3LZXA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form ii)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase 2
total genus 92
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA02
3D1CA 4RSLA 2JB1A 2H88A 4EQSA 1F8SA 1DJNA 1CHUA 2XFPA 2WPFA 3ALMA 5IQ4A 4NEVA 3G5RA 5KVHA 3EF6A 1JNZA 3BI2A 1P2HA 1CF3A 3AB1A 5BULA 1EL7A 2Y6QA 4OPGA 3UCLA 2C72A 3UTHA 2APGA 3UTFA 2OLOA 2WU2A 1H7XA 1N4WA 2C70A 1TDOA 4J34A 4Z26A 1TDNA 2X99A 2V61A 4IVOB 5FS9A 5BRTA 3I3LA 3P4PA 4DSGA 4UDQA 3NYFA 4YTPA 3H4KA 3RP8A 5KWFA 1DODA 2RGJA 1LVLA 3FIMB 4B64A 1XHCA 1O95A 5C2TA 4X9MA 4B67A 2XVJA 2WEUA 1O5WA 4APNA 3PO7A 2WPCA 2XFUA 3CNPA 1L0VA 2V6OA 1PXAA 4JNAA 2BK3A 4H50A 2VRMA 3OZ2A 2YG3A 4Y4NA 1BZLA 3PS9A 5TR3A 3CGBA 4GUVA 1LV0A 2GMJA 2YLTA 2YLRA 3GYIA 3RP6A 1L9CA 2AAQA 3NT6A 3UTEA 4A79A 3AECA 1E39A 3FG2P 3ALJA 3CGEA 3NTDA 4OPDA 1M64A 1RYIA 1Z6LA 3NNEA 4TM4A 3IHMA 1F6MA 2NVKX 4TM0A 1OJAA 4U8PA 1ZX9A 1L9DA 4AP3A 2VQ7A 3VQRA 2YLSA 1GALA 3DJEA 4D04A 3AD7B 3CNTA 4B69A 3UKKA 3RHAA 3AEBA 1KFYA 5J7XA 1ZMDA 5HY5A 3FPZA 2BABA 2YVJA 1CC6A 2GV8A 3B3RA 4DSHA 1CC2A 4H7UA 1Q9IA 5FS8A 3SGLA 3F8DA 2DKHA 1EL8A 1M6IA 2WP9A 3L8KA 2XLUA 1FEBA 3ADAB 4NTCA 5FMHA 2Z5XA 5KVIA 5EB5A 2GR1A 2R0PA 2GAGB 3V3OA 2WOVA 3V76A 3NK1X 4Z24A 3UKPA 1COYA 3CPIG 4J2WA 3UP4A 5BUKA 3KD9A 2X50A 1BF3A 2BC0A 2ZBWA 3CGCA 2BC1A 4A6NB 2EQ8A 5C3JA 2BCPA 4B1BA 1YQ3A 2R46A 3EANA 1ZMCA 3ATRA 3ZYXA 3C4AA 3RP7A 3UOYA 3SFDA 2B9XA 4BV6A 3NH3X 5KRQA 2I0ZA 2XLPA 4K5SA 1H84A 2YLZA 1GRFA 1P2EA 2VQBA 4I58A 3QFBA 1N1PA 3DK9A 4GF7A 4AOXA 1FCDA 3KPFA 3KA7A 2YQUA 4FDCB 4EQWA 3GSIA 1PBFA 5JCNA 1ZOVA 2WP6A 1L9EA 4Z44A 3BI5A 4YSXA 3KVEA 4FK1C 1X31B 1GTEA 4H4QA 2F5ZA 1RP0A 1NHRA 4OCGA 2XVFA 1NAAA 1MOKA 2QAEA 4USQA 1OJTA 2HQMA 3K7TA 2BK5A 3RNMA 3BHKA 2ZZCA 1QJDA 3GWDA 3PVCA 4B66A 2BS3A 3DJGX 2FBWA 3AE9A 3QSEA 4H4XA 5KOWA 4TM3A 4ZCCA 2WQYA 4YT0A 1KSSA 1RSGA 1GTHA 3AEDA 4O5UA 1IUWA 1GERA 2YM1A 1B4VA 1GRTA 2Y6RA 4CCQA 5M10A 2H89A 5U25A 1CJ2A 1GRHA 1H86A 3AEFA 3M0OA 5GSNA 5KOXA 1E1KA 2JAEA 3DGHA 3LADA 4H4ZA 4U8LA 3G5SA 4OPTA 5JCMA 2FJEA 1VDCA 4HB9A 4CNKA 1B37A 1JRZA 1PBEA 1S2YA 4JQ9A 1S3BA 1OJ9A 2E1MA 2YG5A 4B68A 2OALA 4GRTA 5IQ1A 2FJDA 3GRSA 4NEWA 2Q0KA 3HZLA 4K8DA 4M52A 2C75A 3AD8B 1VG0A 1ZP0A 2QCUA 1PXBA 1ONFA 4BJYA 4Z2TA 1ELIA 4BK3A 3DH9A 4U2SA 4H4PA 4CRTA 2WBAA 4C77A 1DOBA 1LQTA 4OPUA 1OJDA 4C3XA 2GVCA 1V59A 3BI4A 1H82A 1GT8A 3CIRA 1HYUA 4EIPA 4YKFA 4IA6A 1GRGA 1D7YA 2GF3A 4YTMA 3NIXA 2J3NA 2TMDA 3AE3A 3QSMA 3P9UA 1CJ4A 2GH5A 1NHPA 4H2PA 2AQJA 1PDHA 4AOSA 1B5QA 1VRQB 3NRNA 3QSSA 4BURA 2VRLA 2WETA 3Q6JA 5EOWA 4C3YA 1FOHA 4GR1A 4EMIA 4H4UA 2OLNA 1XANA 2XVIA 2V3BA 1EBDA 2YR5A 3VRAA 1PXCA 2C3CA 2CVJA 2VVLG 4CY6A 2AR8A 3VRBA 1REOA 3LZXA 1H6VA 1QO8A 1E1NA 4TLZA 4AT0A 2C76A 2YLXA 3AE5A 4K7ZA 2GQWA 1NHSA 1EL5A 1YY5A 3CN8A 3ISHA 3NLCA 4HA6A 5JCIA 1KF6A 3O0HA 2CDUA 2YWLA 3KU9A 4J33A 3E1TA 4A7AA 2YR4A 3CPHG 5EBKA 1NENA 2B76A 4H2QA 3UTGA 3CNDA 2EQ7A 4LU6A 1S3EA 4OPLA 4CCRA 3GD3A 2X8HA 3GMCA 4YKGA 3M13A 3NN0X 2Q7VA 4EMWA 4OPCA 1KNRA 2C3DA 3IC9A 3OC4A 5CQFA 1LPFA 3AEAA 2GR3A 3K7QX 4XWZA 5M0ZA 4OVIA 5U1OA 1NG3A 3AE2A 3CPJG 4NZHA 1GSNA 1ZY8A 2X3NA 3G5QA 4RG3A 2OAMA 1GXFA 2WESA 2XVEA 2X8CA 2XVHA 4YXDA 4GCMA 1SEZA 1MXTA 1Q1WA 5KXJA 1K0IA 5GRTA 3GDPA 2JBVA 2UZZA 3H8LA 2XLTA 4U8IA 5U63A 1Q1RA 2YVGA 4ZN0A 2R0CA 2QA1A 3AEEA 3V3NA 1O94A 2GAHB 4ICYA 3LXDA 1N4VA 3F8PA 3QVPA 2QA2A 1S2QA 2XFOA 2GEWA 2RGOA 3NYEA 2JB3A 4JDRA 1GPEA 3EPTA 3ICRA 3AE1A 3S5WA 3CTYA 2BS4A 4ADWA 4J31A 1NPXA 3AE8A 4JY3A 2XDOA 4N9XA 4Z2RA 1ZOYA 2EQ6A 5JCLA 4A5LA 2C66A 1TYPA 3AYIA 4OPIA 3WE0A 2V60A 4BK1A 4NTDA 4ZCDA 4H2RA 3DA1A 2DKIA 4I59A 1K4QA 2GR0A 4B63A 4EMJA 3I6DA 2C65A 4UP3A 1BWCA 3II4A 4U8NA 2ACZA 4X9NA 1D7LA 4Z43A 1FEAA 3R9UA 2R45A 4H4YA 3FMWA 2NPXA 2B7SA 1XDIA 3CNJA 3P4QA 4YWOA 5HHFA 2WHDA 3UP5A 2YM2A 4U2LA 3GD4A 4CBQA 1NHQA 1IUSA 2XLSA 1NEKA 1UKVG 3GMBA 4Z25A 1FL2A 1GESA 2BACA 3LJPA 1NDAA 2YG7A 4K2XA 3NG7X 2WS3A 1TDFA 4REKA 2TPRA 1PBBA 3DJDA 5ER0A 2PYXA 1KDGA 1AOGA 5BVAA 1D4EA 1PS9A 1PN0A 2XCGA 3CNSA 2WPEA 3UKFA 2BK4A 4J56A 4U8JA 4H2NA 1PBCA 2XFQA 2IVDA 3COXA 3DMEA 2Q6UA 4BJZA 3DJJA 1PJ6A 2WDVA 1IUTA 4J57A 1E1LA 3NYCA 3K30A 2YG6A 2BA9A 4NTEA 2BCGG 3AE6A 1TDKA 2W0HA 3LZWA 3DK4A 1YKJA 2R9ZA 3JSKA 3QVRA 1IUUA 2CFYA 1H81A 4IA5A 3IWAA 1YQZA 3ABVA 3P1WA 4PAAA 5FS6A 1BGNA 2FJBA 1E6EA 1FECA 3NGCX 2VOUA 1D4DA 1JNRA 3F8RA 2IVEA 1CJCA 2V3AA 3NN6X 4KPRA 3GDNA 1PBDA 4U8OA 1NG4A 4AP1A 3UOXA 3K7MX 3AYJA 3NKSA 4MJWA 3ZDNA 1B8SA 2B9WA 2RGHA 1GOSA 3P4SA 1YQ4A 4Z2UA 3VR8A 2YR6A 2GMHA 3C4NA 1F8RA 4H4WA 3VR9A 1H83A 2CULA 2Z5YA 4XXGA 1GRBA 1CC4A 2E5VA 1PJ7A 1OJCA 1W4XA 2A8XA 1IJHA 3GWFA 2VVMA 2XFNA 1Y56B 3DGZA 3GYJA 2E4GA 1F8WA 2C73A 3AE7A 3AXBA 3AWIA 4WX1A 4YSHA 4ECHA 5HXIA 1Y56A 2R4EA 5LV9A 4E0VA 2XYOA 4UDPA 1LJ1A 4D03A 2VVLA 2GR2A 4K22A 3B6DA 3H8IA 4PABA 4Y4LA 3NK0X 3UKHA 2C67A 2PHHA 4A65A 1GREA 1JRYA 1TDEA 2C64A 4TM1A 2BXRA 3SQPA 3AE4A 3AYLA 1GEUA 1GETA 2OA1A 2X8GA 1ZKQA 2FJAA 2C7GA 4YTNA 2EQ9A 3ATQA 4KX6A 1IUVA 1DOCA 3M12A 3EAOA 1PHHA 3L1RA 2XLRA 4LA1A 1MO9A 4AT2A 3GRTA 3NK2X 4C5OA 2GQFA 3SFEA 4RG4A 4LIIA 1E1MA 1TYTA 4JNQA 1DJQA 3IF9A 1KNPA 5EB4A 4DGKA 4FX9A 1Y0PA 2JB2A 4YSYA 5JCKA 3UKAA 3CGDA 4J36A 1D5TA 4UDRA 4YSZA 5L46A 3UKLA 1K0LA 2YVFA 3LB8A 4P9SA 3BHFA 2WDQA 4FK1A 1JEHA 1K0JA 4USRA 1BGJA 1F3PA 2V5ZA 1IUXA 2R0GA 3LOVA 2R4JA 4TLXA 3REDA 3T37A 1LTXR 3UOVA 2B9YA 4GDEA 3SM8A 4EM4A 4Y4MA 3UKQA 1JU2A 5DBJA 1KSUA 4B65A 2A89A 2WOWA 4H4SA 1QLBA 4IVMB 5FS7A 3Q9TA 1ZDLA 2O9ZA 1GV4A 3KKJA 1N4UA 2IIDA 1LQUA 2ZZ0A 3AEGA 5HYMA 2A87A 3ALLA 2RABA 2B7RA 2BXSA 4JN9A 2WOIA 1GRAA 3C96A 3IHGA 5J60A 4CNJA 1EL9A 4WCTA 4DNAA 4A6NA 4EIQA 3ITJA 3DK8A 2BS2A 2ZZBA 2GB0A 1H7WA 1DXLA 2VZ2A 3ICSA 2BYBA 2WU5A 4A99A 3P4RA 2ARDA 1GNDA 4JY2A 1XPQA 2Q0LA 4K5RA 4U2TA 4EQXA 4U8KA 3UOZA 1D4CA 2YLWA 1ZK7A 4X4JA 4H4VA 5IPYA 1CL0A 3QFAA 4A9WA 3BNUA 3FBSA 1DNCA 4IV9A 3ICTA 4BK2A 5CKUA 1E7PA 2WDRA 3NTAA 2WP5A 4EM3A 4U8MA 3NHOX 4GDPA 1DOEA 2YG4A 4O5QA 1JRXA 1CBOA 1BKWA 3AD9B 3URHA 1JOAA 3D8XA 4CY8A 4EQRA 3VRDB 3S61A 1TRBA 3QJ4A 1VQWA 2JKCA 2GRTA 4H4TA 1PJ5A 2YAUA 3BNMA 4H4RA 4XWRA 4C74A 1CJ3A 1VG9A 2JK6A 3KLJA
chains in the Genus database with same CATH superfamily
3D1CA 4RSLA 2JB1A 2H88A 4EQSA 1F8SA 1DJNA 1CHUA 2XFPA 2WPFA 3ALMA 5IQ4A 4NEVA 3G5RA 5KVHA 3EF6A 1JNZA 3BI2A 1P2HA 1CF3A 3AB1A 5BULA 1EL7A 2Y6QA 4OPGA 3UCLA 2C72A 3UTHA 2APGA 3UTFA 2OLOA 2WU2A 1H7XA 1N4WA 2C70A 1TDOA 4J34A 4Z26A 1TDNA 2X99A 2V61A 4IVOB 5FS9A 5BRTA 3I3LA 3P4PA 4DSGA 4UDQA 3NYFA 4YTPA 3H4KA 3RP8A 5KWFA 1DODA 2RGJA 1LVLA 3FIMB 4B64A 1XHCA 1O95A 3SZ0A 4X9MA 5C2TA 4B67A 2XVJA 2WEUA 1O5WA 4APNA 3PO7A 2WPCA 2XFUA 3CNPA 1L0VA 2V6OA 1PXAA 4JNAA 2BK3A 4H50A 2VRMA 3OZ2A 2YG3A 4Y4NA 1BZLA 3PS9A 5TR3A 3CGBA 4GUVA 1LV0A 2GMJA 2YLTA 2YLRA 3GYIA 3RP6A 1L9CA 2AAQA 3NT6A 3UTEA 4A79A 3AECA 1E39A 3FG2P 3ALJA 3CGEA 3NTDA 4OPDA 1M64A 1RYIA 1Z6LA 3NNEA 4TM4A 3IHMA 1F6MA 2NVKX 4TM0A 1OJAA 4U8PA 1ZX9A 1L9DA 4AP3A 2VQ7A 3VQRA 2YLSA 1GALA 3DJEA 4D04A 3AD7B 3CNTA 4B69A 3UKKA 3RHAA 3AEBA 1KFYA 5J7XA 1ZMDA 5HY5A 3FPZA 2BABA 2YVJA 1CC6A 2GV8A 3B3RA 4DSHA 1CC2A 4H7UA 4GAPA 1Q9IA 5FS8A 3SGLA 3F8DA 2DKHA 1EL8A 1M6IA 2WP9A 3L8KA 2XLUA 1FEBA 3ADAB 4NTCA 5FMHA 2Z5XA 5KVIA 5EB5A 2GR1A 2R0PA 2GAGB 3V3OA 2WOVA 3KPKA 3V76A 3NK1X 4Z24A 3UKPA 1COYA 3CPIG 4J2WA 3UP4A 5BUKA 3KD9A 2X50A 1BF3A 2BC0A 2ZBWA 3CGCA 2BC1A 4A6NB 2EQ8A 5C3JA 4II2A 2BCPA 5KMQA 1YQ3A 2R46A 3EANA 4B1BA 1ZMCA 3SXIA 3ATRA 3ZYXA 3C4AA 3RP7A 3UOYA 3SFDA 2B9XA 4BV6A 3NH3X 5KRQA 2I0ZA 2XLPA 4K5SA 1H84A 2YLZA 1GRFA 1P2EA 2VQBA 4I58A 3QFBA 1N1PA 3DK9A 4GF7A 4AOXA 1FCDA 3KPFA 3KA7A 2YQUA 4G73A 4FDCB 4EQWA 3GSIA 1PBFA 5JCNA 1ZOVA 2WP6A 1L9EA 4Z44A 3BI5A 4YSXA 3KVEA 4FK1C 1X31B 1GTEA 4H4QA 2F5ZA 1RP0A 1NHRA 4OCGA 2XVFA 1NAAA 1MOKA 2QAEA 4USQA 1OJTA 2HQMA 3K7TA 2BK5A 3RNMA 3BHKA 2ZZCA 1QJDA 3GWDA 3PVCA 4B66A 2BS3A 4G6HA 3DJGX 2FBWA 3AE9A 3QSEA 4H4XA 5KOWA 2C4CA 4TM3A 4ZCCA 2WQYA 4YT0A 1KSSA 1RSGA 1GTHA 3AEDA 4O5UA 1IUWA 4G74A 1GERA 2YM1A 1B4VA 1GRTA 2Y6RA 4CCQA 5M10A 2H89A 5U25A 1CJ2A 1GRHA 1H86A 3AEFA 3M0OA 5GSNA 5KOXA 1E1KA 2JAEA 3DGHA 3SYIA 3LADA 4H4ZA 4U8LA 3G5SA 4OPTA 4NNJA 5JCMA 2FJEA 1VDCA 4HB9A 4CNKA 1B37A 1JRZA 1PBEA 1S2YA 4JQ9A 1S3BA 1OJ9A 2E1MA 2YG5A 4B68A 2OALA 4GRTA 5IQ1A 2FJDA 3GRSA 4NEWA 2Q0KA 3HZLA 4K8DA 4M52A 2C75A 3AD8B 1VG0A 1ZP0A 2QCUA 1PXBA 1ONFA 4BJYA 4Z2TA 1ELIA 4BK3A 3DH9A 4U2SA 4H4PA 4CRTA 2WBAA 4GAVA 4C77A 1DOBA 1LQTA 4OPUA 1OJDA 4C3XA 2GVCA 1V59A 3BI4A 1H82A 1GT8A 3CIRA 1HYUA 4EIPA 4YKFA 4IA6A 1GRGA 1D7YA 2GF3A 4YTMA 3NIXA 2J3NA 2TMDA 3AE3A 3QSMA 3P9UA 1CJ4A 2GH5A 1NHPA 4H2PA 2AQJA 1PDHA 4AOSA 1B5QA 1VRQB 3NRNA 3QSSA 4BURA 2VRLA 2WETA 3Q6JA 5EOWA 4C3YA 1FOHA 3HYVA 4GR1A 4EMIA 4H4UA 2OLNA 1XANA 2XVIA 3GYXA 2V3BA 1EBDA 2YR5A 3VRAA 1PXCA 2C3CA 2CVJA 2VVLG 4CY6A 2AR8A 3VRBA 1REOA 3LZXA 1H6VA 1QO8A 1E1NA 4TLZA 4AT0A 2C76A 2YLXA 3AE5A 4K7ZA 2GQWA 1NHSA 1EL5A 1YY5A 3CN8A 3ISHA 3NLCA 4HA6A 5JCIA 1KF6A 3O0HA 4G6GA 2CDUA 2YWLA 3KU9A 4J33A 3E1TA 4A7AA 2YR4A 3CPHG 5EBKA 1NENA 2B76A 4H2QA 3UTGA 3CNDA 2EQ7A 4LU6A 1S3EA 4OPLA 4CCRA 3GD3A 2X8HA 3CMMA 3GMCA 4YKGA 3M13A 3NN0X 2Q7VA 4EMWA 4OPCA 1KNRA 2C3DA 3IC9A 3OC4A 5CQFA 1LPFA 3AEAA 2GR3A 3K7QX 4XWZA 5M0ZA 3SZWA 3HYXA 4OVIA 5U1OA 1NG3A 3AE2A 3CPJG 4NZHA 1GSNA 1ZY8A 2X3NA 3G5QA 4RG3A 2OAMA 1GXFA 2WESA 2XVEA 2X8CA 2XVHA 4YXDA 5KNLA 4GCMA 3T31A 1SEZA 1MXTA 1Q1WA 5KXJA 1K0IA 5GRTA 3GDPA 2JBVA 2UZZA 3H8LA 2XLTA 4U8IA 5U63A 1Q1RA 2YVGA 4ZN0A 2R0CA 2QA1A 3AEEA 3V3NA 1O94A 4G9KA 2GAHB 4ICYA 3LXDA 1N4VA 3F8PA 3QVPA 2QA2A 1S2QA 2XFOA 2GEWA 2RGOA 3NYEA 2JB3A 4JDRA 1GPEA 3EPTA 3ICRA 3AE1A 3S5WA 3CTYA 2BS4A 4ADWA 4J31A 1NPXA 3AE8A 4JY3A 2XDOA 4N9XA 4Z2RA 1ZOYA 2EQ6A 5JCLA 4A5LA 2C66A 1TYPA 3AYIA 4OPIA 3WE0A 2V60A 4BK1A 4NTDA 4ZCDA 4H2RA 3DA1A 2DKIA 4NWZA 4I59A 1K4QA 2GR0A 4B63A 4EMJA 3I6DA 2C65A 4UP3A 1BWCA 3II4A 4U8NA 2ACZA 4X9NA 1D7LA 4Z43A 1FEAA 3R9UA 2R45A 4H4YA 3FMWA 2NPXA 2B7SA 1XDIA 3CNJA 3P4QA 4YWOA 5HHFA 2WHDA 3UP5A 2YM2A 4U2LA 3GD4A 4CBQA 1NHQA 1IUSA 2XLSA 1NEKA 1UKVG 3GMBA 4Z25A 1FL2A 1GESA 2BACA 3LJPA 1NDAA 2YG7A 4K2XA 3NG7X 2WS3A 1TDFA 4REKA 2TPRA 1PBBA 3DJDA 5ER0A 2PYXA 1KDGA 1AOGA 5BVAA 1D4EA 1PS9A 1PN0A 2XCGA 3CNSA 2WPEA 3UKFA 2BK4A 4J56A 4U8JA 4H2NA 1PBCA 3T0KA 2XFQA 2IVDA 3COXA 3DMEA 2Q6UA 4BJZA 3DJJA 1PJ6A 2WDVA 1IUTA 3T2YA 4J57A 1E1LA 3NYCA 3K30A 2YG6A 2BA9A 4NTEA 2BCGG 3AE6A 1TDKA 2W0HA 3LZWA 3SY4A 3DK4A 1YKJA 2R9ZA 3JSKA 3QVRA 1IUUA 2CFYA 1H81A 4IA5A 4II3A 3IWAA 1YQZA 3ABVA 3P1WA 4PAAA 5FS6A 1BGNA 2FJBA 1E6EA 1FECA 3NGCX 2VOUA 1D4DA 1JNRA 3F8RA 2IVEA 1CJCA 2V3AA 3NN6X 4KPRA 3GDNA 1PBDA 4U8OA 1NG4A 4AP1A 3UOXA 3K7MX 3AYJA 3NKSA 4MJWA 3ZDNA 1B8SA 2B9WA 2RGHA 1GOSA 3P4SA 1YQ4A 4Z2UA 3VR8A 2YR6A 2GMHA 3C4NA 1F8RA 4H4WA 3VR9A 1H83A 2CULA 2Z5YA 4XXGA 1GRBA 1CC4A 2E5VA 1PJ7A 1OJCA 1W4XA 2A8XA 1IJHA 3SX6A 3GWFA 2VVMA 2XFNA 1Y56B 3DGZA 3GYJA 2E4GA 1F8WA 2C73A 3AE7A 3AXBA 3AWIA 4WX1A 4YSHA 4ECHA 5HXIA 1Y56A 2R4EA 5LV9A 4E0VA 2XYOA 4UDPA 1LJ1A 4D03A 2VVLA 2GR2A 4K22A 3B6DA 3H8IA 4PABA 4Y4LA 3NK0X 3UKHA 2C67A 2PHHA 4A65A 1GREA 1JRYA 1TDEA 2C64A 4TM1A 2BXRA 3SQPA 3AE4A 3AYLA 1GEUA 1GETA 2OA1A 2X8GA 1ZKQA 2FJAA 2C7GA 4YTNA 2EQ9A 5KMRA 3ATQA 4KX6A 1IUVA 1DOCA 5KMPA 3M12A 3EAOA 1PHHA 3L1RA 2XLRA 4LA1A 1MO9A 4AT2A 3GRTA 3NK2X 4C5OA 2GQFA 3SFEA 3T2ZA 5KMSA 4RG4A 4LIIA 1E1MA 1TYTA 4JNQA 1DJQA 3IF9A 1KNPA 5EB4A 4DGKA 4FX9A 1Y0PA 2JB2A 4YSYA 5JCKA 3UKAA 3CGDA 4J36A 1D5TA 4UDRA 4YSZA 5L46A 3UKLA 1K0LA 2YVFA 3LB8A 4P9SA 3BHFA 2WDQA 4FK1A 1JEHA 1K0JA 4USRA 1BGJA 1F3PA 2V5ZA 1IUXA 2R0GA 3LOVA 2R4JA 4TLXA 3REDA 3T37A 1LTXR 3UOVA 2B9YA 3HYWA 4GDEA 2BRAA 3SM8A 4EM4A 4Y4MA 3UKQA 1JU2A 5DBJA 1KSUA 4B65A 2A89A 2WOWA 4H4SA 1QLBA 4IVMB 5FS7A 3Q9TA 1ZDLA 2O9ZA 1GV4A 3KKJA 1N4UA 2IIDA 1LQUA 2ZZ0A 3AEGA 5HYMA 2A87A 3ALLA 2RABA 2B7RA 2BXSA 3T2KA 4JN9A 2WOIA 1GRAA 3C96A 3IHGA 5J60A 4CNJA 1EL9A 4WCTA 4DNAA 4A6NA 4EIQA 3ITJA 3DK8A 2BS2A 2ZZBA 2GB0A 1H7WA 2BRYA 1DXLA 2VZ2A 3ICSA 2BYBA 2WU5A 4A99A 3P4RA 2ARDA 1GNDA 4JY2A 1XPQA 2Q0LA 4K5RA 4U2TA 3T14A 4EQXA 4U8KA 3UOZA 1D4CA 2YLWA 1ZK7A 4X4JA 4H4VA 5IPYA 1CL0A 3QFAA 4A9WA 3BNUA 3FBSA 1DNCA 4IV9A 3ICTA 4BK2A 5CKUA 1E7PA 2WDRA 3NTAA 2WP5A 4EM3A 4U8MA 3NHOX 4GDPA 3SZCA 1DOEA 2YG4A 4O5QA 1JRXA 1CBOA 1BKWA 3AD9B 3URHA 1JOAA 3D8XA 4CY8A 4EQRA 3SZFA 3VRDB 3S61A 1TRBA 3QJ4A 1VQWA 2JKCA 2GRTA 4H4TA 1PJ5A 2YAUA 3BNMA 4H4RA 4XWRA 4C74A 1CJ3A 1VG9A 2JK6A 3KLJA
chains in the Genus database with same CATH topology
3D1CA 4RSLA 2JB1A 2H88A 4EQSA 1F8SA 1DJNA 1CHUA 2XFPA 2WPFA 3ALMA 5IQ4A 4NEVA 3G5RA 5KVHA 3EF6A 1JNZA 3BI2A 1P2HA 1CF3A 3AB1A 5BULA 1EL7A 2Y6QA 4OPGA 3UCLA 2C72A 3UTHA 2APGA 3UTFA 2OLOA 2WU2A 1H7XA 1N4WA 2C70A 1TDOA 4J34A 4Z26A 1TDNA 2X99A 2V61A 4IVOB 5FS9A 5BRTA 3I3LA 3P4PA 4DSGA 4UDQA 3NYFA 4YTPA 3H4KA 3RP8A 5KWFA 1DODA 2RGJA 1LVLA 3FIMB 4B64A 1XHCA 1O95A 3SZ0A 4X9MA 5C2TA 4B67A 2XVJA 2WEUA 1O5WA 4APNA 3PO7A 2WPCA 2XFUA 3CNPA 1L0VA 2V6OA 1PXAA 4JNAA 2BK3A 4H50A 2VRMA 3OZ2A 2YG3A 4Y4NA 1BZLA 3PS9A 5TR3A 3CGBA 4GUVA 1LV0A 2GMJA 2YLTA 2YLRA 3GYIA 3RP6A 1L9CA 2AAQA 3NT6A 3UTEA 4A79A 3AECA 1E39A 3FG2P 3ALJA 3CGEA 3NTDA 4OPDA 1M64A 1RYIA 1Z6LA 3NNEA 4TM4A 3IHMA 1F6MA 2NVKX 4TM0A 1OJAA 4U8PA 1ZX9A 1L9DA 4AP3A 2VQ7A 3VQRA 2YLSA 1GALA 3DJEA 4D04A 3AD7B 3CNTA 4B69A 3UKKA 3RHAA 3AEBA 1KFYA 5J7XA 1ZMDA 5HY5A 3FPZA 2BABA 2YVJA 1CC6A 2GV8A 3B3RA 4DSHA 1CC2A 4H7UA 4GAPA 1Q9IA 5FS8A 3SGLA 3F8DA 2DKHA 1EL8A 1M6IA 2WP9A 3L8KA 2XLUA 1FEBA 3ADAB 4NTCA 5FMHA 2Z5XA 5KVIA 5EB5A 2GR1A 2R0PA 2GAGB 3V3OA 2WOVA 3KPKA 3V76A 3NK1X 4Z24A 3UKPA 1COYA 3CPIG 4J2WA 3UP4A 5BUKA 3KD9A 2X50A 1BF3A 2BC0A 2ZBWA 3CGCA 2BC1A 4A6NB 2EQ8A 5C3JA 4II2A 2BCPA 5KMQA 1YQ3A 2R46A 3EANA 4B1BA 1ZMCA 3SXIA 3ATRA 3ZYXA 3C4AA 3RP7A 3UOYA 3SFDA 2B9XA 4BV6A 3NH3X 5KRQA 2I0ZA 2XLPA 4K5SA 1H84A 2YLZA 1GRFA 1P2EA 2VQBA 4I58A 3QFBA 1N1PA 3DK9A 4GF7A 4AOXA 1FCDA 3KPFA 3KA7A 2YQUA 4G73A 4FDCB 4EQWA 3GSIA 1PBFA 5JCNA 1ZOVA 2WP6A 1L9EA 4Z44A 3BI5A 4YSXA 3KVEA 4FK1C 1X31B 1GTEA 4H4QA 2F5ZA 1RP0A 1NHRA 4OCGA 2XVFA 1NAAA 1MOKA 2QAEA 4USQA 1OJTA 2HQMA 3K7TA 2BK5A 3RNMA 3BHKA 2ZZCA 1QJDA 3GWDA 3PVCA 4B66A 2BS3A 4G6HA 3DJGX 2FBWA 3AE9A 3QSEA 4H4XA 5KOWA 2C4CA 4TM3A 4ZCCA 2WQYA 4YT0A 1KSSA 1RSGA 1GTHA 3AEDA 4O5UA 1IUWA 4G74A 1GERA 2YM1A 1B4VA 1GRTA 2Y6RA 4CCQA 5M10A 2H89A 5U25A 1CJ2A 1GRHA 1H86A 3AEFA 3M0OA 5GSNA 5KOXA 1E1KA 2JAEA 3DGHA 3SYIA 3LADA 4H4ZA 4U8LA 3G5SA 4OPTA 4NNJA 5JCMA 2FJEA 1VDCA 4HB9A 4CNKA 1B37A 1JRZA 1PBEA 1S2YA 4JQ9A 1S3BA 1OJ9A 2E1MA 2YG5A 4B68A 2OALA 4GRTA 5IQ1A 2FJDA 3GRSA 4NEWA 2Q0KA 3HZLA 4K8DA 4M52A 2C75A 3AD8B 1VG0A 1ZP0A 2QCUA 1PXBA 1ONFA 4BJYA 4Z2TA 1ELIA 4BK3A 3DH9A 4U2SA 4H4PA 4CRTA 2WBAA 4GAVA 4C77A 1DOBA 1LQTA 4OPUA 1OJDA 4C3XA 2GVCA 1V59A 3BI4A 1H82A 1GT8A 3CIRA 1HYUA 4EIPA 4YKFA 4IA6A 1GRGA 1D7YA 2GF3A 4YTMA 3NIXA 2J3NA 2TMDA 3AE3A 3QSMA 3P9UA 1CJ4A 2GH5A 1NHPA 4H2PA 2AQJA 1PDHA 4AOSA 1B5QA 1VRQB 3NRNA 3QSSA 4BURA 2VRLA 2WETA 3Q6JA 5EOWA 4C3YA 1FOHA 3HYVA 4GR1A 4EMIA 4H4UA 2OLNA 1XANA 2XVIA 3GYXA 2V3BA 1EBDA 2YR5A 3VRAA 1PXCA 2C3CA 2CVJA 2VVLG 4CY6A 2AR8A 3VRBA 1REOA 3LZXA 1H6VA 1QO8A 1E1NA 4TLZA 4AT0A 2C76A 2YLXA 3AE5A 4K7ZA 2GQWA 1NHSA 1EL5A 1YY5A 3CN8A 3ISHA 3NLCA 4HA6A 5JCIA 1KF6A 3O0HA 4G6GA 2CDUA 2YWLA 3KU9A 4J33A 3E1TA 4A7AA 2YR4A 3CPHG 5EBKA 1NENA 2B76A 4H2QA 3UTGA 3CNDA 2EQ7A 4LU6A 1S3EA 4OPLA 4CCRA 3GD3A 2X8HA 3CMMA 3GMCA 4YKGA 3M13A 3NN0X 2Q7VA 4EMWA 4OPCA 1KNRA 2C3DA 3IC9A 3OC4A 5CQFA 1LPFA 3AEAA 2GR3A 3K7QX 4XWZA 5M0ZA 3SZWA 3HYXA 4OVIA 5U1OA 1NG3A 3AE2A 3CPJG 4NZHA 1GSNA 1ZY8A 2X3NA 3G5QA 4RG3A 2OAMA 1GXFA 2WESA 2XVEA 2X8CA 2XVHA 4YXDA 5KNLA 4GCMA 3T31A 1SEZA 1MXTA 1Q1WA 5KXJA 1K0IA 5GRTA 3GDPA 2JBVA 2UZZA 3H8LA 2XLTA 4U8IA 5U63A 1Q1RA 2YVGA 4ZN0A 2R0CA 2QA1A 3AEEA 3V3NA 1O94A 4G9KA 2GAHB 4ICYA 3LXDA 1N4VA 3F8PA 3QVPA 2QA2A 1S2QA 2XFOA 2GEWA 2RGOA 3NYEA 2JB3A 4JDRA 1GPEA 3EPTA 3ICRA 3AE1A 3S5WA 3CTYA 2BS4A 4ADWA 4J31A 1NPXA 3AE8A 4JY3A 2XDOA 4N9XA 4Z2RA 1ZOYA 2EQ6A 5JCLA 4A5LA 2C66A 1TYPA 3AYIA 4OPIA 3WE0A 2V60A 4BK1A 4NTDA 4ZCDA 4H2RA 3DA1A 2DKIA 4NWZA 4I59A 1K4QA 2GR0A 4B63A 4EMJA 3I6DA 2C65A 4UP3A 1BWCA 3II4A 4U8NA 2ACZA 4X9NA 1D7LA 4Z43A 1FEAA 3R9UA 2R45A 4H4YA 3FMWA 2NPXA 2B7SA 1XDIA 3CNJA 3P4QA 4YWOA 5HHFA 2WHDA 3UP5A 2YM2A 4U2LA 3GD4A 4CBQA 1NHQA 1IUSA 2XLSA 1NEKA 1UKVG 3GMBA 4Z25A 1FL2A 1GESA 2BACA 3LJPA 1NDAA 2YG7A 4K2XA 3NG7X 2WS3A 1TDFA 4REKA 2TPRA 1PBBA 3DJDA 5ER0A 2PYXA 1KDGA 1AOGA 5BVAA 1D4EA 1PS9A 1PN0A 2XCGA 3CNSA 2WPEA 3UKFA 2BK4A 4J56A 4U8JA 4H2NA 1PBCA 3T0KA 2XFQA 2IVDA 3COXA 3DMEA 2Q6UA 4BJZA 3DJJA 1PJ6A 2WDVA 1IUTA 3T2YA 4J57A 1E1LA 3NYCA 3K30A 2YG6A 2BA9A 4NTEA 2BCGG 3AE6A 1TDKA 2W0HA 3LZWA 3SY4A 3DK4A 1YKJA 2R9ZA 3JSKA 3QVRA 1IUUA 2CFYA 1H81A 4IA5A 4II3A 3IWAA 1YQZA 3ABVA 3P1WA 4PAAA 5FS6A 1BGNA 2FJBA 1E6EA 1FECA 3NGCX 2VOUA 1D4DA 1JNRA 3F8RA 2IVEA 1CJCA 2V3AA 3NN6X 4KPRA 3GDNA 1PBDA 4U8OA 1NG4A 4AP1A 3UOXA 3K7MX 3AYJA 3NKSA 4MJWA 3ZDNA 1B8SA 2B9WA 2RGHA 1GOSA 3P4SA 1YQ4A 4Z2UA 3VR8A 2YR6A 2GMHA 3C4NA 1F8RA 4H4WA 3VR9A 1H83A 2CULA 2Z5YA 4XXGA 1GRBA 1CC4A 2E5VA 1PJ7A 1OJCA 1W4XA 2A8XA 1IJHA 3SX6A 3GWFA 2VVMA 2XFNA 1Y56B 3DGZA 3GYJA 2E4GA 1F8WA 2C73A 3AE7A 3AXBA 3AWIA 4WX1A 4YSHA 4ECHA 5HXIA 1Y56A 2R4EA 5LV9A 4E0VA 2XYOA 4UDPA 1LJ1A 4D03A 2VVLA 2GR2A 4K22A 3B6DA 3H8IA 4PABA 4Y4LA 3NK0X 3UKHA 2C67A 2PHHA 4A65A 1GREA 1JRYA 1TDEA 2C64A 4TM1A 2BXRA 3SQPA 3AE4A 3AYLA 1GEUA 1GETA 2OA1A 2X8GA 1ZKQA 2FJAA 2C7GA 4YTNA 2EQ9A 5KMRA 3ATQA 4KX6A 1IUVA 1DOCA 5KMPA 3M12A 3EAOA 1PHHA 3L1RA 2XLRA 4LA1A 1MO9A 4AT2A 3GRTA 3NK2X 4C5OA 2GQFA 3SFEA 3T2ZA 5KMSA 4RG4A 4LIIA 1E1MA 1TYTA 4JNQA 1DJQA 3IF9A 1KNPA 5EB4A 4DGKA 4FX9A 1Y0PA 2JB2A 4YSYA 5JCKA 3UKAA 3CGDA 4J36A 1D5TA 4UDRA 4YSZA 5L46A 3UKLA 1K0LA 2YVFA 3LB8A 4P9SA 3BHFA 2WDQA 4FK1A 1JEHA 1K0JA 4USRA 1BGJA 1F3PA 2V5ZA 1IUXA 2R0GA 3LOVA 2R4JA 4TLXA 3REDA 3T37A 1LTXR 3UOVA 2B9YA 3HYWA 4GDEA 2BRAA 3SM8A 4EM4A 4Y4MA 3UKQA 1JU2A 5DBJA 1KSUA 4B65A 2A89A 2WOWA 4H4SA 1QLBA 4IVMB 5FS7A 3Q9TA 1ZDLA 2O9ZA 1GV4A 3KKJA 1N4UA 2IIDA 1LQUA 2ZZ0A 3AEGA 5HYMA 2A87A 3ALLA 2RABA 2B7RA 2BXSA 3T2KA 4JN9A 2WOIA 1GRAA 3C96A 3IHGA 5J60A 4CNJA 1EL9A 4WCTA 4DNAA 4A6NA 4EIQA 3ITJA 3DK8A 2BS2A 2ZZBA 2GB0A 1H7WA 2BRYA 1DXLA 2VZ2A 3ICSA 2BYBA 2WU5A 4A99A 3P4RA 2ARDA 1GNDA 4JY2A 1XPQA 2Q0LA 4K5RA 4U2TA 3T14A 4EQXA 4U8KA 3UOZA 1D4CA 2YLWA 1ZK7A 4X4JA 4H4VA 5IPYA 1CL0A 3QFAA 4A9WA 3BNUA 3FBSA 1DNCA 4IV9A 3ICTA 4BK2A 5CKUA 1E7PA 2WDRA 3NTAA 2WP5A 4EM3A 4U8MA 3NHOX 4GDPA 3SZCA 1DOEA 2YG4A 4O5QA 1JRXA 1CBOA 1BKWA 3AD9B 3URHA 1JOAA 3D8XA 4CY8A 4EQRA 3SZFA 3VRDB 3S61A 1TRBA 3QJ4A 1VQWA 2JKCA 2GRTA 4H4TA 1PJ5A 2YAUA 3BNMA 4H4RA 4XWRA 4C74A 1CJ3A 1VG9A 2JK6A 3KLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1C A;  4RSL A;  2JB1 A;  2H88 A;  4EQS A;  1F8S A;  1DJN A;  1CHU A;  2XFP A;  2WPF A;  3ALM A;  5IQ4 A;  4NEV A;  3G5R A;  5KVH A;  3EF6 A;  1JNZ A;  3BI2 A;  1P2H A;  1CF3 A;  3AB1 A;  5BUL A;  1EL7 A;  2Y6Q A;  4OPG A;  3UCL A;  2C72 A;  3UTH A;  2APG A;  3UTF A;  2OLO A;  2WU2 A;  1H7X A;  1N4W A;  2C70 A;  1TDO A;  4J34 A;  4Z26 A;  1TDN A;  2X99 A;  2V61 A;  4IVO B;  5FS9 A;  5BRT A;  3I3L A;  3P4P A;  4DSG A;  4UDQ A;  3NYF A;  4YTP A;  3H4K A;  3RP8 A;  5KWF A;  1DOD A;  2RGJ A;  1LVL A;  3FIM B;  4B64 A;  1XHC A;  1O95 A;  5C2T A;  4X9M A;  4B67 A;  2XVJ A;  2WEU A;  1O5W A;  4APN A;  3PO7 A;  2WPC A;  2XFU A;  3CNP A;  1L0V A;  2V6O A;  1PXA A;  4JNA A;  2BK3 A;  4H50 A;  2VRM A;  3OZ2 A;  2YG3 A;  4Y4N A;  1BZL A;  3PS9 A;  5TR3 A;  3CGB A;  4GUV A;  1LV0 A;  2GMJ A;  2YLT A;  2YLR A;  3GYI A;  3RP6 A;  1L9C A;  2AAQ A;  3NT6 A;  3UTE A;  4A79 A;  3AEC A;  1E39 A;  3FG2 P;  3ALJ A;  3CGE A;  3NTD A;  4OPD A;  1M64 A;  1RYI A;  1Z6L A;  3NNE A;  4TM4 A;  3IHM A;  1F6M A;  2NVK X;  4TM0 A;  1OJA A;  4U8P A;  1ZX9 A;  1L9D A;  4AP3 A;  2VQ7 A;  3VQR A;  2YLS A;  1GAL A;  3DJE A;  4D04 A;  3AD7 B;  3CNT A;  4B69 A;  3UKK A;  3RHA A;  3AEB A;  1KFY A;  5J7X A;  1ZMD A;  5HY5 A;  3FPZ A;  2BAB A;  2YVJ A;  1CC6 A;  2GV8 A;  3B3R A;  4DSH A;  1CC2 A;  4H7U A;  1Q9I A;  5FS8 A;  3SGL A;  3F8D A;  2DKH A;  1EL8 A;  1M6I A;  2WP9 A;  3L8K A;  2XLU A;  1FEB A;  3ADA B;  4NTC A;  5FMH A;  2Z5X A;  5KVI A;  5EB5 A;  2GR1 A;  2R0P A;  2GAG B;  3V3O A;  2WOV A;  3V76 A;  3NK1 X;  4Z24 A;  3UKP A;  1COY A;  3CPI G;  4J2W A;  3UP4 A;  5BUK A;  3KD9 A;  2X50 A;  1BF3 A;  2BC0 A;  2ZBW A;  3CGC A;  2BC1 A;  4A6N B;  2EQ8 A;  5C3J A;  2BCP A;  4B1B A;  1YQ3 A;  2R46 A;  3EAN A;  1ZMC A;  3ATR A;  3ZYX A;  3C4A A;  3RP7 A;  3UOY A;  3SFD A;  2B9X A;  4BV6 A;  3NH3 X;  5KRQ A;  2I0Z A;  2XLP A;  4K5S A;  1H84 A;  2YLZ A;  1GRF A;  1P2E A;  2VQB A;  4I58 A;  3QFB A;  1N1P A;  3DK9 A;  4GF7 A;  4AOX A;  1FCD A;  3KPF A;  3KA7 A;  2YQU A;  4FDC B;  4EQW A;  3GSI A;  1PBF A;  5JCN A;  1ZOV A;  2WP6 A;  1L9E A;  4Z44 A;  3BI5 A;  4YSX A;  3KVE A;  4FK1 C;  1X31 B;  1GTE A;  4H4Q A;  2F5Z A;  1RP0 A;  1NHR A;  4OCG A;  2XVF A;  1NAA A;  1MOK A;  2QAE A;  4USQ A;  1OJT A;  2HQM A;  3K7T A;  2BK5 A;  3RNM A;  3BHK A;  2ZZC A;  1QJD A;  3GWD A;  3PVC A;  4B66 A;  2BS3 A;  3DJG X;  2FBW A;  3AE9 A;  3QSE A;  4H4X A;  5KOW A;  4TM3 A;  4ZCC A;  2WQY A;  4YT0 A;  1KSS A;  1RSG A;  1GTH A;  3AED A;  4O5U A;  1IUW A;  1GER A;  2YM1 A;  1B4V A;  1GRT A;  2Y6R A;  4CCQ A;  5M10 A;  2H89 A;  5U25 A;  1CJ2 A;  1GRH A;  1H86 A;  3AEF A;  3M0O A;  5GSN A;  5KOX A;  1E1K A;  2JAE A;  3DGH A;  3LAD A;  4H4Z A;  4U8L A;  3G5S A;  4OPT A;  5JCM A;  2FJE A;  1VDC A;  4HB9 A;  4CNK A;  1B37 A;  1JRZ A;  1PBE A;  1S2Y A;  4JQ9 A;  1S3B A;  1OJ9 A;  2E1M A;  2YG5 A;  4B68 A;  2OAL A;  4GRT A;  5IQ1 A;  2FJD A;  3GRS A;  4NEW A;  2Q0K A;  3HZL A;  4K8D A;  4M52 A;  2C75 A;  3AD8 B;  1VG0 A;  1ZP0 A;  2QCU A;  1PXB A;  1ONF A;  4BJY A;  4Z2T A;  1ELI A;  4BK3 A;  3DH9 A;  4U2S A;  4H4P A;  4CRT A;  2WBA A;  4C77 A;  1DOB A;  1LQT A;  4OPU A;  1OJD A;  4C3X A;  2GVC A;  1V59 A;  3BI4 A;  1H82 A;  1GT8 A;  3CIR A;  1HYU A;  4EIP A;  4YKF A;  4IA6 A;  1GRG A;  1D7Y A;  2GF3 A;  4YTM A;  3NIX A;  2J3N A;  2TMD A;  3AE3 A;  3QSM A;  3P9U A;  1CJ4 A;  2GH5 A;  1NHP A;  4H2P A;  2AQJ A;  1PDH A;  4AOS A;  1B5Q A;  1VRQ B;  3NRN A;  3QSS A;  4BUR A;  2VRL A;  2WET A;  3Q6J A;  5EOW A;  4C3Y A;  1FOH A;  4GR1 A;  4EMI A;  4H4U A;  2OLN A;  1XAN A;  2XVI A;  2V3B A;  1EBD A;  2YR5 A;  3VRA A;  1PXC A;  2C3C A;  2CVJ A;  2VVL G;  4CY6 A;  2AR8 A;  3VRB A;  1REO A;  3LZX A;  1H6V A;  1QO8 A;  1E1N A;  4TLZ A;  4AT0 A;  2C76 A;  2YLX A;  3AE5 A;  4K7Z A;  2GQW A;  1NHS A;  1EL5 A;  1YY5 A;  3CN8 A;  3ISH A;  3NLC A;  4HA6 A;  5JCI A;  1KF6 A;  3O0H A;  2CDU A;  2YWL A;  3KU9 A;  4J33 A;  3E1T A;  4A7A A;  2YR4 A;  3CPH G;  5EBK A;  1NEN A;  2B76 A;  4H2Q A;  3UTG A;  3CND A;  2EQ7 A;  4LU6 A;  1S3E A;  4OPL A;  4CCR A;  3GD3 A;  2X8H A;  3GMC A;  4YKG A;  3M13 A;  3NN0 X;  2Q7V A;  4EMW A;  4OPC A;  1KNR A;  2C3D A;  3IC9 A;  3OC4 A;  5CQF A;  1LPF A;  3AEA A;  2GR3 A;  3K7Q X;  4XWZ A;  5M0Z A;  4OVI A;  5U1O A;  1NG3 A;  3AE2 A;  3CPJ G;  4NZH A;  1GSN A;  1ZY8 A;  2X3N A;  3G5Q A;  4RG3 A;  2OAM A;  1GXF A;  2WES A;  2XVE A;  2X8C A;  2XVH A;  4YXD A;  4GCM A;  1SEZ A;  1MXT A;  1Q1W A;  5KXJ A;  1K0I A;  5GRT A;  3GDP A;  2JBV A;  2UZZ A;  3H8L A;  2XLT A;  4U8I A;  5U63 A;  1Q1R A;  2YVG A;  4ZN0 A;  2R0C A;  2QA1 A;  3AEE A;  3V3N A;  1O94 A;  2GAH B;  4ICY A;  3LXD A;  1N4V A;  3F8P A;  3QVP A;  2QA2 A;  1S2Q A;  2XFO A;  2GEW A;  2RGO A;  3NYE A;  2JB3 A;  4JDR A;  1GPE A;  3EPT A;  3ICR A;  3AE1 A;  3S5W A;  3CTY A;  2BS4 A;  4ADW A;  4J31 A;  1NPX A;  3AE8 A;  4JY3 A;  2XDO A;  4N9X A;  4Z2R A;  1ZOY A;  2EQ6 A;  5JCL A;  4A5L A;  2C66 A;  1TYP A;  3AYI A;  4OPI A;  3WE0 A;  2V60 A;  4BK1 A;  4NTD A;  4ZCD A;  4H2R A;  3DA1 A;  2DKI A;  4I59 A;  1K4Q A;  2GR0 A;  4B63 A;  4EMJ A;  3I6D A;  2C65 A;  4UP3 A;  1BWC A;  3II4 A;  4U8N A;  2ACZ A;  4X9N A;  1D7L A;  4Z43 A;  1FEA A;  3R9U A;  2R45 A;  4H4Y A;  3FMW A;  2NPX A;  2B7S A;  1XDI A;  3CNJ A;  3P4Q A;  4YWO A;  5HHF A;  2WHD A;  3UP5 A;  2YM2 A;  4U2L A;  3GD4 A;  4CBQ A;  1NHQ A;  1IUS A;  2XLS A;  1NEK A;  1UKV G;  3GMB A;  4Z25 A;  1FL2 A;  1GES A;  2BAC A;  3LJP A;  1NDA A;  2YG7 A;  4K2X A;  3NG7 X;  2WS3 A;  1TDF A;  4REK A;  2TPR A;  1PBB A;  3DJD A;  5ER0 A;  2PYX A;  1KDG A;  1AOG A;  5BVA A;  1D4E A;  1PS9 A;  1PN0 A;  2XCG A;  3CNS A;  2WPE A;  3UKF A;  2BK4 A;  4J56 A;  4U8J A;  4H2N A;  1PBC A;  2XFQ A;  2IVD A;  3COX A;  3DME A;  2Q6U A;  4BJZ A;  3DJJ A;  1PJ6 A;  2WDV A;  1IUT A;  4J57 A;  1E1L A;  3NYC A;  3K30 A;  2YG6 A;  2BA9 A;  4NTE A;  2BCG G;  3AE6 A;  1TDK A;  2W0H A;  3LZW A;  3DK4 A;  1YKJ A;  2R9Z A;  3JSK A;  3QVR A;  1IUU A;  2CFY A;  1H81 A;  4IA5 A;  3IWA A;  1YQZ A;  3ABV A;  3P1W A;  4PAA A;  5FS6 A;  1BGN A;  2FJB A;  1E6E A;  1FEC A;  3NGC X;  2VOU A;  1D4D A;  1JNR A;  3F8R A;  2IVE A;  1CJC A;  2V3A A;  3NN6 X;  4KPR A;  3GDN A;  1PBD A;  4U8O A;  1NG4 A;  4AP1 A;  3UOX A;  3K7M X;  3AYJ A;  3NKS A;  4MJW A;  3ZDN A;  1B8S A;  2B9W A;  2RGH A;  1GOS A;  3P4S A;  1YQ4 A;  4Z2U A;  3VR8 A;  2YR6 A;  2GMH A;  3C4N A;  1F8R A;  4H4W A;  3VR9 A;  1H83 A;  2CUL A;  2Z5Y A;  4XXG A;  1GRB A;  1CC4 A;  2E5V A;  1PJ7 A;  1OJC A;  1W4X A;  2A8X A;  1IJH A;  3GWF A;  2VVM A;  2XFN A;  1Y56 B;  3DGZ A;  3GYJ A;  2E4G A;  1F8W A;  2C73 A;  3AE7 A;  3AXB A;  3AWI A;  4WX1 A;  4YSH A;  4ECH A;  5HXI A;  1Y56 A;  2R4E A;  5LV9 A;  4E0V A;  2XYO A;  4UDP A;  1LJ1 A;  4D03 A;  2VVL A;  2GR2 A;  4K22 A;  3B6D A;  3H8I A;  4PAB A;  4Y4L A;  3NK0 X;  3UKH A;  2C67 A;  2PHH A;  4A65 A;  1GRE A;  1JRY A;  1TDE A;  2C64 A;  4TM1 A;  2BXR A;  3SQP A;  3AE4 A;  3AYL A;  1GEU A;  1GET A;  2OA1 A;  2X8G A;  1ZKQ A;  2FJA A;  2C7G A;  4YTN A;  2EQ9 A;  3ATQ A;  4KX6 A;  1IUV A;  1DOC A;  3M12 A;  3EAO A;  1PHH A;  3L1R A;  2XLR A;  4LA1 A;  1MO9 A;  4AT2 A;  3GRT A;  3NK2 X;  4C5O A;  2GQF A;  3SFE A;  4RG4 A;  4LII A;  1E1M A;  1TYT A;  4JNQ A;  1DJQ A;  3IF9 A;  1KNP A;  5EB4 A;  4DGK A;  4FX9 A;  1Y0P A;  2JB2 A;  4YSY A;  5JCK A;  3UKA A;  3CGD A;  4J36 A;  1D5T A;  4UDR A;  4YSZ A;  5L46 A;  3UKL A;  1K0L A;  2YVF A;  3LB8 A;  4P9S A;  3BHF A;  2WDQ A;  4FK1 A;  1JEH A;  1K0J A;  4USR A;  1BGJ A;  1F3P A;  2V5Z A;  1IUX A;  2R0G A;  3LOV A;  2R4J A;  4TLX A;  3RED A;  3T37 A;  1LTX R;  3UOV A;  2B9Y A;  4GDE A;  3SM8 A;  4EM4 A;  4Y4M A;  3UKQ A;  1JU2 A;  5DBJ A;  1KSU A;  4B65 A;  2A89 A;  2WOW A;  4H4S A;  1QLB A;  4IVM B;  5FS7 A;  3Q9T A;  1ZDL A;  2O9Z A;  1GV4 A;  3KKJ A;  1N4U A;  2IID A;  1LQU A;  2ZZ0 A;  3AEG A;  5HYM A;  2A87 A;  3ALL A;  2RAB A;  2B7R A;  2BXS A;  4JN9 A;  2WOI A;  1GRA A;  3C96 A;  3IHG A;  5J60 A;  4CNJ A;  1EL9 A;  4WCT A;  4DNA A;  4A6N A;  4EIQ A;  3ITJ A;  3DK8 A;  2BS2 A;  2ZZB A;  2GB0 A;  1H7W A;  1DXL A;  2VZ2 A;  3ICS A;  2BYB A;  2WU5 A;  4A99 A;  3P4R A;  2ARD A;  1GND A;  4JY2 A;  1XPQ A;  2Q0L A;  4K5R A;  4U2T A;  4EQX A;  4U8K A;  3UOZ A;  1D4C A;  2YLW A;  1ZK7 A;  4X4J A;  4H4V A;  5IPY A;  1CL0 A;  3QFA A;  4A9W A;  3BNU A;  3FBS A;  1DNC A;  4IV9 A;  3ICT A;  4BK2 A;  5CKU A;  1E7P A;  2WDR A;  3NTA A;  2WP5 A;  4EM3 A;  4U8M A;  3NHO X;  4GDP A;  1DOE A;  2YG4 A;  4O5Q A;  1JRX A;  1CBO A;  1BKW A;  3AD9 B;  3URH A;  1JOA A;  3D8X A;  4CY8 A;  4EQR A;  3VRD B;  3S61 A;  1TRB A;  3QJ4 A;  1VQW A;  2JKC A;  2GRT A;  4H4T A;  1PJ5 A;  2YAU A;  3BNM A;  4H4R A;  4XWR A;  4C74 A;  1CJ3 A;  1VG9 A;  2JK6 A;  3KLJ A; 
#chains in the Genus database with same CATH topology
 3D1C A;  4RSL A;  2JB1 A;  2H88 A;  4EQS A;  1F8S A;  1DJN A;  1CHU A;  2XFP A;  2WPF A;  3ALM A;  5IQ4 A;  4NEV A;  3G5R A;  5KVH A;  3EF6 A;  1JNZ A;  3BI2 A;  1P2H A;  1CF3 A;  3AB1 A;  5BUL A;  1EL7 A;  2Y6Q A;  4OPG A;  3UCL A;  2C72 A;  3UTH A;  2APG A;  3UTF A;  2OLO A;  2WU2 A;  1H7X A;  1N4W A;  2C70 A;  1TDO A;  4J34 A;  4Z26 A;  1TDN A;  2X99 A;  2V61 A;  4IVO B;  5FS9 A;  5BRT A;  3I3L A;  3P4P A;  4DSG A;  4UDQ A;  3NYF A;  4YTP A;  3H4K A;  3RP8 A;  5KWF A;  1DOD A;  2RGJ A;  1LVL A;  3FIM B;  4B64 A;  1XHC A;  1O95 A;  3SZ0 A;  4X9M A;  5C2T A;  4B67 A;  2XVJ A;  2WEU A;  1O5W A;  4APN A;  3PO7 A;  2WPC A;  2XFU A;  3CNP A;  1L0V A;  2V6O A;  1PXA A;  4JNA A;  2BK3 A;  4H50 A;  2VRM A;  3OZ2 A;  2YG3 A;  4Y4N A;  1BZL A;  3PS9 A;  5TR3 A;  3CGB A;  4GUV A;  1LV0 A;  2GMJ A;  2YLT A;  2YLR A;  3GYI A;  3RP6 A;  1L9C A;  2AAQ A;  3NT6 A;  3UTE A;  4A79 A;  3AEC A;  1E39 A;  3FG2 P;  3ALJ A;  3CGE A;  3NTD A;  4OPD A;  1M64 A;  1RYI A;  1Z6L A;  3NNE A;  4TM4 A;  3IHM A;  1F6M A;  2NVK X;  4TM0 A;  1OJA A;  4U8P A;  1ZX9 A;  1L9D A;  4AP3 A;  2VQ7 A;  3VQR A;  2YLS A;  1GAL A;  3DJE A;  4D04 A;  3AD7 B;  3CNT A;  4B69 A;  3UKK A;  3RHA A;  3AEB A;  1KFY A;  5J7X A;  1ZMD A;  5HY5 A;  3FPZ A;  2BAB A;  2YVJ A;  1CC6 A;  2GV8 A;  3B3R A;  4DSH A;  1CC2 A;  4H7U A;  4GAP A;  1Q9I A;  5FS8 A;  3SGL A;  3F8D A;  2DKH A;  1EL8 A;  1M6I A;  2WP9 A;  3L8K A;  2XLU A;  1FEB A;  3ADA B;  4NTC A;  5FMH A;  2Z5X A;  5KVI A;  5EB5 A;  2GR1 A;  2R0P A;  2GAG B;  3V3O A;  2WOV A;  3KPK A;  3V76 A;  3NK1 X;  4Z24 A;  3UKP A;  1COY A;  3CPI G;  4J2W A;  3UP4 A;  5BUK A;  3KD9 A;  2X50 A;  1BF3 A;  2BC0 A;  2ZBW A;  3CGC A;  2BC1 A;  4A6N B;  2EQ8 A;  5C3J A;  4II2 A;  2BCP A;  5KMQ A;  1YQ3 A;  2R46 A;  3EAN A;  4B1B A;  1ZMC A;  3SXI A;  3ATR A;  3ZYX A;  3C4A A;  3RP7 A;  3UOY A;  3SFD A;  2B9X A;  4BV6 A;  3NH3 X;  5KRQ A;  2I0Z A;  2XLP A;  4K5S A;  1H84 A;  2YLZ A;  1GRF A;  1P2E A;  2VQB A;  4I58 A;  3QFB A;  1N1P A;  3DK9 A;  4GF7 A;  4AOX A;  1FCD A;  3KPF A;  3KA7 A;  2YQU A;  4G73 A;  4FDC B;  4EQW A;  3GSI A;  1PBF A;  5JCN A;  1ZOV A;  2WP6 A;  1L9E A;  4Z44 A;  3BI5 A;  4YSX A;  3KVE A;  4FK1 C;  1X31 B;  1GTE A;  4H4Q A;  2F5Z A;  1RP0 A;  1NHR A;  4OCG A;  2XVF A;  1NAA A;  1MOK A;  2QAE A;  4USQ A;  1OJT A;  2HQM A;  3K7T A;  2BK5 A;  3RNM A;  3BHK A;  2ZZC A;  1QJD A;  3GWD A;  3PVC A;  4B66 A;  2BS3 A;  4G6H A;  3DJG X;  2FBW A;  3AE9 A;  3QSE A;  4H4X A;  5KOW A;  2C4C A;  4TM3 A;  4ZCC A;  2WQY A;  4YT0 A;  1KSS A;  1RSG A;  1GTH A;  3AED A;  4O5U A;  1IUW A;  4G74 A;  1GER A;  2YM1 A;  1B4V A;  1GRT A;  2Y6R A;  4CCQ A;  5M10 A;  2H89 A;  5U25 A;  1CJ2 A;  1GRH A;  1H86 A;  3AEF A;  3M0O A;  5GSN A;  5KOX A;  1E1K A;  2JAE A;  3DGH A;  3SYI A;  3LAD A;  4H4Z A;  4U8L A;  3G5S A;  4OPT A;  4NNJ A;  5JCM A;  2FJE A;  1VDC A;  4HB9 A;  4CNK A;  1B37 A;  1JRZ A;  1PBE A;  1S2Y A;  4JQ9 A;  1S3B A;  1OJ9 A;  2E1M A;  2YG5 A;  4B68 A;  2OAL A;  4GRT A;  5IQ1 A;  2FJD A;  3GRS A;  4NEW A;  2Q0K A;  3HZL A;  4K8D A;  4M52 A;  2C75 A;  3AD8 B;  1VG0 A;  1ZP0 A;  2QCU A;  1PXB A;  1ONF A;  4BJY A;  4Z2T A;  1ELI A;  4BK3 A;  3DH9 A;  4U2S A;  4H4P A;  4CRT A;  2WBA A;  4GAV A;  4C77 A;  1DOB A;  1LQT A;  4OPU A;  1OJD A;  4C3X A;  2GVC A;  1V59 A;  3BI4 A;  1H82 A;  1GT8 A;  3CIR A;  1HYU A;  4EIP A;  4YKF A;  4IA6 A;  1GRG A;  1D7Y A;  2GF3 A;  4YTM A;  3NIX A;  2J3N A;  2TMD A;  3AE3 A;  3QSM A;  3P9U A;  1CJ4 A;  2GH5 A;  1NHP A;  4H2P A;  2AQJ A;  1PDH A;  4AOS A;  1B5Q A;  1VRQ B;  3NRN A;  3QSS A;  4BUR A;  2VRL A;  2WET A;  3Q6J A;  5EOW A;  4C3Y A;  1FOH A;  3HYV A;  4GR1 A;  4EMI A;  4H4U A;  2OLN A;  1XAN A;  2XVI A;  3GYX A;  2V3B A;  1EBD A;  2YR5 A;  3VRA A;  1PXC A;  2C3C A;  2CVJ A;  2VVL G;  4CY6 A;  2AR8 A;  3VRB A;  1REO A;  3LZX A;  1H6V A;  1QO8 A;  1E1N A;  4TLZ A;  4AT0 A;  2C76 A;  2YLX A;  3AE5 A;  4K7Z A;  2GQW A;  1NHS A;  1EL5 A;  1YY5 A;  3CN8 A;  3ISH A;  3NLC A;  4HA6 A;  5JCI A;  1KF6 A;  3O0H A;  4G6G A;  2CDU A;  2YWL A;  3KU9 A;  4J33 A;  3E1T A;  4A7A A;  2YR4 A;  3CPH G;  5EBK A;  1NEN A;  2B76 A;  4H2Q A;  3UTG A;  3CND A;  2EQ7 A;  4LU6 A;  1S3E A;  4OPL A;  4CCR A;  3GD3 A;  2X8H A;  3CMM A;  3GMC A;  4YKG A;  3M13 A;  3NN0 X;  2Q7V A;  4EMW A;  4OPC A;  1KNR A;  2C3D A;  3IC9 A;  3OC4 A;  5CQF A;  1LPF A;  3AEA A;  2GR3 A;  3K7Q X;  4XWZ A;  5M0Z A;  3SZW A;  3HYX A;  4OVI A;  5U1O A;  1NG3 A;  3AE2 A;  3CPJ G;  4NZH A;  1GSN A;  1ZY8 A;  2X3N A;  3G5Q A;  4RG3 A;  2OAM A;  1GXF A;  2WES A;  2XVE A;  2X8C A;  2XVH A;  4YXD A;  5KNL A;  4GCM A;  3T31 A;  1SEZ A;  1MXT A;  1Q1W A;  5KXJ A;  1K0I A;  5GRT A;  3GDP A;  2JBV A;  2UZZ A;  3H8L A;  2XLT A;  4U8I A;  5U63 A;  1Q1R A;  2YVG A;  4ZN0 A;  2R0C A;  2QA1 A;  3AEE A;  3V3N A;  1O94 A;  4G9K A;  2GAH B;  4ICY A;  3LXD A;  1N4V A;  3F8P A;  3QVP A;  2QA2 A;  1S2Q A;  2XFO A;  2GEW A;  2RGO A;  3NYE A;  2JB3 A;  4JDR A;  1GPE A;  3EPT A;  3ICR A;  3AE1 A;  3S5W A;  3CTY A;  2BS4 A;  4ADW A;  4J31 A;  1NPX A;  3AE8 A;  4JY3 A;  2XDO A;  4N9X A;  4Z2R A;  1ZOY A;  2EQ6 A;  5JCL A;  4A5L A;  2C66 A;  1TYP A;  3AYI A;  4OPI A;  3WE0 A;  2V60 A;  4BK1 A;  4NTD A;  4ZCD A;  4H2R A;  3DA1 A;  2DKI A;  4NWZ A;  4I59 A;  1K4Q A;  2GR0 A;  4B63 A;  4EMJ A;  3I6D A;  2C65 A;  4UP3 A;  1BWC A;  3II4 A;  4U8N A;  2ACZ A;  4X9N A;  1D7L A;  4Z43 A;  1FEA A;  3R9U A;  2R45 A;  4H4Y A;  3FMW A;  2NPX A;  2B7S A;  1XDI A;  3CNJ A;  3P4Q A;  4YWO A;  5HHF A;  2WHD A;  3UP5 A;  2YM2 A;  4U2L A;  3GD4 A;  4CBQ A;  1NHQ A;  1IUS A;  2XLS A;  1NEK A;  1UKV G;  3GMB A;  4Z25 A;  1FL2 A;  1GES A;  2BAC A;  3LJP A;  1NDA A;  2YG7 A;  4K2X A;  3NG7 X;  2WS3 A;  1TDF A;  4REK A;  2TPR A;  1PBB A;  3DJD A;  5ER0 A;  2PYX A;  1KDG A;  1AOG A;  5BVA A;  1D4E A;  1PS9 A;  1PN0 A;  2XCG A;  3CNS A;  2WPE A;  3UKF A;  2BK4 A;  4J56 A;  4U8J A;  4H2N A;  1PBC A;  3T0K A;  2XFQ A;  2IVD A;  3COX A;  3DME A;  2Q6U A;  4BJZ A;  3DJJ A;  1PJ6 A;  2WDV A;  1IUT A;  3T2Y A;  4J57 A;  1E1L A;  3NYC A;  3K30 A;  2YG6 A;  2BA9 A;  4NTE A;  2BCG G;  3AE6 A;  1TDK A;  2W0H A;  3LZW A;  3SY4 A;  3DK4 A;  1YKJ A;  2R9Z A;  3JSK A;  3QVR A;  1IUU A;  2CFY A;  1H81 A;  4IA5 A;  4II3 A;  3IWA A;  1YQZ A;  3ABV A;  3P1W A;  4PAA A;  5FS6 A;  1BGN A;  2FJB A;  1E6E A;  1FEC A;  3NGC X;  2VOU A;  1D4D A;  1JNR A;  3F8R A;  2IVE A;  1CJC A;  2V3A A;  3NN6 X;  4KPR A;  3GDN A;  1PBD A;  4U8O A;  1NG4 A;  4AP1 A;  3UOX A;  3K7M X;  3AYJ A;  3NKS A;  4MJW A;  3ZDN A;  1B8S A;  2B9W A;  2RGH A;  1GOS A;  3P4S A;  1YQ4 A;  4Z2U A;  3VR8 A;  2YR6 A;  2GMH A;  3C4N A;  1F8R A;  4H4W A;  3VR9 A;  1H83 A;  2CUL A;  2Z5Y A;  4XXG A;  1GRB A;  1CC4 A;  2E5V A;  1PJ7 A;  1OJC A;  1W4X A;  2A8X A;  1IJH A;  3SX6 A;  3GWF A;  2VVM A;  2XFN A;  1Y56 B;  3DGZ A;  3GYJ A;  2E4G A;  1F8W A;  2C73 A;  3AE7 A;  3AXB A;  3AWI A;  4WX1 A;  4YSH A;  4ECH A;  5HXI A;  1Y56 A;  2R4E A;  5LV9 A;  4E0V A;  2XYO A;  4UDP A;  1LJ1 A;  4D03 A;  2VVL A;  2GR2 A;  4K22 A;  3B6D A;  3H8I A;  4PAB A;  4Y4L A;  3NK0 X;  3UKH A;  2C67 A;  2PHH A;  4A65 A;  1GRE A;  1JRY A;  1TDE A;  2C64 A;  4TM1 A;  2BXR A;  3SQP A;  3AE4 A;  3AYL A;  1GEU A;  1GET A;  2OA1 A;  2X8G A;  1ZKQ A;  2FJA A;  2C7G A;  4YTN A;  2EQ9 A;  5KMR A;  3ATQ A;  4KX6 A;  1IUV A;  1DOC A;  5KMP A;  3M12 A;  3EAO A;  1PHH A;  3L1R A;  2XLR A;  4LA1 A;  1MO9 A;  4AT2 A;  3GRT A;  3NK2 X;  4C5O A;  2GQF A;  3SFE A;  3T2Z A;  5KMS A;  4RG4 A;  4LII A;  1E1M A;  1TYT A;  4JNQ A;  1DJQ A;  3IF9 A;  1KNP A;  5EB4 A;  4DGK A;  4FX9 A;  1Y0P A;  2JB2 A;  4YSY A;  5JCK A;  3UKA A;  3CGD A;  4J36 A;  1D5T A;  4UDR A;  4YSZ A;  5L46 A;  3UKL A;  1K0L A;  2YVF A;  3LB8 A;  4P9S A;  3BHF A;  2WDQ A;  4FK1 A;  1JEH A;  1K0J A;  4USR A;  1BGJ A;  1F3P A;  2V5Z A;  1IUX A;  2R0G A;  3LOV A;  2R4J A;  4TLX A;  3RED A;  3T37 A;  1LTX R;  3UOV A;  2B9Y A;  3HYW A;  4GDE A;  2BRA A;  3SM8 A;  4EM4 A;  4Y4M A;  3UKQ A;  1JU2 A;  5DBJ A;  1KSU A;  4B65 A;  2A89 A;  2WOW A;  4H4S A;  1QLB A;  4IVM B;  5FS7 A;  3Q9T A;  1ZDL A;  2O9Z A;  1GV4 A;  3KKJ A;  1N4U A;  2IID A;  1LQU A;  2ZZ0 A;  3AEG A;  5HYM A;  2A87 A;  3ALL A;  2RAB A;  2B7R A;  2BXS A;  3T2K A;  4JN9 A;  2WOI A;  1GRA A;  3C96 A;  3IHG A;  5J60 A;  4CNJ A;  1EL9 A;  4WCT A;  4DNA A;  4A6N A;  4EIQ A;  3ITJ A;  3DK8 A;  2BS2 A;  2ZZB A;  2GB0 A;  1H7W A;  2BRY A;  1DXL A;  2VZ2 A;  3ICS A;  2BYB A;  2WU5 A;  4A99 A;  3P4R A;  2ARD A;  1GND A;  4JY2 A;  1XPQ A;  2Q0L A;  4K5R A;  4U2T A;  3T14 A;  4EQX A;  4U8K A;  3UOZ A;  1D4C A;  2YLW A;  1ZK7 A;  4X4J A;  4H4V A;  5IPY A;  1CL0 A;  3QFA A;  4A9W A;  3BNU A;  3FBS A;  1DNC A;  4IV9 A;  3ICT A;  4BK2 A;  5CKU A;  1E7P A;  2WDR A;  3NTA A;  2WP5 A;  4EM3 A;  4U8M A;  3NHO X;  4GDP A;  3SZC A;  1DOE A;  2YG4 A;  4O5Q A;  1JRX A;  1CBO A;  1BKW A;  3AD9 B;  3URH A;  1JOA A;  3D8X A;  4CY8 A;  4EQR A;  3SZF A;  3VRD B;  3S61 A;  1TRB A;  3QJ4 A;  1VQW A;  2JKC A;  2GRT A;  4H4T A;  1PJ5 A;  2YAU A;  3BNM A;  4H4R A;  4XWR A;  4C74 A;  1CJ3 A;  1VG9 A;  2JK6 A;  3KLJ A; 
#chains in the Genus database with same CATH homology
 3D1C A;  4RSL A;  2JB1 A;  2H88 A;  4EQS A;  1F8S A;  1DJN A;  1CHU A;  2XFP A;  2WPF A;  3ALM A;  5IQ4 A;  4NEV A;  3G5R A;  5KVH A;  3EF6 A;  1JNZ A;  3BI2 A;  1P2H A;  1CF3 A;  3AB1 A;  5BUL A;  1EL7 A;  2Y6Q A;  4OPG A;  3UCL A;  2C72 A;  3UTH A;  2APG A;  3UTF A;  2OLO A;  2WU2 A;  1H7X A;  1N4W A;  2C70 A;  1TDO A;  4J34 A;  4Z26 A;  1TDN A;  2X99 A;  2V61 A;  4IVO B;  5FS9 A;  5BRT A;  3I3L A;  3P4P A;  4DSG A;  4UDQ A;  3NYF A;  4YTP A;  3H4K A;  3RP8 A;  5KWF A;  1DOD A;  2RGJ A;  1LVL A;  3FIM B;  4B64 A;  1XHC A;  1O95 A;  3SZ0 A;  4X9M A;  5C2T A;  4B67 A;  2XVJ A;  2WEU A;  1O5W A;  4APN A;  3PO7 A;  2WPC A;  2XFU A;  3CNP A;  1L0V A;  2V6O A;  1PXA A;  4JNA A;  2BK3 A;  4H50 A;  2VRM A;  3OZ2 A;  2YG3 A;  4Y4N A;  1BZL A;  3PS9 A;  5TR3 A;  3CGB A;  4GUV A;  1LV0 A;  2GMJ A;  2YLT A;  2YLR A;  3GYI A;  3RP6 A;  1L9C A;  2AAQ A;  3NT6 A;  3UTE A;  4A79 A;  3AEC A;  1E39 A;  3FG2 P;  3ALJ A;  3CGE A;  3NTD A;  4OPD A;  1M64 A;  1RYI A;  1Z6L A;  3NNE A;  4TM4 A;  3IHM A;  1F6M A;  2NVK X;  4TM0 A;  1OJA A;  4U8P A;  1ZX9 A;  1L9D A;  4AP3 A;  2VQ7 A;  3VQR A;  2YLS A;  1GAL A;  3DJE A;  4D04 A;  3AD7 B;  3CNT A;  4B69 A;  3UKK A;  3RHA A;  3AEB A;  1KFY A;  5J7X A;  1ZMD A;  5HY5 A;  3FPZ A;  2BAB A;  2YVJ A;  1CC6 A;  2GV8 A;  3B3R A;  4DSH A;  1CC2 A;  4H7U A;  4GAP A;  1Q9I A;  5FS8 A;  3SGL A;  3F8D A;  2DKH A;  1EL8 A;  1M6I A;  2WP9 A;  3L8K A;  2XLU A;  1FEB A;  3ADA B;  4NTC A;  5FMH A;  2Z5X A;  5KVI A;  5EB5 A;  2GR1 A;  2R0P A;  2GAG B;  3V3O A;  2WOV A;  3KPK A;  3V76 A;  3NK1 X;  4Z24 A;  3UKP A;  1COY A;  3CPI G;  4J2W A;  3UP4 A;  5BUK A;  3KD9 A;  2X50 A;  1BF3 A;  2BC0 A;  2ZBW A;  3CGC A;  2BC1 A;  4A6N B;  2EQ8 A;  5C3J A;  4II2 A;  2BCP A;  5KMQ A;  1YQ3 A;  2R46 A;  3EAN A;  4B1B A;  1ZMC A;  3SXI A;  3ATR A;  3ZYX A;  3C4A A;  3RP7 A;  3UOY A;  3SFD A;  2B9X A;  4BV6 A;  3NH3 X;  5KRQ A;  2I0Z A;  2XLP A;  4K5S A;  1H84 A;  2YLZ A;  1GRF A;  1P2E A;  2VQB A;  4I58 A;  3QFB A;  1N1P A;  3DK9 A;  4GF7 A;  4AOX A;  1FCD A;  3KPF A;  3KA7 A;  2YQU A;  4G73 A;  4FDC B;  4EQW A;  3GSI A;  1PBF A;  5JCN A;  1ZOV A;  2WP6 A;  1L9E A;  4Z44 A;  3BI5 A;  4YSX A;  3KVE A;  4FK1 C;  1X31 B;  1GTE A;  4H4Q A;  2F5Z A;  1RP0 A;  1NHR A;  4OCG A;  2XVF A;  1NAA A;  1MOK A;  2QAE A;  4USQ A;  1OJT A;  2HQM A;  3K7T A;  2BK5 A;  3RNM A;  3BHK A;  2ZZC A;  1QJD A;  3GWD A;  3PVC A;  4B66 A;  2BS3 A;  4G6H A;  3DJG X;  2FBW A;  3AE9 A;  3QSE A;  4H4X A;  5KOW A;  2C4C A;  4TM3 A;  4ZCC A;  2WQY A;  4YT0 A;  1KSS A;  1RSG A;  1GTH A;  3AED A;  4O5U A;  1IUW A;  4G74 A;  1GER A;  2YM1 A;  1B4V A;  1GRT A;  2Y6R A;  4CCQ A;  5M10 A;  2H89 A;  5U25 A;  1CJ2 A;  1GRH A;  1H86 A;  3AEF A;  3M0O A;  5GSN A;  5KOX A;  1E1K A;  2JAE A;  3DGH A;  3SYI A;  3LAD A;  4H4Z A;  4U8L A;  3G5S A;  4OPT A;  4NNJ A;  5JCM A;  2FJE A;  1VDC A;  4HB9 A;  4CNK A;  1B37 A;  1JRZ A;  1PBE A;  1S2Y A;  4JQ9 A;  1S3B A;  1OJ9 A;  2E1M A;  2YG5 A;  4B68 A;  2OAL A;  4GRT A;  5IQ1 A;  2FJD A;  3GRS A;  4NEW A;  2Q0K A;  3HZL A;  4K8D A;  4M52 A;  2C75 A;  3AD8 B;  1VG0 A;  1ZP0 A;  2QCU A;  1PXB A;  1ONF A;  4BJY A;  4Z2T A;  1ELI A;  4BK3 A;  3DH9 A;  4U2S A;  4H4P A;  4CRT A;  2WBA A;  4GAV A;  4C77 A;  1DOB A;  1LQT A;  4OPU A;  1OJD A;  4C3X A;  2GVC A;  1V59 A;  3BI4 A;  1H82 A;  1GT8 A;  3CIR A;  1HYU A;  4EIP A;  4YKF A;  4IA6 A;  1GRG A;  1D7Y A;  2GF3 A;  4YTM A;  3NIX A;  2J3N A;  2TMD A;  3AE3 A;  3QSM A;  3P9U A;  1CJ4 A;  2GH5 A;  1NHP A;  4H2P A;  2AQJ A;  1PDH A;  4AOS A;  1B5Q A;  1VRQ B;  3NRN A;  3QSS A;  4BUR A;  2VRL A;  2WET A;  3Q6J A;  5EOW A;  4C3Y A;  1FOH A;  3HYV A;  4GR1 A;  4EMI A;  4H4U A;  2OLN A;  1XAN A;  2XVI A;  3GYX A;  2V3B A;  1EBD A;  2YR5 A;  3VRA A;  1PXC A;  2C3C A;  2CVJ A;  2VVL G;  4CY6 A;  2AR8 A;  3VRB A;  1REO A;  3LZX A;  1H6V A;  1QO8 A;  1E1N A;  4TLZ A;  4AT0 A;  2C76 A;  2YLX A;  3AE5 A;  4K7Z A;  2GQW A;  1NHS A;  1EL5 A;  1YY5 A;  3CN8 A;  3ISH A;  3NLC A;  4HA6 A;  5JCI A;  1KF6 A;  3O0H A;  4G6G A;  2CDU A;  2YWL A;  3KU9 A;  4J33 A;  3E1T A;  4A7A A;  2YR4 A;  3CPH G;  5EBK A;  1NEN A;  2B76 A;  4H2Q A;  3UTG A;  3CND A;  2EQ7 A;  4LU6 A;  1S3E A;  4OPL A;  4CCR A;  3GD3 A;  2X8H A;  3CMM A;  3GMC A;  4YKG A;  3M13 A;  3NN0 X;  2Q7V A;  4EMW A;  4OPC A;  1KNR A;  2C3D A;  3IC9 A;  3OC4 A;  5CQF A;  1LPF A;  3AEA A;  2GR3 A;  3K7Q X;  4XWZ A;  5M0Z A;  3SZW A;  3HYX A;  4OVI A;  5U1O A;  1NG3 A;  3AE2 A;  3CPJ G;  4NZH A;  1GSN A;  1ZY8 A;  2X3N A;  3G5Q A;  4RG3 A;  2OAM A;  1GXF A;  2WES A;  2XVE A;  2X8C A;  2XVH A;  4YXD A;  5KNL A;  4GCM A;  3T31 A;  1SEZ A;  1MXT A;  1Q1W A;  5KXJ A;  1K0I A;  5GRT A;  3GDP A;  2JBV A;  2UZZ A;  3H8L A;  2XLT A;  4U8I A;  5U63 A;  1Q1R A;  2YVG A;  4ZN0 A;  2R0C A;  2QA1 A;  3AEE A;  3V3N A;  1O94 A;  4G9K A;  2GAH B;  4ICY A;  3LXD A;  1N4V A;  3F8P A;  3QVP A;  2QA2 A;  1S2Q A;  2XFO A;  2GEW A;  2RGO A;  3NYE A;  2JB3 A;  4JDR A;  1GPE A;  3EPT A;  3ICR A;  3AE1 A;  3S5W A;  3CTY A;  2BS4 A;  4ADW A;  4J31 A;  1NPX A;  3AE8 A;  4JY3 A;  2XDO A;  4N9X A;  4Z2R A;  1ZOY A;  2EQ6 A;  5JCL A;  4A5L A;  2C66 A;  1TYP A;  3AYI A;  4OPI A;  3WE0 A;  2V60 A;  4BK1 A;  4NTD A;  4ZCD A;  4H2R A;  3DA1 A;  2DKI A;  4NWZ A;  4I59 A;  1K4Q A;  2GR0 A;  4B63 A;  4EMJ A;  3I6D A;  2C65 A;  4UP3 A;  1BWC A;  3II4 A;  4U8N A;  2ACZ A;  4X9N A;  1D7L A;  4Z43 A;  1FEA A;  3R9U A;  2R45 A;  4H4Y A;  3FMW A;  2NPX A;  2B7S A;  1XDI A;  3CNJ A;  3P4Q A;  4YWO A;  5HHF A;  2WHD A;  3UP5 A;  2YM2 A;  4U2L A;  3GD4 A;  4CBQ A;  1NHQ A;  1IUS A;  2XLS A;  1NEK A;  1UKV G;  3GMB A;  4Z25 A;  1FL2 A;  1GES A;  2BAC A;  3LJP A;  1NDA A;  2YG7 A;  4K2X A;  3NG7 X;  2WS3 A;  1TDF A;  4REK A;  2TPR A;  1PBB A;  3DJD A;  5ER0 A;  2PYX A;  1KDG A;  1AOG A;  5BVA A;  1D4E A;  1PS9 A;  1PN0 A;  2XCG A;  3CNS A;  2WPE A;  3UKF A;  2BK4 A;  4J56 A;  4U8J A;  4H2N A;  1PBC A;  3T0K A;  2XFQ A;  2IVD A;  3COX A;  3DME A;  2Q6U A;  4BJZ A;  3DJJ A;  1PJ6 A;  2WDV A;  1IUT A;  3T2Y A;  4J57 A;  1E1L A;  3NYC A;  3K30 A;  2YG6 A;  2BA9 A;  4NTE A;  2BCG G;  3AE6 A;  1TDK A;  2W0H A;  3LZW A;  3SY4 A;  3DK4 A;  1YKJ A;  2R9Z A;  3JSK A;  3QVR A;  1IUU A;  2CFY A;  1H81 A;  4IA5 A;  4II3 A;  3IWA A;  1YQZ A;  3ABV A;  3P1W A;  4PAA A;  5FS6 A;  1BGN A;  2FJB A;  1E6E A;  1FEC A;  3NGC X;  2VOU A;  1D4D A;  1JNR A;  3F8R A;  2IVE A;  1CJC A;  2V3A A;  3NN6 X;  4KPR A;  3GDN A;  1PBD A;  4U8O A;  1NG4 A;  4AP1 A;  3UOX A;  3K7M X;  3AYJ A;  3NKS A;  4MJW A;  3ZDN A;  1B8S A;  2B9W A;  2RGH A;  1GOS A;  3P4S A;  1YQ4 A;  4Z2U A;  3VR8 A;  2YR6 A;  2GMH A;  3C4N A;  1F8R A;  4H4W A;  3VR9 A;  1H83 A;  2CUL A;  2Z5Y A;  4XXG A;  1GRB A;  1CC4 A;  2E5V A;  1PJ7 A;  1OJC A;  1W4X A;  2A8X A;  1IJH A;  3SX6 A;  3GWF A;  2VVM A;  2XFN A;  1Y56 B;  3DGZ A;  3GYJ A;  2E4G A;  1F8W A;  2C73 A;  3AE7 A;  3AXB A;  3AWI A;  4WX1 A;  4YSH A;  4ECH A;  5HXI A;  1Y56 A;  2R4E A;  5LV9 A;  4E0V A;  2XYO A;  4UDP A;  1LJ1 A;  4D03 A;  2VVL A;  2GR2 A;  4K22 A;  3B6D A;  3H8I A;  4PAB A;  4Y4L A;  3NK0 X;  3UKH A;  2C67 A;  2PHH A;  4A65 A;  1GRE A;  1JRY A;  1TDE A;  2C64 A;  4TM1 A;  2BXR A;  3SQP A;  3AE4 A;  3AYL A;  1GEU A;  1GET A;  2OA1 A;  2X8G A;  1ZKQ A;  2FJA A;  2C7G A;  4YTN A;  2EQ9 A;  5KMR A;  3ATQ A;  4KX6 A;  1IUV A;  1DOC A;  5KMP A;  3M12 A;  3EAO A;  1PHH A;  3L1R A;  2XLR A;  4LA1 A;  1MO9 A;  4AT2 A;  3GRT A;  3NK2 X;  4C5O A;  2GQF A;  3SFE A;  3T2Z A;  5KMS A;  4RG4 A;  4LII A;  1E1M A;  1TYT A;  4JNQ A;  1DJQ A;  3IF9 A;  1KNP A;  5EB4 A;  4DGK A;  4FX9 A;  1Y0P A;  2JB2 A;  4YSY A;  5JCK A;  3UKA A;  3CGD A;  4J36 A;  1D5T A;  4UDR A;  4YSZ A;  5L46 A;  3UKL A;  1K0L A;  2YVF A;  3LB8 A;  4P9S A;  3BHF A;  2WDQ A;  4FK1 A;  1JEH A;  1K0J A;  4USR A;  1BGJ A;  1F3P A;  2V5Z A;  1IUX A;  2R0G A;  3LOV A;  2R4J A;  4TLX A;  3RED A;  3T37 A;  1LTX R;  3UOV A;  2B9Y A;  3HYW A;  4GDE A;  2BRA A;  3SM8 A;  4EM4 A;  4Y4M A;  3UKQ A;  1JU2 A;  5DBJ A;  1KSU A;  4B65 A;  2A89 A;  2WOW A;  4H4S A;  1QLB A;  4IVM B;  5FS7 A;  3Q9T A;  1ZDL A;  2O9Z A;  1GV4 A;  3KKJ A;  1N4U A;  2IID A;  1LQU A;  2ZZ0 A;  3AEG A;  5HYM A;  2A87 A;  3ALL A;  2RAB A;  2B7R A;  2BXS A;  3T2K A;  4JN9 A;  2WOI A;  1GRA A;  3C96 A;  3IHG A;  5J60 A;  4CNJ A;  1EL9 A;  4WCT A;  4DNA A;  4A6N A;  4EIQ A;  3ITJ A;  3DK8 A;  2BS2 A;  2ZZB A;  2GB0 A;  1H7W A;  2BRY A;  1DXL A;  2VZ2 A;  3ICS A;  2BYB A;  2WU5 A;  4A99 A;  3P4R A;  2ARD A;  1GND A;  4JY2 A;  1XPQ A;  2Q0L A;  4K5R A;  4U2T A;  3T14 A;  4EQX A;  4U8K A;  3UOZ A;  1D4C A;  2YLW A;  1ZK7 A;  4X4J A;  4H4V A;  5IPY A;  1CL0 A;  3QFA A;  4A9W A;  3BNU A;  3FBS A;  1DNC A;  4IV9 A;  3ICT A;  4BK2 A;  5CKU A;  1E7P A;  2WDR A;  3NTA A;  2WP5 A;  4EM3 A;  4U8M A;  3NHO X;  4GDP A;  3SZC A;  1DOE A;  2YG4 A;  4O5Q A;  1JRX A;  1CBO A;  1BKW A;  3AD9 B;  3URH A;  1JOA A;  3D8X A;  4CY8 A;  4EQR A;  3SZF A;  3VRD B;  3S61 A;  1TRB A;  3QJ4 A;  1VQW A;  2JKC A;  2GRT A;  4H4T A;  1PJ5 A;  2YAU A;  3BNM A;  4H4R A;  4XWR A;  4C74 A;  1CJ3 A;  1VG9 A;  2JK6 A;  3KLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...