3LZXA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form ii)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 92
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA02
2C64A 3BI2A 3BNUA 3II4A 1S3BA 1ZK7A 4Z2TA 1H83A 2JB1A 1TYTA 1PXAA 3M12A 2W0HA 1DOEA 1ZMCA 1S2YA 2GF3A 2VQ7A 3JSKA 1PBFA 1O95A 2EQ9A 4B67A 2GMHA 4C77A 3EANA 4REKA 1H6VA 3C96A 3AEEA 3O0HA 4H2RA 3DA1A 2XFUA 2AR8A 2YLZA 1H82A 1GTHA 3CPJG 4GCMA 1FL2A 3AWIA 3CGDA 1KF6A 4H4QA 3ZYXA 2RGJA 1LTXR 2XVJA 4X9NA 4Y4LA 1PJ5A 5EOWA 3NGCX 2VRLA 4HB9A 3F8RA 3H8IA 3L1RA 2GH5A 4K2XA 1DOCA 3G5SA 2WU5A 4B69A 2QA2A 3UP4A 2YG5A 4EQXA 4NTCA 2QCUA 3NLCA 1CJCA 1FECA 2XLRA 3AEFA 4ZCDA 4C3YA 2J3NA 4BK3A 4YKGA 2B9YA 4I58A 4GDPA 4KPRA 5LV9A 2R0CA 3AE5A 4YTNA 2E5VA 1NENA 1XPQA 1VDCA 2Q6UA 4NEVA 2XCGA 4UDQA 4O5UA 4AOSA 4BK1A 3UKLA 2VVMA 2TPRA 4CNKA 2A89A 4A79A 4EM3A 3AD9B 2FBWA 1H7XA 3K7QX 1TDFA 1DOBA 2JK6A 2YLTA 1ELIA 2YM2A 1PXCA 4DNAA 1GRHA 4Z26A 1E1KA 2BK4A 4U2LA 4USQA 4J31A 2NPXA 1OJAA 2XLTA 2R4EA 4BK2A 4OVIA 3CNTA 2OLNA 2R0PA 4H4SA 5KRQA 2ZZBA 5EB5A 4A65A 1NDAA 1QLBA 2WPFA 1KNRA 3VR9A 1LQTA 2A8XA 1PBBA 1CJ4A 2A87A 4OPIA 2WP5A 3CPHG 2RGHA 2V3AA 4H4XA 1SEZA 1CC4A 2ZZ0A 5KWFA 2YAUA 2IVDA 3G5QA 5EB4A 1S2QA 3LOVA 5FS6A 1S3EA 3P9UA 4OCGA 4EQSA 1N4WA 3FIMB 3P1WA 1GRTA 3GSIA 4MJWA 3VRAA 2CVJA 2BA9A 2BCPA 3GWFA 3I6DA 4RG4A 5EBKA 5FS8A 2C75A 5U63A 4H4VA 2X8CA 2B7SA 2YR4A 2WOIA 1CF3A 2RABA 3IF9A 3KPFA 4J33A 3UCLA 4FX9A 4JQ9A 4UDPA 1JRZA 2V3BA 4TM4A 2VZ2A 3AEGA 2YR5A 3UOYA 4EMJA 3NIXA 2FJBA 3UKFA 1OJDA 3K7MX 4H4ZA 3ZDNA 2BK3A 5HYMA 4D03A 3DJGX 3UKHA 1REOA 3AD8B 3QSEA 1PHHA 1ZMDA 3BI4A 4AT0A 5IPYA 1GPEA 3KLJA 2ACZA 5DBJA 2FJAA 3AE9A 4EQWA 3QSMA 1B5QA 5KOXA 3CIRA 3AE1A 1OJCA 3P4RA 2IVEA 4GR1A 5JCNA 4BV6A 2X50A 3AEAA 2BABA 2XLSA 2R46A 2C72A 1E7PA 1PJ7A 1Z6LA 1OJTA 2C3DA 4H4UA 1L9EA 4P9SA 2VVLA 1DNCA 1IUTA 3FBSA 5JCMA 2R45A 1BGJA 2F5ZA 4USRA 1LV0A 2YQUA 3QJ4A 3DJJA 1L0VA 2C65A 4B64A 1GRBA 1B4VA 1XHCA 4U8OA 2V61A 2V5ZA 4Y4MA 2V60A 1DODA 1H84A 1KDGA 4JDRA 4AT2A 1PS9A 4U8KA 1E6EA 5CKUA 3WE0A 3SQPA 2C7GA 3UOXA 4OPTA 2BC1A 2JAEA 5GRTA 2OA1A 2WP6A 1D4CA 3E1TA 3R9UA 1CL0A 3SFEA 1CJ2A 3DK9A 1JEHA 1LPFA 3OZ2A 2WDQA 3KA7A 3P4SA 3UKKA 3NTAA 1K0LA 1H7WA 2WS3A 3SFDA 2GR2A 1GEUA 4CCRA 4EQRA 4OPGA 1ZDLA 4JNQA 2B9XA 4B68A 2WHDA 1GESA 1KFYA 4J56A 4U2SA 2JB2A 5HXIA 3CPIG 3LB8A 2GR1A 2H88A 2Q0LA 1X31B 5IQ4A 4NEWA 4Y4NA 2WU2A 4LIIA 1GNDA 4K5RA 4B1BA 4I59A 1KSUA 4BJZA 4A99A 3AEBA 4IVOB 4U8LA 4K5SA 4OPLA 4U2TA 4TLXA 2PHHA 4Z44A 5FS9A 3GMBA 1P2HA 1Q9IA 4IV9A 3QSSA 4YSHA 3EAOA 1PN0A 2QAEA 3DGZA 3GYIA 3AE7A 3NHOX 4FDCB 2CDUA 5IQ1A 5C2TA 1BF3A 3DJDA 1JU2A 3T37A 5TR3A 3I3LA 2XLPA 3K7TA 4EMWA 4NTDA 4ZN0A 2VVLG 4H2QA 3UKAA 4DSGA 1QO8A 3AYLA 4CY8A 2GEWA 4C3XA 5KVHA 4H7UA 3UP5A 5BUKA 1D7LA 3IHMA 1PJ6A 3S61A 1D4EA 4D04A 4Z25A 3ALJA 3NYEA 1PBDA 2YVJA 4PAAA 4BURA 2XDOA 5C3JA 4YT0A 4WCTA 3VR8A 1IJHA 3GDNA 3AE4A 4B65A 5BULA 2FJEA 2WDVA 4H4PA 3RP6A 4EMIA 1M64A 2YLWA 3AE3A 5KVIA 1DJQA 4FK1A 2YG6A 1F8SA 2CULA 2TMDA 2WETA 3NN6X 4B63A 3UTFA 2BCGG 3ATQA 4TM3A 3VRBA 3FPZA 2GR0A 4M52A 1GT8A 2V6OA 2PYXA 3GRTA 4XXGA 2OALA 2YG3A 2OAMA 2WOWA 3LJPA 2WEUA 3F8DA 5J7XA 3H4KA 1GV4A 3IWAA 3OC4A 1JRYA 2WDRA 3CTYA 1TDOA 3ABVA 1QJDA 2GR3A 1DJNA 4YSYA 1MXTA 2GAHB 4YTPA 1D4DA 2HQMA 3AE8A 1ZP0A 4OPDA 1GETA 3UOVA 3AE6A 1Y0PA 2XFOA 2EQ7A 2GQFA 3UOZA 2Z5XA 1HYUA 2XFPA 2AAQA 3IC9A 4NZHA 1IUUA 3EF6A 1EL5A 2YG7A 2YLXA 1NHQA 3KKJA 3DK8A 1FCDA 3CNPA 1N4VA 5ER0A 2YLRA 1ZY8A 1F8WA 1B8SA 4H4WA 3FMWA 3HZLA 1ZOYA 1XANA 3AD7B 4JNAA 4H50A 3DMEA 1LQUA 1LJ1A 4GRTA 3P4QA 4X9MA 4WX1A 4Z43A 3CNDA 4C5OA 2QA1A 4YSZA 2EQ6A 2X8HA 3NT6A 4RG3A 1L9DA 1N1PA 2WOVA 3FG2P 3M0OA 2X99A 4A5LA 2WBAA 4YWOA 3PO7A 4RSLA 2BK5A 4CY6A 3S5WA 4ADWA 1MOKA 1NHRA 2WPEA 3AECA 4U8MA 3IHGA 1CC2A 2YVGA 4DSHA 2R4JA 1IUSA 1L9CA 3CGEA 3KVEA 3GD4A 3QVRA 1KSSA 1ZOVA 1D5TA 4ICYA 4APNA 1KNPA 4EIPA 3H8LA 1ONFA 3CNJA 4EIQA 1GRFA 3V3NA 4O5QA 4N9XA 2ZBWA 2XYOA 4DGKA 1D7YA 5M0ZA 1GRGA 4CNJA 5M10A 4C74A 3PVCA 2GRTA 5FS7A 1K0JA 3B6DA 2Q7VA 1F3PA 2UZZA 2BS4A 3BNMA 4YKFA 2H89A 1IUWA 2DKIA 2WP9A 2JKCA 1GSNA 2YR6A 4CRTA 2BXSA 2BC0A 1E39A 2YM1A 1VQWA 3ISHA 1TRBA 4NTEA 1BWCA 4CBQA 3B3RA 4JY2A 5J60A 2GAGB 4JY3A 1YQ4A 3ICSA 3K30A 3QFBA 1OJ9A 1YY5A 4FK1C 4PABA 3GYJA 5FMHA 1FOHA 3UKPA 4EM4A 1W4XA 3COXA 2IIDA 1PBEA 5JCLA 3PS9A 2YLSA 3CGCA 3CNSA 1CC6A 1ZX9A 2BYBA 1NEKA 2B76A 2C70A 3UTHA 3C4AA 1TYPA 3ITJA 3P4PA 3NTDA 5GSNA 3NKSA 2WQYA 3D1CA 4UDRA 1ZKQA 2GVCA 3DJEA 4XWZA 4YXDA 2I0ZA 1JRXA 2O9ZA 4Z2RA 2XVHA 1V59A 3NK0X 1EBDA 3NN0X 4Z24A 1Q1RA 2ZZCA 4LA1A 1NAAA 2E1MA 4U8PA 1E1MA 3AYJA 1JNZA 4AOXA 1COYA 4JN9A 5U25A 4OPCA 1NHPA 3BHKA 2B7RA 4GF7A 4GDEA 5JCIA 2B9WA 1PBCA 4YSXA 4Z2UA 2Q0KA 3BHFA 3GDPA 3RP8A 3GD3A 1O94A 1NG3A 3RNMA 1VG9A 3GMCA 1M6IA 1PXBA 2C73A 1YQ3A 1VRQB 3V76A 4CCQA 1F8RA 1K0IA 3L8KA 3V3OA 3QFAA 3D8XA 3VRDB 2JB3A 4A6NA 2Z5YA 4X4JA 5JCKA 4A6NB 1E1NA 2R0GA 1GERA 2C3CA 3EPTA 2C76A 3NYFA 2X3NA 3UKQA 4H2PA 2GB0A 2VQBA 2XFNA 1Y56A 3NG7X 1Y56B 3G5RA 3M13A 4U8NA 1AOGA 1H81A 1E1LA 3DH9A 1PDHA 1DXLA 3RP7A 2X8GA 4J57A 1CBOA 2GMJA 4UP3A 3C4NA 1TDKA 3F8PA 3CN8A 1GXFA 1N4UA 4IA6A 2VOUA 1LVLA 1TDEA 5HY5A 2C66A 4K22A 1NPXA 2EQ8A 2BS3A 2XFQA 4H4YA 4U8JA 5L46A 5HHFA 1GOSA 1P2EA 3DK4A 4OPUA 5KOWA 1H86A 3URHA 2NVKX 2C67A 4K7ZA 1FEBA 2E4GA 2XVEA 3AE2A 4B66A 1TDNA 3GWDA 1JNRA 1FEAA 2GV8A 1RP0A 3NRNA 3SM8A 2BS2A 2YG4A 4J2WA 3LXDA 2WPCA 2BXRA 3AB1A 1JOAA 1Q1WA 4IVMB 2Y6QA 4K8DA 3NK1X 3RHAA 5KXJA 4XWRA 2RGOA 3QVPA 4LU6A 1O5WA 1GREA 2XLUA 4GUVA 3ALLA 2APGA 3LZXA 4A7AA 3CGBA 1EL7A 1GTEA 4A9WA 4E0VA 1CHUA 4ZCCA 2FJDA 2XVFA 4BJYA 4TLZA 1NG4A 2GQWA 2XVIA 5BVAA 3ADAB 3AXBA 4KX6A 1BZLA 3ALMA 2DKHA 1B37A 1YKJA 4YTMA 1EL9A 3AEDA 3KD9A 1NHSA 2WESA 2VRMA 1BKWA 4H4TA 4HA6A 1MO9A 4IA5A 3REDA 1EL8A 2R9ZA 3DGHA 2JBVA 3UTEA 4TM1A 2AQJA 3ATRA 4H4RA 3UTGA 1RYIA 2CFYA 4AP1A 3NH3X 2YWLA 1RSGA 1VG0A 3AYIA 3Q9TA 3VQRA 1IUVA 1GALA 1K4QA 3LZWA 5U1OA 1F6MA 1UKVG 1CJ3A 1YQZA 3NK2X 4J34A 2Y6RA 4J36A 3LADA 2BACA 4U8IA 3BI5A 2OLOA 4ECHA 3NYCA 3ICTA 3ICRA 3NNEA 2ARDA 4H2NA 4AP3A 1BGNA 5CQFA 4TM0A 3SGLA 3GRSA 1GRAA 2YVFA 1IUXA 3Q6JA 1XDIA 3KU9A 5BRTA
chains in the Genus database with same CATH superfamily
2C64A 3BI2A 3BNUA 3II4A 1S3BA 1ZK7A 4Z2TA 1H83A 2JB1A 1TYTA 1PXAA 3CMMA 3M12A 2W0HA 1DOEA 1ZMCA 1S2YA 2GF3A 2VQ7A 3JSKA 1PBFA 1O95A 2EQ9A 4B67A 2GMHA 4C77A 3EANA 4REKA 3T2ZA 1H6VA 3C96A 3AEEA 3O0HA 4H2RA 3DA1A 2XFUA 2AR8A 2YLZA 1H82A 1GTHA 3CPJG 4GCMA 1FL2A 3AWIA 3CGDA 1KF6A 4H4QA 3ZYXA 2RGJA 1LTXR 2XVJA 4X9NA 4Y4LA 2BRYA 1PJ5A 5EOWA 3SY4A 3NGCX 2VRLA 4HB9A 3F8RA 3H8IA 3L1RA 2GH5A 4K2XA 1DOCA 3G5SA 2WU5A 4B69A 2QA2A 3UP4A 2YG5A 4EQXA 4NTCA 2QCUA 3NLCA 1CJCA 1FECA 2XLRA 3AEFA 4ZCDA 4C3YA 2J3NA 4BK3A 4YKGA 2B9YA 4I58A 4GDPA 4KPRA 5LV9A 2R0CA 3AE5A 4YTNA 2E5VA 1NENA 1XPQA 1VDCA 2Q6UA 4NEVA 2XCGA 4UDQA 4O5UA 4AOSA 4BK1A 3UKLA 2VVMA 2TPRA 4CNKA 2A89A 4A79A 3HYVA 4EM3A 3AD9B 2FBWA 1H7XA 3K7QX 1TDFA 1DOBA 2JK6A 5KMPA 2YLTA 1ELIA 2YM2A 1PXCA 4DNAA 1GRHA 4Z26A 1E1KA 2BK4A 4U2LA 4USQA 4J31A 2NPXA 1OJAA 2XLTA 2R4EA 4BK2A 4OVIA 3CNTA 2OLNA 2R0PA 4H4SA 5KRQA 2ZZBA 5EB5A 4A65A 1NDAA 1QLBA 2WPFA 1KNRA 3VR9A 1LQTA 2A8XA 1PBBA 1CJ4A 2A87A 4OPIA 2WP5A 3CPHG 2RGHA 2V3AA 4H4XA 1SEZA 1CC4A 2ZZ0A 5KWFA 2YAUA 2IVDA 3G5QA 5EB4A 1S2QA 3LOVA 5FS6A 3T31A 1S3EA 3P9UA 4OCGA 4EQSA 1N4WA 3FIMB 3P1WA 1GRTA 3GSIA 4MJWA 3VRAA 2CVJA 2BA9A 2BCPA 3GWFA 3I6DA 4RG4A 5EBKA 5FS8A 2C75A 5U63A 4H4VA 2X8CA 2B7SA 2YR4A 2WOIA 1CF3A 2RABA 3IF9A 3KPFA 4J33A 3UCLA 4FX9A 4JQ9A 4UDPA 1JRZA 2V3BA 4TM4A 2VZ2A 3AEGA 2YR5A 3UOYA 4EMJA 3NIXA 2FJBA 3UKFA 1OJDA 3K7MX 4H4ZA 3ZDNA 2BK3A 5HYMA 4D03A 3DJGX 3UKHA 1REOA 3AD8B 3QSEA 4GAPA 1PHHA 1ZMDA 3BI4A 4AT0A 5IPYA 1GPEA 3KLJA 2ACZA 5DBJA 5KMRA 2FJAA 3AE9A 4EQWA 3QSMA 1B5QA 5KOXA 3CIRA 3AE1A 1OJCA 3P4RA 2IVEA 4G74A 4GR1A 3SZWA 5JCNA 4BV6A 2X50A 3AEAA 2BABA 2XLSA 2R46A 2C72A 1E7PA 1PJ7A 1Z6LA 1OJTA 2C3DA 3SZFA 4H4UA 1L9EA 4P9SA 2VVLA 1DNCA 1IUTA 3FBSA 5JCMA 2R45A 1BGJA 2F5ZA 4II2A 4USRA 1LV0A 2YQUA 3QJ4A 3DJJA 1L0VA 2C65A 4B64A 1GRBA 1B4VA 1XHCA 4U8OA 2V61A 2V5ZA 4Y4MA 2V60A 1DODA 1H84A 1KDGA 4JDRA 3T2KA 4AT2A 1PS9A 4U8KA 1E6EA 5CKUA 3WE0A 3SQPA 2C7GA 3UOXA 4OPTA 2BC1A 2JAEA 5GRTA 2OA1A 2WP6A 1D4CA 3E1TA 3R9UA 1CL0A 3SFEA 1CJ2A 3DK9A 1JEHA 1LPFA 3OZ2A 2WDQA 3KA7A 3P4SA 3UKKA 3NTAA 1K0LA 1H7WA 2WS3A 3SX6A 3SFDA 2GR2A 1GEUA 4CCRA 4EQRA 4OPGA 1ZDLA 4JNQA 2B9XA 4B68A 2WHDA 1GESA 1KFYA 4J56A 4U2SA 2JB2A 5HXIA 3CPIG 3LB8A 2GR1A 2H88A 2Q0LA 1X31B 5IQ4A 4NEWA 4Y4NA 2WU2A 4LIIA 1GNDA 4K5RA 4B1BA 4I59A 1KSUA 3T2YA 4BJZA 4A99A 3AEBA 4IVOB 4U8LA 4K5SA 3HYWA 4OPLA 4U2TA 4TLXA 2PHHA 4Z44A 5FS9A 3GMBA 1P2HA 1Q9IA 4IV9A 3QSSA 4YSHA 3EAOA 1PN0A 2QAEA 3DGZA 3GYIA 3AE7A 3NHOX 4FDCB 2CDUA 5IQ1A 5C2TA 1BF3A 3DJDA 1JU2A 3T37A 5TR3A 3I3LA 2XLPA 3K7TA 4EMWA 4NTDA 4ZN0A 2VVLG 4H2QA 3UKAA 4DSGA 1QO8A 3AYLA 4CY8A 2GEWA 4C3XA 5KVHA 4H7UA 3UP5A 5BUKA 1D7LA 3IHMA 1PJ6A 3S61A 1D4EA 3T0KA 4D04A 4Z25A 3ALJA 5KMQA 5KNLA 3NYEA 1PBDA 2YVJA 4PAAA 4BURA 2XDOA 3SYIA 5C3JA 4YT0A 4WCTA 3VR8A 1IJHA 3GDNA 3AE4A 4B65A 5BULA 2FJEA 2WDVA 4H4PA 3RP6A 4EMIA 1M64A 2YLWA 3AE3A 5KVIA 1DJQA 4FK1A 2YG6A 1F8SA 2CULA 2TMDA 2WETA 3NN6X 4B63A 3UTFA 2BCGG 3ATQA 4TM3A 3VRBA 3FPZA 2GR0A 4M52A 1GT8A 2V6OA 2PYXA 3GRTA 4XXGA 2OALA 2YG3A 2OAMA 2WOWA 3LJPA 2WEUA 3F8DA 5J7XA 3H4KA 1GV4A 3IWAA 3OC4A 1JRYA 2WDRA 3CTYA 1TDOA 3ABVA 1QJDA 2GR3A 1DJNA 4YSYA 1MXTA 2GAHB 4YTPA 1D4DA 2HQMA 3AE8A 1ZP0A 4OPDA 1GETA 3UOVA 3AE6A 1Y0PA 2XFOA 2EQ7A 2GQFA 3UOZA 2Z5XA 1HYUA 2XFPA 2AAQA 3IC9A 4NZHA 1IUUA 3EF6A 1EL5A 2YG7A 2YLXA 1NHQA 3KKJA 4NNJA 3DK8A 1FCDA 3CNPA 1N4VA 4NWZA 5ER0A 2YLRA 1ZY8A 1F8WA 1B8SA 4H4WA 3FMWA 3HZLA 1ZOYA 1XANA 3AD7B 4JNAA 4H50A 3DMEA 1LQUA 1LJ1A 4GRTA 3P4QA 4X9MA 4WX1A 4Z43A 3CNDA 3SXIA 4C5OA 2QA1A 4YSZA 2EQ6A 2X8HA 3NT6A 4RG3A 1L9DA 1N1PA 2WOVA 3FG2P 3M0OA 2X99A 4A5LA 2WBAA 4YWOA 3PO7A 4RSLA 2BK5A 4CY6A 3S5WA 4ADWA 1MOKA 1NHRA 2WPEA 4G6GA 3AECA 4U8MA 3IHGA 1CC2A 2YVGA 4DSHA 2R4JA 1IUSA 1L9CA 3CGEA 3KVEA 3GD4A 3QVRA 1KSSA 1ZOVA 1D5TA 4ICYA 4APNA 1KNPA 4EIPA 3H8LA 1ONFA 3CNJA 4EIQA 1GRFA 3V3NA 4O5QA 4N9XA 2ZBWA 2XYOA 4DGKA 1D7YA 5M0ZA 3HYXA 1GRGA 4CNJA 5M10A 4C74A 3PVCA 2GRTA 5FS7A 1K0JA 3B6DA 2Q7VA 1F3PA 2UZZA 2BS4A 3BNMA 4YKFA 2H89A 1IUWA 2DKIA 2WP9A 2JKCA 5KMSA 1GSNA 2YR6A 4CRTA 2BXSA 2BC0A 1E39A 2YM1A 1VQWA 3ISHA 1TRBA 4NTEA 1BWCA 4CBQA 3B3RA 4JY2A 5J60A 2GAGB 4JY3A 1YQ4A 3ICSA 3K30A 3QFBA 1OJ9A 1YY5A 4FK1C 4II3A 3GYJA 4PABA 1FOHA 5FMHA 3UKPA 4EM4A 1W4XA 3COXA 2IIDA 3SZ0A 1PBEA 5JCLA 3PS9A 2YLSA 3CGCA 3CNSA 1CC6A 1ZX9A 2BYBA 1NEKA 2B76A 2C70A 3UTHA 3C4AA 1TYPA 3ITJA 3P4PA 3NTDA 5GSNA 3NKSA 2WQYA 3D1CA 4UDRA 1ZKQA 2GVCA 3DJEA 4XWZA 4YXDA 2I0ZA 1JRXA 2O9ZA 4Z2RA 2XVHA 1V59A 3NK0X 1EBDA 3NN0X 4Z24A 1Q1RA 2ZZCA 4LA1A 1NAAA 2E1MA 4U8PA 1E1MA 3AYJA 1JNZA 4AOXA 1COYA 4JN9A 5U25A 4OPCA 1NHPA 3BHKA 2B7RA 4GF7A 4GDEA 5JCIA 2B9WA 1PBCA 4YSXA 4Z2UA 2Q0KA 3BHFA 3GDPA 3RP8A 3GD3A 1O94A 1NG3A 3RNMA 1VG9A 3GMCA 1M6IA 1PXBA 2C73A 1YQ3A 1VRQB 3V76A 4CCQA 1F8RA 1K0IA 3L8KA 3V3OA 3QFAA 3D8XA 3VRDB 2JB3A 4A6NA 2Z5YA 4X4JA 5JCKA 4A6NB 1E1NA 2R0GA 1GERA 2C3CA 3EPTA 2C76A 3NYFA 2X3NA 3UKQA 4H2PA 2GB0A 2VQBA 2XFNA 1Y56A 4G9KA 3NG7X 1Y56B 3G5RA 3M13A 4U8NA 1AOGA 1H81A 1E1LA 3DH9A 1PDHA 1DXLA 3RP7A 2X8GA 4J57A 1CBOA 2GMJA 4UP3A 3C4NA 1TDKA 3F8PA 3CN8A 1GXFA 1N4UA 4IA6A 2VOUA 1LVLA 1TDEA 5HY5A 2C66A 4K22A 1NPXA 3KPKA 2EQ8A 2BS3A 2XFQA 4H4YA 4U8JA 5L46A 5HHFA 1GOSA 1P2EA 3DK4A 4OPUA 5KOWA 1H86A 3URHA 2NVKX 2C67A 4K7ZA 1FEBA 2E4GA 2XVEA 3AE2A 4B66A 3T14A 1TDNA 3GWDA 1JNRA 1FEAA 2GV8A 1RP0A 3NRNA 3SM8A 2BS2A 2YG4A 4J2WA 3LXDA 2WPCA 2BXRA 3AB1A 4GAVA 1JOAA 1Q1WA 4IVMB 2Y6QA 4K8DA 3NK1X 3RHAA 5KXJA 4XWRA 2RGOA 3QVPA 4LU6A 1O5WA 1GREA 2XLUA 4GUVA 3ALLA 2APGA 3LZXA 4A7AA 3CGBA 1EL7A 1GTEA 4A9WA 3SZCA 1CHUA 4E0VA 4ZCCA 2FJDA 2XVFA 4BJYA 4TLZA 1NG4A 2GQWA 2XVIA 3GYXA 4G73A 5BVAA 3ADAB 3AXBA 4KX6A 1BZLA 3ALMA 2BRAA 2DKHA 1B37A 1YKJA 4YTMA 1EL9A 3AEDA 3KD9A 1NHSA 2WESA 2VRMA 1BKWA 4H4TA 4HA6A 1MO9A 4IA5A 3REDA 4G6HA 1EL8A 2R9ZA 3DGHA 2JBVA 3UTEA 4TM1A 2AQJA 3ATRA 4H4RA 3UTGA 1RYIA 2CFYA 4AP1A 3NH3X 2YWLA 1RSGA 1VG0A 3AYIA 3Q9TA 3VQRA 2C4CA 1IUVA 1GALA 1K4QA 3LZWA 5U1OA 1F6MA 1UKVG 1CJ3A 1YQZA 3NK2X 4J34A 2Y6RA 4J36A 3LADA 2BACA 4U8IA 3BI5A 2OLOA 4ECHA 3NYCA 3ICTA 3ICRA 3NNEA 2ARDA 4H2NA 4AP3A 1BGNA 5CQFA 4TM0A 3SGLA 3GRSA 1GRAA 2YVFA 1IUXA 3Q6JA 1XDIA 3KU9A 5BRTA
chains in the Genus database with same CATH topology
2C64A 3BI2A 3BNUA 3II4A 1S3BA 1ZK7A 4Z2TA 1H83A 2JB1A 1TYTA 1PXAA 3CMMA 3M12A 2W0HA 1DOEA 1ZMCA 1S2YA 2GF3A 2VQ7A 3JSKA 1PBFA 1O95A 2EQ9A 4B67A 2GMHA 4C77A 3EANA 4REKA 3T2ZA 1H6VA 3C96A 3AEEA 3O0HA 4H2RA 3DA1A 2XFUA 2AR8A 2YLZA 1H82A 1GTHA 3CPJG 4GCMA 1FL2A 3AWIA 3CGDA 1KF6A 4H4QA 3ZYXA 2RGJA 1LTXR 2XVJA 4X9NA 4Y4LA 2BRYA 1PJ5A 5EOWA 3SY4A 3NGCX 2VRLA 4HB9A 3F8RA 3H8IA 3L1RA 2GH5A 4K2XA 1DOCA 3G5SA 2WU5A 4B69A 2QA2A 3UP4A 2YG5A 4EQXA 4NTCA 2QCUA 3NLCA 1CJCA 1FECA 2XLRA 3AEFA 4ZCDA 4C3YA 2J3NA 4BK3A 4YKGA 2B9YA 4I58A 4GDPA 4KPRA 5LV9A 2R0CA 3AE5A 4YTNA 2E5VA 1NENA 1XPQA 1VDCA 2Q6UA 4NEVA 2XCGA 4UDQA 4O5UA 4AOSA 4BK1A 3UKLA 2VVMA 2TPRA 4CNKA 2A89A 4A79A 3HYVA 4EM3A 3AD9B 2FBWA 1H7XA 3K7QX 1TDFA 1DOBA 2JK6A 5KMPA 2YLTA 1ELIA 2YM2A 1PXCA 4DNAA 1GRHA 4Z26A 1E1KA 2BK4A 4U2LA 4USQA 4J31A 2NPXA 1OJAA 2XLTA 2R4EA 4BK2A 4OVIA 3CNTA 2OLNA 2R0PA 4H4SA 5KRQA 2ZZBA 5EB5A 4A65A 1NDAA 1QLBA 2WPFA 1KNRA 3VR9A 1LQTA 2A8XA 1PBBA 1CJ4A 2A87A 4OPIA 2WP5A 3CPHG 2RGHA 2V3AA 4H4XA 1SEZA 1CC4A 2ZZ0A 5KWFA 2YAUA 2IVDA 3G5QA 5EB4A 1S2QA 3LOVA 5FS6A 3T31A 1S3EA 3P9UA 4OCGA 4EQSA 1N4WA 3FIMB 3P1WA 1GRTA 3GSIA 4MJWA 3VRAA 2CVJA 2BA9A 2BCPA 3GWFA 3I6DA 4RG4A 5EBKA 5FS8A 2C75A 5U63A 4H4VA 2X8CA 2B7SA 2YR4A 2WOIA 1CF3A 2RABA 3IF9A 3KPFA 4J33A 3UCLA 4FX9A 4JQ9A 4UDPA 1JRZA 2V3BA 4TM4A 2VZ2A 3AEGA 2YR5A 3UOYA 4EMJA 3NIXA 2FJBA 3UKFA 1OJDA 3K7MX 4H4ZA 3ZDNA 2BK3A 5HYMA 4D03A 3DJGX 3UKHA 1REOA 3AD8B 3QSEA 4GAPA 1PHHA 1ZMDA 3BI4A 4AT0A 5IPYA 1GPEA 3KLJA 2ACZA 5DBJA 5KMRA 2FJAA 3AE9A 4EQWA 3QSMA 1B5QA 5KOXA 3CIRA 3AE1A 1OJCA 3P4RA 2IVEA 4G74A 4GR1A 3SZWA 5JCNA 4BV6A 2X50A 3AEAA 2BABA 2XLSA 2R46A 2C72A 1E7PA 1PJ7A 1Z6LA 1OJTA 2C3DA 3SZFA 4H4UA 1L9EA 4P9SA 2VVLA 1DNCA 1IUTA 3FBSA 5JCMA 2R45A 1BGJA 2F5ZA 4II2A 4USRA 1LV0A 2YQUA 3QJ4A 3DJJA 1L0VA 2C65A 4B64A 1GRBA 1B4VA 1XHCA 4U8OA 2V61A 2V5ZA 4Y4MA 2V60A 1DODA 1H84A 1KDGA 4JDRA 3T2KA 4AT2A 1PS9A 4U8KA 1E6EA 5CKUA 3WE0A 3SQPA 2C7GA 3UOXA 4OPTA 2BC1A 2JAEA 5GRTA 2OA1A 2WP6A 1D4CA 3E1TA 3R9UA 1CL0A 3SFEA 1CJ2A 3DK9A 1JEHA 1LPFA 3OZ2A 2WDQA 3KA7A 3P4SA 3UKKA 3NTAA 1K0LA 1H7WA 2WS3A 3SX6A 3SFDA 2GR2A 1GEUA 4CCRA 4EQRA 4OPGA 1ZDLA 4JNQA 2B9XA 4B68A 2WHDA 1GESA 1KFYA 4J56A 4U2SA 2JB2A 5HXIA 3CPIG 3LB8A 2GR1A 2H88A 2Q0LA 1X31B 5IQ4A 4NEWA 4Y4NA 2WU2A 4LIIA 1GNDA 4K5RA 4B1BA 4I59A 1KSUA 3T2YA 4BJZA 4A99A 3AEBA 4IVOB 4U8LA 4K5SA 3HYWA 4OPLA 4U2TA 4TLXA 2PHHA 4Z44A 5FS9A 3GMBA 1P2HA 1Q9IA 4IV9A 3QSSA 4YSHA 3EAOA 1PN0A 2QAEA 3DGZA 3GYIA 3AE7A 3NHOX 4FDCB 2CDUA 5IQ1A 5C2TA 1BF3A 3DJDA 1JU2A 3T37A 5TR3A 3I3LA 2XLPA 3K7TA 4EMWA 4NTDA 4ZN0A 2VVLG 4H2QA 3UKAA 4DSGA 1QO8A 3AYLA 4CY8A 2GEWA 4C3XA 5KVHA 4H7UA 3UP5A 5BUKA 1D7LA 3IHMA 1PJ6A 3S61A 1D4EA 3T0KA 4D04A 4Z25A 3ALJA 5KMQA 5KNLA 3NYEA 1PBDA 2YVJA 4PAAA 4BURA 2XDOA 3SYIA 5C3JA 4YT0A 4WCTA 3VR8A 1IJHA 3GDNA 3AE4A 4B65A 5BULA 2FJEA 2WDVA 4H4PA 3RP6A 4EMIA 1M64A 2YLWA 3AE3A 5KVIA 1DJQA 4FK1A 2YG6A 1F8SA 2CULA 2TMDA 2WETA 3NN6X 4B63A 3UTFA 2BCGG 3ATQA 4TM3A 3VRBA 3FPZA 2GR0A 4M52A 1GT8A 2V6OA 2PYXA 3GRTA 4XXGA 2OALA 2YG3A 2OAMA 2WOWA 3LJPA 2WEUA 3F8DA 5J7XA 3H4KA 1GV4A 3IWAA 3OC4A 1JRYA 2WDRA 3CTYA 1TDOA 3ABVA 1QJDA 2GR3A 1DJNA 4YSYA 1MXTA 2GAHB 4YTPA 1D4DA 2HQMA 3AE8A 1ZP0A 4OPDA 1GETA 3UOVA 3AE6A 1Y0PA 2XFOA 2EQ7A 2GQFA 3UOZA 2Z5XA 1HYUA 2XFPA 2AAQA 3IC9A 4NZHA 1IUUA 3EF6A 1EL5A 2YG7A 2YLXA 1NHQA 3KKJA 4NNJA 3DK8A 1FCDA 3CNPA 1N4VA 4NWZA 5ER0A 2YLRA 1ZY8A 1F8WA 1B8SA 4H4WA 3FMWA 3HZLA 1ZOYA 1XANA 3AD7B 4JNAA 4H50A 3DMEA 1LQUA 1LJ1A 4GRTA 3P4QA 4X9MA 4WX1A 4Z43A 3CNDA 3SXIA 4C5OA 2QA1A 4YSZA 2EQ6A 2X8HA 3NT6A 4RG3A 1L9DA 1N1PA 2WOVA 3FG2P 3M0OA 2X99A 4A5LA 2WBAA 4YWOA 3PO7A 4RSLA 2BK5A 4CY6A 3S5WA 4ADWA 1MOKA 1NHRA 2WPEA 4G6GA 3AECA 4U8MA 3IHGA 1CC2A 2YVGA 4DSHA 2R4JA 1IUSA 1L9CA 3CGEA 3KVEA 3GD4A 3QVRA 1KSSA 1ZOVA 1D5TA 4ICYA 4APNA 1KNPA 4EIPA 3H8LA 1ONFA 3CNJA 4EIQA 1GRFA 3V3NA 4O5QA 4N9XA 2ZBWA 2XYOA 4DGKA 1D7YA 5M0ZA 3HYXA 1GRGA 4CNJA 5M10A 4C74A 3PVCA 2GRTA 5FS7A 1K0JA 3B6DA 2Q7VA 1F3PA 2UZZA 2BS4A 3BNMA 4YKFA 2H89A 1IUWA 2DKIA 2WP9A 2JKCA 5KMSA 1GSNA 2YR6A 4CRTA 2BXSA 2BC0A 1E39A 2YM1A 1VQWA 3ISHA 1TRBA 4NTEA 1BWCA 4CBQA 3B3RA 4JY2A 5J60A 2GAGB 4JY3A 1YQ4A 3ICSA 3K30A 3QFBA 1OJ9A 1YY5A 4FK1C 4II3A 3GYJA 4PABA 1FOHA 5FMHA 3UKPA 4EM4A 1W4XA 3COXA 2IIDA 3SZ0A 1PBEA 5JCLA 3PS9A 2YLSA 3CGCA 3CNSA 1CC6A 1ZX9A 2BYBA 1NEKA 2B76A 2C70A 3UTHA 3C4AA 1TYPA 3ITJA 3P4PA 3NTDA 5GSNA 3NKSA 2WQYA 3D1CA 4UDRA 1ZKQA 2GVCA 3DJEA 4XWZA 4YXDA 2I0ZA 1JRXA 2O9ZA 4Z2RA 2XVHA 1V59A 3NK0X 1EBDA 3NN0X 4Z24A 1Q1RA 2ZZCA 4LA1A 1NAAA 2E1MA 4U8PA 1E1MA 3AYJA 1JNZA 4AOXA 1COYA 4JN9A 5U25A 4OPCA 1NHPA 3BHKA 2B7RA 4GF7A 4GDEA 5JCIA 2B9WA 1PBCA 4YSXA 4Z2UA 2Q0KA 3BHFA 3GDPA 3RP8A 3GD3A 1O94A 1NG3A 3RNMA 1VG9A 3GMCA 1M6IA 1PXBA 2C73A 1YQ3A 1VRQB 3V76A 4CCQA 1F8RA 1K0IA 3L8KA 3V3OA 3QFAA 3D8XA 3VRDB 2JB3A 4A6NA 2Z5YA 4X4JA 5JCKA 4A6NB 1E1NA 2R0GA 1GERA 2C3CA 3EPTA 2C76A 3NYFA 2X3NA 3UKQA 4H2PA 2GB0A 2VQBA 2XFNA 1Y56A 4G9KA 3NG7X 1Y56B 3G5RA 3M13A 4U8NA 1AOGA 1H81A 1E1LA 3DH9A 1PDHA 1DXLA 3RP7A 2X8GA 4J57A 1CBOA 2GMJA 4UP3A 3C4NA 1TDKA 3F8PA 3CN8A 1GXFA 1N4UA 4IA6A 2VOUA 1LVLA 1TDEA 5HY5A 2C66A 4K22A 1NPXA 3KPKA 2EQ8A 2BS3A 2XFQA 4H4YA 4U8JA 5L46A 5HHFA 1GOSA 1P2EA 3DK4A 4OPUA 5KOWA 1H86A 3URHA 2NVKX 2C67A 4K7ZA 1FEBA 2E4GA 2XVEA 3AE2A 4B66A 3T14A 1TDNA 3GWDA 1JNRA 1FEAA 2GV8A 1RP0A 3NRNA 3SM8A 2BS2A 2YG4A 4J2WA 3LXDA 2WPCA 2BXRA 3AB1A 4GAVA 1JOAA 1Q1WA 4IVMB 2Y6QA 4K8DA 3NK1X 3RHAA 5KXJA 4XWRA 2RGOA 3QVPA 4LU6A 1O5WA 1GREA 2XLUA 4GUVA 3ALLA 2APGA 3LZXA 4A7AA 3CGBA 1EL7A 1GTEA 4A9WA 3SZCA 1CHUA 4E0VA 4ZCCA 2FJDA 2XVFA 4BJYA 4TLZA 1NG4A 2GQWA 2XVIA 3GYXA 4G73A 5BVAA 3ADAB 3AXBA 4KX6A 1BZLA 3ALMA 2BRAA 2DKHA 1B37A 1YKJA 4YTMA 1EL9A 3AEDA 3KD9A 1NHSA 2WESA 2VRMA 1BKWA 4H4TA 4HA6A 1MO9A 4IA5A 3REDA 4G6HA 1EL8A 2R9ZA 3DGHA 2JBVA 3UTEA 4TM1A 2AQJA 3ATRA 4H4RA 3UTGA 1RYIA 2CFYA 4AP1A 3NH3X 2YWLA 1RSGA 1VG0A 3AYIA 3Q9TA 3VQRA 2C4CA 1IUVA 1GALA 1K4QA 3LZWA 5U1OA 1F6MA 1UKVG 1CJ3A 1YQZA 3NK2X 4J34A 2Y6RA 4J36A 3LADA 2BACA 4U8IA 3BI5A 2OLOA 4ECHA 3NYCA 3ICTA 3ICRA 3NNEA 2ARDA 4H2NA 4AP3A 1BGNA 5CQFA 4TM0A 3SGLA 3GRSA 1GRAA 2YVFA 1IUXA 3Q6JA 1XDIA 3KU9A 5BRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C64 A;  3BI2 A;  3BNU A;  3II4 A;  1S3B A;  1ZK7 A;  4Z2T A;  1H83 A;  2JB1 A;  1TYT A;  1PXA A;  3M12 A;  2W0H A;  1DOE A;  1ZMC A;  1S2Y A;  2GF3 A;  2VQ7 A;  3JSK A;  1PBF A;  1O95 A;  2EQ9 A;  4B67 A;  2GMH A;  4C77 A;  3EAN A;  4REK A;  1H6V A;  3C96 A;  3AEE A;  3O0H A;  4H2R A;  3DA1 A;  2XFU A;  2AR8 A;  2YLZ A;  1H82 A;  1GTH A;  3CPJ G;  4GCM A;  1FL2 A;  3AWI A;  3CGD A;  1KF6 A;  4H4Q A;  3ZYX A;  2RGJ A;  1LTX R;  2XVJ A;  4X9N A;  4Y4L A;  1PJ5 A;  5EOW A;  3NGC X;  2VRL A;  4HB9 A;  3F8R A;  3H8I A;  3L1R A;  2GH5 A;  4K2X A;  1DOC A;  3G5S A;  2WU5 A;  4B69 A;  2QA2 A;  3UP4 A;  2YG5 A;  4EQX A;  4NTC A;  2QCU A;  3NLC A;  1CJC A;  1FEC A;  2XLR A;  3AEF A;  4ZCD A;  4C3Y A;  2J3N A;  4BK3 A;  4YKG A;  2B9Y A;  4I58 A;  4GDP A;  4KPR A;  5LV9 A;  2R0C A;  3AE5 A;  4YTN A;  2E5V A;  1NEN A;  1XPQ A;  1VDC A;  2Q6U A;  4NEV A;  2XCG A;  4UDQ A;  4O5U A;  4AOS A;  4BK1 A;  3UKL A;  2VVM A;  2TPR A;  4CNK A;  2A89 A;  4A79 A;  4EM3 A;  3AD9 B;  2FBW A;  1H7X A;  3K7Q X;  1TDF A;  1DOB A;  2JK6 A;  2YLT A;  1ELI A;  2YM2 A;  1PXC A;  4DNA A;  1GRH A;  4Z26 A;  1E1K A;  2BK4 A;  4U2L A;  4USQ A;  4J31 A;  2NPX A;  1OJA A;  2XLT A;  2R4E A;  4BK2 A;  4OVI A;  3CNT A;  2OLN A;  2R0P A;  4H4S A;  5KRQ A;  2ZZB A;  5EB5 A;  4A65 A;  1NDA A;  1QLB A;  2WPF A;  1KNR A;  3VR9 A;  1LQT A;  2A8X A;  1PBB A;  1CJ4 A;  2A87 A;  4OPI A;  2WP5 A;  3CPH G;  2RGH A;  2V3A A;  4H4X A;  1SEZ A;  1CC4 A;  2ZZ0 A;  5KWF A;  2YAU A;  2IVD A;  3G5Q A;  5EB4 A;  1S2Q A;  3LOV A;  5FS6 A;  1S3E A;  3P9U A;  4OCG A;  4EQS A;  1N4W A;  3FIM B;  3P1W A;  1GRT A;  3GSI A;  4MJW A;  3VRA A;  2CVJ A;  2BA9 A;  2BCP A;  3GWF A;  3I6D A;  4RG4 A;  5EBK A;  5FS8 A;  2C75 A;  5U63 A;  4H4V A;  2X8C A;  2B7S A;  2YR4 A;  2WOI A;  1CF3 A;  2RAB A;  3IF9 A;  3KPF A;  4J33 A;  3UCL A;  4FX9 A;  4JQ9 A;  4UDP A;  1JRZ A;  2V3B A;  4TM4 A;  2VZ2 A;  3AEG A;  2YR5 A;  3UOY A;  4EMJ A;  3NIX A;  2FJB A;  3UKF A;  1OJD A;  3K7M X;  4H4Z A;  3ZDN A;  2BK3 A;  5HYM A;  4D03 A;  3DJG X;  3UKH A;  1REO A;  3AD8 B;  3QSE A;  1PHH A;  1ZMD A;  3BI4 A;  4AT0 A;  5IPY A;  1GPE A;  3KLJ A;  2ACZ A;  5DBJ A;  2FJA A;  3AE9 A;  4EQW A;  3QSM A;  1B5Q A;  5KOX A;  3CIR A;  3AE1 A;  1OJC A;  3P4R A;  2IVE A;  4GR1 A;  5JCN A;  4BV6 A;  2X50 A;  3AEA A;  2BAB A;  2XLS A;  2R46 A;  2C72 A;  1E7P A;  1PJ7 A;  1Z6L A;  1OJT A;  2C3D A;  4H4U A;  1L9E A;  4P9S A;  2VVL A;  1DNC A;  1IUT A;  3FBS A;  5JCM A;  2R45 A;  1BGJ A;  2F5Z A;  4USR A;  1LV0 A;  2YQU A;  3QJ4 A;  3DJJ A;  1L0V A;  2C65 A;  4B64 A;  1GRB A;  1B4V A;  1XHC A;  4U8O A;  2V61 A;  2V5Z A;  4Y4M A;  2V60 A;  1DOD A;  1H84 A;  1KDG A;  4JDR A;  4AT2 A;  1PS9 A;  4U8K A;  1E6E A;  5CKU A;  3WE0 A;  3SQP A;  2C7G A;  3UOX A;  4OPT A;  2BC1 A;  2JAE A;  5GRT A;  2OA1 A;  2WP6 A;  1D4C A;  3E1T A;  3R9U A;  1CL0 A;  3SFE A;  1CJ2 A;  3DK9 A;  1JEH A;  1LPF A;  3OZ2 A;  2WDQ A;  3KA7 A;  3P4S A;  3UKK A;  3NTA A;  1K0L A;  1H7W A;  2WS3 A;  3SFD A;  2GR2 A;  1GEU A;  4CCR A;  4EQR A;  4OPG A;  1ZDL A;  4JNQ A;  2B9X A;  4B68 A;  2WHD A;  1GES A;  1KFY A;  4J56 A;  4U2S A;  2JB2 A;  5HXI A;  3CPI G;  3LB8 A;  2GR1 A;  2H88 A;  2Q0L A;  1X31 B;  5IQ4 A;  4NEW A;  4Y4N A;  2WU2 A;  4LII A;  1GND A;  4K5R A;  4B1B A;  4I59 A;  1KSU A;  4BJZ A;  4A99 A;  3AEB A;  4IVO B;  4U8L A;  4K5S A;  4OPL A;  4U2T A;  4TLX A;  2PHH A;  4Z44 A;  5FS9 A;  3GMB A;  1P2H A;  1Q9I A;  4IV9 A;  3QSS A;  4YSH A;  3EAO A;  1PN0 A;  2QAE A;  3DGZ A;  3GYI A;  3AE7 A;  3NHO X;  4FDC B;  2CDU A;  5IQ1 A;  5C2T A;  1BF3 A;  3DJD A;  1JU2 A;  3T37 A;  5TR3 A;  3I3L A;  2XLP A;  3K7T A;  4EMW A;  4NTD A;  4ZN0 A;  2VVL G;  4H2Q A;  3UKA A;  4DSG A;  1QO8 A;  3AYL A;  4CY8 A;  2GEW A;  4C3X A;  5KVH A;  4H7U A;  3UP5 A;  5BUK A;  1D7L A;  3IHM A;  1PJ6 A;  3S61 A;  1D4E A;  4D04 A;  4Z25 A;  3ALJ A;  3NYE A;  1PBD A;  2YVJ A;  4PAA A;  4BUR A;  2XDO A;  5C3J A;  4YT0 A;  4WCT A;  3VR8 A;  1IJH A;  3GDN A;  3AE4 A;  4B65 A;  5BUL A;  2FJE A;  2WDV A;  4H4P A;  3RP6 A;  4EMI A;  1M64 A;  2YLW A;  3AE3 A;  5KVI A;  1DJQ A;  4FK1 A;  2YG6 A;  1F8S A;  2CUL A;  2TMD A;  2WET A;  3NN6 X;  4B63 A;  3UTF A;  2BCG G;  3ATQ A;  4TM3 A;  3VRB A;  3FPZ A;  2GR0 A;  4M52 A;  1GT8 A;  2V6O A;  2PYX A;  3GRT A;  4XXG A;  2OAL A;  2YG3 A;  2OAM A;  2WOW A;  3LJP A;  2WEU A;  3F8D A;  5J7X A;  3H4K A;  1GV4 A;  3IWA A;  3OC4 A;  1JRY A;  2WDR A;  3CTY A;  1TDO A;  3ABV A;  1QJD A;  2GR3 A;  1DJN A;  4YSY A;  1MXT A;  2GAH B;  4YTP A;  1D4D A;  2HQM A;  3AE8 A;  1ZP0 A;  4OPD A;  1GET A;  3UOV A;  3AE6 A;  1Y0P A;  2XFO A;  2EQ7 A;  2GQF A;  3UOZ A;  2Z5X A;  1HYU A;  2XFP A;  2AAQ A;  3IC9 A;  4NZH A;  1IUU A;  3EF6 A;  1EL5 A;  2YG7 A;  2YLX A;  1NHQ A;  3KKJ A;  3DK8 A;  1FCD A;  3CNP A;  1N4V A;  5ER0 A;  2YLR A;  1ZY8 A;  1F8W A;  1B8S A;  4H4W A;  3FMW A;  3HZL A;  1ZOY A;  1XAN A;  3AD7 B;  4JNA A;  4H50 A;  3DME A;  1LQU A;  1LJ1 A;  4GRT A;  3P4Q A;  4X9M A;  4WX1 A;  4Z43 A;  3CND A;  4C5O A;  2QA1 A;  4YSZ A;  2EQ6 A;  2X8H A;  3NT6 A;  4RG3 A;  1L9D A;  1N1P A;  2WOV A;  3FG2 P;  3M0O A;  2X99 A;  4A5L A;  2WBA A;  4YWO A;  3PO7 A;  4RSL A;  2BK5 A;  4CY6 A;  3S5W A;  4ADW A;  1MOK A;  1NHR A;  2WPE A;  3AEC A;  4U8M A;  3IHG A;  1CC2 A;  2YVG A;  4DSH A;  2R4J A;  1IUS A;  1L9C A;  3CGE A;  3KVE A;  3GD4 A;  3QVR A;  1KSS A;  1ZOV A;  1D5T A;  4ICY A;  4APN A;  1KNP A;  4EIP A;  3H8L A;  1ONF A;  3CNJ A;  4EIQ A;  1GRF A;  3V3N A;  4O5Q A;  4N9X A;  2ZBW A;  2XYO A;  4DGK A;  1D7Y A;  5M0Z A;  1GRG A;  4CNJ A;  5M10 A;  4C74 A;  3PVC A;  2GRT A;  5FS7 A;  1K0J A;  3B6D A;  2Q7V A;  1F3P A;  2UZZ A;  2BS4 A;  3BNM A;  4YKF A;  2H89 A;  1IUW A;  2DKI A;  2WP9 A;  2JKC A;  1GSN A;  2YR6 A;  4CRT A;  2BXS A;  2BC0 A;  1E39 A;  2YM1 A;  1VQW A;  3ISH A;  1TRB A;  4NTE A;  1BWC A;  4CBQ A;  3B3R A;  4JY2 A;  5J60 A;  2GAG B;  4JY3 A;  1YQ4 A;  3ICS A;  3K30 A;  3QFB A;  1OJ9 A;  1YY5 A;  4FK1 C;  4PAB A;  3GYJ A;  5FMH A;  1FOH A;  3UKP A;  4EM4 A;  1W4X A;  3COX A;  2IID A;  1PBE A;  5JCL A;  3PS9 A;  2YLS A;  3CGC A;  3CNS A;  1CC6 A;  1ZX9 A;  2BYB A;  1NEK A;  2B76 A;  2C70 A;  3UTH A;  3C4A A;  1TYP A;  3ITJ A;  3P4P A;  3NTD A;  5GSN A;  3NKS A;  2WQY A;  3D1C A;  4UDR A;  1ZKQ A;  2GVC A;  3DJE A;  4XWZ A;  4YXD A;  2I0Z A;  1JRX A;  2O9Z A;  4Z2R A;  2XVH A;  1V59 A;  3NK0 X;  1EBD A;  3NN0 X;  4Z24 A;  1Q1R A;  2ZZC A;  4LA1 A;  1NAA A;  2E1M A;  4U8P A;  1E1M A;  3AYJ A;  1JNZ A;  4AOX A;  1COY A;  4JN9 A;  5U25 A;  4OPC A;  1NHP A;  3BHK A;  2B7R A;  4GF7 A;  4GDE A;  5JCI A;  2B9W A;  1PBC A;  4YSX A;  4Z2U A;  2Q0K A;  3BHF A;  3GDP A;  3RP8 A;  3GD3 A;  1O94 A;  1NG3 A;  3RNM A;  1VG9 A;  3GMC A;  1M6I A;  1PXB A;  2C73 A;  1YQ3 A;  1VRQ B;  3V76 A;  4CCQ A;  1F8R A;  1K0I A;  3L8K A;  3V3O A;  3QFA A;  3D8X A;  3VRD B;  2JB3 A;  4A6N A;  2Z5Y A;  4X4J A;  5JCK A;  4A6N B;  1E1N A;  2R0G A;  1GER A;  2C3C A;  3EPT A;  2C76 A;  3NYF A;  2X3N A;  3UKQ A;  4H2P A;  2GB0 A;  2VQB A;  2XFN A;  1Y56 A;  3NG7 X;  1Y56 B;  3G5R A;  3M13 A;  4U8N A;  1AOG A;  1H81 A;  1E1L A;  3DH9 A;  1PDH A;  1DXL A;  3RP7 A;  2X8G A;  4J57 A;  1CBO A;  2GMJ A;  4UP3 A;  3C4N A;  1TDK A;  3F8P A;  3CN8 A;  1GXF A;  1N4U A;  4IA6 A;  2VOU A;  1LVL A;  1TDE A;  5HY5 A;  2C66 A;  4K22 A;  1NPX A;  2EQ8 A;  2BS3 A;  2XFQ A;  4H4Y A;  4U8J A;  5L46 A;  5HHF A;  1GOS A;  1P2E A;  3DK4 A;  4OPU A;  5KOW A;  1H86 A;  3URH A;  2NVK X;  2C67 A;  4K7Z A;  1FEB A;  2E4G A;  2XVE A;  3AE2 A;  4B66 A;  1TDN A;  3GWD A;  1JNR A;  1FEA A;  2GV8 A;  1RP0 A;  3NRN A;  3SM8 A;  2BS2 A;  2YG4 A;  4J2W A;  3LXD A;  2WPC A;  2BXR A;  3AB1 A;  1JOA A;  1Q1W A;  4IVM B;  2Y6Q A;  4K8D A;  3NK1 X;  3RHA A;  5KXJ A;  4XWR A;  2RGO A;  3QVP A;  4LU6 A;  1O5W A;  1GRE A;  2XLU A;  4GUV A;  3ALL A;  2APG A;  3LZX A;  4A7A A;  3CGB A;  1EL7 A;  1GTE A;  4A9W A;  4E0V A;  1CHU A;  4ZCC A;  2FJD A;  2XVF A;  4BJY A;  4TLZ A;  1NG4 A;  2GQW A;  2XVI A;  5BVA A;  3ADA B;  3AXB A;  4KX6 A;  1BZL A;  3ALM A;  2DKH A;  1B37 A;  1YKJ A;  4YTM A;  1EL9 A;  3AED A;  3KD9 A;  1NHS A;  2WES A;  2VRM A;  1BKW A;  4H4T A;  4HA6 A;  1MO9 A;  4IA5 A;  3RED A;  1EL8 A;  2R9Z A;  3DGH A;  2JBV A;  3UTE A;  4TM1 A;  2AQJ A;  3ATR A;  4H4R A;  3UTG A;  1RYI A;  2CFY A;  4AP1 A;  3NH3 X;  2YWL A;  1RSG A;  1VG0 A;  3AYI A;  3Q9T A;  3VQR A;  1IUV A;  1GAL A;  1K4Q A;  3LZW A;  5U1O A;  1F6M A;  1UKV G;  1CJ3 A;  1YQZ A;  3NK2 X;  4J34 A;  2Y6R A;  4J36 A;  3LAD A;  2BAC A;  4U8I A;  3BI5 A;  2OLO A;  4ECH A;  3NYC A;  3ICT A;  3ICR A;  3NNE A;  2ARD A;  4H2N A;  4AP3 A;  1BGN A;  5CQF A;  4TM0 A;  3SGL A;  3GRS A;  1GRA A;  2YVF A;  1IUX A;  3Q6J A;  1XDI A;  3KU9 A;  5BRT A; 
#chains in the Genus database with same CATH topology
 2C64 A;  3BI2 A;  3BNU A;  3II4 A;  1S3B A;  1ZK7 A;  4Z2T A;  1H83 A;  2JB1 A;  1TYT A;  1PXA A;  3CMM A;  3M12 A;  2W0H A;  1DOE A;  1ZMC A;  1S2Y A;  2GF3 A;  2VQ7 A;  3JSK A;  1PBF A;  1O95 A;  2EQ9 A;  4B67 A;  2GMH A;  4C77 A;  3EAN A;  4REK A;  3T2Z A;  1H6V A;  3C96 A;  3AEE A;  3O0H A;  4H2R A;  3DA1 A;  2XFU A;  2AR8 A;  2YLZ A;  1H82 A;  1GTH A;  3CPJ G;  4GCM A;  1FL2 A;  3AWI A;  3CGD A;  1KF6 A;  4H4Q A;  3ZYX A;  2RGJ A;  1LTX R;  2XVJ A;  4X9N A;  4Y4L A;  2BRY A;  1PJ5 A;  5EOW A;  3SY4 A;  3NGC X;  2VRL A;  4HB9 A;  3F8R A;  3H8I A;  3L1R A;  2GH5 A;  4K2X A;  1DOC A;  3G5S A;  2WU5 A;  4B69 A;  2QA2 A;  3UP4 A;  2YG5 A;  4EQX A;  4NTC A;  2QCU A;  3NLC A;  1CJC A;  1FEC A;  2XLR A;  3AEF A;  4ZCD A;  4C3Y A;  2J3N A;  4BK3 A;  4YKG A;  2B9Y A;  4I58 A;  4GDP A;  4KPR A;  5LV9 A;  2R0C A;  3AE5 A;  4YTN A;  2E5V A;  1NEN A;  1XPQ A;  1VDC A;  2Q6U A;  4NEV A;  2XCG A;  4UDQ A;  4O5U A;  4AOS A;  4BK1 A;  3UKL A;  2VVM A;  2TPR A;  4CNK A;  2A89 A;  4A79 A;  3HYV A;  4EM3 A;  3AD9 B;  2FBW A;  1H7X A;  3K7Q X;  1TDF A;  1DOB A;  2JK6 A;  5KMP A;  2YLT A;  1ELI A;  2YM2 A;  1PXC A;  4DNA A;  1GRH A;  4Z26 A;  1E1K A;  2BK4 A;  4U2L A;  4USQ A;  4J31 A;  2NPX A;  1OJA A;  2XLT A;  2R4E A;  4BK2 A;  4OVI A;  3CNT A;  2OLN A;  2R0P A;  4H4S A;  5KRQ A;  2ZZB A;  5EB5 A;  4A65 A;  1NDA A;  1QLB A;  2WPF A;  1KNR A;  3VR9 A;  1LQT A;  2A8X A;  1PBB A;  1CJ4 A;  2A87 A;  4OPI A;  2WP5 A;  3CPH G;  2RGH A;  2V3A A;  4H4X A;  1SEZ A;  1CC4 A;  2ZZ0 A;  5KWF A;  2YAU A;  2IVD A;  3G5Q A;  5EB4 A;  1S2Q A;  3LOV A;  5FS6 A;  3T31 A;  1S3E A;  3P9U A;  4OCG A;  4EQS A;  1N4W A;  3FIM B;  3P1W A;  1GRT A;  3GSI A;  4MJW A;  3VRA A;  2CVJ A;  2BA9 A;  2BCP A;  3GWF A;  3I6D A;  4RG4 A;  5EBK A;  5FS8 A;  2C75 A;  5U63 A;  4H4V A;  2X8C A;  2B7S A;  2YR4 A;  2WOI A;  1CF3 A;  2RAB A;  3IF9 A;  3KPF A;  4J33 A;  3UCL A;  4FX9 A;  4JQ9 A;  4UDP A;  1JRZ A;  2V3B A;  4TM4 A;  2VZ2 A;  3AEG A;  2YR5 A;  3UOY A;  4EMJ A;  3NIX A;  2FJB A;  3UKF A;  1OJD A;  3K7M X;  4H4Z A;  3ZDN A;  2BK3 A;  5HYM A;  4D03 A;  3DJG X;  3UKH A;  1REO A;  3AD8 B;  3QSE A;  4GAP A;  1PHH A;  1ZMD A;  3BI4 A;  4AT0 A;  5IPY A;  1GPE A;  3KLJ A;  2ACZ A;  5DBJ A;  5KMR A;  2FJA A;  3AE9 A;  4EQW A;  3QSM A;  1B5Q A;  5KOX A;  3CIR A;  3AE1 A;  1OJC A;  3P4R A;  2IVE A;  4G74 A;  4GR1 A;  3SZW A;  5JCN A;  4BV6 A;  2X50 A;  3AEA A;  2BAB A;  2XLS A;  2R46 A;  2C72 A;  1E7P A;  1PJ7 A;  1Z6L A;  1OJT A;  2C3D A;  3SZF A;  4H4U A;  1L9E A;  4P9S A;  2VVL A;  1DNC A;  1IUT A;  3FBS A;  5JCM A;  2R45 A;  1BGJ A;  2F5Z A;  4II2 A;  4USR A;  1LV0 A;  2YQU A;  3QJ4 A;  3DJJ A;  1L0V A;  2C65 A;  4B64 A;  1GRB A;  1B4V A;  1XHC A;  4U8O A;  2V61 A;  2V5Z A;  4Y4M A;  2V60 A;  1DOD A;  1H84 A;  1KDG A;  4JDR A;  3T2K A;  4AT2 A;  1PS9 A;  4U8K A;  1E6E A;  5CKU A;  3WE0 A;  3SQP A;  2C7G A;  3UOX A;  4OPT A;  2BC1 A;  2JAE A;  5GRT A;  2OA1 A;  2WP6 A;  1D4C A;  3E1T A;  3R9U A;  1CL0 A;  3SFE A;  1CJ2 A;  3DK9 A;  1JEH A;  1LPF A;  3OZ2 A;  2WDQ A;  3KA7 A;  3P4S A;  3UKK A;  3NTA A;  1K0L A;  1H7W A;  2WS3 A;  3SX6 A;  3SFD A;  2GR2 A;  1GEU A;  4CCR A;  4EQR A;  4OPG A;  1ZDL A;  4JNQ A;  2B9X A;  4B68 A;  2WHD A;  1GES A;  1KFY A;  4J56 A;  4U2S A;  2JB2 A;  5HXI A;  3CPI G;  3LB8 A;  2GR1 A;  2H88 A;  2Q0L A;  1X31 B;  5IQ4 A;  4NEW A;  4Y4N A;  2WU2 A;  4LII A;  1GND A;  4K5R A;  4B1B A;  4I59 A;  1KSU A;  3T2Y A;  4BJZ A;  4A99 A;  3AEB A;  4IVO B;  4U8L A;  4K5S A;  3HYW A;  4OPL A;  4U2T A;  4TLX A;  2PHH A;  4Z44 A;  5FS9 A;  3GMB A;  1P2H A;  1Q9I A;  4IV9 A;  3QSS A;  4YSH A;  3EAO A;  1PN0 A;  2QAE A;  3DGZ A;  3GYI A;  3AE7 A;  3NHO X;  4FDC B;  2CDU A;  5IQ1 A;  5C2T A;  1BF3 A;  3DJD A;  1JU2 A;  3T37 A;  5TR3 A;  3I3L A;  2XLP A;  3K7T A;  4EMW A;  4NTD A;  4ZN0 A;  2VVL G;  4H2Q A;  3UKA A;  4DSG A;  1QO8 A;  3AYL A;  4CY8 A;  2GEW A;  4C3X A;  5KVH A;  4H7U A;  3UP5 A;  5BUK A;  1D7L A;  3IHM A;  1PJ6 A;  3S61 A;  1D4E A;  3T0K A;  4D04 A;  4Z25 A;  3ALJ A;  5KMQ A;  5KNL A;  3NYE A;  1PBD A;  2YVJ A;  4PAA A;  4BUR A;  2XDO A;  3SYI A;  5C3J A;  4YT0 A;  4WCT A;  3VR8 A;  1IJH A;  3GDN A;  3AE4 A;  4B65 A;  5BUL A;  2FJE A;  2WDV A;  4H4P A;  3RP6 A;  4EMI A;  1M64 A;  2YLW A;  3AE3 A;  5KVI A;  1DJQ A;  4FK1 A;  2YG6 A;  1F8S A;  2CUL A;  2TMD A;  2WET A;  3NN6 X;  4B63 A;  3UTF A;  2BCG G;  3ATQ A;  4TM3 A;  3VRB A;  3FPZ A;  2GR0 A;  4M52 A;  1GT8 A;  2V6O A;  2PYX A;  3GRT A;  4XXG A;  2OAL A;  2YG3 A;  2OAM A;  2WOW A;  3LJP A;  2WEU A;  3F8D A;  5J7X A;  3H4K A;  1GV4 A;  3IWA A;  3OC4 A;  1JRY A;  2WDR A;  3CTY A;  1TDO A;  3ABV A;  1QJD A;  2GR3 A;  1DJN A;  4YSY A;  1MXT A;  2GAH B;  4YTP A;  1D4D A;  2HQM A;  3AE8 A;  1ZP0 A;  4OPD A;  1GET A;  3UOV A;  3AE6 A;  1Y0P A;  2XFO A;  2EQ7 A;  2GQF A;  3UOZ A;  2Z5X A;  1HYU A;  2XFP A;  2AAQ A;  3IC9 A;  4NZH A;  1IUU A;  3EF6 A;  1EL5 A;  2YG7 A;  2YLX A;  1NHQ A;  3KKJ A;  4NNJ A;  3DK8 A;  1FCD A;  3CNP A;  1N4V A;  4NWZ A;  5ER0 A;  2YLR A;  1ZY8 A;  1F8W A;  1B8S A;  4H4W A;  3FMW A;  3HZL A;  1ZOY A;  1XAN A;  3AD7 B;  4JNA A;  4H50 A;  3DME A;  1LQU A;  1LJ1 A;  4GRT A;  3P4Q A;  4X9M A;  4WX1 A;  4Z43 A;  3CND A;  3SXI A;  4C5O A;  2QA1 A;  4YSZ A;  2EQ6 A;  2X8H A;  3NT6 A;  4RG3 A;  1L9D A;  1N1P A;  2WOV A;  3FG2 P;  3M0O A;  2X99 A;  4A5L A;  2WBA A;  4YWO A;  3PO7 A;  4RSL A;  2BK5 A;  4CY6 A;  3S5W A;  4ADW A;  1MOK A;  1NHR A;  2WPE A;  4G6G A;  3AEC A;  4U8M A;  3IHG A;  1CC2 A;  2YVG A;  4DSH A;  2R4J A;  1IUS A;  1L9C A;  3CGE A;  3KVE A;  3GD4 A;  3QVR A;  1KSS A;  1ZOV A;  1D5T A;  4ICY A;  4APN A;  1KNP A;  4EIP A;  3H8L A;  1ONF A;  3CNJ A;  4EIQ A;  1GRF A;  3V3N A;  4O5Q A;  4N9X A;  2ZBW A;  2XYO A;  4DGK A;  1D7Y A;  5M0Z A;  3HYX A;  1GRG A;  4CNJ A;  5M10 A;  4C74 A;  3PVC A;  2GRT A;  5FS7 A;  1K0J A;  3B6D A;  2Q7V A;  1F3P A;  2UZZ A;  2BS4 A;  3BNM A;  4YKF A;  2H89 A;  1IUW A;  2DKI A;  2WP9 A;  2JKC A;  5KMS A;  1GSN A;  2YR6 A;  4CRT A;  2BXS A;  2BC0 A;  1E39 A;  2YM1 A;  1VQW A;  3ISH A;  1TRB A;  4NTE A;  1BWC A;  4CBQ A;  3B3R A;  4JY2 A;  5J60 A;  2GAG B;  4JY3 A;  1YQ4 A;  3ICS A;  3K30 A;  3QFB A;  1OJ9 A;  1YY5 A;  4FK1 C;  4II3 A;  3GYJ A;  4PAB A;  1FOH A;  5FMH A;  3UKP A;  4EM4 A;  1W4X A;  3COX A;  2IID A;  3SZ0 A;  1PBE A;  5JCL A;  3PS9 A;  2YLS A;  3CGC A;  3CNS A;  1CC6 A;  1ZX9 A;  2BYB A;  1NEK A;  2B76 A;  2C70 A;  3UTH A;  3C4A A;  1TYP A;  3ITJ A;  3P4P A;  3NTD A;  5GSN A;  3NKS A;  2WQY A;  3D1C A;  4UDR A;  1ZKQ A;  2GVC A;  3DJE A;  4XWZ A;  4YXD A;  2I0Z A;  1JRX A;  2O9Z A;  4Z2R A;  2XVH A;  1V59 A;  3NK0 X;  1EBD A;  3NN0 X;  4Z24 A;  1Q1R A;  2ZZC A;  4LA1 A;  1NAA A;  2E1M A;  4U8P A;  1E1M A;  3AYJ A;  1JNZ A;  4AOX A;  1COY A;  4JN9 A;  5U25 A;  4OPC A;  1NHP A;  3BHK A;  2B7R A;  4GF7 A;  4GDE A;  5JCI A;  2B9W A;  1PBC A;  4YSX A;  4Z2U A;  2Q0K A;  3BHF A;  3GDP A;  3RP8 A;  3GD3 A;  1O94 A;  1NG3 A;  3RNM A;  1VG9 A;  3GMC A;  1M6I A;  1PXB A;  2C73 A;  1YQ3 A;  1VRQ B;  3V76 A;  4CCQ A;  1F8R A;  1K0I A;  3L8K A;  3V3O A;  3QFA A;  3D8X A;  3VRD B;  2JB3 A;  4A6N A;  2Z5Y A;  4X4J A;  5JCK A;  4A6N B;  1E1N A;  2R0G A;  1GER A;  2C3C A;  3EPT A;  2C76 A;  3NYF A;  2X3N A;  3UKQ A;  4H2P A;  2GB0 A;  2VQB A;  2XFN A;  1Y56 A;  4G9K A;  3NG7 X;  1Y56 B;  3G5R A;  3M13 A;  4U8N A;  1AOG A;  1H81 A;  1E1L A;  3DH9 A;  1PDH A;  1DXL A;  3RP7 A;  2X8G A;  4J57 A;  1CBO A;  2GMJ A;  4UP3 A;  3C4N A;  1TDK A;  3F8P A;  3CN8 A;  1GXF A;  1N4U A;  4IA6 A;  2VOU A;  1LVL A;  1TDE A;  5HY5 A;  2C66 A;  4K22 A;  1NPX A;  3KPK A;  2EQ8 A;  2BS3 A;  2XFQ A;  4H4Y A;  4U8J A;  5L46 A;  5HHF A;  1GOS A;  1P2E A;  3DK4 A;  4OPU A;  5KOW A;  1H86 A;  3URH A;  2NVK X;  2C67 A;  4K7Z A;  1FEB A;  2E4G A;  2XVE A;  3AE2 A;  4B66 A;  3T14 A;  1TDN A;  3GWD A;  1JNR A;  1FEA A;  2GV8 A;  1RP0 A;  3NRN A;  3SM8 A;  2BS2 A;  2YG4 A;  4J2W A;  3LXD A;  2WPC A;  2BXR A;  3AB1 A;  4GAV A;  1JOA A;  1Q1W A;  4IVM B;  2Y6Q A;  4K8D A;  3NK1 X;  3RHA A;  5KXJ A;  4XWR A;  2RGO A;  3QVP A;  4LU6 A;  1O5W A;  1GRE A;  2XLU A;  4GUV A;  3ALL A;  2APG A;  3LZX A;  4A7A A;  3CGB A;  1EL7 A;  1GTE A;  4A9W A;  3SZC A;  1CHU A;  4E0V A;  4ZCC A;  2FJD A;  2XVF A;  4BJY A;  4TLZ A;  1NG4 A;  2GQW A;  2XVI A;  3GYX A;  4G73 A;  5BVA A;  3ADA B;  3AXB A;  4KX6 A;  1BZL A;  3ALM A;  2BRA A;  2DKH A;  1B37 A;  1YKJ A;  4YTM A;  1EL9 A;  3AED A;  3KD9 A;  1NHS A;  2WES A;  2VRM A;  1BKW A;  4H4T A;  4HA6 A;  1MO9 A;  4IA5 A;  3RED A;  4G6H A;  1EL8 A;  2R9Z A;  3DGH A;  2JBV A;  3UTE A;  4TM1 A;  2AQJ A;  3ATR A;  4H4R A;  3UTG A;  1RYI A;  2CFY A;  4AP1 A;  3NH3 X;  2YWL A;  1RSG A;  1VG0 A;  3AYI A;  3Q9T A;  3VQR A;  2C4C A;  1IUV A;  1GAL A;  1K4Q A;  3LZW A;  5U1O A;  1F6M A;  1UKV G;  1CJ3 A;  1YQZ A;  3NK2 X;  4J34 A;  2Y6R A;  4J36 A;  3LAD A;  2BAC A;  4U8I A;  3BI5 A;  2OLO A;  4ECH A;  3NYC A;  3ICT A;  3ICR A;  3NNE A;  2ARD A;  4H2N A;  4AP3 A;  1BGN A;  5CQF A;  4TM0 A;  3SGL A;  3GRS A;  1GRA A;  2YVF A;  1IUX A;  3Q6J A;  1XDI A;  3KU9 A;  5BRT A; 
#chains in the Genus database with same CATH homology
 2C64 A;  3BI2 A;  3BNU A;  3II4 A;  1S3B A;  1ZK7 A;  4Z2T A;  1H83 A;  2JB1 A;  1TYT A;  1PXA A;  3CMM A;  3M12 A;  2W0H A;  1DOE A;  1ZMC A;  1S2Y A;  2GF3 A;  2VQ7 A;  3JSK A;  1PBF A;  1O95 A;  2EQ9 A;  4B67 A;  2GMH A;  4C77 A;  3EAN A;  4REK A;  3T2Z A;  1H6V A;  3C96 A;  3AEE A;  3O0H A;  4H2R A;  3DA1 A;  2XFU A;  2AR8 A;  2YLZ A;  1H82 A;  1GTH A;  3CPJ G;  4GCM A;  1FL2 A;  3AWI A;  3CGD A;  1KF6 A;  4H4Q A;  3ZYX A;  2RGJ A;  1LTX R;  2XVJ A;  4X9N A;  4Y4L A;  2BRY A;  1PJ5 A;  5EOW A;  3SY4 A;  3NGC X;  2VRL A;  4HB9 A;  3F8R A;  3H8I A;  3L1R A;  2GH5 A;  4K2X A;  1DOC A;  3G5S A;  2WU5 A;  4B69 A;  2QA2 A;  3UP4 A;  2YG5 A;  4EQX A;  4NTC A;  2QCU A;  3NLC A;  1CJC A;  1FEC A;  2XLR A;  3AEF A;  4ZCD A;  4C3Y A;  2J3N A;  4BK3 A;  4YKG A;  2B9Y A;  4I58 A;  4GDP A;  4KPR A;  5LV9 A;  2R0C A;  3AE5 A;  4YTN A;  2E5V A;  1NEN A;  1XPQ A;  1VDC A;  2Q6U A;  4NEV A;  2XCG A;  4UDQ A;  4O5U A;  4AOS A;  4BK1 A;  3UKL A;  2VVM A;  2TPR A;  4CNK A;  2A89 A;  4A79 A;  3HYV A;  4EM3 A;  3AD9 B;  2FBW A;  1H7X A;  3K7Q X;  1TDF A;  1DOB A;  2JK6 A;  5KMP A;  2YLT A;  1ELI A;  2YM2 A;  1PXC A;  4DNA A;  1GRH A;  4Z26 A;  1E1K A;  2BK4 A;  4U2L A;  4USQ A;  4J31 A;  2NPX A;  1OJA A;  2XLT A;  2R4E A;  4BK2 A;  4OVI A;  3CNT A;  2OLN A;  2R0P A;  4H4S A;  5KRQ A;  2ZZB A;  5EB5 A;  4A65 A;  1NDA A;  1QLB A;  2WPF A;  1KNR A;  3VR9 A;  1LQT A;  2A8X A;  1PBB A;  1CJ4 A;  2A87 A;  4OPI A;  2WP5 A;  3CPH G;  2RGH A;  2V3A A;  4H4X A;  1SEZ A;  1CC4 A;  2ZZ0 A;  5KWF A;  2YAU A;  2IVD A;  3G5Q A;  5EB4 A;  1S2Q A;  3LOV A;  5FS6 A;  3T31 A;  1S3E A;  3P9U A;  4OCG A;  4EQS A;  1N4W A;  3FIM B;  3P1W A;  1GRT A;  3GSI A;  4MJW A;  3VRA A;  2CVJ A;  2BA9 A;  2BCP A;  3GWF A;  3I6D A;  4RG4 A;  5EBK A;  5FS8 A;  2C75 A;  5U63 A;  4H4V A;  2X8C A;  2B7S A;  2YR4 A;  2WOI A;  1CF3 A;  2RAB A;  3IF9 A;  3KPF A;  4J33 A;  3UCL A;  4FX9 A;  4JQ9 A;  4UDP A;  1JRZ A;  2V3B A;  4TM4 A;  2VZ2 A;  3AEG A;  2YR5 A;  3UOY A;  4EMJ A;  3NIX A;  2FJB A;  3UKF A;  1OJD A;  3K7M X;  4H4Z A;  3ZDN A;  2BK3 A;  5HYM A;  4D03 A;  3DJG X;  3UKH A;  1REO A;  3AD8 B;  3QSE A;  4GAP A;  1PHH A;  1ZMD A;  3BI4 A;  4AT0 A;  5IPY A;  1GPE A;  3KLJ A;  2ACZ A;  5DBJ A;  5KMR A;  2FJA A;  3AE9 A;  4EQW A;  3QSM A;  1B5Q A;  5KOX A;  3CIR A;  3AE1 A;  1OJC A;  3P4R A;  2IVE A;  4G74 A;  4GR1 A;  3SZW A;  5JCN A;  4BV6 A;  2X50 A;  3AEA A;  2BAB A;  2XLS A;  2R46 A;  2C72 A;  1E7P A;  1PJ7 A;  1Z6L A;  1OJT A;  2C3D A;  3SZF A;  4H4U A;  1L9E A;  4P9S A;  2VVL A;  1DNC A;  1IUT A;  3FBS A;  5JCM A;  2R45 A;  1BGJ A;  2F5Z A;  4II2 A;  4USR A;  1LV0 A;  2YQU A;  3QJ4 A;  3DJJ A;  1L0V A;  2C65 A;  4B64 A;  1GRB A;  1B4V A;  1XHC A;  4U8O A;  2V61 A;  2V5Z A;  4Y4M A;  2V60 A;  1DOD A;  1H84 A;  1KDG A;  4JDR A;  3T2K A;  4AT2 A;  1PS9 A;  4U8K A;  1E6E A;  5CKU A;  3WE0 A;  3SQP A;  2C7G A;  3UOX A;  4OPT A;  2BC1 A;  2JAE A;  5GRT A;  2OA1 A;  2WP6 A;  1D4C A;  3E1T A;  3R9U A;  1CL0 A;  3SFE A;  1CJ2 A;  3DK9 A;  1JEH A;  1LPF A;  3OZ2 A;  2WDQ A;  3KA7 A;  3P4S A;  3UKK A;  3NTA A;  1K0L A;  1H7W A;  2WS3 A;  3SX6 A;  3SFD A;  2GR2 A;  1GEU A;  4CCR A;  4EQR A;  4OPG A;  1ZDL A;  4JNQ A;  2B9X A;  4B68 A;  2WHD A;  1GES A;  1KFY A;  4J56 A;  4U2S A;  2JB2 A;  5HXI A;  3CPI G;  3LB8 A;  2GR1 A;  2H88 A;  2Q0L A;  1X31 B;  5IQ4 A;  4NEW A;  4Y4N A;  2WU2 A;  4LII A;  1GND A;  4K5R A;  4B1B A;  4I59 A;  1KSU A;  3T2Y A;  4BJZ A;  4A99 A;  3AEB A;  4IVO B;  4U8L A;  4K5S A;  3HYW A;  4OPL A;  4U2T A;  4TLX A;  2PHH A;  4Z44 A;  5FS9 A;  3GMB A;  1P2H A;  1Q9I A;  4IV9 A;  3QSS A;  4YSH A;  3EAO A;  1PN0 A;  2QAE A;  3DGZ A;  3GYI A;  3AE7 A;  3NHO X;  4FDC B;  2CDU A;  5IQ1 A;  5C2T A;  1BF3 A;  3DJD A;  1JU2 A;  3T37 A;  5TR3 A;  3I3L A;  2XLP A;  3K7T A;  4EMW A;  4NTD A;  4ZN0 A;  2VVL G;  4H2Q A;  3UKA A;  4DSG A;  1QO8 A;  3AYL A;  4CY8 A;  2GEW A;  4C3X A;  5KVH A;  4H7U A;  3UP5 A;  5BUK A;  1D7L A;  3IHM A;  1PJ6 A;  3S61 A;  1D4E A;  3T0K A;  4D04 A;  4Z25 A;  3ALJ A;  5KMQ A;  5KNL A;  3NYE A;  1PBD A;  2YVJ A;  4PAA A;  4BUR A;  2XDO A;  3SYI A;  5C3J A;  4YT0 A;  4WCT A;  3VR8 A;  1IJH A;  3GDN A;  3AE4 A;  4B65 A;  5BUL A;  2FJE A;  2WDV A;  4H4P A;  3RP6 A;  4EMI A;  1M64 A;  2YLW A;  3AE3 A;  5KVI A;  1DJQ A;  4FK1 A;  2YG6 A;  1F8S A;  2CUL A;  2TMD A;  2WET A;  3NN6 X;  4B63 A;  3UTF A;  2BCG G;  3ATQ A;  4TM3 A;  3VRB A;  3FPZ A;  2GR0 A;  4M52 A;  1GT8 A;  2V6O A;  2PYX A;  3GRT A;  4XXG A;  2OAL A;  2YG3 A;  2OAM A;  2WOW A;  3LJP A;  2WEU A;  3F8D A;  5J7X A;  3H4K A;  1GV4 A;  3IWA A;  3OC4 A;  1JRY A;  2WDR A;  3CTY A;  1TDO A;  3ABV A;  1QJD A;  2GR3 A;  1DJN A;  4YSY A;  1MXT A;  2GAH B;  4YTP A;  1D4D A;  2HQM A;  3AE8 A;  1ZP0 A;  4OPD A;  1GET A;  3UOV A;  3AE6 A;  1Y0P A;  2XFO A;  2EQ7 A;  2GQF A;  3UOZ A;  2Z5X A;  1HYU A;  2XFP A;  2AAQ A;  3IC9 A;  4NZH A;  1IUU A;  3EF6 A;  1EL5 A;  2YG7 A;  2YLX A;  1NHQ A;  3KKJ A;  4NNJ A;  3DK8 A;  1FCD A;  3CNP A;  1N4V A;  4NWZ A;  5ER0 A;  2YLR A;  1ZY8 A;  1F8W A;  1B8S A;  4H4W A;  3FMW A;  3HZL A;  1ZOY A;  1XAN A;  3AD7 B;  4JNA A;  4H50 A;  3DME A;  1LQU A;  1LJ1 A;  4GRT A;  3P4Q A;  4X9M A;  4WX1 A;  4Z43 A;  3CND A;  3SXI A;  4C5O A;  2QA1 A;  4YSZ A;  2EQ6 A;  2X8H A;  3NT6 A;  4RG3 A;  1L9D A;  1N1P A;  2WOV A;  3FG2 P;  3M0O A;  2X99 A;  4A5L A;  2WBA A;  4YWO A;  3PO7 A;  4RSL A;  2BK5 A;  4CY6 A;  3S5W A;  4ADW A;  1MOK A;  1NHR A;  2WPE A;  4G6G A;  3AEC A;  4U8M A;  3IHG A;  1CC2 A;  2YVG A;  4DSH A;  2R4J A;  1IUS A;  1L9C A;  3CGE A;  3KVE A;  3GD4 A;  3QVR A;  1KSS A;  1ZOV A;  1D5T A;  4ICY A;  4APN A;  1KNP A;  4EIP A;  3H8L A;  1ONF A;  3CNJ A;  4EIQ A;  1GRF A;  3V3N A;  4O5Q A;  4N9X A;  2ZBW A;  2XYO A;  4DGK A;  1D7Y A;  5M0Z A;  3HYX A;  1GRG A;  4CNJ A;  5M10 A;  4C74 A;  3PVC A;  2GRT A;  5FS7 A;  1K0J A;  3B6D A;  2Q7V A;  1F3P A;  2UZZ A;  2BS4 A;  3BNM A;  4YKF A;  2H89 A;  1IUW A;  2DKI A;  2WP9 A;  2JKC A;  5KMS A;  1GSN A;  2YR6 A;  4CRT A;  2BXS A;  2BC0 A;  1E39 A;  2YM1 A;  1VQW A;  3ISH A;  1TRB A;  4NTE A;  1BWC A;  4CBQ A;  3B3R A;  4JY2 A;  5J60 A;  2GAG B;  4JY3 A;  1YQ4 A;  3ICS A;  3K30 A;  3QFB A;  1OJ9 A;  1YY5 A;  4FK1 C;  4II3 A;  3GYJ A;  4PAB A;  1FOH A;  5FMH A;  3UKP A;  4EM4 A;  1W4X A;  3COX A;  2IID A;  3SZ0 A;  1PBE A;  5JCL A;  3PS9 A;  2YLS A;  3CGC A;  3CNS A;  1CC6 A;  1ZX9 A;  2BYB A;  1NEK A;  2B76 A;  2C70 A;  3UTH A;  3C4A A;  1TYP A;  3ITJ A;  3P4P A;  3NTD A;  5GSN A;  3NKS A;  2WQY A;  3D1C A;  4UDR A;  1ZKQ A;  2GVC A;  3DJE A;  4XWZ A;  4YXD A;  2I0Z A;  1JRX A;  2O9Z A;  4Z2R A;  2XVH A;  1V59 A;  3NK0 X;  1EBD A;  3NN0 X;  4Z24 A;  1Q1R A;  2ZZC A;  4LA1 A;  1NAA A;  2E1M A;  4U8P A;  1E1M A;  3AYJ A;  1JNZ A;  4AOX A;  1COY A;  4JN9 A;  5U25 A;  4OPC A;  1NHP A;  3BHK A;  2B7R A;  4GF7 A;  4GDE A;  5JCI A;  2B9W A;  1PBC A;  4YSX A;  4Z2U A;  2Q0K A;  3BHF A;  3GDP A;  3RP8 A;  3GD3 A;  1O94 A;  1NG3 A;  3RNM A;  1VG9 A;  3GMC A;  1M6I A;  1PXB A;  2C73 A;  1YQ3 A;  1VRQ B;  3V76 A;  4CCQ A;  1F8R A;  1K0I A;  3L8K A;  3V3O A;  3QFA A;  3D8X A;  3VRD B;  2JB3 A;  4A6N A;  2Z5Y A;  4X4J A;  5JCK A;  4A6N B;  1E1N A;  2R0G A;  1GER A;  2C3C A;  3EPT A;  2C76 A;  3NYF A;  2X3N A;  3UKQ A;  4H2P A;  2GB0 A;  2VQB A;  2XFN A;  1Y56 A;  4G9K A;  3NG7 X;  1Y56 B;  3G5R A;  3M13 A;  4U8N A;  1AOG A;  1H81 A;  1E1L A;  3DH9 A;  1PDH A;  1DXL A;  3RP7 A;  2X8G A;  4J57 A;  1CBO A;  2GMJ A;  4UP3 A;  3C4N A;  1TDK A;  3F8P A;  3CN8 A;  1GXF A;  1N4U A;  4IA6 A;  2VOU A;  1LVL A;  1TDE A;  5HY5 A;  2C66 A;  4K22 A;  1NPX A;  3KPK A;  2EQ8 A;  2BS3 A;  2XFQ A;  4H4Y A;  4U8J A;  5L46 A;  5HHF A;  1GOS A;  1P2E A;  3DK4 A;  4OPU A;  5KOW A;  1H86 A;  3URH A;  2NVK X;  2C67 A;  4K7Z A;  1FEB A;  2E4G A;  2XVE A;  3AE2 A;  4B66 A;  3T14 A;  1TDN A;  3GWD A;  1JNR A;  1FEA A;  2GV8 A;  1RP0 A;  3NRN A;  3SM8 A;  2BS2 A;  2YG4 A;  4J2W A;  3LXD A;  2WPC A;  2BXR A;  3AB1 A;  4GAV A;  1JOA A;  1Q1W A;  4IVM B;  2Y6Q A;  4K8D A;  3NK1 X;  3RHA A;  5KXJ A;  4XWR A;  2RGO A;  3QVP A;  4LU6 A;  1O5W A;  1GRE A;  2XLU A;  4GUV A;  3ALL A;  2APG A;  3LZX A;  4A7A A;  3CGB A;  1EL7 A;  1GTE A;  4A9W A;  3SZC A;  1CHU A;  4E0V A;  4ZCC A;  2FJD A;  2XVF A;  4BJY A;  4TLZ A;  1NG4 A;  2GQW A;  2XVI A;  3GYX A;  4G73 A;  5BVA A;  3ADA B;  3AXB A;  4KX6 A;  1BZL A;  3ALM A;  2BRA A;  2DKH A;  1B37 A;  1YKJ A;  4YTM A;  1EL9 A;  3AED A;  3KD9 A;  1NHS A;  2WES A;  2VRM A;  1BKW A;  4H4T A;  4HA6 A;  1MO9 A;  4IA5 A;  3RED A;  4G6H A;  1EL8 A;  2R9Z A;  3DGH A;  2JBV A;  3UTE A;  4TM1 A;  2AQJ A;  3ATR A;  4H4R A;  3UTG A;  1RYI A;  2CFY A;  4AP1 A;  3NH3 X;  2YWL A;  1RSG A;  1VG0 A;  3AYI A;  3Q9T A;  3VQR A;  2C4C A;  1IUV A;  1GAL A;  1K4Q A;  3LZW A;  5U1O A;  1F6M A;  1UKV G;  1CJ3 A;  1YQZ A;  3NK2 X;  4J34 A;  2Y6R A;  4J36 A;  3LAD A;  2BAC A;  4U8I A;  3BI5 A;  2OLO A;  4ECH A;  3NYC A;  3ICT A;  3ICR A;  3NNE A;  2ARD A;  4H2N A;  4AP3 A;  1BGN A;  5CQF A;  4TM0 A;  3SGL A;  3GRS A;  1GRA A;  2YVF A;  1IUX A;  3Q6J A;  1XDI A;  3KU9 A;  5BRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...