4J A;  3BNU A;  2BRA A;  3LZW A;  4P9S A;  3I6D A;  1M64 A;  2VQB A;  3B3R A;  1NG4 A;  3CGD A;  4GDE A;  4YKG A;  4YSH A;  2YLX A;  3VRA A;  2C67 A;  1H6V A;  4OPG A;  2YLW A;  3SFD A;  4CRT A;  2YQU A;  1H84 A;  3M0O A;  2VVL A;  2ZZB A;  2FJD A;  3SX6 A;  3AD7 B;  3HYW A;  3DGH A;  3NGC X;  2ZZ0 A;  4C3Y A;  2BAB A;  3COX A;  4U2L A;  1FOH A;  3UOZ A;  5BVA A;  5IQ4 A;  2WOI A;  4J2W A;  5HYM A;  1ELI A;  3CGC A;  3NH3 X;  1GES A;  5CKU A;  1IUU A;  4ICY A;  2Z5Y A;  4IVO B;  2FJA A;  2C73 A;  2YR5 A;  2WDV A;  3ZYX A;  2R9Z A;  1K0I A;  3GD4 A;  1E7P A;  4YXD A;  1N4W A;  3BHF A;  4WCT A;  5U63 A;  2Z5X A;  2V5Z A;  1E1N A;  1F8R A;  3GMB A;  3GMC A;  4H2Q A;  1LPF A;  1GRG A;  3DK4 A;  2VQ7 A;  1H81 A;  2XLT A;  2XFN A;  1O5W A;  3AEG A;  1NDA A;  4OVI A;  4USQ A;  3GDN A;  3UKL A;  4FK1 C;  2BK5 A;  2WPC A;  3GRS A;  1CJC A;  4EM4 A;  1GXF A;  4O5U A;  4Z44 A;  2BCG G;  5J60 A;  4H4S A;  4BK3 A;  2Q7V A;  4LA1 A;  2V3A A;  3HYV A;  3EAN A;  4U8K A;  3CNS A;  1PJ5 A;  4GRT A;  2NVK X;  3LZX A;  3AEB A;  2RGJ A;  1NPX A;  2R45 A;  4UDR A;  4UDQ A;  1COY A;  3NIX A;  2YG5 A;  1L9D A;  1NHS A;  3AED A;  5KVI A;  4J31 A;  4EM3 A;  2VRM A;  3SFE A;  4AT0 A;  1CHU A;  1LV0 A;  3CPJ G;  1CC2 A;  4AP3 A;  2GV8 A;  2AR8 A;  4B65 A;  2BYB A;  2YLT A;  1DJQ A;  3CTY A;  2XLS A;  4YWO A;  2XLU A;  3F8P A;  5KVH A;  5M10 A;  5HY5 A;  5JCM A;  1UKV G;  2HQM A;  5U25 A;  1F8W A;  1YQ4 A;  4JY2 A;  3KVE A;  5EOW A;  4A6N B;  2O9Z A;  1BF3 A;  2GQW A;  2R0P A;  4NEW A;  2V61 A;  2WU5 A;  5KRQ A;  1VRQ B;  2YM2 A;  4D04 A;  2BAC A;  5FS8 A;  3KPF A;  4J33 A;  4BJY A;  4C3X A;  5FMH A;  1RP0 A;  2XFU A;  4H4W A;  2NPX A;  3GYJ A;  3P1W A;  2YG7 A;  2CVJ A;  4HA6 A;  3FPZ A;  3HYX A;  4GAP A;  2UZZ A;  2WET A;  2DKI A;  3AEE A;  3CGB A;  4DSG A;  4UP3 A;  3NLC A;  4YSZ A;  2C76 A;  1PDH A;  2WP6 A;  1DJN A;  2QA1 A;  2WES A;  4NTD A;  1Y56 A;  3AE8 A;  1H7X A;  4K5S A;  4CCQ A;  1Y0P A;  1GND A;  2JBV A;  4EMJ A;  4K5R A;  1DOB A;  3QFB A;  3DJE A;  4H2P A;  3EF6 A;  5IQ1 A;  5M0Z A;  3NNE A;  1H86 A;  2B7R A;  3LAD A;  3SY4 A;  3SXI A;  1SEZ A;  4Z43 A;  5HHF A;  2EQ6 A;  3AE3 A;  2C4C A;  3ISH A;  1IUX A;  1MO9 A;  1TDO A;  4JY3 A;  4NTE A;  4DNA A;  1BZL A;  1ZOV A;  1IJH A;  2C65 A;  2GVC A;  4I58 A;  5EB4 A;  1VG9 A;  1HYU A;  1X31 B;  4U8L A;  3P9U A;  1OJD A;  1O95 A;  2B76 A;  2C64 A;  3PVC A;  2RGH A;  3VR9 A;  3IHG A;  1CJ4 A;  4GDP A;  2BS4 A;  2BC1 A;  1L0V A;  2XCG A;  3RNM A;  2YR4 A;  1CJ3 A;  1FEB A;  4DGK A;  2R0G A;  2V3B A;  1FCD A;  3CPI G;  4N9X A;  4B1B A;  5KMP A;  4EMI A;  3II4 A;  1D7Y A;  2R46 A;  1LVL A;  5BRT A;  2YVG A;  2W0H A;  5LV9 A;  2GEW A;  2XLR A;  2WBA A;  3AD8 B;  1NEK A;  1PBC A;  4X9N A;  1L9E A;  2B9Y A;  3NTA A;  3SZW A;  4B68 A;  4A65 A;  4ZCC A;  4Z26 A;  5KWF A;  3CPH G;  4H4R A;  4H2R A;  5EB5 A;  1K4Q A;  1RSG A;  3CNP A;  4K22 A;  1TDF A;  5FS7 A;  2XFP A;  3G5Q A;  5KNL A;  3IC9 A;  2EQ7 A;  2QAE A;  3NK2 X;  1ZOY A;  4H4Q A;  2EQ9 A;  3AE9 A;  2JB3 A;  2WDQ A;  2C7G A;  2VVM A;  3BHK A;  2XVF A;  3AE7 A;  4GAV A;  1VDC A;  1B37 A;  1NHP A;  4JQ9 A;  5JCL A;  2XDO A;  1ZY8 A;  5C3J A;  1KNP A;  3F8D A;  2IVD A;  4U2S A;  4JNQ A;  3LJP A;  2RAB A;  1JRZ A;  3I3L A;  5BUL A;  3NT6 A;  4NZH A;  3AYL A;  1OJT A;  2YLS A;  4LII A;  3LOV A;  2WS3 A;  1GAL A;  3H4K A;  2XVJ A;  3DJJ A;  4H50 A;  4H7U A;  4OPI A;  2BA9 A;  4U8M A;  3WE0 A;  4H4T A;  4MJW A;  4U8I A;  5KMS A;  1CC6 A;  3JSK A;  3UCL A;  3UOX A;  1IUV A;  2QA2 A;  3GSI A;  1NHR A;  1GRE A;  3NN6 X;  1PBE A;  1Q1R A;  3AD9 B;  4A7A A;  3D1C A;  1GPE A;  4XWZ A;  3K30 A;  3NYC A;  4UDP A;  4B69 A;  1TYP A;  2Q0L A;  3NYE A;  3K7Q X;  3ITJ A;  4FK1 A;  2OLN A;  5TR3 A;  4IA6 A;  1GRH A;  1D4E A;  2GR3 A;  1QLB A;  2J3N A;  1ONF A;  1ZK7 A;  1P2E A;  4K8D A;  1GTE A;  3UTF A;  4IV9 A;  3RHA A;  4G74 A;  4HB9 A;  1Y56 B;  2YM1 A;  3D8X A;  4XXG A;  4ZN0 A;  2YVJ A;  4H4Z A;  4YSY A;  2WDR A;  2BK3 A;  2TMD A;  2APG A;  1PBB A;  3BI2 A;  3DJG X;  1D5T A;  1PXA A;  1PJ6 A;  4NWZ A;  3VQR A;  2GR1 A;  4OCG A;  4BK2 A;  3NN0 X;  3C4N A;  2XVE A;  4M52 A;  3UKK A;  4JDR A;  4NTC A;  3DGZ A;  4REK A;  3OC4 A;  4H4V A;  3AWI A;  3CGE A;  3AXB A;  4TM4 A;  1Z6L A;  3GYX A;  3O0H A;  4B64 A;  2BC0 A;  2Y6R A;  2R0C A;  3UP5 A;  1DNC A;  2ZBW A;  2XVH A;  2ZZC A;  3DA1 A;  4KPR A;  4E0V A;  1LQT A;  1PS9 A;  2YG6 A;  4H4X A;  5EBK A;  4CY6 A;  1GET A;  1ZMC A;  4CCR A;  1XDI A;  2E1M A;  4PAB A;  2VOU A;  3DK8 A;  3PS9 A;  2C75 A;  4X9M A;  3UOY A;  2YWL A;  3V76 A;  1ZKQ A;  3F8R A;  1LTX R;  2YR6 A;  4EQX A;  1CL0 A;  3T2K A;  1TDN A;  3SM8 A;  2X8G A;  1Q9I A;  2OAM A;  4OPC A;  4RG4 A;  2A8X A;  3S61 A;  2B9X A;  3AYJ A;  3AEA A;  2GF3 A;  4GF7 A;  4YTM A;  4J57 A;  2FBW A;  2C3C A;  1GT8 A;  1KF6 A;  1REO A;  1S3B A;  3GWD A;  1NG3 A;  4PAA A;  1GV4 A;  1OJC A;  2DKH A;  3GWF A;  3M12 A;  1DOE A;  1N1P A;  1KFY A;  2F5Z A;  3FIM B;  3KU9 A;  4K7Z A;  3P4S A;  1TRB A;  3P4P A;  3SYI A;  1KSU A;  3S5W A;  4OPD A;  1FEA A;  1PN0 A;  4NEV A;  2GQF A;  1PJ7 A;  2OAL A;  1CF3 A;  1BGJ A;  2I0Z A;  1E39 A;  4K2X A;  1S2Q A;  3KKJ A;  2XFQ A;  3SGL A;  3RED A;  1JEH A;  1TDE A;  4TLX A;  4A5L A;  4BJZ A;  3NTD A;  1GTH A;  4H2N A;  3G5S A;  3BNM A;  1GOS A;  1YKJ A;  4U8N A;  1FL2 A;  3DH9 A;  1PBD A;  1XPQ A;  3CMM A;  3CNT A;  4ECH A;  3AEC A;  1S2Y A;  2V6O A;  2XLP A;  3LXD A;  3SZ0 A;  5CQF A;  2YG4 A;  3AE1 A;  4Z2R A;  5GSN A;  3ALL A;  1NEN A;  5FS9 A;  3AEF A;  3GD3 A;  4B67 A;  1EL9 A;  4CNJ A;  2WP9 A;  3NG7 X;  1YQZ A;  4J36 A;  3ALJ A;  2A87 A;  1D7L A;  2WHD A;  3BI4 A;  3NYF A;  3DME A;  4WX1 A;  3T2Y A;  1OJA A;  3AE6 A;  4B66 A;  1DOD A;  4LU6 A;  4DSH A;  1IUT A;  1H83 A;  2JB2 A;  3H8L A;  1P2H A;  1XHC A;  3IF9 A;  4IVM B;  4Z24 A;  1JU2 A;  3UTG A;  1YQ3 A;  2E4G A;  2IVE A;  4JN9 A;  2XYO A;  3T14 A;  2GB0 A;  3CND A;  2YLR A;  2JKC A;  1CBO A;  4U8O A;  5BUK A;  2Q6U A;  1S3E A;  4AOS A;  2GR0 A;  1B4V A;  3QJ4 A;  1PBF A;  1QJD A;  4H4U A;  3UTH A;  4B63 A;  4U2T A;  3BI5 A;  4YTN A;  4TM0 A;  4C5O A;  1NHQ A;  2X3N A;  2GRT A;  1F6M A;  4IA5 A;  3R9U A;  2XFO A;  3B6D A;  3ABV A;  3T2Z A;  3LB8 A;  4TLZ A;  3FMW A;  4ZCD A;  2JB1 A;  1VQW A;  4GCM A;  2B7S A;  2WOV A;  3QVP A;  1N4V A;  1VG0 A;  2WPE A;  4OPU A;  2X8C A;  2XVI A;  3KLJ A;  4ADW A;  1EL5 A;  3QVR A;  2C3D A;  5KMQ A;  4AP1 A;  4D03 A;  1QO8 A;  4YSX A;  4USR A;  3UKP A;  1F3P A;  1IUS A;  4FX9 A;  3URH A;  3NK0 X;  1K0J A;  2X50 A;  2JK6 A;  1N4U A;  3DJD A;  3T0K A;  4C77 A;  4G6H A;  4YT0 A;  1E1L A;  3G5R A;  2GAH B;  3CN8 A;  3UTE A;  2H89 A;  2GR2 A;  2VVL G;  2JAE A;  1TYT A;  1RYI A;  3UKH A;  1H7W A;  3UP4 A;  3VRB A;  2WU2 A;  4AT2 A;  4I59 A;  4G9K A; 
#chains in the Genus database with same CATH homology
 4EQR A;  3L8K A;  4Z25 A;  4BV6 A;  4GUV A;  3QSE A;  3IWA A;  2R4J A;  1DXL A;  2GAG B;  2WP5 A;  4II3 A;  3HZL A;  4U8J A;  3ZDN A;  4J34 A;  1BWC A;  2ACZ A;  3IHM A;  3NK1 X;  2VZ2 A;  1GRB A;  4Y4L A;  4A99 A;  3AE2 A;  3UKQ A;  2Y6Q A;  4EQS A;  1KNR A;  2CDU A;  1JOA A;  4EMW A;  5KMR A;  2X99 A;  4EIP A;  3V3N A;  3CNJ A;  5JCN A;  2B9W A;  3GYI A;  3QSM A;  4J56 A;  1ZDL A;  5GRT A;  5C2T A;  2C70 A;  2AAQ A;  1D4C A;  3Q6J A;  3VR8 A;  3H8I A;  5ER0 A;  2YG3 A;  2C66 A;  3UKA A;  3EAO A;  1ZX9 A;  3RP8 A;  1PHH A;  4AOX A;  4G73 A;  1F8S A;  4BK1 A;  3Q9T A;  3C96 A;  1E1M A;  2R4E A;  4YKF A;  1B8S A;  3P4R A;  3ICT A;  1TDK A;  2A89 A;  4OPL A;  2BCP A;  1LJ1 A;  1W4X A;  4Y4N A;  3GDP A;  1YY5 A;  2WEU A;  3UKF A;  2BXR A;  2FJE A;  3ICS A;  1OJ9 A;  3KD9 A;  1MXT A;  3P4Q A;  1GRA A;  2PHH A;  2IID A;  4II2 A;  4EQW A;  2CFY A;  1D4D A;  1E1K A;  1CC4 A;  1BGN A;  3FBS A;  4EIQ A;  5KXJ A;  3GRT A;  3AB1 A;  2BS3 A;  3PO7 A;  4RG3 A;  3VRD B;  2Q0K A;  3OZ2 A;  1JNZ A;  1ZMD A;  4APN A;  5JCK A;  2WPF A;  3ATR A;  3QFA A;  4O5Q A;  4TM1 A;  1E6E A;  3SZF A;  4NNJ A;  3SZC A;  2BS2 A;  2GMJ A;  3KA7 A;  1GSN A;  4G6G A;  1Q1W A;  4U8P A;  2FJB A;  3NHO X;  3AE4 A;  3K7M X;  4CY8 A;  5KOW A;  2E5V A;  4FDC B;  1KDG A;  4RSL A;  4Z2U A;  3E1T A;  1K0L A;  2X8H A;  2QCU A;  2CUL A;  1EBD A;  3AYI A;  3K7T A;  3T37 A;  3AE5 A;  3CIR A;  1GEU A;  1EL8 A;  2GMH A;  5J7X A;  3M13 A;  1BKW A;  4C74 A;  2WQY A;  4H4P A;  4CBQ A;  3NKS A;  3QSS A;  1LQU A;  3L1R A;  5U1O A;  4CNK A;  1GRT A;  3ALM A;  5L46 A;  2OA1 A;  5JCI A;  3ICR A;  1M6I A;  1PXB A;  3UOV A;  2OLO A;  4JNA A;  1JNR A;  1H82 A;  1V59 A;  2BRY A;  2GH5 A;  4YTP A;  1KSS A;  1JRY A;  2YAU A;  5HXI A;  5IPY A;  4Y4M A;  4A9W A;  1O94 A;  1L9C A;  1GRF A;  2RGO A;  4GR1 A;  3RP7 A;  2C72 A;  3V3O A;  4TM3 A;  2BXS A;  5DBJ A;  2ARD A;  5FS6 A;  2EQ8 A;  4KX6 A;  2VRL A;  3KPK A;  4OPT A;  4A6N A;  4BUR A;  2TPR A;  4A79 A;  1XAN A;  1GER A;  3T31 A;  1EL7 A;  3C4A A;  3ADA B;  4H4Y A;  1B5Q A;  2V60 A;  3EPT A;  1MOK A;  1PXC A;  2BK4 A;  3ATQ A;  1DOC A;  2H88 A;  1IUW A;  3RP6 A;  1FEC A;  5KOX A;  4Z2T A;  3DK9 A;  1JRX A;  2AQJ A;  2PYX A;  2YLZ A;  1NAA A;  2YVF A;  3NRN A;  1CJ2 A;  2WOW A;  3FG2 P;  4XWR A;  3SQP A;  1AOG A;  1ZP0 A;  4X4J A;  3BNU A;  2BRA A;  3LZW A;  4P9S A;  3I6D A;  1M64 A;  2VQB A;  3B3R A;  1NG4 A;  3CGD A;  4GDE A;  4YKG A;  4YSH A;  2YLX A;  3VRA A;  2C67 A;  1H6V A;  4OPG A;  2YLW A;  3SFD A;  4CRT A;  2YQU A;  1H84 A;  3M0O A;  2VVL A;  2ZZB A;  2FJD A;  3SX6 A;  3AD7 B;  3HYW A;  3DGH A;  3NGC X;  2ZZ0 A;  4C3Y A;  2BAB A;  3COX A;  4U2L A;  1FOH A;  3UOZ A;  5BVA A;  5IQ4 A;  2WOI A;  4J2W A;  5HYM A;  1ELI A;  3CGC A;  3NH3 X;  1GES A;  5CKU A;  1IUU A;  4ICY A;  2Z5Y A;  4IVO B;  2FJA A;  2C73 A;  2YR5 A;  2WDV A;  3ZYX A;  2R9Z A;  1K0I A;  3GD4 A;  1E7P A;  4YXD A;  1N4W A;  3BHF A;  4WCT A;  5U63 A;  2Z5X A;  2V5Z A;  1E1N A;  1F8R A;  3GMB A;  3GMC A;  4H2Q A;  1LPF A;  1GRG A;  3DK4 A;  2VQ7 A;  1H81 A;  2XLT A;  2XFN A;  1O5W A;  3AEG A;  1NDA A;  4OVI A;  4USQ A;  3GDN A;  3UKL A;  4FK1 C;  2BK5 A;  2WPC A;  3GRS A;  1CJC A;  4EM4 A;  1GXF A;  4O5U A;  4Z44 A;  2BCG G;  5J60 A;  4H4S A;  4BK3 A;  2Q7V A;  4LA1 A;  2V3A A;  3HYV A;  3EAN A;  4U8K A;  3CNS A;  1PJ5 A;  4GRT A;  2NVK X;  3LZX A;  3AEB A;  2RGJ A;  1NPX A;  2R45 A;  4UDR A;  4UDQ A;  1COY A;  3NIX A;  2YG5 A;  1L9D A;  1NHS A;  3AED A;  5KVI A;  4J31 A;  4EM3 A;  2VRM A;  3SFE A;  4AT0 A;  1CHU A;  1LV0 A;  3CPJ G;  1CC2 A;  4AP3 A;  2GV8 A;  2AR8 A;  4B65 A;  2BYB A;  2YLT A;  1DJQ A;  3CTY A;  2XLS A;  4YWO A;  2XLU A;  3F8P A;  5KVH A;  5M10 A;  5HY5 A;  5JCM A;  1UKV G;  2HQM A;  5U25 A;  1F8W A;  1YQ4 A;  4JY2 A;  3KVE A;  5EOW A;  4A6N B;  2O9Z A;  1BF3 A;  2GQW A;  2R0P A;  4NEW A;  2V61 A;  2WU5 A;  5KRQ A;  1VRQ B;  2YM2 A;  4D04 A;  2BAC A;  5FS8 A;  3KPF A;  4J33 A;  4BJY A;  4C3X A;  5FMH A;  1RP0 A;  2XFU A;  4H4W A;  2NPX A;  3GYJ A;  3P1W A;  2YG7 A;  2CVJ A;  4HA6 A;  3FPZ A;  3HYX A;  4GAP A;  2UZZ A;  2WET A;  2DKI A;  3AEE A;  3CGB A;  4DSG A;  4UP3 A;  3NLC A;  4YSZ A;  2C76 A;  1PDH A;  2WP6 A;  1DJN A;  2QA1 A;  2WES A;  4NTD A;  1Y56 A;  3AE8 A;  1H7X A;  4K5S A;  4CCQ A;  1Y0P A;  1GND A;  2JBV A;  4EMJ A;  4K5R A;  1DOB A;  3QFB A;  3DJE A;  4H2P A;  3EF6 A;  5IQ1 A;  5M0Z A;  3NNE A;  1H86 A;  2B7R A;  3LAD A;  3SY4 A;  3SXI A;  1SEZ A;  4Z43 A;  5HHF A;  2EQ6 A;  3AE3 A;  2C4C A;  3ISH A;  1IUX A;  1MO9 A;  1TDO A;  4JY3 A;  4NTE A;  4DNA A;  1BZL A;  1ZOV A;  1IJH A;  2C65 A;  2GVC A;  4I58 A;  5EB4 A;  1VG9 A;  1HYU A;  1X31 B;  4U8L A;  3P9U A;  1OJD A;  1O95 A;  2B76 A;  2C64 A;  3PVC A;  2RGH A;  3VR9 A;  3IHG A;  1CJ4 A;  4GDP A;  2BS4 A;  2BC1 A;  1L0V A;  2XCG A;  3RNM A;  2YR4 A;  1CJ3 A;  1FEB A;  4DGK A;  2R0G A;  2V3B A;  1FCD A;  3CPI G;  4N9X A;  4B1B A;  5KMP A;  4EMI A;  3II4 A;  1D7Y A;  2R46 A;  1LVL A;  5BRT A;  2YVG A;  2W0H A;  5LV9 A;  2GEW A;  2XLR A;  2WBA A;  3AD8 B;  1NEK A;  1PBC A;  4X9N A;  1L9E A;  2B9Y A;  3NTA A;  3SZW A;  4B68 A;  4A65 A;  4ZCC A;  4Z26 A;  5KWF A;  3CPH G;  4H4R A;  4H2R A;  5EB5 A;  1K4Q A;  1RSG A;  3CNP A;  4K22 A;  1TDF A;  5FS7 A;  2XFP A;  3G5Q A;  5KNL A;  3IC9 A;  2EQ7 A;  2QAE A;  3NK2 X;  1ZOY A;  4H4Q A;  2EQ9 A;  3AE9 A;  2JB3 A;  2WDQ A;  2C7G A;  2VVM A;  3BHK A;  2XVF A;  3AE7 A;  4GAV A;  1VDC A;  1B37 A;  1NHP A;  4JQ9 A;  5JCL A;  2XDO A;  1ZY8 A;  5C3J A;  1KNP A;  3F8D A;  2IVD A;  4U2S A;  4JNQ A;  3LJP A;  2RAB A;  1JRZ A;  3I3L A;  5BUL A;  3NT6 A;  4NZH A;  3AYL A;  1OJT A;  2YLS A;  4LII A;  3LOV A;  2WS3 A;  1GAL A;  3H4K A;  2XVJ A;  3DJJ A;  4H50 A;  4H7U A;  4OPI A;  2BA9 A;  4U8M A;  3WE0 A;  4H4T A;  4MJW A;  4U8I A;  5KMS A;  1CC6 A;  3JSK A;  3UCL A;  3UOX A;  1IUV A;  2QA2 A;  3GSI A;  1NHR A;  1GRE A;  3NN6 X;  1PBE A;  1Q1R A;  3AD9 B;  4A7A A;  3D1C A;  1GPE A;  4XWZ A;  3K30 A;  3NYC A;  4UDP A;  4B69 A;  1TYP A;  2Q0L A;  3NYE A;  3K7Q X;  3ITJ A;  4FK1 A;  2OLN A;  5TR3 A;  4IA6 A;  1GRH A;  1D4E A;  2GR3 A;  1QLB A;  2J3N A;  1ONF A;  1ZK7 A;  1P2E A;  4K8D A;  1GTE A;  3UTF A;  4IV9 A;  3RHA A;  4G74 A;  4HB9 A;  1Y56 B;  2YM1 A;  3D8X A;  4XXG A;  4ZN0 A;  2YVJ A;  4H4Z A;  4YSY A;  2WDR A;  2BK3 A;  2TMD A;  2APG A;  1PBB A;  3BI2 A;  3DJG X;  1D5T A;  1PXA A;  1PJ6 A;  4NWZ A;  3VQR A;  2GR1 A;  4OCG A;  4BK2 A;  3NN0 X;  3C4N A;  2XVE A;  4M52 A;  3UKK A;  4JDR A;  4NTC A;  3DGZ A;  4REK A;  3OC4 A;  4H4V A;  3AWI A;  3CGE A;  3AXB A;  4TM4 A;  1Z6L A;  3GYX A;  3O0H A;  4B64 A;  2BC0 A;  2Y6R A;  2R0C A;  3UP5 A;  1DNC A;  2ZBW A;  2XVH A;  2ZZC A;  3DA1 A;  4KPR A;  4E0V A;  1LQT A;  1PS9 A;  2YG6 A;  4H4X A;  5EBK A;  4CY6 A;  1GET A;  1ZMC A;  4CCR A;  1XDI A;  2E1M A;  4PAB A;  2VOU A;  3DK8 A;  3PS9 A;  2C75 A;  4X9M A;  3UOY A;  2YWL A;  3V76 A;  1ZKQ A;  3F8R A;  1LTX R;  2YR6 A;  4EQX A;  1CL0 A;  3T2K A;  1TDN A;  3SM8 A;  2X8G A;  1Q9I A;  2OAM A;  4OPC A;  4RG4 A;  2A8X A;  3S61 A;  2B9X A;  3AYJ A;  3AEA A;  2GF3 A;  4GF7 A;  4YTM A;  4J57 A;  2FBW A;  2C3C A;  1GT8 A;  1KF6 A;  1REO A;  1S3B A;  3GWD A;  1NG3 A;  4PAA A;  1GV4 A;  1OJC A;  2DKH A;  3GWF A;  3M12 A;  1DOE A;  1N1P A;  1KFY A;  2F5Z A;  3FIM B;  3KU9 A;  4K7Z A;  3P4S A;  1TRB A;  3P4P A;  3SYI A;  1KSU A;  3S5W A;  4OPD A;  1FEA A;  1PN0 A;  4NEV A;  2GQF A;  1PJ7 A;  2OAL A;  1CF3 A;  1BGJ A;  2I0Z A;  1E39 A;  4K2X A;  1S2Q A;  3KKJ A;  2XFQ A;  3SGL A;  3RED A;  1JEH A;  1TDE A;  4TLX A;  4A5L A;  4BJZ A;  3NTD A;  1GTH A;  4H2N A;  3G5S A;  3BNM A;  1GOS A;  1YKJ A;  4U8N A;  1FL2 A;  3DH9 A;  1PBD A;  1XPQ A;  3CMM A;  3CNT A;  4ECH A;  3AEC A;  1S2Y A;  2V6O A;  2XLP A;  3LXD A;  3SZ0 A;  5CQF A;  2YG4 A;  3AE1 A;  4Z2R A;  5GSN A;  3ALL A;  1NEN A;  5FS9 A;  3AEF A;  3GD3 A;  4B67 A;  1EL9 A;  4CNJ A;  2WP9 A;  3NG7 X;  1YQZ A;  4J36 A;  3ALJ A;  2A87 A;  1D7L A;  2WHD A;  3BI4 A;  3NYF A;  3DME A;  4WX1 A;  3T2Y A;  1OJA A;  3AE6 A;  4B66 A;  1DOD A;  4LU6 A;  4DSH A;  1IUT A;  1H83 A;  2JB2 A;  3H8L A;  1P2H A;  1XHC A;  3IF9 A;  4IVM B;  4Z24 A;  1JU2 A;  3UTG A;  1YQ3 A;  2E4G A;  2IVE A;  4JN9 A;  2XYO A;  3T14 A;  2GB0 A;  3CND A;  2YLR A;  2JKC A;  1CBO A;  4U8O A;  5BUK A;  2Q6U A;  1S3E A;  4AOS A;  2GR0 A;  1B4V A;  3QJ4 A;  1PBF A;  1QJD A;  4H4U A;  3UTH A;  4B63 A;  4U2T A;  3BI5 A;  4YTN A;  4TM0 A;  4C5O A;  1NHQ A;  2X3N A;  2GRT A;  1F6M A;  4IA5 A;  3R9U A;  2XFO A;  3B6D A;  3ABV A;  3T2Z A;  3LB8 A;  4TLZ A;  3FMW A;  4ZCD A;  2JB1 A;  1VQW A;  4GCM A;  2B7S A;  2WOV A;  3QVP A;  1N4V A;  1VG0 A;  2WPE A;  4OPU A;  2X8C A;  2XVI A;  3KLJ A;  4ADW A;  1EL5 A;  3QVR A;  2C3D A;  5KMQ A;  4AP1 A;  4D03 A;  1QO8 A;  4YSX A;  4USR A;  3UKP A;  1F3P A;  1IUS A;  4FX9 A;  3URH A;  3NK0 X;  1K0J A;  2X50 A;  2JK6 A;  1N4U A;  3DJD A;  3T0K A;  4C77 A;  4G6H A;  4YT0 A;  1E1L A;  3G5R A;  2GAH B;  3CN8 A;  3UTE A;  2H89 A;  2GR2 A;  2VVL G;  2JAE A;  1TYT A;  1RYI A;  3UKH A;  1H7W A;  3UP4 A;  3VRB A;  2WU2 A;  4AT2 A;  4I59 A;  4G9K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...