3LZXA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form ii)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
329
structure length
329
Chain Sequence
b'MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 92
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA02
2I0ZA 3G5QA 4YSXA 1LTXR 4EMWA 2EQ8A 3CNDA 2QCUA 4OVIA 4PABA 1FCDA 3B3RA 4EM3A 2BK4A 4ZCCA 2BCGG 3BNMA 2GRTA 3K7TA 3AYJA 2BS4A 1KNRA 1NDAA 4H2PA 1CJCA 3VQRA 4D03A 1P2EA 4NTCA 1GRAA 5U1OA 1FOHA 4B65A 5KVHA 1GRBA 3AE3A 2QAEA 1K0LA 2ZBWA 5JCIA 2YG5A 4U8IA 1GERA 2APGA 3P4QA 2BK5A 4NTEA 4OPLA 4YKFA 2EQ9A 1X31B 3UTHA 4HA6A 5BRTA 4YSHA 4Z24A 4ICYA 2VOUA 4CRTA 4H4XA 2VVLG 4FK1A 3QSEA 2BK3A 1FL2A 1H83A 3EPTA 5FS8A 2JKCA 3KPFA 3ATQA 3GD4A 3JSKA 5BVAA 3NK2X 3AE2A 4AT0A 1UKVG 3SGLA 2Q6UA 1PBCA 3CGEA 1H6VA 1GT8A 2WQYA 2C76A 2FJEA 3NRNA 2XLTA 1S3EA 4GDEA 2BXSA 1GRTA 2GB0A 1GRFA 3GRSA 4UDRA 4A6NA 1S3BA 2GQWA 2E5VA 4J2WA 3ABVA 1GTEA 1ZK7A 4TM1A 4DSGA 1GEUA 5EB5A 4H7UA 4TM3A 2X99A 4K7ZA 2CDUA 2BXRA 2C72A 4K2XA 2Y6QA 2AR8A 2ZZBA 3AB1A 3LXDA 3S5WA 2B9XA 4M52A 1CJ2A 1EL9A 1M64A 2ZZCA 1CJ3A 3VRBA 1TDEA 1VDCA 3ICSA 4IA6A 1NHRA 2YM2A 2VQBA 2XFNA 4OPGA 2BCPA 1EL8A 1L9DA 1BF3A 1VRQB 2X8HA 3AE5A 3NN6X 4U2SA 2XLRA 2GEWA 4XWRA 2XLPA 3DJEA 2FJDA 4IVMB 2WPEA 1MO9A 2YR4A 4K8DA 2C66A 3QSMA 4Y4NA 1ZOYA 5JCMA 3C4NA 3H4KA 1YQZA 2YVGA 3L1RA 2V3AA 4JY2A 3REDA 3FIMB 1CC6A 2YR5A 2R45A 3GDNA 3GYJA 4NTDA 3DJJA 1TDKA 3NK1X 1OJDA 1TRBA 2OA1A 2WP9A 3UTEA 1N4UA 2XVFA 4CCQA 2B9YA 3NKSA 3ALMA 3V3NA 1ZMDA 3BHFA 5FS7A 1QJDA 2A8XA 2FJBA 1K4QA 1ONFA 4J56A 2YVJA 1W4XA 3B6DA 4H4UA 3RP8A 3CPJG 4X4JA 4K5SA 3QFAA 4C3YA 1KDGA 2YQUA 1L9CA 2WPFA 1O5WA 3KVEA 4YT0A 1L9EA 1O94A 2BACA 3FMWA 4XWZA 1RP0A 2YVFA 4H4TA 3UTFA 4YTPA 4DGKA 1DJNA 1V59A 3GWFA 4GRTA 4BK1A 1TDFA 3KLJA 4EM4A 1IJHA 2C3DA 5JCNA 3DJDA 3UOXA 2YG6A 1NG3A 3M13A 3LB8A 4OCGA 4OPTA 4E0VA 2WOWA 2VRMA 1B5QA 4C77A 3NN0X 3UKQA 4Z2TA 4H4YA 4IV9A 4Y4MA 4C3XA 1NAAA 2FJAA 3AYLA 1PDHA 3NLCA 4Y4LA 2C67A 3UKHA 3CGCA 1NHQA 4H4SA 2C7GA 2NVKX 3NIXA 4U8NA 4AP3A 1TYTA 1ZMCA 3H8LA 3P4PA 3AE1A 2XLSA 4B1BA 2C64A 3AEBA 2Y6RA 4YKGA 2BYBA 1ZP0A 1KF6A 5HHFA 1VG0A 1PJ5A 1ZOVA 4Z43A 1PBDA 3RHAA 2B7SA 4YSZA 5CQFA 2AAQA 3PS9A 1KFYA 2GR3A 1L0VA 1K0IA 5HY5A 4BK2A 1E1MA 1DOBA 1PBFA 4H4RA 2XVJA 3CIRA 3URHA 2WDVA 2WPCA 3F8DA 4UDPA 3VR8A 1D7LA 3LADA 3AE9A 1JOAA 1MOKA 2H88A 2IVDA 2ACZA 1LJ1A 3P9UA 3GMBA 1CC4A 1LPFA 4OPDA 1EL7A 5M0ZA 1JRZA 3E1TA 4GUVA 4EMJA 3ZDNA 2GF3A 4Z26A 1NHPA 4JQ9A 3L8KA 1H84A 2GMJA 1GETA 3ATRA 3FBSA 1JRYA 4WCTA 3IHMA 4CY8A 1ZDLA 3VRAA 1FEBA 1XPQA 3GYIA 4AOXA 3PO7A 1BGNA 2WDRA 3HZLA 5KVIA 1H82A 3DGHA 1E6EA 4U8OA 3CTYA 4JN9A 4A6NB 4NZHA 3VRDB 4B63A 1SEZA 4BJZA 2XYOA 3AEAA 1JRXA 1FECA 5ER0A 2PYXA 4YXDA 3BHKA 1IUVA 4U2LA 3AEEA 3IHGA 1OJAA 4EQRA 4A99A 3RP6A 4AP1A 2O9ZA 3AECA 2C65A 3AEGA 2XVEA 4FK1C 1TDOA 2Q7VA 4WX1A 4A79A 1NENA 1LQTA 1PJ7A 2WP6A 2H89A 3O0HA 4LU6A 3DK4A 2IIDA 4C5OA 4A7AA 4BJYA 2YWLA 3M12A 4DNAA 4JNAA 1IUWA 1H81A 2R9ZA 4BV6A 3ALJA 1IUUA 1CL0A 1DOEA 2DKHA 3UKAA 5U63A 5KXJA 1REOA 1YY5A 1LVLA 1P2HA 1Y0PA 2ZZ0A 3NK0X 2Z5XA 4H2QA 5J60A 3LOVA 3DMEA 1N1PA 1XDIA 3Q9TA 2YG4A 4KX6A 3ICTA 3DK9A 2YG3A 3CGDA 2GQFA 1FEAA 2GMHA 5CKUA 2BC0A 4YTMA 5L46A 3NTDA 4RSLA 2BC1A 1RSGA 3EF6A 3GSIA 3LZWA 3CN8A 1S2QA 3SFDA 2VZ2A 1JNRA 3KA7A 4B64A 4U8LA 1Z6LA 3ICRA 3F8RA 4JY3A 3QSSA 4TM0A 4B66A 3UOYA 4EIPA 1E1KA 4PAAA 1S2YA 1GESA 2WESA 4N9XA 2C3CA 1NEKA 4CY6A 4CNJA 4H2RA 3EAOA 1KSSA 4J57A 1LQUA 2YM1A 2WP5A 4P9SA 5GRTA 5BULA 3AE7A 2XFPA 4GDPA 2YLWA 4FDCB 2VQ7A 4RG3A 4AT2A 3CPIG 3QFBA 1NG4A 3D1CA 2YLXA 1O95A 1TYPA 3BNUA 4ECHA 2JK6A 4BK3A 1YKJA 1DJQA 2A89A 2XVIA 1DOCA 1PXCA 2WETA 4MJWA 4X9MA 4NEVA 2PHHA 2GV8A 3CNPA 1OJCA 2BS3A 1PXAA 4JNQA 4YWOA 2VRLA 1GPEA 1CC2A 1KNPA 5BUKA 2BS2A 2WOIA 3WE0A 1YQ3A 4GF7A 1E1NA 1D7YA 4RG4A 4EMIA 3NTAA 5FMHA 5JCLA 2WBAA 1F6MA 5EBKA 2RGHA 3R9UA 3ITJA 4USRA 1E7PA 2CULA 2W0HA 2VVLA 1EL5A 5FS9A 3AE8A 3OC4A 4DSHA 3P4SA 4Z2UA 2AQJA 2R0CA 2TPRA 2YLTA 3ADAB 5IQ4A 1GNDA 1Q1RA 1MXTA 4C74A 2EQ7A 3G5RA 4J36A 3RP7A 3SM8A 3ZYXA 4GR1A 2YG7A 1D4DA 1N4WA 3BI2A 1Q1WA 3KD9A 1F8RA 2CVJA 2C73A 3CNSA 3P1WA 2XCGA 3RNMA 5IQ1A 2IVEA 4H4QA 4GCMA 5FS6A 4LIIA 3UP5A 1NHSA 1BKWA 5U25A 1D5TA 3NYFA 5C2TA 2OAMA 1H86A 1OJ9A 1DNCA 4HB9A 3PVCA 3C4AA 2JB3A 3BI5A 4OPCA 3KKJA 1IUSA 2GAHB 2GR0A 1PXBA 2J3NA 3F8PA 1QLBA 2X8CA 5JCKA 3C96A 2Q0LA 1HYUA 3LJPA 1QO8A 3Q6JA 1KSUA 4USQA 4JDRA 1B4VA 2V5ZA 4EQSA 5KOWA 4K5RA 2F5ZA 3K7QX 3AEDA 1TDNA 3UKLA 3AEFA 2YLZA 4I58A 3AD8B 3AWIA 4IVOB 4ZCDA 2R0GA 2Z5YA 4A5LA 5LV9A 2NPXA 3DA1A 4U8JA 2YLRA 3H8IA 1GTHA 3UTGA 1B8SA 4YSYA 1GRGA 1XHCA 2GAGB 3FG2P 3NHOX 2WU5A 3AD9B 4H4WA 2V6OA 2XVHA 5HXIA 4UP3A 1NPXA 1XANA 2XDOA 1IUXA 3SQPA 2V3BA 3II4A 3M0OA 2X3NA 1N4VA 2YR6A 1VQWA 2X50A 4NEWA 4APNA 4CCRA 1Y56A 3V76A 2CFYA 2XFOA 3I3LA 1Y56B 4ZN0A 5KRQA 2QA1A 1K0JA 3QVRA 5GSNA 1F8WA 2RGOA 3GWDA 4Z44A 2V60A 4TM4A 1GV4A 3NYCA 4XXGA 5IPYA 4X9NA 4OPIA 2X8GA 1PHHA 1DXLA 1GXFA 4H4ZA 2BA9A 3NT6A 1PBEA 4FX9A 2JB1A 4UDQA 3GDPA 1H7WA 4EQWA 3CGBA 2RABA 3DJGX 3GD3A 3K30A 4AOSA 2VVMA 2V61A 4J33A 4BURA 3NG7X 3I6DA 4H4PA 2C75A 2FBWA 3AXBA 4H4VA 2C70A 3OZ2A 2JAEA 5C3JA 3CNTA 3NYEA 4TLZA 3EANA 1JEHA 2TMDA 5J7XA 1GALA 3IF9A 4Z25A 2WS3A 1ELIA 2E1MA 1H7XA 2XLUA 3AE6A 4IA5A 2B9WA 4REKA 3UOZA 2Q0KA 4LA1A 4CBQA 3GMCA 1BGJA 3UKPA 1PS9A 1DODA 2BABA 1E39A 3D8XA 1M6IA 2XFUA 3LZXA 2GH5A 4B67A 2R0PA 3DGZA 1D4EA 4U8MA 2YLSA 3UKFA 4Z2RA 2DKIA 2E4GA 3T37A 3ALLA 3UCLA 4J34A 1CF3A 5DBJA 5M10A 1F8SA 4D04A 3DH9A 2HQMA 1E1LA 4ADWA 1ZX9A 3QJ4A 1GSNA 5HYMA 2B7RA 2WEUA 1LV0A 1BZLA 1IUTA 4EQXA 4YTNA 4OPUA 4EIQA 1CHUA 2GR2A 3IC9A 4KPRA 4O5QA 2OLOA 2R4JA 3CNJA 2WU2A 3BI4A 2JB2A 3VR9A 1OJTA 1BWCA 1ZKQA 2GR1A 3G5SA 3FPZA 1CBOA 3UOVA 3NH3X 1EBDA 2GVCA 3AYIA 1JU2A 5TR3A 2QA2A 3GRTA 1D4CA 3DK8A 4K22A 2R4EA 4A65A 3AE4A 2RGJA 3K7MX 4CNKA 5EB4A 4O5UA 5EOWA 3CPHG 3KU9A 5KOXA 4J31A 1YQ4A 1F3PA 3IWAA 4H2NA 2WHDA 1GRHA 3QVPA 1JNZA 4A9WA 1Q9IA 1CJ4A 2JBVA 4TLXA 3V3OA 5KWFA 2EQ6A 3UP4A 1VG9A 2OLNA 2WDQA 3AD7B 1PBBA 3P4RA 2XFQA 3COXA 3ISHA 2ARDA 1COYA 1GOSA 2UZZA 4B68A 2OALA 3SFEA 2YAUA 4H50A 4U2TA 1GREA 3NNEA 3NGCX 2R46A 1ZY8A 3UKKA 1PJ6A 2B76A 2WOVA 1AOGA 4U8PA 1B37A 2A87A 1PN0A 4B69A 3S61A 4U8KA 1RYIA 4I59A
chains in the Genus database with same CATH superfamily
2I0ZA 3G5QA 4YSXA 1LTXR 4EMWA 2EQ8A 3CNDA 2QCUA 4OVIA 4PABA 1FCDA 3B3RA 4EM3A 2BK4A 4ZCCA 2BCGG 3BNMA 2GRTA 3K7TA 3AYJA 2BS4A 1KNRA 1NDAA 4H2PA 3T31A 1CJCA 3VQRA 4D03A 1P2EA 4NTCA 4NWZA 1GRAA 5U1OA 1FOHA 4B65A 5KNLA 5KVHA 1GRBA 3AE3A 2QAEA 1K0LA 2ZBWA 5JCIA 2YG5A 4U8IA 1GERA 2APGA 3P4QA 2BK5A 4NTEA 4OPLA 4YKFA 2EQ9A 1X31B 3T0KA 4HA6A 3UTHA 5BRTA 4YSHA 4Z24A 4ICYA 2VOUA 4CRTA 4H4XA 2VVLG 4FK1A 3T2KA 3QSEA 2BK3A 3CMMA 1FL2A 1H83A 3EPTA 5FS8A 2JKCA 3KPFA 3ATQA 3GD4A 3JSKA 5BVAA 3NK2X 3AE2A 4AT0A 1UKVG 3SGLA 2Q6UA 1PBCA 4II2A 5KMQA 3CGEA 1H6VA 1GT8A 2WQYA 2C76A 2FJEA 4II3A 3NRNA 2XLTA 1S3EA 4GDEA 2BXSA 1GRTA 2GB0A 1GRFA 3GRSA 4UDRA 4G6GA 4A6NA 1S3BA 2GQWA 2E5VA 4J2WA 3ABVA 1GTEA 1ZK7A 4TM1A 3SX6A 4DSGA 1GEUA 5EB5A 4H7UA 4TM3A 2X99A 4K7ZA 2CDUA 2BXRA 2C72A 4K2XA 2Y6QA 2AR8A 2ZZBA 3AB1A 3LXDA 3S5WA 2B9XA 4M52A 1CJ2A 3HYWA 1EL9A 1M64A 2ZZCA 1CJ3A 3SZCA 1TDEA 3VRBA 1VDCA 3ICSA 4IA6A 1NHRA 2YM2A 2VQBA 2XFNA 4OPGA 2BCPA 1EL8A 1L9DA 1BF3A 1VRQB 2X8HA 3AE5A 3NN6X 4U2SA 2XLRA 2GEWA 4XWRA 2XLPA 3DJEA 2FJDA 4IVMB 2WPEA 1MO9A 2YR4A 4K8DA 2C66A 3QSMA 4Y4NA 1ZOYA 5JCMA 3C4NA 3H4KA 1YQZA 2YVGA 3L1RA 2V3AA 4JY2A 3REDA 3FIMB 1CC6A 2YR5A 2R45A 3GDNA 3GYJA 4NTDA 3DJJA 1TDKA 3NK1X 1OJDA 1TRBA 2OA1A 2WP9A 3UTEA 1N4UA 2XVFA 4CCQA 2B9YA 3NKSA 3ALMA 3V3NA 1ZMDA 3BHFA 5FS7A 1QJDA 2A8XA 2BRYA 1K4QA 1ONFA 2FJBA 2YVJA 4J56A 1W4XA 3B6DA 4H4UA 3RP8A 3CPJG 4X4JA 4K5SA 3QFAA 4C3YA 1KDGA 2YQUA 1L9CA 2WPFA 1O5WA 3KVEA 4YT0A 1L9EA 1O94A 2BACA 3FMWA 4XWZA 1RP0A 2YVFA 4H4TA 3UTFA 4YTPA 4DGKA 1DJNA 1V59A 3GWFA 4GRTA 4BK1A 1TDFA 3KLJA 4EM4A 1IJHA 2C3DA 5JCNA 3DJDA 3UOXA 2YG6A 1NG3A 3M13A 3LB8A 4OCGA 4OPTA 4E0VA 2WOWA 2VRMA 1B5QA 4C77A 3NN0X 3UKQA 4Z2TA 4H4YA 4IV9A 4Y4MA 4C3XA 1NAAA 2FJAA 3AYLA 1PDHA 3NLCA 4Y4LA 2C67A 3UKHA 3CGCA 1NHQA 4H4SA 2C7GA 2NVKX 3NIXA 4U8NA 4AP3A 1TYTA 1ZMCA 3H8LA 3P4PA 3AE1A 2XLSA 4B1BA 2C64A 3AEBA 2Y6RA 4YKGA 2BYBA 1ZP0A 1KF6A 5HHFA 1VG0A 1PJ5A 1ZOVA 4Z43A 1PBDA 3RHAA 2B7SA 4YSZA 5CQFA 2AAQA 3PS9A 1KFYA 2GR3A 4GAPA 1L0VA 1K0IA 5HY5A 4BK2A 1E1MA 1DOBA 1PBFA 4H4RA 3SY4A 2XVJA 3CIRA 3URHA 2WDVA 2WPCA 3F8DA 4UDPA 3VR8A 1D7LA 3LADA 3AE9A 1JOAA 1MOKA 2H88A 2IVDA 2ACZA 1LJ1A 3P9UA 3GMBA 1CC4A 1LPFA 4OPDA 1EL7A 5M0ZA 1JRZA 3E1TA 4GUVA 4EMJA 3ZDNA 2GF3A 4Z26A 1NHPA 4JQ9A 4GAVA 3L8KA 1H84A 2GMJA 1GETA 3ATRA 3FBSA 1JRYA 4WCTA 3IHMA 4CY8A 1ZDLA 3VRAA 1FEBA 1XPQA 3GYIA 4AOXA 3PO7A 1BGNA 3T2YA 2WDRA 3HZLA 5KVIA 1H82A 3DGHA 1E6EA 4U8OA 3CTYA 4JN9A 4A6NB 4NZHA 3VRDB 4B63A 1SEZA 4BJZA 2XYOA 3AEAA 1JRXA 1FECA 5ER0A 2PYXA 4YXDA 3BHKA 1IUVA 4U2LA 3AEEA 3IHGA 1OJAA 4EQRA 4A99A 3RP6A 4AP1A 2O9ZA 3AECA 2C65A 3AEGA 2XVEA 4FK1C 1TDOA 2BRAA 2Q7VA 4WX1A 4A79A 1NENA 1LQTA 1PJ7A 2WP6A 2H89A 3O0HA 4LU6A 3DK4A 3T14A 2IIDA 4C5OA 4A7AA 4BJYA 2YWLA 3M12A 4DNAA 4JNAA 1IUWA 1H81A 2R9ZA 4BV6A 3SZ0A 3ALJA 1IUUA 1CL0A 1DOEA 2DKHA 3UKAA 5U63A 5KXJA 1REOA 1YY5A 1LVLA 1P2HA 1Y0PA 2ZZ0A 3NK0X 2Z5XA 4H2QA 5J60A 3LOVA 3DMEA 1N1PA 1XDIA 3Q9TA 2YG4A 4KX6A 3ICTA 3DK9A 2YG3A 3CGDA 2GQFA 1FEAA 2GMHA 5CKUA 2BC0A 4YTMA 5L46A 3NTDA 4RSLA 2BC1A 1RSGA 3EF6A 3GSIA 3LZWA 3CN8A 1S2QA 3SFDA 2VZ2A 1JNRA 3KA7A 4B64A 5KMRA 4U8LA 1Z6LA 3ICRA 3F8RA 4JY3A 3QSSA 4TM0A 4B66A 3UOYA 4G6HA 4EIPA 1E1KA 4PAAA 1S2YA 1GESA 2WESA 4N9XA 2C3CA 1NEKA 4CY6A 4CNJA 4H2RA 3EAOA 1KSSA 4J57A 1LQUA 2YM1A 2WP5A 4P9SA 5GRTA 5BULA 3AE7A 2XFPA 4GDPA 2YLWA 3SXIA 4FDCB 2VQ7A 4RG3A 4AT2A 3CPIG 3QFBA 1NG4A 3D1CA 2YLXA 1O95A 1TYPA 3BNUA 4ECHA 2JK6A 4BK3A 1YKJA 1DJQA 2A89A 2XVIA 1DOCA 1PXCA 2WETA 4MJWA 4X9MA 4NEVA 2PHHA 2GV8A 3CNPA 1OJCA 2BS3A 1PXAA 4G74A 4JNQA 2VRLA 4YWOA 1GPEA 1CC2A 1KNPA 5BUKA 2BS2A 2WOIA 3WE0A 1YQ3A 4GF7A 1E1NA 1D7YA 4RG4A 4EMIA 3NTAA 5FMHA 5JCLA 2WBAA 1F6MA 5EBKA 2RGHA 3R9UA 3ITJA 4USRA 1E7PA 2CULA 2W0HA 2VVLA 1EL5A 5FS9A 3AE8A 3OC4A 4DSHA 3P4SA 4Z2UA 2AQJA 2R0CA 2TPRA 2YLTA 3ADAB 5IQ4A 1GNDA 1Q1RA 1MXTA 4C74A 2EQ7A 3G5RA 4J36A 3RP7A 3SM8A 3ZYXA 4GR1A 2YG7A 1D4DA 1N4WA 3BI2A 1Q1WA 3KD9A 1F8RA 2CVJA 2C73A 3CNSA 3P1WA 2XCGA 3RNMA 5IQ1A 2IVEA 5KMSA 4H4QA 4GCMA 5FS6A 4LIIA 3UP5A 1NHSA 1BKWA 5U25A 1D5TA 3NYFA 5C2TA 2OAMA 1H86A 1OJ9A 1DNCA 4HB9A 3PVCA 3C4AA 2JB3A 3BI5A 4OPCA 3KKJA 1IUSA 2GAHB 3GYXA 2GR0A 1PXBA 2J3NA 3F8PA 1QLBA 2X8CA 5JCKA 3C96A 2Q0LA 1HYUA 3LJPA 1QO8A 3Q6JA 1KSUA 4USQA 4JDRA 1B4VA 2V5ZA 4EQSA 5KOWA 4K5RA 2F5ZA 3K7QX 3AEDA 1TDNA 3KPKA 3UKLA 3AEFA 2YLZA 4I58A 3AD8B 3AWIA 4IVOB 4ZCDA 2R0GA 2Z5YA 4A5LA 5LV9A 2NPXA 3DA1A 4U8JA 2YLRA 3H8IA 3SYIA 1GTHA 3UTGA 1B8SA 4G9KA 4YSYA 1GRGA 1XHCA 2GAGB 3FG2P 3NHOX 2WU5A 3AD9B 3HYXA 4H4WA 2V6OA 2XVHA 5HXIA 4UP3A 1NPXA 1XANA 2XDOA 1IUXA 3SQPA 2V3BA 3II4A 3M0OA 2X3NA 3T2ZA 1N4VA 2YR6A 1VQWA 2X50A 4NEWA 4APNA 3SZFA 4CCRA 1Y56A 3V76A 2CFYA 2XFOA 3I3LA 1Y56B 4ZN0A 5KRQA 2QA1A 1K0JA 3QVRA 5GSNA 1F8WA 2RGOA 3GWDA 4Z44A 2V60A 4TM4A 1GV4A 3NYCA 4XXGA 5IPYA 4X9NA 4OPIA 2X8GA 1PHHA 1DXLA 1GXFA 4H4ZA 2BA9A 3NT6A 1PBEA 4FX9A 2JB1A 4UDQA 3GDPA 1H7WA 4EQWA 3CGBA 2RABA 3DJGX 3GD3A 3K30A 4NNJA 2VVMA 2V61A 4J33A 4AOSA 4BURA 3NG7X 3I6DA 4H4PA 2C75A 2FBWA 3AXBA 4H4VA 2C70A 3OZ2A 2JAEA 5C3JA 3CNTA 3NYEA 4TLZA 3EANA 1JEHA 2TMDA 5J7XA 1GALA 3IF9A 4Z25A 2WS3A 1ELIA 2E1MA 1H7XA 2XLUA 3AE6A 4IA5A 2B9WA 4REKA 3UOZA 2Q0KA 4LA1A 4CBQA 3GMCA 1BGJA 3UKPA 1PS9A 5KMPA 1DODA 2BABA 1E39A 3D8XA 1M6IA 2XFUA 3LZXA 2GH5A 4B67A 2R0PA 3DGZA 1D4EA 4U8MA 2YLSA 3UKFA 4Z2RA 2DKIA 2E4GA 3T37A 3ALLA 3UCLA 4J34A 1CF3A 2C4CA 5DBJA 1F8SA 5M10A 4D04A 3DH9A 2HQMA 1E1LA 4ADWA 1ZX9A 3QJ4A 1GSNA 5HYMA 2B7RA 2WEUA 1LV0A 1BZLA 1IUTA 4EQXA 4YTNA 4OPUA 4EIQA 1CHUA 2GR2A 3IC9A 4KPRA 4O5QA 2OLOA 2R4JA 3CNJA 2WU2A 3BI4A 2JB2A 3VR9A 1OJTA 1BWCA 1ZKQA 2GR1A 3G5SA 3FPZA 1CBOA 3UOVA 3NH3X 3SZWA 1EBDA 2GVCA 3AYIA 1JU2A 5TR3A 2QA2A 3GRTA 1D4CA 3DK8A 4K22A 2R4EA 4A65A 3AE4A 2RGJA 3K7MX 4CNKA 5EB4A 4O5UA 5EOWA 3CPHG 3KU9A 3HYVA 5KOXA 4J31A 1YQ4A 1F3PA 3IWAA 4H2NA 2WHDA 1GRHA 3QVPA 1JNZA 4A9WA 1Q9IA 1CJ4A 2JBVA 4TLXA 3V3OA 4G73A 2EQ6A 3UP4A 1VG9A 5KWFA 2OLNA 2WDQA 3AD7B 1PBBA 3P4RA 2XFQA 3COXA 3ISHA 2ARDA 1COYA 1GOSA 2UZZA 4B68A 2OALA 3SFEA 2YAUA 4H50A 4U2TA 1GREA 3NNEA 3NGCX 2R46A 1ZY8A 3UKKA 1PJ6A 2B76A 2WOVA 1AOGA 4U8PA 1B37A 2A87A 1PN0A 4B69A 3S61A 4U8KA 1RYIA 4I59A
chains in the Genus database with same CATH topology
2I0ZA 3G5QA 4YSXA 1LTXR 4EMWA 2EQ8A 3CNDA 2QCUA 4OVIA 4PABA 1FCDA 3B3RA 4EM3A 2BK4A 4ZCCA 2BCGG 3BNMA 2GRTA 3K7TA 3AYJA 2BS4A 1KNRA 1NDAA 4H2PA 3T31A 1CJCA 3VQRA 4D03A 1P2EA 4NTCA 4NWZA 1GRAA 5U1OA 1FOHA 4B65A 5KNLA 5KVHA 1GRBA 3AE3A 2QAEA 1K0LA 2ZBWA 5JCIA 2YG5A 4U8IA 1GERA 2APGA 3P4QA 2BK5A 4NTEA 4OPLA 4YKFA 2EQ9A 1X31B 3T0KA 4HA6A 3UTHA 5BRTA 4YSHA 4Z24A 4ICYA 2VOUA 4CRTA 4H4XA 2VVLG 4FK1A 3T2KA 3QSEA 2BK3A 3CMMA 1FL2A 1H83A 3EPTA 5FS8A 2JKCA 3KPFA 3ATQA 3GD4A 3JSKA 5BVAA 3NK2X 3AE2A 4AT0A 1UKVG 3SGLA 2Q6UA 1PBCA 4II2A 5KMQA 3CGEA 1H6VA 1GT8A 2WQYA 2C76A 2FJEA 4II3A 3NRNA 2XLTA 1S3EA 4GDEA 2BXSA 1GRTA 2GB0A 1GRFA 3GRSA 4UDRA 4G6GA 4A6NA 1S3BA 2GQWA 2E5VA 4J2WA 3ABVA 1GTEA 1ZK7A 4TM1A 3SX6A 4DSGA 1GEUA 5EB5A 4H7UA 4TM3A 2X99A 4K7ZA 2CDUA 2BXRA 2C72A 4K2XA 2Y6QA 2AR8A 2ZZBA 3AB1A 3LXDA 3S5WA 2B9XA 4M52A 1CJ2A 3HYWA 1EL9A 1M64A 2ZZCA 1CJ3A 3SZCA 1TDEA 3VRBA 1VDCA 3ICSA 4IA6A 1NHRA 2YM2A 2VQBA 2XFNA 4OPGA 2BCPA 1EL8A 1L9DA 1BF3A 1VRQB 2X8HA 3AE5A 3NN6X 4U2SA 2XLRA 2GEWA 4XWRA 2XLPA 3DJEA 2FJDA 4IVMB 2WPEA 1MO9A 2YR4A 4K8DA 2C66A 3QSMA 4Y4NA 1ZOYA 5JCMA 3C4NA 3H4KA 1YQZA 2YVGA 3L1RA 2V3AA 4JY2A 3REDA 3FIMB 1CC6A 2YR5A 2R45A 3GDNA 3GYJA 4NTDA 3DJJA 1TDKA 3NK1X 1OJDA 1TRBA 2OA1A 2WP9A 3UTEA 1N4UA 2XVFA 4CCQA 2B9YA 3NKSA 3ALMA 3V3NA 1ZMDA 3BHFA 5FS7A 1QJDA 2A8XA 2BRYA 1K4QA 1ONFA 2FJBA 2YVJA 4J56A 1W4XA 3B6DA 4H4UA 3RP8A 3CPJG 4X4JA 4K5SA 3QFAA 4C3YA 1KDGA 2YQUA 1L9CA 2WPFA 1O5WA 3KVEA 4YT0A 1L9EA 1O94A 2BACA 3FMWA 4XWZA 1RP0A 2YVFA 4H4TA 3UTFA 4YTPA 4DGKA 1DJNA 1V59A 3GWFA 4GRTA 4BK1A 1TDFA 3KLJA 4EM4A 1IJHA 2C3DA 5JCNA 3DJDA 3UOXA 2YG6A 1NG3A 3M13A 3LB8A 4OCGA 4OPTA 4E0VA 2WOWA 2VRMA 1B5QA 4C77A 3NN0X 3UKQA 4Z2TA 4H4YA 4IV9A 4Y4MA 4C3XA 1NAAA 2FJAA 3AYLA 1PDHA 3NLCA 4Y4LA 2C67A 3UKHA 3CGCA 1NHQA 4H4SA 2C7GA 2NVKX 3NIXA 4U8NA 4AP3A 1TYTA 1ZMCA 3H8LA 3P4PA 3AE1A 2XLSA 4B1BA 2C64A 3AEBA 2Y6RA 4YKGA 2BYBA 1ZP0A 1KF6A 5HHFA 1VG0A 1PJ5A 1ZOVA 4Z43A 1PBDA 3RHAA 2B7SA 4YSZA 5CQFA 2AAQA 3PS9A 1KFYA 2GR3A 4GAPA 1L0VA 1K0IA 5HY5A 4BK2A 1E1MA 1DOBA 1PBFA 4H4RA 3SY4A 2XVJA 3CIRA 3URHA 2WDVA 2WPCA 3F8DA 4UDPA 3VR8A 1D7LA 3LADA 3AE9A 1JOAA 1MOKA 2H88A 2IVDA 2ACZA 1LJ1A 3P9UA 3GMBA 1CC4A 1LPFA 4OPDA 1EL7A 5M0ZA 1JRZA 3E1TA 4GUVA 4EMJA 3ZDNA 2GF3A 4Z26A 1NHPA 4JQ9A 4GAVA 3L8KA 1H84A 2GMJA 1GETA 3ATRA 3FBSA 1JRYA 4WCTA 3IHMA 4CY8A 1ZDLA 3VRAA 1FEBA 1XPQA 3GYIA 4AOXA 3PO7A 1BGNA 3T2YA 2WDRA 3HZLA 5KVIA 1H82A 3DGHA 1E6EA 4U8OA 3CTYA 4JN9A 4A6NB 4NZHA 3VRDB 4B63A 1SEZA 4BJZA 2XYOA 3AEAA 1JRXA 1FECA 5ER0A 2PYXA 4YXDA 3BHKA 1IUVA 4U2LA 3AEEA 3IHGA 1OJAA 4EQRA 4A99A 3RP6A 4AP1A 2O9ZA 3AECA 2C65A 3AEGA 2XVEA 4FK1C 1TDOA 2BRAA 2Q7VA 4WX1A 4A79A 1NENA 1LQTA 1PJ7A 2WP6A 2H89A 3O0HA 4LU6A 3DK4A 3T14A 2IIDA 4C5OA 4A7AA 4BJYA 2YWLA 3M12A 4DNAA 4JNAA 1IUWA 1H81A 2R9ZA 4BV6A 3SZ0A 3ALJA 1IUUA 1CL0A 1DOEA 2DKHA 3UKAA 5U63A 5KXJA 1REOA 1YY5A 1LVLA 1P2HA 1Y0PA 2ZZ0A 3NK0X 2Z5XA 4H2QA 5J60A 3LOVA 3DMEA 1N1PA 1XDIA 3Q9TA 2YG4A 4KX6A 3ICTA 3DK9A 2YG3A 3CGDA 2GQFA 1FEAA 2GMHA 5CKUA 2BC0A 4YTMA 5L46A 3NTDA 4RSLA 2BC1A 1RSGA 3EF6A 3GSIA 3LZWA 3CN8A 1S2QA 3SFDA 2VZ2A 1JNRA 3KA7A 4B64A 5KMRA 4U8LA 1Z6LA 3ICRA 3F8RA 4JY3A 3QSSA 4TM0A 4B66A 3UOYA 4G6HA 4EIPA 1E1KA 4PAAA 1S2YA 1GESA 2WESA 4N9XA 2C3CA 1NEKA 4CY6A 4CNJA 4H2RA 3EAOA 1KSSA 4J57A 1LQUA 2YM1A 2WP5A 4P9SA 5GRTA 5BULA 3AE7A 2XFPA 4GDPA 2YLWA 3SXIA 4FDCB 2VQ7A 4RG3A 4AT2A 3CPIG 3QFBA 1NG4A 3D1CA 2YLXA 1O95A 1TYPA 3BNUA 4ECHA 2JK6A 4BK3A 1YKJA 1DJQA 2A89A 2XVIA 1DOCA 1PXCA 2WETA 4MJWA 4X9MA 4NEVA 2PHHA 2GV8A 3CNPA 1OJCA 2BS3A 1PXAA 4G74A 4JNQA 2VRLA 4YWOA 1GPEA 1CC2A 1KNPA 5BUKA 2BS2A 2WOIA 3WE0A 1YQ3A 4GF7A 1E1NA 1D7YA 4RG4A 4EMIA 3NTAA 5FMHA 5JCLA 2WBAA 1F6MA 5EBKA 2RGHA 3R9UA 3ITJA 4USRA 1E7PA 2CULA 2W0HA 2VVLA 1EL5A 5FS9A 3AE8A 3OC4A 4DSHA 3P4SA 4Z2UA 2AQJA 2R0CA 2TPRA 2YLTA 3ADAB 5IQ4A 1GNDA 1Q1RA 1MXTA 4C74A 2EQ7A 3G5RA 4J36A 3RP7A 3SM8A 3ZYXA 4GR1A 2YG7A 1D4DA 1N4WA 3BI2A 1Q1WA 3KD9A 1F8RA 2CVJA 2C73A 3CNSA 3P1WA 2XCGA 3RNMA 5IQ1A 2IVEA 5KMSA 4H4QA 4GCMA 5FS6A 4LIIA 3UP5A 1NHSA 1BKWA 5U25A 1D5TA 3NYFA 5C2TA 2OAMA 1H86A 1OJ9A 1DNCA 4HB9A 3PVCA 3C4AA 2JB3A 3BI5A 4OPCA 3KKJA 1IUSA 2GAHB 3GYXA 2GR0A 1PXBA 2J3NA 3F8PA 1QLBA 2X8CA 5JCKA 3C96A 2Q0LA 1HYUA 3LJPA 1QO8A 3Q6JA 1KSUA 4USQA 4JDRA 1B4VA 2V5ZA 4EQSA 5KOWA 4K5RA 2F5ZA 3K7QX 3AEDA 1TDNA 3KPKA 3UKLA 3AEFA 2YLZA 4I58A 3AD8B 3AWIA 4IVOB 4ZCDA 2R0GA 2Z5YA 4A5LA 5LV9A 2NPXA 3DA1A 4U8JA 2YLRA 3H8IA 3SYIA 1GTHA 3UTGA 1B8SA 4G9KA 4YSYA 1GRGA 1XHCA 2GAGB 3FG2P 3NHOX 2WU5A 3AD9B 3HYXA 4H4WA 2V6OA 2XVHA 5HXIA 4UP3A 1NPXA 1XANA 2XDOA 1IUXA 3SQPA 2V3BA 3II4A 3M0OA 2X3NA 3T2ZA 1N4VA 2YR6A 1VQWA 2X50A 4NEWA 4APNA 3SZFA 4CCRA 1Y56A 3V76A 2CFYA 2XFOA 3I3LA 1Y56B 4ZN0A 5KRQA 2QA1A 1K0JA 3QVRA 5GSNA 1F8WA 2RGOA 3GWDA 4Z44A 2V60A 4TM4A 1GV4A 3NYCA 4XXGA 5IPYA 4X9NA 4OPIA 2X8GA 1PHHA 1DXLA 1GXFA 4H4ZA 2BA9A 3NT6A 1PBEA 4FX9A 2JB1A 4UDQA 3GDPA 1H7WA 4EQWA 3CGBA 2RABA 3DJGX 3GD3A 3K30A 4NNJA 2VVMA 2V61A 4J33A 4AOSA 4BURA 3NG7X 3I6DA 4H4PA 2C75A 2FBWA 3AXBA 4H4VA 2C70A 3OZ2A 2JAEA 5C3JA 3CNTA 3NYEA 4TLZA 3EANA 1JEHA 2TMDA 5J7XA 1GALA 3IF9A 4Z25A 2WS3A 1ELIA 2E1MA 1H7XA 2XLUA 3AE6A 4IA5A 2B9WA 4REKA 3UOZA 2Q0KA 4LA1A 4CBQA 3GMCA 1BGJA 3UKPA 1PS9A 5KMPA 1DODA 2BABA 1E39A 3D8XA 1M6IA 2XFUA 3LZXA 2GH5A 4B67A 2R0PA 3DGZA 1D4EA 4U8MA 2YLSA 3UKFA 4Z2RA 2DKIA 2E4GA 3T37A 3ALLA 3UCLA 4J34A 1CF3A 2C4CA 5DBJA 1F8SA 5M10A 4D04A 3DH9A 2HQMA 1E1LA 4ADWA 1ZX9A 3QJ4A 1GSNA 5HYMA 2B7RA 2WEUA 1LV0A 1BZLA 1IUTA 4EQXA 4YTNA 4OPUA 4EIQA 1CHUA 2GR2A 3IC9A 4KPRA 4O5QA 2OLOA 2R4JA 3CNJA 2WU2A 3BI4A 2JB2A 3VR9A 1OJTA 1BWCA 1ZKQA 2GR1A 3G5SA 3FPZA 1CBOA 3UOVA 3NH3X 3SZWA 1EBDA 2GVCA 3AYIA 1JU2A 5TR3A 2QA2A 3GRTA 1D4CA 3DK8A 4K22A 2R4EA 4A65A 3AE4A 2RGJA 3K7MX 4CNKA 5EB4A 4O5UA 5EOWA 3CPHG 3KU9A 3HYVA 5KOXA 4J31A 1YQ4A 1F3PA 3IWAA 4H2NA 2WHDA 1GRHA 3QVPA 1JNZA 4A9WA 1Q9IA 1CJ4A 2JBVA 4TLXA 3V3OA 4G73A 2EQ6A 3UP4A 1VG9A 5KWFA 2OLNA 2WDQA 3AD7B 1PBBA 3P4RA 2XFQA 3COXA 3ISHA 2ARDA 1COYA 1GOSA 2UZZA 4B68A 2OALA 3SFEA 2YAUA 4H50A 4U2TA 1GREA 3NNEA 3NGCX 2R46A 1ZY8A 3UKKA 1PJ6A 2B76A 2WOVA 1AOGA 4U8PA 1B37A 2A87A 1PN0A 4B69A 3S61A 4U8KA 1RYIA 4I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0Z A;  3G5Q A;  4YSX A;  1LTX R;  4EMW A;  2EQ8 A;  3CND A;  2QCU A;  4OVI A;  4PAB A;  1FCD A;  3B3R A;  4EM3 A;  2BK4 A;  4ZCC A;  2BCG G;  3BNM A;  2GRT A;  3K7T A;  3AYJ A;  2BS4 A;  1KNR A;  1NDA A;  4H2P A;  1CJC A;  3VQR A;  4D03 A;  1P2E A;  4NTC A;  1GRA A;  5U1O A;  1FOH A;  4B65 A;  5KVH A;  1GRB A;  3AE3 A;  2QAE A;  1K0L A;  2ZBW A;  5JCI A;  2YG5 A;  4U8I A;  1GER A;  2APG A;  3P4Q A;  2BK5 A;  4NTE A;  4OPL A;  4YKF A;  2EQ9 A;  1X31 B;  3UTH A;  4HA6 A;  5BRT A;  4YSH A;  4Z24 A;  4ICY A;  2VOU A;  4CRT A;  4H4X A;  2VVL G;  4FK1 A;  3QSE A;  2BK3 A;  1FL2 A;  1H83 A;  3EPT A;  5FS8 A;  2JKC A;  3KPF A;  3ATQ A;  3GD4 A;  3JSK A;  5BVA A;  3NK2 X;  3AE2 A;  4AT0 A;  1UKV G;  3SGL A;  2Q6U A;  1PBC A;  3CGE A;  1H6V A;  1GT8 A;  2WQY A;  2C76 A;  2FJE A;  3NRN A;  2XLT A;  1S3E A;  4GDE A;  2BXS A;  1GRT A;  2GB0 A;  1GRF A;  3GRS A;  4UDR A;  4A6N A;  1S3B A;  2GQW A;  2E5V A;  4J2W A;  3ABV A;  1GTE A;  1ZK7 A;  4TM1 A;  4DSG A;  1GEU A;  5EB5 A;  4H7U A;  4TM3 A;  2X99 A;  4K7Z A;  2CDU A;  2BXR A;  2C72 A;  4K2X A;  2Y6Q A;  2AR8 A;  2ZZB A;  3AB1 A;  3LXD A;  3S5W A;  2B9X A;  4M52 A;  1CJ2 A;  1EL9 A;  1M64 A;  2ZZC A;  1CJ3 A;  3VRB A;  1TDE A;  1VDC A;  3ICS A;  4IA6 A;  1NHR A;  2YM2 A;  2VQB A;  2XFN A;  4OPG A;  2BCP A;  1EL8 A;  1L9D A;  1BF3 A;  1VRQ B;  2X8H A;  3AE5 A;  3NN6 X;  4U2S A;  2XLR A;  2GEW A;  4XWR A;  2XLP A;  3DJE A;  2FJD A;  4IVM B;  2WPE A;  1MO9 A;  2YR4 A;  4K8D A;  2C66 A;  3QSM A;  4Y4N A;  1ZOY A;  5JCM A;  3C4N A;  3H4K A;  1YQZ A;  2YVG A;  3L1R A;  2V3A A;  4JY2 A;  3RED A;  3FIM B;  1CC6 A;  2YR5 A;  2R45 A;  3GDN A;  3GYJ A;  4NTD A;  3DJJ A;  1TDK A;  3NK1 X;  1OJD A;  1TRB A;  2OA1 A;  2WP9 A;  3UTE A;  1N4U A;  2XVF A;  4CCQ A;  2B9Y A;  3NKS A;  3ALM A;  3V3N A;  1ZMD A;  3BHF A;  5FS7 A;  1QJD A;  2A8X A;  2FJB A;  1K4Q A;  1ONF A;  4J56 A;  2YVJ A;  1W4X A;  3B6D A;  4H4U A;  3RP8 A;  3CPJ G;  4X4J A;  4K5S A;  3QFA A;  4C3Y A;  1KDG A;  2YQU A;  1L9C A;  2WPF A;  1O5W A;  3KVE A;  4YT0 A;  1L9E A;  1O94 A;  2BAC A;  3FMW A;  4XWZ A;  1RP0 A;  2YVF A;  4H4T A;  3UTF A;  4YTP A;  4DGK A;  1DJN A;  1V59 A;  3GWF A;  4GRT A;  4BK1 A;  1TDF A;  3KLJ A;  4EM4 A;  1IJH A;  2C3D A;  5JCN A;  3DJD A;  3UOX A;  2YG6 A;  1NG3 A;  3M13 A;  3LB8 A;  4OCG A;  4OPT A;  4E0V A;  2WOW A;  2VRM A;  1B5Q A;  4C77 A;  3NN0 X;  3UKQ A;  4Z2T A;  4H4Y A;  4IV9 A;  4Y4M A;  4C3X A;  1NAA A;  2FJA A;  3AYL A;  1PDH A;  3NLC A;  4Y4L A;  2C67 A;  3UKH A;  3CGC A;  1NHQ A;  4H4S A;  2C7G A;  2NVK X;  3NIX A;  4U8N A;  4AP3 A;  1TYT A;  1ZMC A;  3H8L A;  3P4P A;  3AE1 A;  2XLS A;  4B1B A;  2C64 A;  3AEB A;  2Y6R A;  4YKG A;  2BYB A;  1ZP0 A;  1KF6 A;  5HHF A;  1VG0 A;  1PJ5 A;  1ZOV A;  4Z43 A;  1PBD A;  3RHA A;  2B7S A;  4YSZ A;  5CQF A;  2AAQ A;  3PS9 A;  1KFY A;  2GR3 A;  1L0V A;  1K0I A;  5HY5 A;  4BK2 A;  1E1M A;  1DOB A;  1PBF A;  4H4R A;  2XVJ A;  3CIR A;  3URH A;  2WDV A;  2WPC A;  3F8D A;  4UDP A;  3VR8 A;  1D7L A;  3LAD A;  3AE9 A;  1JOA A;  1MOK A;  2H88 A;  2IVD A;  2ACZ A;  1LJ1 A;  3P9U A;  3GMB A;  1CC4 A;  1LPF A;  4OPD A;  1EL7 A;  5M0Z A;  1JRZ A;  3E1T A;  4GUV A;  4EMJ A;  3ZDN A;  2GF3 A;  4Z26 A;  1NHP A;  4JQ9 A;  3L8K A;  1H84 A;  2GMJ A;  1GET A;  3ATR A;  3FBS A;  1JRY A;  4WCT A;  3IHM A;  4CY8 A;  1ZDL A;  3VRA A;  1FEB A;  1XPQ A;  3GYI A;  4AOX A;  3PO7 A;  1BGN A;  2WDR A;  3HZL A;  5KVI A;  1H82 A;  3DGH A;  1E6E A;  4U8O A;  3CTY A;  4JN9 A;  4A6N B;  4NZH A;  3VRD B;  4B63 A;  1SEZ A;  4BJZ A;  2XYO A;  3AEA A;  1JRX A;  1FEC A;  5ER0 A;  2PYX A;  4YXD A;  3BHK A;  1IUV A;  4U2L A;  3AEE A;  3IHG A;  1OJA A;  4EQR A;  4A99 A;  3RP6 A;  4AP1 A;  2O9Z A;  3AEC A;  2C65 A;  3AEG A;  2XVE A;  4FK1 C;  1TDO A;  2Q7V A;  4WX1 A;  4A79 A;  1NEN A;  1LQT A;  1PJ7 A;  2WP6 A;  2H89 A;  3O0H A;  4LU6 A;  3DK4 A;  2IID A;  4C5O A;  4A7A A;  4BJY A;  2YWL A;  3M12 A;  4DNA A;  4JNA A;  1IUW A;  1H81 A;  2R9Z A;  4BV6 A;  3ALJ A;  1IUU A;  1CL0 A;  1DOE A;  2DKH A;  3UKA A;  5U63 A;  5KXJ A;  1REO A;  1YY5 A;  1LVL A;  1P2H A;  1Y0P A;  2ZZ0 A;  3NK0 X;  2Z5X A;  4H2Q A;  5J60 A;  3LOV A;  3DME A;  1N1P A;  1XDI A;  3Q9T A;  2YG4 A;  4KX6 A;  3ICT A;  3DK9 A;  2YG3 A;  3CGD A;  2GQF A;  1FEA A;  2GMH A;  5CKU A;  2BC0 A;  4YTM A;  5L46 A;  3NTD A;  4RSL A;  2BC1 A;  1RSG A;  3EF6 A;  3GSI A;  3LZW A;  3CN8 A;  1S2Q A;  3SFD A;  2VZ2 A;  1JNR A;  3KA7 A;  4B64 A;  4U8L A;  1Z6L A;  3ICR A;  3F8R A;  4JY3 A;  3QSS A;  4TM0 A;  4B66 A;  3UOY A;  4EIP A;  1E1K A;  4PAA A;  1S2Y A;  1GES A;  2WES A;  4N9X A;  2C3C A;  1NEK A;  4CY6 A;  4CNJ A;  4H2R A;  3EAO A;  1KSS A;  4J57 A;  1LQU A;  2YM1 A;  2WP5 A;  4P9S A;  5GRT A;  5BUL A;  3AE7 A;  2XFP A;  4GDP A;  2YLW A;  4FDC B;  2VQ7 A;  4RG3 A;  4AT2 A;  3CPI G;  3QFB A;  1NG4 A;  3D1C A;  2YLX A;  1O95 A;  1TYP A;  3BNU A;  4ECH A;  2JK6 A;  4BK3 A;  1YKJ A;  1DJQ A;  2A89 A;  2XVI A;  1DOC A;  1PXC A;  2WET A;  4MJW A;  4X9M A;  4NEV A;  2PHH A;  2GV8 A;  3CNP A;  1OJC A;  2BS3 A;  1PXA A;  4JNQ A;  4YWO A;  2VRL A;  1GPE A;  1CC2 A;  1KNP A;  5BUK A;  2BS2 A;  2WOI A;  3WE0 A;  1YQ3 A;  4GF7 A;  1E1N A;  1D7Y A;  4RG4 A;  4EMI A;  3NTA A;  5FMH A;  5JCL A;  2WBA A;  1F6M A;  5EBK A;  2RGH A;  3R9U A;  3ITJ A;  4USR A;  1E7P A;  2CUL A;  2W0H A;  2VVL A;  1EL5 A;  5FS9 A;  3AE8 A;  3OC4 A;  4DSH A;  3P4S A;  4Z2U A;  2AQJ A;  2R0C A;  2TPR A;  2YLT A;  3ADA B;  5IQ4 A;  1GND A;  1Q1R A;  1MXT A;  4C74 A;  2EQ7 A;  3G5R A;  4J36 A;  3RP7 A;  3SM8 A;  3ZYX A;  4GR1 A;  2YG7 A;  1D4D A;  1N4W A;  3BI2 A;  1Q1W A;  3KD9 A;  1F8R A;  2CVJ A;  2C73 A;  3CNS A;  3P1W A;  2XCG A;  3RNM A;  5IQ1 A;  2IVE A;  4H4Q A;  4GCM A;  5FS6 A;  4LII A;  3UP5 A;  1NHS A;  1BKW A;  5U25 A;  1D5T A;  3NYF A;  5C2T A;  2OAM A;  1H86 A;  1OJ9 A;  1DNC A;  4HB9 A;  3PVC A;  3C4A A;  2JB3 A;  3BI5 A;  4OPC A;  3KKJ A;  1IUS A;  2GAH B;  2GR0 A;  1PXB A;  2J3N A;  3F8P A;  1QLB A;  2X8C A;  5JCK A;  3C96 A;  2Q0L A;  1HYU A;  3LJP A;  1QO8 A;  3Q6J A;  1KSU A;  4USQ A;  4JDR A;  1B4V A;  2V5Z A;  4EQS A;  5KOW A;  4K5R A;  2F5Z A;  3K7Q X;  3AED A;  1TDN A;  3UKL A;  3AEF A;  2YLZ A;  4I58 A;  3AD8 B;  3AWI A;  4IVO B;  4ZCD A;  2R0G A;  2Z5Y A;  4A5L A;  5LV9 A;  2NPX A;  3DA1 A;  4U8J A;  2YLR A;  3H8I A;  1GTH A;  3UTG A;  1B8S A;  4YSY A;  1GRG A;  1XHC A;  2GAG B;  3FG2 P;  3NHO X;  2WU5 A;  3AD9 B;  4H4W A;  2V6O A;  2XVH A;  5HXI A;  4UP3 A;  1NPX A;  1XAN A;  2XDO A;  1IUX A;  3SQP A;  2V3B A;  3II4 A;  3M0O A;  2X3N A;  1N4V A;  2YR6 A;  1VQW A;  2X50 A;  4NEW A;  4APN A;  4CCR A;  1Y56 A;  3V76 A;  2CFY A;  2XFO A;  3I3L A;  1Y56 B;  4ZN0 A;  5KRQ A;  2QA1 A;  1K0J A;  3QVR A;  5GSN A;  1F8W A;  2RGO A;  3GWD A;  4Z44 A;  2V60 A;  4TM4 A;  1GV4 A;  3NYC A;  4XXG A;  5IPY A;  4X9N A;  4OPI A;  2X8G A;  1PHH A;  1DXL A;  1GXF A;  4H4Z A;  2BA9 A;  3NT6 A;  1PBE A;  4FX9 A;  2JB1 A;  4UDQ A;  3GDP A;  1H7W A;  4EQW A;  3CGB A;  2RAB A;  3DJG X;  3GD3 A;  3K30 A;  4AOS A;  2VVM A;  2V61 A;  4J33 A;  4BUR A;  3NG7 X;  3I6D A;  4H4P A;  2C75 A;  2FBW A;  3AXB A;  4H4V A;  2C70 A;  3OZ2 A;  2JAE A;  5C3J A;  3CNT A;  3NYE A;  4TLZ A;  3EAN A;  1JEH A;  2TMD A;  5J7X A;  1GAL A;  3IF9 A;  4Z25 A;  2WS3 A;  1ELI A;  2E1M A;  1H7X A;  2XLU A;  3AE6 A;  4IA5 A;  2B9W A;  4REK A;  3UOZ A;  2Q0K A;  4LA1 A;  4CBQ A;  3GMC A;  1BGJ A;  3UKP A;  1PS9 A;  1DOD A;  2BAB A;  1E39 A;  3D8X A;  1M6I A;  2XFU A;  3LZX A;  2GH5 A;  4B67 A;  2R0P A;  3DGZ A;  1D4E A;  4U8M A;  2YLS A;  3UKF A;  4Z2R A;  2DKI A;  2E4G A;  3T37 A;  3ALL A;  3UCL A;  4J34 A;  1CF3 A;  5DBJ A;  5M10 A;  1F8S A;  4D04 A;  3DH9 A;  2HQM A;  1E1L A;  4ADW A;  1ZX9 A;  3QJ4 A;  1GSN A;  5HYM A;  2B7R A;  2WEU A;  1LV0 A;  1BZL A;  1IUT A;  4EQX A;  4YTN A;  4OPU A;  4EIQ A;  1CHU A;  2GR2 A;  3IC9 A;  4KPR A;  4O5Q A;  2OLO A;  2R4J A;  3CNJ A;  2WU2 A;  3BI4 A;  2JB2 A;  3VR9 A;  1OJT A;  1BWC A;  1ZKQ A;  2GR1 A;  3G5S A;  3FPZ A;  1CBO A;  3UOV A;  3NH3 X;  1EBD A;  2GVC A;  3AYI A;  1JU2 A;  5TR3 A;  2QA2 A;  3GRT A;  1D4C A;  3DK8 A;  4K22 A;  2R4E A;  4A65 A;  3AE4 A;  2RGJ A;  3K7M X;  4CNK A;  5EB4 A;  4O5U A;  5EOW A;  3CPH G;  3KU9 A;  5KOX A;  4J31 A;  1YQ4 A;  1F3P A;  3IWA A;  4H2N A;  2WHD A;  1GRH A;  3QVP A;  1JNZ A;  4A9W A;  1Q9I A;  1CJ4 A;  2JBV A;  4TLX A;  3V3O A;  5KWF A;  2EQ6 A;  3UP4 A;  1VG9 A;  2OLN A;  2WDQ A;  3AD7 B;  1PBB A;  3P4R A;  2XFQ A;  3COX A;  3ISH A;  2ARD A;  1COY A;  1GOS A;  2UZZ A;  4B68 A;  2OAL A;  3SFE A;  2YAU A;  4H50 A;  4U2T A;  1GRE A;  3NNE A;  3NGC X;  2R46 A;  1ZY8 A;  3UKK A;  1PJ6 A;  2B76 A;  2WOV A;  1AOG A;  4U8P A;  1B37 A;  2A87 A;  1PN0 A;  4B69 A;  3S61 A;  4U8K A;  1RYI A;  4I59 A; 
#chains in the Genus database with same CATH topology
 2I0Z A;  3G5Q A;  4YSX A;  1LTX R;  4EMW A;  2EQ8 A;  3CND A;  2QCU A;  4OVI A;  4PAB A;  1FCD A;  3B3R A;  4EM3 A;  2BK4 A;  4ZCC A;  2BCG G;  3BNM A;  2GRT A;  3K7T A;  3AYJ A;  2BS4 A;  1KNR A;  1NDA A;  4H2P A;  3T31 A;  1CJC A;  3VQR A;  4D03 A;  1P2E A;  4NTC A;  4NWZ A;  1GRA A;  5U1O A;  1FOH A;  4B65 A;  5KNL A;  5KVH A;  1GRB A;  3AE3 A;  2QAE A;  1K0L A;  2ZBW A;  5JCI A;  2YG5 A;  4U8I A;  1GER A;  2APG A;  3P4Q A;  2BK5 A;  4NTE A;  4OPL A;  4YKF A;  2EQ9 A;  1X31 B;  3T0K A;  4HA6 A;  3UTH A;  5BRT A;  4YSH A;  4Z24 A;  4ICY A;  2VOU A;  4CRT A;  4H4X A;  2VVL G;  4FK1 A;  3T2K A;  3QSE A;  2BK3 A;  3CMM A;  1FL2 A;  1H83 A;  3EPT A;  5FS8 A;  2JKC A;  3KPF A;  3ATQ A;  3GD4 A;  3JSK A;  5BVA A;  3NK2 X;  3AE2 A;  4AT0 A;  1UKV G;  3SGL A;  2Q6U A;  1PBC A;  4II2 A;  5KMQ A;  3CGE A;  1H6V A;  1GT8 A;  2WQY A;  2C76 A;  2FJE A;  4II3 A;  3NRN A;  2XLT A;  1S3E A;  4GDE A;  2BXS A;  1GRT A;  2GB0 A;  1GRF A;  3GRS A;  4UDR A;  4G6G A;  4A6N A;  1S3B A;  2GQW A;  2E5V A;  4J2W A;  3ABV A;  1GTE A;  1ZK7 A;  4TM1 A;  3SX6 A;  4DSG A;  1GEU A;  5EB5 A;  4H7U A;  4TM3 A;  2X99 A;  4K7Z A;  2CDU A;  2BXR A;  2C72 A;  4K2X A;  2Y6Q A;  2AR8 A;  2ZZB A;  3AB1 A;  3LXD A;  3S5W A;  2B9X A;  4M52 A;  1CJ2 A;  3HYW A;  1EL9 A;  1M64 A;  2ZZC A;  1CJ3 A;  3SZC A;  1TDE A;  3VRB A;  1VDC A;  3ICS A;  4IA6 A;  1NHR A;  2YM2 A;  2VQB A;  2XFN A;  4OPG A;  2BCP A;  1EL8 A;  1L9D A;  1BF3 A;  1VRQ B;  2X8H A;  3AE5 A;  3NN6 X;  4U2S A;  2XLR A;  2GEW A;  4XWR A;  2XLP A;  3DJE A;  2FJD A;  4IVM B;  2WPE A;  1MO9 A;  2YR4 A;  4K8D A;  2C66 A;  3QSM A;  4Y4N A;  1ZOY A;  5JCM A;  3C4N A;  3H4K A;  1YQZ A;  2YVG A;  3L1R A;  2V3A A;  4JY2 A;  3RED A;  3FIM B;  1CC6 A;  2YR5 A;  2R45 A;  3GDN A;  3GYJ A;  4NTD A;  3DJJ A;  1TDK A;  3NK1 X;  1OJD A;  1TRB A;  2OA1 A;  2WP9 A;  3UTE A;  1N4U A;  2XVF A;  4CCQ A;  2B9Y A;  3NKS A;  3ALM A;  3V3N A;  1ZMD A;  3BHF A;  5FS7 A;  1QJD A;  2A8X A;  2BRY A;  1K4Q A;  1ONF A;  2FJB A;  2YVJ A;  4J56 A;  1W4X A;  3B6D A;  4H4U A;  3RP8 A;  3CPJ G;  4X4J A;  4K5S A;  3QFA A;  4C3Y A;  1KDG A;  2YQU A;  1L9C A;  2WPF A;  1O5W A;  3KVE A;  4YT0 A;  1L9E A;  1O94 A;  2BAC A;  3FMW A;  4XWZ A;  1RP0 A;  2YVF A;  4H4T A;  3UTF A;  4YTP A;  4DGK A;  1DJN A;  1V59 A;  3GWF A;  4GRT A;  4BK1 A;  1TDF A;  3KLJ A;  4EM4 A;  1IJH A;  2C3D A;  5JCN A;  3DJD A;  3UOX A;  2YG6 A;  1NG3 A;  3M13 A;  3LB8 A;  4OCG A;  4OPT A;  4E0V A;  2WOW A;  2VRM A;  1B5Q A;  4C77 A;  3NN0 X;  3UKQ A;  4Z2T A;  4H4Y A;  4IV9 A;  4Y4M A;  4C3X A;  1NAA A;  2FJA A;  3AYL A;  1PDH A;  3NLC A;  4Y4L A;  2C67 A;  3UKH A;  3CGC A;  1NHQ A;  4H4S A;  2C7G A;  2NVK X;  3NIX A;  4U8N A;  4AP3 A;  1TYT A;  1ZMC A;  3H8L A;  3P4P A;  3AE1 A;  2XLS A;  4B1B A;  2C64 A;  3AEB A;  2Y6R A;  4YKG A;  2BYB A;  1ZP0 A;  1KF6 A;  5HHF A;  1VG0 A;  1PJ5 A;  1ZOV A;  4Z43 A;  1PBD A;  3RHA A;  2B7S A;  4YSZ A;  5CQF A;  2AAQ A;  3PS9 A;  1KFY A;  2GR3 A;  4GAP A;  1L0V A;  1K0I A;  5HY5 A;  4BK2 A;  1E1M A;  1DOB A;  1PBF A;  4H4R A;  3SY4 A;  2XVJ A;  3CIR A;  3URH A;  2WDV A;  2WPC A;  3F8D A;  4UDP A;  3VR8 A;  1D7L A;  3LAD A;  3AE9 A;  1JOA A;  1MOK A;  2H88 A;  2IVD A;  2ACZ A;  1LJ1 A;  3P9U A;  3GMB A;  1CC4 A;  1LPF A;  4OPD A;  1EL7 A;  5M0Z A;  1JRZ A;  3E1T A;  4GUV A;  4EMJ A;  3ZDN A;  2GF3 A;  4Z26 A;  1NHP A;  4JQ9 A;  4GAV A;  3L8K A;  1H84 A;  2GMJ A;  1GET A;  3ATR A;  3FBS A;  1JRY A;  4WCT A;  3IHM A;  4CY8 A;  1ZDL A;  3VRA A;  1FEB A;  1XPQ A;  3GYI A;  4AOX A;  3PO7 A;  1BGN A;  3T2Y A;  2WDR A;  3HZL A;  5KVI A;  1H82 A;  3DGH A;  1E6E A;  4U8O A;  3CTY A;  4JN9 A;  4A6N B;  4NZH A;  3VRD B;  4B63 A;  1SEZ A;  4BJZ A;  2XYO A;  3AEA A;  1JRX A;  1FEC A;  5ER0 A;  2PYX A;  4YXD A;  3BHK A;  1IUV A;  4U2L A;  3AEE A;  3IHG A;  1OJA A;  4EQR A;  4A99 A;  3RP6 A;  4AP1 A;  2O9Z A;  3AEC A;  2C65 A;  3AEG A;  2XVE A;  4FK1 C;  1TDO A;  2BRA A;  2Q7V A;  4WX1 A;  4A79 A;  1NEN A;  1LQT A;  1PJ7 A;  2WP6 A;  2H89 A;  3O0H A;  4LU6 A;  3DK4 A;  3T14 A;  2IID A;  4C5O A;  4A7A A;  4BJY A;  2YWL A;  3M12 A;  4DNA A;  4JNA A;  1IUW A;  1H81 A;  2R9Z A;  4BV6 A;  3SZ0 A;  3ALJ A;  1IUU A;  1CL0 A;  1DOE A;  2DKH A;  3UKA A;  5U63 A;  5KXJ A;  1REO A;  1YY5 A;  1LVL A;  1P2H A;  1Y0P A;  2ZZ0 A;  3NK0 X;  2Z5X A;  4H2Q A;  5J60 A;  3LOV A;  3DME A;  1N1P A;  1XDI A;  3Q9T A;  2YG4 A;  4KX6 A;  3ICT A;  3DK9 A;  2YG3 A;  3CGD A;  2GQF A;  1FEA A;  2GMH A;  5CKU A;  2BC0 A;  4YTM A;  5L46 A;  3NTD A;  4RSL A;  2BC1 A;  1RSG A;  3EF6 A;  3GSI A;  3LZW A;  3CN8 A;  1S2Q A;  3SFD A;  2VZ2 A;  1JNR A;  3KA7 A;  4B64 A;  5KMR A;  4U8L A;  1Z6L A;  3ICR A;  3F8R A;  4JY3 A;  3QSS A;  4TM0 A;  4B66 A;  3UOY A;  4G6H A;  4EIP A;  1E1K A;  4PAA A;  1S2Y A;  1GES A;  2WES A;  4N9X A;  2C3C A;  1NEK A;  4CY6 A;  4CNJ A;  4H2R A;  3EAO A;  1KSS A;  4J57 A;  1LQU A;  2YM1 A;  2WP5 A;  4P9S A;  5GRT A;  5BUL A;  3AE7 A;  2XFP A;  4GDP A;  2YLW A;  3SXI A;  4FDC B;  2VQ7 A;  4RG3 A;  4AT2 A;  3CPI G;  3QFB A;  1NG4 A;  3D1C A;  2YLX A;  1O95 A;  1TYP A;  3BNU A;  4ECH A;  2JK6 A;  4BK3 A;  1YKJ A;  1DJQ A;  2A89 A;  2XVI A;  1DOC A;  1PXC A;  2WET A;  4MJW A;  4X9M A;  4NEV A;  2PHH A;  2GV8 A;  3CNP A;  1OJC A;  2BS3 A;  1PXA A;  4G74 A;  4JNQ A;  2VRL A;  4YWO A;  1GPE A;  1CC2 A;  1KNP A;  5BUK A;  2BS2 A;  2WOI A;  3WE0 A;  1YQ3 A;  4GF7 A;  1E1N A;  1D7Y A;  4RG4 A;  4EMI A;  3NTA A;  5FMH A;  5JCL A;  2WBA A;  1F6M A;  5EBK A;  2RGH A;  3R9U A;  3ITJ A;  4USR A;  1E7P A;  2CUL A;  2W0H A;  2VVL A;  1EL5 A;  5FS9 A;  3AE8 A;  3OC4 A;  4DSH A;  3P4S A;  4Z2U A;  2AQJ A;  2R0C A;  2TPR A;  2YLT A;  3ADA B;  5IQ4 A;  1GND A;  1Q1R A;  1MXT A;  4C74 A;  2EQ7 A;  3G5R A;  4J36 A;  3RP7 A;  3SM8 A;  3ZYX A;  4GR1 A;  2YG7 A;  1D4D A;  1N4W A;  3BI2 A;  1Q1W A;  3KD9 A;  1F8R A;  2CVJ A;  2C73 A;  3CNS A;  3P1W A;  2XCG A;  3RNM A;  5IQ1 A;  2IVE A;  5KMS A;  4H4Q A;  4GCM A;  5FS6 A;  4LII A;  3UP5 A;  1NHS A;  1BKW A;  5U25 A;  1D5T A;  3NYF A;  5C2T A;  2OAM A;  1H86 A;  1OJ9 A;  1DNC A;  4HB9 A;  3PVC A;  3C4A A;  2JB3 A;  3BI5 A;  4OPC A;  3KKJ A;  1IUS A;  2GAH B;  3GYX A;  2GR0 A;  1PXB A;  2J3N A;  3F8P A;  1QLB A;  2X8C A;  5JCK A;  3C96 A;  2Q0L A;  1HYU A;  3LJP A;  1QO8 A;  3Q6J A;  1KSU A;  4USQ A;  4JDR A;  1B4V A;  2V5Z A;  4EQS A;  5KOW A;  4K5R A;  2F5Z A;  3K7Q X;  3AED A;  1TDN A;  3KPK A;  3UKL A;  3AEF A;  2YLZ A;  4I58 A;  3AD8 B;  3AWI A;  4IVO B;  4ZCD A;  2R0G A;  2Z5Y A;  4A5L A;  5LV9 A;  2NPX A;  3DA1 A;  4U8J A;  2YLR A;  3H8I A;  3SYI A;  1GTH A;  3UTG A;  1B8S A;  4G9K A;  4YSY A;  1GRG A;  1XHC A;  2GAG B;  3FG2 P;  3NHO X;  2WU5 A;  3AD9 B;  3HYX A;  4H4W A;  2V6O A;  2XVH A;  5HXI A;  4UP3 A;  1NPX A;  1XAN A;  2XDO A;  1IUX A;  3SQP A;  2V3B A;  3II4 A;  3M0O A;  2X3N A;  3T2Z A;  1N4V A;  2YR6 A;  1VQW A;  2X50 A;  4NEW A;  4APN A;  3SZF A;  4CCR A;  1Y56 A;  3V76 A;  2CFY A;  2XFO A;  3I3L A;  1Y56 B;  4ZN0 A;  5KRQ A;  2QA1 A;  1K0J A;  3QVR A;  5GSN A;  1F8W A;  2RGO A;  3GWD A;  4Z44 A;  2V60 A;  4TM4 A;  1GV4 A;  3NYC A;  4XXG A;  5IPY A;  4X9N A;  4OPI A;  2X8G A;  1PHH A;  1DXL A;  1GXF A;  4H4Z A;  2BA9 A;  3NT6 A;  1PBE A;  4FX9 A;  2JB1 A;  4UDQ A;  3GDP A;  1H7W A;  4EQW A;  3CGB A;  2RAB A;  3DJG X;  3GD3 A;  3K30 A;  4NNJ A;  2VVM A;  2V61 A;  4J33 A;  4AOS A;  4BUR A;  3NG7 X;  3I6D A;  4H4P A;  2C75 A;  2FBW A;  3AXB A;  4H4V A;  2C70 A;  3OZ2 A;  2JAE A;  5C3J A;  3CNT A;  3NYE A;  4TLZ A;  3EAN A;  1JEH A;  2TMD A;  5J7X A;  1GAL A;  3IF9 A;  4Z25 A;  2WS3 A;  1ELI A;  2E1M A;  1H7X A;  2XLU A;  3AE6 A;  4IA5 A;  2B9W A;  4REK A;  3UOZ A;  2Q0K A;  4LA1 A;  4CBQ A;  3GMC A;  1BGJ A;  3UKP A;  1PS9 A;  5KMP A;  1DOD A;  2BAB A;  1E39 A;  3D8X A;  1M6I A;  2XFU A;  3LZX A;  2GH5 A;  4B67 A;  2R0P A;  3DGZ A;  1D4E A;  4U8M A;  2YLS A;  3UKF A;  4Z2R A;  2DKI A;  2E4G A;  3T37 A;  3ALL A;  3UCL A;  4J34 A;  1CF3 A;  2C4C A;  5DBJ A;  1F8S A;  5M10 A;  4D04 A;  3DH9 A;  2HQM A;  1E1L A;  4ADW A;  1ZX9 A;  3QJ4 A;  1GSN A;  5HYM A;  2B7R A;  2WEU A;  1LV0 A;  1BZL A;  1IUT A;  4EQX A;  4YTN A;  4OPU A;  4EIQ A;  1CHU A;  2GR2 A;  3IC9 A;  4KPR A;  4O5Q A;  2OLO A;  2R4J A;  3CNJ A;  2WU2 A;  3BI4 A;  2JB2 A;  3VR9 A;  1OJT A;  1BWC A;  1ZKQ A;  2GR1 A;  3G5S A;  3FPZ A;  1CBO A;  3UOV A;  3NH3 X;  3SZW A;  1EBD A;  2GVC A;  3AYI A;  1JU2 A;  5TR3 A;  2QA2 A;  3GRT A;  1D4C A;  3DK8 A;  4K22 A;  2R4E A;  4A65 A;  3AE4 A;  2RGJ A;  3K7M X;  4CNK A;  5EB4 A;  4O5U A;  5EOW A;  3CPH G;  3KU9 A;  3HYV A;  5KOX A;  4J31 A;  1YQ4 A;  1F3P A;  3IWA A;  4H2N A;  2WHD A;  1GRH A;  3QVP A;  1JNZ A;  4A9W A;  1Q9I A;  1CJ4 A;  2JBV A;  4TLX A;  3V3O A;  4G73 A;  2EQ6 A;  3UP4 A;  1VG9 A;  5KWF A;  2OLN A;  2WDQ A;  3AD7 B;  1PBB A;  3P4R A;  2XFQ A;  3COX A;  3ISH A;  2ARD A;  1COY A;  1GOS A;  2UZZ A;  4B68 A;  2OAL A;  3SFE A;  2YAU A;  4H50 A;  4U2T A;  1GRE A;  3NNE A;  3NGC X;  2R46 A;  1ZY8 A;  3UKK A;  1PJ6 A;  2B76 A;  2WOV A;  1AOG A;  4U8P A;  1B37 A;  2A87 A;  1PN0 A;  4B69 A;  3S61 A;  4U8K A;  1RYI A;  4I59 A; 
#chains in the Genus database with same CATH homology
 2I0Z A;  3G5Q A;  4YSX A;  1LTX R;  4EMW A;  2EQ8 A;  3CND A;  2QCU A;  4OVI A;  4PAB A;  1FCD A;  3B3R A;  4EM3 A;  2BK4 A;  4ZCC A;  2BCG G;  3BNM A;  2GRT A;  3K7T A;  3AYJ A;  2BS4 A;  1KNR A;  1NDA A;  4H2P A;  3T31 A;  1CJC A;  3VQR A;  4D03 A;  1P2E A;  4NTC A;  4NWZ A;  1GRA A;  5U1O A;  1FOH A;  4B65 A;  5KNL A;  5KVH A;  1GRB A;  3AE3 A;  2QAE A;  1K0L A;  2ZBW A;  5JCI A;  2YG5 A;  4U8I A;  1GER A;  2APG A;  3P4Q A;  2BK5 A;  4NTE A;  4OPL A;  4YKF A;  2EQ9 A;  1X31 B;  3T0K A;  4HA6 A;  3UTH A;  5BRT A;  4YSH A;  4Z24 A;  4ICY A;  2VOU A;  4CRT A;  4H4X A;  2VVL G;  4FK1 A;  3T2K A;  3QSE A;  2BK3 A;  3CMM A;  1FL2 A;  1H83 A;  3EPT A;  5FS8 A;  2JKC A;  3KPF A;  3ATQ A;  3GD4 A;  3JSK A;  5BVA A;  3NK2 X;  3AE2 A;  4AT0 A;  1UKV G;  3SGL A;  2Q6U A;  1PBC A;  4II2 A;  5KMQ A;  3CGE A;  1H6V A;  1GT8 A;  2WQY A;  2C76 A;  2FJE A;  4II3 A;  3NRN A;  2XLT A;  1S3E A;  4GDE A;  2BXS A;  1GRT A;  2GB0 A;  1GRF A;  3GRS A;  4UDR A;  4G6G A;  4A6N A;  1S3B A;  2GQW A;  2E5V A;  4J2W A;  3ABV A;  1GTE A;  1ZK7 A;  4TM1 A;  3SX6 A;  4DSG A;  1GEU A;  5EB5 A;  4H7U A;  4TM3 A;  2X99 A;  4K7Z A;  2CDU A;  2BXR A;  2C72 A;  4K2X A;  2Y6Q A;  2AR8 A;  2ZZB A;  3AB1 A;  3LXD A;  3S5W A;  2B9X A;  4M52 A;  1CJ2 A;  3HYW A;  1EL9 A;  1M64 A;  2ZZC A;  1CJ3 A;  3SZC A;  1TDE A;  3VRB A;  1VDC A;  3ICS A;  4IA6 A;  1NHR A;  2YM2 A;  2VQB A;  2XFN A;  4OPG A;  2BCP A;  1EL8 A;  1L9D A;  1BF3 A;  1VRQ B;  2X8H A;  3AE5 A;  3NN6 X;  4U2S A;  2XLR A;  2GEW A;  4XWR A;  2XLP A;  3DJE A;  2FJD A;  4IVM B;  2WPE A;  1MO9 A;  2YR4 A;  4K8D A;  2C66 A;  3QSM A;  4Y4N A;  1ZOY A;  5JCM A;  3C4N A;  3H4K A;  1YQZ A;  2YVG A;  3L1R A;  2V3A A;  4JY2 A;  3RED A;  3FIM B;  1CC6 A;  2YR5 A;  2R45 A;  3GDN A;  3GYJ A;  4NTD A;  3DJJ A;  1TDK A;  3NK1 X;  1OJD A;  1TRB A;  2OA1 A;  2WP9 A;  3UTE A;  1N4U A;  2XVF A;  4CCQ A;  2B9Y A;  3NKS A;  3ALM A;  3V3N A;  1ZMD A;  3BHF A;  5FS7 A;  1QJD A;  2A8X A;  2BRY A;  1K4Q A;  1ONF A;  2FJB A;  2YVJ A;  4J56 A;  1W4X A;  3B6D A;  4H4U A;  3RP8 A;  3CPJ G;  4X4J A;  4K5S A;  3QFA A;  4C3Y A;  1KDG A;  2YQU A;  1L9C A;  2WPF A;  1O5W A;  3KVE A;  4YT0 A;  1L9E A;  1O94 A;  2BAC A;  3FMW A;  4XWZ A;  1RP0 A;  2YVF A;  4H4T A;  3UTF A;  4YTP A;  4DGK A;  1DJN A;  1V59 A;  3GWF A;  4GRT A;  4BK1 A;  1TDF A;  3KLJ A;  4EM4 A;  1IJH A;  2C3D A;  5JCN A;  3DJD A;  3UOX A;  2YG6 A;  1NG3 A;  3M13 A;  3LB8 A;  4OCG A;  4OPT A;  4E0V A;  2WOW A;  2VRM A;  1B5Q A;  4C77 A;  3NN0 X;  3UKQ A;  4Z2T A;  4H4Y A;  4IV9 A;  4Y4M A;  4C3X A;  1NAA A;  2FJA A;  3AYL A;  1PDH A;  3NLC A;  4Y4L A;  2C67 A;  3UKH A;  3CGC A;  1NHQ A;  4H4S A;  2C7G A;  2NVK X;  3NIX A;  4U8N A;  4AP3 A;  1TYT A;  1ZMC A;  3H8L A;  3P4P A;  3AE1 A;  2XLS A;  4B1B A;  2C64 A;  3AEB A;  2Y6R A;  4YKG A;  2BYB A;  1ZP0 A;  1KF6 A;  5HHF A;  1VG0 A;  1PJ5 A;  1ZOV A;  4Z43 A;  1PBD A;  3RHA A;  2B7S A;  4YSZ A;  5CQF A;  2AAQ A;  3PS9 A;  1KFY A;  2GR3 A;  4GAP A;  1L0V A;  1K0I A;  5HY5 A;  4BK2 A;  1E1M A;  1DOB A;  1PBF A;  4H4R A;  3SY4 A;  2XVJ A;  3CIR A;  3URH A;  2WDV A;  2WPC A;  3F8D A;  4UDP A;  3VR8 A;  1D7L A;  3LAD A;  3AE9 A;  1JOA A;  1MOK A;  2H88 A;  2IVD A;  2ACZ A;  1LJ1 A;  3P9U A;  3GMB A;  1CC4 A;  1LPF A;  4OPD A;  1EL7 A;  5M0Z A;  1JRZ A;  3E1T A;  4GUV A;  4EMJ A;  3ZDN A;  2GF3 A;  4Z26 A;  1NHP A;  4JQ9 A;  4GAV A;  3L8K A;  1H84 A;  2GMJ A;  1GET A;  3ATR A;  3FBS A;  1JRY A;  4WCT A;  3IHM A;  4CY8 A;  1ZDL A;  3VRA A;  1FEB A;  1XPQ A;  3GYI A;  4AOX A;  3PO7 A;  1BGN A;  3T2Y A;  2WDR A;  3HZL A;  5KVI A;  1H82 A;  3DGH A;  1E6E A;  4U8O A;  3CTY A;  4JN9 A;  4A6N B;  4NZH A;  3VRD B;  4B63 A;  1SEZ A;  4BJZ A;  2XYO A;  3AEA A;  1JRX A;  1FEC A;  5ER0 A;  2PYX A;  4YXD A;  3BHK A;  1IUV A;  4U2L A;  3AEE A;  3IHG A;  1OJA A;  4EQR A;  4A99 A;  3RP6 A;  4AP1 A;  2O9Z A;  3AEC A;  2C65 A;  3AEG A;  2XVE A;  4FK1 C;  1TDO A;  2BRA A;  2Q7V A;  4WX1 A;  4A79 A;  1NEN A;  1LQT A;  1PJ7 A;  2WP6 A;  2H89 A;  3O0H A;  4LU6 A;  3DK4 A;  3T14 A;  2IID A;  4C5O A;  4A7A A;  4BJY A;  2YWL A;  3M12 A;  4DNA A;  4JNA A;  1IUW A;  1H81 A;  2R9Z A;  4BV6 A;  3SZ0 A;  3ALJ A;  1IUU A;  1CL0 A;  1DOE A;  2DKH A;  3UKA A;  5U63 A;  5KXJ A;  1REO A;  1YY5 A;  1LVL A;  1P2H A;  1Y0P A;  2ZZ0 A;  3NK0 X;  2Z5X A;  4H2Q A;  5J60 A;  3LOV A;  3DME A;  1N1P A;  1XDI A;  3Q9T A;  2YG4 A;  4KX6 A;  3ICT A;  3DK9 A;  2YG3 A;  3CGD A;  2GQF A;  1FEA A;  2GMH A;  5CKU A;  2BC0 A;  4YTM A;  5L46 A;  3NTD A;  4RSL A;  2BC1 A;  1RSG A;  3EF6 A;  3GSI A;  3LZW A;  3CN8 A;  1S2Q A;  3SFD A;  2VZ2 A;  1JNR A;  3KA7 A;  4B64 A;  5KMR A;  4U8L A;  1Z6L A;  3ICR A;  3F8R A;  4JY3 A;  3QSS A;  4TM0 A;  4B66 A;  3UOY A;  4G6H A;  4EIP A;  1E1K A;  4PAA A;  1S2Y A;  1GES A;  2WES A;  4N9X A;  2C3C A;  1NEK A;  4CY6 A;  4CNJ A;  4H2R A;  3EAO A;  1KSS A;  4J57 A;  1LQU A;  2YM1 A;  2WP5 A;  4P9S A;  5GRT A;  5BUL A;  3AE7 A;  2XFP A;  4GDP A;  2YLW A;  3SXI A;  4FDC B;  2VQ7 A;  4RG3 A;  4AT2 A;  3CPI G;  3QFB A;  1NG4 A;  3D1C A;  2YLX A;  1O95 A;  1TYP A;  3BNU A;  4ECH A;  2JK6 A;  4BK3 A;  1YKJ A;  1DJQ A;  2A89 A;  2XVI A;  1DOC A;  1PXC A;  2WET A;  4MJW A;  4X9M A;  4NEV A;  2PHH A;  2GV8 A;  3CNP A;  1OJC A;  2BS3 A;  1PXA A;  4G74 A;  4JNQ A;  2VRL A;  4YWO A;  1GPE A;  1CC2 A;  1KNP A;  5BUK A;  2BS2 A;  2WOI A;  3WE0 A;  1YQ3 A;  4GF7 A;  1E1N A;  1D7Y A;  4RG4 A;  4EMI A;  3NTA A;  5FMH A;  5JCL A;  2WBA A;  1F6M A;  5EBK A;  2RGH A;  3R9U A;  3ITJ A;  4USR A;  1E7P A;  2CUL A;  2W0H A;  2VVL A;  1EL5 A;  5FS9 A;  3AE8 A;  3OC4 A;  4DSH A;  3P4S A;  4Z2U A;  2AQJ A;  2R0C A;  2TPR A;  2YLT A;  3ADA B;  5IQ4 A;  1GND A;  1Q1R A;  1MXT A;  4C74 A;  2EQ7 A;  3G5R A;  4J36 A;  3RP7 A;  3SM8 A;  3ZYX A;  4GR1 A;  2YG7 A;  1D4D A;  1N4W A;  3BI2 A;  1Q1W A;  3KD9 A;  1F8R A;  2CVJ A;  2C73 A;  3CNS A;  3P1W A;  2XCG A;  3RNM A;  5IQ1 A;  2IVE A;  5KMS A;  4H4Q A;  4GCM A;  5FS6 A;  4LII A;  3UP5 A;  1NHS A;  1BKW A;  5U25 A;  1D5T A;  3NYF A;  5C2T A;  2OAM A;  1H86 A;  1OJ9 A;  1DNC A;  4HB9 A;  3PVC A;  3C4A A;  2JB3 A;  3BI5 A;  4OPC A;  3KKJ A;  1IUS A;  2GAH B;  3GYX A;  2GR0 A;  1PXB A;  2J3N A;  3F8P A;  1QLB A;  2X8C A;  5JCK A;  3C96 A;  2Q0L A;  1HYU A;  3LJP A;  1QO8 A;  3Q6J A;  1KSU A;  4USQ A;  4JDR A;  1B4V A;  2V5Z A;  4EQS A;  5KOW A;  4K5R A;  2F5Z A;  3K7Q X;  3AED A;  1TDN A;  3KPK A;  3UKL A;  3AEF A;  2YLZ A;  4I58 A;  3AD8 B;  3AWI A;  4IVO B;  4ZCD A;  2R0G A;  2Z5Y A;  4A5L A;  5LV9 A;  2NPX A;  3DA1 A;  4U8J A;  2YLR A;  3H8I A;  3SYI A;  1GTH A;  3UTG A;  1B8S A;  4G9K A;  4YSY A;  1GRG A;  1XHC A;  2GAG B;  3FG2 P;  3NHO X;  2WU5 A;  3AD9 B;  3HYX A;  4H4W A;  2V6O A;  2XVH A;  5HXI A;  4UP3 A;  1NPX A;  1XAN A;  2XDO A;  1IUX A;  3SQP A;  2V3B A;  3II4 A;  3M0O A;  2X3N A;  3T2Z A;  1N4V A;  2YR6 A;  1VQW A;  2X50 A;  4NEW A;  4APN A;  3SZF A;  4CCR A;  1Y56 A;  3V76 A;  2CFY A;  2XFO A;  3I3L A;  1Y56 B;  4ZN0 A;  5KRQ A;  2QA1 A;  1K0J A;  3QVR A;  5GSN A;  1F8W A;  2RGO A;  3GWD A;  4Z44 A;  2V60 A;  4TM4 A;  1GV4 A;  3NYC A;  4XXG A;  5IPY A;  4X9N A;  4OPI A;  2X8G A;  1PHH A;  1DXL A;  1GXF A;  4H4Z A;  2BA9 A;  3NT6 A;  1PBE A;  4FX9 A;  2JB1 A;  4UDQ A;  3GDP A;  1H7W A;  4EQW A;  3CGB A;  2RAB A;  3DJG X;  3GD3 A;  3K30 A;  4NNJ A;  2VVM A;  2V61 A;  4J33 A;  4AOS A;  4BUR A;  3NG7 X;  3I6D A;  4H4P A;  2C75 A;  2FBW A;  3AXB A;  4H4V A;  2C70 A;  3OZ2 A;  2JAE A;  5C3J A;  3CNT A;  3NYE A;  4TLZ A;  3EAN A;  1JEH A;  2TMD A;  5J7X A;  1GAL A;  3IF9 A;  4Z25 A;  2WS3 A;  1ELI A;  2E1M A;  1H7X A;  2XLU A;  3AE6 A;  4IA5 A;  2B9W A;  4REK A;  3UOZ A;  2Q0K A;  4LA1 A;  4CBQ A;  3GMC A;  1BGJ A;  3UKP A;  1PS9 A;  5KMP A;  1DOD A;  2BAB A;  1E39 A;  3D8X A;  1M6I A;  2XFU A;  3LZX A;  2GH5 A;  4B67 A;  2R0P A;  3DGZ A;  1D4E A;  4U8M A;  2YLS A;  3UKF A;  4Z2R A;  2DKI A;  2E4G A;  3T37 A;  3ALL A;  3UCL A;  4J34 A;  1CF3 A;  2C4C A;  5DBJ A;  1F8S A;  5M10 A;  4D04 A;  3DH9 A;  2HQM A;  1E1L A;  4ADW A;  1ZX9 A;  3QJ4 A;  1GSN A;  5HYM A;  2B7R A;  2WEU A;  1LV0 A;  1BZL A;  1IUT A;  4EQX A;  4YTN A;  4OPU A;  4EIQ A;  1CHU A;  2GR2 A;  3IC9 A;  4KPR A;  4O5Q A;  2OLO A;  2R4J A;  3CNJ A;  2WU2 A;  3BI4 A;  2JB2 A;  3VR9 A;  1OJT A;  1BWC A;  1ZKQ A;  2GR1 A;  3G5S A;  3FPZ A;  1CBO A;  3UOV A;  3NH3 X;  3SZW A;  1EBD A;  2GVC A;  3AYI A;  1JU2 A;  5TR3 A;  2QA2 A;  3GRT A;  1D4C A;  3DK8 A;  4K22 A;  2R4E A;  4A65 A;  3AE4 A;  2RGJ A;  3K7M X;  4CNK A;  5EB4 A;  4O5U A;  5EOW A;  3CPH G;  3KU9 A;  3HYV A;  5KOX A;  4J31 A;  1YQ4 A;  1F3P A;  3IWA A;  4H2N A;  2WHD A;  1GRH A;  3QVP A;  1JNZ A;  4A9W A;  1Q9I A;  1CJ4 A;  2JBV A;  4TLX A;  3V3O A;  4G73 A;  2EQ6 A;  3UP4 A;  1VG9 A;  5KWF A;  2OLN A;  2WDQ A;  3AD7 B;  1PBB A;  3P4R A;  2XFQ A;  3COX A;  3ISH A;  2ARD A;  1COY A;  1GOS A;  2UZZ A;  4B68 A;  2OAL A;  3SFE A;  2YAU A;  4H50 A;  4U2T A;  1GRE A;  3NNE A;  3NGC X;  2R46 A;  1ZY8 A;  3UKK A;  1PJ6 A;  2B76 A;  2WOV A;  1AOG A;  4U8P A;  1B37 A;  2A87 A;  1PN0 A;  4B69 A;  3S61 A;  4U8K A;  1RYI A;  4I59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...