3LZXA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form ii)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
total genus 92
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA02
2JB1A 2CVJA 1DOCA 4YSHA 4O5UA 4P9SA 2JB2A 3KD9A 3NYFA 3REDA 5BVAA 3NN6X 5KXJA 1B5QA 1H6VA 3RP6A 4A9WA 4BURA 1P2HA 4CY8A 3UP4A 3HZLA 4A6NB 1LQUA 2C70A 3KLJA 4A65A 1B4VA 1NPXA 3V3NA 4JQ9A 4Z2UA 3NNEA 1GRGA 2RGHA 3NIXA 5FS7A 1IUSA 2EQ7A 1JOAA 1EL5A 2V3BA 2X8GA 3LOVA 4YSYA 2BS2A 5U63A 1PJ5A 2X50A 1K0IA 3L8KA 3UP5A 5GRTA 5HY5A 3CGDA 1GNDA 4J33A 4A79A 4KX6A 3UOZA 1O95A 3AE3A 3KU9A 3URHA 1H81A 2GAGB 1Z6LA 3AE8A 4H50A 2C73A 1PBBA 5HXIA 3B6DA 3AEBA 4OPIA 3COXA 4UDQA 3WE0A 2B7SA 2X3NA 1L9DA 4JDRA 2YLTA 4IVMB 4NZHA 2R9ZA 2XCGA 1FECA 3AEEA 4RG4A 1XPQA 4ADWA 2BK5A 4AT2A 4JN9A 2WPFA 1Y56B 1JU2A 2VZ2A 3AEDA 2WETA 2VQ7A 1JNZA 3NLCA 1YQ3A 4H4SA 1LVLA 2WP5A 2BCPA 4C3XA 5JCLA 2IVDA 3VR9A 1COYA 3FBSA 3GWDA 3C4AA 3AEGA 4ZCDA 1VQWA 3CGEA 2XVEA 1GT8A 4DSGA 3K30A 4EQSA 1MXTA 2ZZ0A 2YG6A 1LPFA 4A5LA 1D4EA 2WDQA 3ZYXA 2FJEA 3BNUA 4Z24A 1OJCA 2C67A 2FJBA 4BJZA 3ITJA 3S61A 4Z2RA 1XDIA 3FIMB 1PXAA 2YLWA 2R0PA 1IJHA 2FBWA 4FDCB 2OA1A 1H86A 3AEFA 3F8RA 4YWOA 2XLUA 4CRTA 2X99A 1H7XA 4H2QA 3KPFA 3V3OA 1TDEA 1N1PA 3H4KA 2E1MA 1BZLA 4X9MA 1E1MA 4NEWA 2WOIA 3T37A 3UKKA 4D03A 3CGBA 5U1OA 2VVMA 4TM4A 5HYMA 1PDHA 4ICYA 4H4TA 4OPCA 3VR8A 1PBEA 4U8KA 4AP3A 1CF3A 2C76A 1ELIA 1E1KA 1NENA 4A6NA 4K7ZA 1GRAA 4GRTA 1REOA 3NYEA 1JRZA 3S5WA 4A7AA 3LB8A 1FEBA 1ZDLA 2WS3A 3DA1A 3PVCA 2TPRA 4B65A 2BXRA 3UCLA 2WHDA 3ICTA 4TLZA 1ZKQA 3AE6A 4PAAA 4U8NA 5KVHA 1V59A 2GH5A 1B8SA 2JKCA 2Q6UA 1GRBA 2WPEA 4HA6A 5GSNA 1PXBA 3K7TA 4C5OA 4U8IA 3RP7A 5JCKA 4H7UA 4U8LA 3DJGX 5EB5A 4K22A 4E0VA 2YVGA 3GSIA 2C65A 3SM8A 2R45A 1RP0A 1PJ7A 4LIIA 2A89A 2V3AA 2BC1A 3AD8B 1D4DA 1Y56A 4NTCA 4YKGA 3JSKA 1GTEA 2GMJA 4IVOB 3DJEA 1LTXR 4GDEA 3AD9B 2CFYA 2W0HA 2XDOA 2WOVA 3AYIA 3GYIA 1QJDA 4Z43A 2GV8A 2IIDA 2WBAA 1N4VA 5HHFA 1ZMDA 3UKLA 3NRNA 4YSXA 4BK2A 4U2TA 2GQWA 4BJYA 1VDCA 3AEAA 4M52A 3DMEA 3AE5A 3IHGA 4U2LA 4EIQA 3NYCA 4EQRA 3BI4A 1LV0A 2GR2A 2YM2A 3P4QA 3ABVA 2VQBA 3CN8A 4OPTA 3F8DA 1KNRA 2ZBWA 2I0ZA 4YTNA 1P2EA 1QO8A 2GR3A 4YTPA 2ARDA 3P4PA 1ONFA 1E6EA 3AYLA 2BYBA 3D1CA 3AYJA 4B68A 3UKHA 1KSUA 4LA1A 4J36A 2YG7A 1EL9A 3Q6JA 3FPZA 3VRBA 3QJ4A 3V76A 2GVCA 2XLSA 2VRLA 1JRYA 5EBKA 3E1TA 2WP9A 3I6DA 3EPTA 1VG0A 2CDUA 3K7MX 2R4EA 2TMDA 2YQUA 3UTEA 2Y6RA 2YR6A 3ICSA 3NTDA 2ZZCA 1TYPA 4EMJA 3FG2P 3M13A 5J60A 3DJJA 2YLXA 4PABA 4TLXA 1VRQB 4GCMA 1NEKA 2AR8A 4OVIA 4USQA 1DODA 2WU5A 3CNTA 1KSSA 2Z5YA 3GYJA 5IQ1A 1RSGA 1ZK7A 3IWAA 5KOWA 4GR1A 1PXCA 4J2WA 1GRHA 2B9YA 2VVLA 3SFEA 1H82A 2VVLG 3EANA 1D4CA 1H84A 1ZX9A 4JY2A 4N9XA 2DKHA 3G5QA 5M0ZA 1GREA 3DK4A 1L9EA 3DH9A 2RGOA 3AE1A 2NPXA 4Z44A 2WOWA 3GMBA 1IUTA 3QSMA 4AOSA 3CNSA 3B3RA 1GTHA 1GESA 1IUXA 1DJNA 4TM3A 4FK1A 2XFOA 5EB4A 3I3LA 4H4QA 5FS6A 3DK8A 2WU2A 2PYXA 3FMWA 3GD3A 4NEVA 5L46A 4H4UA 3CPIG 4LU6A 4XWRA 3LXDA 1CJ3A 2C72A 2OAMA 1OJTA 2Y6QA 1TDKA 3GDPA 2BS3A 3NKSA 1X31B 4IA5A 1MOKA 4H2NA 2C3DA 3VRAA 3CGCA 1LJ1A 3ISHA 1NG4A 3LZXA 2WPCA 2BABA 1N4UA 3AE9A 3IC9A 2E4GA 1DJQA 1NAAA 1D7YA 4ZN0A 1CJCA 4X9NA 4OPGA 1FEAA 5J7XA 1EL7A 1UKVG 2AAQA 1GPEA 2JB3A 3F8PA 4ZCCA 3P4SA 4GDPA 1GOSA 4EMWA 4CY6A 2ZZBA 3UTFA 5LV9A 3R9UA 4IA6A 2GMHA 4USRA 1GEUA 1CC2A 1JNRA 3C4NA 5CKUA 3VRDB 4AOXA 4NTEA 4Y4MA 5KVIA 2B9WA 1K4QA 3QFBA 2YWLA 1MO9A 1CJ2A 2FJAA 2H88A 2WESA 3M12A 3QVPA 2XVIA 2YLZA 3NH3X 4H4ZA 3BHFA 4AT0A 4B63A 3RNMA 1QLBA 4BK3A 2JAEA 1PJ6A 1ZMCA 2BK3A 3LZWA 4C74A 2NVKX 1L0VA 2YG5A 2DKIA 3UKPA 2CULA 2WDRA 1OJAA 4B69A 5JCNA 1ZOVA 3ATQA 1CHUA 1DXLA 1F8RA 2GF3A 4CCRA 2X8HA 2OLOA 1M64A 4JNQA 4MJWA 2GQFA 2BACA 1HYUA 3UOXA 3AB1A 5FMHA 2BS4A 3QFAA 4YKFA 1TDFA 5U25A 2YVFA 1YQZA 2J3NA 3CIRA 1JRXA 2C7GA 4U8JA 3LJPA 2QCUA 4APNA 1YQ4A 3ALMA 4EM3A 2IVEA 1PBDA 4OPDA 3NK0X 2R0GA 1N4WA 2APGA 3BI2A 4TM1A 2C3CA 2QA2A 1IUWA 4RG3A 1W4XA 4CNJA 1CC6A 2QAEA 1BF3A 2YLSA 3BI5A 4EMIA 3K7QX 4YTMA 1K0JA 2WP6A 1PBFA 3RHAA 2V5ZA 3ALJA 2WDVA 4OPLA 2R0CA 2WEUA 2X8CA 2UZZA 2BA9A 1BGJA 5KWFA 4O5QA 5FS8A 3NTAA 3DJDA 1EBDA 3BHKA 2BK4A 1OJDA 4NTDA 2PHHA 4J34A 1H7WA 3EAOA 4JY3A 4D04A 2Q0LA 2HQMA 2FJDA 1YY5A 1H83A 2BC0A 4GUVA 2YM1A 3NG7X 1VG9A 4K5RA 4BK1A 3H8LA 1GXFA 1PHHA 2JK6A 4OPUA 1O94A 1KF6A 3EF6A 4DSHA 3AE4A 2RGJA 3AXBA 1FCDA 3UTGA 1Q1WA 4B66A 3IF9A 2V61A 2QA1A 4CNKA 3LADA 3OC4A 1AOGA 1CJ4A 4H4VA 1D7LA 1GV4A 4U8MA 3GWFA 1BKWA 2A8XA 1PBCA 3KVEA 3UOVA 3NGCX 5BULA 2XVJA 1GRFA 2V6OA 4B1BA 3ATRA 3DK9A 1TDOA 4UDRA 3AECA 2GR0A 1S2YA 3NK2X 3O0HA 3NN0X 5TR3A 4Z25A 1BGNA 2F5ZA 1Q9IA 2XFQA 3AE2A 4J57A 1F8SA 4K5SA 2BXSA 4H2RA 1LQTA 3SGLA 2GR1A 2E5VA 3Q9TA 4EM4A 2RABA 3G5SA 2BCGG 4HB9A 2XVFA 3GMCA 2H89A 4CCQA 2XLPA 1DOBA 1ZY8A 3BNMA 3SQPA 4CBQA 5BUKA 1DOEA 2XFPA 4KPRA 4H4RA 3UKAA 1F3PA 1CC4A 2XFUA 4UDPA 1Y0PA 2C75A 3RP8A 1BWCA 1NG3A 3H8IA 5BRTA 2EQ8A 2XYOA 1F6MA 3ADAB 3GRTA 1KDGA 2VRMA 3AE7A 1JEHA 3OZ2A 3C96A 3GD4A 3IHMA 3ICRA 3KKJA 1DNCA 4B67A 3PO7A 3CNDA 1TYTA 4DNAA 5IPYA 2B76A 3GDNA 1GALA 1CL0A 4X4JA 4REKA 4K8DA 4H2PA 4UP3A 5DBJA 1ZOYA 4TM0A 2C66A 5KRQA 1OJ9A 1NDAA 2Z5XA 4J31A 3QSSA 4YXDA 3P9UA 2XLRA 4I59A 2V60A 1IUVA 1GRTA 4ECHA 1TRBA 1KFYA 2YAUA 3CNPA 4U8OA 3DGHA 4J56A 1IUUA 3UKQA 1B37A 3NT6A 5EOWA 4YSZA 4H4YA 2GRTA 4AP1A 1D5TA 4XWZA 4Y4NA 1NHRA 1NHSA 5ER0A 1FOHA 2ACZA 1ZP0A 1RYIA 3SFDA 1K0LA 4OCGA 4U2SA 1NHQA 2VOUA 3AD7B 3QVRA 5M10A 3UOYA 2GEWA 2OLNA 3G5RA 2B7RA 5JCIA 1E1NA 2YR5A 2R46A 1KNPA 5C2TA 1E1LA 1FL2A 2YG4A 2YG3A 3NHOX 2WQYA 4DGKA 2EQ9A 3CPJG 2O9ZA 5C3JA 4H4WA 2A87A 4H4XA 3VQRA 1L9CA 2R4JA 1XANA 4EQXA 4WX1A 2GB0A 2EQ6A 3DGZA 2B9XA 3KA7A 4YT0A 4BV6A 4FX9A 3L1RA 1XHCA 4JNAA 4XXGA 3ZDNA 4C3YA 2YLRA 3GRSA 5CQFA 1F8WA 3II4A 4GF7A 3D8XA 4C77A 1E39A 2YR4A 5IQ4A 4Y4LA 1S3BA 4Z26A 1S3EA 4U8PA 4IV9A 2Q7VA 3CNJA 3CTYA 3QSEA 1SEZA 1EL8A 2OALA 1S2QA 5KOXA 3PS9A 2Q0KA 4RSLA 4EIPA 4Z2TA 2C64A 2XFNA 3P4RA 4FK1C 1NHPA 3ALLA 3M0OA 3AWIA 4B64A 3UKFA 1Q1RA 1GETA 1M6IA 4EQWA 3CPHG 1GERA 2YVJA 2JBVA 1PS9A 3P1WA 4WCTA 1E7PA 4A99A 1O5WA 3UTHA 1PN0A 2AQJA 1TDNA 1YKJA 4K2XA 2XVHA 2GAHB 1GSNA 5FS9A 5JCMA 4H4PA 3NK1X 2XLTA 4I58A 1CBOA
chains in the Genus database with same CATH superfamily
2JB1A 2CVJA 1DOCA 4YSHA 4O5UA 4P9SA 2JB2A 3KD9A 3NYFA 3REDA 5BVAA 3NN6X 5KXJA 1B5QA 1H6VA 3RP6A 4A9WA 4BURA 1P2HA 4II2A 4CY8A 3UP4A 3HZLA 4A6NB 1LQUA 2C70A 3KLJA 4A65A 1B4VA 1NPXA 3V3NA 4JQ9A 4Z2UA 3NNEA 1GRGA 2RGHA 3NIXA 5FS7A 1IUSA 2EQ7A 1JOAA 1EL5A 2V3BA 2X8GA 3LOVA 4YSYA 2BS2A 5U63A 1PJ5A 2X50A 1K0IA 3L8KA 3UP5A 5GRTA 5HY5A 3CGDA 1GNDA 4J33A 4A79A 4KX6A 3UOZA 1O95A 3AE3A 3KU9A 3URHA 1H81A 2GAGB 1Z6LA 3AE8A 4H50A 2C73A 1PBBA 5HXIA 3B6DA 3AEBA 4OPIA 3COXA 4UDQA 3WE0A 2B7SA 2X3NA 1L9DA 4JDRA 4GAVA 2YLTA 4IVMB 4NZHA 2R9ZA 2XCGA 1FECA 3AEEA 3HYXA 1XPQA 4RG4A 4ADWA 2BK5A 4AT2A 4JN9A 2WPFA 1Y56B 1JU2A 2VZ2A 3AEDA 2WETA 2VQ7A 1JNZA 3NLCA 1YQ3A 4H4SA 1LVLA 2WP5A 2BCPA 4C3XA 5JCLA 2IVDA 3VR9A 1COYA 3FBSA 3GWDA 5KMSA 3C4AA 3AEGA 4ZCDA 1VQWA 3CGEA 2XVEA 1GT8A 3T2KA 3K30A 4DSGA 4EQSA 1MXTA 2ZZ0A 2YG6A 1LPFA 4A5LA 1D4EA 3CMMA 2WDQA 3ZYXA 2FJEA 3BNUA 4Z24A 1OJCA 2C67A 2FJBA 4BJZA 3ITJA 3S61A 4Z2RA 1XDIA 3FIMB 1PXAA 3SZCA 2YLWA 2R0PA 1IJHA 2FBWA 4FDCB 2OA1A 1H86A 3AEFA 3F8RA 4YWOA 2XLUA 4CRTA 2X99A 1H7XA 4H2QA 3KPFA 3V3OA 1TDEA 1N1PA 3H4KA 2E1MA 1BZLA 4X9MA 1E1MA 4NEWA 2WOIA 3T37A 3UKKA 4D03A 3CGBA 5U1OA 2VVMA 4TM4A 5HYMA 1PDHA 4ICYA 4H4TA 3T2ZA 4OPCA 3VR8A 1PBEA 4U8KA 4AP3A 1CF3A 2C76A 1ELIA 1E1KA 1NENA 4A6NA 4K7ZA 1GRAA 4GRTA 1REOA 3NYEA 1JRZA 3S5WA 4A7AA 3LB8A 1FEBA 1ZDLA 2WS3A 3DA1A 3PVCA 2TPRA 4B65A 2BXRA 3UCLA 2WHDA 3ICTA 4TLZA 1ZKQA 3AE6A 4PAAA 4U8NA 5KVHA 1V59A 2GH5A 1B8SA 2JKCA 2Q6UA 1GRBA 2WPEA 4HA6A 5GSNA 1PXBA 4NWZA 3K7TA 5KNLA 4C5OA 4U8IA 3RP7A 5JCKA 4H7UA 4U8LA 3DJGX 5EB5A 4K22A 4E0VA 2YVGA 3GSIA 2C65A 3SM8A 2R45A 1RP0A 1PJ7A 4LIIA 2A89A 2V3AA 2BC1A 3AD8B 1D4DA 1Y56A 4NTCA 4YKGA 3JSKA 1GTEA 2GMJA 4IVOB 4NNJA 3DJEA 1LTXR 4GDEA 3AD9B 2CFYA 2W0HA 2XDOA 2WOVA 3AYIA 3GYIA 1QJDA 4Z43A 2GV8A 2IIDA 2WBAA 1N4VA 5HHFA 1ZMDA 3UKLA 3NRNA 4YSXA 4BK2A 4U2TA 2GQWA 3HYVA 4BJYA 1VDCA 3AEAA 4M52A 3DMEA 3AE5A 3IHGA 4U2LA 4EIQA 3NYCA 4EQRA 3BI4A 1LV0A 2GR2A 2YM2A 3P4QA 3ABVA 2VQBA 3CN8A 4OPTA 3F8DA 1KNRA 2ZBWA 2I0ZA 4YTNA 1P2EA 1QO8A 2GR3A 4YTPA 2ARDA 3P4PA 1ONFA 1E6EA 3AYLA 2BYBA 3D1CA 3AYJA 4B68A 3UKHA 1KSUA 4LA1A 4J36A 2YG7A 1EL9A 3Q6JA 3FPZA 3VRBA 3QJ4A 3V76A 2GVCA 2XLSA 2VRLA 1JRYA 5EBKA 3E1TA 2WP9A 3I6DA 3EPTA 1VG0A 2CDUA 3K7MX 2R4EA 2TMDA 2YQUA 3UTEA 2Y6RA 2YR6A 3ICSA 3NTDA 5KMPA 2ZZCA 4G6GA 1TYPA 4EMJA 3FG2P 3M13A 5J60A 3DJJA 2YLXA 4PABA 4TLXA 1VRQB 4GCMA 4GAPA 1NEKA 2AR8A 4OVIA 4USQA 1DODA 2WU5A 3CNTA 1KSSA 2Z5YA 3GYJA 5IQ1A 1RSGA 1ZK7A 3IWAA 5KOWA 4GR1A 1PXCA 4J2WA 1GRHA 2B9YA 2VVLA 3SFEA 1H82A 2VVLG 3EANA 1D4CA 1H84A 1ZX9A 4JY2A 4N9XA 2DKHA 3G5QA 5M0ZA 1GREA 3DK4A 1L9EA 3DH9A 2RGOA 3AE1A 2NPXA 4Z44A 2WOWA 3GMBA 1IUTA 3QSMA 4AOSA 3CNSA 3B3RA 1GTHA 1GESA 1IUXA 1DJNA 4TM3A 4FK1A 2XFOA 5EB4A 3I3LA 4H4QA 5KMQA 5FS6A 3DK8A 2WU2A 2PYXA 3FMWA 3GD3A 4NEVA 5L46A 3HYWA 4H4UA 3CPIG 4LU6A 4XWRA 3LXDA 1CJ3A 2C72A 2OAMA 1OJTA 2Y6QA 1TDKA 3GDPA 2BS3A 3NKSA 1X31B 4IA5A 4G73A 1MOKA 4H2NA 2C3DA 3VRAA 3CGCA 1LJ1A 3ISHA 1NG4A 3LZXA 2WPCA 2BABA 1N4UA 3AE9A 3IC9A 2E4GA 1DJQA 1NAAA 1D7YA 4ZN0A 1CJCA 4X9NA 4OPGA 1FEAA 5J7XA 1EL7A 2C4CA 1UKVG 2AAQA 1GPEA 2JB3A 3F8PA 4ZCCA 3P4SA 4GDPA 1GOSA 4EMWA 4CY6A 2ZZBA 3UTFA 5LV9A 3R9UA 4IA6A 2GMHA 4USRA 1GEUA 1CC2A 1JNRA 3C4NA 5CKUA 3VRDB 4AOXA 4NTEA 4Y4MA 5KVIA 2B9WA 1K4QA 3QFBA 2YWLA 1MO9A 1CJ2A 2FJAA 2H88A 2WESA 3M12A 3QVPA 2XVIA 2YLZA 3NH3X 4H4ZA 3BHFA 4AT0A 4B63A 3RNMA 1QLBA 4BK3A 2JAEA 1PJ6A 1ZMCA 2BK3A 3LZWA 4C74A 2NVKX 1L0VA 2YG5A 2DKIA 3KPKA 3UKPA 2CULA 2WDRA 1OJAA 4B69A 5JCNA 1ZOVA 3ATQA 1CHUA 1DXLA 1F8RA 2GF3A 4CCRA 2X8HA 2OLOA 1M64A 4JNQA 4MJWA 2GQFA 2BACA 1HYUA 3UOXA 3AB1A 5FMHA 2BS4A 3QFAA 4YKFA 1TDFA 5U25A 2YVFA 1YQZA 2J3NA 3CIRA 1JRXA 2C7GA 4U8JA 3LJPA 2QCUA 4APNA 1YQ4A 3ALMA 4EM3A 2IVEA 1PBDA 4OPDA 3NK0X 2R0GA 1N4WA 2APGA 3BI2A 4TM1A 5KMRA 2C3CA 2QA2A 1IUWA 4RG3A 1W4XA 4CNJA 1CC6A 2QAEA 1BF3A 2YLSA 3BI5A 4EMIA 2BRAA 3K7QX 4YTMA 1K0JA 2WP6A 1PBFA 3RHAA 2V5ZA 3ALJA 2WDVA 4OPLA 2R0CA 2WEUA 2X8CA 2UZZA 2BA9A 1BGJA 5KWFA 4O5QA 5FS8A 3NTAA 3SZ0A 3DJDA 1EBDA 3BHKA 2BK4A 1OJDA 4NTDA 2PHHA 4J34A 1H7WA 3EAOA 4JY3A 4D04A 2Q0LA 2HQMA 2FJDA 3SXIA 1YY5A 1H83A 2BC0A 4GUVA 2YM1A 3NG7X 1VG9A 4K5RA 4BK1A 3H8LA 1GXFA 1PHHA 2JK6A 4OPUA 1O94A 1KF6A 3EF6A 4DSHA 3AE4A 2RGJA 3AXBA 1FCDA 3UTGA 1Q1WA 4B66A 3IF9A 2V61A 2QA1A 4CNKA 3LADA 3OC4A 1AOGA 1CJ4A 4H4VA 1D7LA 1GV4A 4U8MA 3T0KA 3GWFA 1BKWA 2A8XA 1PBCA 3KVEA 3UOVA 3NGCX 5BULA 2XVJA 1GRFA 2V6OA 4B1BA 3ATRA 3DK9A 1TDOA 4UDRA 3AECA 2GR0A 1S2YA 3NK2X 3O0HA 3NN0X 5TR3A 4Z25A 1BGNA 2F5ZA 1Q9IA 2XFQA 3AE2A 4J57A 1F8SA 4K5SA 2BRYA 2BXSA 4H2RA 1LQTA 3SGLA 2GR1A 2E5VA 3Q9TA 4EM4A 2RABA 3G5SA 2BCGG 4HB9A 2XVFA 3GMCA 2H89A 4CCQA 2XLPA 1DOBA 1ZY8A 3BNMA 3GYXA 3SQPA 4CBQA 5BUKA 1DOEA 2XFPA 4KPRA 4H4RA 3UKAA 1F3PA 1CC4A 2XFUA 4UDPA 1Y0PA 2C75A 4G6HA 3RP8A 1BWCA 1NG3A 3H8IA 5BRTA 2EQ8A 2XYOA 1F6MA 3ADAB 3GRTA 1KDGA 2VRMA 3AE7A 3T31A 1JEHA 3OZ2A 3C96A 3GD4A 3IHMA 3ICRA 3KKJA 1DNCA 4B67A 3PO7A 3CNDA 1TYTA 4DNAA 5IPYA 2B76A 3GDNA 1GALA 1CL0A 4X4JA 4REKA 4K8DA 4H2PA 4UP3A 5DBJA 1ZOYA 4TM0A 3SY4A 2C66A 5KRQA 1OJ9A 1NDAA 2Z5XA 4J31A 3QSSA 4YXDA 3P9UA 2XLRA 4I59A 2V60A 1IUVA 1GRTA 4ECHA 1TRBA 1KFYA 2YAUA 3CNPA 4U8OA 3DGHA 4J56A 1IUUA 3UKQA 1B37A 3NT6A 5EOWA 4YSZA 4H4YA 2GRTA 4AP1A 1D5TA 4XWZA 4Y4NA 1NHRA 1NHSA 5ER0A 1FOHA 2ACZA 1ZP0A 1RYIA 3SFDA 1K0LA 4OCGA 4U2SA 1NHQA 2VOUA 3AD7B 3QVRA 5M10A 3UOYA 2GEWA 2OLNA 3G5RA 2B7RA 5JCIA 1E1NA 2YR5A 2R46A 1KNPA 5C2TA 1E1LA 1FL2A 2YG4A 2YG3A 3NHOX 2WQYA 4DGKA 2EQ9A 3CPJG 2O9ZA 5C3JA 4H4WA 2A87A 4H4XA 3VQRA 1L9CA 2R4JA 1XANA 3T2YA 4EQXA 4WX1A 2GB0A 2EQ6A 3DGZA 2B9XA 3KA7A 4YT0A 4BV6A 4FX9A 3L1RA 1XHCA 4JNAA 4XXGA 3ZDNA 4C3YA 2YLRA 3GRSA 3SZFA 5CQFA 1F8WA 3II4A 4GF7A 4G9KA 3D8XA 4C77A 1E39A 3SYIA 2YR4A 5IQ4A 3SX6A 3T14A 4Y4LA 1S3BA 4Z26A 1S3EA 4U8PA 4IV9A 2Q7VA 3CNJA 3CTYA 3QSEA 1SEZA 1EL8A 2OALA 1S2QA 5KOXA 3PS9A 2Q0KA 4RSLA 4EIPA 4Z2TA 3SZWA 2C64A 2XFNA 4G74A 3P4RA 4FK1C 1NHPA 3ALLA 3M0OA 3AWIA 4B64A 3UKFA 1Q1RA 1GETA 1M6IA 4EQWA 3CPHG 1GERA 2YVJA 2JBVA 1PS9A 3P1WA 4WCTA 1E7PA 4A99A 4II3A 1O5WA 3UTHA 1PN0A 2AQJA 1TDNA 1YKJA 4K2XA 2XVHA 2GAHB 1GSNA 5FS9A 5JCMA 4H4PA 3NK1X 2XLTA 4I58A 1CBOA
chains in the Genus database with same CATH topology
2JB1A 2CVJA 1DOCA 4YSHA 4O5UA 4P9SA 2JB2A 3KD9A 3NYFA 3REDA 5BVAA 3NN6X 5KXJA 1B5QA 1H6VA 3RP6A 4A9WA 4BURA 1P2HA 4II2A 4CY8A 3UP4A 3HZLA 4A6NB 1LQUA 2C70A 3KLJA 4A65A 1B4VA 1NPXA 3V3NA 4JQ9A 4Z2UA 3NNEA 1GRGA 2RGHA 3NIXA 5FS7A 1IUSA 2EQ7A 1JOAA 1EL5A 2V3BA 2X8GA 3LOVA 4YSYA 2BS2A 5U63A 1PJ5A 2X50A 1K0IA 3L8KA 3UP5A 5GRTA 5HY5A 3CGDA 1GNDA 4J33A 4A79A 4KX6A 3UOZA 1O95A 3AE3A 3KU9A 3URHA 1H81A 2GAGB 1Z6LA 3AE8A 4H50A 2C73A 1PBBA 5HXIA 3B6DA 3AEBA 4OPIA 3COXA 4UDQA 3WE0A 2B7SA 2X3NA 1L9DA 4JDRA 4GAVA 2YLTA 4IVMB 4NZHA 2R9ZA 2XCGA 1FECA 3AEEA 3HYXA 1XPQA 4RG4A 4ADWA 2BK5A 4AT2A 4JN9A 2WPFA 1Y56B 1JU2A 2VZ2A 3AEDA 2WETA 2VQ7A 1JNZA 3NLCA 1YQ3A 4H4SA 1LVLA 2WP5A 2BCPA 4C3XA 5JCLA 2IVDA 3VR9A 1COYA 3FBSA 3GWDA 5KMSA 3C4AA 3AEGA 4ZCDA 1VQWA 3CGEA 2XVEA 1GT8A 3T2KA 3K30A 4DSGA 4EQSA 1MXTA 2ZZ0A 2YG6A 1LPFA 4A5LA 1D4EA 3CMMA 2WDQA 3ZYXA 2FJEA 3BNUA 4Z24A 1OJCA 2C67A 2FJBA 4BJZA 3ITJA 3S61A 4Z2RA 1XDIA 3FIMB 1PXAA 3SZCA 2YLWA 2R0PA 1IJHA 2FBWA 4FDCB 2OA1A 1H86A 3AEFA 3F8RA 4YWOA 2XLUA 4CRTA 2X99A 1H7XA 4H2QA 3KPFA 3V3OA 1TDEA 1N1PA 3H4KA 2E1MA 1BZLA 4X9MA 1E1MA 4NEWA 2WOIA 3T37A 3UKKA 4D03A 3CGBA 5U1OA 2VVMA 4TM4A 5HYMA 1PDHA 4ICYA 4H4TA 3T2ZA 4OPCA 3VR8A 1PBEA 4U8KA 4AP3A 1CF3A 2C76A 1ELIA 1E1KA 1NENA 4A6NA 4K7ZA 1GRAA 4GRTA 1REOA 3NYEA 1JRZA 3S5WA 4A7AA 3LB8A 1FEBA 1ZDLA 2WS3A 3DA1A 3PVCA 2TPRA 4B65A 2BXRA 3UCLA 2WHDA 3ICTA 4TLZA 1ZKQA 3AE6A 4PAAA 4U8NA 5KVHA 1V59A 2GH5A 1B8SA 2JKCA 2Q6UA 1GRBA 2WPEA 4HA6A 5GSNA 1PXBA 4NWZA 3K7TA 5KNLA 4C5OA 4U8IA 3RP7A 5JCKA 4H7UA 4U8LA 3DJGX 5EB5A 4K22A 4E0VA 2YVGA 3GSIA 2C65A 3SM8A 2R45A 1RP0A 1PJ7A 4LIIA 2A89A 2V3AA 2BC1A 3AD8B 1D4DA 1Y56A 4NTCA 4YKGA 3JSKA 1GTEA 2GMJA 4IVOB 4NNJA 3DJEA 1LTXR 4GDEA 3AD9B 2CFYA 2W0HA 2XDOA 2WOVA 3AYIA 3GYIA 1QJDA 4Z43A 2GV8A 2IIDA 2WBAA 1N4VA 5HHFA 1ZMDA 3UKLA 3NRNA 4YSXA 4BK2A 4U2TA 2GQWA 3HYVA 4BJYA 1VDCA 3AEAA 4M52A 3DMEA 3AE5A 3IHGA 4U2LA 4EIQA 3NYCA 4EQRA 3BI4A 1LV0A 2GR2A 2YM2A 3P4QA 3ABVA 2VQBA 3CN8A 4OPTA 3F8DA 1KNRA 2ZBWA 2I0ZA 4YTNA 1P2EA 1QO8A 2GR3A 4YTPA 2ARDA 3P4PA 1ONFA 1E6EA 3AYLA 2BYBA 3D1CA 3AYJA 4B68A 3UKHA 1KSUA 4LA1A 4J36A 2YG7A 1EL9A 3Q6JA 3FPZA 3VRBA 3QJ4A 3V76A 2GVCA 2XLSA 2VRLA 1JRYA 5EBKA 3E1TA 2WP9A 3I6DA 3EPTA 1VG0A 2CDUA 3K7MX 2R4EA 2TMDA 2YQUA 3UTEA 2Y6RA 2YR6A 3ICSA 3NTDA 5KMPA 2ZZCA 4G6GA 1TYPA 4EMJA 3FG2P 3M13A 5J60A 3DJJA 2YLXA 4PABA 4TLXA 1VRQB 4GCMA 4GAPA 1NEKA 2AR8A 4OVIA 4USQA 1DODA 2WU5A 3CNTA 1KSSA 2Z5YA 3GYJA 5IQ1A 1RSGA 1ZK7A 3IWAA 5KOWA 4GR1A 1PXCA 4J2WA 1GRHA 2B9YA 2VVLA 3SFEA 1H82A 2VVLG 3EANA 1D4CA 1H84A 1ZX9A 4JY2A 4N9XA 2DKHA 3G5QA 5M0ZA 1GREA 3DK4A 1L9EA 3DH9A 2RGOA 3AE1A 2NPXA 4Z44A 2WOWA 3GMBA 1IUTA 3QSMA 4AOSA 3CNSA 3B3RA 1GTHA 1GESA 1IUXA 1DJNA 4TM3A 4FK1A 2XFOA 5EB4A 3I3LA 4H4QA 5KMQA 5FS6A 3DK8A 2WU2A 2PYXA 3FMWA 3GD3A 4NEVA 5L46A 3HYWA 4H4UA 3CPIG 4LU6A 4XWRA 3LXDA 1CJ3A 2C72A 2OAMA 1OJTA 2Y6QA 1TDKA 3GDPA 2BS3A 3NKSA 1X31B 4IA5A 4G73A 1MOKA 4H2NA 2C3DA 3VRAA 3CGCA 1LJ1A 3ISHA 1NG4A 3LZXA 2WPCA 2BABA 1N4UA 3AE9A 3IC9A 2E4GA 1DJQA 1NAAA 1D7YA 4ZN0A 1CJCA 4X9NA 4OPGA 1FEAA 5J7XA 1EL7A 2C4CA 1UKVG 2AAQA 1GPEA 2JB3A 3F8PA 4ZCCA 3P4SA 4GDPA 1GOSA 4EMWA 4CY6A 2ZZBA 3UTFA 5LV9A 3R9UA 4IA6A 2GMHA 4USRA 1GEUA 1CC2A 1JNRA 3C4NA 5CKUA 3VRDB 4AOXA 4NTEA 4Y4MA 5KVIA 2B9WA 1K4QA 3QFBA 2YWLA 1MO9A 1CJ2A 2FJAA 2H88A 2WESA 3M12A 3QVPA 2XVIA 2YLZA 3NH3X 4H4ZA 3BHFA 4AT0A 4B63A 3RNMA 1QLBA 4BK3A 2JAEA 1PJ6A 1ZMCA 2BK3A 3LZWA 4C74A 2NVKX 1L0VA 2YG5A 2DKIA 3KPKA 3UKPA 2CULA 2WDRA 1OJAA 4B69A 5JCNA 1ZOVA 3ATQA 1CHUA 1DXLA 1F8RA 2GF3A 4CCRA 2X8HA 2OLOA 1M64A 4JNQA 4MJWA 2GQFA 2BACA 1HYUA 3UOXA 3AB1A 5FMHA 2BS4A 3QFAA 4YKFA 1TDFA 5U25A 2YVFA 1YQZA 2J3NA 3CIRA 1JRXA 2C7GA 4U8JA 3LJPA 2QCUA 4APNA 1YQ4A 3ALMA 4EM3A 2IVEA 1PBDA 4OPDA 3NK0X 2R0GA 1N4WA 2APGA 3BI2A 4TM1A 5KMRA 2C3CA 2QA2A 1IUWA 4RG3A 1W4XA 4CNJA 1CC6A 2QAEA 1BF3A 2YLSA 3BI5A 4EMIA 2BRAA 3K7QX 4YTMA 1K0JA 2WP6A 1PBFA 3RHAA 2V5ZA 3ALJA 2WDVA 4OPLA 2R0CA 2WEUA 2X8CA 2UZZA 2BA9A 1BGJA 5KWFA 4O5QA 5FS8A 3NTAA 3SZ0A 3DJDA 1EBDA 3BHKA 2BK4A 1OJDA 4NTDA 2PHHA 4J34A 1H7WA 3EAOA 4JY3A 4D04A 2Q0LA 2HQMA 2FJDA 3SXIA 1YY5A 1H83A 2BC0A 4GUVA 2YM1A 3NG7X 1VG9A 4K5RA 4BK1A 3H8LA 1GXFA 1PHHA 2JK6A 4OPUA 1O94A 1KF6A 3EF6A 4DSHA 3AE4A 2RGJA 3AXBA 1FCDA 3UTGA 1Q1WA 4B66A 3IF9A 2V61A 2QA1A 4CNKA 3LADA 3OC4A 1AOGA 1CJ4A 4H4VA 1D7LA 1GV4A 4U8MA 3T0KA 3GWFA 1BKWA 2A8XA 1PBCA 3KVEA 3UOVA 3NGCX 5BULA 2XVJA 1GRFA 2V6OA 4B1BA 3ATRA 3DK9A 1TDOA 4UDRA 3AECA 2GR0A 1S2YA 3NK2X 3O0HA 3NN0X 5TR3A 4Z25A 1BGNA 2F5ZA 1Q9IA 2XFQA 3AE2A 4J57A 1F8SA 4K5SA 2BRYA 2BXSA 4H2RA 1LQTA 3SGLA 2GR1A 2E5VA 3Q9TA 4EM4A 2RABA 3G5SA 2BCGG 4HB9A 2XVFA 3GMCA 2H89A 4CCQA 2XLPA 1DOBA 1ZY8A 3BNMA 3GYXA 3SQPA 4CBQA 5BUKA 1DOEA 2XFPA 4KPRA 4H4RA 3UKAA 1F3PA 1CC4A 2XFUA 4UDPA 1Y0PA 2C75A 4G6HA 3RP8A 1BWCA 1NG3A 3H8IA 5BRTA 2EQ8A 2XYOA 1F6MA 3ADAB 3GRTA 1KDGA 2VRMA 3AE7A 3T31A 1JEHA 3OZ2A 3C96A 3GD4A 3IHMA 3ICRA 3KKJA 1DNCA 4B67A 3PO7A 3CNDA 1TYTA 4DNAA 5IPYA 2B76A 3GDNA 1GALA 1CL0A 4X4JA 4REKA 4K8DA 4H2PA 4UP3A 5DBJA 1ZOYA 4TM0A 3SY4A 2C66A 5KRQA 1OJ9A 1NDAA 2Z5XA 4J31A 3QSSA 4YXDA 3P9UA 2XLRA 4I59A 2V60A 1IUVA 1GRTA 4ECHA 1TRBA 1KFYA 2YAUA 3CNPA 4U8OA 3DGHA 4J56A 1IUUA 3UKQA 1B37A 3NT6A 5EOWA 4YSZA 4H4YA 2GRTA 4AP1A 1D5TA 4XWZA 4Y4NA 1NHRA 1NHSA 5ER0A 1FOHA 2ACZA 1ZP0A 1RYIA 3SFDA 1K0LA 4OCGA 4U2SA 1NHQA 2VOUA 3AD7B 3QVRA 5M10A 3UOYA 2GEWA 2OLNA 3G5RA 2B7RA 5JCIA 1E1NA 2YR5A 2R46A 1KNPA 5C2TA 1E1LA 1FL2A 2YG4A 2YG3A 3NHOX 2WQYA 4DGKA 2EQ9A 3CPJG 2O9ZA 5C3JA 4H4WA 2A87A 4H4XA 3VQRA 1L9CA 2R4JA 1XANA 3T2YA 4EQXA 4WX1A 2GB0A 2EQ6A 3DGZA 2B9XA 3KA7A 4YT0A 4BV6A 4FX9A 3L1RA 1XHCA 4JNAA 4XXGA 3ZDNA 4C3YA 2YLRA 3GRSA 3SZFA 5CQFA 1F8WA 3II4A 4GF7A 4G9KA 3D8XA 4C77A 1E39A 3SYIA 2YR4A 5IQ4A 3SX6A 3T14A 4Y4LA 1S3BA 4Z26A 1S3EA 4U8PA 4IV9A 2Q7VA 3CNJA 3CTYA 3QSEA 1SEZA 1EL8A 2OALA 1S2QA 5KOXA 3PS9A 2Q0KA 4RSLA 4EIPA 4Z2TA 3SZWA 2C64A 2XFNA 4G74A 3P4RA 4FK1C 1NHPA 3ALLA 3M0OA 3AWIA 4B64A 3UKFA 1Q1RA 1GETA 1M6IA 4EQWA 3CPHG 1GERA 2YVJA 2JBVA 1PS9A 3P1WA 4WCTA 1E7PA 4A99A 4II3A 1O5WA 3UTHA 1PN0A 2AQJA 1TDNA 1YKJA 4K2XA 2XVHA 2GAHB 1GSNA 5FS9A 5JCMA 4H4PA 3NK1X 2XLTA 4I58A 1CBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JB1 A;  2CVJ A;  1DOC A;  4YSH A;  4O5U A;  4P9S A;  2JB2 A;  3KD9 A;  3NYF A;  3RED A;  5BVA A;  3NN6 X;  5KXJ A;  1B5Q A;  1H6V A;  3RP6 A;  4A9W A;  4BUR A;  1P2H A;  4CY8 A;  3UP4 A;  3HZL A;  4A6N B;  1LQU A;  2C70 A;  3KLJ A;  4A65 A;  1B4V A;  1NPX A;  3V3N A;  4JQ9 A;  4Z2U A;  3NNE A;  1GRG A;  2RGH A;  3NIX A;  5FS7 A;  1IUS A;  2EQ7 A;  1JOA A;  1EL5 A;  2V3B A;  2X8G A;  3LOV A;  4YSY A;  2BS2 A;  5U63 A;  1PJ5 A;  2X50 A;  1K0I A;  3L8K A;  3UP5 A;  5GRT A;  5HY5 A;  3CGD A;  1GND A;  4J33 A;  4A79 A;  4KX6 A;  3UOZ A;  1O95 A;  3AE3 A;  3KU9 A;  3URH A;  1H81 A;  2GAG B;  1Z6L A;  3AE8 A;  4H50 A;  2C73 A;  1PBB A;  5HXI A;  3B6D A;  3AEB A;  4OPI A;  3COX A;  4UDQ A;  3WE0 A;  2B7S A;  2X3N A;  1L9D A;  4JDR A;  2YLT A;  4IVM B;  4NZH A;  2R9Z A;  2XCG A;  1FEC A;  3AEE A;  4RG4 A;  1XPQ A;  4ADW A;  2BK5 A;  4AT2 A;  4JN9 A;  2WPF A;  1Y56 B;  1JU2 A;  2VZ2 A;  3AED A;  2WET A;  2VQ7 A;  1JNZ A;  3NLC A;  1YQ3 A;  4H4S A;  1LVL A;  2WP5 A;  2BCP A;  4C3X A;  5JCL A;  2IVD A;  3VR9 A;  1COY A;  3FBS A;  3GWD A;  3C4A A;  3AEG A;  4ZCD A;  1VQW A;  3CGE A;  2XVE A;  1GT8 A;  4DSG A;  3K30 A;  4EQS A;  1MXT A;  2ZZ0 A;  2YG6 A;  1LPF A;  4A5L A;  1D4E A;  2WDQ A;  3ZYX A;  2FJE A;  3BNU A;  4Z24 A;  1OJC A;  2C67 A;  2FJB A;  4BJZ A;  3ITJ A;  3S61 A;  4Z2R A;  1XDI A;  3FIM B;  1PXA A;  2YLW A;  2R0P A;  1IJH A;  2FBW A;  4FDC B;  2OA1 A;  1H86 A;  3AEF A;  3F8R A;  4YWO A;  2XLU A;  4CRT A;  2X99 A;  1H7X A;  4H2Q A;  3KPF A;  3V3O A;  1TDE A;  1N1P A;  3H4K A;  2E1M A;  1BZL A;  4X9M A;  1E1M A;  4NEW A;  2WOI A;  3T37 A;  3UKK A;  4D03 A;  3CGB A;  5U1O A;  2VVM A;  4TM4 A;  5HYM A;  1PDH A;  4ICY A;  4H4T A;  4OPC A;  3VR8 A;  1PBE A;  4U8K A;  4AP3 A;  1CF3 A;  2C76 A;  1ELI A;  1E1K A;  1NEN A;  4A6N A;  4K7Z A;  1GRA A;  4GRT A;  1REO A;  3NYE A;  1JRZ A;  3S5W A;  4A7A A;  3LB8 A;  1FEB A;  1ZDL A;  2WS3 A;  3DA1 A;  3PVC A;  2TPR A;  4B65 A;  2BXR A;  3UCL A;  2WHD A;  3ICT A;  4TLZ A;  1ZKQ A;  3AE6 A;  4PAA A;  4U8N A;  5KVH A;  1V59 A;  2GH5 A;  1B8S A;  2JKC A;  2Q6U A;  1GRB A;  2WPE A;  4HA6 A;  5GSN A;  1PXB A;  3K7T A;  4C5O A;  4U8I A;  3RP7 A;  5JCK A;  4H7U A;  4U8L A;  3DJG X;  5EB5 A;  4K22 A;  4E0V A;  2YVG A;  3GSI A;  2C65 A;  3SM8 A;  2R45 A;  1RP0 A;  1PJ7 A;  4LII A;  2A89 A;  2V3A A;  2BC1 A;  3AD8 B;  1D4D A;  1Y56 A;  4NTC A;  4YKG A;  3JSK A;  1GTE A;  2GMJ A;  4IVO B;  3DJE A;  1LTX R;  4GDE A;  3AD9 B;  2CFY A;  2W0H A;  2XDO A;  2WOV A;  3AYI A;  3GYI A;  1QJD A;  4Z43 A;  2GV8 A;  2IID A;  2WBA A;  1N4V A;  5HHF A;  1ZMD A;  3UKL A;  3NRN A;  4YSX A;  4BK2 A;  4U2T A;  2GQW A;  4BJY A;  1VDC A;  3AEA A;  4M52 A;  3DME A;  3AE5 A;  3IHG A;  4U2L A;  4EIQ A;  3NYC A;  4EQR A;  3BI4 A;  1LV0 A;  2GR2 A;  2YM2 A;  3P4Q A;  3ABV A;  2VQB A;  3CN8 A;  4OPT A;  3F8D A;  1KNR A;  2ZBW A;  2I0Z A;  4YTN A;  1P2E A;  1QO8 A;  2GR3 A;  4YTP A;  2ARD A;  3P4P A;  1ONF A;  1E6E A;  3AYL A;  2BYB A;  3D1C A;  3AYJ A;  4B68 A;  3UKH A;  1KSU A;  4LA1 A;  4J36 A;  2YG7 A;  1EL9 A;  3Q6J A;  3FPZ A;  3VRB A;  3QJ4 A;  3V76 A;  2GVC A;  2XLS A;  2VRL A;  1JRY A;  5EBK A;  3E1T A;  2WP9 A;  3I6D A;  3EPT A;  1VG0 A;  2CDU A;  3K7M X;  2R4E A;  2TMD A;  2YQU A;  3UTE A;  2Y6R A;  2YR6 A;  3ICS A;  3NTD A;  2ZZC A;  1TYP A;  4EMJ A;  3FG2 P;  3M13 A;  5J60 A;  3DJJ A;  2YLX A;  4PAB A;  4TLX A;  1VRQ B;  4GCM A;  1NEK A;  2AR8 A;  4OVI A;  4USQ A;  1DOD A;  2WU5 A;  3CNT A;  1KSS A;  2Z5Y A;  3GYJ A;  5IQ1 A;  1RSG A;  1ZK7 A;  3IWA A;  5KOW A;  4GR1 A;  1PXC A;  4J2W A;  1GRH A;  2B9Y A;  2VVL A;  3SFE A;  1H82 A;  2VVL G;  3EAN A;  1D4C A;  1H84 A;  1ZX9 A;  4JY2 A;  4N9X A;  2DKH A;  3G5Q A;  5M0Z A;  1GRE A;  3DK4 A;  1L9E A;  3DH9 A;  2RGO A;  3AE1 A;  2NPX A;  4Z44 A;  2WOW A;  3GMB A;  1IUT A;  3QSM A;  4AOS A;  3CNS A;  3B3R A;  1GTH A;  1GES A;  1IUX A;  1DJN A;  4TM3 A;  4FK1 A;  2XFO A;  5EB4 A;  3I3L A;  4H4Q A;  5FS6 A;  3DK8 A;  2WU2 A;  2PYX A;  3FMW A;  3GD3 A;  4NEV A;  5L46 A;  4H4U A;  3CPI G;  4LU6 A;  4XWR A;  3LXD A;  1CJ3 A;  2C72 A;  2OAM A;  1OJT A;  2Y6Q A;  1TDK A;  3GDP A;  2BS3 A;  3NKS A;  1X31 B;  4IA5 A;  1MOK A;  4H2N A;  2C3D A;  3VRA A;  3CGC A;  1LJ1 A;  3ISH A;  1NG4 A;  3LZX A;  2WPC A;  2BAB A;  1N4U A;  3AE9 A;  3IC9 A;  2E4G A;  1DJQ A;  1NAA A;  1D7Y A;  4ZN0 A;  1CJC A;  4X9N A;  4OPG A;  1FEA A;  5J7X A;  1EL7 A;  1UKV G;  2AAQ A;  1GPE A;  2JB3 A;  3F8P A;  4ZCC A;  3P4S A;  4GDP A;  1GOS A;  4EMW A;  4CY6 A;  2ZZB A;  3UTF A;  5LV9 A;  3R9U A;  4IA6 A;  2GMH A;  4USR A;  1GEU A;  1CC2 A;  1JNR A;  3C4N A;  5CKU A;  3VRD B;  4AOX A;  4NTE A;  4Y4M A;  5KVI A;  2B9W A;  1K4Q A;  3QFB A;  2YWL A;  1MO9 A;  1CJ2 A;  2FJA A;  2H88 A;  2WES A;  3M12 A;  3QVP A;  2XVI A;  2YLZ A;  3NH3 X;  4H4Z A;  3BHF A;  4AT0 A;  4B63 A;  3RNM A;  1QLB A;  4BK3 A;  2JAE A;  1PJ6 A;  1ZMC A;  2BK3 A;  3LZW A;  4C74 A;  2NVK X;  1L0V A;  2YG5 A;  2DKI A;  3UKP A;  2CUL A;  2WDR A;  1OJA A;  4B69 A;  5JCN A;  1ZOV A;  3ATQ A;  1CHU A;  1DXL A;  1F8R A;  2GF3 A;  4CCR A;  2X8H A;  2OLO A;  1M64 A;  4JNQ A;  4MJW A;  2GQF A;  2BAC A;  1HYU A;  3UOX A;  3AB1 A;  5FMH A;  2BS4 A;  3QFA A;  4YKF A;  1TDF A;  5U25 A;  2YVF A;  1YQZ A;  2J3N A;  3CIR A;  1JRX A;  2C7G A;  4U8J A;  3LJP A;  2QCU A;  4APN A;  1YQ4 A;  3ALM A;  4EM3 A;  2IVE A;  1PBD A;  4OPD A;  3NK0 X;  2R0G A;  1N4W A;  2APG A;  3BI2 A;  4TM1 A;  2C3C A;  2QA2 A;  1IUW A;  4RG3 A;  1W4X A;  4CNJ A;  1CC6 A;  2QAE A;  1BF3 A;  2YLS A;  3BI5 A;  4EMI A;  3K7Q X;  4YTM A;  1K0J A;  2WP6 A;  1PBF A;  3RHA A;  2V5Z A;  3ALJ A;  2WDV A;  4OPL A;  2R0C A;  2WEU A;  2X8C A;  2UZZ A;  2BA9 A;  1BGJ A;  5KWF A;  4O5Q A;  5FS8 A;  3NTA A;  3DJD A;  1EBD A;  3BHK A;  2BK4 A;  1OJD A;  4NTD A;  2PHH A;  4J34 A;  1H7W A;  3EAO A;  4JY3 A;  4D04 A;  2Q0L A;  2HQM A;  2FJD A;  1YY5 A;  1H83 A;  2BC0 A;  4GUV A;  2YM1 A;  3NG7 X;  1VG9 A;  4K5R A;  4BK1 A;  3H8L A;  1GXF A;  1PHH A;  2JK6 A;  4OPU A;  1O94 A;  1KF6 A;  3EF6 A;  4DSH A;  3AE4 A;  2RGJ A;  3AXB A;  1FCD A;  3UTG A;  1Q1W A;  4B66 A;  3IF9 A;  2V61 A;  2QA1 A;  4CNK A;  3LAD A;  3OC4 A;  1AOG A;  1CJ4 A;  4H4V A;  1D7L A;  1GV4 A;  4U8M A;  3GWF A;  1BKW A;  2A8X A;  1PBC A;  3KVE A;  3UOV A;  3NGC X;  5BUL A;  2XVJ A;  1GRF A;  2V6O A;  4B1B A;  3ATR A;  3DK9 A;  1TDO A;  4UDR A;  3AEC A;  2GR0 A;  1S2Y A;  3NK2 X;  3O0H A;  3NN0 X;  5TR3 A;  4Z25 A;  1BGN A;  2F5Z A;  1Q9I A;  2XFQ A;  3AE2 A;  4J57 A;  1F8S A;  4K5S A;  2BXS A;  4H2R A;  1LQT A;  3SGL A;  2GR1 A;  2E5V A;  3Q9T A;  4EM4 A;  2RAB A;  3G5S A;  2BCG G;  4HB9 A;  2XVF A;  3GMC A;  2H89 A;  4CCQ A;  2XLP A;  1DOB A;  1ZY8 A;  3BNM A;  3SQP A;  4CBQ A;  5BUK A;  1DOE A;  2XFP A;  4KPR A;  4H4R A;  3UKA A;  1F3P A;  1CC4 A;  2XFU A;  4UDP A;  1Y0P A;  2C75 A;  3RP8 A;  1BWC A;  1NG3 A;  3H8I A;  5BRT A;  2EQ8 A;  2XYO A;  1F6M A;  3ADA B;  3GRT A;  1KDG A;  2VRM A;  3AE7 A;  1JEH A;  3OZ2 A;  3C96 A;  3GD4 A;  3IHM A;  3ICR A;  3KKJ A;  1DNC A;  4B67 A;  3PO7 A;  3CND A;  1TYT A;  4DNA A;  5IPY A;  2B76 A;  3GDN A;  1GAL A;  1CL0 A;  4X4J A;  4REK A;  4K8D A;  4H2P A;  4UP3 A;  5DBJ A;  1ZOY A;  4TM0 A;  2C66 A;  5KRQ A;  1OJ9 A;  1NDA A;  2Z5X A;  4J31 A;  3QSS A;  4YXD A;  3P9U A;  2XLR A;  4I59 A;  2V60 A;  1IUV A;  1GRT A;  4ECH A;  1TRB A;  1KFY A;  2YAU A;  3CNP A;  4U8O A;  3DGH A;  4J56 A;  1IUU A;  3UKQ A;  1B37 A;  3NT6 A;  5EOW A;  4YSZ A;  4H4Y A;  2GRT A;  4AP1 A;  1D5T A;  4XWZ A;  4Y4N A;  1NHR A;  1NHS A;  5ER0 A;  1FOH A;  2ACZ A;  1ZP0 A;  1RYI A;  3SFD A;  1K0L A;  4OCG A;  4U2S A;  1NHQ A;  2VOU A;  3AD7 B;  3QVR A;  5M10 A;  3UOY A;  2GEW A;  2OLN A;  3G5R A;  2B7R A;  5JCI A;  1E1N A;  2YR5 A;  2R46 A;  1KNP A;  5C2T A;  1E1L A;  1FL2 A;  2YG4 A;  2YG3 A;  3NHO X;  2WQY A;  4DGK A;  2EQ9 A;  3CPJ G;  2O9Z A;  5C3J A;  4H4W A;  2A87 A;  4H4X A;  3VQR A;  1L9C A;  2R4J A;  1XAN A;  4EQX A;  4WX1 A;  2GB0 A;  2EQ6 A;  3DGZ A;  2B9X A;  3KA7 A;  4YT0 A;  4BV6 A;  4FX9 A;  3L1R A;  1XHC A;  4JNA A;  4XXG A;  3ZDN A;  4C3Y A;  2YLR A;  3GRS A;  5CQF A;  1F8W A;  3II4 A;  4GF7 A;  3D8X A;  4C77 A;  1E39 A;  2YR4 A;  5IQ4 A;  4Y4L A;  1S3B A;  4Z26 A;  1S3E A;  4U8P A;  4IV9 A;  2Q7V A;  3CNJ A;  3CTY A;  3QSE A;  1SEZ A;  1EL8 A;  2OAL A;  1S2Q A;  5KOX A;  3PS9 A;  2Q0K A;  4RSL A;  4EIP A;  4Z2T A;  2C64 A;  2XFN A;  3P4R A;  4FK1 C;  1NHP A;  3ALL A;  3M0O A;  3AWI A;  4B64 A;  3UKF A;  1Q1R A;  1GET A;  1M6I A;  4EQW A;  3CPH G;  1GER A;  2YVJ A;  2JBV A;  1PS9 A;  3P1W A;  4WCT A;  1E7P A;  4A99 A;  1O5W A;  3UTH A;  1PN0 A;  2AQJ A;  1TDN A;  1YKJ A;  4K2X A;  2XVH A;  2GAH B;  1GSN A;  5FS9 A;  5JCM A;  4H4P A;  3NK1 X;  2XLT A;  4I58 A;  1CBO A; 
#chains in the Genus database with same CATH topology
 2JB1 A;  2CVJ A;  1DOC A;  4YSH A;  4O5U A;  4P9S A;  2JB2 A;  3KD9 A;  3NYF A;  3RED A;  5BVA A;  3NN6 X;  5KXJ A;  1B5Q A;  1H6V A;  3RP6 A;  4A9W A;  4BUR A;  1P2H A;  4II2 A;  4CY8 A;  3UP4 A;  3HZL A;  4A6N B;  1LQU A;  2C70 A;  3KLJ A;  4A65 A;  1B4V A;  1NPX A;  3V3N A;  4JQ9 A;  4Z2U A;  3NNE A;  1GRG A;  2RGH A;  3NIX A;  5FS7 A;  1IUS A;  2EQ7 A;  1JOA A;  1EL5 A;  2V3B A;  2X8G A;  3LOV A;  4YSY A;  2BS2 A;  5U63 A;  1PJ5 A;  2X50 A;  1K0I A;  3L8K A;  3UP5 A;  5GRT A;  5HY5 A;  3CGD A;  1GND A;  4J33 A;  4A79 A;  4KX6 A;  3UOZ A;  1O95 A;  3AE3 A;  3KU9 A;  3URH A;  1H81 A;  2GAG B;  1Z6L A;  3AE8 A;  4H50 A;  2C73 A;  1PBB A;  5HXI A;  3B6D A;  3AEB A;  4OPI A;  3COX A;  4UDQ A;  3WE0 A;  2B7S A;  2X3N A;  1L9D A;  4JDR A;  4GAV A;  2YLT A;  4IVM B;  4NZH A;  2R9Z A;  2XCG A;  1FEC A;  3AEE A;  3HYX A;  1XPQ A;  4RG4 A;  4ADW A;  2BK5 A;  4AT2 A;  4JN9 A;  2WPF A;  1Y56 B;  1JU2 A;  2VZ2 A;  3AED A;  2WET A;  2VQ7 A;  1JNZ A;  3NLC A;  1YQ3 A;  4H4S A;  1LVL A;  2WP5 A;  2BCP A;  4C3X A;  5JCL A;  2IVD A;  3VR9 A;  1COY A;  3FBS A;  3GWD A;  5KMS A;  3C4A A;  3AEG A;  4ZCD A;  1VQW A;  3CGE A;  2XVE A;  1GT8 A;  3T2K A;  3K30 A;  4DSG A;  4EQS A;  1MXT A;  2ZZ0 A;  2YG6 A;  1LPF A;  4A5L A;  1D4E A;  3CMM A;  2WDQ A;  3ZYX A;  2FJE A;  3BNU A;  4Z24 A;  1OJC A;  2C67 A;  2FJB A;  4BJZ A;  3ITJ A;  3S61 A;  4Z2R A;  1XDI A;  3FIM B;  1PXA A;  3SZC A;  2YLW A;  2R0P A;  1IJH A;  2FBW A;  4FDC B;  2OA1 A;  1H86 A;  3AEF A;  3F8R A;  4YWO A;  2XLU A;  4CRT A;  2X99 A;  1H7X A;  4H2Q A;  3KPF A;  3V3O A;  1TDE A;  1N1P A;  3H4K A;  2E1M A;  1BZL A;  4X9M A;  1E1M A;  4NEW A;  2WOI A;  3T37 A;  3UKK A;  4D03 A;  3CGB A;  5U1O A;  2VVM A;  4TM4 A;  5HYM A;  1PDH A;  4ICY A;  4H4T A;  3T2Z A;  4OPC A;  3VR8 A;  1PBE A;  4U8K A;  4AP3 A;  1CF3 A;  2C76 A;  1ELI A;  1E1K A;  1NEN A;  4A6N A;  4K7Z A;  1GRA A;  4GRT A;  1REO A;  3NYE A;  1JRZ A;  3S5W A;  4A7A A;  3LB8 A;  1FEB A;  1ZDL A;  2WS3 A;  3DA1 A;  3PVC A;  2TPR A;  4B65 A;  2BXR A;  3UCL A;  2WHD A;  3ICT A;  4TLZ A;  1ZKQ A;  3AE6 A;  4PAA A;  4U8N A;  5KVH A;  1V59 A;  2GH5 A;  1B8S A;  2JKC A;  2Q6U A;  1GRB A;  2WPE A;  4HA6 A;  5GSN A;  1PXB A;  4NWZ A;  3K7T A;  5KNL A;  4C5O A;  4U8I A;  3RP7 A;  5JCK A;  4H7U A;  4U8L A;  3DJG X;  5EB5 A;  4K22 A;  4E0V A;  2YVG A;  3GSI A;  2C65 A;  3SM8 A;  2R45 A;  1RP0 A;  1PJ7 A;  4LII A;  2A89 A;  2V3A A;  2BC1 A;  3AD8 B;  1D4D A;  1Y56 A;  4NTC A;  4YKG A;  3JSK A;  1GTE A;  2GMJ A;  4IVO B;  4NNJ A;  3DJE A;  1LTX R;  4GDE A;  3AD9 B;  2CFY A;  2W0H A;  2XDO A;  2WOV A;  3AYI A;  3GYI A;  1QJD A;  4Z43 A;  2GV8 A;  2IID A;  2WBA A;  1N4V A;  5HHF A;  1ZMD A;  3UKL A;  3NRN A;  4YSX A;  4BK2 A;  4U2T A;  2GQW A;  3HYV A;  4BJY A;  1VDC A;  3AEA A;  4M52 A;  3DME A;  3AE5 A;  3IHG A;  4U2L A;  4EIQ A;  3NYC A;  4EQR A;  3BI4 A;  1LV0 A;  2GR2 A;  2YM2 A;  3P4Q A;  3ABV A;  2VQB A;  3CN8 A;  4OPT A;  3F8D A;  1KNR A;  2ZBW A;  2I0Z A;  4YTN A;  1P2E A;  1QO8 A;  2GR3 A;  4YTP A;  2ARD A;  3P4P A;  1ONF A;  1E6E A;  3AYL A;  2BYB A;  3D1C A;  3AYJ A;  4B68 A;  3UKH A;  1KSU A;  4LA1 A;  4J36 A;  2YG7 A;  1EL9 A;  3Q6J A;  3FPZ A;  3VRB A;  3QJ4 A;  3V76 A;  2GVC A;  2XLS A;  2VRL A;  1JRY A;  5EBK A;  3E1T A;  2WP9 A;  3I6D A;  3EPT A;  1VG0 A;  2CDU A;  3K7M X;  2R4E A;  2TMD A;  2YQU A;  3UTE A;  2Y6R A;  2YR6 A;  3ICS A;  3NTD A;  5KMP A;  2ZZC A;  4G6G A;  1TYP A;  4EMJ A;  3FG2 P;  3M13 A;  5J60 A;  3DJJ A;  2YLX A;  4PAB A;  4TLX A;  1VRQ B;  4GCM A;  4GAP A;  1NEK A;  2AR8 A;  4OVI A;  4USQ A;  1DOD A;  2WU5 A;  3CNT A;  1KSS A;  2Z5Y A;  3GYJ A;  5IQ1 A;  1RSG A;  1ZK7 A;  3IWA A;  5KOW A;  4GR1 A;  1PXC A;  4J2W A;  1GRH A;  2B9Y A;  2VVL A;  3SFE A;  1H82 A;  2VVL G;  3EAN A;  1D4C A;  1H84 A;  1ZX9 A;  4JY2 A;  4N9X A;  2DKH A;  3G5Q A;  5M0Z A;  1GRE A;  3DK4 A;  1L9E A;  3DH9 A;  2RGO A;  3AE1 A;  2NPX A;  4Z44 A;  2WOW A;  3GMB A;  1IUT A;  3QSM A;  4AOS A;  3CNS A;  3B3R A;  1GTH A;  1GES A;  1IUX A;  1DJN A;  4TM3 A;  4FK1 A;  2XFO A;  5EB4 A;  3I3L A;  4H4Q A;  5KMQ A;  5FS6 A;  3DK8 A;  2WU2 A;  2PYX A;  3FMW A;  3GD3 A;  4NEV A;  5L46 A;  3HYW A;  4H4U A;  3CPI G;  4LU6 A;  4XWR A;  3LXD A;  1CJ3 A;  2C72 A;  2OAM A;  1OJT A;  2Y6Q A;  1TDK A;  3GDP A;  2BS3 A;  3NKS A;  1X31 B;  4IA5 A;  4G73 A;  1MOK A;  4H2N A;  2C3D A;  3VRA A;  3CGC A;  1LJ1 A;  3ISH A;  1NG4 A;  3LZX A;  2WPC A;  2BAB A;  1N4U A;  3AE9 A;  3IC9 A;  2E4G A;  1DJQ A;  1NAA A;  1D7Y A;  4ZN0 A;  1CJC A;  4X9N A;  4OPG A;  1FEA A;  5J7X A;  1EL7 A;  2C4C A;  1UKV G;  2AAQ A;  1GPE A;  2JB3 A;  3F8P A;  4ZCC A;  3P4S A;  4GDP A;  1GOS A;  4EMW A;  4CY6 A;  2ZZB A;  3UTF A;  5LV9 A;  3R9U A;  4IA6 A;  2GMH A;  4USR A;  1GEU A;  1CC2 A;  1JNR A;  3C4N A;  5CKU A;  3VRD B;  4AOX A;  4NTE A;  4Y4M A;  5KVI A;  2B9W A;  1K4Q A;  3QFB A;  2YWL A;  1MO9 A;  1CJ2 A;  2FJA A;  2H88 A;  2WES A;  3M12 A;  3QVP A;  2XVI A;  2YLZ A;  3NH3 X;  4H4Z A;  3BHF A;  4AT0 A;  4B63 A;  3RNM A;  1QLB A;  4BK3 A;  2JAE A;  1PJ6 A;  1ZMC A;  2BK3 A;  3LZW A;  4C74 A;  2NVK X;  1L0V A;  2YG5 A;  2DKI A;  3KPK A;  3UKP A;  2CUL A;  2WDR A;  1OJA A;  4B69 A;  5JCN A;  1ZOV A;  3ATQ A;  1CHU A;  1DXL A;  1F8R A;  2GF3 A;  4CCR A;  2X8H A;  2OLO A;  1M64 A;  4JNQ A;  4MJW A;  2GQF A;  2BAC A;  1HYU A;  3UOX A;  3AB1 A;  5FMH A;  2BS4 A;  3QFA A;  4YKF A;  1TDF A;  5U25 A;  2YVF A;  1YQZ A;  2J3N A;  3CIR A;  1JRX A;  2C7G A;  4U8J A;  3LJP A;  2QCU A;  4APN A;  1YQ4 A;  3ALM A;  4EM3 A;  2IVE A;  1PBD A;  4OPD A;  3NK0 X;  2R0G A;  1N4W A;  2APG A;  3BI2 A;  4TM1 A;  5KMR A;  2C3C A;  2QA2 A;  1IUW A;  4RG3 A;  1W4X A;  4CNJ A;  1CC6 A;  2QAE A;  1BF3 A;  2YLS A;  3BI5 A;  4EMI A;  2BRA A;  3K7Q X;  4YTM A;  1K0J A;  2WP6 A;  1PBF A;  3RHA A;  2V5Z A;  3ALJ A;  2WDV A;  4OPL A;  2R0C A;  2WEU A;  2X8C A;  2UZZ A;  2BA9 A;  1BGJ A;  5KWF A;  4O5Q A;  5FS8 A;  3NTA A;  3SZ0 A;  3DJD A;  1EBD A;  3BHK A;  2BK4 A;  1OJD A;  4NTD A;  2PHH A;  4J34 A;  1H7W A;  3EAO A;  4JY3 A;  4D04 A;  2Q0L A;  2HQM A;  2FJD A;  3SXI A;  1YY5 A;  1H83 A;  2BC0 A;  4GUV A;  2YM1 A;  3NG7 X;  1VG9 A;  4K5R A;  4BK1 A;  3H8L A;  1GXF A;  1PHH A;  2JK6 A;  4OPU A;  1O94 A;  1KF6 A;  3EF6 A;  4DSH A;  3AE4 A;  2RGJ A;  3AXB A;  1FCD A;  3UTG A;  1Q1W A;  4B66 A;  3IF9 A;  2V61 A;  2QA1 A;  4CNK A;  3LAD A;  3OC4 A;  1AOG A;  1CJ4 A;  4H4V A;  1D7L A;  1GV4 A;  4U8M A;  3T0K A;  3GWF A;  1BKW A;  2A8X A;  1PBC A;  3KVE A;  3UOV A;  3NGC X;  5BUL A;  2XVJ A;  1GRF A;  2V6O A;  4B1B A;  3ATR A;  3DK9 A;  1TDO A;  4UDR A;  3AEC A;  2GR0 A;  1S2Y A;  3NK2 X;  3O0H A;  3NN0 X;  5TR3 A;  4Z25 A;  1BGN A;  2F5Z A;  1Q9I A;  2XFQ A;  3AE2 A;  4J57 A;  1F8S A;  4K5S A;  2BRY A;  2BXS A;  4H2R A;  1LQT A;  3SGL A;  2GR1 A;  2E5V A;  3Q9T A;  4EM4 A;  2RAB A;  3G5S A;  2BCG G;  4HB9 A;  2XVF A;  3GMC A;  2H89 A;  4CCQ A;  2XLP A;  1DOB A;  1ZY8 A;  3BNM A;  3GYX A;  3SQP A;  4CBQ A;  5BUK A;  1DOE A;  2XFP A;  4KPR A;  4H4R A;  3UKA A;  1F3P A;  1CC4 A;  2XFU A;  4UDP A;  1Y0P A;  2C75 A;  4G6H A;  3RP8 A;  1BWC A;  1NG3 A;  3H8I A;  5BRT A;  2EQ8 A;  2XYO A;  1F6M A;  3ADA B;  3GRT A;  1KDG A;  2VRM A;  3AE7 A;  3T31 A;  1JEH A;  3OZ2 A;  3C96 A;  3GD4 A;  3IHM A;  3ICR A;  3KKJ A;  1DNC A;  4B67 A;  3PO7 A;  3CND A;  1TYT A;  4DNA A;  5IPY A;  2B76 A;  3GDN A;  1GAL A;  1CL0 A;  4X4J A;  4REK A;  4K8D A;  4H2P A;  4UP3 A;  5DBJ A;  1ZOY A;  4TM0 A;  3SY4 A;  2C66 A;  5KRQ A;  1OJ9 A;  1NDA A;  2Z5X A;  4J31 A;  3QSS A;  4YXD A;  3P9U A;  2XLR A;  4I59 A;  2V60 A;  1IUV A;  1GRT A;  4ECH A;  1TRB A;  1KFY A;  2YAU A;  3CNP A;  4U8O A;  3DGH A;  4J56 A;  1IUU A;  3UKQ A;  1B37 A;  3NT6 A;  5EOW A;  4YSZ A;  4H4Y A;  2GRT A;  4AP1 A;  1D5T A;  4XWZ A;  4Y4N A;  1NHR A;  1NHS A;  5ER0 A;  1FOH A;  2ACZ A;  1ZP0 A;  1RYI A;  3SFD A;  1K0L A;  4OCG A;  4U2S A;  1NHQ A;  2VOU A;  3AD7 B;  3QVR A;  5M10 A;  3UOY A;  2GEW A;  2OLN A;  3G5R A;  2B7R A;  5JCI A;  1E1N A;  2YR5 A;  2R46 A;  1KNP A;  5C2T A;  1E1L A;  1FL2 A;  2YG4 A;  2YG3 A;  3NHO X;  2WQY A;  4DGK A;  2EQ9 A;  3CPJ G;  2O9Z A;  5C3J A;  4H4W A;  2A87 A;  4H4X A;  3VQR A;  1L9C A;  2R4J A;  1XAN A;  3T2Y A;  4EQX A;  4WX1 A;  2GB0 A;  2EQ6 A;  3DGZ A;  2B9X A;  3KA7 A;  4YT0 A;  4BV6 A;  4FX9 A;  3L1R A;  1XHC A;  4JNA A;  4XXG A;  3ZDN A;  4C3Y A;  2YLR A;  3GRS A;  3SZF A;  5CQF A;  1F8W A;  3II4 A;  4GF7 A;  4G9K A;  3D8X A;  4C77 A;  1E39 A;  3SYI A;  2YR4 A;  5IQ4 A;  3SX6 A;  3T14 A;  4Y4L A;  1S3B A;  4Z26 A;  1S3E A;  4U8P A;  4IV9 A;  2Q7V A;  3CNJ A;  3CTY A;  3QSE A;  1SEZ A;  1EL8 A;  2OAL A;  1S2Q A;  5KOX A;  3PS9 A;  2Q0K A;  4RSL A;  4EIP A;  4Z2T A;  3SZW A;  2C64 A;  2XFN A;  4G74 A;  3P4R A;  4FK1 C;  1NHP A;  3ALL A;  3M0O A;  3AWI A;  4B64 A;  3UKF A;  1Q1R A;  1GET A;  1M6I A;  4EQW A;  3CPH G;  1GER A;  2YVJ A;  2JBV A;  1PS9 A;  3P1W A;  4WCT A;  1E7P A;  4A99 A;  4II3 A;  1O5W A;  3UTH A;  1PN0 A;  2AQJ A;  1TDN A;  1YKJ A;  4K2X A;  2XVH A;  2GAH B;  1GSN A;  5FS9 A;  5JCM A;  4H4P A;  3NK1 X;  2XLT A;  4I58 A;  1CBO A; 
#chains in the Genus database with same CATH homology
 2JB1 A;  2CVJ A;  1DOC A;  4YSH A;  4O5U A;  4P9S A;  2JB2 A;  3KD9 A;  3NYF A;  3RED A;  5BVA A;  3NN6 X;  5KXJ A;  1B5Q A;  1H6V A;  3RP6 A;  4A9W A;  4BUR A;  1P2H A;  4II2 A;  4CY8 A;  3UP4 A;  3HZL A;  4A6N B;  1LQU A;  2C70 A;  3KLJ A;  4A65 A;  1B4V A;  1NPX A;  3V3N A;  4JQ9 A;  4Z2U A;  3NNE A;  1GRG A;  2RGH A;  3NIX A;  5FS7 A;  1IUS A;  2EQ7 A;  1JOA A;  1EL5 A;  2V3B A;  2X8G A;  3LOV A;  4YSY A;  2BS2 A;  5U63 A;  1PJ5 A;  2X50 A;  1K0I A;  3L8K A;  3UP5 A;  5GRT A;  5HY5 A;  3CGD A;  1GND A;  4J33 A;  4A79 A;  4KX6 A;  3UOZ A;  1O95 A;  3AE3 A;  3KU9 A;  3URH A;  1H81 A;  2GAG B;  1Z6L A;  3AE8 A;  4H50 A;  2C73 A;  1PBB A;  5HXI A;  3B6D A;  3AEB A;  4OPI A;  3COX A;  4UDQ A;  3WE0 A;  2B7S A;  2X3N A;  1L9D A;  4JDR A;  4GAV A;  2YLT A;  4IVM B;  4NZH A;  2R9Z A;  2XCG A;  1FEC A;  3AEE A;  3HYX A;  1XPQ A;  4RG4 A;  4ADW A;  2BK5 A;  4AT2 A;  4JN9 A;  2WPF A;  1Y56 B;  1JU2 A;  2VZ2 A;  3AED A;  2WET A;  2VQ7 A;  1JNZ A;  3NLC A;  1YQ3 A;  4H4S A;  1LVL A;  2WP5 A;  2BCP A;  4C3X A;  5JCL A;  2IVD A;  3VR9 A;  1COY A;  3FBS A;  3GWD A;  5KMS A;  3C4A A;  3AEG A;  4ZCD A;  1VQW A;  3CGE A;  2XVE A;  1GT8 A;  3T2K A;  3K30 A;  4DSG A;  4EQS A;  1MXT A;  2ZZ0 A;  2YG6 A;  1LPF A;  4A5L A;  1D4E A;  3CMM A;  2WDQ A;  3ZYX A;  2FJE A;  3BNU A;  4Z24 A;  1OJC A;  2C67 A;  2FJB A;  4BJZ A;  3ITJ A;  3S61 A;  4Z2R A;  1XDI A;  3FIM B;  1PXA A;  3SZC A;  2YLW A;  2R0P A;  1IJH A;  2FBW A;  4FDC B;  2OA1 A;  1H86 A;  3AEF A;  3F8R A;  4YWO A;  2XLU A;  4CRT A;  2X99 A;  1H7X A;  4H2Q A;  3KPF A;  3V3O A;  1TDE A;  1N1P A;  3H4K A;  2E1M A;  1BZL A;  4X9M A;  1E1M A;  4NEW A;  2WOI A;  3T37 A;  3UKK A;  4D03 A;  3CGB A;  5U1O A;  2VVM A;  4TM4 A;  5HYM A;  1PDH A;  4ICY A;  4H4T A;  3T2Z A;  4OPC A;  3VR8 A;  1PBE A;  4U8K A;  4AP3 A;  1CF3 A;  2C76 A;  1ELI A;  1E1K A;  1NEN A;  4A6N A;  4K7Z A;  1GRA A;  4GRT A;  1REO A;  3NYE A;  1JRZ A;  3S5W A;  4A7A A;  3LB8 A;  1FEB A;  1ZDL A;  2WS3 A;  3DA1 A;  3PVC A;  2TPR A;  4B65 A;  2BXR A;  3UCL A;  2WHD A;  3ICT A;  4TLZ A;  1ZKQ A;  3AE6 A;  4PAA A;  4U8N A;  5KVH A;  1V59 A;  2GH5 A;  1B8S A;  2JKC A;  2Q6U A;  1GRB A;  2WPE A;  4HA6 A;  5GSN A;  1PXB A;  4NWZ A;  3K7T A;  5KNL A;  4C5O A;  4U8I A;  3RP7 A;  5JCK A;  4H7U A;  4U8L A;  3DJG X;  5EB5 A;  4K22 A;  4E0V A;  2YVG A;  3GSI A;  2C65 A;  3SM8 A;  2R45 A;  1RP0 A;  1PJ7 A;  4LII A;  2A89 A;  2V3A A;  2BC1 A;  3AD8 B;  1D4D A;  1Y56 A;  4NTC A;  4YKG A;  3JSK A;  1GTE A;  2GMJ A;  4IVO B;  4NNJ A;  3DJE A;  1LTX R;  4GDE A;  3AD9 B;  2CFY A;  2W0H A;  2XDO A;  2WOV A;  3AYI A;  3GYI A;  1QJD A;  4Z43 A;  2GV8 A;  2IID A;  2WBA A;  1N4V A;  5HHF A;  1ZMD A;  3UKL A;  3NRN A;  4YSX A;  4BK2 A;  4U2T A;  2GQW A;  3HYV A;  4BJY A;  1VDC A;  3AEA A;  4M52 A;  3DME A;  3AE5 A;  3IHG A;  4U2L A;  4EIQ A;  3NYC A;  4EQR A;  3BI4 A;  1LV0 A;  2GR2 A;  2YM2 A;  3P4Q A;  3ABV A;  2VQB A;  3CN8 A;  4OPT A;  3F8D A;  1KNR A;  2ZBW A;  2I0Z A;  4YTN A;  1P2E A;  1QO8 A;  2GR3 A;  4YTP A;  2ARD A;  3P4P A;  1ONF A;  1E6E A;  3AYL A;  2BYB A;  3D1C A;  3AYJ A;  4B68 A;  3UKH A;  1KSU A;  4LA1 A;  4J36 A;  2YG7 A;  1EL9 A;  3Q6J A;  3FPZ A;  3VRB A;  3QJ4 A;  3V76 A;  2GVC A;  2XLS A;  2VRL A;  1JRY A;  5EBK A;  3E1T A;  2WP9 A;  3I6D A;  3EPT A;  1VG0 A;  2CDU A;  3K7M X;  2R4E A;  2TMD A;  2YQU A;  3UTE A;  2Y6R A;  2YR6 A;  3ICS A;  3NTD A;  5KMP A;  2ZZC A;  4G6G A;  1TYP A;  4EMJ A;  3FG2 P;  3M13 A;  5J60 A;  3DJJ A;  2YLX A;  4PAB A;  4TLX A;  1VRQ B;  4GCM A;  4GAP A;  1NEK A;  2AR8 A;  4OVI A;  4USQ A;  1DOD A;  2WU5 A;  3CNT A;  1KSS A;  2Z5Y A;  3GYJ A;  5IQ1 A;  1RSG A;  1ZK7 A;  3IWA A;  5KOW A;  4GR1 A;  1PXC A;  4J2W A;  1GRH A;  2B9Y A;  2VVL A;  3SFE A;  1H82 A;  2VVL G;  3EAN A;  1D4C A;  1H84 A;  1ZX9 A;  4JY2 A;  4N9X A;  2DKH A;  3G5Q A;  5M0Z A;  1GRE A;  3DK4 A;  1L9E A;  3DH9 A;  2RGO A;  3AE1 A;  2NPX A;  4Z44 A;  2WOW A;  3GMB A;  1IUT A;  3QSM A;  4AOS A;  3CNS A;  3B3R A;  1GTH A;  1GES A;  1IUX A;  1DJN A;  4TM3 A;  4FK1 A;  2XFO A;  5EB4 A;  3I3L A;  4H4Q A;  5KMQ A;  5FS6 A;  3DK8 A;  2WU2 A;  2PYX A;  3FMW A;  3GD3 A;  4NEV A;  5L46 A;  3HYW A;  4H4U A;  3CPI G;  4LU6 A;  4XWR A;  3LXD A;  1CJ3 A;  2C72 A;  2OAM A;  1OJT A;  2Y6Q A;  1TDK A;  3GDP A;  2BS3 A;  3NKS A;  1X31 B;  4IA5 A;  4G73 A;  1MOK A;  4H2N A;  2C3D A;  3VRA A;  3CGC A;  1LJ1 A;  3ISH A;  1NG4 A;  3LZX A;  2WPC A;  2BAB A;  1N4U A;  3AE9 A;  3IC9 A;  2E4G A;  1DJQ A;  1NAA A;  1D7Y A;  4ZN0 A;  1CJC A;  4X9N A;  4OPG A;  1FEA A;  5J7X A;  1EL7 A;  2C4C A;  1UKV G;  2AAQ A;  1GPE A;  2JB3 A;  3F8P A;  4ZCC A;  3P4S A;  4GDP A;  1GOS A;  4EMW A;  4CY6 A;  2ZZB A;  3UTF A;  5LV9 A;  3R9U A;  4IA6 A;  2GMH A;  4USR A;  1GEU A;  1CC2 A;  1JNR A;  3C4N A;  5CKU A;  3VRD B;  4AOX A;  4NTE A;  4Y4M A;  5KVI A;  2B9W A;  1K4Q A;  3QFB A;  2YWL A;  1MO9 A;  1CJ2 A;  2FJA A;  2H88 A;  2WES A;  3M12 A;  3QVP A;  2XVI A;  2YLZ A;  3NH3 X;  4H4Z A;  3BHF A;  4AT0 A;  4B63 A;  3RNM A;  1QLB A;  4BK3 A;  2JAE A;  1PJ6 A;  1ZMC A;  2BK3 A;  3LZW A;  4C74 A;  2NVK X;  1L0V A;  2YG5 A;  2DKI A;  3KPK A;  3UKP A;  2CUL A;  2WDR A;  1OJA A;  4B69 A;  5JCN A;  1ZOV A;  3ATQ A;  1CHU A;  1DXL A;  1F8R A;  2GF3 A;  4CCR A;  2X8H A;  2OLO A;  1M64 A;  4JNQ A;  4MJW A;  2GQF A;  2BAC A;  1HYU A;  3UOX A;  3AB1 A;  5FMH A;  2BS4 A;  3QFA A;  4YKF A;  1TDF A;  5U25 A;  2YVF A;  1YQZ A;  2J3N A;  3CIR A;  1JRX A;  2C7G A;  4U8J A;  3LJP A;  2QCU A;  4APN A;  1YQ4 A;  3ALM A;  4EM3 A;  2IVE A;  1PBD A;  4OPD A;  3NK0 X;  2R0G A;  1N4W A;  2APG A;  3BI2 A;  4TM1 A;  5KMR A;  2C3C A;  2QA2 A;  1IUW A;  4RG3 A;  1W4X A;  4CNJ A;  1CC6 A;  2QAE A;  1BF3 A;  2YLS A;  3BI5 A;  4EMI A;  2BRA A;  3K7Q X;  4YTM A;  1K0J A;  2WP6 A;  1PBF A;  3RHA A;  2V5Z A;  3ALJ A;  2WDV A;  4OPL A;  2R0C A;  2WEU A;  2X8C A;  2UZZ A;  2BA9 A;  1BGJ A;  5KWF A;  4O5Q A;  5FS8 A;  3NTA A;  3SZ0 A;  3DJD A;  1EBD A;  3BHK A;  2BK4 A;  1OJD A;  4NTD A;  2PHH A;  4J34 A;  1H7W A;  3EAO A;  4JY3 A;  4D04 A;  2Q0L A;  2HQM A;  2FJD A;  3SXI A;  1YY5 A;  1H83 A;  2BC0 A;  4GUV A;  2YM1 A;  3NG7 X;  1VG9 A;  4K5R A;  4BK1 A;  3H8L A;  1GXF A;  1PHH A;  2JK6 A;  4OPU A;  1O94 A;  1KF6 A;  3EF6 A;  4DSH A;  3AE4 A;  2RGJ A;  3AXB A;  1FCD A;  3UTG A;  1Q1W A;  4B66 A;  3IF9 A;  2V61 A;  2QA1 A;  4CNK A;  3LAD A;  3OC4 A;  1AOG A;  1CJ4 A;  4H4V A;  1D7L A;  1GV4 A;  4U8M A;  3T0K A;  3GWF A;  1BKW A;  2A8X A;  1PBC A;  3KVE A;  3UOV A;  3NGC X;  5BUL A;  2XVJ A;  1GRF A;  2V6O A;  4B1B A;  3ATR A;  3DK9 A;  1TDO A;  4UDR A;  3AEC A;  2GR0 A;  1S2Y A;  3NK2 X;  3O0H A;  3NN0 X;  5TR3 A;  4Z25 A;  1BGN A;  2F5Z A;  1Q9I A;  2XFQ A;  3AE2 A;  4J57 A;  1F8S A;  4K5S A;  2BRY A;  2BXS A;  4H2R A;  1LQT A;  3SGL A;  2GR1 A;  2E5V A;  3Q9T A;  4EM4 A;  2RAB A;  3G5S A;  2BCG G;  4HB9 A;  2XVF A;  3GMC A;  2H89 A;  4CCQ A;  2XLP A;  1DOB A;  1ZY8 A;  3BNM A;  3GYX A;  3SQP A;  4CBQ A;  5BUK A;  1DOE A;  2XFP A;  4KPR A;  4H4R A;  3UKA A;  1F3P A;  1CC4 A;  2XFU A;  4UDP A;  1Y0P A;  2C75 A;  4G6H A;  3RP8 A;  1BWC A;  1NG3 A;  3H8I A;  5BRT A;  2EQ8 A;  2XYO A;  1F6M A;  3ADA B;  3GRT A;  1KDG A;  2VRM A;  3AE7 A;  3T31 A;  1JEH A;  3OZ2 A;  3C96 A;  3GD4 A;  3IHM A;  3ICR A;  3KKJ A;  1DNC A;  4B67 A;  3PO7 A;  3CND A;  1TYT A;  4DNA A;  5IPY A;  2B76 A;  3GDN A;  1GAL A;  1CL0 A;  4X4J A;  4REK A;  4K8D A;  4H2P A;  4UP3 A;  5DBJ A;  1ZOY A;  4TM0 A;  3SY4 A;  2C66 A;  5KRQ A;  1OJ9 A;  1NDA A;  2Z5X A;  4J31 A;  3QSS A;  4YXD A;  3P9U A;  2XLR A;  4I59 A;  2V60 A;  1IUV A;  1GRT A;  4ECH A;  1TRB A;  1KFY A;  2YAU A;  3CNP A;  4U8O A;  3DGH A;  4J56 A;  1IUU A;  3UKQ A;  1B37 A;  3NT6 A;  5EOW A;  4YSZ A;  4H4Y A;  2GRT A;  4AP1 A;  1D5T A;  4XWZ A;  4Y4N A;  1NHR A;  1NHS A;  5ER0 A;  1FOH A;  2ACZ A;  1ZP0 A;  1RYI A;  3SFD A;  1K0L A;  4OCG A;  4U2S A;  1NHQ A;  2VOU A;  3AD7 B;  3QVR A;  5M10 A;  3UOY A;  2GEW A;  2OLN A;  3G5R A;  2B7R A;  5JCI A;  1E1N A;  2YR5 A;  2R46 A;  1KNP A;  5C2T A;  1E1L A;  1FL2 A;  2YG4 A;  2YG3 A;  3NHO X;  2WQY A;  4DGK A;  2EQ9 A;  3CPJ G;  2O9Z A;  5C3J A;  4H4W A;  2A87 A;  4H4X A;  3VQR A;  1L9C A;  2R4J A;  1XAN A;  3T2Y A;  4EQX A;  4WX1 A;  2GB0 A;  2EQ6 A;  3DGZ A;  2B9X A;  3KA7 A;  4YT0 A;  4BV6 A;  4FX9 A;  3L1R A;  1XHC A;  4JNA A;  4XXG A;  3ZDN A;  4C3Y A;  2YLR A;  3GRS A;  3SZF A;  5CQF A;  1F8W A;  3II4 A;  4GF7 A;  4G9K A;  3D8X A;  4C77 A;  1E39 A;  3SYI A;  2YR4 A;  5IQ4 A;  3SX6 A;  3T14 A;  4Y4L A;  1S3B A;  4Z26 A;  1S3E A;  4U8P A;  4IV9 A;  2Q7V A;  3CNJ A;  3CTY A;  3QSE A;  1SEZ A;  1EL8 A;  2OAL A;  1S2Q A;  5KOX A;  3PS9 A;  2Q0K A;  4RSL A;  4EIP A;  4Z2T A;  3SZW A;  2C64 A;  2XFN A;  4G74 A;  3P4R A;  4FK1 C;  1NHP A;  3ALL A;  3M0O A;  3AWI A;  4B64 A;  3UKF A;  1Q1R A;  1GET A;  1M6I A;  4EQW A;  3CPH G;  1GER A;  2YVJ A;  2JBV A;  1PS9 A;  3P1W A;  4WCT A;  1E7P A;  4A99 A;  4II3 A;  1O5W A;  3UTH A;  1PN0 A;  2AQJ A;  1TDN A;  1YKJ A;  4K2X A;  2XVH A;  2GAH B;  1GSN A;  5FS9 A;  5JCM A;  4H4P A;  3NK1 X;  2XLT A;  4I58 A;  1CBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...