2VQBA

Bacterial flavin-containing monooxygenase in complex with nadp: soaking in aerated solution
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
443
structure length
443
Chain Sequence
TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
source organism Methylophaga sp. sk1
total genus 162
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vqbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vqbA02
2R0PA 4J57A 2B9XA 2YR6A 3BI2A 3P4RA 4U8KA 3IHMA 4KPRA 1CJ4A 1JOAA 1GSNA 2XFOA 4Y4NA 5TR3A 2E1MA 1NHSA 3RP7A 3NNEA 3QSMA 4D04A 1K4QA 2EQ9A 1FEAA 1KDGA 1GRTA 4UDPA 2YG4A 1L0VA 2APGA 4JY2A 4WX1A 4JNQA 1KFYA 3GRTA 2GRTA 2WP9A 3CNDA 3GMCA 1H7WA 2VRMA 3AECA 3RP6A 1LJ1A 4H4ZA 1ZOVA 3UTGA 5JCIA 3UKAA 4APNA 2BXRA 2X3NA 4H4UA 4IA6A 5M10A 4ICYA 3UKPA 2V60A 1TRBA 3GMBA 1SEZA 1O95A 3CGBA 1CHUA 2Q0LA 3II4A 3UTEA 4A9WA 2WDVA 2WDQA 2YVJA 3SQPA 2WOVA 2WP5A 3CNTA 1E1MA 3AE3A 3QSSA 2FJDA 4NEVA 1IUUA 4TLXA 3T37A 4U8JA 2BS3A 2X8GA 3C4AA 2HQMA 2CFYA 4H50A 5EB4A 4AOSA 4EM4A 1M6IA 2UZZA 1H83A 2GV8A 4N9XA 5EB5A 1LVLA 3P1WA 5CKUA 2BK4A 2R4JA 4I58A 4EMWA 1ZY8A 2GB0A 5KVIA 2BC1A 3CNJA 1E39A 2GMJA 1JNZA 3BNUA 5M0ZA 2WU2A 4A6NB 3CN8A 1IUWA 1GNDA 1DOCA 3FG2P 4J33A 1QJDA 4CCRA 1H81A 4RSLA 3NG7X 1L9DA 4NEWA 4E0VA 1IUXA 4EIQA 4NTDA 4GF7A 1S2QA 3GWDA 3BHKA 2YM2A 4HB9A 3H8LA 3UOVA 4AOXA 2C64A 1B4VA 1DJNA 2RGJA 3FIMB 4J34A 1UKVG 2XVHA 5FMHA 1D4EA 4H2PA 1Q1WA 2JK6A 1PN0A 3NYFA 4K5RA 2BYBA 4OPTA 3UOXA 4TLZA 2XLUA 4EQRA 1MXTA 3LJPA 3BI4A 1GT8A 3UKLA 4H7UA 4CNJA 2FBWA 2VVLA 3QSEA 3AE4A 2GF3A 1PBEA 1COYA 3KD9A 4H4SA 2YWLA 1TYTA 2EQ6A 1CF3A 4BK2A 1E1KA 2BS2A 3AD9B 4H4XA 1E6EA 3NK1X 5HY5A 2BK5A 3DJGX 1XANA 4K5SA 1LQTA 3RP8A 1EL9A 3KKJA 2XFPA 4M52A 4ADWA 2AR8A 1D5TA 5U25A 4AP3A 4DSHA 4FK1A 2XLSA 3ALJA 2CDUA 3AE9A 1FEBA 3VQRA 4TM4A 3DGZA 2C3DA 5U63A 2A89A 1YQ4A 3ZYXA 2BS4A 2GQWA 3ICSA 3VRDB 4YT0A 3EAOA 1RP0A 3SM8A 2AQJA 1E1LA 1TDKA 2GAGB 1OJAA 3AB1A 2IIDA 3S5WA 3BNMA 1NEKA 2Q0KA 4YTNA 1GESA 4TM1A 4CCQA 4OPCA 2XVIA 2RGHA 3UTFA 1NG3A 4JY3A 1F3PA 3AYIA 1BF3A 2B9WA 4IVOB 4EIPA 3REDA 2GR2A 3NH3X 4JDRA 1ZDLA 3LB8A 4GRTA 4IA5A 1CL0A 4Z2TA 4BV6A 1FECA 4K22A 2CULA 1DOBA 3EPTA 4RG3A 4TM0A 1NENA 1D7YA 4H4YA 1D7LA 4ZN0A 4USQA 2JB3A 1LPFA 3C4NA 3PO7A 2B7SA 4YSHA 1BWCA 3NK2X 1KSSA 3OC4A 1FL2A 3AYLA 1PBDA 1ZOYA 4H4TA 2NPXA 2GEWA 3LZWA 1IJHA 3NGCX 1DNCA 4EQWA 2YM1A 2AAQA 2OA1A 4EM3A 2XVJA 3S61A 4A6NA 4A7AA 3Q6JA 3B6DA 4YKFA 1PBFA 5HYMA 3DK8A 1D4CA 2OLNA 4BK1A 5IPYA 2FJAA 4U8LA 2C76A 2Z5YA 1RYIA 3LZXA 2X8HA 3COXA 5GSNA 1RSGA 3G5SA 5C3JA 2XFNA 4DGKA 4GCMA 1XPQA 4AT0A 2E4GA 2RABA 1GXFA 2WOIA 4IV9A 5FS7A 3SFEA 4A5LA 4H2QA 4B1BA 4REKA 5KOXA 1TYPA 4J31A 3ADAB 4C77A 2IVDA 2WEUA 1GTEA 3P4QA 3GDNA 4BK3A 2XYOA 4C5OA 5JCMA 4O5UA 4J36A 3AYJA 3GD3A 2C3CA 1PJ5A 4USRA 4Y4LA 4Y4MA 3IHGA 2BA9A 5JCKA 2WESA 1YQZA 1TDFA 1N4UA 3CGCA 4EQXA 2YG3A 4Z2RA 1JRYA 1PXAA 4OPDA 5KOWA 4C74A 5U1OA 3URHA 3ATQA 3AXBA 4YSXA 4GDPA 3AE1A 3ITJA 1GPEA 4PABA 2ZBWA 5HHFA 1EBDA 4B67A 2XLPA 2YLRA 3G5QA 3QVPA 1KNPA 1PBBA 2WDRA 2JAEA 1H86A 4EQSA 3JSKA 3IC9A 1DODA 2XLRA 2ZZCA 3ZDNA 4U2SA 3DK9A 3G5RA 1S3EA 3L8KA 4FDCB 2B9YA 1NG4A 2ZZBA 2C73A 3D8XA 1PXBA 1Y56A 4U8IA 5CQFA 1BKWA 1BGJA 1M64A 1GALA 3LOVA 2Y6RA 2V3BA 4Z44A 2VOUA 1OJTA 2XDOA 3HZLA 2YG7A 1B37A 2FJEA 2RGOA 2YVFA 2YG6A 1NPXA 3GDPA 4K8DA 1YKJA 2GAHB 1XHCA 4C3XA 3I6DA 4Z2UA 1DOEA 3VR8A 2WQYA 1CJCA 1V59A 3NLCA 4B69A 3AEEA 1ZMDA 2X50A 4TM3A 1E7PA 1NAAA 3K7TA 1LV0A 1YY5A 2GVCA 1MO9A 2XVEA 3NKSA 4FK1C 3UKKA 3AEFA 1CC6A 3NTDA 4H4QA 4BJZA 3SFDA 1H6VA 3VRBA 2H88A 2CVJA 3FMWA 3BI5A 3K7QX 2YLTA 2GR1A 1E1NA 2WPFA 3CPHG 3K30A 2VRLA 3UKQA 3B3RA 3BHFA 4U2LA 3CNSA 4EMIA 2WPCA 3GYJA 4YTMA 4CBQA 2EQ8A 4CY8A 3GYIA 3AE6A 1N4WA 5C2TA 4DNAA 1GERA 4H4VA 2OLOA 3ICRA 4FX9A 4K7ZA 2C67A 2PHHA 2C65A 1VDCA 2YLXA 4MJWA 1JRXA 1OJDA 2JB2A 3AD8B 3DK4A 3OZ2A 4OCGA 4U8PA 3F8PA 4RG4A 1JNRA 1H7XA 4IVMB 1OJ9A 4U8MA 1PDHA 1TDOA 4XXGA 5KVHA 1NHRA 2YR5A 3KA7A 4KX6A 3H8IA 4OPUA 1FOHA 4Z26A 3VR9A 2BACA 3NN0X 2J3NA 3GSIA 1NDAA 1W4XA 2XFUA 4YXDA 3P9UA 2QAEA 1VQWA 1GRAA 3AEDA 4K2XA 3GD4A 3Q9TA 2V5ZA 4BURA 5DBJA 1YQ3A 4X4JA 1BGNA 4WCTA 4XWRA 1CJ2A 1GTHA 3QFAA 3I3LA 1O5WA 2QA2A 5ER0A 5KRQA 3KVEA 1ELIA 2GR0A 1BZLA 4P9SA 5GRTA 3V3NA 2C70A 1Q9IA 3K7MX 5IQ1A 4J2WA 1HYUA 1VRQB 1ZX9A 3LADA 3NYEA 3F8RA 2BC0A 3QFBA 5FS9A 5BVAA 1GRFA 1ZKQA 3NT6A 5BRTA 4JN9A 1PBCA 1ZMCA 4ZCCA 1MOKA 2GR3A 2VZ2A 2VQBA 2R9ZA 4GDEA 4JQ9A 1N4VA 2JB1A 4UDRA 3CPIG 4A99A 2FJBA 2R4EA 4XWZA 3AWIA 1GRHA 4YTPA 3M12A 4NTCA 4U2TA 4AT2A 2XVFA 1AOGA 3R9UA 1Z6LA 2V3AA 3M0OA 3FBSA 4C3YA 1GREA 2B7RA 3NRNA 2GQFA 1F6MA 1P2EA 2JKCA 3KPFA 5EOWA 4B68A 5KXJA 3CGEA 5EBKA 5BULA 4NTEA 2WP6A 2YG5A 3DA1A 2WETA 4LA1A 1KNRA 2WS3A 3AD7B 3DJEA 2R46A 1QLBA 3PVCA 4B63A 1S3BA 3CGDA 1B8SA 3UKHA 2BCPA 1LQUA 1F8RA 2ARDA 2R0CA 3UP5A 2ZZ0A 1GV4A 2YVGA 1CC2A 1O94A 2VVLG 3AE2A 2PYXA 3PS9A 3NHOX 4H4PA 1FCDA 3KLJA 4B66A 3KU9A 2XCGA 2YAUA 3ABVA 4OPIA 1CC4A 3UCLA 2IVEA 3NIXA 2BXSA 5FS8A 4DSGA 1CJ3A 5HXIA 3ATRA 5JCLA 4Z25A 3DJDA 3RHAA 3ALMA 5LV9A 4H2NA 1S2YA 3ISHA 2WU5A 4Z24A 3GRSA 3F8DA 2WOWA 3NN6X 2NVKX 1Y0PA 3IF9A 1TDNA 2BABA 3H4KA 4X9MA 3ICTA 2VQ7A 3V76A 1XDIA 2V61A 2Q6UA 4YSYA 1F8WA 3EANA 2V6OA 3QVRA 5IQ4A 3M13A 1EL7A 1H84A 3E1TA 4CY6A 4D03A 4GR1A 1ZP0A 3UOYA 4H4WA 2YLSA 1JRZA 1GETA 4OPGA 2DKIA 2H89A 2QCUA 2WHDA 3P4SA 1NHQA 3L1RA 4BJYA 3AE5A 2B76A 4I59A 1CBOA 1NHPA 2A8XA 4LIIA 5KWFA 2X8CA 2C72A 3AEGA 5JCNA 3GWFA 3FPZA 4YWOA 4Z43A 5FS6A 4ZCDA 2QA1A 3UKFA 1N1PA 1PHHA 2XLTA 2GMHA 3CTYA 2W0HA 1L9CA 2Z5XA 4UP3A 2C7GA 3VRAA 4OPLA 4YKGA 1X31B 3SGLA 5BUKA 3RNMA 1JEHA 5L46A 3UOZA 3AEBA 4OVIA 3NTAA 1JU2A 4A65A 3DH9A 2R0GA 3ALLA 3DGHA 4H2RA 1F8SA 1K0IA 1ONFA 4GUVA 1H82A 1PJ6A 1D4DA 4U8NA 2I0ZA 1TDEA 1DXLA 1LTXR 1IUVA 1Q1RA 1REOA 1KF6A 4AP1A 3UTHA 1EL8A 4PAAA 4B64A 1GRGA 4X9NA 1GEUA 3O0HA 4JNAA 2F5ZA 4EMJA 2C66A 1IUSA 2YQUA 3AE7A 2ACZA 2WBAA 3DMEA 2BK3A 4LU6A 1PS9A 4CRTA 4J56A 2GH5A 2O9ZA 3LXDA 2EQ7A 3CIRA 3CNPA 4CNKA 2BCGG 2YLZA 2XFQA 1K0LA 2VVMA 3C96A 3V3OA 3IWAA 1GOSA 4A79A 4NZHA 3NYCA 2E5VA 4B65A 4H4RA 2DKHA 2TMDA 3UP4A 2R45A 1P2HA 1Y56B 2Y6QA 3WE0A 3AEAA 2C75A 2YR4A 1IUTA 2A87A 3QJ4A 1VG0A 1OJCA 3CPJG 4O5QA 4YSZA 1PXCA 1K0JA 4ECHA 4U8OA 3EF6A 2TPRA 2OAMA 5J60A 3NK0X 1VG9A 1ZK7A 2WPEA 3DJJA 2OALA 1DJQA 4UDQA 3D1CA 3AE8A 3P4PA 1PJ7A 2JBVA 2X99A 1L9EA 1KSUA 1QO8A 1GRBA 1EL5A 2Q7VA 2YLWA 4HA6A 1B5QA 5J7XA
chains in the Genus database with same CATH superfamily
2R0PA 4J57A 2B9XA 2YR6A 3BI2A 3P4RA 4U8KA 3IHMA 4KPRA 1CJ4A 1JOAA 1GSNA 2XFOA 4Y4NA 4GAPA 5TR3A 2E1MA 1NHSA 3RP7A 3NNEA 3QSMA 3T31A 4D04A 1K4QA 2EQ9A 1FEAA 1KDGA 1GRTA 4UDPA 2YG4A 1L0VA 2APGA 4JY2A 4WX1A 4JNQA 1KFYA 3GRTA 2GRTA 2WP9A 3CNDA 3GMCA 1H7WA 2VRMA 3AECA 3RP6A 1LJ1A 4H4ZA 1ZOVA 3UTGA 5JCIA 3UKAA 4APNA 2BXRA 2X3NA 4H4UA 4IA6A 5M10A 4ICYA 3UKPA 2V60A 1TRBA 3GMBA 1SEZA 1O95A 3CGBA 1CHUA 2Q0LA 3II4A 3UTEA 4A9WA 2WDVA 2WDQA 2YVJA 4G6GA 3SQPA 2WOVA 2WP5A 3CNTA 1E1MA 3AE3A 3QSSA 2FJDA 4NEVA 1IUUA 4TLXA 3T37A 4U8JA 2BS3A 2X8GA 3C4AA 2HQMA 2CFYA 4H50A 5EB4A 4AOSA 4EM4A 1M6IA 2UZZA 1H83A 2GV8A 4N9XA 5EB5A 1LVLA 3P1WA 5CKUA 2BK4A 3KPKA 2R4JA 4I58A 4EMWA 1ZY8A 2GB0A 5KVIA 2BC1A 3CNJA 1E39A 2GMJA 1JNZA 3BNUA 5M0ZA 2WU2A 4A6NB 4G9KA 3CN8A 1IUWA 1GNDA 1DOCA 3FG2P 4J33A 1QJDA 4II2A 1H81A 4RSLA 3NG7X 1L9DA 4NEWA 4CCRA 4E0VA 1IUXA 4EIQA 4NTDA 4GF7A 1S2QA 3GWDA 3BHKA 2YM2A 4HB9A 3H8LA 3UOVA 4AOXA 2C64A 1B4VA 1DJNA 2RGJA 3FIMB 4J34A 1UKVG 2XVHA 5FMHA 1D4EA 4H2PA 1Q1WA 2JK6A 1PN0A 3NYFA 4K5RA 2BYBA 4OPTA 3UOXA 4TLZA 2XLUA 4EQRA 1MXTA 3LJPA 3BI4A 1GT8A 3UKLA 4H7UA 4CNJA 2FBWA 2VVLA 3HYVA 3QSEA 3AE4A 2GF3A 1PBEA 1COYA 3KD9A 4H4SA 2YWLA 1TYTA 2EQ6A 1CF3A 4BK2A 1E1KA 2BS2A 3AD9B 4H4XA 1E6EA 3NK1X 5HY5A 2BK5A 3DJGX 1XANA 4K5SA 1LQTA 3RP8A 1EL9A 3KKJA 2XFPA 4M52A 4ADWA 2AR8A 1D5TA 5U25A 4AP3A 4DSHA 4FK1A 2XLSA 3ALJA 2CDUA 3AE9A 4II3A 1FEBA 3SY4A 3VQRA 4TM4A 3DGZA 4NNJA 2C3DA 5U63A 2A89A 1YQ4A 3ZYXA 2BS4A 2GQWA 3ICSA 3T2YA 3VRDB 4YT0A 3EAOA 1RP0A 3SM8A 2AQJA 1E1LA 1TDKA 2GAGB 1OJAA 3AB1A 2IIDA 3S5WA 3BNMA 1NEKA 2Q0KA 4YTNA 1GESA 4TM1A 4CCQA 4OPCA 2XVIA 2RGHA 3UTFA 1NG3A 4JY3A 1F3PA 3AYIA 1BF3A 2B9WA 4IVOB 4EIPA 3REDA 2GR2A 3NH3X 4JDRA 1ZDLA 3LB8A 4GRTA 4IA5A 1CL0A 4Z2TA 4BV6A 1FECA 4K22A 2CULA 1DOBA 3EPTA 4RG3A 4TM0A 1NENA 1D7YA 2BRAA 4H4YA 1D7LA 4ZN0A 4USQA 2JB3A 1LPFA 3C4NA 3PO7A 2B7SA 4YSHA 1BWCA 3NK2X 1KSSA 3HYWA 3OC4A 1FL2A 3AYLA 1PBDA 1ZOYA 4H4TA 2NPXA 2GEWA 3LZWA 1IJHA 3NGCX 1DNCA 4EQWA 2YM1A 2AAQA 2OA1A 4EM3A 2XVJA 3S61A 4A6NA 3SZFA 4A7AA 3Q6JA 3B6DA 4YKFA 1PBFA 5HYMA 3DK8A 1D4CA 2OLNA 4BK1A 5IPYA 2FJAA 4U8LA 2C76A 2Z5YA 1RYIA 3LZXA 4G73A 2X8HA 3COXA 5GSNA 1RSGA 3G5SA 5C3JA 5KMSA 2XFNA 4DGKA 4GCMA 1XPQA 4AT0A 2E4GA 2RABA 1GXFA 2WOIA 4IV9A 5FS7A 4GAVA 3SFEA 4A5LA 4H2QA 4B1BA 4REKA 5KOXA 1TYPA 4J31A 3ADAB 4C77A 2IVDA 2WEUA 1GTEA 3P4QA 3GDNA 4BK3A 2XYOA 4C5OA 5JCMA 4O5UA 2BRYA 3AYJA 3GD3A 2C3CA 1PJ5A 4J36A 4USRA 4Y4LA 4Y4MA 4G74A 3IHGA 2BA9A 5JCKA 2WESA 1YQZA 1TDFA 1N4UA 3CGCA 4EQXA 2YG3A 4Z2RA 1JRYA 1PXAA 4OPDA 5KOWA 4C74A 5U1OA 3URHA 3ATQA 3AXBA 4YSXA 4GDPA 3AE1A 3ITJA 1GPEA 4PABA 2ZBWA 5HHFA 1EBDA 4B67A 2XLPA 2YLRA 3G5QA 3QVPA 1KNPA 1PBBA 2WDRA 2JAEA 1H86A 4EQSA 3JSKA 3IC9A 1DODA 2XLRA 2ZZCA 3ZDNA 4U2SA 3DK9A 3G5RA 1S3EA 3L8KA 4FDCB 2B9YA 1NG4A 2ZZBA 2C73A 3D8XA 5KNLA 1PXBA 1Y56A 4U8IA 5CQFA 1BKWA 1BGJA 1M64A 1GALA 3LOVA 2Y6RA 2V3BA 4Z44A 2VOUA 1OJTA 2XDOA 3HZLA 5KMPA 2YG7A 1B37A 2FJEA 2RGOA 3T2ZA 2YVFA 2YG6A 1NPXA 3GDPA 4K8DA 1YKJA 2GAHB 1XHCA 4C3XA 3I6DA 4Z2UA 1DOEA 3VR8A 2WQYA 1CJCA 1V59A 3NLCA 4B69A 3AEEA 1ZMDA 2X50A 4TM3A 1E7PA 1NAAA 3K7TA 1LV0A 1YY5A 2GVCA 1MO9A 2XVEA 3NKSA 4FK1C 3UKKA 3AEFA 1CC6A 3NTDA 4H4QA 4BJZA 3SFDA 1H6VA 3VRBA 2H88A 2CVJA 3FMWA 3BI5A 3K7QX 2YLTA 2GR1A 1E1NA 2WPFA 3CPHG 3K30A 2VRLA 3UKQA 3B3RA 3BHFA 4U2LA 3CNSA 4EMIA 2WPCA 3GYJA 4YTMA 4CBQA 2EQ8A 4CY8A 3GYIA 3AE6A 1N4WA 5C2TA 4DNAA 1GERA 4H4VA 2OLOA 3ICRA 4FX9A 4K7ZA 2C67A 2PHHA 2C65A 1VDCA 2YLXA 4MJWA 1JRXA 1OJDA 2JB2A 3AD8B 3DK4A 3OZ2A 4OCGA 4U8PA 3F8PA 4RG4A 1JNRA 1H7XA 4IVMB 1OJ9A 4U8MA 1PDHA 1TDOA 4XXGA 5KVHA 1NHRA 2YR5A 3KA7A 4KX6A 3H8IA 4OPUA 1FOHA 4Z26A 3VR9A 2BACA 3NN0X 2J3NA 3GSIA 1NDAA 1W4XA 2XFUA 4YXDA 3P9UA 2QAEA 1VQWA 1GRAA 3AEDA 4K2XA 3GD4A 3Q9TA 2V5ZA 4BURA 5DBJA 1YQ3A 4X4JA 1BGNA 4WCTA 4XWRA 1CJ2A 1GTHA 3QFAA 3I3LA 1O5WA 2QA2A 5ER0A 5KRQA 3KVEA 1ELIA 2GR0A 1BZLA 4P9SA 5GRTA 3V3NA 2C70A 1Q9IA 3K7MX 5IQ1A 4J2WA 1HYUA 1VRQB 1ZX9A 3LADA 3NYEA 3F8RA 2BC0A 3QFBA 5FS9A 3T0KA 5BVAA 1GRFA 1ZKQA 3NT6A 5BRTA 4JN9A 1PBCA 1ZMCA 4ZCCA 1MOKA 2GR3A 2VZ2A 2VQBA 2R9ZA 4GDEA 4JQ9A 3T14A 1N4VA 2JB1A 4UDRA 3CPIG 4A99A 2FJBA 2R4EA 4XWZA 3AWIA 1GRHA 4YTPA 3M12A 4NTCA 4U2TA 4AT2A 2XVFA 1AOGA 3R9UA 1Z6LA 2V3AA 3M0OA 3FBSA 4C3YA 1GREA 2B7RA 3NRNA 2GQFA 1F6MA 1P2EA 2JKCA 3KPFA 5EOWA 4B68A 5KXJA 3CGEA 5EBKA 5BULA 4NTEA 2WP6A 2YG5A 3DA1A 2WETA 4LA1A 1KNRA 2WS3A 3AD7B 3DJEA 2R46A 1QLBA 3PVCA 4B63A 1S3BA 3CGDA 1B8SA 3UKHA 2BCPA 1LQUA 1F8RA 2ARDA 2R0CA 3UP5A 2ZZ0A 1GV4A 2YVGA 1CC2A 1O94A 2VVLG 3AE2A 2PYXA 3PS9A 3NHOX 4H4PA 1FCDA 3KLJA 4B66A 3KU9A 2XCGA 2YAUA 3ABVA 4OPIA 1CC4A 3UCLA 2IVEA 3NIXA 2BXSA 5FS8A 4DSGA 1CJ3A 5HXIA 3ATRA 5JCLA 4Z25A 3DJDA 3RHAA 3ALMA 5LV9A 4H2NA 1S2YA 3ISHA 2WU5A 4Z24A 3GRSA 3F8DA 2WOWA 3NN6X 2NVKX 1Y0PA 2C4CA 3IF9A 1TDNA 2BABA 3H4KA 4X9MA 3ICTA 2VQ7A 3V76A 5KMQA 1XDIA 2V61A 2Q6UA 4YSYA 1F8WA 3EANA 2V6OA 3QVRA 5IQ4A 3SX6A 3M13A 1EL7A 1H84A 3E1TA 3GYXA 4CY6A 4GR1A 1ZP0A 3UOYA 4D03A 4G6HA 4H4WA 2YLSA 1JRZA 1GETA 4OPGA 2DKIA 2H89A 2QCUA 2WHDA 3P4SA 1NHQA 3L1RA 4NWZA 4BJYA 3AE5A 2B76A 4I59A 1CBOA 1NHPA 2A8XA 4LIIA 5KWFA 2X8CA 2C72A 3AEGA 5JCNA 3GWFA 3FPZA 4YWOA 4Z43A 5FS6A 4ZCDA 2QA1A 5KMRA 3UKFA 1N1PA 3SZ0A 1PHHA 2XLTA 2GMHA 3CTYA 2W0HA 1L9CA 2Z5XA 4UP3A 2C7GA 3VRAA 4OPLA 4YKGA 1X31B 3SGLA 5BUKA 3RNMA 1JEHA 5L46A 3UOZA 3AEBA 4OVIA 3NTAA 1JU2A 4A65A 3DH9A 2R0GA 3ALLA 3DGHA 4H2RA 1F8SA 1K0IA 1ONFA 4GUVA 1H82A 1PJ6A 1D4DA 4U8NA 2I0ZA 1TDEA 1DXLA 1LTXR 1IUVA 1Q1RA 1REOA 1KF6A 4AP1A 3UTHA 1EL8A 4PAAA 4B64A 1GRGA 4X9NA 1GEUA 3O0HA 4JNAA 2F5ZA 4EMJA 3SZWA 2C66A 1IUSA 2YQUA 3SZCA 3AE7A 2ACZA 2WBAA 3DMEA 2BK3A 4LU6A 1PS9A 3SYIA 4J56A 4CRTA 2GH5A 2O9ZA 3LXDA 2EQ7A 3CIRA 3SXIA 3CNPA 4CNKA 2BCGG 2YLZA 2XFQA 1K0LA 2VVMA 3C96A 3V3OA 3IWAA 1GOSA 4A79A 4NZHA 3NYCA 2E5VA 4B65A 4H4RA 2DKHA 2TMDA 3UP4A 2R45A 1P2HA 3HYXA 1Y56B 2Y6QA 3WE0A 3AEAA 2C75A 2YR4A 1IUTA 2A87A 3QJ4A 1VG0A 1OJCA 3CPJG 4O5QA 4YSZA 1PXCA 1K0JA 4ECHA 4U8OA 3EF6A 2TPRA 2OAMA 5J60A 3NK0X 1VG9A 1ZK7A 2WPEA 3CMMA 3DJJA 2OALA 1DJQA 4UDQA 3T2KA 3D1CA 3AE8A 3P4PA 1PJ7A 2JBVA 2X99A 1L9EA 1KSUA 1QO8A 1GRBA 1EL5A 2Q7VA 2YLWA 4HA6A 1B5QA 5J7XA
chains in the Genus database with same CATH topology
2R0PA 4J57A 2B9XA 2YR6A 3BI2A 3P4RA 4U8KA 3IHMA 4KPRA 1CJ4A 1JOAA 1GSNA 2XFOA 4Y4NA 4GAPA 5TR3A 2E1MA 1NHSA 3RP7A 3NNEA 3QSMA 3T31A 4D04A 1K4QA 2EQ9A 1FEAA 1KDGA 1GRTA 4UDPA 2YG4A 1L0VA 2APGA 4JY2A 4WX1A 4JNQA 1KFYA 3GRTA 2GRTA 2WP9A 3CNDA 3GMCA 1H7WA 2VRMA 3AECA 3RP6A 1LJ1A 4H4ZA 1ZOVA 3UTGA 5JCIA 3UKAA 4APNA 2BXRA 2X3NA 4H4UA 4IA6A 5M10A 4ICYA 3UKPA 2V60A 1TRBA 3GMBA 1SEZA 1O95A 3CGBA 1CHUA 2Q0LA 3II4A 3UTEA 4A9WA 2WDVA 2WDQA 2YVJA 4G6GA 3SQPA 2WOVA 2WP5A 3CNTA 1E1MA 3AE3A 3QSSA 2FJDA 4NEVA 1IUUA 4TLXA 3T37A 4U8JA 2BS3A 2X8GA 3C4AA 2HQMA 2CFYA 4H50A 5EB4A 4AOSA 4EM4A 1M6IA 2UZZA 1H83A 2GV8A 4N9XA 5EB5A 1LVLA 3P1WA 5CKUA 2BK4A 3KPKA 2R4JA 4I58A 4EMWA 1ZY8A 2GB0A 5KVIA 2BC1A 3CNJA 1E39A 2GMJA 1JNZA 3BNUA 5M0ZA 2WU2A 4A6NB 4G9KA 3CN8A 1IUWA 1GNDA 1DOCA 3FG2P 4J33A 1QJDA 4II2A 1H81A 4RSLA 3NG7X 1L9DA 4NEWA 4CCRA 4E0VA 1IUXA 4EIQA 4NTDA 4GF7A 1S2QA 3GWDA 3BHKA 2YM2A 4HB9A 3H8LA 3UOVA 4AOXA 2C64A 1B4VA 1DJNA 2RGJA 3FIMB 4J34A 1UKVG 2XVHA 5FMHA 1D4EA 4H2PA 1Q1WA 2JK6A 1PN0A 3NYFA 4K5RA 2BYBA 4OPTA 3UOXA 4TLZA 2XLUA 4EQRA 1MXTA 3LJPA 3BI4A 1GT8A 3UKLA 4H7UA 4CNJA 2FBWA 2VVLA 3HYVA 3QSEA 3AE4A 2GF3A 1PBEA 1COYA 3KD9A 4H4SA 2YWLA 1TYTA 2EQ6A 1CF3A 4BK2A 1E1KA 2BS2A 3AD9B 4H4XA 1E6EA 3NK1X 5HY5A 2BK5A 3DJGX 1XANA 4K5SA 1LQTA 3RP8A 1EL9A 3KKJA 2XFPA 4M52A 4ADWA 2AR8A 1D5TA 5U25A 4AP3A 4DSHA 4FK1A 2XLSA 3ALJA 2CDUA 3AE9A 4II3A 1FEBA 3SY4A 3VQRA 4TM4A 3DGZA 4NNJA 2C3DA 5U63A 2A89A 1YQ4A 3ZYXA 2BS4A 2GQWA 3ICSA 3T2YA 3VRDB 4YT0A 3EAOA 1RP0A 3SM8A 2AQJA 1E1LA 1TDKA 2GAGB 1OJAA 3AB1A 2IIDA 3S5WA 3BNMA 1NEKA 2Q0KA 4YTNA 1GESA 4TM1A 4CCQA 4OPCA 2XVIA 2RGHA 3UTFA 1NG3A 4JY3A 1F3PA 3AYIA 1BF3A 2B9WA 4IVOB 4EIPA 3REDA 2GR2A 3NH3X 4JDRA 1ZDLA 3LB8A 4GRTA 4IA5A 1CL0A 4Z2TA 4BV6A 1FECA 4K22A 2CULA 1DOBA 3EPTA 4RG3A 4TM0A 1NENA 1D7YA 2BRAA 4H4YA 1D7LA 4ZN0A 4USQA 2JB3A 1LPFA 3C4NA 3PO7A 2B7SA 4YSHA 1BWCA 3NK2X 1KSSA 3HYWA 3OC4A 1FL2A 3AYLA 1PBDA 1ZOYA 4H4TA 2NPXA 2GEWA 3LZWA 1IJHA 3NGCX 1DNCA 4EQWA 2YM1A 2AAQA 2OA1A 4EM3A 2XVJA 3S61A 4A6NA 3SZFA 4A7AA 3Q6JA 3B6DA 4YKFA 1PBFA 5HYMA 3DK8A 1D4CA 2OLNA 4BK1A 5IPYA 2FJAA 4U8LA 2C76A 2Z5YA 1RYIA 3LZXA 4G73A 2X8HA 3COXA 5GSNA 1RSGA 3G5SA 5C3JA 5KMSA 2XFNA 4DGKA 4GCMA 1XPQA 4AT0A 2E4GA 2RABA 1GXFA 2WOIA 4IV9A 5FS7A 4GAVA 3SFEA 4A5LA 4H2QA 4B1BA 4REKA 5KOXA 1TYPA 4J31A 3ADAB 4C77A 2IVDA 2WEUA 1GTEA 3P4QA 3GDNA 4BK3A 2XYOA 4C5OA 5JCMA 4O5UA 2BRYA 3AYJA 3GD3A 2C3CA 1PJ5A 4J36A 4USRA 4Y4LA 4Y4MA 4G74A 3IHGA 2BA9A 5JCKA 2WESA 1YQZA 1TDFA 1N4UA 3CGCA 4EQXA 2YG3A 4Z2RA 1JRYA 1PXAA 4OPDA 5KOWA 4C74A 5U1OA 3URHA 3ATQA 3AXBA 4YSXA 4GDPA 3AE1A 3ITJA 1GPEA 4PABA 2ZBWA 5HHFA 1EBDA 4B67A 2XLPA 2YLRA 3G5QA 3QVPA 1KNPA 1PBBA 2WDRA 2JAEA 1H86A 4EQSA 3JSKA 3IC9A 1DODA 2XLRA 2ZZCA 3ZDNA 4U2SA 3DK9A 3G5RA 1S3EA 3L8KA 4FDCB 2B9YA 1NG4A 2ZZBA 2C73A 3D8XA 5KNLA 1PXBA 1Y56A 4U8IA 5CQFA 1BKWA 1BGJA 1M64A 1GALA 3LOVA 2Y6RA 2V3BA 4Z44A 2VOUA 1OJTA 2XDOA 3HZLA 5KMPA 2YG7A 1B37A 2FJEA 2RGOA 3T2ZA 2YVFA 2YG6A 1NPXA 3GDPA 4K8DA 1YKJA 2GAHB 1XHCA 4C3XA 3I6DA 4Z2UA 1DOEA 3VR8A 2WQYA 1CJCA 1V59A 3NLCA 4B69A 3AEEA 1ZMDA 2X50A 4TM3A 1E7PA 1NAAA 3K7TA 1LV0A 1YY5A 2GVCA 1MO9A 2XVEA 3NKSA 4FK1C 3UKKA 3AEFA 1CC6A 3NTDA 4H4QA 4BJZA 3SFDA 1H6VA 3VRBA 2H88A 2CVJA 3FMWA 3BI5A 3K7QX 2YLTA 2GR1A 1E1NA 2WPFA 3CPHG 3K30A 2VRLA 3UKQA 3B3RA 3BHFA 4U2LA 3CNSA 4EMIA 2WPCA 3GYJA 4YTMA 4CBQA 2EQ8A 4CY8A 3GYIA 3AE6A 1N4WA 5C2TA 4DNAA 1GERA 4H4VA 2OLOA 3ICRA 4FX9A 4K7ZA 2C67A 2PHHA 2C65A 1VDCA 2YLXA 4MJWA 1JRXA 1OJDA 2JB2A 3AD8B 3DK4A 3OZ2A 4OCGA 4U8PA 3F8PA 4RG4A 1JNRA 1H7XA 4IVMB 1OJ9A 4U8MA 1PDHA 1TDOA 4XXGA 5KVHA 1NHRA 2YR5A 3KA7A 4KX6A 3H8IA 4OPUA 1FOHA 4Z26A 3VR9A 2BACA 3NN0X 2J3NA 3GSIA 1NDAA 1W4XA 2XFUA 4YXDA 3P9UA 2QAEA 1VQWA 1GRAA 3AEDA 4K2XA 3GD4A 3Q9TA 2V5ZA 4BURA 5DBJA 1YQ3A 4X4JA 1BGNA 4WCTA 4XWRA 1CJ2A 1GTHA 3QFAA 3I3LA 1O5WA 2QA2A 5ER0A 5KRQA 3KVEA 1ELIA 2GR0A 1BZLA 4P9SA 5GRTA 3V3NA 2C70A 1Q9IA 3K7MX 5IQ1A 4J2WA 1HYUA 1VRQB 1ZX9A 3LADA 3NYEA 3F8RA 2BC0A 3QFBA 5FS9A 3T0KA 5BVAA 1GRFA 1ZKQA 3NT6A 5BRTA 4JN9A 1PBCA 1ZMCA 4ZCCA 1MOKA 2GR3A 2VZ2A 2VQBA 2R9ZA 4GDEA 4JQ9A 3T14A 1N4VA 2JB1A 4UDRA 3CPIG 4A99A 2FJBA 2R4EA 4XWZA 3AWIA 1GRHA 4YTPA 3M12A 4NTCA 4U2TA 4AT2A 2XVFA 1AOGA 3R9UA 1Z6LA 2V3AA 3M0OA 3FBSA 4C3YA 1GREA 2B7RA 3NRNA 2GQFA 1F6MA 1P2EA 2JKCA 3KPFA 5EOWA 4B68A 5KXJA 3CGEA 5EBKA 5BULA 4NTEA 2WP6A 2YG5A 3DA1A 2WETA 4LA1A 1KNRA 2WS3A 3AD7B 3DJEA 2R46A 1QLBA 3PVCA 4B63A 1S3BA 3CGDA 1B8SA 3UKHA 2BCPA 1LQUA 1F8RA 2ARDA 2R0CA 3UP5A 2ZZ0A 1GV4A 2YVGA 1CC2A 1O94A 2VVLG 3AE2A 2PYXA 3PS9A 3NHOX 4H4PA 1FCDA 3KLJA 4B66A 3KU9A 2XCGA 2YAUA 3ABVA 4OPIA 1CC4A 3UCLA 2IVEA 3NIXA 2BXSA 5FS8A 4DSGA 1CJ3A 5HXIA 3ATRA 5JCLA 4Z25A 3DJDA 3RHAA 3ALMA 5LV9A 4H2NA 1S2YA 3ISHA 2WU5A 4Z24A 3GRSA 3F8DA 2WOWA 3NN6X 2NVKX 1Y0PA 2C4CA 3IF9A 1TDNA 2BABA 3H4KA 4X9MA 3ICTA 2VQ7A 3V76A 5KMQA 1XDIA 2V61A 2Q6UA 4YSYA 1F8WA 3EANA 2V6OA 3QVRA 5IQ4A 3SX6A 3M13A 1EL7A 1H84A 3E1TA 3GYXA 4CY6A 4GR1A 1ZP0A 3UOYA 4D03A 4G6HA 4H4WA 2YLSA 1JRZA 1GETA 4OPGA 2DKIA 2H89A 2QCUA 2WHDA 3P4SA 1NHQA 3L1RA 4NWZA 4BJYA 3AE5A 2B76A 4I59A 1CBOA 1NHPA 2A8XA 4LIIA 5KWFA 2X8CA 2C72A 3AEGA 5JCNA 3GWFA 3FPZA 4YWOA 4Z43A 5FS6A 4ZCDA 2QA1A 5KMRA 3UKFA 1N1PA 3SZ0A 1PHHA 2XLTA 2GMHA 3CTYA 2W0HA 1L9CA 2Z5XA 4UP3A 2C7GA 3VRAA 4OPLA 4YKGA 1X31B 3SGLA 5BUKA 3RNMA 1JEHA 5L46A 3UOZA 3AEBA 4OVIA 3NTAA 1JU2A 4A65A 3DH9A 2R0GA 3ALLA 3DGHA 4H2RA 1F8SA 1K0IA 1ONFA 4GUVA 1H82A 1PJ6A 1D4DA 4U8NA 2I0ZA 1TDEA 1DXLA 1LTXR 1IUVA 1Q1RA 1REOA 1KF6A 4AP1A 3UTHA 1EL8A 4PAAA 4B64A 1GRGA 4X9NA 1GEUA 3O0HA 4JNAA 2F5ZA 4EMJA 3SZWA 2C66A 1IUSA 2YQUA 3SZCA 3AE7A 2ACZA 2WBAA 3DMEA 2BK3A 4LU6A 1PS9A 3SYIA 4J56A 4CRTA 2GH5A 2O9ZA 3LXDA 2EQ7A 3CIRA 3SXIA 3CNPA 4CNKA 2BCGG 2YLZA 2XFQA 1K0LA 2VVMA 3C96A 3V3OA 3IWAA 1GOSA 4A79A 4NZHA 3NYCA 2E5VA 4B65A 4H4RA 2DKHA 2TMDA 3UP4A 2R45A 1P2HA 3HYXA 1Y56B 2Y6QA 3WE0A 3AEAA 2C75A 2YR4A 1IUTA 2A87A 3QJ4A 1VG0A 1OJCA 3CPJG 4O5QA 4YSZA 1PXCA 1K0JA 4ECHA 4U8OA 3EF6A 2TPRA 2OAMA 5J60A 3NK0X 1VG9A 1ZK7A 2WPEA 3CMMA 3DJJA 2OALA 1DJQA 4UDQA 3T2KA 3D1CA 3AE8A 3P4PA 1PJ7A 2JBVA 2X99A 1L9EA 1KSUA 1QO8A 1GRBA 1EL5A 2Q7VA 2YLWA 4HA6A 1B5QA 5J7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R0P A;  4J57 A;  2B9X A;  2YR6 A;  3BI2 A;  3P4R A;  4U8K A;  3IHM A;  4KPR A;  1CJ4 A;  1JOA A;  1GSN A;  2XFO A;  4Y4N A;  5TR3 A;  2E1M A;  1NHS A;  3RP7 A;  3NNE A;  3QSM A;  4D04 A;  1K4Q A;  2EQ9 A;  1FEA A;  1KDG A;  1GRT A;  4UDP A;  2YG4 A;  1L0V A;  2APG A;  4JY2 A;  4WX1 A;  4JNQ A;  1KFY A;  3GRT A;  2GRT A;  2WP9 A;  3CND A;  3GMC A;  1H7W A;  2VRM A;  3AEC A;  3RP6 A;  1LJ1 A;  4H4Z A;  1ZOV A;  3UTG A;  5JCI A;  3UKA A;  4APN A;  2BXR A;  2X3N A;  4H4U A;  4IA6 A;  5M10 A;  4ICY A;  3UKP A;  2V60 A;  1TRB A;  3GMB A;  1SEZ A;  1O95 A;  3CGB A;  1CHU A;  2Q0L A;  3II4 A;  3UTE A;  4A9W A;  2WDV A;  2WDQ A;  2YVJ A;  3SQP A;  2WOV A;  2WP5 A;  3CNT A;  1E1M A;  3AE3 A;  3QSS A;  2FJD A;  4NEV A;  1IUU A;  4TLX A;  3T37 A;  4U8J A;  2BS3 A;  2X8G A;  3C4A A;  2HQM A;  2CFY A;  4H50 A;  5EB4 A;  4AOS A;  4EM4 A;  1M6I A;  2UZZ A;  1H83 A;  2GV8 A;  4N9X A;  5EB5 A;  1LVL A;  3P1W A;  5CKU A;  2BK4 A;  2R4J A;  4I58 A;  4EMW A;  1ZY8 A;  2GB0 A;  5KVI A;  2BC1 A;  3CNJ A;  1E39 A;  2GMJ A;  1JNZ A;  3BNU A;  5M0Z A;  2WU2 A;  4A6N B;  3CN8 A;  1IUW A;  1GND A;  1DOC A;  3FG2 P;  4J33 A;  1QJD A;  4CCR A;  1H81 A;  4RSL A;  3NG7 X;  1L9D A;  4NEW A;  4E0V A;  1IUX A;  4EIQ A;  4NTD A;  4GF7 A;  1S2Q A;  3GWD A;  3BHK A;  2YM2 A;  4HB9 A;  3H8L A;  3UOV A;  4AOX A;  2C64 A;  1B4V A;  1DJN A;  2RGJ A;  3FIM B;  4J34 A;  1UKV G;  2XVH A;  5FMH A;  1D4E A;  4H2P A;  1Q1W A;  2JK6 A;  1PN0 A;  3NYF A;  4K5R A;  2BYB A;  4OPT A;  3UOX A;  4TLZ A;  2XLU A;  4EQR A;  1MXT A;  3LJP A;  3BI4 A;  1GT8 A;  3UKL A;  4H7U A;  4CNJ A;  2FBW A;  2VVL A;  3QSE A;  3AE4 A;  2GF3 A;  1PBE A;  1COY A;  3KD9 A;  4H4S A;  2YWL A;  1TYT A;  2EQ6 A;  1CF3 A;  4BK2 A;  1E1K A;  2BS2 A;  3AD9 B;  4H4X A;  1E6E A;  3NK1 X;  5HY5 A;  2BK5 A;  3DJG X;  1XAN A;  4K5S A;  1LQT A;  3RP8 A;  1EL9 A;  3KKJ A;  2XFP A;  4M52 A;  4ADW A;  2AR8 A;  1D5T A;  5U25 A;  4AP3 A;  4DSH A;  4FK1 A;  2XLS A;  3ALJ A;  2CDU A;  3AE9 A;  1FEB A;  3VQR A;  4TM4 A;  3DGZ A;  2C3D A;  5U63 A;  2A89 A;  1YQ4 A;  3ZYX A;  2BS4 A;  2GQW A;  3ICS A;  3VRD B;  4YT0 A;  3EAO A;  1RP0 A;  3SM8 A;  2AQJ A;  1E1L A;  1TDK A;  2GAG B;  1OJA A;  3AB1 A;  2IID A;  3S5W A;  3BNM A;  1NEK A;  2Q0K A;  4YTN A;  1GES A;  4TM1 A;  4CCQ A;  4OPC A;  2XVI A;  2RGH A;  3UTF A;  1NG3 A;  4JY3 A;  1F3P A;  3AYI A;  1BF3 A;  2B9W A;  4IVO B;  4EIP A;  3RED A;  2GR2 A;  3NH3 X;  4JDR A;  1ZDL A;  3LB8 A;  4GRT A;  4IA5 A;  1CL0 A;  4Z2T A;  4BV6 A;  1FEC A;  4K22 A;  2CUL A;  1DOB A;  3EPT A;  4RG3 A;  4TM0 A;  1NEN A;  1D7Y A;  4H4Y A;  1D7L A;  4ZN0 A;  4USQ A;  2JB3 A;  1LPF A;  3C4N A;  3PO7 A;  2B7S A;  4YSH A;  1BWC A;  3NK2 X;  1KSS A;  3OC4 A;  1FL2 A;  3AYL A;  1PBD A;  1ZOY A;  4H4T A;  2NPX A;  2GEW A;  3LZW A;  1IJH A;  3NGC X;  1DNC A;  4EQW A;  2YM1 A;  2AAQ A;  2OA1 A;  4EM3 A;  2XVJ A;  3S61 A;  4A6N A;  4A7A A;  3Q6J A;  3B6D A;  4YKF A;  1PBF A;  5HYM A;  3DK8 A;  1D4C A;  2OLN A;  4BK1 A;  5IPY A;  2FJA A;  4U8L A;  2C76 A;  2Z5Y A;  1RYI A;  3LZX A;  2X8H A;  3COX A;  5GSN A;  1RSG A;  3G5S A;  5C3J A;  2XFN A;  4DGK A;  4GCM A;  1XPQ A;  4AT0 A;  2E4G A;  2RAB A;  1GXF A;  2WOI A;  4IV9 A;  5FS7 A;  3SFE A;  4A5L A;  4H2Q A;  4B1B A;  4REK A;  5KOX A;  1TYP A;  4J31 A;  3ADA B;  4C77 A;  2IVD A;  2WEU A;  1GTE A;  3P4Q A;  3GDN A;  4BK3 A;  2XYO A;  4C5O A;  5JCM A;  4O5U A;  4J36 A;  3AYJ A;  3GD3 A;  2C3C A;  1PJ5 A;  4USR A;  4Y4L A;  4Y4M A;  3IHG A;  2BA9 A;  5JCK A;  2WES A;  1YQZ A;  1TDF A;  1N4U A;  3CGC A;  4EQX A;  2YG3 A;  4Z2R A;  1JRY A;  1PXA A;  4OPD A;  5KOW A;  4C74 A;  5U1O A;  3URH A;  3ATQ A;  3AXB A;  4YSX A;  4GDP A;  3AE1 A;  3ITJ A;  1GPE A;  4PAB A;  2ZBW A;  5HHF A;  1EBD A;  4B67 A;  2XLP A;  2YLR A;  3G5Q A;  3QVP A;  1KNP A;  1PBB A;  2WDR A;  2JAE A;  1H86 A;  4EQS A;  3JSK A;  3IC9 A;  1DOD A;  2XLR A;  2ZZC A;  3ZDN A;  4U2S A;  3DK9 A;  3G5R A;  1S3E A;  3L8K A;  4FDC B;  2B9Y A;  1NG4 A;  2ZZB A;  2C73 A;  3D8X A;  1PXB A;  1Y56 A;  4U8I A;  5CQF A;  1BKW A;  1BGJ A;  1M64 A;  1GAL A;  3LOV A;  2Y6R A;  2V3B A;  4Z44 A;  2VOU A;  1OJT A;  2XDO A;  3HZL A;  2YG7 A;  1B37 A;  2FJE A;  2RGO A;  2YVF A;  2YG6 A;  1NPX A;  3GDP A;  4K8D A;  1YKJ A;  2GAH B;  1XHC A;  4C3X A;  3I6D A;  4Z2U A;  1DOE A;  3VR8 A;  2WQY A;  1CJC A;  1V59 A;  3NLC A;  4B69 A;  3AEE A;  1ZMD A;  2X50 A;  4TM3 A;  1E7P A;  1NAA A;  3K7T A;  1LV0 A;  1YY5 A;  2GVC A;  1MO9 A;  2XVE A;  3NKS A;  4FK1 C;  3UKK A;  3AEF A;  1CC6 A;  3NTD A;  4H4Q A;  4BJZ A;  3SFD A;  1H6V A;  3VRB A;  2H88 A;  2CVJ A;  3FMW A;  3BI5 A;  3K7Q X;  2YLT A;  2GR1 A;  1E1N A;  2WPF A;  3CPH G;  3K30 A;  2VRL A;  3UKQ A;  3B3R A;  3BHF A;  4U2L A;  3CNS A;  4EMI A;  2WPC A;  3GYJ A;  4YTM A;  4CBQ A;  2EQ8 A;  4CY8 A;  3GYI A;  3AE6 A;  1N4W A;  5C2T A;  4DNA A;  1GER A;  4H4V A;  2OLO A;  3ICR A;  4FX9 A;  4K7Z A;  2C67 A;  2PHH A;  2C65 A;  1VDC A;  2YLX A;  4MJW A;  1JRX A;  1OJD A;  2JB2 A;  3AD8 B;  3DK4 A;  3OZ2 A;  4OCG A;  4U8P A;  3F8P A;  4RG4 A;  1JNR A;  1H7X A;  4IVM B;  1OJ9 A;  4U8M A;  1PDH A;  1TDO A;  4XXG A;  5KVH A;  1NHR A;  2YR5 A;  3KA7 A;  4KX6 A;  3H8I A;  4OPU A;  1FOH A;  4Z26 A;  3VR9 A;  2BAC A;  3NN0 X;  2J3N A;  3GSI A;  1NDA A;  1W4X A;  2XFU A;  4YXD A;  3P9U A;  2QAE A;  1VQW A;  1GRA A;  3AED A;  4K2X A;  3GD4 A;  3Q9T A;  2V5Z A;  4BUR A;  5DBJ A;  1YQ3 A;  4X4J A;  1BGN A;  4WCT A;  4XWR A;  1CJ2 A;  1GTH A;  3QFA A;  3I3L A;  1O5W A;  2QA2 A;  5ER0 A;  5KRQ A;  3KVE A;  1ELI A;  2GR0 A;  1BZL A;  4P9S A;  5GRT A;  3V3N A;  2C70 A;  1Q9I A;  3K7M X;  5IQ1 A;  4J2W A;  1HYU A;  1VRQ B;  1ZX9 A;  3LAD A;  3NYE A;  3F8R A;  2BC0 A;  3QFB A;  5FS9 A;  5BVA A;  1GRF A;  1ZKQ A;  3NT6 A;  5BRT A;  4JN9 A;  1PBC A;  1ZMC A;  4ZCC A;  1MOK A;  2GR3 A;  2VZ2 A;  2VQB A;  2R9Z A;  4GDE A;  4JQ9 A;  1N4V A;  2JB1 A;  4UDR A;  3CPI G;  4A99 A;  2FJB A;  2R4E A;  4XWZ A;  3AWI A;  1GRH A;  4YTP A;  3M12 A;  4NTC A;  4U2T A;  4AT2 A;  2XVF A;  1AOG A;  3R9U A;  1Z6L A;  2V3A A;  3M0O A;  3FBS A;  4C3Y A;  1GRE A;  2B7R A;  3NRN A;  2GQF A;  1F6M A;  1P2E A;  2JKC A;  3KPF A;  5EOW A;  4B68 A;  5KXJ A;  3CGE A;  5EBK A;  5BUL A;  4NTE A;  2WP6 A;  2YG5 A;  3DA1 A;  2WET A;  4LA1 A;  1KNR A;  2WS3 A;  3AD7 B;  3DJE A;  2R46 A;  1QLB A;  3PVC A;  4B63 A;  1S3B A;  3CGD A;  1B8S A;  3UKH A;  2BCP A;  1LQU A;  1F8R A;  2ARD A;  2R0C A;  3UP5 A;  2ZZ0 A;  1GV4 A;  2YVG A;  1CC2 A;  1O94 A;  2VVL G;  3AE2 A;  2PYX A;  3PS9 A;  3NHO X;  4H4P A;  1FCD A;  3KLJ A;  4B66 A;  3KU9 A;  2XCG A;  2YAU A;  3ABV A;  4OPI A;  1CC4 A;  3UCL A;  2IVE A;  3NIX A;  2BXS A;  5FS8 A;  4DSG A;  1CJ3 A;  5HXI A;  3ATR A;  5JCL A;  4Z25 A;  3DJD A;  3RHA A;  3ALM A;  5LV9 A;  4H2N A;  1S2Y A;  3ISH A;  2WU5 A;  4Z24 A;  3GRS A;  3F8D A;  2WOW A;  3NN6 X;  2NVK X;  1Y0P A;  3IF9 A;  1TDN A;  2BAB A;  3H4K A;  4X9M A;  3ICT A;  2VQ7 A;  3V76 A;  1XDI A;  2V61 A;  2Q6U A;  4YSY A;  1F8W A;  3EAN A;  2V6O A;  3QVR A;  5IQ4 A;  3M13 A;  1EL7 A;  1H84 A;  3E1T A;  4CY6 A;  4D03 A;  4GR1 A;  1ZP0 A;  3UOY A;  4H4W A;  2YLS A;  1JRZ A;  1GET A;  4OPG A;  2DKI A;  2H89 A;  2QCU A;  2WHD A;  3P4S A;  1NHQ A;  3L1R A;  4BJY A;  3AE5 A;  2B76 A;  4I59 A;  1CBO A;  1NHP A;  2A8X A;  4LII A;  5KWF A;  2X8C A;  2C72 A;  3AEG A;  5JCN A;  3GWF A;  3FPZ A;  4YWO A;  4Z43 A;  5FS6 A;  4ZCD A;  2QA1 A;  3UKF A;  1N1P A;  1PHH A;  2XLT A;  2GMH A;  3CTY A;  2W0H A;  1L9C A;  2Z5X A;  4UP3 A;  2C7G A;  3VRA A;  4OPL A;  4YKG A;  1X31 B;  3SGL A;  5BUK A;  3RNM A;  1JEH A;  5L46 A;  3UOZ A;  3AEB A;  4OVI A;  3NTA A;  1JU2 A;  4A65 A;  3DH9 A;  2R0G A;  3ALL A;  3DGH A;  4H2R A;  1F8S A;  1K0I A;  1ONF A;  4GUV A;  1H82 A;  1PJ6 A;  1D4D A;  4U8N A;  2I0Z A;  1TDE A;  1DXL A;  1LTX R;  1IUV A;  1Q1R A;  1REO A;  1KF6 A;  4AP1 A;  3UTH A;  1EL8 A;  4PAA A;  4B64 A;  1GRG A;  4X9N A;  1GEU A;  3O0H A;  4JNA A;  2F5Z A;  4EMJ A;  2C66 A;  1IUS A;  2YQU A;  3AE7 A;  2ACZ A;  2WBA A;  3DME A;  2BK3 A;  4LU6 A;  1PS9 A;  4CRT A;  4J56 A;  2GH5 A;  2O9Z A;  3LXD A;  2EQ7 A;  3CIR A;  3CNP A;  4CNK A;  2BCG G;  2YLZ A;  2XFQ A;  1K0L A;  2VVM A;  3C96 A;  3V3O A;  3IWA A;  1GOS A;  4A79 A;  4NZH A;  3NYC A;  2E5V A;  4B65 A;  4H4R A;  2DKH A;  2TMD A;  3UP4 A;  2R45 A;  1P2H A;  1Y56 B;  2Y6Q A;  3WE0 A;  3AEA A;  2C75 A;  2YR4 A;  1IUT A;  2A87 A;  3QJ4 A;  1VG0 A;  1OJC A;  3CPJ G;  4O5Q A;  4YSZ A;  1PXC A;  1K0J A;  4ECH A;  4U8O A;  3EF6 A;  2TPR A;  2OAM A;  5J60 A;  3NK0 X;  1VG9 A;  1ZK7 A;  2WPE A;  3DJJ A;  2OAL A;  1DJQ A;  4UDQ A;  3D1C A;  3AE8 A;  3P4P A;  1PJ7 A;  2JBV A;  2X99 A;  1L9E A;  1KSU A;  1QO8 A;  1GRB A;  1EL5 A;  2Q7V A;  2YLW A;  4HA6 A;  1B5Q A;  5J7X A; 
#chains in the Genus database with same CATH topology
 2R0P A;  4J57 A;  2B9X A;  2YR6 A;  3BI2 A;  3P4R A;  4U8K A;  3IHM A;  4KPR A;  1CJ4 A;  1JOA A;  1GSN A;  2XFO A;  4Y4N A;  4GAP A;  5TR3 A;  2E1M A;  1NHS A;  3RP7 A;  3NNE A;  3QSM A;  3T31 A;  4D04 A;  1K4Q A;  2EQ9 A;  1FEA A;  1KDG A;  1GRT A;  4UDP A;  2YG4 A;  1L0V A;  2APG A;  4JY2 A;  4WX1 A;  4JNQ A;  1KFY A;  3GRT A;  2GRT A;  2WP9 A;  3CND A;  3GMC A;  1H7W A;  2VRM A;  3AEC A;  3RP6 A;  1LJ1 A;  4H4Z A;  1ZOV A;  3UTG A;  5JCI A;  3UKA A;  4APN A;  2BXR A;  2X3N A;  4H4U A;  4IA6 A;  5M10 A;  4ICY A;  3UKP A;  2V60 A;  1TRB A;  3GMB A;  1SEZ A;  1O95 A;  3CGB A;  1CHU A;  2Q0L A;  3II4 A;  3UTE A;  4A9W A;  2WDV A;  2WDQ A;  2YVJ A;  4G6G A;  3SQP A;  2WOV A;  2WP5 A;  3CNT A;  1E1M A;  3AE3 A;  3QSS A;  2FJD A;  4NEV A;  1IUU A;  4TLX A;  3T37 A;  4U8J A;  2BS3 A;  2X8G A;  3C4A A;  2HQM A;  2CFY A;  4H50 A;  5EB4 A;  4AOS A;  4EM4 A;  1M6I A;  2UZZ A;  1H83 A;  2GV8 A;  4N9X A;  5EB5 A;  1LVL A;  3P1W A;  5CKU A;  2BK4 A;  3KPK A;  2R4J A;  4I58 A;  4EMW A;  1ZY8 A;  2GB0 A;  5KVI A;  2BC1 A;  3CNJ A;  1E39 A;  2GMJ A;  1JNZ A;  3BNU A;  5M0Z A;  2WU2 A;  4A6N B;  4G9K A;  3CN8 A;  1IUW A;  1GND A;  1DOC A;  3FG2 P;  4J33 A;  1QJD A;  4II2 A;  1H81 A;  4RSL A;  3NG7 X;  1L9D A;  4NEW A;  4CCR A;  4E0V A;  1IUX A;  4EIQ A;  4NTD A;  4GF7 A;  1S2Q A;  3GWD A;  3BHK A;  2YM2 A;  4HB9 A;  3H8L A;  3UOV A;  4AOX A;  2C64 A;  1B4V A;  1DJN A;  2RGJ A;  3FIM B;  4J34 A;  1UKV G;  2XVH A;  5FMH A;  1D4E A;  4H2P A;  1Q1W A;  2JK6 A;  1PN0 A;  3NYF A;  4K5R A;  2BYB A;  4OPT A;  3UOX A;  4TLZ A;  2XLU A;  4EQR A;  1MXT A;  3LJP A;  3BI4 A;  1GT8 A;  3UKL A;  4H7U A;  4CNJ A;  2FBW A;  2VVL A;  3HYV A;  3QSE A;  3AE4 A;  2GF3 A;  1PBE A;  1COY A;  3KD9 A;  4H4S A;  2YWL A;  1TYT A;  2EQ6 A;  1CF3 A;  4BK2 A;  1E1K A;  2BS2 A;  3AD9 B;  4H4X A;  1E6E A;  3NK1 X;  5HY5 A;  2BK5 A;  3DJG X;  1XAN A;  4K5S A;  1LQT A;  3RP8 A;  1EL9 A;  3KKJ A;  2XFP A;  4M52 A;  4ADW A;  2AR8 A;  1D5T A;  5U25 A;  4AP3 A;  4DSH A;  4FK1 A;  2XLS A;  3ALJ A;  2CDU A;  3AE9 A;  4II3 A;  1FEB A;  3SY4 A;  3VQR A;  4TM4 A;  3DGZ A;  4NNJ A;  2C3D A;  5U63 A;  2A89 A;  1YQ4 A;  3ZYX A;  2BS4 A;  2GQW A;  3ICS A;  3T2Y A;  3VRD B;  4YT0 A;  3EAO A;  1RP0 A;  3SM8 A;  2AQJ A;  1E1L A;  1TDK A;  2GAG B;  1OJA A;  3AB1 A;  2IID A;  3S5W A;  3BNM A;  1NEK A;  2Q0K A;  4YTN A;  1GES A;  4TM1 A;  4CCQ A;  4OPC A;  2XVI A;  2RGH A;  3UTF A;  1NG3 A;  4JY3 A;  1F3P A;  3AYI A;  1BF3 A;  2B9W A;  4IVO B;  4EIP A;  3RED A;  2GR2 A;  3NH3 X;  4JDR A;  1ZDL A;  3LB8 A;  4GRT A;  4IA5 A;  1CL0 A;  4Z2T A;  4BV6 A;  1FEC A;  4K22 A;  2CUL A;  1DOB A;  3EPT A;  4RG3 A;  4TM0 A;  1NEN A;  1D7Y A;  2BRA A;  4H4Y A;  1D7L A;  4ZN0 A;  4USQ A;  2JB3 A;  1LPF A;  3C4N A;  3PO7 A;  2B7S A;  4YSH A;  1BWC A;  3NK2 X;  1KSS A;  3HYW A;  3OC4 A;  1FL2 A;  3AYL A;  1PBD A;  1ZOY A;  4H4T A;  2NPX A;  2GEW A;  3LZW A;  1IJH A;  3NGC X;  1DNC A;  4EQW A;  2YM1 A;  2AAQ A;  2OA1 A;  4EM3 A;  2XVJ A;  3S61 A;  4A6N A;  3SZF A;  4A7A A;  3Q6J A;  3B6D A;  4YKF A;  1PBF A;  5HYM A;  3DK8 A;  1D4C A;  2OLN A;  4BK1 A;  5IPY A;  2FJA A;  4U8L A;  2C76 A;  2Z5Y A;  1RYI A;  3LZX A;  4G73 A;  2X8H A;  3COX A;  5GSN A;  1RSG A;  3G5S A;  5C3J A;  5KMS A;  2XFN A;  4DGK A;  4GCM A;  1XPQ A;  4AT0 A;  2E4G A;  2RAB A;  1GXF A;  2WOI A;  4IV9 A;  5FS7 A;  4GAV A;  3SFE A;  4A5L A;  4H2Q A;  4B1B A;  4REK A;  5KOX A;  1TYP A;  4J31 A;  3ADA B;  4C77 A;  2IVD A;  2WEU A;  1GTE A;  3P4Q A;  3GDN A;  4BK3 A;  2XYO A;  4C5O A;  5JCM A;  4O5U A;  2BRY A;  3AYJ A;  3GD3 A;  2C3C A;  1PJ5 A;  4J36 A;  4USR A;  4Y4L A;  4Y4M A;  4G74 A;  3IHG A;  2BA9 A;  5JCK A;  2WES A;  1YQZ A;  1TDF A;  1N4U A;  3CGC A;  4EQX A;  2YG3 A;  4Z2R A;  1JRY A;  1PXA A;  4OPD A;  5KOW A;  4C74 A;  5U1O A;  3URH A;  3ATQ A;  3AXB A;  4YSX A;  4GDP A;  3AE1 A;  3ITJ A;  1GPE A;  4PAB A;  2ZBW A;  5HHF A;  1EBD A;  4B67 A;  2XLP A;  2YLR A;  3G5Q A;  3QVP A;  1KNP A;  1PBB A;  2WDR A;  2JAE A;  1H86 A;  4EQS A;  3JSK A;  3IC9 A;  1DOD A;  2XLR A;  2ZZC A;  3ZDN A;  4U2S A;  3DK9 A;  3G5R A;  1S3E A;  3L8K A;  4FDC B;  2B9Y A;  1NG4 A;  2ZZB A;  2C73 A;  3D8X A;  5KNL A;  1PXB A;  1Y56 A;  4U8I A;  5CQF A;  1BKW A;  1BGJ A;  1M64 A;  1GAL A;  3LOV A;  2Y6R A;  2V3B A;  4Z44 A;  2VOU A;  1OJT A;  2XDO A;  3HZL A;  5KMP A;  2YG7 A;  1B37 A;  2FJE A;  2RGO A;  3T2Z A;  2YVF A;  2YG6 A;  1NPX A;  3GDP A;  4K8D A;  1YKJ A;  2GAH B;  1XHC A;  4C3X A;  3I6D A;  4Z2U A;  1DOE A;  3VR8 A;  2WQY A;  1CJC A;  1V59 A;  3NLC A;  4B69 A;  3AEE A;  1ZMD A;  2X50 A;  4TM3 A;  1E7P A;  1NAA A;  3K7T A;  1LV0 A;  1YY5 A;  2GVC A;  1MO9 A;  2XVE A;  3NKS A;  4FK1 C;  3UKK A;  3AEF A;  1CC6 A;  3NTD A;  4H4Q A;  4BJZ A;  3SFD A;  1H6V A;  3VRB A;  2H88 A;  2CVJ A;  3FMW A;  3BI5 A;  3K7Q X;  2YLT A;  2GR1 A;  1E1N A;  2WPF A;  3CPH G;  3K30 A;  2VRL A;  3UKQ A;  3B3R A;  3BHF A;  4U2L A;  3CNS A;  4EMI A;  2WPC A;  3GYJ A;  4YTM A;  4CBQ A;  2EQ8 A;  4CY8 A;  3GYI A;  3AE6 A;  1N4W A;  5C2T A;  4DNA A;  1GER A;  4H4V A;  2OLO A;  3ICR A;  4FX9 A;  4K7Z A;  2C67 A;  2PHH A;  2C65 A;  1VDC A;  2YLX A;  4MJW A;  1JRX A;  1OJD A;  2JB2 A;  3AD8 B;  3DK4 A;  3OZ2 A;  4OCG A;  4U8P A;  3F8P A;  4RG4 A;  1JNR A;  1H7X A;  4IVM B;  1OJ9 A;  4U8M A;  1PDH A;  1TDO A;  4XXG A;  5KVH A;  1NHR A;  2YR5 A;  3KA7 A;  4KX6 A;  3H8I A;  4OPU A;  1FOH A;  4Z26 A;  3VR9 A;  2BAC A;  3NN0 X;  2J3N A;  3GSI A;  1NDA A;  1W4X A;  2XFU A;  4YXD A;  3P9U A;  2QAE A;  1VQW A;  1GRA A;  3AED A;  4K2X A;  3GD4 A;  3Q9T A;  2V5Z A;  4BUR A;  5DBJ A;  1YQ3 A;  4X4J A;  1BGN A;  4WCT A;  4XWR A;  1CJ2 A;  1GTH A;  3QFA A;  3I3L A;  1O5W A;  2QA2 A;  5ER0 A;  5KRQ A;  3KVE A;  1ELI A;  2GR0 A;  1BZL A;  4P9S A;  5GRT A;  3V3N A;  2C70 A;  1Q9I A;  3K7M X;  5IQ1 A;  4J2W A;  1HYU A;  1VRQ B;  1ZX9 A;  3LAD A;  3NYE A;  3F8R A;  2BC0 A;  3QFB A;  5FS9 A;  3T0K A;  5BVA A;  1GRF A;  1ZKQ A;  3NT6 A;  5BRT A;  4JN9 A;  1PBC A;  1ZMC A;  4ZCC A;  1MOK A;  2GR3 A;  2VZ2 A;  2VQB A;  2R9Z A;  4GDE A;  4JQ9 A;  3T14 A;  1N4V A;  2JB1 A;  4UDR A;  3CPI G;  4A99 A;  2FJB A;  2R4E A;  4XWZ A;  3AWI A;  1GRH A;  4YTP A;  3M12 A;  4NTC A;  4U2T A;  4AT2 A;  2XVF A;  1AOG A;  3R9U A;  1Z6L A;  2V3A A;  3M0O A;  3FBS A;  4C3Y A;  1GRE A;  2B7R A;  3NRN A;  2GQF A;  1F6M A;  1P2E A;  2JKC A;  3KPF A;  5EOW A;  4B68 A;  5KXJ A;  3CGE A;  5EBK A;  5BUL A;  4NTE A;  2WP6 A;  2YG5 A;  3DA1 A;  2WET A;  4LA1 A;  1KNR A;  2WS3 A;  3AD7 B;  3DJE A;  2R46 A;  1QLB A;  3PVC A;  4B63 A;  1S3B A;  3CGD A;  1B8S A;  3UKH A;  2BCP A;  1LQU A;  1F8R A;  2ARD A;  2R0C A;  3UP5 A;  2ZZ0 A;  1GV4 A;  2YVG A;  1CC2 A;  1O94 A;  2VVL G;  3AE2 A;  2PYX A;  3PS9 A;  3NHO X;  4H4P A;  1FCD A;  3KLJ A;  4B66 A;  3KU9 A;  2XCG A;  2YAU A;  3ABV A;  4OPI A;  1CC4 A;  3UCL A;  2IVE A;  3NIX A;  2BXS A;  5FS8 A;  4DSG A;  1CJ3 A;  5HXI A;  3ATR A;  5JCL A;  4Z25 A;  3DJD A;  3RHA A;  3ALM A;  5LV9 A;  4H2N A;  1S2Y A;  3ISH A;  2WU5 A;  4Z24 A;  3GRS A;  3F8D A;  2WOW A;  3NN6 X;  2NVK X;  1Y0P A;  2C4C A;  3IF9 A;  1TDN A;  2BAB A;  3H4K A;  4X9M A;  3ICT A;  2VQ7 A;  3V76 A;  5KMQ A;  1XDI A;  2V61 A;  2Q6U A;  4YSY A;  1F8W A;  3EAN A;  2V6O A;  3QVR A;  5IQ4 A;  3SX6 A;  3M13 A;  1EL7 A;  1H84 A;  3E1T A;  3GYX A;  4CY6 A;  4GR1 A;  1ZP0 A;  3UOY A;  4D03 A;  4G6H A;  4H4W A;  2YLS A;  1JRZ A;  1GET A;  4OPG A;  2DKI A;  2H89 A;  2QCU A;  2WHD A;  3P4S A;  1NHQ A;  3L1R A;  4NWZ A;  4BJY A;  3AE5 A;  2B76 A;  4I59 A;  1CBO A;  1NHP A;  2A8X A;  4LII A;  5KWF A;  2X8C A;  2C72 A;  3AEG A;  5JCN A;  3GWF A;  3FPZ A;  4YWO A;  4Z43 A;  5FS6 A;  4ZCD A;  2QA1 A;  5KMR A;  3UKF A;  1N1P A;  3SZ0 A;  1PHH A;  2XLT A;  2GMH A;  3CTY A;  2W0H A;  1L9C A;  2Z5X A;  4UP3 A;  2C7G A;  3VRA A;  4OPL A;  4YKG A;  1X31 B;  3SGL A;  5BUK A;  3RNM A;  1JEH A;  5L46 A;  3UOZ A;  3AEB A;  4OVI A;  3NTA A;  1JU2 A;  4A65 A;  3DH9 A;  2R0G A;  3ALL A;  3DGH A;  4H2R A;  1F8S A;  1K0I A;  1ONF A;  4GUV A;  1H82 A;  1PJ6 A;  1D4D A;  4U8N A;  2I0Z A;  1TDE A;  1DXL A;  1LTX R;  1IUV A;  1Q1R A;  1REO A;  1KF6 A;  4AP1 A;  3UTH A;  1EL8 A;  4PAA A;  4B64 A;  1GRG A;  4X9N A;  1GEU A;  3O0H A;  4JNA A;  2F5Z A;  4EMJ A;  3SZW A;  2C66 A;  1IUS A;  2YQU A;  3SZC A;  3AE7 A;  2ACZ A;  2WBA A;  3DME A;  2BK3 A;  4LU6 A;  1PS9 A;  3SYI A;  4J56 A;  4CRT A;  2GH5 A;  2O9Z A;  3LXD A;  2EQ7 A;  3CIR A;  3SXI A;  3CNP A;  4CNK A;  2BCG G;  2YLZ A;  2XFQ A;  1K0L A;  2VVM A;  3C96 A;  3V3O A;  3IWA A;  1GOS A;  4A79 A;  4NZH A;  3NYC A;  2E5V A;  4B65 A;  4H4R A;  2DKH A;  2TMD A;  3UP4 A;  2R45 A;  1P2H A;  3HYX A;  1Y56 B;  2Y6Q A;  3WE0 A;  3AEA A;  2C75 A;  2YR4 A;  1IUT A;  2A87 A;  3QJ4 A;  1VG0 A;  1OJC A;  3CPJ G;  4O5Q A;  4YSZ A;  1PXC A;  1K0J A;  4ECH A;  4U8O A;  3EF6 A;  2TPR A;  2OAM A;  5J60 A;  3NK0 X;  1VG9 A;  1ZK7 A;  2WPE A;  3CMM A;  3DJJ A;  2OAL A;  1DJQ A;  4UDQ A;  3T2K A;  3D1C A;  3AE8 A;  3P4P A;  1PJ7 A;  2JBV A;  2X99 A;  1L9E A;  1KSU A;  1QO8 A;  1GRB A;  1EL5 A;  2Q7V A;  2YLW A;  4HA6 A;  1B5Q A;  5J7X A; 
#chains in the Genus database with same CATH homology
 2R0P A;  4J57 A;  2B9X A;  2YR6 A;  3BI2 A;  3P4R A;  4U8K A;  3IHM A;  4KPR A;  1CJ4 A;  1JOA A;  1GSN A;  2XFO A;  4Y4N A;  4GAP A;  5TR3 A;  2E1M A;  1NHS A;  3RP7 A;  3NNE A;  3QSM A;  3T31 A;  4D04 A;  1K4Q A;  2EQ9 A;  1FEA A;  1KDG A;  1GRT A;  4UDP A;  2YG4 A;  1L0V A;  2APG A;  4JY2 A;  4WX1 A;  4JNQ A;  1KFY A;  3GRT A;  2GRT A;  2WP9 A;  3CND A;  3GMC A;  1H7W A;  2VRM A;  3AEC A;  3RP6 A;  1LJ1 A;  4H4Z A;  1ZOV A;  3UTG A;  5JCI A;  3UKA A;  4APN A;  2BXR A;  2X3N A;  4H4U A;  4IA6 A;  5M10 A;  4ICY A;  3UKP A;  2V60 A;  1TRB A;  3GMB A;  1SEZ A;  1O95 A;  3CGB A;  1CHU A;  2Q0L A;  3II4 A;  3UTE A;  4A9W A;  2WDV A;  2WDQ A;  2YVJ A;  4G6G A;  3SQP A;  2WOV A;  2WP5 A;  3CNT A;  1E1M A;  3AE3 A;  3QSS A;  2FJD A;  4NEV A;  1IUU A;  4TLX A;  3T37 A;  4U8J A;  2BS3 A;  2X8G A;  3C4A A;  2HQM A;  2CFY A;  4H50 A;  5EB4 A;  4AOS A;  4EM4 A;  1M6I A;  2UZZ A;  1H83 A;  2GV8 A;  4N9X A;  5EB5 A;  1LVL A;  3P1W A;  5CKU A;  2BK4 A;  3KPK A;  2R4J A;  4I58 A;  4EMW A;  1ZY8 A;  2GB0 A;  5KVI A;  2BC1 A;  3CNJ A;  1E39 A;  2GMJ A;  1JNZ A;  3BNU A;  5M0Z A;  2WU2 A;  4A6N B;  4G9K A;  3CN8 A;  1IUW A;  1GND A;  1DOC A;  3FG2 P;  4J33 A;  1QJD A;  4II2 A;  1H81 A;  4RSL A;  3NG7 X;  1L9D A;  4NEW A;  4CCR A;  4E0V A;  1IUX A;  4EIQ A;  4NTD A;  4GF7 A;  1S2Q A;  3GWD A;  3BHK A;  2YM2 A;  4HB9 A;  3H8L A;  3UOV A;  4AOX A;  2C64 A;  1B4V A;  1DJN A;  2RGJ A;  3FIM B;  4J34 A;  1UKV G;  2XVH A;  5FMH A;  1D4E A;  4H2P A;  1Q1W A;  2JK6 A;  1PN0 A;  3NYF A;  4K5R A;  2BYB A;  4OPT A;  3UOX A;  4TLZ A;  2XLU A;  4EQR A;  1MXT A;  3LJP A;  3BI4 A;  1GT8 A;  3UKL A;  4H7U A;  4CNJ A;  2FBW A;  2VVL A;  3HYV A;  3QSE A;  3AE4 A;  2GF3 A;  1PBE A;  1COY A;  3KD9 A;  4H4S A;  2YWL A;  1TYT A;  2EQ6 A;  1CF3 A;  4BK2 A;  1E1K A;  2BS2 A;  3AD9 B;  4H4X A;  1E6E A;  3NK1 X;  5HY5 A;  2BK5 A;  3DJG X;  1XAN A;  4K5S A;  1LQT A;  3RP8 A;  1EL9 A;  3KKJ A;  2XFP A;  4M52 A;  4ADW A;  2AR8 A;  1D5T A;  5U25 A;  4AP3 A;  4DSH A;  4FK1 A;  2XLS A;  3ALJ A;  2CDU A;  3AE9 A;  4II3 A;  1FEB A;  3SY4 A;  3VQR A;  4TM4 A;  3DGZ A;  4NNJ A;  2C3D A;  5U63 A;  2A89 A;  1YQ4 A;  3ZYX A;  2BS4 A;  2GQW A;  3ICS A;  3T2Y A;  3VRD B;  4YT0 A;  3EAO A;  1RP0 A;  3SM8 A;  2AQJ A;  1E1L A;  1TDK A;  2GAG B;  1OJA A;  3AB1 A;  2IID A;  3S5W A;  3BNM A;  1NEK A;  2Q0K A;  4YTN A;  1GES A;  4TM1 A;  4CCQ A;  4OPC A;  2XVI A;  2RGH A;  3UTF A;  1NG3 A;  4JY3 A;  1F3P A;  3AYI A;  1BF3 A;  2B9W A;  4IVO B;  4EIP A;  3RED A;  2GR2 A;  3NH3 X;  4JDR A;  1ZDL A;  3LB8 A;  4GRT A;  4IA5 A;  1CL0 A;  4Z2T A;  4BV6 A;  1FEC A;  4K22 A;  2CUL A;  1DOB A;  3EPT A;  4RG3 A;  4TM0 A;  1NEN A;  1D7Y A;  2BRA A;  4H4Y A;  1D7L A;  4ZN0 A;  4USQ A;  2JB3 A;  1LPF A;  3C4N A;  3PO7 A;  2B7S A;  4YSH A;  1BWC A;  3NK2 X;  1KSS A;  3HYW A;  3OC4 A;  1FL2 A;  3AYL A;  1PBD A;  1ZOY A;  4H4T A;  2NPX A;  2GEW A;  3LZW A;  1IJH A;  3NGC X;  1DNC A;  4EQW A;  2YM1 A;  2AAQ A;  2OA1 A;  4EM3 A;  2XVJ A;  3S61 A;  4A6N A;  3SZF A;  4A7A A;  3Q6J A;  3B6D A;  4YKF A;  1PBF A;  5HYM A;  3DK8 A;  1D4C A;  2OLN A;  4BK1 A;  5IPY A;  2FJA A;  4U8L A;  2C76 A;  2Z5Y A;  1RYI A;  3LZX A;  4G73 A;  2X8H A;  3COX A;  5GSN A;  1RSG A;  3G5S A;  5C3J A;  5KMS A;  2XFN A;  4DGK A;  4GCM A;  1XPQ A;  4AT0 A;  2E4G A;  2RAB A;  1GXF A;  2WOI A;  4IV9 A;  5FS7 A;  4GAV A;  3SFE A;  4A5L A;  4H2Q A;  4B1B A;  4REK A;  5KOX A;  1TYP A;  4J31 A;  3ADA B;  4C77 A;  2IVD A;  2WEU A;  1GTE A;  3P4Q A;  3GDN A;  4BK3 A;  2XYO A;  4C5O A;  5JCM A;  4O5U A;  2BRY A;  3AYJ A;  3GD3 A;  2C3C A;  1PJ5 A;  4J36 A;  4USR A;  4Y4L A;  4Y4M A;  4G74 A;  3IHG A;  2BA9 A;  5JCK A;  2WES A;  1YQZ A;  1TDF A;  1N4U A;  3CGC A;  4EQX A;  2YG3 A;  4Z2R A;  1JRY A;  1PXA A;  4OPD A;  5KOW A;  4C74 A;  5U1O A;  3URH A;  3ATQ A;  3AXB A;  4YSX A;  4GDP A;  3AE1 A;  3ITJ A;  1GPE A;  4PAB A;  2ZBW A;  5HHF A;  1EBD A;  4B67 A;  2XLP A;  2YLR A;  3G5Q A;  3QVP A;  1KNP A;  1PBB A;  2WDR A;  2JAE A;  1H86 A;  4EQS A;  3JSK A;  3IC9 A;  1DOD A;  2XLR A;  2ZZC A;  3ZDN A;  4U2S A;  3DK9 A;  3G5R A;  1S3E A;  3L8K A;  4FDC B;  2B9Y A;  1NG4 A;  2ZZB A;  2C73 A;  3D8X A;  5KNL A;  1PXB A;  1Y56 A;  4U8I A;  5CQF A;  1BKW A;  1BGJ A;  1M64 A;  1GAL A;  3LOV A;  2Y6R A;  2V3B A;  4Z44 A;  2VOU A;  1OJT A;  2XDO A;  3HZL A;  5KMP A;  2YG7 A;  1B37 A;  2FJE A;  2RGO A;  3T2Z A;  2YVF A;  2YG6 A;  1NPX A;  3GDP A;  4K8D A;  1YKJ A;  2GAH B;  1XHC A;  4C3X A;  3I6D A;  4Z2U A;  1DOE A;  3VR8 A;  2WQY A;  1CJC A;  1V59 A;  3NLC A;  4B69 A;  3AEE A;  1ZMD A;  2X50 A;  4TM3 A;  1E7P A;  1NAA A;  3K7T A;  1LV0 A;  1YY5 A;  2GVC A;  1MO9 A;  2XVE A;  3NKS A;  4FK1 C;  3UKK A;  3AEF A;  1CC6 A;  3NTD A;  4H4Q A;  4BJZ A;  3SFD A;  1H6V A;  3VRB A;  2H88 A;  2CVJ A;  3FMW A;  3BI5 A;  3K7Q X;  2YLT A;  2GR1 A;  1E1N A;  2WPF A;  3CPH G;  3K30 A;  2VRL A;  3UKQ A;  3B3R A;  3BHF A;  4U2L A;  3CNS A;  4EMI A;  2WPC A;  3GYJ A;  4YTM A;  4CBQ A;  2EQ8 A;  4CY8 A;  3GYI A;  3AE6 A;  1N4W A;  5C2T A;  4DNA A;  1GER A;  4H4V A;  2OLO A;  3ICR A;  4FX9 A;  4K7Z A;  2C67 A;  2PHH A;  2C65 A;  1VDC A;  2YLX A;  4MJW A;  1JRX A;  1OJD A;  2JB2 A;  3AD8 B;  3DK4 A;  3OZ2 A;  4OCG A;  4U8P A;  3F8P A;  4RG4 A;  1JNR A;  1H7X A;  4IVM B;  1OJ9 A;  4U8M A;  1PDH A;  1TDO A;  4XXG A;  5KVH A;  1NHR A;  2YR5 A;  3KA7 A;  4KX6 A;  3H8I A;  4OPU A;  1FOH A;  4Z26 A;  3VR9 A;  2BAC A;  3NN0 X;  2J3N A;  3GSI A;  1NDA A;  1W4X A;  2XFU A;  4YXD A;  3P9U A;  2QAE A;  1VQW A;  1GRA A;  3AED A;  4K2X A;  3GD4 A;  3Q9T A;  2V5Z A;  4BUR A;  5DBJ A;  1YQ3 A;  4X4J A;  1BGN A;  4WCT A;  4XWR A;  1CJ2 A;  1GTH A;  3QFA A;  3I3L A;  1O5W A;  2QA2 A;  5ER0 A;  5KRQ A;  3KVE A;  1ELI A;  2GR0 A;  1BZL A;  4P9S A;  5GRT A;  3V3N A;  2C70 A;  1Q9I A;  3K7M X;  5IQ1 A;  4J2W A;  1HYU A;  1VRQ B;  1ZX9 A;  3LAD A;  3NYE A;  3F8R A;  2BC0 A;  3QFB A;  5FS9 A;  3T0K A;  5BVA A;  1GRF A;  1ZKQ A;  3NT6 A;  5BRT A;  4JN9 A;  1PBC A;  1ZMC A;  4ZCC A;  1MOK A;  2GR3 A;  2VZ2 A;  2VQB A;  2R9Z A;  4GDE A;  4JQ9 A;  3T14 A;  1N4V A;  2JB1 A;  4UDR A;  3CPI G;  4A99 A;  2FJB A;  2R4E A;  4XWZ A;  3AWI A;  1GRH A;  4YTP A;  3M12 A;  4NTC A;  4U2T A;  4AT2 A;  2XVF A;  1AOG A;  3R9U A;  1Z6L A;  2V3A A;  3M0O A;  3FBS A;  4C3Y A;  1GRE A;  2B7R A;  3NRN A;  2GQF A;  1F6M A;  1P2E A;  2JKC A;  3KPF A;  5EOW A;  4B68 A;  5KXJ A;  3CGE A;  5EBK A;  5BUL A;  4NTE A;  2WP6 A;  2YG5 A;  3DA1 A;  2WET A;  4LA1 A;  1KNR A;  2WS3 A;  3AD7 B;  3DJE A;  2R46 A;  1QLB A;  3PVC A;  4B63 A;  1S3B A;  3CGD A;  1B8S A;  3UKH A;  2BCP A;  1LQU A;  1F8R A;  2ARD A;  2R0C A;  3UP5 A;  2ZZ0 A;  1GV4 A;  2YVG A;  1CC2 A;  1O94 A;  2VVL G;  3AE2 A;  2PYX A;  3PS9 A;  3NHO X;  4H4P A;  1FCD A;  3KLJ A;  4B66 A;  3KU9 A;  2XCG A;  2YAU A;  3ABV A;  4OPI A;  1CC4 A;  3UCL A;  2IVE A;  3NIX A;  2BXS A;  5FS8 A;  4DSG A;  1CJ3 A;  5HXI A;  3ATR A;  5JCL A;  4Z25 A;  3DJD A;  3RHA A;  3ALM A;  5LV9 A;  4H2N A;  1S2Y A;  3ISH A;  2WU5 A;  4Z24 A;  3GRS A;  3F8D A;  2WOW A;  3NN6 X;  2NVK X;  1Y0P A;  2C4C A;  3IF9 A;  1TDN A;  2BAB A;  3H4K A;  4X9M A;  3ICT A;  2VQ7 A;  3V76 A;  5KMQ A;  1XDI A;  2V61 A;  2Q6U A;  4YSY A;  1F8W A;  3EAN A;  2V6O A;  3QVR A;  5IQ4 A;  3SX6 A;  3M13 A;  1EL7 A;  1H84 A;  3E1T A;  3GYX A;  4CY6 A;  4GR1 A;  1ZP0 A;  3UOY A;  4D03 A;  4G6H A;  4H4W A;  2YLS A;  1JRZ A;  1GET A;  4OPG A;  2DKI A;  2H89 A;  2QCU A;  2WHD A;  3P4S A;  1NHQ A;  3L1R A;  4NWZ A;  4BJY A;  3AE5 A;  2B76 A;  4I59 A;  1CBO A;  1NHP A;  2A8X A;  4LII A;  5KWF A;  2X8C A;  2C72 A;  3AEG A;  5JCN A;  3GWF A;  3FPZ A;  4YWO A;  4Z43 A;  5FS6 A;  4ZCD A;  2QA1 A;  5KMR A;  3UKF A;  1N1P A;  3SZ0 A;  1PHH A;  2XLT A;  2GMH A;  3CTY A;  2W0H A;  1L9C A;  2Z5X A;  4UP3 A;  2C7G A;  3VRA A;  4OPL A;  4YKG A;  1X31 B;  3SGL A;  5BUK A;  3RNM A;  1JEH A;  5L46 A;  3UOZ A;  3AEB A;  4OVI A;  3NTA A;  1JU2 A;  4A65 A;  3DH9 A;  2R0G A;  3ALL A;  3DGH A;  4H2R A;  1F8S A;  1K0I A;  1ONF A;  4GUV A;  1H82 A;  1PJ6 A;  1D4D A;  4U8N A;  2I0Z A;  1TDE A;  1DXL A;  1LTX R;  1IUV A;  1Q1R A;  1REO A;  1KF6 A;  4AP1 A;  3UTH A;  1EL8 A;  4PAA A;  4B64 A;  1GRG A;  4X9N A;  1GEU A;  3O0H A;  4JNA A;  2F5Z A;  4EMJ A;  3SZW A;  2C66 A;  1IUS A;  2YQU A;  3SZC A;  3AE7 A;  2ACZ A;  2WBA A;  3DME A;  2BK3 A;  4LU6 A;  1PS9 A;  3SYI A;  4J56 A;  4CRT A;  2GH5 A;  2O9Z A;  3LXD A;  2EQ7 A;  3CIR A;  3SXI A;  3CNP A;  4CNK A;  2BCG G;  2YLZ A;  2XFQ A;  1K0L A;  2VVM A;  3C96 A;  3V3O A;  3IWA A;  1GOS A;  4A79 A;  4NZH A;  3NYC A;  2E5V A;  4B65 A;  4H4R A;  2DKH A;  2TMD A;  3UP4 A;  2R45 A;  1P2H A;  3HYX A;  1Y56 B;  2Y6Q A;  3WE0 A;  3AEA A;  2C75 A;  2YR4 A;  1IUT A;  2A87 A;  3QJ4 A;  1VG0 A;  1OJC A;  3CPJ G;  4O5Q A;  4YSZ A;  1PXC A;  1K0J A;  4ECH A;  4U8O A;  3EF6 A;  2TPR A;  2OAM A;  5J60 A;  3NK0 X;  1VG9 A;  1ZK7 A;  2WPE A;  3CMM A;  3DJJ A;  2OAL A;  1DJQ A;  4UDQ A;  3T2K A;  3D1C A;  3AE8 A;  3P4P A;  1PJ7 A;  2JBV A;  2X99 A;  1L9E A;  1KSU A;  1QO8 A;  1GRB A;  1EL5 A;  2Q7V A;  2YLW A;  4HA6 A;  1B5Q A;  5J7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...