2VQBA

Bacterial flavin-containing monooxygenase in complex with nadp: soaking in aerated solution
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
443
structure length
443
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
total genus 162
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vqbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vqbA02
2ACZA 3AEBA 3AEDA 1GSNA 2A89A 3NGCX 2HQMA 2WOWA 1GRHA 2VQBA 3GRTA 1FL2A 2FJAA 3NG7X 4U8IA 4AP1A 2GR2A 3NIXA 2YVJA 2V60A 2XVEA 2XFUA 1XPQA 3GWFA 2YG4A 1YQZA 1O95A 3AD8B 1ZP0A 1NHQA 4MJWA 1GOSA 4D03A 4GCMA 3UOZA 1O5WA 2OALA 4U2TA 4USRA 4TLXA 3VR9A 2R9ZA 2JK6A 3G5QA 2C70A 3UCLA 2FBWA 1FECA 4GDEA 1N4UA 1V59A 4A5LA 2BCGG 2C7GA 4EMJA 1LV0A 3C4AA 1GREA 3IHMA 4TM4A 5EB4A 1CF3A 2FJEA 3UKPA 3UTGA 1M64A 3EANA 3II4A 2XVFA 3IWAA 1GERA 4IVOB 5TR3A 3EPTA 1TDKA 1GESA 1D7YA 4YXDA 4Y4LA 4GUVA 5JCKA 3UKQA 4EMWA 3KVEA 2YLXA 4FK1A 2VRMA 1PBCA 3PO7A 1PBDA 3DJJA 1E6EA 1OJ9A 3DJDA 3FBSA 3ISHA 3AE9A 3JSKA 1PJ6A 2XFOA 3B3RA 3G5RA 3NT6A 4C74A 4CY6A 4U8JA 1GNDA 1H83A 3QSMA 5CKUA 2QA1A 2XLTA 1GT8A 2FJBA 3CNJA 4UDQA 3CNTA 2TMDA 4LIIA 1NENA 2GMHA 5LV9A 2JB3A 2WETA 1JRYA 2XVJA 3AE7A 3BHFA 1XDIA 2Q7VA 2GMJA 3RNMA 3CNSA 3DK4A 3NYEA 4OPCA 1PXAA 1S2QA 4U8KA 1NAAA 1KSUA 1K0LA 2V3AA 2YR5A 3GRSA 4H4XA 3QSSA 1H6VA 4DGKA 2W0HA 1DOBA 2CDUA 3GD3A 1TDOA 3UKAA 3ALJA 4GR1A 4N9XA 5FMHA 3ICRA 2H89A 1JRXA 4TM1A 2VQ7A 4A65A 4X9MA 4RG4A 3BI5A 4J34A 1GXFA 5J7XA 4O5UA 4ZCDA 3RHAA 2C76A 3PS9A 4YWOA 4H2PA 3I6DA 2YG3A 5HY5A 4OPUA 3DGHA 4I59A 1GEUA 3ATQA 3E1TA 4P9SA 3CNDA 4CRTA 2EQ9A 5U1OA 2RGHA 2BC0A 2VVMA 3SFEA 1NDAA 3EAOA 2YVGA 4YTPA 2IIDA 3NRNA 3LOVA 3AEAA 2AAQA 2WU2A 3AB1A 1PBFA 4J56A 1K0JA 1IUUA 4YTMA 4IA5A 4Z25A 4FDCB 5KVIA 3CPIG 1VDCA 2BXRA 3P4SA 1YQ3A 4A7AA 1OJTA 2GV8A 2C64A 2XFNA 1YY5A 1F8SA 3CN8A 2GVCA 5KWFA 3RP7A 1LQTA 1DNCA 1GRBA 4TLZA 5C2TA 3DK9A 1GRGA 5JCIA 5JCMA 1F6MA 4B69A 2WQYA 4BK3A 1JNRA 2C65A 1IJHA 4AOSA 3P9UA 5BULA 1GRFA 5GSNA 2WDRA 4EIPA 4K22A 2WDVA 4X9NA 2JAEA 2ARDA 3QJ4A 5IPYA 3DH9A 4APNA 2R46A 2E1MA 1L9DA 4H2RA 1N1PA 1YKJA 3K7MX 4UP3A 1PHHA 1H7WA 4J31A 4YSZA 3IF9A 4WX1A 3S5WA 3VRBA 4HB9A 3UKFA 4UDPA 1COYA 3NN0X 4M52A 4Z44A 2X8CA 2X3NA 3QFAA 3VRAA 4Z2RA 1O94A 1S2YA 1EL8A 1ZMCA 2VRLA 4AT0A 5BVAA 2X50A 1ZKQA 2XFQA 3AE8A 4Z26A 4PABA 1KFYA 1ZOYA 4KX6A 3NTAA 5KXJA 1IUVA 3P4PA 2JB1A 2YG5A 3SGLA 1H86A 1H81A 2C3CA 2DKHA 3ICTA 3ZDNA 3FIMB 1TDEA 5BRTA 2C73A 1F8RA 4Z24A 2WPCA 2BABA 1NHSA 1LVLA 4U8LA 2E4GA 4YSHA 4H4YA 4H4QA 1ZY8A 2WU5A 3SFDA 1KF6A 3ALLA 1PN0A 1X31B 1REOA 2Q0LA 4H4RA 4YT0A 4H4ZA 3KA7A 3AE4A 3M13A 2Z5YA 4DSGA 1ZDLA 3GD4A 1OJCA 1FEBA 2WS3A 3AEFA 3GMBA 1GRAA 2YM2A 2C72A 3CPJG 1CC4A 1RSGA 1TDFA 3F8PA 2Q6UA 5CQFA 3KD9A 2IVDA 3BI2A 4BK1A 4EM3A 4A99A 2BK3A 2B9WA 2XYOA 4YKGA 2XLSA 4BURA 3OC4A 4BJYA 1JRZA 2YQUA 3G5SA 3UKLA 3ZYXA 2RABA 4OPTA 5KRQA 4EQWA 1PBBA 1S3EA 2BA9A 2XFPA 5EOWA 2OLOA 1CJCA 2YLWA 3CGDA 4KPRA 4EM4A 2O9ZA 3REDA 2A87A 2WOVA 4H4VA 3T37A 2Z5XA 3UP5A 1Y56B 2ZZBA 2PYXA 1CC6A 2QCUA 4OVIA 1IUSA 1P2EA 3AE3A 4J57A 4GRTA 4JDRA 3GWDA 2X8GA 2XCGA 3ABVA 4H4UA 4C5OA 1GTHA 2WDQA 2R0CA 1CC2A 4JY3A 1Q9IA 2V6OA 3V76A 1TRBA 4J2WA 4JY2A 4X4JA 4ADWA 2BS3A 1NEKA 4U2SA 2Y6QA 3QSEA 2BYBA 3QVRA 1Q1WA 4A6NB 3V3NA 1ZK7A 1CL0A 4OPGA 2DKIA 3AEGA 2I0ZA 2B76A 1GTEA 4CNJA 3LXDA 5ER0A 3VRDB 3UKKA 3AECA 4OCGA 1D4DA 1EL9A 1ZOVA 4REKA 3DK8A 1D5TA 3LB8A 1PS9A 3NTDA 4LA1A 4C3YA 2JBVA 2AQJA 3DMEA 5HXIA 4GDPA 3P4RA 3L8KA 2BACA 2GQWA 1ELIA 1Y0PA 5BUKA 3SM8A 4USQA 4IA6A 2EQ8A 2A8XA 4A9WA 3K7TA 1NHRA 2BK5A 4ZCCA 1FEAA 1B8SA 1DODA 2BK4A 2YG7A 4A6NA 1DXLA 3DA1A 2J3NA 3PVCA 5IQ1A 2GF3A 1M6IA 4NTDA 5U63A 2ZBWA 3CTYA 3AYIA 4JQ9A 4CCQA 5U25A 2R45A 4CBQA 4C3XA 3UP4A 2C66A 1GV4A 4H2QA 4K8DA 4U2LA 2VVLG 4EMIA 1XHCA 3BHKA 2XLPA 3LZWA 4TM0A 1PXCA 1F3PA 4IVMB 1GRTA 4FX9A 5C3JA 4ECHA 2WP6A 3D8XA 2CFYA 2WESA 2WHDA 2PHHA 3NYFA 2F5ZA 1DOCA 3DGZA 4NZHA 4A79A 1E1KA 2RGJA 3AXBA 3P1WA 4H50A 1JNZA 1KNPA 1Y56A 5L46A 5FS7A 2WOIA 5DBJA 4H2NA 4H4TA 2Q0KA 4RG3A 5GRTA 2YM1A 4K5SA 1LTXR 1JEHA 1IUWA 3CPHG 1BF3A 1N4VA 2GH5A 3CGCA 3H4KA 4B64A 1QO8A 2GAHB 1E1NA 2B9XA 3B6DA 2C67A 2OAMA 2RGOA 3NNEA 1DOEA 3EF6A 1DJQA 3AE1A 4Z43A 1KDGA 3KLJA 1L9CA 2EQ6A 1CJ3A 5EB5A 3VR8A 2NVKX 3ATRA 4LU6A 3ALMA 2GB0A 1JOAA 3KKJA 3NYCA 3UKHA 1PBEA 2OLNA 4EQSA 1B37A 2CULA 5M0ZA 4Z2TA 3NK1X 1LPFA 1RP0A 2BC1A 3ITJA 3AE5A 3O0HA 4J33A 2XLRA 1K4QA 4PAAA 4RSLA 3GSIA 4YKFA 3RP6A 2C75A 2XDOA 4H4PA 2V5ZA 5JCLA 2CVJA 4JNQA 3NK0X 4FK1C 2YG6A 1L9EA 4AP3A 2E5VA 5FS9A 4XXGA 2V3BA 3URHA 3GDNA 3LADA 2YAUA 4B68A 1B4VA 1CJ4A 4Y4NA 1FOHA 1D7LA 3GMCA 1PDHA 3ICSA 4OPIA 1OJAA 3BNUA 3CGBA 2BXSA 4J36A 2R4EA 1EBDA 3FMWA 1B5QA 2WP5A 2IVEA 3K7QX 4CCRA 1ZX9A 2JKCA 4CNKA 2VVLA 3CGEA 4HA6A 1E1LA 4YSXA 2H88A 1NHPA 4UDRA 1VG0A 3UOXA 3P4QA 1GETA 3AE2A 1AOGA 2WEUA 5J60A 3M0OA 3HZLA 3L1RA 1PJ7A 3NKSA 4K7ZA 3S61A 1GPEA 2B9YA 4EQRA 2GAGB 1HYUA 1H82A 1NG4A 1PJ5A 1MO9A 4IV9A 3I3LA 1CJ2A 2BCPA 3UOVA 2R0PA 4GF7A 4H7UA 1FCDA 4DNAA 1F8WA 1CHUA 2ZZ0A 1TDNA 3FG2P 4BK2A 3NLCA 1PXBA 1BKWA 2WPEA 5HYMA 1NPXA 2YLSA 2YR4A 4BJZA 1UKVG 1ZMDA 2OA1A 1LJ1A 2GQFA 5KOXA 3ADAB 2XLUA 3DJEA 2WBAA 4XWZA 1RYIA 2JB2A 4CY8A 4OPDA 4B67A 5FS8A 2APGA 1IUTA 1LQUA 4TM3A 4U8OA 4I58A 4NTCA 3NN6X 2YVFA 3COXA 1H84A 1QJDA 4U8PA 1GALA 1MXTA 2VOUA 1KNRA 3NHOX 3BNMA 4C77A 2GEWA 3AYJA 4YTNA 4B1BA 3QVPA 3RP8A 3F8RA 3SQPA 3Q9TA 2YLRA 1BZLA 1D4EA 2GR1A 2BS2A 2QAEA 3LJPA 2VZ2A 2B7RA 3GYIA 2QA2A 3M12A 3VQRA 2GRTA 1QLBA 3AYLA 3QFBA 1E7PA 5KVHA 2XVIA 1TYTA 3OZ2A 2X99A 3IHGA 5KOWA 1BWCA 4EQXA 4D04A 1BGJA 1MOKA 1YQ4A 1VRQB 4K5RA 1N4WA 1K0IA 4U8NA 3GDPA 4U8MA 1IUXA 4NEWA 2R4JA 2V61A 1VG9A 1BGNA 3H8LA 3DJGX 1P2HA 5FS6A 4O5QA 2YWLA 2ZZCA 4ICYA 2XVHA 3FPZA 1Z6LA 3UTHA 2WPFA 3CNPA 4DSHA 3UTEA 3AD7B 3H8IA 2WP9A 3AD9B 1S3BA 4K2XA 3AWIA 3R9UA 2GR3A 3F8DA 1NG3A 3UOYA 4YSYA 1E1MA 1SEZA 2GR0A 4AOXA 1TYPA 4EIQA 4Z2UA 3NK2X 4JNAA 1L0VA 1KSSA 3Q6JA 3AE6A 3BI4A 3GYJA 4BV6A 1D4CA 1EL7A 2YR6A 2FJDA 2TPRA 1H7XA 2X8HA 2YLZA 2AR8A 1E39A 4Y4MA 4B65A 3LZXA 4AT2A 2BS4A 1EL5A 3AEEA 3V3OA 3NH3X 2R0GA 3C96A 3CIRA 5IQ4A 2NPXA 4JN9A 2YLTA 4H4SA 4OPLA 5M10A 4H4WA 3K30A 1XANA 1OJDA 1Q1RA 3KU9A 4XWRA 1CBOA 1DJNA 3KPFA 4B66A 5JCNA 4WCTA 3D1CA 1VQWA 4NTEA 1ONFA 5EBKA 3WE0A 4ZN0A 1W4XA 2C3DA 2UZZA 2B7SA 2Y6RA 3IC9A 3C4NA 4B63A 2EQ7A 1JU2A 4E0VA 4NEVA 5HHFA 3UTFA
chains in the Genus database with same CATH superfamily
2ACZA 3AEBA 3AEDA 1GSNA 2A89A 3NGCX 2HQMA 2WOWA 1GRHA 2VQBA 3GRTA 1FL2A 2FJAA 3NG7X 4U8IA 4AP1A 2GR2A 3NIXA 2YVJA 2V60A 2XVEA 2XFUA 1XPQA 3GWFA 2YG4A 1YQZA 1O95A 3AD8B 1ZP0A 1NHQA 4MJWA 1GOSA 4D03A 4GCMA 3UOZA 1O5WA 2OALA 4U2TA 4USRA 4TLXA 3VR9A 2R9ZA 2JK6A 3G5QA 2C70A 3UCLA 2FBWA 1FECA 4GDEA 1N4UA 1V59A 4A5LA 2BCGG 2C7GA 4EMJA 1LV0A 3C4AA 4G9KA 1GREA 3IHMA 4NNJA 4TM4A 5EB4A 1CF3A 2FJEA 3UKPA 3UTGA 1M64A 3EANA 3II4A 2XVFA 3IWAA 1GERA 4IVOB 5TR3A 3EPTA 1TDKA 1GESA 1D7YA 3HYVA 4YXDA 4Y4LA 4GUVA 5JCKA 3UKQA 4EMWA 3KVEA 2YLXA 4FK1A 2VRMA 1PBCA 3PO7A 1PBDA 3DJJA 1E6EA 1OJ9A 3DJDA 3FBSA 3ISHA 3AE9A 3JSKA 1PJ6A 2XFOA 3B3RA 3G5RA 3NT6A 3T14A 4C74A 4CY6A 4U8JA 1GNDA 1H83A 3QSMA 5CKUA 2QA1A 2XLTA 1GT8A 2FJBA 3CNJA 4UDQA 3CNTA 2TMDA 4G6GA 4LIIA 1NENA 2GMHA 5LV9A 2JB3A 2WETA 1JRYA 2XVJA 3AE7A 3BHFA 1XDIA 2Q7VA 2GMJA 3RNMA 3CNSA 3DK4A 3NYEA 4OPCA 1PXAA 1S2QA 4U8KA 1NAAA 1KSUA 1K0LA 2V3AA 2YR5A 3GRSA 4H4XA 3QSSA 1H6VA 4DGKA 2W0HA 1DOBA 4NWZA 2CDUA 3GD3A 1TDOA 3UKAA 3ALJA 4GR1A 4N9XA 5FMHA 3ICRA 2H89A 1JRXA 4TM1A 2VQ7A 4A65A 4X9MA 4RG4A 3BI5A 4J34A 1GXFA 5J7XA 4O5UA 4ZCDA 3RHAA 2C76A 3PS9A 4YWOA 4H2PA 3I6DA 2YG3A 5HY5A 4OPUA 3DGHA 4I59A 1GEUA 3ATQA 3E1TA 4P9SA 3CNDA 4CRTA 2EQ9A 5U1OA 2RGHA 2BC0A 2VVMA 3SFEA 1NDAA 3EAOA 2YVGA 4G73A 4YTPA 2IIDA 5KMQA 3NRNA 3LOVA 3AEAA 2AAQA 2WU2A 3AB1A 1PBFA 4J56A 1K0JA 1IUUA 4YTMA 4IA5A 4Z25A 4FDCB 5KVIA 3CPIG 1VDCA 2BXRA 3P4SA 1YQ3A 4A7AA 1OJTA 2GV8A 2C64A 2XFNA 1YY5A 1F8SA 3CN8A 3SYIA 2GVCA 5KWFA 3RP7A 1LQTA 1DNCA 1GRBA 4TLZA 5C2TA 3DK9A 1GRGA 5JCIA 3T2KA 1F6MA 5JCMA 4B69A 2WQYA 4BK3A 1JNRA 2C65A 1IJHA 4AOSA 3P9UA 5BULA 1GRFA 4II3A 5GSNA 2WDRA 4EIPA 4K22A 2WDVA 4X9NA 2JAEA 2ARDA 3QJ4A 5IPYA 3DH9A 4APNA 2R46A 2E1MA 1L9DA 4H2RA 1N1PA 1YKJA 3K7MX 4UP3A 1PHHA 1H7WA 4J31A 4YSZA 3IF9A 4WX1A 3S5WA 3VRBA 4HB9A 3UKFA 4UDPA 1COYA 3NN0X 4M52A 4Z44A 2X8CA 2X3NA 3QFAA 3VRAA 4Z2RA 1O94A 1S2YA 1EL8A 1ZMCA 2VRLA 4AT0A 5BVAA 2X50A 1ZKQA 2XFQA 3AE8A 4Z26A 4PABA 1KFYA 1ZOYA 4KX6A 3NTAA 5KXJA 1IUVA 3P4PA 2JB1A 2YG5A 3SGLA 1H86A 1H81A 2C3CA 2DKHA 3ICTA 3ZDNA 3FIMB 1TDEA 5BRTA 2C73A 1F8RA 4Z24A 2WPCA 2BABA 1NHSA 1LVLA 4U8LA 2E4GA 4YSHA 4H4YA 4H4QA 1ZY8A 2WU5A 3SFDA 1KF6A 3ALLA 1PN0A 1X31B 1REOA 2Q0LA 4H4RA 4YT0A 4H4ZA 3KA7A 3AE4A 3M13A 2Z5YA 4DSGA 1ZDLA 3GD4A 1OJCA 1FEBA 2WS3A 3AEFA 3GMBA 1GRAA 2YM2A 2C72A 3CPJG 1CC4A 1RSGA 1TDFA 3F8PA 2Q6UA 5CQFA 3KD9A 2IVDA 3BI2A 4BK1A 4EM3A 4A99A 2BK3A 2B9WA 2XYOA 4YKGA 2XLSA 4BURA 3OC4A 4BJYA 1JRZA 2YQUA 3G5SA 3UKLA 3ZYXA 2RABA 4OPTA 3SZFA 5KRQA 4EQWA 1PBBA 1S3EA 2BA9A 2XFPA 5EOWA 2OLOA 1CJCA 2YLWA 3CGDA 4KPRA 4EM4A 5KMSA 2O9ZA 3REDA 3SY4A 2A87A 2WOVA 4H4VA 3T37A 2Z5XA 3UP5A 1Y56B 2ZZBA 2PYXA 1CC6A 2QCUA 4OVIA 1IUSA 1P2EA 3AE3A 4J57A 4GRTA 3T2ZA 4JDRA 3GWDA 2X8GA 2XCGA 3ABVA 4H4UA 4C5OA 1GTHA 2WDQA 2R0CA 1CC2A 4JY3A 1Q9IA 2V6OA 3V76A 5KMPA 1TRBA 4J2WA 4JY2A 4X4JA 4ADWA 2BS3A 1NEKA 4U2SA 2Y6QA 3QSEA 2BYBA 3QVRA 1Q1WA 4A6NB 3V3NA 1ZK7A 1CL0A 4OPGA 2DKIA 3AEGA 2I0ZA 2B76A 1GTEA 4CNJA 3LXDA 5ER0A 3VRDB 3UKKA 3AECA 4OCGA 1D4DA 1EL9A 1ZOVA 4REKA 3DK8A 1D5TA 3LB8A 1PS9A 3NTDA 4LA1A 4C3YA 2JBVA 2AQJA 3DMEA 5HXIA 4GDPA 3P4RA 3L8KA 2BACA 2GQWA 1ELIA 1Y0PA 3CMMA 5BUKA 3SM8A 4USQA 4IA6A 2EQ8A 2A8XA 3KPKA 3K7TA 4A9WA 1NHRA 2BK5A 4ZCCA 1FEAA 1B8SA 1DODA 2BK4A 2YG7A 4A6NA 1DXLA 3DA1A 2J3NA 3PVCA 5IQ1A 2GF3A 1M6IA 4NTDA 5U63A 2ZBWA 3CTYA 3AYIA 4JQ9A 4CCQA 5U25A 2R45A 3GYXA 4CBQA 4C3XA 3UP4A 2C66A 1GV4A 4H2QA 4K8DA 4U2LA 5KMRA 2VVLG 4EMIA 1XHCA 3BHKA 2XLPA 3LZWA 4TM0A 1PXCA 1F3PA 4IVMB 1GRTA 4FX9A 5C3JA 4ECHA 2WP6A 3D8XA 2CFYA 2WESA 2WHDA 2PHHA 3NYFA 2F5ZA 1DOCA 3DGZA 4NZHA 4A79A 1E1KA 2RGJA 3AXBA 3P1WA 4H50A 1JNZA 1KNPA 1Y56A 5L46A 5FS7A 2WOIA 5DBJA 4H2NA 4H4TA 2Q0KA 4RG3A 5GRTA 2YM1A 4K5SA 1LTXR 1JEHA 1IUWA 3CPHG 1BF3A 1N4VA 2GH5A 3CGCA 3H4KA 4B64A 1QO8A 2GAHB 1E1NA 2B9XA 3B6DA 2C67A 2OAMA 2RGOA 3NNEA 1DOEA 3EF6A 1DJQA 3AE1A 3SZ0A 1KDGA 3KLJA 4Z43A 1L9CA 2EQ6A 1CJ3A 5EB5A 3VR8A 2NVKX 3ATRA 4LU6A 3ALMA 2GB0A 1JOAA 3KKJA 3NYCA 3UKHA 1PBEA 2OLNA 4EQSA 1B37A 2CULA 5M0ZA 4Z2TA 3NK1X 1LPFA 1RP0A 2BC1A 3ITJA 3AE5A 3O0HA 4J33A 2XLRA 1K4QA 4PAAA 4RSLA 3SXIA 3GSIA 4YKFA 3RP6A 2C75A 2XDOA 4H4PA 2V5ZA 5JCLA 3T31A 2CVJA 4JNQA 2BRYA 3NK0X 4FK1C 2YG6A 1L9EA 4AP3A 2E5VA 5FS9A 4XXGA 2V3BA 3URHA 3GDNA 3LADA 2YAUA 4B68A 1B4VA 1CJ4A 4Y4NA 1FOHA 1D7LA 3GMCA 1PDHA 3ICSA 4OPIA 1OJAA 3BNUA 3CGBA 2BXSA 4J36A 2R4EA 1EBDA 3FMWA 1B5QA 2WP5A 2IVEA 3K7QX 4CCRA 1ZX9A 2JKCA 4CNKA 2VVLA 3CGEA 4HA6A 1E1LA 4YSXA 4G74A 2H88A 1NHPA 4UDRA 1VG0A 3UOXA 3P4QA 3HYXA 1GETA 3AE2A 1AOGA 2WEUA 5J60A 3M0OA 3HZLA 3L1RA 1PJ7A 3NKSA 4K7ZA 3S61A 1GPEA 2B9YA 4GAPA 4EQRA 2GAGB 1HYUA 1H82A 1NG4A 1PJ5A 1MO9A 4IV9A 3I3LA 1CJ2A 2BCPA 3UOVA 2R0PA 4GF7A 4H7UA 1FCDA 4DNAA 1F8WA 1CHUA 2ZZ0A 1TDNA 3FG2P 4BK2A 3NLCA 1PXBA 1BKWA 2WPEA 5HYMA 1NPXA 2YLSA 2YR4A 4BJZA 1UKVG 1ZMDA 2OA1A 1LJ1A 2GQFA 3T0KA 3ADAB 5KOXA 2XLUA 3DJEA 2WBAA 4XWZA 1RYIA 2JB2A 4CY8A 4OPDA 4B67A 5FS8A 4GAVA 2APGA 3SZWA 1IUTA 1LQUA 4TM3A 4U8OA 4I58A 4NTCA 3NN6X 2YVFA 3COXA 1H84A 1QJDA 4U8PA 1GALA 1MXTA 2VOUA 1KNRA 3NHOX 3BNMA 4C77A 2GEWA 3AYJA 4YTNA 4B1BA 3QVPA 3RP8A 5KNLA 3F8RA 3SQPA 3Q9TA 3SZCA 2YLRA 1BZLA 1D4EA 2GR1A 2BS2A 2QAEA 3LJPA 2VZ2A 3HYWA 2B7RA 3GYIA 2QA2A 3M12A 3VQRA 2GRTA 1QLBA 3AYLA 3QFBA 1E7PA 5KVHA 2XVIA 1TYTA 3OZ2A 2X99A 3IHGA 4G6HA 5KOWA 1BWCA 4EQXA 4D04A 1BGJA 1MOKA 1YQ4A 1VRQB 4K5RA 1N4WA 1K0IA 4U8NA 3GDPA 4U8MA 1IUXA 4NEWA 2R4JA 2V61A 1VG9A 1BGNA 2BRAA 3DJGX 3H8LA 1P2HA 5FS6A 4O5QA 2YWLA 2ZZCA 4ICYA 2XVHA 3FPZA 1Z6LA 3UTHA 2WPFA 3CNPA 4DSHA 4II2A 3UTEA 3AD7B 3H8IA 2WP9A 3AD9B 1S3BA 4K2XA 3AWIA 3R9UA 2GR3A 3F8DA 1NG3A 3UOYA 4YSYA 3SX6A 1E1MA 1SEZA 2GR0A 4AOXA 1TYPA 4EIQA 4Z2UA 3NK2X 4JNAA 1L0VA 1KSSA 3Q6JA 3AE6A 3BI4A 3GYJA 4BV6A 1D4CA 1EL7A 2YR6A 2FJDA 2TPRA 1H7XA 2C4CA 2X8HA 2AR8A 2YLZA 1E39A 4Y4MA 4B65A 3LZXA 4AT2A 2BS4A 1EL5A 3AEEA 3V3OA 3NH3X 2R0GA 3C96A 3CIRA 5IQ4A 2NPXA 4JN9A 2YLTA 4H4SA 4OPLA 5M10A 4H4WA 3K30A 1XANA 1OJDA 1Q1RA 3KU9A 4XWRA 1CBOA 1DJNA 3KPFA 4B66A 5JCNA 4WCTA 3D1CA 1VQWA 4NTEA 1ONFA 5EBKA 3WE0A 4ZN0A 1W4XA 2C3DA 2UZZA 2B7SA 2Y6RA 3IC9A 3T2YA 3C4NA 4B63A 2EQ7A 1JU2A 4E0VA 4NEVA 5HHFA 3UTFA
chains in the Genus database with same CATH topology
2ACZA 3AEBA 3AEDA 1GSNA 2A89A 3NGCX 2HQMA 2WOWA 1GRHA 2VQBA 3GRTA 1FL2A 2FJAA 3NG7X 4U8IA 4AP1A 2GR2A 3NIXA 2YVJA 2V60A 2XVEA 2XFUA 1XPQA 3GWFA 2YG4A 1YQZA 1O95A 3AD8B 1ZP0A 1NHQA 4MJWA 1GOSA 4D03A 4GCMA 3UOZA 1O5WA 2OALA 4U2TA 4USRA 4TLXA 3VR9A 2R9ZA 2JK6A 3G5QA 2C70A 3UCLA 2FBWA 1FECA 4GDEA 1N4UA 1V59A 4A5LA 2BCGG 2C7GA 4EMJA 1LV0A 3C4AA 4G9KA 1GREA 3IHMA 4NNJA 4TM4A 5EB4A 1CF3A 2FJEA 3UKPA 3UTGA 1M64A 3EANA 3II4A 2XVFA 3IWAA 1GERA 4IVOB 5TR3A 3EPTA 1TDKA 1GESA 1D7YA 3HYVA 4YXDA 4Y4LA 4GUVA 5JCKA 3UKQA 4EMWA 3KVEA 2YLXA 4FK1A 2VRMA 1PBCA 3PO7A 1PBDA 3DJJA 1E6EA 1OJ9A 3DJDA 3FBSA 3ISHA 3AE9A 3JSKA 1PJ6A 2XFOA 3B3RA 3G5RA 3NT6A 3T14A 4C74A 4CY6A 4U8JA 1GNDA 1H83A 3QSMA 5CKUA 2QA1A 2XLTA 1GT8A 2FJBA 3CNJA 4UDQA 3CNTA 2TMDA 4G6GA 4LIIA 1NENA 2GMHA 5LV9A 2JB3A 2WETA 1JRYA 2XVJA 3AE7A 3BHFA 1XDIA 2Q7VA 2GMJA 3RNMA 3CNSA 3DK4A 3NYEA 4OPCA 1PXAA 1S2QA 4U8KA 1NAAA 1KSUA 1K0LA 2V3AA 2YR5A 3GRSA 4H4XA 3QSSA 1H6VA 4DGKA 2W0HA 1DOBA 4NWZA 2CDUA 3GD3A 1TDOA 3UKAA 3ALJA 4GR1A 4N9XA 5FMHA 3ICRA 2H89A 1JRXA 4TM1A 2VQ7A 4A65A 4X9MA 4RG4A 3BI5A 4J34A 1GXFA 5J7XA 4O5UA 4ZCDA 3RHAA 2C76A 3PS9A 4YWOA 4H2PA 3I6DA 2YG3A 5HY5A 4OPUA 3DGHA 4I59A 1GEUA 3ATQA 3E1TA 4P9SA 3CNDA 4CRTA 2EQ9A 5U1OA 2RGHA 2BC0A 2VVMA 3SFEA 1NDAA 3EAOA 2YVGA 4G73A 4YTPA 2IIDA 5KMQA 3NRNA 3LOVA 3AEAA 2AAQA 2WU2A 3AB1A 1PBFA 4J56A 1K0JA 1IUUA 4YTMA 4IA5A 4Z25A 4FDCB 5KVIA 3CPIG 1VDCA 2BXRA 3P4SA 1YQ3A 4A7AA 1OJTA 2GV8A 2C64A 2XFNA 1YY5A 1F8SA 3CN8A 3SYIA 2GVCA 5KWFA 3RP7A 1LQTA 1DNCA 1GRBA 4TLZA 5C2TA 3DK9A 1GRGA 5JCIA 3T2KA 1F6MA 5JCMA 4B69A 2WQYA 4BK3A 1JNRA 2C65A 1IJHA 4AOSA 3P9UA 5BULA 1GRFA 4II3A 5GSNA 2WDRA 4EIPA 4K22A 2WDVA 4X9NA 2JAEA 2ARDA 3QJ4A 5IPYA 3DH9A 4APNA 2R46A 2E1MA 1L9DA 4H2RA 1N1PA 1YKJA 3K7MX 4UP3A 1PHHA 1H7WA 4J31A 4YSZA 3IF9A 4WX1A 3S5WA 3VRBA 4HB9A 3UKFA 4UDPA 1COYA 3NN0X 4M52A 4Z44A 2X8CA 2X3NA 3QFAA 3VRAA 4Z2RA 1O94A 1S2YA 1EL8A 1ZMCA 2VRLA 4AT0A 5BVAA 2X50A 1ZKQA 2XFQA 3AE8A 4Z26A 4PABA 1KFYA 1ZOYA 4KX6A 3NTAA 5KXJA 1IUVA 3P4PA 2JB1A 2YG5A 3SGLA 1H86A 1H81A 2C3CA 2DKHA 3ICTA 3ZDNA 3FIMB 1TDEA 5BRTA 2C73A 1F8RA 4Z24A 2WPCA 2BABA 1NHSA 1LVLA 4U8LA 2E4GA 4YSHA 4H4YA 4H4QA 1ZY8A 2WU5A 3SFDA 1KF6A 3ALLA 1PN0A 1X31B 1REOA 2Q0LA 4H4RA 4YT0A 4H4ZA 3KA7A 3AE4A 3M13A 2Z5YA 4DSGA 1ZDLA 3GD4A 1OJCA 1FEBA 2WS3A 3AEFA 3GMBA 1GRAA 2YM2A 2C72A 3CPJG 1CC4A 1RSGA 1TDFA 3F8PA 2Q6UA 5CQFA 3KD9A 2IVDA 3BI2A 4BK1A 4EM3A 4A99A 2BK3A 2B9WA 2XYOA 4YKGA 2XLSA 4BURA 3OC4A 4BJYA 1JRZA 2YQUA 3G5SA 3UKLA 3ZYXA 2RABA 4OPTA 3SZFA 5KRQA 4EQWA 1PBBA 1S3EA 2BA9A 2XFPA 5EOWA 2OLOA 1CJCA 2YLWA 3CGDA 4KPRA 4EM4A 5KMSA 2O9ZA 3REDA 3SY4A 2A87A 2WOVA 4H4VA 3T37A 2Z5XA 3UP5A 1Y56B 2ZZBA 2PYXA 1CC6A 2QCUA 4OVIA 1IUSA 1P2EA 3AE3A 4J57A 4GRTA 3T2ZA 4JDRA 3GWDA 2X8GA 2XCGA 3ABVA 4H4UA 4C5OA 1GTHA 2WDQA 2R0CA 1CC2A 4JY3A 1Q9IA 2V6OA 3V76A 5KMPA 1TRBA 4J2WA 4JY2A 4X4JA 4ADWA 2BS3A 1NEKA 4U2SA 2Y6QA 3QSEA 2BYBA 3QVRA 1Q1WA 4A6NB 3V3NA 1ZK7A 1CL0A 4OPGA 2DKIA 3AEGA 2I0ZA 2B76A 1GTEA 4CNJA 3LXDA 5ER0A 3VRDB 3UKKA 3AECA 4OCGA 1D4DA 1EL9A 1ZOVA 4REKA 3DK8A 1D5TA 3LB8A 1PS9A 3NTDA 4LA1A 4C3YA 2JBVA 2AQJA 3DMEA 5HXIA 4GDPA 3P4RA 3L8KA 2BACA 2GQWA 1ELIA 1Y0PA 3CMMA 5BUKA 3SM8A 4USQA 4IA6A 2EQ8A 2A8XA 3KPKA 3K7TA 4A9WA 1NHRA 2BK5A 4ZCCA 1FEAA 1B8SA 1DODA 2BK4A 2YG7A 4A6NA 1DXLA 3DA1A 2J3NA 3PVCA 5IQ1A 2GF3A 1M6IA 4NTDA 5U63A 2ZBWA 3CTYA 3AYIA 4JQ9A 4CCQA 5U25A 2R45A 3GYXA 4CBQA 4C3XA 3UP4A 2C66A 1GV4A 4H2QA 4K8DA 4U2LA 5KMRA 2VVLG 4EMIA 1XHCA 3BHKA 2XLPA 3LZWA 4TM0A 1PXCA 1F3PA 4IVMB 1GRTA 4FX9A 5C3JA 4ECHA 2WP6A 3D8XA 2CFYA 2WESA 2WHDA 2PHHA 3NYFA 2F5ZA 1DOCA 3DGZA 4NZHA 4A79A 1E1KA 2RGJA 3AXBA 3P1WA 4H50A 1JNZA 1KNPA 1Y56A 5L46A 5FS7A 2WOIA 5DBJA 4H2NA 4H4TA 2Q0KA 4RG3A 5GRTA 2YM1A 4K5SA 1LTXR 1JEHA 1IUWA 3CPHG 1BF3A 1N4VA 2GH5A 3CGCA 3H4KA 4B64A 1QO8A 2GAHB 1E1NA 2B9XA 3B6DA 2C67A 2OAMA 2RGOA 3NNEA 1DOEA 3EF6A 1DJQA 3AE1A 3SZ0A 1KDGA 3KLJA 4Z43A 1L9CA 2EQ6A 1CJ3A 5EB5A 3VR8A 2NVKX 3ATRA 4LU6A 3ALMA 2GB0A 1JOAA 3KKJA 3NYCA 3UKHA 1PBEA 2OLNA 4EQSA 1B37A 2CULA 5M0ZA 4Z2TA 3NK1X 1LPFA 1RP0A 2BC1A 3ITJA 3AE5A 3O0HA 4J33A 2XLRA 1K4QA 4PAAA 4RSLA 3SXIA 3GSIA 4YKFA 3RP6A 2C75A 2XDOA 4H4PA 2V5ZA 5JCLA 3T31A 2CVJA 4JNQA 2BRYA 3NK0X 4FK1C 2YG6A 1L9EA 4AP3A 2E5VA 5FS9A 4XXGA 2V3BA 3URHA 3GDNA 3LADA 2YAUA 4B68A 1B4VA 1CJ4A 4Y4NA 1FOHA 1D7LA 3GMCA 1PDHA 3ICSA 4OPIA 1OJAA 3BNUA 3CGBA 2BXSA 4J36A 2R4EA 1EBDA 3FMWA 1B5QA 2WP5A 2IVEA 3K7QX 4CCRA 1ZX9A 2JKCA 4CNKA 2VVLA 3CGEA 4HA6A 1E1LA 4YSXA 4G74A 2H88A 1NHPA 4UDRA 1VG0A 3UOXA 3P4QA 3HYXA 1GETA 3AE2A 1AOGA 2WEUA 5J60A 3M0OA 3HZLA 3L1RA 1PJ7A 3NKSA 4K7ZA 3S61A 1GPEA 2B9YA 4GAPA 4EQRA 2GAGB 1HYUA 1H82A 1NG4A 1PJ5A 1MO9A 4IV9A 3I3LA 1CJ2A 2BCPA 3UOVA 2R0PA 4GF7A 4H7UA 1FCDA 4DNAA 1F8WA 1CHUA 2ZZ0A 1TDNA 3FG2P 4BK2A 3NLCA 1PXBA 1BKWA 2WPEA 5HYMA 1NPXA 2YLSA 2YR4A 4BJZA 1UKVG 1ZMDA 2OA1A 1LJ1A 2GQFA 3T0KA 3ADAB 5KOXA 2XLUA 3DJEA 2WBAA 4XWZA 1RYIA 2JB2A 4CY8A 4OPDA 4B67A 5FS8A 4GAVA 2APGA 3SZWA 1IUTA 1LQUA 4TM3A 4U8OA 4I58A 4NTCA 3NN6X 2YVFA 3COXA 1H84A 1QJDA 4U8PA 1GALA 1MXTA 2VOUA 1KNRA 3NHOX 3BNMA 4C77A 2GEWA 3AYJA 4YTNA 4B1BA 3QVPA 3RP8A 5KNLA 3F8RA 3SQPA 3Q9TA 3SZCA 2YLRA 1BZLA 1D4EA 2GR1A 2BS2A 2QAEA 3LJPA 2VZ2A 3HYWA 2B7RA 3GYIA 2QA2A 3M12A 3VQRA 2GRTA 1QLBA 3AYLA 3QFBA 1E7PA 5KVHA 2XVIA 1TYTA 3OZ2A 2X99A 3IHGA 4G6HA 5KOWA 1BWCA 4EQXA 4D04A 1BGJA 1MOKA 1YQ4A 1VRQB 4K5RA 1N4WA 1K0IA 4U8NA 3GDPA 4U8MA 1IUXA 4NEWA 2R4JA 2V61A 1VG9A 1BGNA 2BRAA 3DJGX 3H8LA 1P2HA 5FS6A 4O5QA 2YWLA 2ZZCA 4ICYA 2XVHA 3FPZA 1Z6LA 3UTHA 2WPFA 3CNPA 4DSHA 4II2A 3UTEA 3AD7B 3H8IA 2WP9A 3AD9B 1S3BA 4K2XA 3AWIA 3R9UA 2GR3A 3F8DA 1NG3A 3UOYA 4YSYA 3SX6A 1E1MA 1SEZA 2GR0A 4AOXA 1TYPA 4EIQA 4Z2UA 3NK2X 4JNAA 1L0VA 1KSSA 3Q6JA 3AE6A 3BI4A 3GYJA 4BV6A 1D4CA 1EL7A 2YR6A 2FJDA 2TPRA 1H7XA 2C4CA 2X8HA 2AR8A 2YLZA 1E39A 4Y4MA 4B65A 3LZXA 4AT2A 2BS4A 1EL5A 3AEEA 3V3OA 3NH3X 2R0GA 3C96A 3CIRA 5IQ4A 2NPXA 4JN9A 2YLTA 4H4SA 4OPLA 5M10A 4H4WA 3K30A 1XANA 1OJDA 1Q1RA 3KU9A 4XWRA 1CBOA 1DJNA 3KPFA 4B66A 5JCNA 4WCTA 3D1CA 1VQWA 4NTEA 1ONFA 5EBKA 3WE0A 4ZN0A 1W4XA 2C3DA 2UZZA 2B7SA 2Y6RA 3IC9A 3T2YA 3C4NA 4B63A 2EQ7A 1JU2A 4E0VA 4NEVA 5HHFA 3UTFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ACZ A;  3AEB A;  3AED A;  1GSN A;  2A89 A;  3NGC X;  2HQM A;  2WOW A;  1GRH A;  2VQB A;  3GRT A;  1FL2 A;  2FJA A;  3NG7 X;  4U8I A;  4AP1 A;  2GR2 A;  3NIX A;  2YVJ A;  2V60 A;  2XVE A;  2XFU A;  1XPQ A;  3GWF A;  2YG4 A;  1YQZ A;  1O95 A;  3AD8 B;  1ZP0 A;  1NHQ A;  4MJW A;  1GOS A;  4D03 A;  4GCM A;  3UOZ A;  1O5W A;  2OAL A;  4U2T A;  4USR A;  4TLX A;  3VR9 A;  2R9Z A;  2JK6 A;  3G5Q A;  2C70 A;  3UCL A;  2FBW A;  1FEC A;  4GDE A;  1N4U A;  1V59 A;  4A5L A;  2BCG G;  2C7G A;  4EMJ A;  1LV0 A;  3C4A A;  1GRE A;  3IHM A;  4TM4 A;  5EB4 A;  1CF3 A;  2FJE A;  3UKP A;  3UTG A;  1M64 A;  3EAN A;  3II4 A;  2XVF A;  3IWA A;  1GER A;  4IVO B;  5TR3 A;  3EPT A;  1TDK A;  1GES A;  1D7Y A;  4YXD A;  4Y4L A;  4GUV A;  5JCK A;  3UKQ A;  4EMW A;  3KVE A;  2YLX A;  4FK1 A;  2VRM A;  1PBC A;  3PO7 A;  1PBD A;  3DJJ A;  1E6E A;  1OJ9 A;  3DJD A;  3FBS A;  3ISH A;  3AE9 A;  3JSK A;  1PJ6 A;  2XFO A;  3B3R A;  3G5R A;  3NT6 A;  4C74 A;  4CY6 A;  4U8J A;  1GND A;  1H83 A;  3QSM A;  5CKU A;  2QA1 A;  2XLT A;  1GT8 A;  2FJB A;  3CNJ A;  4UDQ A;  3CNT A;  2TMD A;  4LII A;  1NEN A;  2GMH A;  5LV9 A;  2JB3 A;  2WET A;  1JRY A;  2XVJ A;  3AE7 A;  3BHF A;  1XDI A;  2Q7V A;  2GMJ A;  3RNM A;  3CNS A;  3DK4 A;  3NYE A;  4OPC A;  1PXA A;  1S2Q A;  4U8K A;  1NAA A;  1KSU A;  1K0L A;  2V3A A;  2YR5 A;  3GRS A;  4H4X A;  3QSS A;  1H6V A;  4DGK A;  2W0H A;  1DOB A;  2CDU A;  3GD3 A;  1TDO A;  3UKA A;  3ALJ A;  4GR1 A;  4N9X A;  5FMH A;  3ICR A;  2H89 A;  1JRX A;  4TM1 A;  2VQ7 A;  4A65 A;  4X9M A;  4RG4 A;  3BI5 A;  4J34 A;  1GXF A;  5J7X A;  4O5U A;  4ZCD A;  3RHA A;  2C76 A;  3PS9 A;  4YWO A;  4H2P A;  3I6D A;  2YG3 A;  5HY5 A;  4OPU A;  3DGH A;  4I59 A;  1GEU A;  3ATQ A;  3E1T A;  4P9S A;  3CND A;  4CRT A;  2EQ9 A;  5U1O A;  2RGH A;  2BC0 A;  2VVM A;  3SFE A;  1NDA A;  3EAO A;  2YVG A;  4YTP A;  2IID A;  3NRN A;  3LOV A;  3AEA A;  2AAQ A;  2WU2 A;  3AB1 A;  1PBF A;  4J56 A;  1K0J A;  1IUU A;  4YTM A;  4IA5 A;  4Z25 A;  4FDC B;  5KVI A;  3CPI G;  1VDC A;  2BXR A;  3P4S A;  1YQ3 A;  4A7A A;  1OJT A;  2GV8 A;  2C64 A;  2XFN A;  1YY5 A;  1F8S A;  3CN8 A;  2GVC A;  5KWF A;  3RP7 A;  1LQT A;  1DNC A;  1GRB A;  4TLZ A;  5C2T A;  3DK9 A;  1GRG A;  5JCI A;  5JCM A;  1F6M A;  4B69 A;  2WQY A;  4BK3 A;  1JNR A;  2C65 A;  1IJH A;  4AOS A;  3P9U A;  5BUL A;  1GRF A;  5GSN A;  2WDR A;  4EIP A;  4K22 A;  2WDV A;  4X9N A;  2JAE A;  2ARD A;  3QJ4 A;  5IPY A;  3DH9 A;  4APN A;  2R46 A;  2E1M A;  1L9D A;  4H2R A;  1N1P A;  1YKJ A;  3K7M X;  4UP3 A;  1PHH A;  1H7W A;  4J31 A;  4YSZ A;  3IF9 A;  4WX1 A;  3S5W A;  3VRB A;  4HB9 A;  3UKF A;  4UDP A;  1COY A;  3NN0 X;  4M52 A;  4Z44 A;  2X8C A;  2X3N A;  3QFA A;  3VRA A;  4Z2R A;  1O94 A;  1S2Y A;  1EL8 A;  1ZMC A;  2VRL A;  4AT0 A;  5BVA A;  2X50 A;  1ZKQ A;  2XFQ A;  3AE8 A;  4Z26 A;  4PAB A;  1KFY A;  1ZOY A;  4KX6 A;  3NTA A;  5KXJ A;  1IUV A;  3P4P A;  2JB1 A;  2YG5 A;  3SGL A;  1H86 A;  1H81 A;  2C3C A;  2DKH A;  3ICT A;  3ZDN A;  3FIM B;  1TDE A;  5BRT A;  2C73 A;  1F8R A;  4Z24 A;  2WPC A;  2BAB A;  1NHS A;  1LVL A;  4U8L A;  2E4G A;  4YSH A;  4H4Y A;  4H4Q A;  1ZY8 A;  2WU5 A;  3SFD A;  1KF6 A;  3ALL A;  1PN0 A;  1X31 B;  1REO A;  2Q0L A;  4H4R A;  4YT0 A;  4H4Z A;  3KA7 A;  3AE4 A;  3M13 A;  2Z5Y A;  4DSG A;  1ZDL A;  3GD4 A;  1OJC A;  1FEB A;  2WS3 A;  3AEF A;  3GMB A;  1GRA A;  2YM2 A;  2C72 A;  3CPJ G;  1CC4 A;  1RSG A;  1TDF A;  3F8P A;  2Q6U A;  5CQF A;  3KD9 A;  2IVD A;  3BI2 A;  4BK1 A;  4EM3 A;  4A99 A;  2BK3 A;  2B9W A;  2XYO A;  4YKG A;  2XLS A;  4BUR A;  3OC4 A;  4BJY A;  1JRZ A;  2YQU A;  3G5S A;  3UKL A;  3ZYX A;  2RAB A;  4OPT A;  5KRQ A;  4EQW A;  1PBB A;  1S3E A;  2BA9 A;  2XFP A;  5EOW A;  2OLO A;  1CJC A;  2YLW A;  3CGD A;  4KPR A;  4EM4 A;  2O9Z A;  3RED A;  2A87 A;  2WOV A;  4H4V A;  3T37 A;  2Z5X A;  3UP5 A;  1Y56 B;  2ZZB A;  2PYX A;  1CC6 A;  2QCU A;  4OVI A;  1IUS A;  1P2E A;  3AE3 A;  4J57 A;  4GRT A;  4JDR A;  3GWD A;  2X8G A;  2XCG A;  3ABV A;  4H4U A;  4C5O A;  1GTH A;  2WDQ A;  2R0C A;  1CC2 A;  4JY3 A;  1Q9I A;  2V6O A;  3V76 A;  1TRB A;  4J2W A;  4JY2 A;  4X4J A;  4ADW A;  2BS3 A;  1NEK A;  4U2S A;  2Y6Q A;  3QSE A;  2BYB A;  3QVR A;  1Q1W A;  4A6N B;  3V3N A;  1ZK7 A;  1CL0 A;  4OPG A;  2DKI A;  3AEG A;  2I0Z A;  2B76 A;  1GTE A;  4CNJ A;  3LXD A;  5ER0 A;  3VRD B;  3UKK A;  3AEC A;  4OCG A;  1D4D A;  1EL9 A;  1ZOV A;  4REK A;  3DK8 A;  1D5T A;  3LB8 A;  1PS9 A;  3NTD A;  4LA1 A;  4C3Y A;  2JBV A;  2AQJ A;  3DME A;  5HXI A;  4GDP A;  3P4R A;  3L8K A;  2BAC A;  2GQW A;  1ELI A;  1Y0P A;  5BUK A;  3SM8 A;  4USQ A;  4IA6 A;  2EQ8 A;  2A8X A;  4A9W A;  3K7T A;  1NHR A;  2BK5 A;  4ZCC A;  1FEA A;  1B8S A;  1DOD A;  2BK4 A;  2YG7 A;  4A6N A;  1DXL A;  3DA1 A;  2J3N A;  3PVC A;  5IQ1 A;  2GF3 A;  1M6I A;  4NTD A;  5U63 A;  2ZBW A;  3CTY A;  3AYI A;  4JQ9 A;  4CCQ A;  5U25 A;  2R45 A;  4CBQ A;  4C3X A;  3UP4 A;  2C66 A;  1GV4 A;  4H2Q A;  4K8D A;  4U2L A;  2VVL G;  4EMI A;  1XHC A;  3BHK A;  2XLP A;  3LZW A;  4TM0 A;  1PXC A;  1F3P A;  4IVM B;  1GRT A;  4FX9 A;  5C3J A;  4ECH A;  2WP6 A;  3D8X A;  2CFY A;  2WES A;  2WHD A;  2PHH A;  3NYF A;  2F5Z A;  1DOC A;  3DGZ A;  4NZH A;  4A79 A;  1E1K A;  2RGJ A;  3AXB A;  3P1W A;  4H50 A;  1JNZ A;  1KNP A;  1Y56 A;  5L46 A;  5FS7 A;  2WOI A;  5DBJ A;  4H2N A;  4H4T A;  2Q0K A;  4RG3 A;  5GRT A;  2YM1 A;  4K5S A;  1LTX R;  1JEH A;  1IUW A;  3CPH G;  1BF3 A;  1N4V A;  2GH5 A;  3CGC A;  3H4K A;  4B64 A;  1QO8 A;  2GAH B;  1E1N A;  2B9X A;  3B6D A;  2C67 A;  2OAM A;  2RGO A;  3NNE A;  1DOE A;  3EF6 A;  1DJQ A;  3AE1 A;  4Z43 A;  1KDG A;  3KLJ A;  1L9C A;  2EQ6 A;  1CJ3 A;  5EB5 A;  3VR8 A;  2NVK X;  3ATR A;  4LU6 A;  3ALM A;  2GB0 A;  1JOA A;  3KKJ A;  3NYC A;  3UKH A;  1PBE A;  2OLN A;  4EQS A;  1B37 A;  2CUL A;  5M0Z A;  4Z2T A;  3NK1 X;  1LPF A;  1RP0 A;  2BC1 A;  3ITJ A;  3AE5 A;  3O0H A;  4J33 A;  2XLR A;  1K4Q A;  4PAA A;  4RSL A;  3GSI A;  4YKF A;  3RP6 A;  2C75 A;  2XDO A;  4H4P A;  2V5Z A;  5JCL A;  2CVJ A;  4JNQ A;  3NK0 X;  4FK1 C;  2YG6 A;  1L9E A;  4AP3 A;  2E5V A;  5FS9 A;  4XXG A;  2V3B A;  3URH A;  3GDN A;  3LAD A;  2YAU A;  4B68 A;  1B4V A;  1CJ4 A;  4Y4N A;  1FOH A;  1D7L A;  3GMC A;  1PDH A;  3ICS A;  4OPI A;  1OJA A;  3BNU A;  3CGB A;  2BXS A;  4J36 A;  2R4E A;  1EBD A;  3FMW A;  1B5Q A;  2WP5 A;  2IVE A;  3K7Q X;  4CCR A;  1ZX9 A;  2JKC A;  4CNK A;  2VVL A;  3CGE A;  4HA6 A;  1E1L A;  4YSX A;  2H88 A;  1NHP A;  4UDR A;  1VG0 A;  3UOX A;  3P4Q A;  1GET A;  3AE2 A;  1AOG A;  2WEU A;  5J60 A;  3M0O A;  3HZL A;  3L1R A;  1PJ7 A;  3NKS A;  4K7Z A;  3S61 A;  1GPE A;  2B9Y A;  4EQR A;  2GAG B;  1HYU A;  1H82 A;  1NG4 A;  1PJ5 A;  1MO9 A;  4IV9 A;  3I3L A;  1CJ2 A;  2BCP A;  3UOV A;  2R0P A;  4GF7 A;  4H7U A;  1FCD A;  4DNA A;  1F8W A;  1CHU A;  2ZZ0 A;  1TDN A;  3FG2 P;  4BK2 A;  3NLC A;  1PXB A;  1BKW A;  2WPE A;  5HYM A;  1NPX A;  2YLS A;  2YR4 A;  4BJZ A;  1UKV G;  1ZMD A;  2OA1 A;  1LJ1 A;  2GQF A;  5KOX A;  3ADA B;  2XLU A;  3DJE A;  2WBA A;  4XWZ A;  1RYI A;  2JB2 A;  4CY8 A;  4OPD A;  4B67 A;  5FS8 A;  2APG A;  1IUT A;  1LQU A;  4TM3 A;  4U8O A;  4I58 A;  4NTC A;  3NN6 X;  2YVF A;  3COX A;  1H84 A;  1QJD A;  4U8P A;  1GAL A;  1MXT A;  2VOU A;  1KNR A;  3NHO X;  3BNM A;  4C77 A;  2GEW A;  3AYJ A;  4YTN A;  4B1B A;  3QVP A;  3RP8 A;  3F8R A;  3SQP A;  3Q9T A;  2YLR A;  1BZL A;  1D4E A;  2GR1 A;  2BS2 A;  2QAE A;  3LJP A;  2VZ2 A;  2B7R A;  3GYI A;  2QA2 A;  3M12 A;  3VQR A;  2GRT A;  1QLB A;  3AYL A;  3QFB A;  1E7P A;  5KVH A;  2XVI A;  1TYT A;  3OZ2 A;  2X99 A;  3IHG A;  5KOW A;  1BWC A;  4EQX A;  4D04 A;  1BGJ A;  1MOK A;  1YQ4 A;  1VRQ B;  4K5R A;  1N4W A;  1K0I A;  4U8N A;  3GDP A;  4U8M A;  1IUX A;  4NEW A;  2R4J A;  2V61 A;  1VG9 A;  1BGN A;  3H8L A;  3DJG X;  1P2H A;  5FS6 A;  4O5Q A;  2YWL A;  2ZZC A;  4ICY A;  2XVH A;  3FPZ A;  1Z6L A;  3UTH A;  2WPF A;  3CNP A;  4DSH A;  3UTE A;  3AD7 B;  3H8I A;  2WP9 A;  3AD9 B;  1S3B A;  4K2X A;  3AWI A;  3R9U A;  2GR3 A;  3F8D A;  1NG3 A;  3UOY A;  4YSY A;  1E1M A;  1SEZ A;  2GR0 A;  4AOX A;  1TYP A;  4EIQ A;  4Z2U A;  3NK2 X;  4JNA A;  1L0V A;  1KSS A;  3Q6J A;  3AE6 A;  3BI4 A;  3GYJ A;  4BV6 A;  1D4C A;  1EL7 A;  2YR6 A;  2FJD A;  2TPR A;  1H7X A;  2X8H A;  2YLZ A;  2AR8 A;  1E39 A;  4Y4M A;  4B65 A;  3LZX A;  4AT2 A;  2BS4 A;  1EL5 A;  3AEE A;  3V3O A;  3NH3 X;  2R0G A;  3C96 A;  3CIR A;  5IQ4 A;  2NPX A;  4JN9 A;  2YLT A;  4H4S A;  4OPL A;  5M10 A;  4H4W A;  3K30 A;  1XAN A;  1OJD A;  1Q1R A;  3KU9 A;  4XWR A;  1CBO A;  1DJN A;  3KPF A;  4B66 A;  5JCN A;  4WCT A;  3D1C A;  1VQW A;  4NTE A;  1ONF A;  5EBK A;  3WE0 A;  4ZN0 A;  1W4X A;  2C3D A;  2UZZ A;  2B7S A;  2Y6R A;  3IC9 A;  3C4N A;  4B63 A;  2EQ7 A;  1JU2 A;  4E0V A;  4NEV A;  5HHF A;  3UTF A; 
#chains in the Genus database with same CATH topology
 2ACZ A;  3AEB A;  3AED A;  1GSN A;  2A89 A;  3NGC X;  2HQM A;  2WOW A;  1GRH A;  2VQB A;  3GRT A;  1FL2 A;  2FJA A;  3NG7 X;  4U8I A;  4AP1 A;  2GR2 A;  3NIX A;  2YVJ A;  2V60 A;  2XVE A;  2XFU A;  1XPQ A;  3GWF A;  2YG4 A;  1YQZ A;  1O95 A;  3AD8 B;  1ZP0 A;  1NHQ A;  4MJW A;  1GOS A;  4D03 A;  4GCM A;  3UOZ A;  1O5W A;  2OAL A;  4U2T A;  4USR A;  4TLX A;  3VR9 A;  2R9Z A;  2JK6 A;  3G5Q A;  2C70 A;  3UCL A;  2FBW A;  1FEC A;  4GDE A;  1N4U A;  1V59 A;  4A5L A;  2BCG G;  2C7G A;  4EMJ A;  1LV0 A;  3C4A A;  4G9K A;  1GRE A;  3IHM A;  4NNJ A;  4TM4 A;  5EB4 A;  1CF3 A;  2FJE A;  3UKP A;  3UTG A;  1M64 A;  3EAN A;  3II4 A;  2XVF A;  3IWA A;  1GER A;  4IVO B;  5TR3 A;  3EPT A;  1TDK A;  1GES A;  1D7Y A;  3HYV A;  4YXD A;  4Y4L A;  4GUV A;  5JCK A;  3UKQ A;  4EMW A;  3KVE A;  2YLX A;  4FK1 A;  2VRM A;  1PBC A;  3PO7 A;  1PBD A;  3DJJ A;  1E6E A;  1OJ9 A;  3DJD A;  3FBS A;  3ISH A;  3AE9 A;  3JSK A;  1PJ6 A;  2XFO A;  3B3R A;  3G5R A;  3NT6 A;  3T14 A;  4C74 A;  4CY6 A;  4U8J A;  1GND A;  1H83 A;  3QSM A;  5CKU A;  2QA1 A;  2XLT A;  1GT8 A;  2FJB A;  3CNJ A;  4UDQ A;  3CNT A;  2TMD A;  4G6G A;  4LII A;  1NEN A;  2GMH A;  5LV9 A;  2JB3 A;  2WET A;  1JRY A;  2XVJ A;  3AE7 A;  3BHF A;  1XDI A;  2Q7V A;  2GMJ A;  3RNM A;  3CNS A;  3DK4 A;  3NYE A;  4OPC A;  1PXA A;  1S2Q A;  4U8K A;  1NAA A;  1KSU A;  1K0L A;  2V3A A;  2YR5 A;  3GRS A;  4H4X A;  3QSS A;  1H6V A;  4DGK A;  2W0H A;  1DOB A;  4NWZ A;  2CDU A;  3GD3 A;  1TDO A;  3UKA A;  3ALJ A;  4GR1 A;  4N9X A;  5FMH A;  3ICR A;  2H89 A;  1JRX A;  4TM1 A;  2VQ7 A;  4A65 A;  4X9M A;  4RG4 A;  3BI5 A;  4J34 A;  1GXF A;  5J7X A;  4O5U A;  4ZCD A;  3RHA A;  2C76 A;  3PS9 A;  4YWO A;  4H2P A;  3I6D A;  2YG3 A;  5HY5 A;  4OPU A;  3DGH A;  4I59 A;  1GEU A;  3ATQ A;  3E1T A;  4P9S A;  3CND A;  4CRT A;  2EQ9 A;  5U1O A;  2RGH A;  2BC0 A;  2VVM A;  3SFE A;  1NDA A;  3EAO A;  2YVG A;  4G73 A;  4YTP A;  2IID A;  5KMQ A;  3NRN A;  3LOV A;  3AEA A;  2AAQ A;  2WU2 A;  3AB1 A;  1PBF A;  4J56 A;  1K0J A;  1IUU A;  4YTM A;  4IA5 A;  4Z25 A;  4FDC B;  5KVI A;  3CPI G;  1VDC A;  2BXR A;  3P4S A;  1YQ3 A;  4A7A A;  1OJT A;  2GV8 A;  2C64 A;  2XFN A;  1YY5 A;  1F8S A;  3CN8 A;  3SYI A;  2GVC A;  5KWF A;  3RP7 A;  1LQT A;  1DNC A;  1GRB A;  4TLZ A;  5C2T A;  3DK9 A;  1GRG A;  5JCI A;  3T2K A;  1F6M A;  5JCM A;  4B69 A;  2WQY A;  4BK3 A;  1JNR A;  2C65 A;  1IJH A;  4AOS A;  3P9U A;  5BUL A;  1GRF A;  4II3 A;  5GSN A;  2WDR A;  4EIP A;  4K22 A;  2WDV A;  4X9N A;  2JAE A;  2ARD A;  3QJ4 A;  5IPY A;  3DH9 A;  4APN A;  2R46 A;  2E1M A;  1L9D A;  4H2R A;  1N1P A;  1YKJ A;  3K7M X;  4UP3 A;  1PHH A;  1H7W A;  4J31 A;  4YSZ A;  3IF9 A;  4WX1 A;  3S5W A;  3VRB A;  4HB9 A;  3UKF A;  4UDP A;  1COY A;  3NN0 X;  4M52 A;  4Z44 A;  2X8C A;  2X3N A;  3QFA A;  3VRA A;  4Z2R A;  1O94 A;  1S2Y A;  1EL8 A;  1ZMC A;  2VRL A;  4AT0 A;  5BVA A;  2X50 A;  1ZKQ A;  2XFQ A;  3AE8 A;  4Z26 A;  4PAB A;  1KFY A;  1ZOY A;  4KX6 A;  3NTA A;  5KXJ A;  1IUV A;  3P4P A;  2JB1 A;  2YG5 A;  3SGL A;  1H86 A;  1H81 A;  2C3C A;  2DKH A;  3ICT A;  3ZDN A;  3FIM B;  1TDE A;  5BRT A;  2C73 A;  1F8R A;  4Z24 A;  2WPC A;  2BAB A;  1NHS A;  1LVL A;  4U8L A;  2E4G A;  4YSH A;  4H4Y A;  4H4Q A;  1ZY8 A;  2WU5 A;  3SFD A;  1KF6 A;  3ALL A;  1PN0 A;  1X31 B;  1REO A;  2Q0L A;  4H4R A;  4YT0 A;  4H4Z A;  3KA7 A;  3AE4 A;  3M13 A;  2Z5Y A;  4DSG A;  1ZDL A;  3GD4 A;  1OJC A;  1FEB A;  2WS3 A;  3AEF A;  3GMB A;  1GRA A;  2YM2 A;  2C72 A;  3CPJ G;  1CC4 A;  1RSG A;  1TDF A;  3F8P A;  2Q6U A;  5CQF A;  3KD9 A;  2IVD A;  3BI2 A;  4BK1 A;  4EM3 A;  4A99 A;  2BK3 A;  2B9W A;  2XYO A;  4YKG A;  2XLS A;  4BUR A;  3OC4 A;  4BJY A;  1JRZ A;  2YQU A;  3G5S A;  3UKL A;  3ZYX A;  2RAB A;  4OPT A;  3SZF A;  5KRQ A;  4EQW A;  1PBB A;  1S3E A;  2BA9 A;  2XFP A;  5EOW A;  2OLO A;  1CJC A;  2YLW A;  3CGD A;  4KPR A;  4EM4 A;  5KMS A;  2O9Z A;  3RED A;  3SY4 A;  2A87 A;  2WOV A;  4H4V A;  3T37 A;  2Z5X A;  3UP5 A;  1Y56 B;  2ZZB A;  2PYX A;  1CC6 A;  2QCU A;  4OVI A;  1IUS A;  1P2E A;  3AE3 A;  4J57 A;  4GRT A;  3T2Z A;  4JDR A;  3GWD A;  2X8G A;  2XCG A;  3ABV A;  4H4U A;  4C5O A;  1GTH A;  2WDQ A;  2R0C A;  1CC2 A;  4JY3 A;  1Q9I A;  2V6O A;  3V76 A;  5KMP A;  1TRB A;  4J2W A;  4JY2 A;  4X4J A;  4ADW A;  2BS3 A;  1NEK A;  4U2S A;  2Y6Q A;  3QSE A;  2BYB A;  3QVR A;  1Q1W A;  4A6N B;  3V3N A;  1ZK7 A;  1CL0 A;  4OPG A;  2DKI A;  3AEG A;  2I0Z A;  2B76 A;  1GTE A;  4CNJ A;  3LXD A;  5ER0 A;  3VRD B;  3UKK A;  3AEC A;  4OCG A;  1D4D A;  1EL9 A;  1ZOV A;  4REK A;  3DK8 A;  1D5T A;  3LB8 A;  1PS9 A;  3NTD A;  4LA1 A;  4C3Y A;  2JBV A;  2AQJ A;  3DME A;  5HXI A;  4GDP A;  3P4R A;  3L8K A;  2BAC A;  2GQW A;  1ELI A;  1Y0P A;  3CMM A;  5BUK A;  3SM8 A;  4USQ A;  4IA6 A;  2EQ8 A;  2A8X A;  3KPK A;  3K7T A;  4A9W A;  1NHR A;  2BK5 A;  4ZCC A;  1FEA A;  1B8S A;  1DOD A;  2BK4 A;  2YG7 A;  4A6N A;  1DXL A;  3DA1 A;  2J3N A;  3PVC A;  5IQ1 A;  2GF3 A;  1M6I A;  4NTD A;  5U63 A;  2ZBW A;  3CTY A;  3AYI A;  4JQ9 A;  4CCQ A;  5U25 A;  2R45 A;  3GYX A;  4CBQ A;  4C3X A;  3UP4 A;  2C66 A;  1GV4 A;  4H2Q A;  4K8D A;  4U2L A;  5KMR A;  2VVL G;  4EMI A;  1XHC A;  3BHK A;  2XLP A;  3LZW A;  4TM0 A;  1PXC A;  1F3P A;  4IVM B;  1GRT A;  4FX9 A;  5C3J A;  4ECH A;  2WP6 A;  3D8X A;  2CFY A;  2WES A;  2WHD A;  2PHH A;  3NYF A;  2F5Z A;  1DOC A;  3DGZ A;  4NZH A;  4A79 A;  1E1K A;  2RGJ A;  3AXB A;  3P1W A;  4H50 A;  1JNZ A;  1KNP A;  1Y56 A;  5L46 A;  5FS7 A;  2WOI A;  5DBJ A;  4H2N A;  4H4T A;  2Q0K A;  4RG3 A;  5GRT A;  2YM1 A;  4K5S A;  1LTX R;  1JEH A;  1IUW A;  3CPH G;  1BF3 A;  1N4V A;  2GH5 A;  3CGC A;  3H4K A;  4B64 A;  1QO8 A;  2GAH B;  1E1N A;  2B9X A;  3B6D A;  2C67 A;  2OAM A;  2RGO A;  3NNE A;  1DOE A;  3EF6 A;  1DJQ A;  3AE1 A;  3SZ0 A;  1KDG A;  3KLJ A;  4Z43 A;  1L9C A;  2EQ6 A;  1CJ3 A;  5EB5 A;  3VR8 A;  2NVK X;  3ATR A;  4LU6 A;  3ALM A;  2GB0 A;  1JOA A;  3KKJ A;  3NYC A;  3UKH A;  1PBE A;  2OLN A;  4EQS A;  1B37 A;  2CUL A;  5M0Z A;  4Z2T A;  3NK1 X;  1LPF A;  1RP0 A;  2BC1 A;  3ITJ A;  3AE5 A;  3O0H A;  4J33 A;  2XLR A;  1K4Q A;  4PAA A;  4RSL A;  3SXI A;  3GSI A;  4YKF A;  3RP6 A;  2C75 A;  2XDO A;  4H4P A;  2V5Z A;  5JCL A;  3T31 A;  2CVJ A;  4JNQ A;  2BRY A;  3NK0 X;  4FK1 C;  2YG6 A;  1L9E A;  4AP3 A;  2E5V A;  5FS9 A;  4XXG A;  2V3B A;  3URH A;  3GDN A;  3LAD A;  2YAU A;  4B68 A;  1B4V A;  1CJ4 A;  4Y4N A;  1FOH A;  1D7L A;  3GMC A;  1PDH A;  3ICS A;  4OPI A;  1OJA A;  3BNU A;  3CGB A;  2BXS A;  4J36 A;  2R4E A;  1EBD A;  3FMW A;  1B5Q A;  2WP5 A;  2IVE A;  3K7Q X;  4CCR A;  1ZX9 A;  2JKC A;  4CNK A;  2VVL A;  3CGE A;  4HA6 A;  1E1L A;  4YSX A;  4G74 A;  2H88 A;  1NHP A;  4UDR A;  1VG0 A;  3UOX A;  3P4Q A;  3HYX A;  1GET A;  3AE2 A;  1AOG A;  2WEU A;  5J60 A;  3M0O A;  3HZL A;  3L1R A;  1PJ7 A;  3NKS A;  4K7Z A;  3S61 A;  1GPE A;  2B9Y A;  4GAP A;  4EQR A;  2GAG B;  1HYU A;  1H82 A;  1NG4 A;  1PJ5 A;  1MO9 A;  4IV9 A;  3I3L A;  1CJ2 A;  2BCP A;  3UOV A;  2R0P A;  4GF7 A;  4H7U A;  1FCD A;  4DNA A;  1F8W A;  1CHU A;  2ZZ0 A;  1TDN A;  3FG2 P;  4BK2 A;  3NLC A;  1PXB A;  1BKW A;  2WPE A;  5HYM A;  1NPX A;  2YLS A;  2YR4 A;  4BJZ A;  1UKV G;  1ZMD A;  2OA1 A;  1LJ1 A;  2GQF A;  3T0K A;  3ADA B;  5KOX A;  2XLU A;  3DJE A;  2WBA A;  4XWZ A;  1RYI A;  2JB2 A;  4CY8 A;  4OPD A;  4B67 A;  5FS8 A;  4GAV A;  2APG A;  3SZW A;  1IUT A;  1LQU A;  4TM3 A;  4U8O A;  4I58 A;  4NTC A;  3NN6 X;  2YVF A;  3COX A;  1H84 A;  1QJD A;  4U8P A;  1GAL A;  1MXT A;  2VOU A;  1KNR A;  3NHO X;  3BNM A;  4C77 A;  2GEW A;  3AYJ A;  4YTN A;  4B1B A;  3QVP A;  3RP8 A;  5KNL A;  3F8R A;  3SQP A;  3Q9T A;  3SZC A;  2YLR A;  1BZL A;  1D4E A;  2GR1 A;  2BS2 A;  2QAE A;  3LJP A;  2VZ2 A;  3HYW A;  2B7R A;  3GYI A;  2QA2 A;  3M12 A;  3VQR A;  2GRT A;  1QLB A;  3AYL A;  3QFB A;  1E7P A;  5KVH A;  2XVI A;  1TYT A;  3OZ2 A;  2X99 A;  3IHG A;  4G6H A;  5KOW A;  1BWC A;  4EQX A;  4D04 A;  1BGJ A;  1MOK A;  1YQ4 A;  1VRQ B;  4K5R A;  1N4W A;  1K0I A;  4U8N A;  3GDP A;  4U8M A;  1IUX A;  4NEW A;  2R4J A;  2V61 A;  1VG9 A;  1BGN A;  2BRA A;  3DJG X;  3H8L A;  1P2H A;  5FS6 A;  4O5Q A;  2YWL A;  2ZZC A;  4ICY A;  2XVH A;  3FPZ A;  1Z6L A;  3UTH A;  2WPF A;  3CNP A;  4DSH A;  4II2 A;  3UTE A;  3AD7 B;  3H8I A;  2WP9 A;  3AD9 B;  1S3B A;  4K2X A;  3AWI A;  3R9U A;  2GR3 A;  3F8D A;  1NG3 A;  3UOY A;  4YSY A;  3SX6 A;  1E1M A;  1SEZ A;  2GR0 A;  4AOX A;  1TYP A;  4EIQ A;  4Z2U A;  3NK2 X;  4JNA A;  1L0V A;  1KSS A;  3Q6J A;  3AE6 A;  3BI4 A;  3GYJ A;  4BV6 A;  1D4C A;  1EL7 A;  2YR6 A;  2FJD A;  2TPR A;  1H7X A;  2C4C A;  2X8H A;  2AR8 A;  2YLZ A;  1E39 A;  4Y4M A;  4B65 A;  3LZX A;  4AT2 A;  2BS4 A;  1EL5 A;  3AEE A;  3V3O A;  3NH3 X;  2R0G A;  3C96 A;  3CIR A;  5IQ4 A;  2NPX A;  4JN9 A;  2YLT A;  4H4S A;  4OPL A;  5M10 A;  4H4W A;  3K30 A;  1XAN A;  1OJD A;  1Q1R A;  3KU9 A;  4XWR A;  1CBO A;  1DJN A;  3KPF A;  4B66 A;  5JCN A;  4WCT A;  3D1C A;  1VQW A;  4NTE A;  1ONF A;  5EBK A;  3WE0 A;  4ZN0 A;  1W4X A;  2C3D A;  2UZZ A;  2B7S A;  2Y6R A;  3IC9 A;  3T2Y A;  3C4N A;  4B63 A;  2EQ7 A;  1JU2 A;  4E0V A;  4NEV A;  5HHF A;  3UTF A; 
#chains in the Genus database with same CATH homology
 2ACZ A;  3AEB A;  3AED A;  1GSN A;  2A89 A;  3NGC X;  2HQM A;  2WOW A;  1GRH A;  2VQB A;  3GRT A;  1FL2 A;  2FJA A;  3NG7 X;  4U8I A;  4AP1 A;  2GR2 A;  3NIX A;  2YVJ A;  2V60 A;  2XVE A;  2XFU A;  1XPQ A;  3GWF A;  2YG4 A;  1YQZ A;  1O95 A;  3AD8 B;  1ZP0 A;  1NHQ A;  4MJW A;  1GOS A;  4D03 A;  4GCM A;  3UOZ A;  1O5W A;  2OAL A;  4U2T A;  4USR A;  4TLX A;  3VR9 A;  2R9Z A;  2JK6 A;  3G5Q A;  2C70 A;  3UCL A;  2FBW A;  1FEC A;  4GDE A;  1N4U A;  1V59 A;  4A5L A;  2BCG G;  2C7G A;  4EMJ A;  1LV0 A;  3C4A A;  4G9K A;  1GRE A;  3IHM A;  4NNJ A;  4TM4 A;  5EB4 A;  1CF3 A;  2FJE A;  3UKP A;  3UTG A;  1M64 A;  3EAN A;  3II4 A;  2XVF A;  3IWA A;  1GER A;  4IVO B;  5TR3 A;  3EPT A;  1TDK A;  1GES A;  1D7Y A;  3HYV A;  4YXD A;  4Y4L A;  4GUV A;  5JCK A;  3UKQ A;  4EMW A;  3KVE A;  2YLX A;  4FK1 A;  2VRM A;  1PBC A;  3PO7 A;  1PBD A;  3DJJ A;  1E6E A;  1OJ9 A;  3DJD A;  3FBS A;  3ISH A;  3AE9 A;  3JSK A;  1PJ6 A;  2XFO A;  3B3R A;  3G5R A;  3NT6 A;  3T14 A;  4C74 A;  4CY6 A;  4U8J A;  1GND A;  1H83 A;  3QSM A;  5CKU A;  2QA1 A;  2XLT A;  1GT8 A;  2FJB A;  3CNJ A;  4UDQ A;  3CNT A;  2TMD A;  4G6G A;  4LII A;  1NEN A;  2GMH A;  5LV9 A;  2JB3 A;  2WET A;  1JRY A;  2XVJ A;  3AE7 A;  3BHF A;  1XDI A;  2Q7V A;  2GMJ A;  3RNM A;  3CNS A;  3DK4 A;  3NYE A;  4OPC A;  1PXA A;  1S2Q A;  4U8K A;  1NAA A;  1KSU A;  1K0L A;  2V3A A;  2YR5 A;  3GRS A;  4H4X A;  3QSS A;  1H6V A;  4DGK A;  2W0H A;  1DOB A;  4NWZ A;  2CDU A;  3GD3 A;  1TDO A;  3UKA A;  3ALJ A;  4GR1 A;  4N9X A;  5FMH A;  3ICR A;  2H89 A;  1JRX A;  4TM1 A;  2VQ7 A;  4A65 A;  4X9M A;  4RG4 A;  3BI5 A;  4J34 A;  1GXF A;  5J7X A;  4O5U A;  4ZCD A;  3RHA A;  2C76 A;  3PS9 A;  4YWO A;  4H2P A;  3I6D A;  2YG3 A;  5HY5 A;  4OPU A;  3DGH A;  4I59 A;  1GEU A;  3ATQ A;  3E1T A;  4P9S A;  3CND A;  4CRT A;  2EQ9 A;  5U1O A;  2RGH A;  2BC0 A;  2VVM A;  3SFE A;  1NDA A;  3EAO A;  2YVG A;  4G73 A;  4YTP A;  2IID A;  5KMQ A;  3NRN A;  3LOV A;  3AEA A;  2AAQ A;  2WU2 A;  3AB1 A;  1PBF A;  4J56 A;  1K0J A;  1IUU A;  4YTM A;  4IA5 A;  4Z25 A;  4FDC B;  5KVI A;  3CPI G;  1VDC A;  2BXR A;  3P4S A;  1YQ3 A;  4A7A A;  1OJT A;  2GV8 A;  2C64 A;  2XFN A;  1YY5 A;  1F8S A;  3CN8 A;  3SYI A;  2GVC A;  5KWF A;  3RP7 A;  1LQT A;  1DNC A;  1GRB A;  4TLZ A;  5C2T A;  3DK9 A;  1GRG A;  5JCI A;  3T2K A;  1F6M A;  5JCM A;  4B69 A;  2WQY A;  4BK3 A;  1JNR A;  2C65 A;  1IJH A;  4AOS A;  3P9U A;  5BUL A;  1GRF A;  4II3 A;  5GSN A;  2WDR A;  4EIP A;  4K22 A;  2WDV A;  4X9N A;  2JAE A;  2ARD A;  3QJ4 A;  5IPY A;  3DH9 A;  4APN A;  2R46 A;  2E1M A;  1L9D A;  4H2R A;  1N1P A;  1YKJ A;  3K7M X;  4UP3 A;  1PHH A;  1H7W A;  4J31 A;  4YSZ A;  3IF9 A;  4WX1 A;  3S5W A;  3VRB A;  4HB9 A;  3UKF A;  4UDP A;  1COY A;  3NN0 X;  4M52 A;  4Z44 A;  2X8C A;  2X3N A;  3QFA A;  3VRA A;  4Z2R A;  1O94 A;  1S2Y A;  1EL8 A;  1ZMC A;  2VRL A;  4AT0 A;  5BVA A;  2X50 A;  1ZKQ A;  2XFQ A;  3AE8 A;  4Z26 A;  4PAB A;  1KFY A;  1ZOY A;  4KX6 A;  3NTA A;  5KXJ A;  1IUV A;  3P4P A;  2JB1 A;  2YG5 A;  3SGL A;  1H86 A;  1H81 A;  2C3C A;  2DKH A;  3ICT A;  3ZDN A;  3FIM B;  1TDE A;  5BRT A;  2C73 A;  1F8R A;  4Z24 A;  2WPC A;  2BAB A;  1NHS A;  1LVL A;  4U8L A;  2E4G A;  4YSH A;  4H4Y A;  4H4Q A;  1ZY8 A;  2WU5 A;  3SFD A;  1KF6 A;  3ALL A;  1PN0 A;  1X31 B;  1REO A;  2Q0L A;  4H4R A;  4YT0 A;  4H4Z A;  3KA7 A;  3AE4 A;  3M13 A;  2Z5Y A;  4DSG A;  1ZDL A;  3GD4 A;  1OJC A;  1FEB A;  2WS3 A;  3AEF A;  3GMB A;  1GRA A;  2YM2 A;  2C72 A;  3CPJ G;  1CC4 A;  1RSG A;  1TDF A;  3F8P A;  2Q6U A;  5CQF A;  3KD9 A;  2IVD A;  3BI2 A;  4BK1 A;  4EM3 A;  4A99 A;  2BK3 A;  2B9W A;  2XYO A;  4YKG A;  2XLS A;  4BUR A;  3OC4 A;  4BJY A;  1JRZ A;  2YQU A;  3G5S A;  3UKL A;  3ZYX A;  2RAB A;  4OPT A;  3SZF A;  5KRQ A;  4EQW A;  1PBB A;  1S3E A;  2BA9 A;  2XFP A;  5EOW A;  2OLO A;  1CJC A;  2YLW A;  3CGD A;  4KPR A;  4EM4 A;  5KMS A;  2O9Z A;  3RED A;  3SY4 A;  2A87 A;  2WOV A;  4H4V A;  3T37 A;  2Z5X A;  3UP5 A;  1Y56 B;  2ZZB A;  2PYX A;  1CC6 A;  2QCU A;  4OVI A;  1IUS A;  1P2E A;  3AE3 A;  4J57 A;  4GRT A;  3T2Z A;  4JDR A;  3GWD A;  2X8G A;  2XCG A;  3ABV A;  4H4U A;  4C5O A;  1GTH A;  2WDQ A;  2R0C A;  1CC2 A;  4JY3 A;  1Q9I A;  2V6O A;  3V76 A;  5KMP A;  1TRB A;  4J2W A;  4JY2 A;  4X4J A;  4ADW A;  2BS3 A;  1NEK A;  4U2S A;  2Y6Q A;  3QSE A;  2BYB A;  3QVR A;  1Q1W A;  4A6N B;  3V3N A;  1ZK7 A;  1CL0 A;  4OPG A;  2DKI A;  3AEG A;  2I0Z A;  2B76 A;  1GTE A;  4CNJ A;  3LXD A;  5ER0 A;  3VRD B;  3UKK A;  3AEC A;  4OCG A;  1D4D A;  1EL9 A;  1ZOV A;  4REK A;  3DK8 A;  1D5T A;  3LB8 A;  1PS9 A;  3NTD A;  4LA1 A;  4C3Y A;  2JBV A;  2AQJ A;  3DME A;  5HXI A;  4GDP A;  3P4R A;  3L8K A;  2BAC A;  2GQW A;  1ELI A;  1Y0P A;  3CMM A;  5BUK A;  3SM8 A;  4USQ A;  4IA6 A;  2EQ8 A;  2A8X A;  3KPK A;  3K7T A;  4A9W A;  1NHR A;  2BK5 A;  4ZCC A;  1FEA A;  1B8S A;  1DOD A;  2BK4 A;  2YG7 A;  4A6N A;  1DXL A;  3DA1 A;  2J3N A;  3PVC A;  5IQ1 A;  2GF3 A;  1M6I A;  4NTD A;  5U63 A;  2ZBW A;  3CTY A;  3AYI A;  4JQ9 A;  4CCQ A;  5U25 A;  2R45 A;  3GYX A;  4CBQ A;  4C3X A;  3UP4 A;  2C66 A;  1GV4 A;  4H2Q A;  4K8D A;  4U2L A;  5KMR A;  2VVL G;  4EMI A;  1XHC A;  3BHK A;  2XLP A;  3LZW A;  4TM0 A;  1PXC A;  1F3P A;  4IVM B;  1GRT A;  4FX9 A;  5C3J A;  4ECH A;  2WP6 A;  3D8X A;  2CFY A;  2WES A;  2WHD A;  2PHH A;  3NYF A;  2F5Z A;  1DOC A;  3DGZ A;  4NZH A;  4A79 A;  1E1K A;  2RGJ A;  3AXB A;  3P1W A;  4H50 A;  1JNZ A;  1KNP A;  1Y56 A;  5L46 A;  5FS7 A;  2WOI A;  5DBJ A;  4H2N A;  4H4T A;  2Q0K A;  4RG3 A;  5GRT A;  2YM1 A;  4K5S A;  1LTX R;  1JEH A;  1IUW A;  3CPH G;  1BF3 A;  1N4V A;  2GH5 A;  3CGC A;  3H4K A;  4B64 A;  1QO8 A;  2GAH B;  1E1N A;  2B9X A;  3B6D A;  2C67 A;  2OAM A;  2RGO A;  3NNE A;  1DOE A;  3EF6 A;  1DJQ A;  3AE1 A;  3SZ0 A;  1KDG A;  3KLJ A;  4Z43 A;  1L9C A;  2EQ6 A;  1CJ3 A;  5EB5 A;  3VR8 A;  2NVK X;  3ATR A;  4LU6 A;  3ALM A;  2GB0 A;  1JOA A;  3KKJ A;  3NYC A;  3UKH A;  1PBE A;  2OLN A;  4EQS A;  1B37 A;  2CUL A;  5M0Z A;  4Z2T A;  3NK1 X;  1LPF A;  1RP0 A;  2BC1 A;  3ITJ A;  3AE5 A;  3O0H A;  4J33 A;  2XLR A;  1K4Q A;  4PAA A;  4RSL A;  3SXI A;  3GSI A;  4YKF A;  3RP6 A;  2C75 A;  2XDO A;  4H4P A;  2V5Z A;  5JCL A;  3T31 A;  2CVJ A;  4JNQ A;  2BRY A;  3NK0 X;  4FK1 C;  2YG6 A;  1L9E A;  4AP3 A;  2E5V A;  5FS9 A;  4XXG A;  2V3B A;  3URH A;  3GDN A;  3LAD A;  2YAU A;  4B68 A;  1B4V A;  1CJ4 A;  4Y4N A;  1FOH A;  1D7L A;  3GMC A;  1PDH A;  3ICS A;  4OPI A;  1OJA A;  3BNU A;  3CGB A;  2BXS A;  4J36 A;  2R4E A;  1EBD A;  3FMW A;  1B5Q A;  2WP5 A;  2IVE A;  3K7Q X;  4CCR A;  1ZX9 A;  2JKC A;  4CNK A;  2VVL A;  3CGE A;  4HA6 A;  1E1L A;  4YSX A;  4G74 A;  2H88 A;  1NHP A;  4UDR A;  1VG0 A;  3UOX A;  3P4Q A;  3HYX A;  1GET A;  3AE2 A;  1AOG A;  2WEU A;  5J60 A;  3M0O A;  3HZL A;  3L1R A;  1PJ7 A;  3NKS A;  4K7Z A;  3S61 A;  1GPE A;  2B9Y A;  4GAP A;  4EQR A;  2GAG B;  1HYU A;  1H82 A;  1NG4 A;  1PJ5 A;  1MO9 A;  4IV9 A;  3I3L A;  1CJ2 A;  2BCP A;  3UOV A;  2R0P A;  4GF7 A;  4H7U A;  1FCD A;  4DNA A;  1F8W A;  1CHU A;  2ZZ0 A;  1TDN A;  3FG2 P;  4BK2 A;  3NLC A;  1PXB A;  1BKW A;  2WPE A;  5HYM A;  1NPX A;  2YLS A;  2YR4 A;  4BJZ A;  1UKV G;  1ZMD A;  2OA1 A;  1LJ1 A;  2GQF A;  3T0K A;  3ADA B;  5KOX A;  2XLU A;  3DJE A;  2WBA A;  4XWZ A;  1RYI A;  2JB2 A;  4CY8 A;  4OPD A;  4B67 A;  5FS8 A;  4GAV A;  2APG A;  3SZW A;  1IUT A;  1LQU A;  4TM3 A;  4U8O A;  4I58 A;  4NTC A;  3NN6 X;  2YVF A;  3COX A;  1H84 A;  1QJD A;  4U8P A;  1GAL A;  1MXT A;  2VOU A;  1KNR A;  3NHO X;  3BNM A;  4C77 A;  2GEW A;  3AYJ A;  4YTN A;  4B1B A;  3QVP A;  3RP8 A;  5KNL A;  3F8R A;  3SQP A;  3Q9T A;  3SZC A;  2YLR A;  1BZL A;  1D4E A;  2GR1 A;  2BS2 A;  2QAE A;  3LJP A;  2VZ2 A;  3HYW A;  2B7R A;  3GYI A;  2QA2 A;  3M12 A;  3VQR A;  2GRT A;  1QLB A;  3AYL A;  3QFB A;  1E7P A;  5KVH A;  2XVI A;  1TYT A;  3OZ2 A;  2X99 A;  3IHG A;  4G6H A;  5KOW A;  1BWC A;  4EQX A;  4D04 A;  1BGJ A;  1MOK A;  1YQ4 A;  1VRQ B;  4K5R A;  1N4W A;  1K0I A;  4U8N A;  3GDP A;  4U8M A;  1IUX A;  4NEW A;  2R4J A;  2V61 A;  1VG9 A;  1BGN A;  2BRA A;  3DJG X;  3H8L A;  1P2H A;  5FS6 A;  4O5Q A;  2YWL A;  2ZZC A;  4ICY A;  2XVH A;  3FPZ A;  1Z6L A;  3UTH A;  2WPF A;  3CNP A;  4DSH A;  4II2 A;  3UTE A;  3AD7 B;  3H8I A;  2WP9 A;  3AD9 B;  1S3B A;  4K2X A;  3AWI A;  3R9U A;  2GR3 A;  3F8D A;  1NG3 A;  3UOY A;  4YSY A;  3SX6 A;  1E1M A;  1SEZ A;  2GR0 A;  4AOX A;  1TYP A;  4EIQ A;  4Z2U A;  3NK2 X;  4JNA A;  1L0V A;  1KSS A;  3Q6J A;  3AE6 A;  3BI4 A;  3GYJ A;  4BV6 A;  1D4C A;  1EL7 A;  2YR6 A;  2FJD A;  2TPR A;  1H7X A;  2C4C A;  2X8H A;  2AR8 A;  2YLZ A;  1E39 A;  4Y4M A;  4B65 A;  3LZX A;  4AT2 A;  2BS4 A;  1EL5 A;  3AEE A;  3V3O A;  3NH3 X;  2R0G A;  3C96 A;  3CIR A;  5IQ4 A;  2NPX A;  4JN9 A;  2YLT A;  4H4S A;  4OPL A;  5M10 A;  4H4W A;  3K30 A;  1XAN A;  1OJD A;  1Q1R A;  3KU9 A;  4XWR A;  1CBO A;  1DJN A;  3KPF A;  4B66 A;  5JCN A;  4WCT A;  3D1C A;  1VQW A;  4NTE A;  1ONF A;  5EBK A;  3WE0 A;  4ZN0 A;  1W4X A;  2C3D A;  2UZZ A;  2B7S A;  2Y6R A;  3IC9 A;  3T2Y A;  3C4N A;  4B63 A;  2EQ7 A;  1JU2 A;  4E0V A;  4NEV A;  5HHF A;  3UTF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...