2VQBA

Bacterial flavin-containing monooxygenase in complex with nadp: soaking in aerated solution
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
443
structure length
443
Chain Sequence
b'TRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSNGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
molecule tags Oxidoreductase
source organism Methylophaga sp. sk1
publication title Revealing the Moonlighting Role of Nadp in the Structure of a Flavin-Containing Monooxygenase.
pubmed doi rcsb
total genus 162
structure length 443
sequence length 443
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vqbA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vqbA02
2BA9A 1PXAA 2WOVA 4BV6A 3DJJA 4B68A 1ZY8A 4H50A 3AWIA 1OJAA 5KRQA 2XFOA 1ZOYA 4NTDA 1QLBA 3COXA 2QCUA 3K7QX 4K2XA 1Y56A 3UP5A 2ZZCA 3CNJA 1PBDA 4Z44A 2X8GA 3PO7A 4CY8A 3UKLA 2WP9A 3FMWA 3ICTA 2YG3A 4Z43A 3P1WA 4J2WA 1BGNA 2TMDA 4Z24A 1YY5A 2AAQA 4HA6A 4REKA 1VRQB 4H7UA 4GDPA 2BC0A 2YLXA 3DH9A 5FS8A 4D03A 1GESA 4NTEA 1F8RA 3BI2A 2C66A 2C65A 2RGJA 1GPEA 2BC1A 1H83A 1F3PA 3EAOA 3UOYA 3AYIA 2WDVA 3JSKA 1N1PA 4AOSA 1JOAA 2GEWA 2BK5A 2BXSA 4PAAA 4C3XA 4MJWA 4YSZA 1PS9A 3URHA 4YT0A 4TLZA 2XFPA 3BI5A 5KWFA 4TM3A 4J31A 2E1MA 1P2EA 1XPQA 1GTEA 2VZ2A 2XFNA 3UTHA 3VR9A 5KOWA 4H4PA 3QFBA 4H2RA 2VVMA 4H4UA 1GRHA 2J3NA 2ZBWA 4J34A 4OPDA 2QAEA 1K0JA 2E4GA 2XYOA 2APGA 4HB9A 1TDNA 2WS3A 3NT6A 5EOWA 4LA1A 1CJ3A 5FS6A 4WX1A 1JU2A 5KOXA 2YLWA 4K5RA 3GYJA 2YM2A 3BNUA 1NHQA 1DJNA 4XWZA 3VR8A 3GYIA 1FCDA 2WPCA 4A5LA 1Q9IA 2WHDA 4NTCA 4IA6A 1KNRA 4B64A 3NK2X 2DKIA 2YLZA 4AT0A 3ADAB 2C72A 4U8NA 5IQ1A 3ICRA 1CJ2A 2W0HA 2YWLA 2WPFA 3CPHG 4KPRA 3AD7B 2EQ6A 2V6OA 2GMHA 2ZZ0A 1ELIA 3EPTA 3LADA 1FOHA 4IVMB 1H84A 1GEUA 3IHGA 2H88A 2VVLA 1PDHA 3F8PA 4O5QA 4EIPA 1PXBA 1S3BA 1D5TA 1O95A 1GRBA 1PJ7A 1CHUA 4IVOB 5L46A 2C76A 3GSIA 1EL5A 3CGDA 3SM8A 1DJQA 3UTEA 1NG4A 4H4QA 5U1OA 4DNAA 4GRTA 1JRYA 1LVLA 4J56A 4Y4NA 2IVDA 4WCTA 3AE2A 2GQFA 1Z6LA 2YG6A 4GDEA 2YVGA 4U8MA 4EIQA 2WETA 4JQ9A 2OALA 2Q0KA 3RNMA 4CNJA 3P4SA 3FIMB 1E1MA 2AR8A 4NEVA 4OPTA 5IPYA 2B9XA 2XFQA 2X3NA 4UDPA 3I6DA 3I3LA 3NG7X 2FJBA 3D8XA 3AE7A 2C75A 1H7XA 1GRAA 2CULA 3K7TA 4H2NA 5CKUA 4UDRA 1RYIA 3UOXA 3ZDNA 1JRXA 3IWAA 3D1CA 2GMJA 2XFUA 2YLTA 4A7AA 3Q9TA 2R0PA 3C4NA 4H4SA 1NAAA 1ZKQA 5EB4A 3NH3X 1PBEA 1JRZA 1TDKA 2XLSA 2YR5A 3K30A 2ACZA 2C64A 1CF3A 1Q1RA 4X9MA 3B3RA 1AOGA 2Q6UA 4J33A 5HHFA 1ZP0A 3SGLA 1HYUA 2YR4A 3AE5A 3ABVA 2BABA 4FX9A 1PJ6A 2BACA 3GRTA 1YQZA 2C73A 3KVEA 1LQTA 1EL9A 4LU6A 1Y0PA 2GV8A 4Z2RA 4K8DA 5FMHA 3AB1A 4DSHA 1E7PA 2GR1A 1KFYA 2GQWA 3NTAA 4GF7A 1IUWA 3NRNA 4X4JA 2FBWA 1W4XA 2A87A 4CY6A 1GTHA 1VG0A 4IV9A 2R0GA 2XDOA 3ZYXA 3GD3A 2R45A 3KD9A 3NTDA 4Z2TA 1IUVA 4U8JA 2R46A 3ATRA 3LOVA 1P2HA 2BK4A 2BYBA 3CGCA 1PXCA 1B8SA 1TDOA 3NIXA 3QVRA 1H7WA 2VQ7A 4K7ZA 1DOCA 3CGBA 4USQA 1NDAA 3DK8A 3NN6X 1L9DA 3AE6A 4JNQA 4AOXA 4ZCDA 2WOIA 3F8DA 3DK9A 2EQ7A 4CNKA 1DOBA 1GV4A 3M0OA 1KSUA 1S2YA 2OLNA 3CNDA 4AT2A 1FEBA 4H4YA 1GRFA 3NN0X 1D4CA 3RP8A 2Y6QA 3G5SA 2JK6A 1K0LA 2X8CA 1IUUA 3NGCX 4FDCB 1KDGA 4ZN0A 2JB3A 3BI4A 3GWFA 4H2PA 3UKQA 1OJTA 1YQ3A 4RG4A 2VVLG 1V59A 2BS3A 1D7YA 3NKSA 1BKWA 1GREA 3C96A 3AD9B 4A6NB 2XLPA 4OVIA 2VRMA 3DJDA 1ZMDA 3GWDA 2XVEA 2PYXA 3BHFA 4I59A 1NHSA 4KX6A 3ITJA 4EQRA 3WE0A 3UCLA 5HYMA 4FK1A 1CJCA 4U8KA 4U2LA 4B66A 1OJDA 2Q7VA 5M10A 3AE9A 1BGJA 3AXBA 5EB5A 4B69A 2WBAA 2V5ZA 4YSYA 5GRTA 2GRTA 3H8LA 4AP1A 4DGKA 3AEAA 2R9ZA 1YQ4A 2CVJA 1REOA 4U2TA 4GR1A 1BF3A 3G5RA 3UOVA 4I58A 3FG2P 2JBVA 2BS4A 1MO9A 4AP3A 1BZLA 4DSGA 3FPZA 2YG4A 2BXRA 2A8XA 4XXGA 3ALMA 3SQPA 4BURA 3ALJA 4H4RA 2C3CA 1TDFA 2XVJA 4TM0A 1M64A 3NNEA 3ICSA 4B65A 4EQWA 2TPRA 3DJEA 1S3EA 2FJAA 2V61A 2JAEA 4Z26A 2BCGG 2A89A 4ICYA 4GCMA 2WDRA 2YLSA 2UZZA 1QJDA 2EQ8A 3ALLA 4K5SA 1B4VA 1E39A 2ARDA 1UKVG 1ZX9A 1ZMCA 4K22A 3AEDA 4U2SA 1JNZA 1D7LA 1CL0A 3GD4A 1IJHA 4BK3A 2JKCA 3P4QA 2GAHB 4UDQA 4YSXA 2C67A 1K4QA 5JCMA 3REDA 4IA5A 5KXJA 4EQXA 5HXIA 4C5OA 1FEAA 3AE4A 1N4WA 3AE1A 2B9YA 2BS2A 4H4XA 2YLRA 1CC6A 1PBFA 1TYTA 5FS9A 3GRSA 4LIIA 3LB8A 4C77A 4EMWA 1Y56B 2OLOA 1LQUA 1N4UA 3VRAA 2YQUA 1GNDA 3CNTA 3KU9A 3V3NA 2B7SA 2GH5A 2X8HA 2Z5YA 3CIRA 3AE8A 1TRBA 4H4VA 2YG5A 2NPXA 5C3JA 4OPUA 2GR3A 3CPJG 4ZCCA 3Q6JA 3NHOX 4OPCA 2V60A 4H2QA 4YWOA 4OCGA 3DA1A 4XWRA 3NYFA 5FS7A 1CC4A 2GAGB 4EMJA 1VDCA 1L9CA 1F8WA 3UKAA 5KVIA 2IIDA 3R9UA 3VRBA 4FK1C 1OJCA 3AE3A 2ZZBA 1DNCA 2QA1A 5IQ4A 3PS9A 1E1NA 2XVHA 4B63A 4EMIA 4H4ZA 2RABA 4YTPA 4C74A 2WP5A 1L0VA 4A65A 1VQWA 1GRGA 3LXDA 3IF9A 3UKPA 3K7MX 1S2QA 3DK4A 1N4VA 1ZK7A 3O0HA 4JDRA 3RP7A 4E0VA 4A9WA 3NK0X 1KF6A 3H8IA 3OZ2A 3GDNA 2CDUA 4NZHA 2EQ9A 4APNA 3DJGX 2C7GA 3BHKA 4CCRA 2YG7A 2WESA 3NLCA 1H86A 1XHCA 1LV0A 3CGEA 5HY5A 3IHMA 2R4EA 1GOSA 1NEKA 1YKJA 2FJEA 4BJZA 4C3YA 2B7RA 3GMBA 3KA7A 3P4RA 1GETA 3NK1X 2CFYA 2B76A 1KSSA 1IUTA 3L1RA 3AYLA 2XVFA 3LZWA 1FECA 2YR6A 3DGHA 3S5WA 3AECA 5C2TA 3GDPA 5KVHA 1M6IA 4YKFA 1JEHA 3QSMA 1RP0A 1PJ5A 4J36A 1L9EA 1VG9A 3DGZA 4CBQA 5J60A 1NPXA 3G5QA 4U8PA 5JCKA 1PN0A 4B67A 1F6MA 1JNRA 2FJDA 2JB2A 4P9SA 1DOEA 2YM1A 1XANA 3M12A 2WQYA 1MOKA 1NENA 3QSSA 3UKKA 1EBDA 2C70A 2OAMA 3F8RA 2PHHA 3UKFA 4PABA 2OA1A 3AEBA 1PBBA 3AEGA 4JN9A 5LV9A 2GR0A 4Z25A 3KLJA 2F5ZA 3QJ4A 4TM1A 4EM3A 1NG3A 2XCGA 3C4AA 2WDQA 3AEEA 3SFDA 3UTGA 3KPFA 5ER0A 3LJPA 4J57A 4A6NA 1O5WA 2O9ZA 3H4KA 4O5UA 4YKGA 4RG3A 2YAUA 3P4PA 5BRTA 1H6VA 1B5QA 2C3DA 2WU2A 3VQRA 3M13A 1PHHA 2GR2A 2VOUA 2GF3A 2WP6A 2BK3A 1ZDLA 3CPIG 1LTXR 4ADWA 1B37A 1NHPA 5JCNA 1TYPA 1K0IA 4NEWA 5BVAA 4TLXA 4BK2A 3UOZA 1E1KA 3EANA 1E6EA 1BWCA 1ONFA 4Y4MA 3EF6A 2GVCA 1NHRA 5J7XA 2GB0A 3UTFA 2WPEA 4GUVA 3RHAA 3V3OA 5JCIA 2X50A 3FBSA 2Y6RA 2BCPA 4D04A 1GRTA 4U8LA 1CJ4A 4X9NA 1SEZA 2XLRA 5M0ZA 1GALA 2V3BA 4M52A 3S61A 4B1BA 4EM4A 3KKJA 2E5VA 2DKHA 2Z5XA 2AQJA 3DMEA 1CC2A 3NYCA 3IC9A 3T37A 2X99A 1D4DA 4JNAA 4U8IA 3RP6A 4Z2UA 3VRDB 4BK1A 1DODA 1CBOA 1IUSA 3ATQA 4BJYA 1QO8A 2YVJA 3QFAA 2B9WA 2R0CA 1Q1WA 3II4A 3CN8A 3P9UA 3E1TA 5EBKA 4A99A 2RGOA 4JY3A 3CNPA 2Q0LA 1FL2A 5U25A 1GXFA 2VRLA 1MXTA 4H4WA 1E1LA 4OPIA 1H81A 2H89A 3BNMA 2YVFA 1LPFA 1PBCA 5U63A 1GERA 2XLUA 1GSNA 1ZOVA 1COYA 1KNPA 4U8OA 3L8KA 2VQBA 3AD8B 3QVPA 2WU5A 2JB1A 4CRTA 2WOWA 5CQFA 2XVIA 4YSHA 4JY2A 1GT8A 1O94A 3OC4A 2I0ZA 4A79A 2V3AA 1RSGA 5BULA 3UKHA 5DBJA 1H82A 1OJ9A 1D4EA 3ISHA 4YTMA 1XDIA 5GSNA 3V76A 3CTYA 3UP4A 1IUXA 5BUKA 5TR3A 2NVKX 1EL7A 3NYEA 1X31B 1F8SA 4EQSA 3SFEA 4YXDA 4ECHA 2R4JA 3GMCA 4RSLA 3AEFA 1TDEA 4H4TA 4CCQA 4YTNA 3B6DA 4OPLA 1EL8A 3HZLA 2HQMA 2QA2A 4USRA 5JCLA 2IVEA 3QSEA 4N9XA 4Y4LA 3AYJA 4UP3A 3PVCA 4OPGA 1LJ1A 2WEUA 2RGHA 4TM4A 2XLTA 3LZXA 1DXLA 3CNSA
chains in the Genus database with same CATH superfamily
2BA9A 1PXAA 2WOVA 4BV6A 3DJJA 4B68A 1ZY8A 4H50A 3AWIA 1OJAA 5KRQA 2XFOA 1ZOYA 4NTDA 1QLBA 3COXA 2QCUA 3K7QX 4K2XA 1Y56A 3UP5A 2ZZCA 3CNJA 1PBDA 4Z44A 2X8GA 3PO7A 4CY8A 3UKLA 2WP9A 3FMWA 3ICTA 2YG3A 4Z43A 2BRYA 3P1WA 4J2WA 1BGNA 2TMDA 4Z24A 1YY5A 2AAQA 4HA6A 4REKA 1VRQB 4H7UA 4GDPA 2BC0A 2YLXA 3DH9A 5FS8A 4D03A 1GESA 4NTEA 1F8RA 3BI2A 5KMSA 2C66A 2C65A 2RGJA 1GPEA 2BC1A 1H83A 1F3PA 3EAOA 3UOYA 3AYIA 2WDVA 3JSKA 1N1PA 4AOSA 1JOAA 2GEWA 2BK5A 2BXSA 4PAAA 4C3XA 4MJWA 4YSZA 1PS9A 3URHA 4YT0A 4TLZA 2XFPA 3BI5A 5KWFA 4TM3A 4J31A 2E1MA 1P2EA 1XPQA 1GTEA 2VZ2A 2XFNA 3UTHA 3VR9A 5KOWA 4H4PA 3QFBA 4H2RA 2VVMA 4H4UA 1GRHA 2J3NA 2ZBWA 4J34A 4OPDA 2QAEA 1K0JA 2E4GA 2XYOA 4G6HA 2APGA 3HYWA 4HB9A 1TDNA 2WS3A 3NT6A 5EOWA 4LA1A 1CJ3A 5FS6A 4WX1A 3T14A 1JU2A 5KOXA 2YLWA 4K5RA 3GYJA 2YM2A 3BNUA 1NHQA 1DJNA 4GAVA 4II2A 3GYIA 4XWZA 1FCDA 2WPCA 3VR8A 4A5LA 1Q9IA 2WHDA 4NTCA 4IA6A 1KNRA 4B64A 3NK2X 2DKIA 2YLZA 4AT0A 3ADAB 2C72A 4U8NA 5IQ1A 3ICRA 1CJ2A 2W0HA 2YWLA 2WPFA 3CPHG 4KPRA 3AD7B 2EQ6A 2V6OA 4NNJA 2GMHA 2ZZ0A 1ELIA 3EPTA 3LADA 1FOHA 4IVMB 1H84A 1GEUA 3IHGA 2H88A 2VVLA 1PDHA 3F8PA 4O5QA 4EIPA 1PXBA 1S3BA 1D5TA 1O95A 1GRBA 1PJ7A 1CHUA 4IVOB 5L46A 2C76A 3GSIA 1EL5A 3CGDA 3SM8A 1DJQA 3T2YA 4NWZA 3UTEA 1NG4A 4H4QA 5U1OA 4DNAA 4GRTA 1JRYA 1LVLA 4J56A 4Y4NA 4II3A 4WCTA 2IVDA 5KMPA 3AE2A 2GQFA 1Z6LA 2YG6A 4GDEA 2YVGA 4U8MA 4EIQA 2WETA 4JQ9A 2OALA 2Q0KA 3RNMA 4CNJA 3P4SA 3FIMB 5KNLA 1E1MA 2AR8A 4NEVA 4OPTA 5IPYA 2B9XA 2XFQA 2X3NA 4UDPA 3I6DA 3I3LA 3NG7X 2FJBA 3D8XA 3AE7A 2C75A 1H7XA 1GRAA 2CULA 3K7TA 4H2NA 5CKUA 4UDRA 1RYIA 3UOXA 3ZDNA 1JRXA 3IWAA 3D1CA 2GMJA 2XFUA 2YLTA 4A7AA 3Q9TA 2R0PA 3C4NA 4H4SA 1NAAA 1ZKQA 5EB4A 3SZFA 3NH3X 1PBEA 1JRZA 1TDKA 2XLSA 2YR5A 3K30A 2ACZA 2C64A 1CF3A 1Q1RA 4X9MA 3B3RA 1AOGA 2Q6UA 4J33A 5HHFA 1ZP0A 3SGLA 1HYUA 2YR4A 3AE5A 3ABVA 2BABA 4FX9A 1PJ6A 2BACA 3GRTA 1YQZA 2C73A 3KVEA 1LQTA 1EL9A 4LU6A 1Y0PA 2GV8A 4Z2RA 4K8DA 5FMHA 3AB1A 4DSHA 1E7PA 2GR1A 1KFYA 2GQWA 3NTAA 4GF7A 1IUWA 3NRNA 4X4JA 2FBWA 1W4XA 2A87A 4CY6A 1GTHA 1VG0A 4IV9A 2R0GA 2XDOA 3ZYXA 3GD3A 2R45A 3KD9A 3NTDA 4Z2TA 1IUVA 4U8JA 2R46A 3ATRA 3LOVA 1P2HA 2BK4A 2BYBA 3CGCA 1PXCA 1B8SA 1TDOA 3NIXA 3QVRA 1H7WA 2VQ7A 4K7ZA 1DOCA 3CGBA 4USQA 1NDAA 3DK8A 3NN6X 1L9DA 3AE6A 4JNQA 4AOXA 4ZCDA 2WOIA 3F8DA 3DK9A 2EQ7A 4CNKA 1DOBA 1GV4A 3M0OA 1KSUA 1S2YA 2OLNA 3CNDA 4AT2A 1FEBA 4H4YA 1GRFA 3NN0X 1D4CA 3RP8A 2Y6QA 3G5SA 2JK6A 1K0LA 2X8CA 1IUUA 3NGCX 4FDCB 1KDGA 4ZN0A 2JB3A 3BI4A 3GWFA 4H2PA 3UKQA 3SZ0A 1OJTA 1YQ3A 4RG4A 2VVLG 1V59A 2BS3A 1D7YA 3NKSA 1BKWA 1GREA 3C96A 3AD9B 4A6NB 2XLPA 4OVIA 2VRMA 3DJDA 1ZMDA 3GWDA 2XVEA 2PYXA 3BHFA 4I59A 1NHSA 4KX6A 3ITJA 4EQRA 3WE0A 3UCLA 5HYMA 4FK1A 1CJCA 4U8KA 4U2LA 4B66A 1OJDA 2Q7VA 5M10A 3AE9A 1BGJA 3AXBA 5EB5A 4B69A 2WBAA 2V5ZA 4YSYA 5GRTA 2GRTA 3H8LA 4AP1A 4DGKA 3AEAA 2R9ZA 1YQ4A 2CVJA 1REOA 4U2TA 4GR1A 1BF3A 3G5RA 3UOVA 4I58A 3FG2P 2JBVA 2BS4A 1MO9A 4AP3A 1BZLA 4DSGA 3FPZA 2YG4A 2BXRA 2A8XA 4XXGA 3ALMA 3SQPA 4BURA 3ALJA 4H4RA 2C3CA 1TDFA 2XVJA 4TM0A 1M64A 3NNEA 3ICSA 4B65A 4EQWA 2TPRA 3DJEA 1S3EA 2FJAA 2V61A 2JAEA 4Z26A 2BCGG 4G9KA 2A89A 3CMMA 4ICYA 4GCMA 2WDRA 2YLSA 5KMRA 2UZZA 1QJDA 2EQ8A 3ALLA 4K5SA 1B4VA 1E39A 2ARDA 1UKVG 1ZX9A 1ZMCA 4K22A 3AEDA 4U2SA 1JNZA 1D7LA 1CL0A 3GD4A 1IJHA 4BK3A 2JKCA 3P4QA 2GAHB 4UDQA 4YSXA 2C67A 1K4QA 3T0KA 5JCMA 3REDA 4IA5A 5KXJA 4EQXA 5HXIA 4C5OA 1FEAA 3AE4A 2BRAA 1N4WA 3AE1A 2B9YA 2C4CA 2BS2A 4H4XA 2YLRA 1CC6A 1PBFA 1TYTA 5FS9A 3GRSA 4LIIA 3LB8A 4C77A 4EMWA 1Y56B 2OLOA 1LQUA 1N4UA 3VRAA 2YQUA 1GNDA 3CNTA 3KU9A 3V3NA 2B7SA 2GH5A 2X8HA 2Z5YA 3T2KA 3CIRA 3AE8A 1TRBA 4H4VA 2YG5A 2NPXA 4GAPA 5C3JA 4OPUA 3HYVA 2GR3A 3CPJG 4ZCCA 3SZWA 3Q6JA 3NHOX 4OPCA 2V60A 4H2QA 4YWOA 4OCGA 3DA1A 4XWRA 3NYFA 5FS7A 1CC4A 2GAGB 4EMJA 1VDCA 1L9CA 1F8WA 3UKAA 5KVIA 2IIDA 3R9UA 3VRBA 4FK1C 1OJCA 3AE3A 2ZZBA 1DNCA 2QA1A 5IQ4A 3PS9A 1E1NA 2XVHA 4B63A 4EMIA 4H4ZA 2RABA 4YTPA 4C74A 2WP5A 4G74A 1L0VA 1VQWA 1GRGA 3LXDA 4A65A 3GYXA 3IF9A 3UKPA 3K7MX 1S2QA 3DK4A 1N4VA 1ZK7A 3O0HA 4JDRA 3RP7A 4E0VA 4A9WA 3NK0X 1KF6A 3H8IA 3SYIA 3OZ2A 3GDNA 2CDUA 4NZHA 2EQ9A 4APNA 3DJGX 2C7GA 3BHKA 4CCRA 2YG7A 2WESA 3NLCA 1H86A 1XHCA 1LV0A 3CGEA 5HY5A 3IHMA 2R4EA 1GOSA 1NEKA 1YKJA 2FJEA 4BJZA 4C3YA 2B7RA 3GMBA 3KA7A 3P4RA 1GETA 3NK1X 2CFYA 2B76A 1KSSA 1IUTA 3L1RA 3AYLA 2XVFA 3LZWA 1FECA 2YR6A 3DGHA 3S5WA 3AECA 5C2TA 3GDPA 5KVHA 1M6IA 4YKFA 1JEHA 3QSMA 1RP0A 1PJ5A 4J36A 1L9EA 1VG9A 3DGZA 4CBQA 5J60A 1NPXA 3G5QA 4U8PA 5JCKA 3SY4A 1PN0A 4B67A 1F6MA 1JNRA 2FJDA 2JB2A 4P9SA 1DOEA 2YM1A 1XANA 3M12A 2WQYA 1MOKA 1NENA 3QSSA 3UKKA 1EBDA 2C70A 2OAMA 3F8RA 2PHHA 3UKFA 4PABA 2OA1A 3AEBA 1PBBA 3AEGA 4JN9A 5LV9A 2GR0A 4Z25A 3KLJA 3T31A 2F5ZA 3QJ4A 4TM1A 4EM3A 4G6GA 1NG3A 2XCGA 3C4AA 2WDQA 3AEEA 3SFDA 3UTGA 3KPFA 5ER0A 3LJPA 4J57A 4A6NA 1O5WA 2O9ZA 3H4KA 4O5UA 4YKGA 4RG3A 2YAUA 3P4PA 5BRTA 1H6VA 1B5QA 2C3DA 2WU2A 3SX6A 3VQRA 3M13A 1PHHA 2GR2A 2VOUA 2GF3A 2WP6A 2BK3A 1ZDLA 3CPIG 1LTXR 4ADWA 1B37A 1NHPA 5JCNA 1TYPA 1K0IA 4NEWA 5BVAA 4TLXA 4BK2A 3UOZA 1E1KA 3EANA 1E6EA 1BWCA 1ONFA 4Y4MA 3EF6A 2GVCA 1NHRA 5J7XA 2GB0A 3UTFA 2WPEA 4GUVA 3RHAA 3V3OA 5JCIA 2X50A 3FBSA 2Y6RA 2BCPA 4D04A 3KPKA 1GRTA 4U8LA 1CJ4A 4X9NA 1SEZA 2XLRA 5M0ZA 1GALA 2V3BA 4M52A 3S61A 4B1BA 3T2ZA 4EM4A 3KKJA 2E5VA 2DKHA 2Z5XA 2AQJA 3DMEA 1CC2A 3NYCA 3IC9A 3T37A 2X99A 1D4DA 4JNAA 4U8IA 3RP6A 4Z2UA 3VRDB 4BK1A 1DODA 1CBOA 1IUSA 3ATQA 4BJYA 1QO8A 2YVJA 3QFAA 3HYXA 2B9WA 2R0CA 1Q1WA 3II4A 3CN8A 3P9UA 3E1TA 5EBKA 4A99A 2RGOA 4JY3A 3CNPA 3SZCA 2Q0LA 1FL2A 5U25A 1GXFA 2VRLA 1MXTA 4H4WA 1E1LA 4OPIA 1H81A 2H89A 3BNMA 2YVFA 1LPFA 1PBCA 5U63A 1GERA 2XLUA 1GSNA 1ZOVA 1COYA 1KNPA 4U8OA 3SXIA 5KMQA 3L8KA 2VQBA 3AD8B 3QVPA 2WU5A 2JB1A 4CRTA 2WOWA 5CQFA 2XVIA 4YSHA 4JY2A 1GT8A 1O94A 3OC4A 2I0ZA 4A79A 2V3AA 1RSGA 5BULA 3UKHA 5DBJA 1H82A 1OJ9A 1D4EA 3ISHA 4YTMA 1XDIA 5GSNA 3V76A 3CTYA 3UP4A 1IUXA 5BUKA 5TR3A 2NVKX 1EL7A 3NYEA 1X31B 1F8SA 4EQSA 3SFEA 4YXDA 4ECHA 2R4JA 3GMCA 4RSLA 3AEFA 1TDEA 4H4TA 4CCQA 4YTNA 3B6DA 4OPLA 1EL8A 3HZLA 2HQMA 2QA2A 4USRA 5JCLA 2IVEA 3QSEA 4N9XA 4Y4LA 3AYJA 4UP3A 3PVCA 4OPGA 1LJ1A 4G73A 2WEUA 2RGHA 4TM4A 2XLTA 3LZXA 1DXLA 3CNSA
chains in the Genus database with same CATH topology
2BA9A 1PXAA 2WOVA 4BV6A 3DJJA 4B68A 1ZY8A 4H50A 3AWIA 1OJAA 5KRQA 2XFOA 1ZOYA 4NTDA 1QLBA 3COXA 2QCUA 3K7QX 4K2XA 1Y56A 3UP5A 2ZZCA 3CNJA 1PBDA 4Z44A 2X8GA 3PO7A 4CY8A 3UKLA 2WP9A 3FMWA 3ICTA 2YG3A 4Z43A 2BRYA 3P1WA 4J2WA 1BGNA 2TMDA 4Z24A 1YY5A 2AAQA 4HA6A 4REKA 1VRQB 4H7UA 4GDPA 2BC0A 2YLXA 3DH9A 5FS8A 4D03A 1GESA 4NTEA 1F8RA 3BI2A 5KMSA 2C66A 2C65A 2RGJA 1GPEA 2BC1A 1H83A 1F3PA 3EAOA 3UOYA 3AYIA 2WDVA 3JSKA 1N1PA 4AOSA 1JOAA 2GEWA 2BK5A 2BXSA 4PAAA 4C3XA 4MJWA 4YSZA 1PS9A 3URHA 4YT0A 4TLZA 2XFPA 3BI5A 5KWFA 4TM3A 4J31A 2E1MA 1P2EA 1XPQA 1GTEA 2VZ2A 2XFNA 3UTHA 3VR9A 5KOWA 4H4PA 3QFBA 4H2RA 2VVMA 4H4UA 1GRHA 2J3NA 2ZBWA 4J34A 4OPDA 2QAEA 1K0JA 2E4GA 2XYOA 4G6HA 2APGA 3HYWA 4HB9A 1TDNA 2WS3A 3NT6A 5EOWA 4LA1A 1CJ3A 5FS6A 4WX1A 3T14A 1JU2A 5KOXA 2YLWA 4K5RA 3GYJA 2YM2A 3BNUA 1NHQA 1DJNA 4GAVA 4II2A 3GYIA 4XWZA 1FCDA 2WPCA 3VR8A 4A5LA 1Q9IA 2WHDA 4NTCA 4IA6A 1KNRA 4B64A 3NK2X 2DKIA 2YLZA 4AT0A 3ADAB 2C72A 4U8NA 5IQ1A 3ICRA 1CJ2A 2W0HA 2YWLA 2WPFA 3CPHG 4KPRA 3AD7B 2EQ6A 2V6OA 4NNJA 2GMHA 2ZZ0A 1ELIA 3EPTA 3LADA 1FOHA 4IVMB 1H84A 1GEUA 3IHGA 2H88A 2VVLA 1PDHA 3F8PA 4O5QA 4EIPA 1PXBA 1S3BA 1D5TA 1O95A 1GRBA 1PJ7A 1CHUA 4IVOB 5L46A 2C76A 3GSIA 1EL5A 3CGDA 3SM8A 1DJQA 3T2YA 4NWZA 3UTEA 1NG4A 4H4QA 5U1OA 4DNAA 4GRTA 1JRYA 1LVLA 4J56A 4Y4NA 4II3A 4WCTA 2IVDA 5KMPA 3AE2A 2GQFA 1Z6LA 2YG6A 4GDEA 2YVGA 4U8MA 4EIQA 2WETA 4JQ9A 2OALA 2Q0KA 3RNMA 4CNJA 3P4SA 3FIMB 5KNLA 1E1MA 2AR8A 4NEVA 4OPTA 5IPYA 2B9XA 2XFQA 2X3NA 4UDPA 3I6DA 3I3LA 3NG7X 2FJBA 3D8XA 3AE7A 2C75A 1H7XA 1GRAA 2CULA 3K7TA 4H2NA 5CKUA 4UDRA 1RYIA 3UOXA 3ZDNA 1JRXA 3IWAA 3D1CA 2GMJA 2XFUA 2YLTA 4A7AA 3Q9TA 2R0PA 3C4NA 4H4SA 1NAAA 1ZKQA 5EB4A 3SZFA 3NH3X 1PBEA 1JRZA 1TDKA 2XLSA 2YR5A 3K30A 2ACZA 2C64A 1CF3A 1Q1RA 4X9MA 3B3RA 1AOGA 2Q6UA 4J33A 5HHFA 1ZP0A 3SGLA 1HYUA 2YR4A 3AE5A 3ABVA 2BABA 4FX9A 1PJ6A 2BACA 3GRTA 1YQZA 2C73A 3KVEA 1LQTA 1EL9A 4LU6A 1Y0PA 2GV8A 4Z2RA 4K8DA 5FMHA 3AB1A 4DSHA 1E7PA 2GR1A 1KFYA 2GQWA 3NTAA 4GF7A 1IUWA 3NRNA 4X4JA 2FBWA 1W4XA 2A87A 4CY6A 1GTHA 1VG0A 4IV9A 2R0GA 2XDOA 3ZYXA 3GD3A 2R45A 3KD9A 3NTDA 4Z2TA 1IUVA 4U8JA 2R46A 3ATRA 3LOVA 1P2HA 2BK4A 2BYBA 3CGCA 1PXCA 1B8SA 1TDOA 3NIXA 3QVRA 1H7WA 2VQ7A 4K7ZA 1DOCA 3CGBA 4USQA 1NDAA 3DK8A 3NN6X 1L9DA 3AE6A 4JNQA 4AOXA 4ZCDA 2WOIA 3F8DA 3DK9A 2EQ7A 4CNKA 1DOBA 1GV4A 3M0OA 1KSUA 1S2YA 2OLNA 3CNDA 4AT2A 1FEBA 4H4YA 1GRFA 3NN0X 1D4CA 3RP8A 2Y6QA 3G5SA 2JK6A 1K0LA 2X8CA 1IUUA 3NGCX 4FDCB 1KDGA 4ZN0A 2JB3A 3BI4A 3GWFA 4H2PA 3UKQA 3SZ0A 1OJTA 1YQ3A 4RG4A 2VVLG 1V59A 2BS3A 1D7YA 3NKSA 1BKWA 1GREA 3C96A 3AD9B 4A6NB 2XLPA 4OVIA 2VRMA 3DJDA 1ZMDA 3GWDA 2XVEA 2PYXA 3BHFA 4I59A 1NHSA 4KX6A 3ITJA 4EQRA 3WE0A 3UCLA 5HYMA 4FK1A 1CJCA 4U8KA 4U2LA 4B66A 1OJDA 2Q7VA 5M10A 3AE9A 1BGJA 3AXBA 5EB5A 4B69A 2WBAA 2V5ZA 4YSYA 5GRTA 2GRTA 3H8LA 4AP1A 4DGKA 3AEAA 2R9ZA 1YQ4A 2CVJA 1REOA 4U2TA 4GR1A 1BF3A 3G5RA 3UOVA 4I58A 3FG2P 2JBVA 2BS4A 1MO9A 4AP3A 1BZLA 4DSGA 3FPZA 2YG4A 2BXRA 2A8XA 4XXGA 3ALMA 3SQPA 4BURA 3ALJA 4H4RA 2C3CA 1TDFA 2XVJA 4TM0A 1M64A 3NNEA 3ICSA 4B65A 4EQWA 2TPRA 3DJEA 1S3EA 2FJAA 2V61A 2JAEA 4Z26A 2BCGG 4G9KA 2A89A 3CMMA 4ICYA 4GCMA 2WDRA 2YLSA 5KMRA 2UZZA 1QJDA 2EQ8A 3ALLA 4K5SA 1B4VA 1E39A 2ARDA 1UKVG 1ZX9A 1ZMCA 4K22A 3AEDA 4U2SA 1JNZA 1D7LA 1CL0A 3GD4A 1IJHA 4BK3A 2JKCA 3P4QA 2GAHB 4UDQA 4YSXA 2C67A 1K4QA 3T0KA 5JCMA 3REDA 4IA5A 5KXJA 4EQXA 5HXIA 4C5OA 1FEAA 3AE4A 2BRAA 1N4WA 3AE1A 2B9YA 2C4CA 2BS2A 4H4XA 2YLRA 1CC6A 1PBFA 1TYTA 5FS9A 3GRSA 4LIIA 3LB8A 4C77A 4EMWA 1Y56B 2OLOA 1LQUA 1N4UA 3VRAA 2YQUA 1GNDA 3CNTA 3KU9A 3V3NA 2B7SA 2GH5A 2X8HA 2Z5YA 3T2KA 3CIRA 3AE8A 1TRBA 4H4VA 2YG5A 2NPXA 4GAPA 5C3JA 4OPUA 3HYVA 2GR3A 3CPJG 4ZCCA 3SZWA 3Q6JA 3NHOX 4OPCA 2V60A 4H2QA 4YWOA 4OCGA 3DA1A 4XWRA 3NYFA 5FS7A 1CC4A 2GAGB 4EMJA 1VDCA 1L9CA 1F8WA 3UKAA 5KVIA 2IIDA 3R9UA 3VRBA 4FK1C 1OJCA 3AE3A 2ZZBA 1DNCA 2QA1A 5IQ4A 3PS9A 1E1NA 2XVHA 4B63A 4EMIA 4H4ZA 2RABA 4YTPA 4C74A 2WP5A 4G74A 1L0VA 1VQWA 1GRGA 3LXDA 4A65A 3GYXA 3IF9A 3UKPA 3K7MX 1S2QA 3DK4A 1N4VA 1ZK7A 3O0HA 4JDRA 3RP7A 4E0VA 4A9WA 3NK0X 1KF6A 3H8IA 3SYIA 3OZ2A 3GDNA 2CDUA 4NZHA 2EQ9A 4APNA 3DJGX 2C7GA 3BHKA 4CCRA 2YG7A 2WESA 3NLCA 1H86A 1XHCA 1LV0A 3CGEA 5HY5A 3IHMA 2R4EA 1GOSA 1NEKA 1YKJA 2FJEA 4BJZA 4C3YA 2B7RA 3GMBA 3KA7A 3P4RA 1GETA 3NK1X 2CFYA 2B76A 1KSSA 1IUTA 3L1RA 3AYLA 2XVFA 3LZWA 1FECA 2YR6A 3DGHA 3S5WA 3AECA 5C2TA 3GDPA 5KVHA 1M6IA 4YKFA 1JEHA 3QSMA 1RP0A 1PJ5A 4J36A 1L9EA 1VG9A 3DGZA 4CBQA 5J60A 1NPXA 3G5QA 4U8PA 5JCKA 3SY4A 1PN0A 4B67A 1F6MA 1JNRA 2FJDA 2JB2A 4P9SA 1DOEA 2YM1A 1XANA 3M12A 2WQYA 1MOKA 1NENA 3QSSA 3UKKA 1EBDA 2C70A 2OAMA 3F8RA 2PHHA 3UKFA 4PABA 2OA1A 3AEBA 1PBBA 3AEGA 4JN9A 5LV9A 2GR0A 4Z25A 3KLJA 3T31A 2F5ZA 3QJ4A 4TM1A 4EM3A 4G6GA 1NG3A 2XCGA 3C4AA 2WDQA 3AEEA 3SFDA 3UTGA 3KPFA 5ER0A 3LJPA 4J57A 4A6NA 1O5WA 2O9ZA 3H4KA 4O5UA 4YKGA 4RG3A 2YAUA 3P4PA 5BRTA 1H6VA 1B5QA 2C3DA 2WU2A 3SX6A 3VQRA 3M13A 1PHHA 2GR2A 2VOUA 2GF3A 2WP6A 2BK3A 1ZDLA 3CPIG 1LTXR 4ADWA 1B37A 1NHPA 5JCNA 1TYPA 1K0IA 4NEWA 5BVAA 4TLXA 4BK2A 3UOZA 1E1KA 3EANA 1E6EA 1BWCA 1ONFA 4Y4MA 3EF6A 2GVCA 1NHRA 5J7XA 2GB0A 3UTFA 2WPEA 4GUVA 3RHAA 3V3OA 5JCIA 2X50A 3FBSA 2Y6RA 2BCPA 4D04A 3KPKA 1GRTA 4U8LA 1CJ4A 4X9NA 1SEZA 2XLRA 5M0ZA 1GALA 2V3BA 4M52A 3S61A 4B1BA 3T2ZA 4EM4A 3KKJA 2E5VA 2DKHA 2Z5XA 2AQJA 3DMEA 1CC2A 3NYCA 3IC9A 3T37A 2X99A 1D4DA 4JNAA 4U8IA 3RP6A 4Z2UA 3VRDB 4BK1A 1DODA 1CBOA 1IUSA 3ATQA 4BJYA 1QO8A 2YVJA 3QFAA 3HYXA 2B9WA 2R0CA 1Q1WA 3II4A 3CN8A 3P9UA 3E1TA 5EBKA 4A99A 2RGOA 4JY3A 3CNPA 3SZCA 2Q0LA 1FL2A 5U25A 1GXFA 2VRLA 1MXTA 4H4WA 1E1LA 4OPIA 1H81A 2H89A 3BNMA 2YVFA 1LPFA 1PBCA 5U63A 1GERA 2XLUA 1GSNA 1ZOVA 1COYA 1KNPA 4U8OA 3SXIA 5KMQA 3L8KA 2VQBA 3AD8B 3QVPA 2WU5A 2JB1A 4CRTA 2WOWA 5CQFA 2XVIA 4YSHA 4JY2A 1GT8A 1O94A 3OC4A 2I0ZA 4A79A 2V3AA 1RSGA 5BULA 3UKHA 5DBJA 1H82A 1OJ9A 1D4EA 3ISHA 4YTMA 1XDIA 5GSNA 3V76A 3CTYA 3UP4A 1IUXA 5BUKA 5TR3A 2NVKX 1EL7A 3NYEA 1X31B 1F8SA 4EQSA 3SFEA 4YXDA 4ECHA 2R4JA 3GMCA 4RSLA 3AEFA 1TDEA 4H4TA 4CCQA 4YTNA 3B6DA 4OPLA 1EL8A 3HZLA 2HQMA 2QA2A 4USRA 5JCLA 2IVEA 3QSEA 4N9XA 4Y4LA 3AYJA 4UP3A 3PVCA 4OPGA 1LJ1A 4G73A 2WEUA 2RGHA 4TM4A 2XLTA 3LZXA 1DXLA 3CNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA9 A;  1PXA A;  2WOV A;  4BV6 A;  3DJJ A;  4B68 A;  1ZY8 A;  4H50 A;  3AWI A;  1OJA A;  5KRQ A;  2XFO A;  1ZOY A;  4NTD A;  1QLB A;  3COX A;  2QCU A;  3K7Q X;  4K2X A;  1Y56 A;  3UP5 A;  2ZZC A;  3CNJ A;  1PBD A;  4Z44 A;  2X8G A;  3PO7 A;  4CY8 A;  3UKL A;  2WP9 A;  3FMW A;  3ICT A;  2YG3 A;  4Z43 A;  3P1W A;  4J2W A;  1BGN A;  2TMD A;  4Z24 A;  1YY5 A;  2AAQ A;  4HA6 A;  4REK A;  1VRQ B;  4H7U A;  4GDP A;  2BC0 A;  2YLX A;  3DH9 A;  5FS8 A;  4D03 A;  1GES A;  4NTE A;  1F8R A;  3BI2 A;  2C66 A;  2C65 A;  2RGJ A;  1GPE A;  2BC1 A;  1H83 A;  1F3P A;  3EAO A;  3UOY A;  3AYI A;  2WDV A;  3JSK A;  1N1P A;  4AOS A;  1JOA A;  2GEW A;  2BK5 A;  2BXS A;  4PAA A;  4C3X A;  4MJW A;  4YSZ A;  1PS9 A;  3URH A;  4YT0 A;  4TLZ A;  2XFP A;  3BI5 A;  5KWF A;  4TM3 A;  4J31 A;  2E1M A;  1P2E A;  1XPQ A;  1GTE A;  2VZ2 A;  2XFN A;  3UTH A;  3VR9 A;  5KOW A;  4H4P A;  3QFB A;  4H2R A;  2VVM A;  4H4U A;  1GRH A;  2J3N A;  2ZBW A;  4J34 A;  4OPD A;  2QAE A;  1K0J A;  2E4G A;  2XYO A;  2APG A;  4HB9 A;  1TDN A;  2WS3 A;  3NT6 A;  5EOW A;  4LA1 A;  1CJ3 A;  5FS6 A;  4WX1 A;  1JU2 A;  5KOX A;  2YLW A;  4K5R A;  3GYJ A;  2YM2 A;  3BNU A;  1NHQ A;  1DJN A;  4XWZ A;  3VR8 A;  3GYI A;  1FCD A;  2WPC A;  4A5L A;  1Q9I A;  2WHD A;  4NTC A;  4IA6 A;  1KNR A;  4B64 A;  3NK2 X;  2DKI A;  2YLZ A;  4AT0 A;  3ADA B;  2C72 A;  4U8N A;  5IQ1 A;  3ICR A;  1CJ2 A;  2W0H A;  2YWL A;  2WPF A;  3CPH G;  4KPR A;  3AD7 B;  2EQ6 A;  2V6O A;  2GMH A;  2ZZ0 A;  1ELI A;  3EPT A;  3LAD A;  1FOH A;  4IVM B;  1H84 A;  1GEU A;  3IHG A;  2H88 A;  2VVL A;  1PDH A;  3F8P A;  4O5Q A;  4EIP A;  1PXB A;  1S3B A;  1D5T A;  1O95 A;  1GRB A;  1PJ7 A;  1CHU A;  4IVO B;  5L46 A;  2C76 A;  3GSI A;  1EL5 A;  3CGD A;  3SM8 A;  1DJQ A;  3UTE A;  1NG4 A;  4H4Q A;  5U1O A;  4DNA A;  4GRT A;  1JRY A;  1LVL A;  4J56 A;  4Y4N A;  2IVD A;  4WCT A;  3AE2 A;  2GQF A;  1Z6L A;  2YG6 A;  4GDE A;  2YVG A;  4U8M A;  4EIQ A;  2WET A;  4JQ9 A;  2OAL A;  2Q0K A;  3RNM A;  4CNJ A;  3P4S A;  3FIM B;  1E1M A;  2AR8 A;  4NEV A;  4OPT A;  5IPY A;  2B9X A;  2XFQ A;  2X3N A;  4UDP A;  3I6D A;  3I3L A;  3NG7 X;  2FJB A;  3D8X A;  3AE7 A;  2C75 A;  1H7X A;  1GRA A;  2CUL A;  3K7T A;  4H2N A;  5CKU A;  4UDR A;  1RYI A;  3UOX A;  3ZDN A;  1JRX A;  3IWA A;  3D1C A;  2GMJ A;  2XFU A;  2YLT A;  4A7A A;  3Q9T A;  2R0P A;  3C4N A;  4H4S A;  1NAA A;  1ZKQ A;  5EB4 A;  3NH3 X;  1PBE A;  1JRZ A;  1TDK A;  2XLS A;  2YR5 A;  3K30 A;  2ACZ A;  2C64 A;  1CF3 A;  1Q1R A;  4X9M A;  3B3R A;  1AOG A;  2Q6U A;  4J33 A;  5HHF A;  1ZP0 A;  3SGL A;  1HYU A;  2YR4 A;  3AE5 A;  3ABV A;  2BAB A;  4FX9 A;  1PJ6 A;  2BAC A;  3GRT A;  1YQZ A;  2C73 A;  3KVE A;  1LQT A;  1EL9 A;  4LU6 A;  1Y0P A;  2GV8 A;  4Z2R A;  4K8D A;  5FMH A;  3AB1 A;  4DSH A;  1E7P A;  2GR1 A;  1KFY A;  2GQW A;  3NTA A;  4GF7 A;  1IUW A;  3NRN A;  4X4J A;  2FBW A;  1W4X A;  2A87 A;  4CY6 A;  1GTH A;  1VG0 A;  4IV9 A;  2R0G A;  2XDO A;  3ZYX A;  3GD3 A;  2R45 A;  3KD9 A;  3NTD A;  4Z2T A;  1IUV A;  4U8J A;  2R46 A;  3ATR A;  3LOV A;  1P2H A;  2BK4 A;  2BYB A;  3CGC A;  1PXC A;  1B8S A;  1TDO A;  3NIX A;  3QVR A;  1H7W A;  2VQ7 A;  4K7Z A;  1DOC A;  3CGB A;  4USQ A;  1NDA A;  3DK8 A;  3NN6 X;  1L9D A;  3AE6 A;  4JNQ A;  4AOX A;  4ZCD A;  2WOI A;  3F8D A;  3DK9 A;  2EQ7 A;  4CNK A;  1DOB A;  1GV4 A;  3M0O A;  1KSU A;  1S2Y A;  2OLN A;  3CND A;  4AT2 A;  1FEB A;  4H4Y A;  1GRF A;  3NN0 X;  1D4C A;  3RP8 A;  2Y6Q A;  3G5S A;  2JK6 A;  1K0L A;  2X8C A;  1IUU A;  3NGC X;  4FDC B;  1KDG A;  4ZN0 A;  2JB3 A;  3BI4 A;  3GWF A;  4H2P A;  3UKQ A;  1OJT A;  1YQ3 A;  4RG4 A;  2VVL G;  1V59 A;  2BS3 A;  1D7Y A;  3NKS A;  1BKW A;  1GRE A;  3C96 A;  3AD9 B;  4A6N B;  2XLP A;  4OVI A;  2VRM A;  3DJD A;  1ZMD A;  3GWD A;  2XVE A;  2PYX A;  3BHF A;  4I59 A;  1NHS A;  4KX6 A;  3ITJ A;  4EQR A;  3WE0 A;  3UCL A;  5HYM A;  4FK1 A;  1CJC A;  4U8K A;  4U2L A;  4B66 A;  1OJD A;  2Q7V A;  5M10 A;  3AE9 A;  1BGJ A;  3AXB A;  5EB5 A;  4B69 A;  2WBA A;  2V5Z A;  4YSY A;  5GRT A;  2GRT A;  3H8L A;  4AP1 A;  4DGK A;  3AEA A;  2R9Z A;  1YQ4 A;  2CVJ A;  1REO A;  4U2T A;  4GR1 A;  1BF3 A;  3G5R A;  3UOV A;  4I58 A;  3FG2 P;  2JBV A;  2BS4 A;  1MO9 A;  4AP3 A;  1BZL A;  4DSG A;  3FPZ A;  2YG4 A;  2BXR A;  2A8X A;  4XXG A;  3ALM A;  3SQP A;  4BUR A;  3ALJ A;  4H4R A;  2C3C A;  1TDF A;  2XVJ A;  4TM0 A;  1M64 A;  3NNE A;  3ICS A;  4B65 A;  4EQW A;  2TPR A;  3DJE A;  1S3E A;  2FJA A;  2V61 A;  2JAE A;  4Z26 A;  2BCG G;  2A89 A;  4ICY A;  4GCM A;  2WDR A;  2YLS A;  2UZZ A;  1QJD A;  2EQ8 A;  3ALL A;  4K5S A;  1B4V A;  1E39 A;  2ARD A;  1UKV G;  1ZX9 A;  1ZMC A;  4K22 A;  3AED A;  4U2S A;  1JNZ A;  1D7L A;  1CL0 A;  3GD4 A;  1IJH A;  4BK3 A;  2JKC A;  3P4Q A;  2GAH B;  4UDQ A;  4YSX A;  2C67 A;  1K4Q A;  5JCM A;  3RED A;  4IA5 A;  5KXJ A;  4EQX A;  5HXI A;  4C5O A;  1FEA A;  3AE4 A;  1N4W A;  3AE1 A;  2B9Y A;  2BS2 A;  4H4X A;  2YLR A;  1CC6 A;  1PBF A;  1TYT A;  5FS9 A;  3GRS A;  4LII A;  3LB8 A;  4C77 A;  4EMW A;  1Y56 B;  2OLO A;  1LQU A;  1N4U A;  3VRA A;  2YQU A;  1GND A;  3CNT A;  3KU9 A;  3V3N A;  2B7S A;  2GH5 A;  2X8H A;  2Z5Y A;  3CIR A;  3AE8 A;  1TRB A;  4H4V A;  2YG5 A;  2NPX A;  5C3J A;  4OPU A;  2GR3 A;  3CPJ G;  4ZCC A;  3Q6J A;  3NHO X;  4OPC A;  2V60 A;  4H2Q A;  4YWO A;  4OCG A;  3DA1 A;  4XWR A;  3NYF A;  5FS7 A;  1CC4 A;  2GAG B;  4EMJ A;  1VDC A;  1L9C A;  1F8W A;  3UKA A;  5KVI A;  2IID A;  3R9U A;  3VRB A;  4FK1 C;  1OJC A;  3AE3 A;  2ZZB A;  1DNC A;  2QA1 A;  5IQ4 A;  3PS9 A;  1E1N A;  2XVH A;  4B63 A;  4EMI A;  4H4Z A;  2RAB A;  4YTP A;  4C74 A;  2WP5 A;  1L0V A;  4A65 A;  1VQW A;  1GRG A;  3LXD A;  3IF9 A;  3UKP A;  3K7M X;  1S2Q A;  3DK4 A;  1N4V A;  1ZK7 A;  3O0H A;  4JDR A;  3RP7 A;  4E0V A;  4A9W A;  3NK0 X;  1KF6 A;  3H8I A;  3OZ2 A;  3GDN A;  2CDU A;  4NZH A;  2EQ9 A;  4APN A;  3DJG X;  2C7G A;  3BHK A;  4CCR A;  2YG7 A;  2WES A;  3NLC A;  1H86 A;  1XHC A;  1LV0 A;  3CGE A;  5HY5 A;  3IHM A;  2R4E A;  1GOS A;  1NEK A;  1YKJ A;  2FJE A;  4BJZ A;  4C3Y A;  2B7R A;  3GMB A;  3KA7 A;  3P4R A;  1GET A;  3NK1 X;  2CFY A;  2B76 A;  1KSS A;  1IUT A;  3L1R A;  3AYL A;  2XVF A;  3LZW A;  1FEC A;  2YR6 A;  3DGH A;  3S5W A;  3AEC A;  5C2T A;  3GDP A;  5KVH A;  1M6I A;  4YKF A;  1JEH A;  3QSM A;  1RP0 A;  1PJ5 A;  4J36 A;  1L9E A;  1VG9 A;  3DGZ A;  4CBQ A;  5J60 A;  1NPX A;  3G5Q A;  4U8P A;  5JCK A;  1PN0 A;  4B67 A;  1F6M A;  1JNR A;  2FJD A;  2JB2 A;  4P9S A;  1DOE A;  2YM1 A;  1XAN A;  3M12 A;  2WQY A;  1MOK A;  1NEN A;  3QSS A;  3UKK A;  1EBD A;  2C70 A;  2OAM A;  3F8R A;  2PHH A;  3UKF A;  4PAB A;  2OA1 A;  3AEB A;  1PBB A;  3AEG A;  4JN9 A;  5LV9 A;  2GR0 A;  4Z25 A;  3KLJ A;  2F5Z A;  3QJ4 A;  4TM1 A;  4EM3 A;  1NG3 A;  2XCG A;  3C4A A;  2WDQ A;  3AEE A;  3SFD A;  3UTG A;  3KPF A;  5ER0 A;  3LJP A;  4J57 A;  4A6N A;  1O5W A;  2O9Z A;  3H4K A;  4O5U A;  4YKG A;  4RG3 A;  2YAU A;  3P4P A;  5BRT A;  1H6V A;  1B5Q A;  2C3D A;  2WU2 A;  3VQR A;  3M13 A;  1PHH A;  2GR2 A;  2VOU A;  2GF3 A;  2WP6 A;  2BK3 A;  1ZDL A;  3CPI G;  1LTX R;  4ADW A;  1B37 A;  1NHP A;  5JCN A;  1TYP A;  1K0I A;  4NEW A;  5BVA A;  4TLX A;  4BK2 A;  3UOZ A;  1E1K A;  3EAN A;  1E6E A;  1BWC A;  1ONF A;  4Y4M A;  3EF6 A;  2GVC A;  1NHR A;  5J7X A;  2GB0 A;  3UTF A;  2WPE A;  4GUV A;  3RHA A;  3V3O A;  5JCI A;  2X50 A;  3FBS A;  2Y6R A;  2BCP A;  4D04 A;  1GRT A;  4U8L A;  1CJ4 A;  4X9N A;  1SEZ A;  2XLR A;  5M0Z A;  1GAL A;  2V3B A;  4M52 A;  3S61 A;  4B1B A;  4EM4 A;  3KKJ A;  2E5V A;  2DKH A;  2Z5X A;  2AQJ A;  3DME A;  1CC2 A;  3NYC A;  3IC9 A;  3T37 A;  2X99 A;  1D4D A;  4JNA A;  4U8I A;  3RP6 A;  4Z2U A;  3VRD B;  4BK1 A;  1DOD A;  1CBO A;  1IUS A;  3ATQ A;  4BJY A;  1QO8 A;  2YVJ A;  3QFA A;  2B9W A;  2R0C A;  1Q1W A;  3II4 A;  3CN8 A;  3P9U A;  3E1T A;  5EBK A;  4A99 A;  2RGO A;  4JY3 A;  3CNP A;  2Q0L A;  1FL2 A;  5U25 A;  1GXF A;  2VRL A;  1MXT A;  4H4W A;  1E1L A;  4OPI A;  1H81 A;  2H89 A;  3BNM A;  2YVF A;  1LPF A;  1PBC A;  5U63 A;  1GER A;  2XLU A;  1GSN A;  1ZOV A;  1COY A;  1KNP A;  4U8O A;  3L8K A;  2VQB A;  3AD8 B;  3QVP A;  2WU5 A;  2JB1 A;  4CRT A;  2WOW A;  5CQF A;  2XVI A;  4YSH A;  4JY2 A;  1GT8 A;  1O94 A;  3OC4 A;  2I0Z A;  4A79 A;  2V3A A;  1RSG A;  5BUL A;  3UKH A;  5DBJ A;  1H82 A;  1OJ9 A;  1D4E A;  3ISH A;  4YTM A;  1XDI A;  5GSN A;  3V76 A;  3CTY A;  3UP4 A;  1IUX A;  5BUK A;  5TR3 A;  2NVK X;  1EL7 A;  3NYE A;  1X31 B;  1F8S A;  4EQS A;  3SFE A;  4YXD A;  4ECH A;  2R4J A;  3GMC A;  4RSL A;  3AEF A;  1TDE A;  4H4T A;  4CCQ A;  4YTN A;  3B6D A;  4OPL A;  1EL8 A;  3HZL A;  2HQM A;  2QA2 A;  4USR A;  5JCL A;  2IVE A;  3QSE A;  4N9X A;  4Y4L A;  3AYJ A;  4UP3 A;  3PVC A;  4OPG A;  1LJ1 A;  2WEU A;  2RGH A;  4TM4 A;  2XLT A;  3LZX A;  1DXL A;  3CNS A; 
#chains in the Genus database with same CATH topology
 2BA9 A;  1PXA A;  2WOV A;  4BV6 A;  3DJJ A;  4B68 A;  1ZY8 A;  4H50 A;  3AWI A;  1OJA A;  5KRQ A;  2XFO A;  1ZOY A;  4NTD A;  1QLB A;  3COX A;  2QCU A;  3K7Q X;  4K2X A;  1Y56 A;  3UP5 A;  2ZZC A;  3CNJ A;  1PBD A;  4Z44 A;  2X8G A;  3PO7 A;  4CY8 A;  3UKL A;  2WP9 A;  3FMW A;  3ICT A;  2YG3 A;  4Z43 A;  2BRY A;  3P1W A;  4J2W A;  1BGN A;  2TMD A;  4Z24 A;  1YY5 A;  2AAQ A;  4HA6 A;  4REK A;  1VRQ B;  4H7U A;  4GDP A;  2BC0 A;  2YLX A;  3DH9 A;  5FS8 A;  4D03 A;  1GES A;  4NTE A;  1F8R A;  3BI2 A;  5KMS A;  2C66 A;  2C65 A;  2RGJ A;  1GPE A;  2BC1 A;  1H83 A;  1F3P A;  3EAO A;  3UOY A;  3AYI A;  2WDV A;  3JSK A;  1N1P A;  4AOS A;  1JOA A;  2GEW A;  2BK5 A;  2BXS A;  4PAA A;  4C3X A;  4MJW A;  4YSZ A;  1PS9 A;  3URH A;  4YT0 A;  4TLZ A;  2XFP A;  3BI5 A;  5KWF A;  4TM3 A;  4J31 A;  2E1M A;  1P2E A;  1XPQ A;  1GTE A;  2VZ2 A;  2XFN A;  3UTH A;  3VR9 A;  5KOW A;  4H4P A;  3QFB A;  4H2R A;  2VVM A;  4H4U A;  1GRH A;  2J3N A;  2ZBW A;  4J34 A;  4OPD A;  2QAE A;  1K0J A;  2E4G A;  2XYO A;  4G6H A;  2APG A;  3HYW A;  4HB9 A;  1TDN A;  2WS3 A;  3NT6 A;  5EOW A;  4LA1 A;  1CJ3 A;  5FS6 A;  4WX1 A;  3T14 A;  1JU2 A;  5KOX A;  2YLW A;  4K5R A;  3GYJ A;  2YM2 A;  3BNU A;  1NHQ A;  1DJN A;  4GAV A;  4II2 A;  3GYI A;  4XWZ A;  1FCD A;  2WPC A;  3VR8 A;  4A5L A;  1Q9I A;  2WHD A;  4NTC A;  4IA6 A;  1KNR A;  4B64 A;  3NK2 X;  2DKI A;  2YLZ A;  4AT0 A;  3ADA B;  2C72 A;  4U8N A;  5IQ1 A;  3ICR A;  1CJ2 A;  2W0H A;  2YWL A;  2WPF A;  3CPH G;  4KPR A;  3AD7 B;  2EQ6 A;  2V6O A;  4NNJ A;  2GMH A;  2ZZ0 A;  1ELI A;  3EPT A;  3LAD A;  1FOH A;  4IVM B;  1H84 A;  1GEU A;  3IHG A;  2H88 A;  2VVL A;  1PDH A;  3F8P A;  4O5Q A;  4EIP A;  1PXB A;  1S3B A;  1D5T A;  1O95 A;  1GRB A;  1PJ7 A;  1CHU A;  4IVO B;  5L46 A;  2C76 A;  3GSI A;  1EL5 A;  3CGD A;  3SM8 A;  1DJQ A;  3T2Y A;  4NWZ A;  3UTE A;  1NG4 A;  4H4Q A;  5U1O A;  4DNA A;  4GRT A;  1JRY A;  1LVL A;  4J56 A;  4Y4N A;  4II3 A;  4WCT A;  2IVD A;  5KMP A;  3AE2 A;  2GQF A;  1Z6L A;  2YG6 A;  4GDE A;  2YVG A;  4U8M A;  4EIQ A;  2WET A;  4JQ9 A;  2OAL A;  2Q0K A;  3RNM A;  4CNJ A;  3P4S A;  3FIM B;  5KNL A;  1E1M A;  2AR8 A;  4NEV A;  4OPT A;  5IPY A;  2B9X A;  2XFQ A;  2X3N A;  4UDP A;  3I6D A;  3I3L A;  3NG7 X;  2FJB A;  3D8X A;  3AE7 A;  2C75 A;  1H7X A;  1GRA A;  2CUL A;  3K7T A;  4H2N A;  5CKU A;  4UDR A;  1RYI A;  3UOX A;  3ZDN A;  1JRX A;  3IWA A;  3D1C A;  2GMJ A;  2XFU A;  2YLT A;  4A7A A;  3Q9T A;  2R0P A;  3C4N A;  4H4S A;  1NAA A;  1ZKQ A;  5EB4 A;  3SZF A;  3NH3 X;  1PBE A;  1JRZ A;  1TDK A;  2XLS A;  2YR5 A;  3K30 A;  2ACZ A;  2C64 A;  1CF3 A;  1Q1R A;  4X9M A;  3B3R A;  1AOG A;  2Q6U A;  4J33 A;  5HHF A;  1ZP0 A;  3SGL A;  1HYU A;  2YR4 A;  3AE5 A;  3ABV A;  2BAB A;  4FX9 A;  1PJ6 A;  2BAC A;  3GRT A;  1YQZ A;  2C73 A;  3KVE A;  1LQT A;  1EL9 A;  4LU6 A;  1Y0P A;  2GV8 A;  4Z2R A;  4K8D A;  5FMH A;  3AB1 A;  4DSH A;  1E7P A;  2GR1 A;  1KFY A;  2GQW A;  3NTA A;  4GF7 A;  1IUW A;  3NRN A;  4X4J A;  2FBW A;  1W4X A;  2A87 A;  4CY6 A;  1GTH A;  1VG0 A;  4IV9 A;  2R0G A;  2XDO A;  3ZYX A;  3GD3 A;  2R45 A;  3KD9 A;  3NTD A;  4Z2T A;  1IUV A;  4U8J A;  2R46 A;  3ATR A;  3LOV A;  1P2H A;  2BK4 A;  2BYB A;  3CGC A;  1PXC A;  1B8S A;  1TDO A;  3NIX A;  3QVR A;  1H7W A;  2VQ7 A;  4K7Z A;  1DOC A;  3CGB A;  4USQ A;  1NDA A;  3DK8 A;  3NN6 X;  1L9D A;  3AE6 A;  4JNQ A;  4AOX A;  4ZCD A;  2WOI A;  3F8D A;  3DK9 A;  2EQ7 A;  4CNK A;  1DOB A;  1GV4 A;  3M0O A;  1KSU A;  1S2Y A;  2OLN A;  3CND A;  4AT2 A;  1FEB A;  4H4Y A;  1GRF A;  3NN0 X;  1D4C A;  3RP8 A;  2Y6Q A;  3G5S A;  2JK6 A;  1K0L A;  2X8C A;  1IUU A;  3NGC X;  4FDC B;  1KDG A;  4ZN0 A;  2JB3 A;  3BI4 A;  3GWF A;  4H2P A;  3UKQ A;  3SZ0 A;  1OJT A;  1YQ3 A;  4RG4 A;  2VVL G;  1V59 A;  2BS3 A;  1D7Y A;  3NKS A;  1BKW A;  1GRE A;  3C96 A;  3AD9 B;  4A6N B;  2XLP A;  4OVI A;  2VRM A;  3DJD A;  1ZMD A;  3GWD A;  2XVE A;  2PYX A;  3BHF A;  4I59 A;  1NHS A;  4KX6 A;  3ITJ A;  4EQR A;  3WE0 A;  3UCL A;  5HYM A;  4FK1 A;  1CJC A;  4U8K A;  4U2L A;  4B66 A;  1OJD A;  2Q7V A;  5M10 A;  3AE9 A;  1BGJ A;  3AXB A;  5EB5 A;  4B69 A;  2WBA A;  2V5Z A;  4YSY A;  5GRT A;  2GRT A;  3H8L A;  4AP1 A;  4DGK A;  3AEA A;  2R9Z A;  1YQ4 A;  2CVJ A;  1REO A;  4U2T A;  4GR1 A;  1BF3 A;  3G5R A;  3UOV A;  4I58 A;  3FG2 P;  2JBV A;  2BS4 A;  1MO9 A;  4AP3 A;  1BZL A;  4DSG A;  3FPZ A;  2YG4 A;  2BXR A;  2A8X A;  4XXG A;  3ALM A;  3SQP A;  4BUR A;  3ALJ A;  4H4R A;  2C3C A;  1TDF A;  2XVJ A;  4TM0 A;  1M64 A;  3NNE A;  3ICS A;  4B65 A;  4EQW A;  2TPR A;  3DJE A;  1S3E A;  2FJA A;  2V61 A;  2JAE A;  4Z26 A;  2BCG G;  4G9K A;  2A89 A;  3CMM A;  4ICY A;  4GCM A;  2WDR A;  2YLS A;  5KMR A;  2UZZ A;  1QJD A;  2EQ8 A;  3ALL A;  4K5S A;  1B4V A;  1E39 A;  2ARD A;  1UKV G;  1ZX9 A;  1ZMC A;  4K22 A;  3AED A;  4U2S A;  1JNZ A;  1D7L A;  1CL0 A;  3GD4 A;  1IJH A;  4BK3 A;  2JKC A;  3P4Q A;  2GAH B;  4UDQ A;  4YSX A;  2C67 A;  1K4Q A;  3T0K A;  5JCM A;  3RED A;  4IA5 A;  5KXJ A;  4EQX A;  5HXI A;  4C5O A;  1FEA A;  3AE4 A;  2BRA A;  1N4W A;  3AE1 A;  2B9Y A;  2C4C A;  2BS2 A;  4H4X A;  2YLR A;  1CC6 A;  1PBF A;  1TYT A;  5FS9 A;  3GRS A;  4LII A;  3LB8 A;  4C77 A;  4EMW A;  1Y56 B;  2OLO A;  1LQU A;  1N4U A;  3VRA A;  2YQU A;  1GND A;  3CNT A;  3KU9 A;  3V3N A;  2B7S A;  2GH5 A;  2X8H A;  2Z5Y A;  3T2K A;  3CIR A;  3AE8 A;  1TRB A;  4H4V A;  2YG5 A;  2NPX A;  4GAP A;  5C3J A;  4OPU A;  3HYV A;  2GR3 A;  3CPJ G;  4ZCC A;  3SZW A;  3Q6J A;  3NHO X;  4OPC A;  2V60 A;  4H2Q A;  4YWO A;  4OCG A;  3DA1 A;  4XWR A;  3NYF A;  5FS7 A;  1CC4 A;  2GAG B;  4EMJ A;  1VDC A;  1L9C A;  1F8W A;  3UKA A;  5KVI A;  2IID A;  3R9U A;  3VRB A;  4FK1 C;  1OJC A;  3AE3 A;  2ZZB A;  1DNC A;  2QA1 A;  5IQ4 A;  3PS9 A;  1E1N A;  2XVH A;  4B63 A;  4EMI A;  4H4Z A;  2RAB A;  4YTP A;  4C74 A;  2WP5 A;  4G74 A;  1L0V A;  1VQW A;  1GRG A;  3LXD A;  4A65 A;  3GYX A;  3IF9 A;  3UKP A;  3K7M X;  1S2Q A;  3DK4 A;  1N4V A;  1ZK7 A;  3O0H A;  4JDR A;  3RP7 A;  4E0V A;  4A9W A;  3NK0 X;  1KF6 A;  3H8I A;  3SYI A;  3OZ2 A;  3GDN A;  2CDU A;  4NZH A;  2EQ9 A;  4APN A;  3DJG X;  2C7G A;  3BHK A;  4CCR A;  2YG7 A;  2WES A;  3NLC A;  1H86 A;  1XHC A;  1LV0 A;  3CGE A;  5HY5 A;  3IHM A;  2R4E A;  1GOS A;  1NEK A;  1YKJ A;  2FJE A;  4BJZ A;  4C3Y A;  2B7R A;  3GMB A;  3KA7 A;  3P4R A;  1GET A;  3NK1 X;  2CFY A;  2B76 A;  1KSS A;  1IUT A;  3L1R A;  3AYL A;  2XVF A;  3LZW A;  1FEC A;  2YR6 A;  3DGH A;  3S5W A;  3AEC A;  5C2T A;  3GDP A;  5KVH A;  1M6I A;  4YKF A;  1JEH A;  3QSM A;  1RP0 A;  1PJ5 A;  4J36 A;  1L9E A;  1VG9 A;  3DGZ A;  4CBQ A;  5J60 A;  1NPX A;  3G5Q A;  4U8P A;  5JCK A;  3SY4 A;  1PN0 A;  4B67 A;  1F6M A;  1JNR A;  2FJD A;  2JB2 A;  4P9S A;  1DOE A;  2YM1 A;  1XAN A;  3M12 A;  2WQY A;  1MOK A;  1NEN A;  3QSS A;  3UKK A;  1EBD A;  2C70 A;  2OAM A;  3F8R A;  2PHH A;  3UKF A;  4PAB A;  2OA1 A;  3AEB A;  1PBB A;  3AEG A;  4JN9 A;  5LV9 A;  2GR0 A;  4Z25 A;  3KLJ A;  3T31 A;  2F5Z A;  3QJ4 A;  4TM1 A;  4EM3 A;  4G6G A;  1NG3 A;  2XCG A;  3C4A A;  2WDQ A;  3AEE A;  3SFD A;  3UTG A;  3KPF A;  5ER0 A;  3LJP A;  4J57 A;  4A6N A;  1O5W A;  2O9Z A;  3H4K A;  4O5U A;  4YKG A;  4RG3 A;  2YAU A;  3P4P A;  5BRT A;  1H6V A;  1B5Q A;  2C3D A;  2WU2 A;  3SX6 A;  3VQR A;  3M13 A;  1PHH A;  2GR2 A;  2VOU A;  2GF3 A;  2WP6 A;  2BK3 A;  1ZDL A;  3CPI G;  1LTX R;  4ADW A;  1B37 A;  1NHP A;  5JCN A;  1TYP A;  1K0I A;  4NEW A;  5BVA A;  4TLX A;  4BK2 A;  3UOZ A;  1E1K A;  3EAN A;  1E6E A;  1BWC A;  1ONF A;  4Y4M A;  3EF6 A;  2GVC A;  1NHR A;  5J7X A;  2GB0 A;  3UTF A;  2WPE A;  4GUV A;  3RHA A;  3V3O A;  5JCI A;  2X50 A;  3FBS A;  2Y6R A;  2BCP A;  4D04 A;  3KPK A;  1GRT A;  4U8L A;  1CJ4 A;  4X9N A;  1SEZ A;  2XLR A;  5M0Z A;  1GAL A;  2V3B A;  4M52 A;  3S61 A;  4B1B A;  3T2Z A;  4EM4 A;  3KKJ A;  2E5V A;  2DKH A;  2Z5X A;  2AQJ A;  3DME A;  1CC2 A;  3NYC A;  3IC9 A;  3T37 A;  2X99 A;  1D4D A;  4JNA A;  4U8I A;  3RP6 A;  4Z2U A;  3VRD B;  4BK1 A;  1DOD A;  1CBO A;  1IUS A;  3ATQ A;  4BJY A;  1QO8 A;  2YVJ A;  3QFA A;  3HYX A;  2B9W A;  2R0C A;  1Q1W A;  3II4 A;  3CN8 A;  3P9U A;  3E1T A;  5EBK A;  4A99 A;  2RGO A;  4JY3 A;  3CNP A;  3SZC A;  2Q0L A;  1FL2 A;  5U25 A;  1GXF A;  2VRL A;  1MXT A;  4H4W A;  1E1L A;  4OPI A;  1H81 A;  2H89 A;  3BNM A;  2YVF A;  1LPF A;  1PBC A;  5U63 A;  1GER A;  2XLU A;  1GSN A;  1ZOV A;  1COY A;  1KNP A;  4U8O A;  3SXI A;  5KMQ A;  3L8K A;  2VQB A;  3AD8 B;  3QVP A;  2WU5 A;  2JB1 A;  4CRT A;  2WOW A;  5CQF A;  2XVI A;  4YSH A;  4JY2 A;  1GT8 A;  1O94 A;  3OC4 A;  2I0Z A;  4A79 A;  2V3A A;  1RSG A;  5BUL A;  3UKH A;  5DBJ A;  1H82 A;  1OJ9 A;  1D4E A;  3ISH A;  4YTM A;  1XDI A;  5GSN A;  3V76 A;  3CTY A;  3UP4 A;  1IUX A;  5BUK A;  5TR3 A;  2NVK X;  1EL7 A;  3NYE A;  1X31 B;  1F8S A;  4EQS A;  3SFE A;  4YXD A;  4ECH A;  2R4J A;  3GMC A;  4RSL A;  3AEF A;  1TDE A;  4H4T A;  4CCQ A;  4YTN A;  3B6D A;  4OPL A;  1EL8 A;  3HZL A;  2HQM A;  2QA2 A;  4USR A;  5JCL A;  2IVE A;  3QSE A;  4N9X A;  4Y4L A;  3AYJ A;  4UP3 A;  3PVC A;  4OPG A;  1LJ1 A;  4G73 A;  2WEU A;  2RGH A;  4TM4 A;  2XLT A;  3LZX A;  1DXL A;  3CNS A; 
#chains in the Genus database with same CATH homology
 2BA9 A;  1PXA A;  2WOV A;  4BV6 A;  3DJJ A;  4B68 A;  1ZY8 A;  4H50 A;  3AWI A;  1OJA A;  5KRQ A;  2XFO A;  1ZOY A;  4NTD A;  1QLB A;  3COX A;  2QCU A;  3K7Q X;  4K2X A;  1Y56 A;  3UP5 A;  2ZZC A;  3CNJ A;  1PBD A;  4Z44 A;  2X8G A;  3PO7 A;  4CY8 A;  3UKL A;  2WP9 A;  3FMW A;  3ICT A;  2YG3 A;  4Z43 A;  2BRY A;  3P1W A;  4J2W A;  1BGN A;  2TMD A;  4Z24 A;  1YY5 A;  2AAQ A;  4HA6 A;  4REK A;  1VRQ B;  4H7U A;  4GDP A;  2BC0 A;  2YLX A;  3DH9 A;  5FS8 A;  4D03 A;  1GES A;  4NTE A;  1F8R A;  3BI2 A;  5KMS A;  2C66 A;  2C65 A;  2RGJ A;  1GPE A;  2BC1 A;  1H83 A;  1F3P A;  3EAO A;  3UOY A;  3AYI A;  2WDV A;  3JSK A;  1N1P A;  4AOS A;  1JOA A;  2GEW A;  2BK5 A;  2BXS A;  4PAA A;  4C3X A;  4MJW A;  4YSZ A;  1PS9 A;  3URH A;  4YT0 A;  4TLZ A;  2XFP A;  3BI5 A;  5KWF A;  4TM3 A;  4J31 A;  2E1M A;  1P2E A;  1XPQ A;  1GTE A;  2VZ2 A;  2XFN A;  3UTH A;  3VR9 A;  5KOW A;  4H4P A;  3QFB A;  4H2R A;  2VVM A;  4H4U A;  1GRH A;  2J3N A;  2ZBW A;  4J34 A;  4OPD A;  2QAE A;  1K0J A;  2E4G A;  2XYO A;  4G6H A;  2APG A;  3HYW A;  4HB9 A;  1TDN A;  2WS3 A;  3NT6 A;  5EOW A;  4LA1 A;  1CJ3 A;  5FS6 A;  4WX1 A;  3T14 A;  1JU2 A;  5KOX A;  2YLW A;  4K5R A;  3GYJ A;  2YM2 A;  3BNU A;  1NHQ A;  1DJN A;  4GAV A;  4II2 A;  3GYI A;  4XWZ A;  1FCD A;  2WPC A;  3VR8 A;  4A5L A;  1Q9I A;  2WHD A;  4NTC A;  4IA6 A;  1KNR A;  4B64 A;  3NK2 X;  2DKI A;  2YLZ A;  4AT0 A;  3ADA B;  2C72 A;  4U8N A;  5IQ1 A;  3ICR A;  1CJ2 A;  2W0H A;  2YWL A;  2WPF A;  3CPH G;  4KPR A;  3AD7 B;  2EQ6 A;  2V6O A;  4NNJ A;  2GMH A;  2ZZ0 A;  1ELI A;  3EPT A;  3LAD A;  1FOH A;  4IVM B;  1H84 A;  1GEU A;  3IHG A;  2H88 A;  2VVL A;  1PDH A;  3F8P A;  4O5Q A;  4EIP A;  1PXB A;  1S3B A;  1D5T A;  1O95 A;  1GRB A;  1PJ7 A;  1CHU A;  4IVO B;  5L46 A;  2C76 A;  3GSI A;  1EL5 A;  3CGD A;  3SM8 A;  1DJQ A;  3T2Y A;  4NWZ A;  3UTE A;  1NG4 A;  4H4Q A;  5U1O A;  4DNA A;  4GRT A;  1JRY A;  1LVL A;  4J56 A;  4Y4N A;  4II3 A;  4WCT A;  2IVD A;  5KMP A;  3AE2 A;  2GQF A;  1Z6L A;  2YG6 A;  4GDE A;  2YVG A;  4U8M A;  4EIQ A;  2WET A;  4JQ9 A;  2OAL A;  2Q0K A;  3RNM A;  4CNJ A;  3P4S A;  3FIM B;  5KNL A;  1E1M A;  2AR8 A;  4NEV A;  4OPT A;  5IPY A;  2B9X A;  2XFQ A;  2X3N A;  4UDP A;  3I6D A;  3I3L A;  3NG7 X;  2FJB A;  3D8X A;  3AE7 A;  2C75 A;  1H7X A;  1GRA A;  2CUL A;  3K7T A;  4H2N A;  5CKU A;  4UDR A;  1RYI A;  3UOX A;  3ZDN A;  1JRX A;  3IWA A;  3D1C A;  2GMJ A;  2XFU A;  2YLT A;  4A7A A;  3Q9T A;  2R0P A;  3C4N A;  4H4S A;  1NAA A;  1ZKQ A;  5EB4 A;  3SZF A;  3NH3 X;  1PBE A;  1JRZ A;  1TDK A;  2XLS A;  2YR5 A;  3K30 A;  2ACZ A;  2C64 A;  1CF3 A;  1Q1R A;  4X9M A;  3B3R A;  1AOG A;  2Q6U A;  4J33 A;  5HHF A;  1ZP0 A;  3SGL A;  1HYU A;  2YR4 A;  3AE5 A;  3ABV A;  2BAB A;  4FX9 A;  1PJ6 A;  2BAC A;  3GRT A;  1YQZ A;  2C73 A;  3KVE A;  1LQT A;  1EL9 A;  4LU6 A;  1Y0P A;  2GV8 A;  4Z2R A;  4K8D A;  5FMH A;  3AB1 A;  4DSH A;  1E7P A;  2GR1 A;  1KFY A;  2GQW A;  3NTA A;  4GF7 A;  1IUW A;  3NRN A;  4X4J A;  2FBW A;  1W4X A;  2A87 A;  4CY6 A;  1GTH A;  1VG0 A;  4IV9 A;  2R0G A;  2XDO A;  3ZYX A;  3GD3 A;  2R45 A;  3KD9 A;  3NTD A;  4Z2T A;  1IUV A;  4U8J A;  2R46 A;  3ATR A;  3LOV A;  1P2H A;  2BK4 A;  2BYB A;  3CGC A;  1PXC A;  1B8S A;  1TDO A;  3NIX A;  3QVR A;  1H7W A;  2VQ7 A;  4K7Z A;  1DOC A;  3CGB A;  4USQ A;  1NDA A;  3DK8 A;  3NN6 X;  1L9D A;  3AE6 A;  4JNQ A;  4AOX A;  4ZCD A;  2WOI A;  3F8D A;  3DK9 A;  2EQ7 A;  4CNK A;  1DOB A;  1GV4 A;  3M0O A;  1KSU A;  1S2Y A;  2OLN A;  3CND A;  4AT2 A;  1FEB A;  4H4Y A;  1GRF A;  3NN0 X;  1D4C A;  3RP8 A;  2Y6Q A;  3G5S A;  2JK6 A;  1K0L A;  2X8C A;  1IUU A;  3NGC X;  4FDC B;  1KDG A;  4ZN0 A;  2JB3 A;  3BI4 A;  3GWF A;  4H2P A;  3UKQ A;  3SZ0 A;  1OJT A;  1YQ3 A;  4RG4 A;  2VVL G;  1V59 A;  2BS3 A;  1D7Y A;  3NKS A;  1BKW A;  1GRE A;  3C96 A;  3AD9 B;  4A6N B;  2XLP A;  4OVI A;  2VRM A;  3DJD A;  1ZMD A;  3GWD A;  2XVE A;  2PYX A;  3BHF A;  4I59 A;  1NHS A;  4KX6 A;  3ITJ A;  4EQR A;  3WE0 A;  3UCL A;  5HYM A;  4FK1 A;  1CJC A;  4U8K A;  4U2L A;  4B66 A;  1OJD A;  2Q7V A;  5M10 A;  3AE9 A;  1BGJ A;  3AXB A;  5EB5 A;  4B69 A;  2WBA A;  2V5Z A;  4YSY A;  5GRT A;  2GRT A;  3H8L A;  4AP1 A;  4DGK A;  3AEA A;  2R9Z A;  1YQ4 A;  2CVJ A;  1REO A;  4U2T A;  4GR1 A;  1BF3 A;  3G5R A;  3UOV A;  4I58 A;  3FG2 P;  2JBV A;  2BS4 A;  1MO9 A;  4AP3 A;  1BZL A;  4DSG A;  3FPZ A;  2YG4 A;  2BXR A;  2A8X A;  4XXG A;  3ALM A;  3SQP A;  4BUR A;  3ALJ A;  4H4R A;  2C3C A;  1TDF A;  2XVJ A;  4TM0 A;  1M64 A;  3NNE A;  3ICS A;  4B65 A;  4EQW A;  2TPR A;  3DJE A;  1S3E A;  2FJA A;  2V61 A;  2JAE A;  4Z26 A;  2BCG G;  4G9K A;  2A89 A;  3CMM A;  4ICY A;  4GCM A;  2WDR A;  2YLS A;  5KMR A;  2UZZ A;  1QJD A;  2EQ8 A;  3ALL A;  4K5S A;  1B4V A;  1E39 A;  2ARD A;  1UKV G;  1ZX9 A;  1ZMC A;  4K22 A;  3AED A;  4U2S A;  1JNZ A;  1D7L A;  1CL0 A;  3GD4 A;  1IJH A;  4BK3 A;  2JKC A;  3P4Q A;  2GAH B;  4UDQ A;  4YSX A;  2C67 A;  1K4Q A;  3T0K A;  5JCM A;  3RED A;  4IA5 A;  5KXJ A;  4EQX A;  5HXI A;  4C5O A;  1FEA A;  3AE4 A;  2BRA A;  1N4W A;  3AE1 A;  2B9Y A;  2C4C A;  2BS2 A;  4H4X A;  2YLR A;  1CC6 A;  1PBF A;  1TYT A;  5FS9 A;  3GRS A;  4LII A;  3LB8 A;  4C77 A;  4EMW A;  1Y56 B;  2OLO A;  1LQU A;  1N4U A;  3VRA A;  2YQU A;  1GND A;  3CNT A;  3KU9 A;  3V3N A;  2B7S A;  2GH5 A;  2X8H A;  2Z5Y A;  3T2K A;  3CIR A;  3AE8 A;  1TRB A;  4H4V A;  2YG5 A;  2NPX A;  4GAP A;  5C3J A;  4OPU A;  3HYV A;  2GR3 A;  3CPJ G;  4ZCC A;  3SZW A;  3Q6J A;  3NHO X;  4OPC A;  2V60 A;  4H2Q A;  4YWO A;  4OCG A;  3DA1 A;  4XWR A;  3NYF A;  5FS7 A;  1CC4 A;  2GAG B;  4EMJ A;  1VDC A;  1L9C A;  1F8W A;  3UKA A;  5KVI A;  2IID A;  3R9U A;  3VRB A;  4FK1 C;  1OJC A;  3AE3 A;  2ZZB A;  1DNC A;  2QA1 A;  5IQ4 A;  3PS9 A;  1E1N A;  2XVH A;  4B63 A;  4EMI A;  4H4Z A;  2RAB A;  4YTP A;  4C74 A;  2WP5 A;  4G74 A;  1L0V A;  1VQW A;  1GRG A;  3LXD A;  4A65 A;  3GYX A;  3IF9 A;  3UKP A;  3K7M X;  1S2Q A;  3DK4 A;  1N4V A;  1ZK7 A;  3O0H A;  4JDR A;  3RP7 A;  4E0V A;  4A9W A;  3NK0 X;  1KF6 A;  3H8I A;  3SYI A;  3OZ2 A;  3GDN A;  2CDU A;  4NZH A;  2EQ9 A;  4APN A;  3DJG X;  2C7G A;  3BHK A;  4CCR A;  2YG7 A;  2WES A;  3NLC A;  1H86 A;  1XHC A;  1LV0 A;  3CGE A;  5HY5 A;  3IHM A;  2R4E A;  1GOS A;  1NEK A;  1YKJ A;  2FJE A;  4BJZ A;  4C3Y A;  2B7R A;  3GMB A;  3KA7 A;  3P4R A;  1GET A;  3NK1 X;  2CFY A;  2B76 A;  1KSS A;  1IUT A;  3L1R A;  3AYL A;  2XVF A;  3LZW A;  1FEC A;  2YR6 A;  3DGH A;  3S5W A;  3AEC A;  5C2T A;  3GDP A;  5KVH A;  1M6I A;  4YKF A;  1JEH A;  3QSM A;  1RP0 A;  1PJ5 A;  4J36 A;  1L9E A;  1VG9 A;  3DGZ A;  4CBQ A;  5J60 A;  1NPX A;  3G5Q A;  4U8P A;  5JCK A;  3SY4 A;  1PN0 A;  4B67 A;  1F6M A;  1JNR A;  2FJD A;  2JB2 A;  4P9S A;  1DOE A;  2YM1 A;  1XAN A;  3M12 A;  2WQY A;  1MOK A;  1NEN A;  3QSS A;  3UKK A;  1EBD A;  2C70 A;  2OAM A;  3F8R A;  2PHH A;  3UKF A;  4PAB A;  2OA1 A;  3AEB A;  1PBB A;  3AEG A;  4JN9 A;  5LV9 A;  2GR0 A;  4Z25 A;  3KLJ A;  3T31 A;  2F5Z A;  3QJ4 A;  4TM1 A;  4EM3 A;  4G6G A;  1NG3 A;  2XCG A;  3C4A A;  2WDQ A;  3AEE A;  3SFD A;  3UTG A;  3KPF A;  5ER0 A;  3LJP A;  4J57 A;  4A6N A;  1O5W A;  2O9Z A;  3H4K A;  4O5U A;  4YKG A;  4RG3 A;  2YAU A;  3P4P A;  5BRT A;  1H6V A;  1B5Q A;  2C3D A;  2WU2 A;  3SX6 A;  3VQR A;  3M13 A;  1PHH A;  2GR2 A;  2VOU A;  2GF3 A;  2WP6 A;  2BK3 A;  1ZDL A;  3CPI G;  1LTX R;  4ADW A;  1B37 A;  1NHP A;  5JCN A;  1TYP A;  1K0I A;  4NEW A;  5BVA A;  4TLX A;  4BK2 A;  3UOZ A;  1E1K A;  3EAN A;  1E6E A;  1BWC A;  1ONF A;  4Y4M A;  3EF6 A;  2GVC A;  1NHR A;  5J7X A;  2GB0 A;  3UTF A;  2WPE A;  4GUV A;  3RHA A;  3V3O A;  5JCI A;  2X50 A;  3FBS A;  2Y6R A;  2BCP A;  4D04 A;  3KPK A;  1GRT A;  4U8L A;  1CJ4 A;  4X9N A;  1SEZ A;  2XLR A;  5M0Z A;  1GAL A;  2V3B A;  4M52 A;  3S61 A;  4B1B A;  3T2Z A;  4EM4 A;  3KKJ A;  2E5V A;  2DKH A;  2Z5X A;  2AQJ A;  3DME A;  1CC2 A;  3NYC A;  3IC9 A;  3T37 A;  2X99 A;  1D4D A;  4JNA A;  4U8I A;  3RP6 A;  4Z2U A;  3VRD B;  4BK1 A;  1DOD A;  1CBO A;  1IUS A;  3ATQ A;  4BJY A;  1QO8 A;  2YVJ A;  3QFA A;  3HYX A;  2B9W A;  2R0C A;  1Q1W A;  3II4 A;  3CN8 A;  3P9U A;  3E1T A;  5EBK A;  4A99 A;  2RGO A;  4JY3 A;  3CNP A;  3SZC A;  2Q0L A;  1FL2 A;  5U25 A;  1GXF A;  2VRL A;  1MXT A;  4H4W A;  1E1L A;  4OPI A;  1H81 A;  2H89 A;  3BNM A;  2YVF A;  1LPF A;  1PBC A;  5U63 A;  1GER A;  2XLU A;  1GSN A;  1ZOV A;  1COY A;  1KNP A;  4U8O A;  3SXI A;  5KMQ A;  3L8K A;  2VQB A;  3AD8 B;  3QVP A;  2WU5 A;  2JB1 A;  4CRT A;  2WOW A;  5CQF A;  2XVI A;  4YSH A;  4JY2 A;  1GT8 A;  1O94 A;  3OC4 A;  2I0Z A;  4A79 A;  2V3A A;  1RSG A;  5BUL A;  3UKH A;  5DBJ A;  1H82 A;  1OJ9 A;  1D4E A;  3ISH A;  4YTM A;  1XDI A;  5GSN A;  3V76 A;  3CTY A;  3UP4 A;  1IUX A;  5BUK A;  5TR3 A;  2NVK X;  1EL7 A;  3NYE A;  1X31 B;  1F8S A;  4EQS A;  3SFE A;  4YXD A;  4ECH A;  2R4J A;  3GMC A;  4RSL A;  3AEF A;  1TDE A;  4H4T A;  4CCQ A;  4YTN A;  3B6D A;  4OPL A;  1EL8 A;  3HZL A;  2HQM A;  2QA2 A;  4USR A;  5JCL A;  2IVE A;  3QSE A;  4N9X A;  4Y4L A;  3AYJ A;  4UP3 A;  3PVC A;  4OPG A;  1LJ1 A;  4G73 A;  2WEU A;  2RGH A;  4TM4 A;  2XLT A;  3LZX A;  1DXL A;  3CNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...