3LZXA

Crystal structure of ferredoxin-nadp+ oxidoreductase from bacillus subtilis (form ii)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
329
structure length
329
Chain Sequence
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAGFPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAGNGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEVSIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEIDDLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGFGEAPTAVNNAKAYMDPKARVQPLHSTSLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin--NADP reductase 2
publication title Crystal structure analysis of Bacillus subtilis ferredoxin-NADP(+) oxidoreductase and the structural basis for its substrate selectivity
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 92
structure length 329
sequence length 329
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3lzxA02
5JCNA 2YLRA 4H4ZA 3UOXA 2J3NA 1GERA 2VZ2A 3NK0X 5M10A 1E6EA 3DA1A 4B63A 2IIDA 1Y56A 2C3DA 4AOSA 2GB0A 3ALMA 3SFDA 2BK3A 1Z6LA 3SM8A 2XLRA 2Z5XA 2X8CA 1BKWA 5HY5A 4EQRA 1SEZA 2I0ZA 1LPFA 4U8LA 4JQ9A 2BCGG 2JBVA 2C76A 2RGHA 3ADAB 1CC4A 2GR0A 3B6DA 3DK4A 1UKVG 2YAUA 2R0CA 1YKJA 3P4SA 3QFAA 3KLJA 1E1NA 1OJDA 4Y4MA 1GPEA 2UZZA 1ZKQA 4H4SA 1NHRA 4IVMB 1X31B 4HA6A 2XFNA 4DNAA 3AECA 5L46A 1GRTA 1JNZA 2DKHA 3IF9A 4XWZA 2XFOA 4TM1A 3UCLA 1IUVA 1TYPA 1VG9A 1ZY8A 4BJYA 1GRGA 2BC1A 1GTEA 4B69A 2VRMA 3VRDB 4JY3A 2XLTA 4NTDA 1D5TA 3G5QA 3QSEA 4A6NB 1KNRA 4Z44A 5KOWA 1GRFA 1PDHA 1TYTA 2WETA 3FMWA 1S2YA 3R9UA 4CY8A 1D4DA 3ZDNA 4YSHA 4ZCDA 4YSXA 1IUWA 4WX1A 1LV0A 2QAEA 2XFPA 3AE4A 2B7RA 3AD8B 3CGCA 3KU9A 5M0ZA 4K22A 1DJNA 4Z25A 4C3XA 3AYJA 3K7MX 1PJ5A 3IC9A 5LV9A 2B9WA 4H4RA 4Y4LA 2XFQA 2YLWA 2CFYA 2H88A 4Z24A 1OJAA 3EF6A 3QSMA 4H4QA 4YT0A 2OLOA 3AXBA 4C74A 1B8SA 1NHPA 2B7SA 2GV8A 3I3LA 3K7QX 4K5RA 3K7TA 4TLZA 2WOWA 3KD9A 3NRNA 5BVAA 1O5WA 1PN0A 3CNPA 3QJ4A 4RSLA 2C7GA 3QFBA 5KXJA 1PBDA 1KNPA 2R0GA 5KVHA 1NPXA 5C3JA 3V3NA 1NENA 4A79A 4I59A 1DXLA 2CVJA 3G5RA 1S3EA 2C67A 3M13A 2R9ZA 1TRBA 3VRAA 1GSNA 3FPZA 3QVPA 4KPRA 1NDAA 3URHA 3DGHA 3EAOA 4A5LA 3AEEA 2VVLA 3NYCA 3VR8A 2XLSA 4RG4A 2XVJA 4J2WA 2WPEA 1KF6A 4YWOA 5JCIA 4EIQA 3BHKA 2JB3A 3H8LA 3DMEA 4UDRA 4YXDA 2R46A 5IPYA 1K4QA 2V6OA 4H50A 2FJBA 2GR1A 2C72A 5HYMA 4NEVA 1E1LA 5EBKA 4APNA 1E39A 2BS4A 2GF3A 2V61A 4USRA 1BZLA 2EQ6A 3GWDA 3NYEA 4YKFA 1XHCA 2VOUA 4IVOB 1JNRA 1PJ7A 3ZYXA 2JB2A 2GAHB 3AE5A 3DJEA 4H2PA 4H2NA 2V5ZA 1MOKA 1ZOVA 4U8MA 4B67A 4K2XA 3KKJA 4U8IA 1GT8A 2YG6A 3DJJA 1LQUA 4ICYA 3ICRA 3VRBA 2OAMA 2B9YA 2XVEA 2BK4A 2BS2A 3PS9A 4H4UA 5U1OA 4CRTA 2WS3A 2BS3A 2WP9A 3LXDA 3DH9A 1JU2A 2GVCA 2Y6RA 3UP5A 3GMCA 4D04A 5EB4A 1M64A 3CNJA 4WCTA 4MJWA 3CIRA 2GQWA 3NLCA 2RGOA 2CULA 4GUVA 4PABA 2EQ9A 1DOBA 4IV9A 2TPRA 1H7WA 3M0OA 4REKA 4CBQA 1B37A 2WDQA 4TM4A 3LJPA 2XYOA 2GH5A 4J56A 1H82A 2WBAA 3F8RA 2AQJA 3GD3A 3IHGA 5FS9A 3L1RA 1BGNA 4USQA 4J33A 4M52A 4I58A 5GRTA 3GDPA 2IVDA 1K0JA 1CJCA 2WU2A 3RP6A 4BV6A 2B76A 4H4PA 2EQ8A 4U8NA 1COYA 2ZBWA 4FK1C 2BACA 1YQ3A 1H86A 1GNDA 1E1KA 1CL0A 4Y4NA 1DJQA 2GRTA 1KSUA 2WOIA 5ER0A 4OPLA 3UTEA 2BK5A 2C66A 4GDPA 1E1MA 2GMHA 3AE2A 1CJ3A 2YVGA 1DOEA 2Q0LA 4A99A 3P4QA 2ACZA 4OPDA 2QA2A 3BHFA 3GYJA 3RP7A 1TDEA 3AEFA 3H4KA 2PYXA 1EL9A 4FK1A 5BRTA 3NNEA 4X9MA 4XWRA 4BK2A 4LU6A 1PXCA 2R0PA 2E4GA 3NN0X 4X9NA 4DSGA 2XLUA 1GRBA 4H4XA 3AWIA 1B4VA 4OPTA 3NN6X 1GRHA 2XLPA 2GQFA 3S5WA 1JRXA 1KDGA 1QO8A 3AD9B 3F8PA 2FJAA 2YVJA 3GWFA 3GDNA 4EM3A 4JNQA 1DNCA 2OLNA 3C4NA 1Y0PA 3NKSA 3QSSA 2Q7VA 3QVRA 1CF3A 1XANA 1L9EA 4H4VA 3V76A 3GMBA 3UP4A 4H4TA 1F3PA 4XXGA 1PBBA 3AE8A 2V60A 1CHUA 1MXTA 2WDRA 3B3RA 5HHFA 1RYIA 2WESA 3AE3A 3NK2X 3ABVA 4FX9A 3AB1A 1IJHA 2V3BA 5JCKA 1F8WA 1PBCA 3I6DA 1F6MA 1OJ9A 3LOVA 1Q9IA 2YR6A 3M12A 2DKIA 1ZOYA 1NAAA 3F8DA 1VQWA 3NHOX 3GRTA 1H81A 1BWCA 3REDA 5FS8A 2BABA 1AOGA 3GSIA 3VQRA 3AEAA 3O0HA 5BUKA 2OA1A 2X50A 1CJ4A 3BI5A 1VG0A 3HZLA 1NG4A 3GYIA 3UKPA 3UKKA 3PO7A 2R4JA 1N4VA 2XVHA 2IVEA 3DK8A 1GOSA 3VR9A 1O94A 1FEBA 4GCMA 5EOWA 1FECA 4B68A 4CY6A 2FBWA 3T37A 5KRQA 1VRQB 2PHHA 1FEAA 2A89A 2HQMA 4RG3A 5FMHA 3K30A 4GF7A 2WP5A 2H89A 1H84A 4U8OA 4EIPA 4OPCA 3L8KA 3P4PA 4EMWA 1IUSA 2C70A 3KA7A 2BXSA 1W4XA 5U25A 3CPIG 2Q0KA 1S2QA 2R45A 1JOAA 4PAAA 2Q6UA 3AEGA 3JSKA 2X3NA 4UDPA 4EQXA 2JK6A 4D03A 4EQWA 2X99A 4K7ZA 2GR3A 1D4EA 4DSHA 1GEUA 4EMIA 4K8DA 3COXA 2YWLA 2JB1A 2WOVA 3DK9A 4N9XA 2GR2A 2C3CA 5DBJA 1XPQA 2C73A 1NHQA 1EL5A 3PVCA 1FCDA 4U8KA 4B66A 4C77A 1CC6A 3ICTA 4DGKA 2YG7A 1JRYA 1PJ6A 1EL8A 2WPCA 2ZZCA 2E5VA 4BURA 3CNTA 3S61A 1H7XA 1K0LA 1BGJA 1KFYA 3CNDA 4CCRA 5KVIA 4CCQA 4NEWA 3ATQA 4UP3A 2AR8A 1D7YA 4TM3A 4U8JA 2WEUA 2WP6A 2ZZ0A 5C2TA 3CN8A 2YR5A 3ALJA 1B5QA 1GREA 2XVIA 1BF3A 5GSNA 3RNMA 3UKLA 3Q9TA 3CGEA 4YTPA 4TM0A 1RP0A 3IWAA 3Q6JA 1EL7A 1F8SA 5CKUA 2ARDA 4BK1A 3RP8A 4CNJA 2X8HA 3BNUA 3P4RA 3RHAA 3UKFA 1KSSA 3OZ2A 1PS9A 4B65A 4A7AA 4U8PA 3AE7A 1H6VA 4ZN0A 2B9XA 4IA5A 1V59A 4TLXA 1ZMCA 3NK1X 3WE0A 3AE9A 4O5UA 1DODA 1JEHA 3AE1A 1Y56B 3ITJA 3NTAA 1PBEA 3ALLA 3ISHA 4C3YA 2YLSA 4B1BA 4U2LA 2XCGA 1GXFA 1TDFA 2BC0A 4IA6A 3ICSA 4ZCCA 4JDRA 2CDUA 3CGBA 4FDCB 4NTEA 1YQZA 1YY5A 2GEWA 2YLZA 4KX6A 4Z2RA 4K5SA 1GTHA 1D4CA 1L9DA 2E1MA 1P2EA 2FJEA 2XDOA 3OC4A 1L9CA 3CTYA 4LA1A 2JAEA 4H4WA 4OPGA 3EANA 4GRTA 4YTNA 2AAQA 1HYUA 2RABA 2OALA 2BXRA 4AT0A 2R4EA 3LB8A 3UOYA 4BJZA 3FBSA 3P9UA 4A6NA 3CPJG 2BYBA 2JKCA 1N4UA 1ZDLA 3SQPA 4BK3A 4YKGA 3LZWA 4Z2TA 1DOCA 4P9SA 1GALA 4B64A 3D1CA 1RSGA 4H2QA 4U2SA 1GETA 2XVFA 2A8XA 3KPFA 2ZZBA 3CGDA 1GV4A 1XDIA 4OPUA 5KWFA 4ADWA 2YM2A 2Z5YA 3AEDA 5TR3A 1NEKA 4J36A 3FIMB 3AYLA 3NIXA 2BA9A 2V3AA 2YG5A 3UKAA 5HXIA 2WQYA 2WU5A 5JCMA 3DGZA 2C65A 2QA1A 4X4JA 5J60A 2GAGB 3GRSA 1REOA 3DJGX 4H7UA 1PXAA 4YSZA 1N4WA 1PHHA 5IQ4A 5JCLA 4AP1A 2TMDA 4JY2A 1LVLA 1LTXR 4JNAA 1IUXA 1N1PA 4JN9A 2VVMA 3SGLA 4GR1A 4UDQA 3V3OA 1GESA 4AOXA 1LJ1A 4J34A 4LIIA 1CBOA 1FOHA 1ZX9A 2WPFA 3G5SA 1CJ2A 1D7LA 3II4A 3KVEA 1E7PA 3H8IA 2NPXA 3NTDA 1IUUA 3AYIA 5FS6A 4A9WA 2YR4A 1CC2A 5U63A 4E0VA 3UTFA 3UTHA 1S3BA 4OCGA 2C64A 1O95A 4Z2UA 3BI4A 3LZXA 3AD7B 3E1TA 1GRAA 4CNKA 1ONFA 5CQFA 2YG4A 4OVIA 1L0VA 2F5ZA 3UOVA 1K0IA 1OJTA 4NTCA 2WHDA 2W0HA 1EBDA 4J57A 3GD4A 2Y6QA 3P1WA 4A65A 5J7XA 5EB5A 4YSYA 1PBFA 3NT6A 3FG2P 1ZMDA 5IQ1A 3NYFA 1OJCA 1NHSA 2RGJA 4EMJA 1QLBA 2A87A 1M6IA 2QCUA 1TDNA 3D8XA 4GDEA 1NG3A 2APGA 2VQBA 3AE6A 3ATRA 2BCPA 4EM4A 1TDOA 1JRZA 3CPHG 4Z26A 1PXBA 2O9ZA 1ELIA 2GMJA 4OPIA 3UKQA 3NGCX 4U2TA 1ZK7A 3LADA 4NZHA 3EPTA 1H83A 3NH3X 2XFUA 2YLTA 5FS7A 3DJDA 1FL2A 2FJDA 4EQSA 3UKHA 2VQ7A 2X8GA 1MO9A 1IUTA 1ZP0A 2NVKX 2YVFA 4HB9A 3BNMA 5KOXA 2VVLG 3UOZA 4C5OA 3AEBA 2YQUA 3UTGA 1Q1WA 1TDKA 4H4YA 4J31A 5BULA 1F8RA 4Z43A 1YQ4A 4AP3A 4AT2A 4ECHA 2YG3A 2YM1A 3SFEA 3IHMA 1P2HA 3C96A 1VDCA 3NG7X 1Q1RA 3BI2A 3CNSA 4O5QA 2YLXA 2C75A 1QJDA 4H2RA 4YTMA 1LQTA 2EQ7A 3C4AA 2WDVA 2VRLA
chains in the Genus database with same CATH superfamily
5JCNA 2YLRA 4H4ZA 3UOXA 2J3NA 1GERA 2VZ2A 3NK0X 5M10A 1E6EA 3DA1A 4B63A 2IIDA 1Y56A 2C3DA 4AOSA 2GB0A 3ALMA 3SFDA 2BK3A 1Z6LA 3SM8A 2XLRA 2Z5XA 2X8CA 1BKWA 5HY5A 4EQRA 1SEZA 2I0ZA 1LPFA 4U8LA 4JQ9A 2BCGG 2JBVA 2C76A 2RGHA 3ADAB 1CC4A 2GR0A 3B6DA 3DK4A 1UKVG 2YAUA 2R0CA 1YKJA 3P4SA 3QFAA 3KLJA 1E1NA 1OJDA 4Y4MA 1GPEA 5KMQA 2UZZA 1ZKQA 4H4SA 1NHRA 4IVMB 1X31B 4HA6A 2XFNA 4DNAA 3AECA 5L46A 1GRTA 1JNZA 2DKHA 3IF9A 4XWZA 3SYIA 2XFOA 4TM1A 3UCLA 1IUVA 1TYPA 1VG9A 1ZY8A 4BJYA 1GRGA 3T2KA 2BC1A 1GTEA 4B69A 2VRMA 3VRDB 4JY3A 2XLTA 4NTDA 1D5TA 3G5QA 3QSEA 4A6NB 1KNRA 4Z44A 5KOWA 1GRFA 1PDHA 1TYTA 2WETA 3FMWA 1S2YA 3R9UA 4CY8A 1D4DA 3ZDNA 4YSHA 4ZCDA 4YSXA 1IUWA 4WX1A 1LV0A 2QAEA 2XFPA 3AE4A 2B7RA 3AD8B 3CGCA 3KU9A 5M0ZA 4K22A 1DJNA 4Z25A 4C3XA 3AYJA 3K7MX 1PJ5A 3IC9A 4GAVA 5LV9A 2B9WA 4H4RA 4Y4LA 2XFQA 2YLWA 2CFYA 2H88A 4Z24A 1OJAA 3EF6A 3QSMA 4H4QA 4YT0A 2OLOA 3AXBA 4C74A 1B8SA 5KMPA 3GYXA 1NHPA 2B7SA 2GV8A 3I3LA 3K7QX 4K5RA 3K7TA 4TLZA 2WOWA 3KD9A 3NRNA 5BVAA 1O5WA 1PN0A 3CNPA 3QJ4A 4RSLA 2C7GA 4G9KA 3QFBA 5KXJA 1PBDA 1KNPA 2R0GA 5KVHA 1NPXA 5C3JA 3V3NA 1NENA 4A79A 4I59A 1DXLA 2CVJA 3G5RA 1S3EA 2C67A 3M13A 2R9ZA 1TRBA 3VRAA 1GSNA 3FPZA 3QVPA 4KPRA 1NDAA 3URHA 3DGHA 3EAOA 4A5LA 3AEEA 2VVLA 3NYCA 3VR8A 2XLSA 4RG4A 2XVJA 4J2WA 2WPEA 1KF6A 4YWOA 5JCIA 4EIQA 3BHKA 2JB3A 3H8LA 3DMEA 4UDRA 4YXDA 2R46A 5IPYA 1K4QA 2V6OA 4H50A 2FJBA 2GR1A 2C72A 5HYMA 4NEVA 1E1LA 5EBKA 4APNA 1E39A 2BS4A 2GF3A 2V61A 4USRA 1BZLA 2EQ6A 3GWDA 3NYEA 4YKFA 1XHCA 2VOUA 4IVOB 1JNRA 1PJ7A 3ZYXA 2C4CA 2JB2A 2GAHB 3AE5A 3DJEA 4H2PA 4H2NA 2V5ZA 1MOKA 1ZOVA 4U8MA 4B67A 4K2XA 3KKJA 4U8IA 1GT8A 2YG6A 3DJJA 1LQUA 4ICYA 3ICRA 3VRBA 3T31A 2OAMA 2B9YA 2XVEA 2BK4A 2BS2A 3PS9A 4H4UA 5U1OA 4CRTA 2WS3A 2BS3A 2WP9A 3LXDA 3DH9A 1JU2A 2GVCA 2Y6RA 3UP5A 3GMCA 4D04A 5EB4A 1M64A 3CNJA 4WCTA 4G6GA 3CIRA 2GQWA 3NLCA 4MJWA 2RGOA 2CULA 4GUVA 4PABA 2EQ9A 1DOBA 4IV9A 2TPRA 1H7WA 3M0OA 4REKA 4CBQA 1B37A 2WDQA 4G73A 3LJPA 2XYOA 4TM4A 2GH5A 4J56A 1H82A 2WBAA 4II2A 3F8RA 2AQJA 3GD3A 3IHGA 5FS9A 3L1RA 1BGNA 4USQA 4J33A 4M52A 4I58A 5GRTA 3GDPA 2IVDA 3HYXA 1K0JA 1CJCA 2WU2A 3SZFA 3RP6A 4BV6A 2B76A 4H4PA 2EQ8A 4U8NA 1COYA 2ZBWA 4FK1C 2BACA 1YQ3A 1H86A 1GNDA 1E1KA 1CL0A 4Y4NA 1DJQA 2GRTA 1KSUA 2WOIA 5ER0A 4OPLA 4GAPA 3UTEA 2BK5A 2C66A 4GDPA 1E1MA 2GMHA 3AE2A 1CJ3A 2YVGA 1DOEA 2Q0LA 4A99A 3P4QA 2ACZA 4OPDA 2QA2A 3BHFA 3GYJA 4G74A 1TDEA 3AEFA 3RP7A 3H4KA 2PYXA 1EL9A 4FK1A 5BRTA 3NNEA 4X9MA 4XWRA 4BK2A 4G6HA 4LU6A 1PXCA 2R0PA 2E4GA 3NN0X 4X9NA 4DSGA 3CMMA 2XLUA 1GRBA 4H4XA 3AWIA 1B4VA 4OPTA 3NN6X 1GRHA 2XLPA 2GQFA 3S5WA 1JRXA 1KDGA 1QO8A 3AD9B 3F8PA 2FJAA 2YVJA 3GWFA 3GDNA 3T2YA 4EM3A 4JNQA 1DNCA 2OLNA 3C4NA 1Y0PA 3NKSA 3QSSA 2Q7VA 3QVRA 1CF3A 1XANA 1L9EA 4H4VA 3V76A 3GMBA 3UP4A 4H4TA 1F3PA 4XXGA 1PBBA 3AE8A 2V60A 1CHUA 1MXTA 2WDRA 3B3RA 5HHFA 1RYIA 2WESA 3AE3A 3NK2X 3ABVA 4FX9A 3AB1A 1IJHA 2V3BA 5JCKA 1F8WA 1PBCA 3I6DA 1F6MA 1OJ9A 3LOVA 1Q9IA 2YR6A 3M12A 5KMRA 2DKIA 3SXIA 1ZOYA 1NAAA 3F8DA 1VQWA 3NHOX 3GRTA 1H81A 1BWCA 3REDA 5FS8A 2BABA 1AOGA 3GSIA 3VQRA 3AEAA 3O0HA 4NWZA 5BUKA 2OA1A 2X50A 1CJ4A 3BI5A 1VG0A 3HZLA 1NG4A 3GYIA 3UKPA 3UKKA 3PO7A 2R4JA 1N4VA 2XVHA 2IVEA 3DK8A 1GOSA 3VR9A 1O94A 1FEBA 4GCMA 5EOWA 1FECA 4B68A 4CY6A 2FBWA 3T37A 5KRQA 1VRQB 2PHHA 1FEAA 2A89A 2HQMA 4RG3A 5FMHA 3K30A 4GF7A 2WP5A 2H89A 1H84A 4U8OA 4EIPA 4OPCA 3L8KA 3SZWA 3P4PA 4EMWA 1IUSA 2C70A 3KA7A 2BXSA 1W4XA 5U25A 3CPIG 2Q0KA 1S2QA 2R45A 1JOAA 4PAAA 2Q6UA 3AEGA 3JSKA 2X3NA 4UDPA 4EQXA 2JK6A 4D03A 4EQWA 2X99A 4K7ZA 2GR3A 1D4EA 4DSHA 1GEUA 4EMIA 4K8DA 3COXA 2YWLA 2JB1A 2WOVA 3DK9A 4N9XA 2GR2A 2C3CA 5DBJA 5KMSA 2BRYA 1XPQA 2C73A 1NHQA 1EL5A 3PVCA 5KNLA 1FCDA 4U8KA 4B66A 4C77A 1CC6A 3ICTA 4DGKA 2YG7A 1JRYA 1PJ6A 1EL8A 2WPCA 2ZZCA 2E5VA 4BURA 3KPKA 3CNTA 4II3A 3S61A 1H7XA 1K0LA 1BGJA 1KFYA 3CNDA 4CCRA 5KVIA 4CCQA 4NEWA 3ATQA 4UP3A 2AR8A 1D7YA 4TM3A 4U8JA 2WEUA 2WP6A 2ZZ0A 5C2TA 3CN8A 2YR5A 3ALJA 1B5QA 1GREA 2XVIA 1BF3A 5GSNA 3RNMA 3UKLA 3Q9TA 3CGEA 4YTPA 4TM0A 1RP0A 3IWAA 3Q6JA 1EL7A 1F8SA 5CKUA 2ARDA 4BK1A 3RP8A 4CNJA 2X8HA 3BNUA 3P4RA 3RHAA 3UKFA 1KSSA 3OZ2A 1PS9A 4B65A 4A7AA 4U8PA 3AE7A 1H6VA 4ZN0A 2B9XA 4IA5A 2BRAA 1V59A 4TLXA 1ZMCA 3HYWA 3NK1X 3WE0A 3AE9A 4O5UA 1DODA 1JEHA 3AE1A 1Y56B 3ITJA 3NTAA 1PBEA 3ALLA 3ISHA 4C3YA 2YLSA 4B1BA 4U2LA 2XCGA 1GXFA 1TDFA 2BC0A 4IA6A 3ICSA 4ZCCA 4JDRA 2CDUA 3CGBA 4FDCB 4NTEA 1YQZA 1YY5A 2GEWA 2YLZA 4KX6A 4Z2RA 4K5SA 1GTHA 1D4CA 1L9DA 2E1MA 1P2EA 2FJEA 2XDOA 3OC4A 1L9CA 3CTYA 4LA1A 2JAEA 4H4WA 4OPGA 3EANA 4GRTA 4YTNA 3SY4A 2AAQA 1HYUA 2RABA 2OALA 2BXRA 4AT0A 2R4EA 3LB8A 3UOYA 4BJZA 3FBSA 3SZ0A 3P9UA 4A6NA 3CPJG 2BYBA 2JKCA 1N4UA 1ZDLA 3SQPA 4BK3A 4YKGA 3LZWA 4Z2TA 1DOCA 4P9SA 1GALA 4B64A 3D1CA 1RSGA 4H2QA 4U2SA 1GETA 2XVFA 2A8XA 3KPFA 2ZZBA 3CGDA 1GV4A 1XDIA 4OPUA 5KWFA 4ADWA 2YM2A 2Z5YA 3AEDA 5TR3A 1NEKA 4J36A 3FIMB 3AYLA 3NIXA 2BA9A 2V3AA 2YG5A 3UKAA 5HXIA 2WQYA 2WU5A 5JCMA 3DGZA 2C65A 2QA1A 4X4JA 5J60A 2GAGB 3GRSA 1REOA 3DJGX 4H7UA 1PXAA 4YSZA 1N4WA 1PHHA 5IQ4A 5JCLA 3T2ZA 2TMDA 4JY2A 1LVLA 3SZCA 4AP1A 1LTXR 4JNAA 1IUXA 1N1PA 4JN9A 2VVMA 3HYVA 4GR1A 4UDQA 3SGLA 3V3OA 1GESA 4AOXA 1LJ1A 4J34A 4LIIA 1CBOA 1FOHA 1ZX9A 2WPFA 3G5SA 1CJ2A 1D7LA 3II4A 3KVEA 1E7PA 3H8IA 2NPXA 3NTDA 1IUUA 3AYIA 5FS6A 4A9WA 2YR4A 1CC2A 5U63A 4E0VA 3UTFA 4NNJA 3UTHA 1S3BA 4OCGA 2C64A 1O95A 4Z2UA 3BI4A 3LZXA 3AD7B 3E1TA 1GRAA 4CNKA 1ONFA 5CQFA 2YG4A 4OVIA 1L0VA 2F5ZA 3UOVA 1K0IA 1OJTA 4NTCA 3SX6A 2WHDA 2W0HA 1EBDA 4J57A 3GD4A 2Y6QA 3P1WA 4A65A 5J7XA 5EB5A 4YSYA 1PBFA 3NT6A 3FG2P 1ZMDA 5IQ1A 3NYFA 1OJCA 1NHSA 2RGJA 4EMJA 1QLBA 2A87A 1M6IA 2QCUA 1TDNA 3D8XA 4GDEA 1NG3A 2APGA 2VQBA 3AE6A 3ATRA 2BCPA 4EM4A 1TDOA 1JRZA 3CPHG 4Z26A 1PXBA 2O9ZA 1ELIA 2GMJA 4OPIA 3UKQA 3NGCX 4U2TA 1ZK7A 3LADA 4NZHA 3EPTA 1H83A 3NH3X 2XFUA 2YLTA 5FS7A 3DJDA 1FL2A 2FJDA 4EQSA 3UKHA 2VQ7A 2X8GA 1MO9A 1IUTA 1ZP0A 2NVKX 2YVFA 4HB9A 3BNMA 5KOXA 2VVLG 3UOZA 3T0KA 4C5OA 3AEBA 2YQUA 3UTGA 1Q1WA 1TDKA 4H4YA 4J31A 5BULA 1F8RA 4Z43A 1YQ4A 4AP3A 4AT2A 4ECHA 2YG3A 2YM1A 3SFEA 3IHMA 1P2HA 3C96A 1VDCA 3T14A 3NG7X 1Q1RA 3BI2A 3CNSA 4O5QA 2YLXA 2C75A 1QJDA 4H2RA 4YTMA 1LQTA 2EQ7A 3C4AA 2WDVA 2VRLA
chains in the Genus database with same CATH topology
5JCNA 2YLRA 4H4ZA 3UOXA 2J3NA 1GERA 2VZ2A 3NK0X 5M10A 1E6EA 3DA1A 4B63A 2IIDA 1Y56A 2C3DA 4AOSA 2GB0A 3ALMA 3SFDA 2BK3A 1Z6LA 3SM8A 2XLRA 2Z5XA 2X8CA 1BKWA 5HY5A 4EQRA 1SEZA 2I0ZA 1LPFA 4U8LA 4JQ9A 2BCGG 2JBVA 2C76A 2RGHA 3ADAB 1CC4A 2GR0A 3B6DA 3DK4A 1UKVG 2YAUA 2R0CA 1YKJA 3P4SA 3QFAA 3KLJA 1E1NA 1OJDA 4Y4MA 1GPEA 5KMQA 2UZZA 1ZKQA 4H4SA 1NHRA 4IVMB 1X31B 4HA6A 2XFNA 4DNAA 3AECA 5L46A 1GRTA 1JNZA 2DKHA 3IF9A 4XWZA 3SYIA 2XFOA 4TM1A 3UCLA 1IUVA 1TYPA 1VG9A 1ZY8A 4BJYA 1GRGA 3T2KA 2BC1A 1GTEA 4B69A 2VRMA 3VRDB 4JY3A 2XLTA 4NTDA 1D5TA 3G5QA 3QSEA 4A6NB 1KNRA 4Z44A 5KOWA 1GRFA 1PDHA 1TYTA 2WETA 3FMWA 1S2YA 3R9UA 4CY8A 1D4DA 3ZDNA 4YSHA 4ZCDA 4YSXA 1IUWA 4WX1A 1LV0A 2QAEA 2XFPA 3AE4A 2B7RA 3AD8B 3CGCA 3KU9A 5M0ZA 4K22A 1DJNA 4Z25A 4C3XA 3AYJA 3K7MX 1PJ5A 3IC9A 4GAVA 5LV9A 2B9WA 4H4RA 4Y4LA 2XFQA 2YLWA 2CFYA 2H88A 4Z24A 1OJAA 3EF6A 3QSMA 4H4QA 4YT0A 2OLOA 3AXBA 4C74A 1B8SA 5KMPA 3GYXA 1NHPA 2B7SA 2GV8A 3I3LA 3K7QX 4K5RA 3K7TA 4TLZA 2WOWA 3KD9A 3NRNA 5BVAA 1O5WA 1PN0A 3CNPA 3QJ4A 4RSLA 2C7GA 4G9KA 3QFBA 5KXJA 1PBDA 1KNPA 2R0GA 5KVHA 1NPXA 5C3JA 3V3NA 1NENA 4A79A 4I59A 1DXLA 2CVJA 3G5RA 1S3EA 2C67A 3M13A 2R9ZA 1TRBA 3VRAA 1GSNA 3FPZA 3QVPA 4KPRA 1NDAA 3URHA 3DGHA 3EAOA 4A5LA 3AEEA 2VVLA 3NYCA 3VR8A 2XLSA 4RG4A 2XVJA 4J2WA 2WPEA 1KF6A 4YWOA 5JCIA 4EIQA 3BHKA 2JB3A 3H8LA 3DMEA 4UDRA 4YXDA 2R46A 5IPYA 1K4QA 2V6OA 4H50A 2FJBA 2GR1A 2C72A 5HYMA 4NEVA 1E1LA 5EBKA 4APNA 1E39A 2BS4A 2GF3A 2V61A 4USRA 1BZLA 2EQ6A 3GWDA 3NYEA 4YKFA 1XHCA 2VOUA 4IVOB 1JNRA 1PJ7A 3ZYXA 2C4CA 2JB2A 2GAHB 3AE5A 3DJEA 4H2PA 4H2NA 2V5ZA 1MOKA 1ZOVA 4U8MA 4B67A 4K2XA 3KKJA 4U8IA 1GT8A 2YG6A 3DJJA 1LQUA 4ICYA 3ICRA 3VRBA 3T31A 2OAMA 2B9YA 2XVEA 2BK4A 2BS2A 3PS9A 4H4UA 5U1OA 4CRTA 2WS3A 2BS3A 2WP9A 3LXDA 3DH9A 1JU2A 2GVCA 2Y6RA 3UP5A 3GMCA 4D04A 5EB4A 1M64A 3CNJA 4WCTA 4G6GA 3CIRA 2GQWA 3NLCA 4MJWA 2RGOA 2CULA 4GUVA 4PABA 2EQ9A 1DOBA 4IV9A 2TPRA 1H7WA 3M0OA 4REKA 4CBQA 1B37A 2WDQA 4G73A 3LJPA 2XYOA 4TM4A 2GH5A 4J56A 1H82A 2WBAA 4II2A 3F8RA 2AQJA 3GD3A 3IHGA 5FS9A 3L1RA 1BGNA 4USQA 4J33A 4M52A 4I58A 5GRTA 3GDPA 2IVDA 3HYXA 1K0JA 1CJCA 2WU2A 3SZFA 3RP6A 4BV6A 2B76A 4H4PA 2EQ8A 4U8NA 1COYA 2ZBWA 4FK1C 2BACA 1YQ3A 1H86A 1GNDA 1E1KA 1CL0A 4Y4NA 1DJQA 2GRTA 1KSUA 2WOIA 5ER0A 4OPLA 4GAPA 3UTEA 2BK5A 2C66A 4GDPA 1E1MA 2GMHA 3AE2A 1CJ3A 2YVGA 1DOEA 2Q0LA 4A99A 3P4QA 2ACZA 4OPDA 2QA2A 3BHFA 3GYJA 4G74A 1TDEA 3AEFA 3RP7A 3H4KA 2PYXA 1EL9A 4FK1A 5BRTA 3NNEA 4X9MA 4XWRA 4BK2A 4G6HA 4LU6A 1PXCA 2R0PA 2E4GA 3NN0X 4X9NA 4DSGA 3CMMA 2XLUA 1GRBA 4H4XA 3AWIA 1B4VA 4OPTA 3NN6X 1GRHA 2XLPA 2GQFA 3S5WA 1JRXA 1KDGA 1QO8A 3AD9B 3F8PA 2FJAA 2YVJA 3GWFA 3GDNA 3T2YA 4EM3A 4JNQA 1DNCA 2OLNA 3C4NA 1Y0PA 3NKSA 3QSSA 2Q7VA 3QVRA 1CF3A 1XANA 1L9EA 4H4VA 3V76A 3GMBA 3UP4A 4H4TA 1F3PA 4XXGA 1PBBA 3AE8A 2V60A 1CHUA 1MXTA 2WDRA 3B3RA 5HHFA 1RYIA 2WESA 3AE3A 3NK2X 3ABVA 4FX9A 3AB1A 1IJHA 2V3BA 5JCKA 1F8WA 1PBCA 3I6DA 1F6MA 1OJ9A 3LOVA 1Q9IA 2YR6A 3M12A 5KMRA 2DKIA 3SXIA 1ZOYA 1NAAA 3F8DA 1VQWA 3NHOX 3GRTA 1H81A 1BWCA 3REDA 5FS8A 2BABA 1AOGA 3GSIA 3VQRA 3AEAA 3O0HA 4NWZA 5BUKA 2OA1A 2X50A 1CJ4A 3BI5A 1VG0A 3HZLA 1NG4A 3GYIA 3UKPA 3UKKA 3PO7A 2R4JA 1N4VA 2XVHA 2IVEA 3DK8A 1GOSA 3VR9A 1O94A 1FEBA 4GCMA 5EOWA 1FECA 4B68A 4CY6A 2FBWA 3T37A 5KRQA 1VRQB 2PHHA 1FEAA 2A89A 2HQMA 4RG3A 5FMHA 3K30A 4GF7A 2WP5A 2H89A 1H84A 4U8OA 4EIPA 4OPCA 3L8KA 3SZWA 3P4PA 4EMWA 1IUSA 2C70A 3KA7A 2BXSA 1W4XA 5U25A 3CPIG 2Q0KA 1S2QA 2R45A 1JOAA 4PAAA 2Q6UA 3AEGA 3JSKA 2X3NA 4UDPA 4EQXA 2JK6A 4D03A 4EQWA 2X99A 4K7ZA 2GR3A 1D4EA 4DSHA 1GEUA 4EMIA 4K8DA 3COXA 2YWLA 2JB1A 2WOVA 3DK9A 4N9XA 2GR2A 2C3CA 5DBJA 5KMSA 2BRYA 1XPQA 2C73A 1NHQA 1EL5A 3PVCA 5KNLA 1FCDA 4U8KA 4B66A 4C77A 1CC6A 3ICTA 4DGKA 2YG7A 1JRYA 1PJ6A 1EL8A 2WPCA 2ZZCA 2E5VA 4BURA 3KPKA 3CNTA 4II3A 3S61A 1H7XA 1K0LA 1BGJA 1KFYA 3CNDA 4CCRA 5KVIA 4CCQA 4NEWA 3ATQA 4UP3A 2AR8A 1D7YA 4TM3A 4U8JA 2WEUA 2WP6A 2ZZ0A 5C2TA 3CN8A 2YR5A 3ALJA 1B5QA 1GREA 2XVIA 1BF3A 5GSNA 3RNMA 3UKLA 3Q9TA 3CGEA 4YTPA 4TM0A 1RP0A 3IWAA 3Q6JA 1EL7A 1F8SA 5CKUA 2ARDA 4BK1A 3RP8A 4CNJA 2X8HA 3BNUA 3P4RA 3RHAA 3UKFA 1KSSA 3OZ2A 1PS9A 4B65A 4A7AA 4U8PA 3AE7A 1H6VA 4ZN0A 2B9XA 4IA5A 2BRAA 1V59A 4TLXA 1ZMCA 3HYWA 3NK1X 3WE0A 3AE9A 4O5UA 1DODA 1JEHA 3AE1A 1Y56B 3ITJA 3NTAA 1PBEA 3ALLA 3ISHA 4C3YA 2YLSA 4B1BA 4U2LA 2XCGA 1GXFA 1TDFA 2BC0A 4IA6A 3ICSA 4ZCCA 4JDRA 2CDUA 3CGBA 4FDCB 4NTEA 1YQZA 1YY5A 2GEWA 2YLZA 4KX6A 4Z2RA 4K5SA 1GTHA 1D4CA 1L9DA 2E1MA 1P2EA 2FJEA 2XDOA 3OC4A 1L9CA 3CTYA 4LA1A 2JAEA 4H4WA 4OPGA 3EANA 4GRTA 4YTNA 3SY4A 2AAQA 1HYUA 2RABA 2OALA 2BXRA 4AT0A 2R4EA 3LB8A 3UOYA 4BJZA 3FBSA 3SZ0A 3P9UA 4A6NA 3CPJG 2BYBA 2JKCA 1N4UA 1ZDLA 3SQPA 4BK3A 4YKGA 3LZWA 4Z2TA 1DOCA 4P9SA 1GALA 4B64A 3D1CA 1RSGA 4H2QA 4U2SA 1GETA 2XVFA 2A8XA 3KPFA 2ZZBA 3CGDA 1GV4A 1XDIA 4OPUA 5KWFA 4ADWA 2YM2A 2Z5YA 3AEDA 5TR3A 1NEKA 4J36A 3FIMB 3AYLA 3NIXA 2BA9A 2V3AA 2YG5A 3UKAA 5HXIA 2WQYA 2WU5A 5JCMA 3DGZA 2C65A 2QA1A 4X4JA 5J60A 2GAGB 3GRSA 1REOA 3DJGX 4H7UA 1PXAA 4YSZA 1N4WA 1PHHA 5IQ4A 5JCLA 3T2ZA 2TMDA 4JY2A 1LVLA 3SZCA 4AP1A 1LTXR 4JNAA 1IUXA 1N1PA 4JN9A 2VVMA 3HYVA 4GR1A 4UDQA 3SGLA 3V3OA 1GESA 4AOXA 1LJ1A 4J34A 4LIIA 1CBOA 1FOHA 1ZX9A 2WPFA 3G5SA 1CJ2A 1D7LA 3II4A 3KVEA 1E7PA 3H8IA 2NPXA 3NTDA 1IUUA 3AYIA 5FS6A 4A9WA 2YR4A 1CC2A 5U63A 4E0VA 3UTFA 4NNJA 3UTHA 1S3BA 4OCGA 2C64A 1O95A 4Z2UA 3BI4A 3LZXA 3AD7B 3E1TA 1GRAA 4CNKA 1ONFA 5CQFA 2YG4A 4OVIA 1L0VA 2F5ZA 3UOVA 1K0IA 1OJTA 4NTCA 3SX6A 2WHDA 2W0HA 1EBDA 4J57A 3GD4A 2Y6QA 3P1WA 4A65A 5J7XA 5EB5A 4YSYA 1PBFA 3NT6A 3FG2P 1ZMDA 5IQ1A 3NYFA 1OJCA 1NHSA 2RGJA 4EMJA 1QLBA 2A87A 1M6IA 2QCUA 1TDNA 3D8XA 4GDEA 1NG3A 2APGA 2VQBA 3AE6A 3ATRA 2BCPA 4EM4A 1TDOA 1JRZA 3CPHG 4Z26A 1PXBA 2O9ZA 1ELIA 2GMJA 4OPIA 3UKQA 3NGCX 4U2TA 1ZK7A 3LADA 4NZHA 3EPTA 1H83A 3NH3X 2XFUA 2YLTA 5FS7A 3DJDA 1FL2A 2FJDA 4EQSA 3UKHA 2VQ7A 2X8GA 1MO9A 1IUTA 1ZP0A 2NVKX 2YVFA 4HB9A 3BNMA 5KOXA 2VVLG 3UOZA 3T0KA 4C5OA 3AEBA 2YQUA 3UTGA 1Q1WA 1TDKA 4H4YA 4J31A 5BULA 1F8RA 4Z43A 1YQ4A 4AP3A 4AT2A 4ECHA 2YG3A 2YM1A 3SFEA 3IHMA 1P2HA 3C96A 1VDCA 3T14A 3NG7X 1Q1RA 3BI2A 3CNSA 4O5QA 2YLXA 2C75A 1QJDA 4H2RA 4YTMA 1LQTA 2EQ7A 3C4AA 2WDVA 2VRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JCN A;  2YLR A;  4H4Z A;  3UOX A;  2J3N A;  1GER A;  2VZ2 A;  3NK0 X;  5M10 A;  1E6E A;  3DA1 A;  4B63 A;  2IID A;  1Y56 A;  2C3D A;  4AOS A;  2GB0 A;  3ALM A;  3SFD A;  2BK3 A;  1Z6L A;  3SM8 A;  2XLR A;  2Z5X A;  2X8C A;  1BKW A;  5HY5 A;  4EQR A;  1SEZ A;  2I0Z A;  1LPF A;  4U8L A;  4JQ9 A;  2BCG G;  2JBV A;  2C76 A;  2RGH A;  3ADA B;  1CC4 A;  2GR0 A;  3B6D A;  3DK4 A;  1UKV G;  2YAU A;  2R0C A;  1YKJ A;  3P4S A;  3QFA A;  3KLJ A;  1E1N A;  1OJD A;  4Y4M A;  1GPE A;  2UZZ A;  1ZKQ A;  4H4S A;  1NHR A;  4IVM B;  1X31 B;  4HA6 A;  2XFN A;  4DNA A;  3AEC A;  5L46 A;  1GRT A;  1JNZ A;  2DKH A;  3IF9 A;  4XWZ A;  2XFO A;  4TM1 A;  3UCL A;  1IUV A;  1TYP A;  1VG9 A;  1ZY8 A;  4BJY A;  1GRG A;  2BC1 A;  1GTE A;  4B69 A;  2VRM A;  3VRD B;  4JY3 A;  2XLT A;  4NTD A;  1D5T A;  3G5Q A;  3QSE A;  4A6N B;  1KNR A;  4Z44 A;  5KOW A;  1GRF A;  1PDH A;  1TYT A;  2WET A;  3FMW A;  1S2Y A;  3R9U A;  4CY8 A;  1D4D A;  3ZDN A;  4YSH A;  4ZCD A;  4YSX A;  1IUW A;  4WX1 A;  1LV0 A;  2QAE A;  2XFP A;  3AE4 A;  2B7R A;  3AD8 B;  3CGC A;  3KU9 A;  5M0Z A;  4K22 A;  1DJN A;  4Z25 A;  4C3X A;  3AYJ A;  3K7M X;  1PJ5 A;  3IC9 A;  5LV9 A;  2B9W A;  4H4R A;  4Y4L A;  2XFQ A;  2YLW A;  2CFY A;  2H88 A;  4Z24 A;  1OJA A;  3EF6 A;  3QSM A;  4H4Q A;  4YT0 A;  2OLO A;  3AXB A;  4C74 A;  1B8S A;  1NHP A;  2B7S A;  2GV8 A;  3I3L A;  3K7Q X;  4K5R A;  3K7T A;  4TLZ A;  2WOW A;  3KD9 A;  3NRN A;  5BVA A;  1O5W A;  1PN0 A;  3CNP A;  3QJ4 A;  4RSL A;  2C7G A;  3QFB A;  5KXJ A;  1PBD A;  1KNP A;  2R0G A;  5KVH A;  1NPX A;  5C3J A;  3V3N A;  1NEN A;  4A79 A;  4I59 A;  1DXL A;  2CVJ A;  3G5R A;  1S3E A;  2C67 A;  3M13 A;  2R9Z A;  1TRB A;  3VRA A;  1GSN A;  3FPZ A;  3QVP A;  4KPR A;  1NDA A;  3URH A;  3DGH A;  3EAO A;  4A5L A;  3AEE A;  2VVL A;  3NYC A;  3VR8 A;  2XLS A;  4RG4 A;  2XVJ A;  4J2W A;  2WPE A;  1KF6 A;  4YWO A;  5JCI A;  4EIQ A;  3BHK A;  2JB3 A;  3H8L A;  3DME A;  4UDR A;  4YXD A;  2R46 A;  5IPY A;  1K4Q A;  2V6O A;  4H50 A;  2FJB A;  2GR1 A;  2C72 A;  5HYM A;  4NEV A;  1E1L A;  5EBK A;  4APN A;  1E39 A;  2BS4 A;  2GF3 A;  2V61 A;  4USR A;  1BZL A;  2EQ6 A;  3GWD A;  3NYE A;  4YKF A;  1XHC A;  2VOU A;  4IVO B;  1JNR A;  1PJ7 A;  3ZYX A;  2JB2 A;  2GAH B;  3AE5 A;  3DJE A;  4H2P A;  4H2N A;  2V5Z A;  1MOK A;  1ZOV A;  4U8M A;  4B67 A;  4K2X A;  3KKJ A;  4U8I A;  1GT8 A;  2YG6 A;  3DJJ A;  1LQU A;  4ICY A;  3ICR A;  3VRB A;  2OAM A;  2B9Y A;  2XVE A;  2BK4 A;  2BS2 A;  3PS9 A;  4H4U A;  5U1O A;  4CRT A;  2WS3 A;  2BS3 A;  2WP9 A;  3LXD A;  3DH9 A;  1JU2 A;  2GVC A;  2Y6R A;  3UP5 A;  3GMC A;  4D04 A;  5EB4 A;  1M64 A;  3CNJ A;  4WCT A;  4MJW A;  3CIR A;  2GQW A;  3NLC A;  2RGO A;  2CUL A;  4GUV A;  4PAB A;  2EQ9 A;  1DOB A;  4IV9 A;  2TPR A;  1H7W A;  3M0O A;  4REK A;  4CBQ A;  1B37 A;  2WDQ A;  4TM4 A;  3LJP A;  2XYO A;  2GH5 A;  4J56 A;  1H82 A;  2WBA A;  3F8R A;  2AQJ A;  3GD3 A;  3IHG A;  5FS9 A;  3L1R A;  1BGN A;  4USQ A;  4J33 A;  4M52 A;  4I58 A;  5GRT A;  3GDP A;  2IVD A;  1K0J A;  1CJC A;  2WU2 A;  3RP6 A;  4BV6 A;  2B76 A;  4H4P A;  2EQ8 A;  4U8N A;  1COY A;  2ZBW A;  4FK1 C;  2BAC A;  1YQ3 A;  1H86 A;  1GND A;  1E1K A;  1CL0 A;  4Y4N A;  1DJQ A;  2GRT A;  1KSU A;  2WOI A;  5ER0 A;  4OPL A;  3UTE A;  2BK5 A;  2C66 A;  4GDP A;  1E1M A;  2GMH A;  3AE2 A;  1CJ3 A;  2YVG A;  1DOE A;  2Q0L A;  4A99 A;  3P4Q A;  2ACZ A;  4OPD A;  2QA2 A;  3BHF A;  3GYJ A;  3RP7 A;  1TDE A;  3AEF A;  3H4K A;  2PYX A;  1EL9 A;  4FK1 A;  5BRT A;  3NNE A;  4X9M A;  4XWR A;  4BK2 A;  4LU6 A;  1PXC A;  2R0P A;  2E4G A;  3NN0 X;  4X9N A;  4DSG A;  2XLU A;  1GRB A;  4H4X A;  3AWI A;  1B4V A;  4OPT A;  3NN6 X;  1GRH A;  2XLP A;  2GQF A;  3S5W A;  1JRX A;  1KDG A;  1QO8 A;  3AD9 B;  3F8P A;  2FJA A;  2YVJ A;  3GWF A;  3GDN A;  4EM3 A;  4JNQ A;  1DNC A;  2OLN A;  3C4N A;  1Y0P A;  3NKS A;  3QSS A;  2Q7V A;  3QVR A;  1CF3 A;  1XAN A;  1L9E A;  4H4V A;  3V76 A;  3GMB A;  3UP4 A;  4H4T A;  1F3P A;  4XXG A;  1PBB A;  3AE8 A;  2V60 A;  1CHU A;  1MXT A;  2WDR A;  3B3R A;  5HHF A;  1RYI A;  2WES A;  3AE3 A;  3NK2 X;  3ABV A;  4FX9 A;  3AB1 A;  1IJH A;  2V3B A;  5JCK A;  1F8W A;  1PBC A;  3I6D A;  1F6M A;  1OJ9 A;  3LOV A;  1Q9I A;  2YR6 A;  3M12 A;  2DKI A;  1ZOY A;  1NAA A;  3F8D A;  1VQW A;  3NHO X;  3GRT A;  1H81 A;  1BWC A;  3RED A;  5FS8 A;  2BAB A;  1AOG A;  3GSI A;  3VQR A;  3AEA A;  3O0H A;  5BUK A;  2OA1 A;  2X50 A;  1CJ4 A;  3BI5 A;  1VG0 A;  3HZL A;  1NG4 A;  3GYI A;  3UKP A;  3UKK A;  3PO7 A;  2R4J A;  1N4V A;  2XVH A;  2IVE A;  3DK8 A;  1GOS A;  3VR9 A;  1O94 A;  1FEB A;  4GCM A;  5EOW A;  1FEC A;  4B68 A;  4CY6 A;  2FBW A;  3T37 A;  5KRQ A;  1VRQ B;  2PHH A;  1FEA A;  2A89 A;  2HQM A;  4RG3 A;  5FMH A;  3K30 A;  4GF7 A;  2WP5 A;  2H89 A;  1H84 A;  4U8O A;  4EIP A;  4OPC A;  3L8K A;  3P4P A;  4EMW A;  1IUS A;  2C70 A;  3KA7 A;  2BXS A;  1W4X A;  5U25 A;  3CPI G;  2Q0K A;  1S2Q A;  2R45 A;  1JOA A;  4PAA A;  2Q6U A;  3AEG A;  3JSK A;  2X3N A;  4UDP A;  4EQX A;  2JK6 A;  4D03 A;  4EQW A;  2X99 A;  4K7Z A;  2GR3 A;  1D4E A;  4DSH A;  1GEU A;  4EMI A;  4K8D A;  3COX A;  2YWL A;  2JB1 A;  2WOV A;  3DK9 A;  4N9X A;  2GR2 A;  2C3C A;  5DBJ A;  1XPQ A;  2C73 A;  1NHQ A;  1EL5 A;  3PVC A;  1FCD A;  4U8K A;  4B66 A;  4C77 A;  1CC6 A;  3ICT A;  4DGK A;  2YG7 A;  1JRY A;  1PJ6 A;  1EL8 A;  2WPC A;  2ZZC A;  2E5V A;  4BUR A;  3CNT A;  3S61 A;  1H7X A;  1K0L A;  1BGJ A;  1KFY A;  3CND A;  4CCR A;  5KVI A;  4CCQ A;  4NEW A;  3ATQ A;  4UP3 A;  2AR8 A;  1D7Y A;  4TM3 A;  4U8J A;  2WEU A;  2WP6 A;  2ZZ0 A;  5C2T A;  3CN8 A;  2YR5 A;  3ALJ A;  1B5Q A;  1GRE A;  2XVI A;  1BF3 A;  5GSN A;  3RNM A;  3UKL A;  3Q9T A;  3CGE A;  4YTP A;  4TM0 A;  1RP0 A;  3IWA A;  3Q6J A;  1EL7 A;  1F8S A;  5CKU A;  2ARD A;  4BK1 A;  3RP8 A;  4CNJ A;  2X8H A;  3BNU A;  3P4R A;  3RHA A;  3UKF A;  1KSS A;  3OZ2 A;  1PS9 A;  4B65 A;  4A7A A;  4U8P A;  3AE7 A;  1H6V A;  4ZN0 A;  2B9X A;  4IA5 A;  1V59 A;  4TLX A;  1ZMC A;  3NK1 X;  3WE0 A;  3AE9 A;  4O5U A;  1DOD A;  1JEH A;  3AE1 A;  1Y56 B;  3ITJ A;  3NTA A;  1PBE A;  3ALL A;  3ISH A;  4C3Y A;  2YLS A;  4B1B A;  4U2L A;  2XCG A;  1GXF A;  1TDF A;  2BC0 A;  4IA6 A;  3ICS A;  4ZCC A;  4JDR A;  2CDU A;  3CGB A;  4FDC B;  4NTE A;  1YQZ A;  1YY5 A;  2GEW A;  2YLZ A;  4KX6 A;  4Z2R A;  4K5S A;  1GTH A;  1D4C A;  1L9D A;  2E1M A;  1P2E A;  2FJE A;  2XDO A;  3OC4 A;  1L9C A;  3CTY A;  4LA1 A;  2JAE A;  4H4W A;  4OPG A;  3EAN A;  4GRT A;  4YTN A;  2AAQ A;  1HYU A;  2RAB A;  2OAL A;  2BXR A;  4AT0 A;  2R4E A;  3LB8 A;  3UOY A;  4BJZ A;  3FBS A;  3P9U A;  4A6N A;  3CPJ G;  2BYB A;  2JKC A;  1N4U A;  1ZDL A;  3SQP A;  4BK3 A;  4YKG A;  3LZW A;  4Z2T A;  1DOC A;  4P9S A;  1GAL A;  4B64 A;  3D1C A;  1RSG A;  4H2Q A;  4U2S A;  1GET A;  2XVF A;  2A8X A;  3KPF A;  2ZZB A;  3CGD A;  1GV4 A;  1XDI A;  4OPU A;  5KWF A;  4ADW A;  2YM2 A;  2Z5Y A;  3AED A;  5TR3 A;  1NEK A;  4J36 A;  3FIM B;  3AYL A;  3NIX A;  2BA9 A;  2V3A A;  2YG5 A;  3UKA A;  5HXI A;  2WQY A;  2WU5 A;  5JCM A;  3DGZ A;  2C65 A;  2QA1 A;  4X4J A;  5J60 A;  2GAG B;  3GRS A;  1REO A;  3DJG X;  4H7U A;  1PXA A;  4YSZ A;  1N4W A;  1PHH A;  5IQ4 A;  5JCL A;  4AP1 A;  2TMD A;  4JY2 A;  1LVL A;  1LTX R;  4JNA A;  1IUX A;  1N1P A;  4JN9 A;  2VVM A;  3SGL A;  4GR1 A;  4UDQ A;  3V3O A;  1GES A;  4AOX A;  1LJ1 A;  4J34 A;  4LII A;  1CBO A;  1FOH A;  1ZX9 A;  2WPF A;  3G5S A;  1CJ2 A;  1D7L A;  3II4 A;  3KVE A;  1E7P A;  3H8I A;  2NPX A;  3NTD A;  1IUU A;  3AYI A;  5FS6 A;  4A9W A;  2YR4 A;  1CC2 A;  5U63 A;  4E0V A;  3UTF A;  3UTH A;  1S3B A;  4OCG A;  2C64 A;  1O95 A;  4Z2U A;  3BI4 A;  3LZX A;  3AD7 B;  3E1T A;  1GRA A;  4CNK A;  1ONF A;  5CQF A;  2YG4 A;  4OVI A;  1L0V A;  2F5Z A;  3UOV A;  1K0I A;  1OJT A;  4NTC A;  2WHD A;  2W0H A;  1EBD A;  4J57 A;  3GD4 A;  2Y6Q A;  3P1W A;  4A65 A;  5J7X A;  5EB5 A;  4YSY A;  1PBF A;  3NT6 A;  3FG2 P;  1ZMD A;  5IQ1 A;  3NYF A;  1OJC A;  1NHS A;  2RGJ A;  4EMJ A;  1QLB A;  2A87 A;  1M6I A;  2QCU A;  1TDN A;  3D8X A;  4GDE A;  1NG3 A;  2APG A;  2VQB A;  3AE6 A;  3ATR A;  2BCP A;  4EM4 A;  1TDO A;  1JRZ A;  3CPH G;  4Z26 A;  1PXB A;  2O9Z A;  1ELI A;  2GMJ A;  4OPI A;  3UKQ A;  3NGC X;  4U2T A;  1ZK7 A;  3LAD A;  4NZH A;  3EPT A;  1H83 A;  3NH3 X;  2XFU A;  2YLT A;  5FS7 A;  3DJD A;  1FL2 A;  2FJD A;  4EQS A;  3UKH A;  2VQ7 A;  2X8G A;  1MO9 A;  1IUT A;  1ZP0 A;  2NVK X;  2YVF A;  4HB9 A;  3BNM A;  5KOX A;  2VVL G;  3UOZ A;  4C5O A;  3AEB A;  2YQU A;  3UTG A;  1Q1W A;  1TDK A;  4H4Y A;  4J31 A;  5BUL A;  1F8R A;  4Z43 A;  1YQ4 A;  4AP3 A;  4AT2 A;  4ECH A;  2YG3 A;  2YM1 A;  3SFE A;  3IHM A;  1P2H A;  3C96 A;  1VDC A;  3NG7 X;  1Q1R A;  3BI2 A;  3CNS A;  4O5Q A;  2YLX A;  2C75 A;  1QJD A;  4H2R A;  4YTM A;  1LQT A;  2EQ7 A;  3C4A A;  2WDV A;  2VRL A; 
#chains in the Genus database with same CATH topology
 5JCN A;  2YLR A;  4H4Z A;  3UOX A;  2J3N A;  1GER A;  2VZ2 A;  3NK0 X;  5M10 A;  1E6E A;  3DA1 A;  4B63 A;  2IID A;  1Y56 A;  2C3D A;  4AOS A;  2GB0 A;  3ALM A;  3SFD A;  2BK3 A;  1Z6L A;  3SM8 A;  2XLR A;  2Z5X A;  2X8C A;  1BKW A;  5HY5 A;  4EQR A;  1SEZ A;  2I0Z A;  1LPF A;  4U8L A;  4JQ9 A;  2BCG G;  2JBV A;  2C76 A;  2RGH A;  3ADA B;  1CC4 A;  2GR0 A;  3B6D A;  3DK4 A;  1UKV G;  2YAU A;  2R0C A;  1YKJ A;  3P4S A;  3QFA A;  3KLJ A;  1E1N A;  1OJD A;  4Y4M A;  1GPE A;  5KMQ A;  2UZZ A;  1ZKQ A;  4H4S A;  1NHR A;  4IVM B;  1X31 B;  4HA6 A;  2XFN A;  4DNA A;  3AEC A;  5L46 A;  1GRT A;  1JNZ A;  2DKH A;  3IF9 A;  4XWZ A;  3SYI A;  2XFO A;  4TM1 A;  3UCL A;  1IUV A;  1TYP A;  1VG9 A;  1ZY8 A;  4BJY A;  1GRG A;  3T2K A;  2BC1 A;  1GTE A;  4B69 A;  2VRM A;  3VRD B;  4JY3 A;  2XLT A;  4NTD A;  1D5T A;  3G5Q A;  3QSE A;  4A6N B;  1KNR A;  4Z44 A;  5KOW A;  1GRF A;  1PDH A;  1TYT A;  2WET A;  3FMW A;  1S2Y A;  3R9U A;  4CY8 A;  1D4D A;  3ZDN A;  4YSH A;  4ZCD A;  4YSX A;  1IUW A;  4WX1 A;  1LV0 A;  2QAE A;  2XFP A;  3AE4 A;  2B7R A;  3AD8 B;  3CGC A;  3KU9 A;  5M0Z A;  4K22 A;  1DJN A;  4Z25 A;  4C3X A;  3AYJ A;  3K7M X;  1PJ5 A;  3IC9 A;  4GAV A;  5LV9 A;  2B9W A;  4H4R A;  4Y4L A;  2XFQ A;  2YLW A;  2CFY A;  2H88 A;  4Z24 A;  1OJA A;  3EF6 A;  3QSM A;  4H4Q A;  4YT0 A;  2OLO A;  3AXB A;  4C74 A;  1B8S A;  5KMP A;  3GYX A;  1NHP A;  2B7S A;  2GV8 A;  3I3L A;  3K7Q X;  4K5R A;  3K7T A;  4TLZ A;  2WOW A;  3KD9 A;  3NRN A;  5BVA A;  1O5W A;  1PN0 A;  3CNP A;  3QJ4 A;  4RSL A;  2C7G A;  4G9K A;  3QFB A;  5KXJ A;  1PBD A;  1KNP A;  2R0G A;  5KVH A;  1NPX A;  5C3J A;  3V3N A;  1NEN A;  4A79 A;  4I59 A;  1DXL A;  2CVJ A;  3G5R A;  1S3E A;  2C67 A;  3M13 A;  2R9Z A;  1TRB A;  3VRA A;  1GSN A;  3FPZ A;  3QVP A;  4KPR A;  1NDA A;  3URH A;  3DGH A;  3EAO A;  4A5L A;  3AEE A;  2VVL A;  3NYC A;  3VR8 A;  2XLS A;  4RG4 A;  2XVJ A;  4J2W A;  2WPE A;  1KF6 A;  4YWO A;  5JCI A;  4EIQ A;  3BHK A;  2JB3 A;  3H8L A;  3DME A;  4UDR A;  4YXD A;  2R46 A;  5IPY A;  1K4Q A;  2V6O A;  4H50 A;  2FJB A;  2GR1 A;  2C72 A;  5HYM A;  4NEV A;  1E1L A;  5EBK A;  4APN A;  1E39 A;  2BS4 A;  2GF3 A;  2V61 A;  4USR A;  1BZL A;  2EQ6 A;  3GWD A;  3NYE A;  4YKF A;  1XHC A;  2VOU A;  4IVO B;  1JNR A;  1PJ7 A;  3ZYX A;  2C4C A;  2JB2 A;  2GAH B;  3AE5 A;  3DJE A;  4H2P A;  4H2N A;  2V5Z A;  1MOK A;  1ZOV A;  4U8M A;  4B67 A;  4K2X A;  3KKJ A;  4U8I A;  1GT8 A;  2YG6 A;  3DJJ A;  1LQU A;  4ICY A;  3ICR A;  3VRB A;  3T31 A;  2OAM A;  2B9Y A;  2XVE A;  2BK4 A;  2BS2 A;  3PS9 A;  4H4U A;  5U1O A;  4CRT A;  2WS3 A;  2BS3 A;  2WP9 A;  3LXD A;  3DH9 A;  1JU2 A;  2GVC A;  2Y6R A;  3UP5 A;  3GMC A;  4D04 A;  5EB4 A;  1M64 A;  3CNJ A;  4WCT A;  4G6G A;  3CIR A;  2GQW A;  3NLC A;  4MJW A;  2RGO A;  2CUL A;  4GUV A;  4PAB A;  2EQ9 A;  1DOB A;  4IV9 A;  2TPR A;  1H7W A;  3M0O A;  4REK A;  4CBQ A;  1B37 A;  2WDQ A;  4G73 A;  3LJP A;  2XYO A;  4TM4 A;  2GH5 A;  4J56 A;  1H82 A;  2WBA A;  4II2 A;  3F8R A;  2AQJ A;  3GD3 A;  3IHG A;  5FS9 A;  3L1R A;  1BGN A;  4USQ A;  4J33 A;  4M52 A;  4I58 A;  5GRT A;  3GDP A;  2IVD A;  3HYX A;  1K0J A;  1CJC A;  2WU2 A;  3SZF A;  3RP6 A;  4BV6 A;  2B76 A;  4H4P A;  2EQ8 A;  4U8N A;  1COY A;  2ZBW A;  4FK1 C;  2BAC A;  1YQ3 A;  1H86 A;  1GND A;  1E1K A;  1CL0 A;  4Y4N A;  1DJQ A;  2GRT A;  1KSU A;  2WOI A;  5ER0 A;  4OPL A;  4GAP A;  3UTE A;  2BK5 A;  2C66 A;  4GDP A;  1E1M A;  2GMH A;  3AE2 A;  1CJ3 A;  2YVG A;  1DOE A;  2Q0L A;  4A99 A;  3P4Q A;  2ACZ A;  4OPD A;  2QA2 A;  3BHF A;  3GYJ A;  4G74 A;  1TDE A;  3AEF A;  3RP7 A;  3H4K A;  2PYX A;  1EL9 A;  4FK1 A;  5BRT A;  3NNE A;  4X9M A;  4XWR A;  4BK2 A;  4G6H A;  4LU6 A;  1PXC A;  2R0P A;  2E4G A;  3NN0 X;  4X9N A;  4DSG A;  3CMM A;  2XLU A;  1GRB A;  4H4X A;  3AWI A;  1B4V A;  4OPT A;  3NN6 X;  1GRH A;  2XLP A;  2GQF A;  3S5W A;  1JRX A;  1KDG A;  1QO8 A;  3AD9 B;  3F8P A;  2FJA A;  2YVJ A;  3GWF A;  3GDN A;  3T2Y A;  4EM3 A;  4JNQ A;  1DNC A;  2OLN A;  3C4N A;  1Y0P A;  3NKS A;  3QSS A;  2Q7V A;  3QVR A;  1CF3 A;  1XAN A;  1L9E A;  4H4V A;  3V76 A;  3GMB A;  3UP4 A;  4H4T A;  1F3P A;  4XXG A;  1PBB A;  3AE8 A;  2V60 A;  1CHU A;  1MXT A;  2WDR A;  3B3R A;  5HHF A;  1RYI A;  2WES A;  3AE3 A;  3NK2 X;  3ABV A;  4FX9 A;  3AB1 A;  1IJH A;  2V3B A;  5JCK A;  1F8W A;  1PBC A;  3I6D A;  1F6M A;  1OJ9 A;  3LOV A;  1Q9I A;  2YR6 A;  3M12 A;  5KMR A;  2DKI A;  3SXI A;  1ZOY A;  1NAA A;  3F8D A;  1VQW A;  3NHO X;  3GRT A;  1H81 A;  1BWC A;  3RED A;  5FS8 A;  2BAB A;  1AOG A;  3GSI A;  3VQR A;  3AEA A;  3O0H A;  4NWZ A;  5BUK A;  2OA1 A;  2X50 A;  1CJ4 A;  3BI5 A;  1VG0 A;  3HZL A;  1NG4 A;  3GYI A;  3UKP A;  3UKK A;  3PO7 A;  2R4J A;  1N4V A;  2XVH A;  2IVE A;  3DK8 A;  1GOS A;  3VR9 A;  1O94 A;  1FEB A;  4GCM A;  5EOW A;  1FEC A;  4B68 A;  4CY6 A;  2FBW A;  3T37 A;  5KRQ A;  1VRQ B;  2PHH A;  1FEA A;  2A89 A;  2HQM A;  4RG3 A;  5FMH A;  3K30 A;  4GF7 A;  2WP5 A;  2H89 A;  1H84 A;  4U8O A;  4EIP A;  4OPC A;  3L8K A;  3SZW A;  3P4P A;  4EMW A;  1IUS A;  2C70 A;  3KA7 A;  2BXS A;  1W4X A;  5U25 A;  3CPI G;  2Q0K A;  1S2Q A;  2R45 A;  1JOA A;  4PAA A;  2Q6U A;  3AEG A;  3JSK A;  2X3N A;  4UDP A;  4EQX A;  2JK6 A;  4D03 A;  4EQW A;  2X99 A;  4K7Z A;  2GR3 A;  1D4E A;  4DSH A;  1GEU A;  4EMI A;  4K8D A;  3COX A;  2YWL A;  2JB1 A;  2WOV A;  3DK9 A;  4N9X A;  2GR2 A;  2C3C A;  5DBJ A;  5KMS A;  2BRY A;  1XPQ A;  2C73 A;  1NHQ A;  1EL5 A;  3PVC A;  5KNL A;  1FCD A;  4U8K A;  4B66 A;  4C77 A;  1CC6 A;  3ICT A;  4DGK A;  2YG7 A;  1JRY A;  1PJ6 A;  1EL8 A;  2WPC A;  2ZZC A;  2E5V A;  4BUR A;  3KPK A;  3CNT A;  4II3 A;  3S61 A;  1H7X A;  1K0L A;  1BGJ A;  1KFY A;  3CND A;  4CCR A;  5KVI A;  4CCQ A;  4NEW A;  3ATQ A;  4UP3 A;  2AR8 A;  1D7Y A;  4TM3 A;  4U8J A;  2WEU A;  2WP6 A;  2ZZ0 A;  5C2T A;  3CN8 A;  2YR5 A;  3ALJ A;  1B5Q A;  1GRE A;  2XVI A;  1BF3 A;  5GSN A;  3RNM A;  3UKL A;  3Q9T A;  3CGE A;  4YTP A;  4TM0 A;  1RP0 A;  3IWA A;  3Q6J A;  1EL7 A;  1F8S A;  5CKU A;  2ARD A;  4BK1 A;  3RP8 A;  4CNJ A;  2X8H A;  3BNU A;  3P4R A;  3RHA A;  3UKF A;  1KSS A;  3OZ2 A;  1PS9 A;  4B65 A;  4A7A A;  4U8P A;  3AE7 A;  1H6V A;  4ZN0 A;  2B9X A;  4IA5 A;  2BRA A;  1V59 A;  4TLX A;  1ZMC A;  3HYW A;  3NK1 X;  3WE0 A;  3AE9 A;  4O5U A;  1DOD A;  1JEH A;  3AE1 A;  1Y56 B;  3ITJ A;  3NTA A;  1PBE A;  3ALL A;  3ISH A;  4C3Y A;  2YLS A;  4B1B A;  4U2L A;  2XCG A;  1GXF A;  1TDF A;  2BC0 A;  4IA6 A;  3ICS A;  4ZCC A;  4JDR A;  2CDU A;  3CGB A;  4FDC B;  4NTE A;  1YQZ A;  1YY5 A;  2GEW A;  2YLZ A;  4KX6 A;  4Z2R A;  4K5S A;  1GTH A;  1D4C A;  1L9D A;  2E1M A;  1P2E A;  2FJE A;  2XDO A;  3OC4 A;  1L9C A;  3CTY A;  4LA1 A;  2JAE A;  4H4W A;  4OPG A;  3EAN A;  4GRT A;  4YTN A;  3SY4 A;  2AAQ A;  1HYU A;  2RAB A;  2OAL A;  2BXR A;  4AT0 A;  2R4E A;  3LB8 A;  3UOY A;  4BJZ A;  3FBS A;  3SZ0 A;  3P9U A;  4A6N A;  3CPJ G;  2BYB A;  2JKC A;  1N4U A;  1ZDL A;  3SQP A;  4BK3 A;  4YKG A;  3LZW A;  4Z2T A;  1DOC A;  4P9S A;  1GAL A;  4B64 A;  3D1C A;  1RSG A;  4H2Q A;  4U2S A;  1GET A;  2XVF A;  2A8X A;  3KPF A;  2ZZB A;  3CGD A;  1GV4 A;  1XDI A;  4OPU A;  5KWF A;  4ADW A;  2YM2 A;  2Z5Y A;  3AED A;  5TR3 A;  1NEK A;  4J36 A;  3FIM B;  3AYL A;  3NIX A;  2BA9 A;  2V3A A;  2YG5 A;  3UKA A;  5HXI A;  2WQY A;  2WU5 A;  5JCM A;  3DGZ A;  2C65 A;  2QA1 A;  4X4J A;  5J60 A;  2GAG B;  3GRS A;  1REO A;  3DJG X;  4H7U A;  1PXA A;  4YSZ A;  1N4W A;  1PHH A;  5IQ4 A;  5JCL A;  3T2Z A;  2TMD A;  4JY2 A;  1LVL A;  3SZC A;  4AP1 A;  1LTX R;  4JNA A;  1IUX A;  1N1P A;  4JN9 A;  2VVM A;  3HYV A;  4GR1 A;  4UDQ A;  3SGL A;  3V3O A;  1GES A;  4AOX A;  1LJ1 A;  4J34 A;  4LII A;  1CBO A;  1FOH A;  1ZX9 A;  2WPF A;  3G5S A;  1CJ2 A;  1D7L A;  3II4 A;  3KVE A;  1E7P A;  3H8I A;  2NPX A;  3NTD A;  1IUU A;  3AYI A;  5FS6 A;  4A9W A;  2YR4 A;  1CC2 A;  5U63 A;  4E0V A;  3UTF A;  4NNJ A;  3UTH A;  1S3B A;  4OCG A;  2C64 A;  1O95 A;  4Z2U A;  3BI4 A;  3LZX A;  3AD7 B;  3E1T A;  1GRA A;  4CNK A;  1ONF A;  5CQF A;  2YG4 A;  4OVI A;  1L0V A;  2F5Z A;  3UOV A;  1K0I A;  1OJT A;  4NTC A;  3SX6 A;  2WHD A;  2W0H A;  1EBD A;  4J57 A;  3GD4 A;  2Y6Q A;  3P1W A;  4A65 A;  5J7X A;  5EB5 A;  4YSY A;  1PBF A;  3NT6 A;  3FG2 P;  1ZMD A;  5IQ1 A;  3NYF A;  1OJC A;  1NHS A;  2RGJ A;  4EMJ A;  1QLB A;  2A87 A;  1M6I A;  2QCU A;  1TDN A;  3D8X A;  4GDE A;  1NG3 A;  2APG A;  2VQB A;  3AE6 A;  3ATR A;  2BCP A;  4EM4 A;  1TDO A;  1JRZ A;  3CPH G;  4Z26 A;  1PXB A;  2O9Z A;  1ELI A;  2GMJ A;  4OPI A;  3UKQ A;  3NGC X;  4U2T A;  1ZK7 A;  3LAD A;  4NZH A;  3EPT A;  1H83 A;  3NH3 X;  2XFU A;  2YLT A;  5FS7 A;  3DJD A;  1FL2 A;  2FJD A;  4EQS A;  3UKH A;  2VQ7 A;  2X8G A;  1MO9 A;  1IUT A;  1ZP0 A;  2NVK X;  2YVF A;  4HB9 A;  3BNM A;  5KOX A;  2VVL G;  3UOZ A;  3T0K A;  4C5O A;  3AEB A;  2YQU A;  3UTG A;  1Q1W A;  1TDK A;  4H4Y A;  4J31 A;  5BUL A;  1F8R A;  4Z43 A;  1YQ4 A;  4AP3 A;  4AT2 A;  4ECH A;  2YG3 A;  2YM1 A;  3SFE A;  3IHM A;  1P2H A;  3C96 A;  1VDC A;  3T14 A;  3NG7 X;  1Q1R A;  3BI2 A;  3CNS A;  4O5Q A;  2YLX A;  2C75 A;  1QJD A;  4H2R A;  4YTM A;  1LQT A;  2EQ7 A;  3C4A A;  2WDV A;  2VRL A; 
#chains in the Genus database with same CATH homology
 5JCN A;  2YLR A;  4H4Z A;  3UOX A;  2J3N A;  1GER A;  2VZ2 A;  3NK0 X;  5M10 A;  1E6E A;  3DA1 A;  4B63 A;  2IID A;  1Y56 A;  2C3D A;  4AOS A;  2GB0 A;  3ALM A;  3SFD A;  2BK3 A;  1Z6L A;  3SM8 A;  2XLR A;  2Z5X A;  2X8C A;  1BKW A;  5HY5 A;  4EQR A;  1SEZ A;  2I0Z A;  1LPF A;  4U8L A;  4JQ9 A;  2BCG G;  2JBV A;  2C76 A;  2RGH A;  3ADA B;  1CC4 A;  2GR0 A;  3B6D A;  3DK4 A;  1UKV G;  2YAU A;  2R0C A;  1YKJ A;  3P4S A;  3QFA A;  3KLJ A;  1E1N A;  1OJD A;  4Y4M A;  1GPE A;  5KMQ A;  2UZZ A;  1ZKQ A;  4H4S A;  1NHR A;  4IVM B;  1X31 B;  4HA6 A;  2XFN A;  4DNA A;  3AEC A;  5L46 A;  1GRT A;  1JNZ A;  2DKH A;  3IF9 A;  4XWZ A;  3SYI A;  2XFO A;  4TM1 A;  3UCL A;  1IUV A;  1TYP A;  1VG9 A;  1ZY8 A;  4BJY A;  1GRG A;  3T2K A;  2BC1 A;  1GTE A;  4B69 A;  2VRM A;  3VRD B;  4JY3 A;  2XLT A;  4NTD A;  1D5T A;  3G5Q A;  3QSE A;  4A6N B;  1KNR A;  4Z44 A;  5KOW A;  1GRF A;  1PDH A;  1TYT A;  2WET A;  3FMW A;  1S2Y A;  3R9U A;  4CY8 A;  1D4D A;  3ZDN A;  4YSH A;  4ZCD A;  4YSX A;  1IUW A;  4WX1 A;  1LV0 A;  2QAE A;  2XFP A;  3AE4 A;  2B7R A;  3AD8 B;  3CGC A;  3KU9 A;  5M0Z A;  4K22 A;  1DJN A;  4Z25 A;  4C3X A;  3AYJ A;  3K7M X;  1PJ5 A;  3IC9 A;  4GAV A;  5LV9 A;  2B9W A;  4H4R A;  4Y4L A;  2XFQ A;  2YLW A;  2CFY A;  2H88 A;  4Z24 A;  1OJA A;  3EF6 A;  3QSM A;  4H4Q A;  4YT0 A;  2OLO A;  3AXB A;  4C74 A;  1B8S A;  5KMP A;  3GYX A;  1NHP A;  2B7S A;  2GV8 A;  3I3L A;  3K7Q X;  4K5R A;  3K7T A;  4TLZ A;  2WOW A;  3KD9 A;  3NRN A;  5BVA A;  1O5W A;  1PN0 A;  3CNP A;  3QJ4 A;  4RSL A;  2C7G A;  4G9K A;  3QFB A;  5KXJ A;  1PBD A;  1KNP A;  2R0G A;  5KVH A;  1NPX A;  5C3J A;  3V3N A;  1NEN A;  4A79 A;  4I59 A;  1DXL A;  2CVJ A;  3G5R A;  1S3E A;  2C67 A;  3M13 A;  2R9Z A;  1TRB A;  3VRA A;  1GSN A;  3FPZ A;  3QVP A;  4KPR A;  1NDA A;  3URH A;  3DGH A;  3EAO A;  4A5L A;  3AEE A;  2VVL A;  3NYC A;  3VR8 A;  2XLS A;  4RG4 A;  2XVJ A;  4J2W A;  2WPE A;  1KF6 A;  4YWO A;  5JCI A;  4EIQ A;  3BHK A;  2JB3 A;  3H8L A;  3DME A;  4UDR A;  4YXD A;  2R46 A;  5IPY A;  1K4Q A;  2V6O A;  4H50 A;  2FJB A;  2GR1 A;  2C72 A;  5HYM A;  4NEV A;  1E1L A;  5EBK A;  4APN A;  1E39 A;  2BS4 A;  2GF3 A;  2V61 A;  4USR A;  1BZL A;  2EQ6 A;  3GWD A;  3NYE A;  4YKF A;  1XHC A;  2VOU A;  4IVO B;  1JNR A;  1PJ7 A;  3ZYX A;  2C4C A;  2JB2 A;  2GAH B;  3AE5 A;  3DJE A;  4H2P A;  4H2N A;  2V5Z A;  1MOK A;  1ZOV A;  4U8M A;  4B67 A;  4K2X A;  3KKJ A;  4U8I A;  1GT8 A;  2YG6 A;  3DJJ A;  1LQU A;  4ICY A;  3ICR A;  3VRB A;  3T31 A;  2OAM A;  2B9Y A;  2XVE A;  2BK4 A;  2BS2 A;  3PS9 A;  4H4U A;  5U1O A;  4CRT A;  2WS3 A;  2BS3 A;  2WP9 A;  3LXD A;  3DH9 A;  1JU2 A;  2GVC A;  2Y6R A;  3UP5 A;  3GMC A;  4D04 A;  5EB4 A;  1M64 A;  3CNJ A;  4WCT A;  4G6G A;  3CIR A;  2GQW A;  3NLC A;  4MJW A;  2RGO A;  2CUL A;  4GUV A;  4PAB A;  2EQ9 A;  1DOB A;  4IV9 A;  2TPR A;  1H7W A;  3M0O A;  4REK A;  4CBQ A;  1B37 A;  2WDQ A;  4G73 A;  3LJP A;  2XYO A;  4TM4 A;  2GH5 A;  4J56 A;  1H82 A;  2WBA A;  4II2 A;  3F8R A;  2AQJ A;  3GD3 A;  3IHG A;  5FS9 A;  3L1R A;  1BGN A;  4USQ A;  4J33 A;  4M52 A;  4I58 A;  5GRT A;  3GDP A;  2IVD A;  3HYX A;  1K0J A;  1CJC A;  2WU2 A;  3SZF A;  3RP6 A;  4BV6 A;  2B76 A;  4H4P A;  2EQ8 A;  4U8N A;  1COY A;  2ZBW A;  4FK1 C;  2BAC A;  1YQ3 A;  1H86 A;  1GND A;  1E1K A;  1CL0 A;  4Y4N A;  1DJQ A;  2GRT A;  1KSU A;  2WOI A;  5ER0 A;  4OPL A;  4GAP A;  3UTE A;  2BK5 A;  2C66 A;  4GDP A;  1E1M A;  2GMH A;  3AE2 A;  1CJ3 A;  2YVG A;  1DOE A;  2Q0L A;  4A99 A;  3P4Q A;  2ACZ A;  4OPD A;  2QA2 A;  3BHF A;  3GYJ A;  4G74 A;  1TDE A;  3AEF A;  3RP7 A;  3H4K A;  2PYX A;  1EL9 A;  4FK1 A;  5BRT A;  3NNE A;  4X9M A;  4XWR A;  4BK2 A;  4G6H A;  4LU6 A;  1PXC A;  2R0P A;  2E4G A;  3NN0 X;  4X9N A;  4DSG A;  3CMM A;  2XLU A;  1GRB A;  4H4X A;  3AWI A;  1B4V A;  4OPT A;  3NN6 X;  1GRH A;  2XLP A;  2GQF A;  3S5W A;  1JRX A;  1KDG A;  1QO8 A;  3AD9 B;  3F8P A;  2FJA A;  2YVJ A;  3GWF A;  3GDN A;  3T2Y A;  4EM3 A;  4JNQ A;  1DNC A;  2OLN A;  3C4N A;  1Y0P A;  3NKS A;  3QSS A;  2Q7V A;  3QVR A;  1CF3 A;  1XAN A;  1L9E A;  4H4V A;  3V76 A;  3GMB A;  3UP4 A;  4H4T A;  1F3P A;  4XXG A;  1PBB A;  3AE8 A;  2V60 A;  1CHU A;  1MXT A;  2WDR A;  3B3R A;  5HHF A;  1RYI A;  2WES A;  3AE3 A;  3NK2 X;  3ABV A;  4FX9 A;  3AB1 A;  1IJH A;  2V3B A;  5JCK A;  1F8W A;  1PBC A;  3I6D A;  1F6M A;  1OJ9 A;  3LOV A;  1Q9I A;  2YR6 A;  3M12 A;  5KMR A;  2DKI A;  3SXI A;  1ZOY A;  1NAA A;  3F8D A;  1VQW A;  3NHO X;  3GRT A;  1H81 A;  1BWC A;  3RED A;  5FS8 A;  2BAB A;  1AOG A;  3GSI A;  3VQR A;  3AEA A;  3O0H A;  4NWZ A;  5BUK A;  2OA1 A;  2X50 A;  1CJ4 A;  3BI5 A;  1VG0 A;  3HZL A;  1NG4 A;  3GYI A;  3UKP A;  3UKK A;  3PO7 A;  2R4J A;  1N4V A;  2XVH A;  2IVE A;  3DK8 A;  1GOS A;  3VR9 A;  1O94 A;  1FEB A;  4GCM A;  5EOW A;  1FEC A;  4B68 A;  4CY6 A;  2FBW A;  3T37 A;  5KRQ A;  1VRQ B;  2PHH A;  1FEA A;  2A89 A;  2HQM A;  4RG3 A;  5FMH A;  3K30 A;  4GF7 A;  2WP5 A;  2H89 A;  1H84 A;  4U8O A;  4EIP A;  4OPC A;  3L8K A;  3SZW A;  3P4P A;  4EMW A;  1IUS A;  2C70 A;  3KA7 A;  2BXS A;  1W4X A;  5U25 A;  3CPI G;  2Q0K A;  1S2Q A;  2R45 A;  1JOA A;  4PAA A;  2Q6U A;  3AEG A;  3JSK A;  2X3N A;  4UDP A;  4EQX A;  2JK6 A;  4D03 A;  4EQW A;  2X99 A;  4K7Z A;  2GR3 A;  1D4E A;  4DSH A;  1GEU A;  4EMI A;  4K8D A;  3COX A;  2YWL A;  2JB1 A;  2WOV A;  3DK9 A;  4N9X A;  2GR2 A;  2C3C A;  5DBJ A;  5KMS A;  2BRY A;  1XPQ A;  2C73 A;  1NHQ A;  1EL5 A;  3PVC A;  5KNL A;  1FCD A;  4U8K A;  4B66 A;  4C77 A;  1CC6 A;  3ICT A;  4DGK A;  2YG7 A;  1JRY A;  1PJ6 A;  1EL8 A;  2WPC A;  2ZZC A;  2E5V A;  4BUR A;  3KPK A;  3CNT A;  4II3 A;  3S61 A;  1H7X A;  1K0L A;  1BGJ A;  1KFY A;  3CND A;  4CCR A;  5KVI A;  4CCQ A;  4NEW A;  3ATQ A;  4UP3 A;  2AR8 A;  1D7Y A;  4TM3 A;  4U8J A;  2WEU A;  2WP6 A;  2ZZ0 A;  5C2T A;  3CN8 A;  2YR5 A;  3ALJ A;  1B5Q A;  1GRE A;  2XVI A;  1BF3 A;  5GSN A;  3RNM A;  3UKL A;  3Q9T A;  3CGE A;  4YTP A;  4TM0 A;  1RP0 A;  3IWA A;  3Q6J A;  1EL7 A;  1F8S A;  5CKU A;  2ARD A;  4BK1 A;  3RP8 A;  4CNJ A;  2X8H A;  3BNU A;  3P4R A;  3RHA A;  3UKF A;  1KSS A;  3OZ2 A;  1PS9 A;  4B65 A;  4A7A A;  4U8P A;  3AE7 A;  1H6V A;  4ZN0 A;  2B9X A;  4IA5 A;  2BRA A;  1V59 A;  4TLX A;  1ZMC A;  3HYW A;  3NK1 X;  3WE0 A;  3AE9 A;  4O5U A;  1DOD A;  1JEH A;  3AE1 A;  1Y56 B;  3ITJ A;  3NTA A;  1PBE A;  3ALL A;  3ISH A;  4C3Y A;  2YLS A;  4B1B A;  4U2L A;  2XCG A;  1GXF A;  1TDF A;  2BC0 A;  4IA6 A;  3ICS A;  4ZCC A;  4JDR A;  2CDU A;  3CGB A;  4FDC B;  4NTE A;  1YQZ A;  1YY5 A;  2GEW A;  2YLZ A;  4KX6 A;  4Z2R A;  4K5S A;  1GTH A;  1D4C A;  1L9D A;  2E1M A;  1P2E A;  2FJE A;  2XDO A;  3OC4 A;  1L9C A;  3CTY A;  4LA1 A;  2JAE A;  4H4W A;  4OPG A;  3EAN A;  4GRT A;  4YTN A;  3SY4 A;  2AAQ A;  1HYU A;  2RAB A;  2OAL A;  2BXR A;  4AT0 A;  2R4E A;  3LB8 A;  3UOY A;  4BJZ A;  3FBS A;  3SZ0 A;  3P9U A;  4A6N A;  3CPJ G;  2BYB A;  2JKC A;  1N4U A;  1ZDL A;  3SQP A;  4BK3 A;  4YKG A;  3LZW A;  4Z2T A;  1DOC A;  4P9S A;  1GAL A;  4B64 A;  3D1C A;  1RSG A;  4H2Q A;  4U2S A;  1GET A;  2XVF A;  2A8X A;  3KPF A;  2ZZB A;  3CGD A;  1GV4 A;  1XDI A;  4OPU A;  5KWF A;  4ADW A;  2YM2 A;  2Z5Y A;  3AED A;  5TR3 A;  1NEK A;  4J36 A;  3FIM B;  3AYL A;  3NIX A;  2BA9 A;  2V3A A;  2YG5 A;  3UKA A;  5HXI A;  2WQY A;  2WU5 A;  5JCM A;  3DGZ A;  2C65 A;  2QA1 A;  4X4J A;  5J60 A;  2GAG B;  3GRS A;  1REO A;  3DJG X;  4H7U A;  1PXA A;  4YSZ A;  1N4W A;  1PHH A;  5IQ4 A;  5JCL A;  3T2Z A;  2TMD A;  4JY2 A;  1LVL A;  3SZC A;  4AP1 A;  1LTX R;  4JNA A;  1IUX A;  1N1P A;  4JN9 A;  2VVM A;  3HYV A;  4GR1 A;  4UDQ A;  3SGL A;  3V3O A;  1GES A;  4AOX A;  1LJ1 A;  4J34 A;  4LII A;  1CBO A;  1FOH A;  1ZX9 A;  2WPF A;  3G5S A;  1CJ2 A;  1D7L A;  3II4 A;  3KVE A;  1E7P A;  3H8I A;  2NPX A;  3NTD A;  1IUU A;  3AYI A;  5FS6 A;  4A9W A;  2YR4 A;  1CC2 A;  5U63 A;  4E0V A;  3UTF A;  4NNJ A;  3UTH A;  1S3B A;  4OCG A;  2C64 A;  1O95 A;  4Z2U A;  3BI4 A;  3LZX A;  3AD7 B;  3E1T A;  1GRA A;  4CNK A;  1ONF A;  5CQF A;  2YG4 A;  4OVI A;  1L0V A;  2F5Z A;  3UOV A;  1K0I A;  1OJT A;  4NTC A;  3SX6 A;  2WHD A;  2W0H A;  1EBD A;  4J57 A;  3GD4 A;  2Y6Q A;  3P1W A;  4A65 A;  5J7X A;  5EB5 A;  4YSY A;  1PBF A;  3NT6 A;  3FG2 P;  1ZMD A;  5IQ1 A;  3NYF A;  1OJC A;  1NHS A;  2RGJ A;  4EMJ A;  1QLB A;  2A87 A;  1M6I A;  2QCU A;  1TDN A;  3D8X A;  4GDE A;  1NG3 A;  2APG A;  2VQB A;  3AE6 A;  3ATR A;  2BCP A;  4EM4 A;  1TDO A;  1JRZ A;  3CPH G;  4Z26 A;  1PXB A;  2O9Z A;  1ELI A;  2GMJ A;  4OPI A;  3UKQ A;  3NGC X;  4U2T A;  1ZK7 A;  3LAD A;  4NZH A;  3EPT A;  1H83 A;  3NH3 X;  2XFU A;  2YLT A;  5FS7 A;  3DJD A;  1FL2 A;  2FJD A;  4EQS A;  3UKH A;  2VQ7 A;  2X8G A;  1MO9 A;  1IUT A;  1ZP0 A;  2NVK X;  2YVF A;  4HB9 A;  3BNM A;  5KOX A;  2VVL G;  3UOZ A;  3T0K A;  4C5O A;  3AEB A;  2YQU A;  3UTG A;  1Q1W A;  1TDK A;  4H4Y A;  4J31 A;  5BUL A;  1F8R A;  4Z43 A;  1YQ4 A;  4AP3 A;  4AT2 A;  4ECH A;  2YG3 A;  2YM1 A;  3SFE A;  3IHM A;  1P2H A;  3C96 A;  1VDC A;  3T14 A;  3NG7 X;  1Q1R A;  3BI2 A;  3CNS A;  4O5Q A;  2YLX A;  2C75 A;  1QJD A;  4H2R A;  4YTM A;  1LQT A;  2EQ7 A;  3C4A A;  2WDV A;  2VRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...