3I6DA

Crystal structure of ppo from bacillus subtilis with af
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
466
structure length
414
Chain Sequence
KKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYIIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGDIDKLSLMSTFPQFYQFQTLSTGLQTLVEEIEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAISHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGKTLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGHKQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protoporphyrinogen oxidase
publication title Structural insight into unique properties of protoporphyrinogen oxidase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 118
structure length 414
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.3.3.4: Protoporphyrinogen oxidase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3110.20 Mainly Alpha Orthogonal Bundle protoporphyrinogen ix oxidase, domain 3 protoporphyrinogen ix oxidase, domain 3 3i6dA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3i6dA01
3.90.660.20 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Protoporphyrinogen oxidase, mitochondrial; domain 2 3i6dA02
5TR3A 3K7MX 4EQRA 4B69A 4GRTA 1GRFA 1B5QA 3NK2X 3AB1A 4H2QA 2V3BA 1GERA 1QLBA 1RP0A 2WBAA 2WDVA 2Z5YA 3ICRA 4U2SA 1GTHA 3NHOX 1B8SA 1ELIA 5L46A 2ZZBA 4U8JA 2EQ9A 1S3BA 2YLZA 3LXDA 1IUWA 1FEBA 3FBSA 2R4EA 3H4KA 2OAMA 1CC4A 4CCQA 4B63A 4BJYA 3DA1A 1CJCA 2YR5A 2XFQA 4K8DA 1KNRA 1Q9IA 2BK4A 4DGKA 4DSHA 1F8RA 2B9WA 4U8IA 3ISHA 4XWRA 2Q7VA 1XANA 1EL8A 4HA6A 1PBCA 3DGHA 2R4JA 2B9YA 1DJNA 3CGDA 2B7SA 1IUTA 4EMWA 2QCUA 2AQJA 3NN6X 4U8MA 3QVRA 4TM3A 1OJCA 3SFEA 3NYFA 1TDFA 1TDEA 1VRQB 1QJDA 1E6EA 2WP9A 1CBOA 2WU5A 4GR1A 4EMIA 2XFNA 3CGBA 4YWOA 1TYPA 5JCMA 3EPTA 4APNA 3GWDA 4D04A 3AEDA 2J3NA 2YLRA 3LOVA 3RNMA 4Z2RA 4YSHA 5M10A 2WOVA 1B37A 4Y4LA 4U8KA 5FS6A 1E1KA 4BK1A 5JCNA 3PVCA 2R9ZA 1VG0A 3GDPA 1E7PA 4Z2UA 1NHRA 3M13A 4JDRA 3SQPA 3VQRA 4YSXA 4AP1A 3DGZA 4UDPA 1V59A 3AECA 2WPEA 3AD8B 3DJJA 5J60A 4OPDA 2GAGB 1GRTA 1KF6A 2NVKX 3GYIA 2C3CA 3NYCA 1BWCA 3NTDA 3KVEA 2VOUA 4P9SA 2WPCA 1FEAA 4JY2A 2RGHA 2GMJA 4A7AA 2QA2A 4C77A 3EF6A 3L1RA 2CULA 2C65A 1PXAA 1NPXA 5JCIA 5C2TA 2E4GA 1H83A 4H4XA 3AYIA 1PHHA 1LVLA 2VQBA 3SM8A 2BS3A 4Y4NA 5ER0A 1NENA 1GALA 3NN0X 4OPUA 1FCDA 3G5RA 2GB0A 4JN9A 4NTEA 4JNQA 5JCKA 3AE3A 1GEUA 2ZBWA 1AOGA 2YLTA 1CC6A 1P2EA 4TM1A 3ZYXA 3ALLA 2BS4A 2YAUA 2DKIA 5FMHA 2GR2A 2QAEA 4REKA 2RGOA 1F6MA 2C76A 2XVEA 2YR6A 4TLZA 3I6DA 2X8GA 1K0IA 3EANA 2DKHA 4Z25A 3AEFA 2GF3A 4RSLA 3CNSA 2A8XA 1HYUA 1JRZA 4CRTA 3DJGX 3LB8A 2YG4A 2YQUA 1M6IA 3GRSA 4RG3A 5HY5A 4U2TA 2BK5A 4C3YA 4YSZA 5KVHA 2Q0LA 5EOWA 3DK8A 2XVIA 1JU2A 5M0ZA 4A9WA 4DSGA 2ZZCA 1LQTA 1F8WA 3URHA 4GDEA 3CTYA 1PJ6A 1XDIA 2A89A 1CHUA 4AOXA 4B67A 4YXDA 1H86A 2Y6QA 1COYA 2R0CA 3GRTA 5FS7A 3SFDA 1TDNA 1DOEA 2V5ZA 1Q1WA 2V6OA 4PABA 2OLNA 3V3NA 4N9XA 4BK2A 2H89A 3KKJA 3IHGA 3BNMA 2R0PA 4OCGA 4YT0A 1ZOVA 2PYXA 1GTEA 1ZDLA 3ABVA 4A5LA 4DNAA 1PBFA 3UKPA 5BULA 3FMWA 5JCLA 1L9EA 1NEKA 3ADAB 2BACA 1PXBA 4CY6A 4B66A 3DK4A 4A99A 3BI4A 4A79A 2WQYA 2VZ2A 3BI5A 1OJDA 3DH9A 3QFBA 3QVPA 1MO9A 1IJHA 4YKGA 3NLCA 2A87A 2BCPA 3P4SA 3K7TA 2RABA 1XHCA 5LV9A 1PJ7A 2E5VA 4A65A 4K5SA 1KDGA 1YQ3A 3BI2A 2C67A 1S2YA 2E1MA 1FECA 2BXRA 1Z6LA 4AP3A 2C3DA 1ZP0A 1GXFA 1M64A 1IUXA 1YY5A 3Q9TA 2VVLG 1ZOYA 1PJ5A 1NHPA 1W4XA 1YQ4A 1DNCA 2YR4A 3P9UA 4WCTA 3LZWA 2XVFA 4Z26A 2GAHB 4U8OA 3CPIG 3QSEA 2Y6RA 1H6VA 2TMDA 1FOHA 2C73A 2GQWA 3GD4A 3NK0X 1QO8A 2B7RA 2GR1A 3S5WA 4H4WA 4CCRA 4PAAA 1L9DA 4LA1A 1PBDA 4D03A 4NTDA 3COXA 1H7XA 4U8NA 2EQ6A 1SEZA 3AD7B 4J56A 4ADWA 2B76A 2RGJA 3AEAA 1IUVA 3NT6A 2CFYA 1KSSA 3H8LA 1PXCA 3WE0A 2BA9A 4EIQA 5BRTA 5C3JA 4H4RA 3UKQA 3F8PA 1H82A 3UOVA 1JEHA 5EB4A 1BGNA 4CNKA 3AYLA 1JOAA 2W0HA 2BK3A 4J33A 4OPTA 3B6DA 3C96A 1K0LA 3NH3X 3C4AA 4TM0A 3UKHA 2ARDA 1JRYA 3AE6A 4O5QA 2JB1A 2FJEA 4XWZA 2BABA 1BKWA 4ZN0A 2GH5A 3UTEA 1D7YA 2Q0KA 4UDQA 4CNJA 2C72A 4FX9A 3UKLA 4EQXA 4X9NA 1GV4A 3G5SA 5U25A 3C4NA 1NDAA 2VVMA 1TYTA 2V60A 1N4WA 4MJWA 2X8CA 3GMCA 4OPLA 1YKJA 4ZCDA 4ZCCA 1GNDA 5FS9A 1EL9A 2WETA 4UDRA 4CBQA 1L9CA 3I3LA 4H50A 3BHKA 1CJ2A 1LTXR 3K30A 3D1CA 1O5WA 2YM2A 3NG7X 5U1OA 1DODA 3FIMB 1P2HA 1NG3A 2GRTA 2WS3A 2YG7A 3GMBA 3OZ2A 2GV8A 2IVDA 2X8HA 4EQSA 2APGA 2YVGA 1D7LA 3H8IA 2ACZA 1NAAA 1ONFA 5HYMA 1IUSA 3AEGA 2VQ7A 3IF9A 4RG4A 4J57A 3CPHG 2VRMA 4K7ZA 1K0JA 5IQ4A 2NPXA 3EAOA 4JY3A 3NGCX 1S2QA 2JB3A 4YSYA 1GRHA 4UP3A 2XVHA 1DXLA 3P4QA 4Z2TA 2JB2A 3P4RA 4HB9A 5FS8A 1N4VA 4H2PA 3KU9A 4H4ZA 1DOBA 5EB5A 2XDOA 4BV6A 3DJEA 1LPFA 3CNDA 3JSKA 3AD9B 2WP6A 3NIXA 3CPJG 3QFAA 1CL0A 4KX6A 1DJQA 1GRAA 4K22A 3RP8A 3UTHA 4EM3A 1D4DA 1GRBA 1D5TA 3E1TA 4J36A 1VG9A 1TRBA 1EL7A 1BF3A 1BGJA 3K7QX 1NHSA 3ALMA 3V3OA 4H2RA 1LV0A 2PHHA 3UTGA 2BS2A 2OLOA 4AT0A 2GMHA 3QSSA 4J31A 3P1WA 4Z24A 2R46A 2JK6A 1F3PA 2JBVA 3AXBA 4IVMB 2WOWA 1D4CA 2WOIA 3GD3A 2R0GA 3PO7A 1H7WA 3AE2A 1GSNA 2XLTA 3NKSA 4H4TA 1GREA 3GWFA 1CJ4A 1OJ9A 3AE5A 1GESA 1S3EA 4WX1A 2YLXA 3AE4A 1Y56A 4IA5A 3SGLA 4C3XA 2XVJA 3GSIA 4U8LA 4XXGA 1N4UA 2VVLA 2BXSA 3F8RA 3ATQA 2WDRA 4EQWA 3RHAA 1E39A 2C7GA 4YTPA 3VRDB 2XLUA 1MXTA 3AWIA 5J7XA 3UP5A 3OC4A 2IVEA 3CNPA 2Z5XA 2X50A 3L8KA 1B4VA 4GDPA 4YKFA 4YTMA 1LJ1A 2C64A 4B65A 1VDCA 3IHMA 1PDHA 4NZHA 2YG6A 2YG3A 1CJ3A 1EBDA 2F5ZA 2WDQA 5CKUA 3ICSA 1D4EA 3HZLA 3KLJA 1NG4A 1JRXA 1L0VA 4TM4A 4H4VA 4H4QA 3VRAA 4NEVA 4B1BA 2X3NA 3UKFA 1K4QA 1CF3A 2YG5A 1GOSA 3CIRA 4BK3A 3FG2P 3UKKA 1KFYA 3D8XA 2CDUA 2YVFA 4H7UA 1H84A 1O95A 2V3AA 3QSMA 4TLXA 3REDA 5KXJA 4OPIA 4GUVA 2V61A 3AYJA 2XYOA 1ZKQA 2ZZ0A 2H88A 1EL5A 2OA1A 3AEBA 3QJ4A 4X9MA 1E1NA 4BURA 2AAQA 1JNRA 1E1MA 4ICYA 1TDOA 2XLPA 1ZMCA 3ITJA 5IQ1A 4AT2A 5BVAA 4USQA 4USRA 3VRBA 3KPFA 2GVCA 2XFUA 2JKCA 3UP4A 1NHQA 2EQ8A 1KSUA 1Q1RA 1GRGA 2OALA 1TDKA 2YM1A 3V76A 3VR9A 2XCGA 1JNZA 4U8PA 1ZY8A 3DJDA 4GF7A 4B64A 2WEUA 2C75A 2FBWA 3NRNA 4K5RA 5CQFA 3NNEA 2QA1A 3M0OA 3UOZA 4M52A 2WESA 4CY8A 1CC2A 5IPYA 2VRLA 1GPEA 2TPRA 1PN0A 3AE1A 4NEWA 3S61A 4I58A 3IC9A 1REOA 5HXIA 4FK1A 2WPFA 2FJAA 2X99A 3AEEA 1MOKA 1GETA 3LADA 5KVIA 1ZK7A 4Y4MA 3IWAA 3UCLA 3G5QA 3CGEA 4OVIA 3UTFA 2HQMA 4ECHA 5GSNA 3BNUA 2O9ZA 4H2NA 2XLRA 1IUUA 2I0ZA 2XFPA 4YTNA 4IVOB 4LIIA 2BYBA 2B9XA 2BC1A 4EM4A 1PBBA 1UKVG 4NTCA 1PS9A 1H81A 4C5OA 3UOXA 1N1PA 3KA7A 3AE7A 3DK9A 4K2XA 4X4JA 3LZXA 3NYEA 4LU6A 3M12A 2WU2A 5HHFA 3FPZA 1O94A 1RYIA 2BCGG 4Z44A 1OJAA 1RSGA 2WP5A 5DBJA 3B3RA 4IA6A 4H4UA 4U2LA 4EIPA 1BZLA 2C66A 4C74A 2WHDA 2GR3A 3NK1X 3AE9A 3AE8A 3CNTA 2R45A 4A6NB 4BJZA 5U63A 2YLSA 3ICTA 3R9UA 4EMJA 1Y56B 4OPGA 5KWFA 4AOSA 2C70A 3II4A 3ZDNA 5KRQA 3UOYA 4JQ9A 2EQ7A 2JAEA 4J34A 2GR0A 3KD9A 4E0VA 4FK1C 5GRTA 4KPRA 4GCMA 3F8DA 1X31B 3DMEA 2YVJA 5KOXA 1PBEA 3O0HA 2UZZA 2BC0A 2GEWA 4H4SA 1VQWA 5KOWA 3CGCA 1LQUA 1F8SA 3CNJA 2FJDA 1XPQA 4H4PA 3P4PA 5EBKA 3RP7A 4O5UA 3VR8A 3ALJA 1E1LA 3Q6JA 1YQZA 2AR8A 2FJBA 2IIDA 1Y0PA 3GYJA 4H4YA 4OPCA 1ZX9A 5BUKA 3CN8A 3PS9A 3RP6A 3ATRA 3NTAA 2XLSA 3LJPA 1OJTA 4J2WA 4IV9A 1ZMDA 2XFOA 3GDNA 4FDCB 1GT8A 2GQFA 1DOCA 2CVJA 1FL2A 2YLWA 4JNAA 4I59A 3UKAA 4A6NA 1KNPA 3T37A 2YWLA 4Z43A 3BHFA 2Q6UA 4B68A
chains in the Genus database with same CATH superfamily
5TR3A 3K7MX 4EQRA 4B69A 4GRTA 1GRFA 1B5QA 3NK2X 3AB1A 4H2QA 2V3BA 1GERA 1QLBA 1RP0A 2WBAA 2WDVA 2Z5YA 3ICRA 4U2SA 1GTHA 3NHOX 1B8SA 1ELIA 5L46A 2ZZBA 4U8JA 2EQ9A 1S3BA 2YLZA 3LXDA 1IUWA 1FEBA 3FBSA 2R4EA 3H4KA 2OAMA 1CC4A 4G6GA 4B63A 4CCQA 4BJYA 3DA1A 1CJCA 2YR5A 2XFQA 4K8DA 1KNRA 1Q9IA 2BK4A 4DGKA 4DSHA 1F8RA 2B9WA 4U8IA 3ISHA 4XWRA 3HYXA 2Q7VA 1XANA 1EL8A 4HA6A 1PBCA 3DGHA 2R4JA 2B9YA 1DJNA 3CGDA 2B7SA 1IUTA 4EMWA 2QCUA 2AQJA 3NN6X 4U8MA 3QVRA 4TM3A 1OJCA 3SFEA 3NYFA 1TDFA 1TDEA 1VRQB 1QJDA 1E6EA 2WP9A 1CBOA 2WU5A 4GR1A 4EMIA 2XFNA 3CGBA 4YWOA 1TYPA 5JCMA 3EPTA 4APNA 3GWDA 4D04A 3AEDA 2J3NA 3LOVA 2YLRA 3RNMA 4Z2RA 4YSHA 5M10A 2WOVA 1B37A 4Y4LA 4U8KA 5FS6A 1E1KA 4BK1A 5JCNA 3PVCA 2R9ZA 1VG0A 3GDPA 1E7PA 4Z2UA 1NHRA 3M13A 4JDRA 3SQPA 3VQRA 4YSXA 4AP1A 3DGZA 4UDPA 1V59A 3AECA 2WPEA 3AD8B 3DJJA 5J60A 4OPDA 2GAGB 1GRTA 1KF6A 2NVKX 3GYIA 2C3CA 3NYCA 1BWCA 3NTDA 3KVEA 2VOUA 4P9SA 2WPCA 1FEAA 4JY2A 2RGHA 2GMJA 4A7AA 2QA2A 4C77A 3EF6A 3L1RA 2CULA 2C65A 1PXAA 1NPXA 5JCIA 5C2TA 2E4GA 1H83A 4H4XA 3AYIA 1PHHA 1LVLA 2VQBA 3SM8A 2BS3A 4Y4NA 5ER0A 1NENA 1GALA 3NN0X 4OPUA 1FCDA 3G5RA 2GB0A 4JN9A 4NTEA 4JNQA 5JCKA 3AE3A 1GEUA 2ZBWA 1AOGA 2YLTA 1CC6A 1P2EA 4TM1A 3ZYXA 3ALLA 2BS4A 2YAUA 2DKIA 5FMHA 2GR2A 2QAEA 3SZ0A 4REKA 2RGOA 1F6MA 2C76A 2XVEA 2YR6A 4TLZA 3I6DA 2X8GA 1K0IA 3EANA 2DKHA 4Z25A 3AEFA 2GF3A 4RSLA 3CNSA 2A8XA 1HYUA 1JRZA 4CRTA 3DJGX 3LB8A 2YG4A 2YQUA 1M6IA 3GRSA 4RG3A 3SXIA 5HY5A 4U2TA 3SZFA 2BK5A 4C3YA 4YSZA 5KVHA 2Q0LA 5EOWA 3DK8A 2XVIA 1JU2A 5M0ZA 4A9WA 4DSGA 2ZZCA 1LQTA 1F8WA 3URHA 4GDEA 3CTYA 1PJ6A 1XDIA 2A89A 1CHUA 4AOXA 4B67A 4YXDA 1H86A 2Y6QA 1COYA 2R0CA 3GRTA 5FS7A 3T0KA 2BRYA 3SFDA 1TDNA 1DOEA 2V5ZA 1Q1WA 2V6OA 4PABA 2OLNA 3V3NA 4N9XA 4NWZA 4BK2A 2H89A 3KKJA 3IHGA 3BNMA 3SZWA 2R0PA 4OCGA 4YT0A 1ZOVA 2PYXA 1GTEA 1ZDLA 3ABVA 4A5LA 4DNAA 1PBFA 3UKPA 5BULA 3FMWA 5JCLA 1L9EA 1NEKA 3ADAB 2BACA 1PXBA 4CY6A 4B66A 3DK4A 4A99A 3BI4A 4A79A 2WQYA 2VZ2A 3BI5A 1OJDA 3DH9A 3QFBA 3QVPA 1MO9A 1IJHA 3HYWA 4YKGA 3NLCA 2A87A 2BCPA 3P4SA 3K7TA 2RABA 3HYVA 1XHCA 5LV9A 1PJ7A 2E5VA 4A65A 4K5SA 1KDGA 1YQ3A 3BI2A 2C67A 1S2YA 2E1MA 1FECA 2BXRA 1Z6LA 4AP3A 2C3DA 1ZP0A 1GXFA 1M64A 1IUXA 1YY5A 3Q9TA 2VVLG 1ZOYA 1PJ5A 1NHPA 1W4XA 1YQ4A 1DNCA 2YR4A 3P9UA 4WCTA 3LZWA 2XVFA 4Z26A 2GAHB 4U8OA 3CPIG 3QSEA 2Y6RA 1H6VA 2TMDA 1FOHA 2C73A 2GQWA 3GD4A 3NK0X 1QO8A 2B7RA 2GR1A 3S5WA 4H4WA 4CCRA 4PAAA 1L9DA 4LA1A 1PBDA 4D03A 4NTDA 3COXA 1H7XA 4U8NA 2EQ6A 1SEZA 3AD7B 4J56A 4ADWA 2B76A 2RGJA 3AEAA 1IUVA 3NT6A 3CMMA 2CFYA 1KSSA 3H8LA 1PXCA 3WE0A 2BA9A 4EIQA 5BRTA 5C3JA 4H4RA 3UKQA 3F8PA 1H82A 3UOVA 1JEHA 5EB4A 1BGNA 4CNKA 3AYLA 1JOAA 2W0HA 2BK3A 4J33A 4OPTA 3B6DA 3C96A 1K0LA 3NH3X 3C4AA 4TM0A 3UKHA 2ARDA 1JRYA 3AE6A 4O5QA 2JB1A 4G9KA 2FJEA 4XWZA 2BABA 1BKWA 4ZN0A 2GH5A 3UTEA 1D7YA 3T14A 2Q0KA 4UDQA 4CNJA 2C72A 4FX9A 3UKLA 4EQXA 4X9NA 1GV4A 3G5SA 5U25A 3C4NA 1NDAA 2VVMA 1TYTA 2V60A 1N4WA 4MJWA 2X8CA 3GMCA 4OPLA 3T2ZA 1YKJA 4ZCDA 4ZCCA 1GNDA 5FS9A 1EL9A 2WETA 4UDRA 5KMPA 4CBQA 1L9CA 3I3LA 4H50A 3BHKA 1CJ2A 1LTXR 3K30A 3D1CA 1O5WA 2YM2A 3NG7X 5U1OA 1DODA 3FIMB 5KMQA 1P2HA 1NG3A 2GRTA 2WS3A 2YG7A 3GMBA 4NNJA 2IVDA 2GV8A 3OZ2A 2X8HA 4EQSA 2APGA 2YVGA 1D7LA 3H8IA 3T2KA 2ACZA 1NAAA 1ONFA 5HYMA 1IUSA 3AEGA 2VQ7A 3IF9A 4RG4A 4J57A 3CPHG 2VRMA 4K7ZA 1K0JA 5IQ4A 2BRAA 2NPXA 3EAOA 4JY3A 3NGCX 1S2QA 2JB3A 4YSYA 1GRHA 4UP3A 2XVHA 1DXLA 3P4QA 4Z2TA 2JB2A 3P4RA 4HB9A 5FS8A 1N4VA 4H2PA 3KU9A 4H4ZA 1DOBA 5EB5A 2XDOA 4BV6A 3DJEA 1LPFA 3CNDA 3JSKA 3AD9B 2WP6A 3NIXA 3CPJG 3QFAA 1CL0A 4KX6A 1DJQA 1GRAA 4K22A 3RP8A 3UTHA 4EM3A 1D4DA 1GRBA 1D5TA 3E1TA 4II2A 4J36A 1VG9A 4G73A 1TRBA 1EL7A 1BF3A 1BGJA 3K7QX 1NHSA 3ALMA 3V3OA 4H2RA 1LV0A 2PHHA 3UTGA 2BS2A 2OLOA 4AT0A 3SX6A 2GMHA 3QSSA 4J31A 3P1WA 4Z24A 2R46A 2JK6A 1F3PA 2JBVA 3AXBA 4IVMB 2WOWA 1D4CA 2WOIA 3GD3A 2R0GA 3PO7A 1H7WA 3AE2A 1GSNA 2XLTA 3NKSA 4H4TA 1GREA 3GWFA 1CJ4A 1OJ9A 3AE5A 1GESA 1S3EA 4WX1A 2YLXA 3AE4A 1Y56A 4IA5A 3SGLA 4C3XA 2XVJA 3GSIA 4U8LA 3SYIA 4XXGA 1N4UA 2VVLA 2BXSA 3F8RA 3ATQA 2WDRA 4EQWA 3RHAA 3SY4A 1E39A 2C7GA 4YTPA 5KMRA 3VRDB 2XLUA 1MXTA 3AWIA 5J7XA 3UP5A 3OC4A 2IVEA 3CNPA 2Z5XA 2X50A 3L8KA 1B4VA 4GDPA 4G6HA 4YKFA 1LJ1A 2C64A 4YTMA 4B65A 1VDCA 3IHMA 1PDHA 4NZHA 2YG6A 2YG3A 1CJ3A 1EBDA 2F5ZA 2WDQA 5CKUA 3ICSA 1D4EA 3HZLA 3KLJA 1NG4A 1JRXA 1L0VA 4TM4A 4H4VA 4H4QA 3VRAA 4NEVA 4B1BA 2X3NA 3UKFA 1K4QA 1CF3A 2YG5A 1GOSA 3CIRA 4BK3A 3FG2P 3UKKA 1KFYA 3D8XA 2CDUA 2YVFA 4H7UA 1H84A 1O95A 2V3AA 3GYXA 3QSMA 4TLXA 3REDA 5KXJA 5KNLA 4OPIA 4GUVA 2V61A 3AYJA 2XYOA 1ZKQA 2ZZ0A 2H88A 1EL5A 2OA1A 3AEBA 3QJ4A 4X9MA 1E1NA 4GAPA 2AAQA 4BURA 1JNRA 1E1MA 4ICYA 1TDOA 2XLPA 1ZMCA 3ITJA 5IQ1A 4AT2A 5BVAA 4USQA 4USRA 3VRBA 3KPFA 5KMSA 2GVCA 2XFUA 2JKCA 3UP4A 1NHQA 2EQ8A 1KSUA 1Q1RA 1GRGA 2OALA 1TDKA 2YM1A 3V76A 3VR9A 2XCGA 1JNZA 4G74A 4U8PA 1ZY8A 3DJDA 4GF7A 4B64A 2WEUA 2C75A 2FBWA 3NRNA 4K5RA 5CQFA 3NNEA 2QA1A 3M0OA 3UOZA 4M52A 2WESA 4CY8A 1CC2A 5IPYA 2VRLA 1GPEA 2TPRA 1PN0A 3AE1A 4NEWA 3S61A 4I58A 3IC9A 1REOA 5HXIA 4FK1A 4II3A 2WPFA 2FJAA 2X99A 3AEEA 1MOKA 1GETA 3LADA 5KVIA 1ZK7A 4Y4MA 3IWAA 3UCLA 3G5QA 3CGEA 4OVIA 3UTFA 2HQMA 4ECHA 5GSNA 3BNUA 2O9ZA 4H2NA 2XLRA 1IUUA 2I0ZA 2XFPA 4YTNA 4IVOB 4LIIA 2BYBA 2B9XA 2BC1A 4EM4A 1PBBA 1UKVG 4NTCA 1PS9A 1H81A 4C5OA 3UOXA 1N1PA 3KA7A 3AE7A 3DK9A 4K2XA 4X4JA 3LZXA 2C4CA 3NYEA 4LU6A 3M12A 2WU2A 5HHFA 3FPZA 1O94A 1RYIA 2BCGG 4Z44A 1OJAA 1RSGA 2WP5A 5DBJA 3SZCA 3B3RA 4IA6A 4H4UA 4U2LA 4EIPA 1BZLA 2C66A 4C74A 2WHDA 2GR3A 3NK1X 3AE9A 3AE8A 3CNTA 2R45A 4A6NB 4BJZA 5U63A 2YLSA 3ICTA 3R9UA 4EMJA 1Y56B 4OPGA 5KWFA 4AOSA 2C70A 3II4A 3ZDNA 5KRQA 3UOYA 4JQ9A 2EQ7A 2JAEA 4J34A 3T2YA 2GR0A 3KD9A 4E0VA 4FK1C 5GRTA 4KPRA 4GCMA 3KPKA 3F8DA 1X31B 3DMEA 2YVJA 4GAVA 5KOXA 1PBEA 3O0HA 2UZZA 2BC0A 2GEWA 4H4SA 1VQWA 5KOWA 3CGCA 1LQUA 1F8SA 3CNJA 2FJDA 1XPQA 4H4PA 3P4PA 5EBKA 3RP7A 3T31A 4O5UA 3VR8A 3ALJA 1E1LA 3Q6JA 1YQZA 2AR8A 2FJBA 2IIDA 1Y0PA 3GYJA 4H4YA 4OPCA 1ZX9A 5BUKA 3CN8A 3PS9A 3RP6A 3ATRA 3NTAA 2XLSA 3LJPA 1OJTA 4J2WA 4IV9A 1ZMDA 2XFOA 3GDNA 4FDCB 1GT8A 2GQFA 1DOCA 2CVJA 1FL2A 2YLWA 4JNAA 4I59A 3UKAA 4A6NA 1KNPA 3T37A 2YWLA 4Z43A 3BHFA 2Q6UA 4B68A
chains in the Genus database with same CATH topology
5TR3A 3K7MX 4EQRA 4B69A 4GRTA 1GRFA 1B5QA 3NK2X 3AB1A 4H2QA 2V3BA 1GERA 1QLBA 1RP0A 2WBAA 2WDVA 2Z5YA 3ICRA 4U2SA 1GTHA 3NHOX 1B8SA 1ELIA 5L46A 2ZZBA 4U8JA 2EQ9A 1S3BA 2YLZA 3LXDA 1IUWA 1FEBA 3FBSA 2R4EA 3H4KA 2OAMA 1CC4A 4G6GA 4B63A 4CCQA 4BJYA 3DA1A 1CJCA 2YR5A 2XFQA 4K8DA 1KNRA 1Q9IA 2BK4A 4DGKA 4DSHA 1F8RA 2B9WA 4U8IA 3ISHA 4XWRA 3HYXA 2Q7VA 1XANA 1EL8A 4HA6A 1PBCA 3DGHA 2R4JA 2B9YA 1DJNA 3CGDA 2B7SA 1IUTA 4EMWA 2QCUA 2AQJA 3NN6X 4U8MA 3QVRA 4TM3A 1OJCA 3SFEA 3NYFA 1TDFA 1TDEA 1VRQB 1QJDA 1E6EA 2WP9A 1CBOA 2WU5A 4GR1A 4EMIA 2XFNA 3CGBA 4YWOA 1TYPA 5JCMA 3EPTA 4APNA 3GWDA 4D04A 3AEDA 2J3NA 3LOVA 2YLRA 3RNMA 4Z2RA 4YSHA 5M10A 2WOVA 1B37A 4Y4LA 4U8KA 5FS6A 1E1KA 4BK1A 5JCNA 3PVCA 2R9ZA 1VG0A 3GDPA 1E7PA 4Z2UA 1NHRA 3M13A 4JDRA 3SQPA 3VQRA 4YSXA 4AP1A 3DGZA 4UDPA 1V59A 3AECA 2WPEA 3AD8B 3DJJA 5J60A 4OPDA 2GAGB 1GRTA 1KF6A 2NVKX 3GYIA 2C3CA 3NYCA 1BWCA 3NTDA 3KVEA 2VOUA 4P9SA 2WPCA 1FEAA 4JY2A 2RGHA 2GMJA 4A7AA 2QA2A 4C77A 3EF6A 3L1RA 2CULA 2C65A 1PXAA 1NPXA 5JCIA 5C2TA 2E4GA 1H83A 4H4XA 3AYIA 1PHHA 1LVLA 2VQBA 3SM8A 2BS3A 4Y4NA 5ER0A 1NENA 1GALA 3NN0X 4OPUA 1FCDA 3G5RA 2GB0A 4JN9A 4NTEA 4JNQA 5JCKA 3AE3A 1GEUA 2ZBWA 1AOGA 2YLTA 1CC6A 1P2EA 4TM1A 3ZYXA 3ALLA 2BS4A 2YAUA 2DKIA 5FMHA 2GR2A 2QAEA 3SZ0A 4REKA 2RGOA 1F6MA 2C76A 2XVEA 2YR6A 4TLZA 3I6DA 2X8GA 1K0IA 3EANA 2DKHA 4Z25A 3AEFA 2GF3A 4RSLA 3CNSA 2A8XA 1HYUA 1JRZA 4CRTA 3DJGX 3LB8A 2YG4A 2YQUA 1M6IA 3GRSA 4RG3A 3SXIA 5HY5A 4U2TA 3SZFA 2BK5A 4C3YA 4YSZA 5KVHA 2Q0LA 5EOWA 3DK8A 2XVIA 1JU2A 5M0ZA 4A9WA 4DSGA 2ZZCA 1LQTA 1F8WA 3URHA 4GDEA 3CTYA 1PJ6A 1XDIA 2A89A 1CHUA 4AOXA 4B67A 4YXDA 1H86A 2Y6QA 1COYA 2R0CA 3GRTA 5FS7A 3T0KA 2BRYA 3SFDA 1TDNA 1DOEA 2V5ZA 1Q1WA 2V6OA 4PABA 2OLNA 3V3NA 4N9XA 4NWZA 4BK2A 2H89A 3KKJA 3IHGA 3BNMA 3SZWA 2R0PA 4OCGA 4YT0A 1ZOVA 2PYXA 1GTEA 1ZDLA 3ABVA 4A5LA 4DNAA 1PBFA 3UKPA 5BULA 3FMWA 5JCLA 1L9EA 1NEKA 3ADAB 2BACA 1PXBA 4CY6A 4B66A 3DK4A 4A99A 3BI4A 4A79A 2WQYA 2VZ2A 3BI5A 1OJDA 3DH9A 3QFBA 3QVPA 1MO9A 1IJHA 3HYWA 4YKGA 3NLCA 2A87A 2BCPA 3P4SA 3K7TA 2RABA 3HYVA 1XHCA 5LV9A 1PJ7A 2E5VA 4A65A 4K5SA 1KDGA 1YQ3A 3BI2A 2C67A 1S2YA 2E1MA 1FECA 2BXRA 1Z6LA 4AP3A 2C3DA 1ZP0A 1GXFA 1M64A 1IUXA 1YY5A 3Q9TA 2VVLG 1ZOYA 1PJ5A 1NHPA 1W4XA 1YQ4A 1DNCA 2YR4A 3P9UA 4WCTA 3LZWA 2XVFA 4Z26A 2GAHB 4U8OA 3CPIG 3QSEA 2Y6RA 1H6VA 2TMDA 1FOHA 2C73A 2GQWA 3GD4A 3NK0X 1QO8A 2B7RA 2GR1A 3S5WA 4H4WA 4CCRA 4PAAA 1L9DA 4LA1A 1PBDA 4D03A 4NTDA 3COXA 1H7XA 4U8NA 2EQ6A 1SEZA 3AD7B 4J56A 4ADWA 2B76A 2RGJA 3AEAA 1IUVA 3NT6A 3CMMA 2CFYA 1KSSA 3H8LA 1PXCA 3WE0A 2BA9A 4EIQA 5BRTA 5C3JA 4H4RA 3UKQA 3F8PA 1H82A 3UOVA 1JEHA 5EB4A 1BGNA 4CNKA 3AYLA 1JOAA 2W0HA 2BK3A 4J33A 4OPTA 3B6DA 3C96A 1K0LA 3NH3X 3C4AA 4TM0A 3UKHA 2ARDA 1JRYA 3AE6A 4O5QA 2JB1A 4G9KA 2FJEA 4XWZA 2BABA 1BKWA 4ZN0A 2GH5A 3UTEA 1D7YA 3T14A 2Q0KA 4UDQA 4CNJA 2C72A 4FX9A 3UKLA 4EQXA 4X9NA 1GV4A 3G5SA 5U25A 3C4NA 1NDAA 2VVMA 1TYTA 2V60A 1N4WA 4MJWA 2X8CA 3GMCA 4OPLA 3T2ZA 1YKJA 4ZCDA 4ZCCA 1GNDA 5FS9A 1EL9A 2WETA 4UDRA 5KMPA 4CBQA 1L9CA 3I3LA 4H50A 3BHKA 1CJ2A 1LTXR 3K30A 3D1CA 1O5WA 2YM2A 3NG7X 5U1OA 1DODA 3FIMB 5KMQA 1P2HA 1NG3A 2GRTA 2WS3A 2YG7A 3GMBA 4NNJA 2IVDA 2GV8A 3OZ2A 2X8HA 4EQSA 2APGA 2YVGA 1D7LA 3H8IA 3T2KA 2ACZA 1NAAA 1ONFA 5HYMA 1IUSA 3AEGA 2VQ7A 3IF9A 4RG4A 4J57A 3CPHG 2VRMA 4K7ZA 1K0JA 5IQ4A 2BRAA 2NPXA 3EAOA 4JY3A 3NGCX 1S2QA 2JB3A 4YSYA 1GRHA 4UP3A 2XVHA 1DXLA 3P4QA 4Z2TA 2JB2A 3P4RA 4HB9A 5FS8A 1N4VA 4H2PA 3KU9A 4H4ZA 1DOBA 5EB5A 2XDOA 4BV6A 3DJEA 1LPFA 3CNDA 3JSKA 3AD9B 2WP6A 3NIXA 3CPJG 3QFAA 1CL0A 4KX6A 1DJQA 1GRAA 4K22A 3RP8A 3UTHA 4EM3A 1D4DA 1GRBA 1D5TA 3E1TA 4II2A 4J36A 1VG9A 4G73A 1TRBA 1EL7A 1BF3A 1BGJA 3K7QX 1NHSA 3ALMA 3V3OA 4H2RA 1LV0A 2PHHA 3UTGA 2BS2A 2OLOA 4AT0A 3SX6A 2GMHA 3QSSA 4J31A 3P1WA 4Z24A 2R46A 2JK6A 1F3PA 2JBVA 3AXBA 4IVMB 2WOWA 1D4CA 2WOIA 3GD3A 2R0GA 3PO7A 1H7WA 3AE2A 1GSNA 2XLTA 3NKSA 4H4TA 1GREA 3GWFA 1CJ4A 1OJ9A 3AE5A 1GESA 1S3EA 4WX1A 2YLXA 3AE4A 1Y56A 4IA5A 3SGLA 4C3XA 2XVJA 3GSIA 4U8LA 3SYIA 4XXGA 1N4UA 2VVLA 2BXSA 3F8RA 3ATQA 2WDRA 4EQWA 3RHAA 3SY4A 1E39A 2C7GA 4YTPA 5KMRA 3VRDB 2XLUA 1MXTA 3AWIA 5J7XA 3UP5A 3OC4A 2IVEA 3CNPA 2Z5XA 2X50A 3L8KA 1B4VA 4GDPA 4G6HA 4YKFA 1LJ1A 2C64A 4YTMA 4B65A 1VDCA 3IHMA 1PDHA 4NZHA 2YG6A 2YG3A 1CJ3A 1EBDA 2F5ZA 2WDQA 5CKUA 3ICSA 1D4EA 3HZLA 3KLJA 1NG4A 1JRXA 1L0VA 4TM4A 4H4VA 4H4QA 3VRAA 4NEVA 4B1BA 2X3NA 3UKFA 1K4QA 1CF3A 2YG5A 1GOSA 3CIRA 4BK3A 3FG2P 3UKKA 1KFYA 3D8XA 2CDUA 2YVFA 4H7UA 1H84A 1O95A 2V3AA 3GYXA 3QSMA 4TLXA 3REDA 5KXJA 5KNLA 4OPIA 4GUVA 2V61A 3AYJA 2XYOA 1ZKQA 2ZZ0A 2H88A 1EL5A 2OA1A 3AEBA 3QJ4A 4X9MA 1E1NA 4GAPA 2AAQA 4BURA 1JNRA 1E1MA 4ICYA 1TDOA 2XLPA 1ZMCA 3ITJA 5IQ1A 4AT2A 5BVAA 4USQA 4USRA 3VRBA 3KPFA 5KMSA 2GVCA 2XFUA 2JKCA 3UP4A 1NHQA 2EQ8A 1KSUA 1Q1RA 1GRGA 2OALA 1TDKA 2YM1A 3V76A 3VR9A 2XCGA 1JNZA 4G74A 4U8PA 1ZY8A 3DJDA 4GF7A 4B64A 2WEUA 2C75A 2FBWA 3NRNA 4K5RA 5CQFA 3NNEA 2QA1A 3M0OA 3UOZA 4M52A 2WESA 4CY8A 1CC2A 5IPYA 2VRLA 1GPEA 2TPRA 1PN0A 3AE1A 4NEWA 3S61A 4I58A 3IC9A 1REOA 5HXIA 4FK1A 4II3A 2WPFA 2FJAA 2X99A 3AEEA 1MOKA 1GETA 3LADA 5KVIA 1ZK7A 4Y4MA 3IWAA 3UCLA 3G5QA 3CGEA 4OVIA 3UTFA 2HQMA 4ECHA 5GSNA 3BNUA 2O9ZA 4H2NA 2XLRA 1IUUA 2I0ZA 2XFPA 4YTNA 4IVOB 4LIIA 2BYBA 2B9XA 2BC1A 4EM4A 1PBBA 1UKVG 4NTCA 1PS9A 1H81A 4C5OA 3UOXA 1N1PA 3KA7A 3AE7A 3DK9A 4K2XA 4X4JA 3LZXA 2C4CA 3NYEA 4LU6A 3M12A 2WU2A 5HHFA 3FPZA 1O94A 1RYIA 2BCGG 4Z44A 1OJAA 1RSGA 2WP5A 5DBJA 3SZCA 3B3RA 4IA6A 4H4UA 4U2LA 4EIPA 1BZLA 2C66A 4C74A 2WHDA 2GR3A 3NK1X 3AE9A 3AE8A 3CNTA 2R45A 4A6NB 4BJZA 5U63A 2YLSA 3ICTA 3R9UA 4EMJA 1Y56B 4OPGA 5KWFA 4AOSA 2C70A 3II4A 3ZDNA 5KRQA 3UOYA 4JQ9A 2EQ7A 2JAEA 4J34A 3T2YA 2GR0A 3KD9A 4E0VA 4FK1C 5GRTA 4KPRA 4GCMA 3KPKA 3F8DA 1X31B 3DMEA 2YVJA 4GAVA 5KOXA 1PBEA 3O0HA 2UZZA 2BC0A 2GEWA 4H4SA 1VQWA 5KOWA 3CGCA 1LQUA 1F8SA 3CNJA 2FJDA 1XPQA 4H4PA 3P4PA 5EBKA 3RP7A 3T31A 4O5UA 3VR8A 3ALJA 1E1LA 3Q6JA 1YQZA 2AR8A 2FJBA 2IIDA 1Y0PA 3GYJA 4H4YA 4OPCA 1ZX9A 5BUKA 3CN8A 3PS9A 3RP6A 3ATRA 3NTAA 2XLSA 3LJPA 1OJTA 4J2WA 4IV9A 1ZMDA 2XFOA 3GDNA 4FDCB 1GT8A 2GQFA 1DOCA 2CVJA 1FL2A 2YLWA 4JNAA 4I59A 3UKAA 4A6NA 1KNPA 3T37A 2YWLA 4Z43A 3BHFA 2Q6UA 4B68A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TR3 A;  3K7M X;  4EQR A;  4B69 A;  4GRT A;  1GRF A;  1B5Q A;  3NK2 X;  3AB1 A;  4H2Q A;  2V3B A;  1GER A;  1QLB A;  1RP0 A;  2WBA A;  2WDV A;  2Z5Y A;  3ICR A;  4U2S A;  1GTH A;  3NHO X;  1B8S A;  1ELI A;  5L46 A;  2ZZB A;  4U8J A;  2EQ9 A;  1S3B A;  2YLZ A;  3LXD A;  1IUW A;  1FEB A;  3FBS A;  2R4E A;  3H4K A;  2OAM A;  1CC4 A;  4CCQ A;  4B63 A;  4BJY A;  3DA1 A;  1CJC A;  2YR5 A;  2XFQ A;  4K8D A;  1KNR A;  1Q9I A;  2BK4 A;  4DGK A;  4DSH A;  1F8R A;  2B9W A;  4U8I A;  3ISH A;  4XWR A;  2Q7V A;  1XAN A;  1EL8 A;  4HA6 A;  1PBC A;  3DGH A;  2R4J A;  2B9Y A;  1DJN A;  3CGD A;  2B7S A;  1IUT A;  4EMW A;  2QCU A;  2AQJ A;  3NN6 X;  4U8M A;  3QVR A;  4TM3 A;  1OJC A;  3SFE A;  3NYF A;  1TDF A;  1TDE A;  1VRQ B;  1QJD A;  1E6E A;  2WP9 A;  1CBO A;  2WU5 A;  4GR1 A;  4EMI A;  2XFN A;  3CGB A;  4YWO A;  1TYP A;  5JCM A;  3EPT A;  4APN A;  3GWD A;  4D04 A;  3AED A;  2J3N A;  2YLR A;  3LOV A;  3RNM A;  4Z2R A;  4YSH A;  5M10 A;  2WOV A;  1B37 A;  4Y4L A;  4U8K A;  5FS6 A;  1E1K A;  4BK1 A;  5JCN A;  3PVC A;  2R9Z A;  1VG0 A;  3GDP A;  1E7P A;  4Z2U A;  1NHR A;  3M13 A;  4JDR A;  3SQP A;  3VQR A;  4YSX A;  4AP1 A;  3DGZ A;  4UDP A;  1V59 A;  3AEC A;  2WPE A;  3AD8 B;  3DJJ A;  5J60 A;  4OPD A;  2GAG B;  1GRT A;  1KF6 A;  2NVK X;  3GYI A;  2C3C A;  3NYC A;  1BWC A;  3NTD A;  3KVE A;  2VOU A;  4P9S A;  2WPC A;  1FEA A;  4JY2 A;  2RGH A;  2GMJ A;  4A7A A;  2QA2 A;  4C77 A;  3EF6 A;  3L1R A;  2CUL A;  2C65 A;  1PXA A;  1NPX A;  5JCI A;  5C2T A;  2E4G A;  1H83 A;  4H4X A;  3AYI A;  1PHH A;  1LVL A;  2VQB A;  3SM8 A;  2BS3 A;  4Y4N A;  5ER0 A;  1NEN A;  1GAL A;  3NN0 X;  4OPU A;  1FCD A;  3G5R A;  2GB0 A;  4JN9 A;  4NTE A;  4JNQ A;  5JCK A;  3AE3 A;  1GEU A;  2ZBW A;  1AOG A;  2YLT A;  1CC6 A;  1P2E A;  4TM1 A;  3ZYX A;  3ALL A;  2BS4 A;  2YAU A;  2DKI A;  5FMH A;  2GR2 A;  2QAE A;  4REK A;  2RGO A;  1F6M A;  2C76 A;  2XVE A;  2YR6 A;  4TLZ A;  3I6D A;  2X8G A;  1K0I A;  3EAN A;  2DKH A;  4Z25 A;  3AEF A;  2GF3 A;  4RSL A;  3CNS A;  2A8X A;  1HYU A;  1JRZ A;  4CRT A;  3DJG X;  3LB8 A;  2YG4 A;  2YQU A;  1M6I A;  3GRS A;  4RG3 A;  5HY5 A;  4U2T A;  2BK5 A;  4C3Y A;  4YSZ A;  5KVH A;  2Q0L A;  5EOW A;  3DK8 A;  2XVI A;  1JU2 A;  5M0Z A;  4A9W A;  4DSG A;  2ZZC A;  1LQT A;  1F8W A;  3URH A;  4GDE A;  3CTY A;  1PJ6 A;  1XDI A;  2A89 A;  1CHU A;  4AOX A;  4B67 A;  4YXD A;  1H86 A;  2Y6Q A;  1COY A;  2R0C A;  3GRT A;  5FS7 A;  3SFD A;  1TDN A;  1DOE A;  2V5Z A;  1Q1W A;  2V6O A;  4PAB A;  2OLN A;  3V3N A;  4N9X A;  4BK2 A;  2H89 A;  3KKJ A;  3IHG A;  3BNM A;  2R0P A;  4OCG A;  4YT0 A;  1ZOV A;  2PYX A;  1GTE A;  1ZDL A;  3ABV A;  4A5L A;  4DNA A;  1PBF A;  3UKP A;  5BUL A;  3FMW A;  5JCL A;  1L9E A;  1NEK A;  3ADA B;  2BAC A;  1PXB A;  4CY6 A;  4B66 A;  3DK4 A;  4A99 A;  3BI4 A;  4A79 A;  2WQY A;  2VZ2 A;  3BI5 A;  1OJD A;  3DH9 A;  3QFB A;  3QVP A;  1MO9 A;  1IJH A;  4YKG A;  3NLC A;  2A87 A;  2BCP A;  3P4S A;  3K7T A;  2RAB A;  1XHC A;  5LV9 A;  1PJ7 A;  2E5V A;  4A65 A;  4K5S A;  1KDG A;  1YQ3 A;  3BI2 A;  2C67 A;  1S2Y A;  2E1M A;  1FEC A;  2BXR A;  1Z6L A;  4AP3 A;  2C3D A;  1ZP0 A;  1GXF A;  1M64 A;  1IUX A;  1YY5 A;  3Q9T A;  2VVL G;  1ZOY A;  1PJ5 A;  1NHP A;  1W4X A;  1YQ4 A;  1DNC A;  2YR4 A;  3P9U A;  4WCT A;  3LZW A;  2XVF A;  4Z26 A;  2GAH B;  4U8O A;  3CPI G;  3QSE A;  2Y6R A;  1H6V A;  2TMD A;  1FOH A;  2C73 A;  2GQW A;  3GD4 A;  3NK0 X;  1QO8 A;  2B7R A;  2GR1 A;  3S5W A;  4H4W A;  4CCR A;  4PAA A;  1L9D A;  4LA1 A;  1PBD A;  4D03 A;  4NTD A;  3COX A;  1H7X A;  4U8N A;  2EQ6 A;  1SEZ A;  3AD7 B;  4J56 A;  4ADW A;  2B76 A;  2RGJ A;  3AEA A;  1IUV A;  3NT6 A;  2CFY A;  1KSS A;  3H8L A;  1PXC A;  3WE0 A;  2BA9 A;  4EIQ A;  5BRT A;  5C3J A;  4H4R A;  3UKQ A;  3F8P A;  1H82 A;  3UOV A;  1JEH A;  5EB4 A;  1BGN A;  4CNK A;  3AYL A;  1JOA A;  2W0H A;  2BK3 A;  4J33 A;  4OPT A;  3B6D A;  3C96 A;  1K0L A;  3NH3 X;  3C4A A;  4TM0 A;  3UKH A;  2ARD A;  1JRY A;  3AE6 A;  4O5Q A;  2JB1 A;  2FJE A;  4XWZ A;  2BAB A;  1BKW A;  4ZN0 A;  2GH5 A;  3UTE A;  1D7Y A;  2Q0K A;  4UDQ A;  4CNJ A;  2C72 A;  4FX9 A;  3UKL A;  4EQX A;  4X9N A;  1GV4 A;  3G5S A;  5U25 A;  3C4N A;  1NDA A;  2VVM A;  1TYT A;  2V60 A;  1N4W A;  4MJW A;  2X8C A;  3GMC A;  4OPL A;  1YKJ A;  4ZCD A;  4ZCC A;  1GND A;  5FS9 A;  1EL9 A;  2WET A;  4UDR A;  4CBQ A;  1L9C A;  3I3L A;  4H50 A;  3BHK A;  1CJ2 A;  1LTX R;  3K30 A;  3D1C A;  1O5W A;  2YM2 A;  3NG7 X;  5U1O A;  1DOD A;  3FIM B;  1P2H A;  1NG3 A;  2GRT A;  2WS3 A;  2YG7 A;  3GMB A;  3OZ2 A;  2GV8 A;  2IVD A;  2X8H A;  4EQS A;  2APG A;  2YVG A;  1D7L A;  3H8I A;  2ACZ A;  1NAA A;  1ONF A;  5HYM A;  1IUS A;  3AEG A;  2VQ7 A;  3IF9 A;  4RG4 A;  4J57 A;  3CPH G;  2VRM A;  4K7Z A;  1K0J A;  5IQ4 A;  2NPX A;  3EAO A;  4JY3 A;  3NGC X;  1S2Q A;  2JB3 A;  4YSY A;  1GRH A;  4UP3 A;  2XVH A;  1DXL A;  3P4Q A;  4Z2T A;  2JB2 A;  3P4R A;  4HB9 A;  5FS8 A;  1N4V A;  4H2P A;  3KU9 A;  4H4Z A;  1DOB A;  5EB5 A;  2XDO A;  4BV6 A;  3DJE A;  1LPF A;  3CND A;  3JSK A;  3AD9 B;  2WP6 A;  3NIX A;  3CPJ G;  3QFA A;  1CL0 A;  4KX6 A;  1DJQ A;  1GRA A;  4K22 A;  3RP8 A;  3UTH A;  4EM3 A;  1D4D A;  1GRB A;  1D5T A;  3E1T A;  4J36 A;  1VG9 A;  1TRB A;  1EL7 A;  1BF3 A;  1BGJ A;  3K7Q X;  1NHS A;  3ALM A;  3V3O A;  4H2R A;  1LV0 A;  2PHH A;  3UTG A;  2BS2 A;  2OLO A;  4AT0 A;  2GMH A;  3QSS A;  4J31 A;  3P1W A;  4Z24 A;  2R46 A;  2JK6 A;  1F3P A;  2JBV A;  3AXB A;  4IVM B;  2WOW A;  1D4C A;  2WOI A;  3GD3 A;  2R0G A;  3PO7 A;  1H7W A;  3AE2 A;  1GSN A;  2XLT A;  3NKS A;  4H4T A;  1GRE A;  3GWF A;  1CJ4 A;  1OJ9 A;  3AE5 A;  1GES A;  1S3E A;  4WX1 A;  2YLX A;  3AE4 A;  1Y56 A;  4IA5 A;  3SGL A;  4C3X A;  2XVJ A;  3GSI A;  4U8L A;  4XXG A;  1N4U A;  2VVL A;  2BXS A;  3F8R A;  3ATQ A;  2WDR A;  4EQW A;  3RHA A;  1E39 A;  2C7G A;  4YTP A;  3VRD B;  2XLU A;  1MXT A;  3AWI A;  5J7X A;  3UP5 A;  3OC4 A;  2IVE A;  3CNP A;  2Z5X A;  2X50 A;  3L8K A;  1B4V A;  4GDP A;  4YKF A;  4YTM A;  1LJ1 A;  2C64 A;  4B65 A;  1VDC A;  3IHM A;  1PDH A;  4NZH A;  2YG6 A;  2YG3 A;  1CJ3 A;  1EBD A;  2F5Z A;  2WDQ A;  5CKU A;  3ICS A;  1D4E A;  3HZL A;  3KLJ A;  1NG4 A;  1JRX A;  1L0V A;  4TM4 A;  4H4V A;  4H4Q A;  3VRA A;  4NEV A;  4B1B A;  2X3N A;  3UKF A;  1K4Q A;  1CF3 A;  2YG5 A;  1GOS A;  3CIR A;  4BK3 A;  3FG2 P;  3UKK A;  1KFY A;  3D8X A;  2CDU A;  2YVF A;  4H7U A;  1H84 A;  1O95 A;  2V3A A;  3QSM A;  4TLX A;  3RED A;  5KXJ A;  4OPI A;  4GUV A;  2V61 A;  3AYJ A;  2XYO A;  1ZKQ A;  2ZZ0 A;  2H88 A;  1EL5 A;  2OA1 A;  3AEB A;  3QJ4 A;  4X9M A;  1E1N A;  4BUR A;  2AAQ A;  1JNR A;  1E1M A;  4ICY A;  1TDO A;  2XLP A;  1ZMC A;  3ITJ A;  5IQ1 A;  4AT2 A;  5BVA A;  4USQ A;  4USR A;  3VRB A;  3KPF A;  2GVC A;  2XFU A;  2JKC A;  3UP4 A;  1NHQ A;  2EQ8 A;  1KSU A;  1Q1R A;  1GRG A;  2OAL A;  1TDK A;  2YM1 A;  3V76 A;  3VR9 A;  2XCG A;  1JNZ A;  4U8P A;  1ZY8 A;  3DJD A;  4GF7 A;  4B64 A;  2WEU A;  2C75 A;  2FBW A;  3NRN A;  4K5R A;  5CQF A;  3NNE A;  2QA1 A;  3M0O A;  3UOZ A;  4M52 A;  2WES A;  4CY8 A;  1CC2 A;  5IPY A;  2VRL A;  1GPE A;  2TPR A;  1PN0 A;  3AE1 A;  4NEW A;  3S61 A;  4I58 A;  3IC9 A;  1REO A;  5HXI A;  4FK1 A;  2WPF A;  2FJA A;  2X99 A;  3AEE A;  1MOK A;  1GET A;  3LAD A;  5KVI A;  1ZK7 A;  4Y4M A;  3IWA A;  3UCL A;  3G5Q A;  3CGE A;  4OVI A;  3UTF A;  2HQM A;  4ECH A;  5GSN A;  3BNU A;  2O9Z A;  4H2N A;  2XLR A;  1IUU A;  2I0Z A;  2XFP A;  4YTN A;  4IVO B;  4LII A;  2BYB A;  2B9X A;  2BC1 A;  4EM4 A;  1PBB A;  1UKV G;  4NTC A;  1PS9 A;  1H81 A;  4C5O A;  3UOX A;  1N1P A;  3KA7 A;  3AE7 A;  3DK9 A;  4K2X A;  4X4J A;  3LZX A;  3NYE A;  4LU6 A;  3M12 A;  2WU2 A;  5HHF A;  3FPZ A;  1O94 A;  1RYI A;  2BCG G;  4Z44 A;  1OJA A;  1RSG A;  2WP5 A;  5DBJ A;  3B3R A;  4IA6 A;  4H4U A;  4U2L A;  4EIP A;  1BZL A;  2C66 A;  4C74 A;  2WHD A;  2GR3 A;  3NK1 X;  3AE9 A;  3AE8 A;  3CNT A;  2R45 A;  4A6N B;  4BJZ A;  5U63 A;  2YLS A;  3ICT A;  3R9U A;  4EMJ A;  1Y56 B;  4OPG A;  5KWF A;  4AOS A;  2C70 A;  3II4 A;  3ZDN A;  5KRQ A;  3UOY A;  4JQ9 A;  2EQ7 A;  2JAE A;  4J34 A;  2GR0 A;  3KD9 A;  4E0V A;  4FK1 C;  5GRT A;  4KPR A;  4GCM A;  3F8D A;  1X31 B;  3DME A;  2YVJ A;  5KOX A;  1PBE A;  3O0H A;  2UZZ A;  2BC0 A;  2GEW A;  4H4S A;  1VQW A;  5KOW A;  3CGC A;  1LQU A;  1F8S A;  3CNJ A;  2FJD A;  1XPQ A;  4H4P A;  3P4P A;  5EBK A;  3RP7 A;  4O5U A;  3VR8 A;  3ALJ A;  1E1L A;  3Q6J A;  1YQZ A;  2AR8 A;  2FJB A;  2IID A;  1Y0P A;  3GYJ A;  4H4Y A;  4OPC A;  1ZX9 A;  5BUK A;  3CN8 A;  3PS9 A;  3RP6 A;  3ATR A;  3NTA A;  2XLS A;  3LJP A;  1OJT A;  4J2W A;  4IV9 A;  1ZMD A;  2XFO A;  3GDN A;  4FDC B;  1GT8 A;  2GQF A;  1DOC A;  2CVJ A;  1FL2 A;  2YLW A;  4JNA A;  4I59 A;  3UKA A;  4A6N A;  1KNP A;  3T37 A;  2YWL A;  4Z43 A;  3BHF A;  2Q6U A;  4B68 A; 
#chains in the Genus database with same CATH topology
 5TR3 A;  3K7M X;  4EQR A;  4B69 A;  4GRT A;  1GRF A;  1B5Q A;  3NK2 X;  3AB1 A;  4H2Q A;  2V3B A;  1GER A;  1QLB A;  1RP0 A;  2WBA A;  2WDV A;  2Z5Y A;  3ICR A;  4U2S A;  1GTH A;  3NHO X;  1B8S A;  1ELI A;  5L46 A;  2ZZB A;  4U8J A;  2EQ9 A;  1S3B A;  2YLZ A;  3LXD A;  1IUW A;  1FEB A;  3FBS A;  2R4E A;  3H4K A;  2OAM A;  1CC4 A;  4G6G A;  4B63 A;  4CCQ A;  4BJY A;  3DA1 A;  1CJC A;  2YR5 A;  2XFQ A;  4K8D A;  1KNR A;  1Q9I A;  2BK4 A;  4DGK A;  4DSH A;  1F8R A;  2B9W A;  4U8I A;  3ISH A;  4XWR A;  3HYX A;  2Q7V A;  1XAN A;  1EL8 A;  4HA6 A;  1PBC A;  3DGH A;  2R4J A;  2B9Y A;  1DJN A;  3CGD A;  2B7S A;  1IUT A;  4EMW A;  2QCU A;  2AQJ A;  3NN6 X;  4U8M A;  3QVR A;  4TM3 A;  1OJC A;  3SFE A;  3NYF A;  1TDF A;  1TDE A;  1VRQ B;  1QJD A;  1E6E A;  2WP9 A;  1CBO A;  2WU5 A;  4GR1 A;  4EMI A;  2XFN A;  3CGB A;  4YWO A;  1TYP A;  5JCM A;  3EPT A;  4APN A;  3GWD A;  4D04 A;  3AED A;  2J3N A;  3LOV A;  2YLR A;  3RNM A;  4Z2R A;  4YSH A;  5M10 A;  2WOV A;  1B37 A;  4Y4L A;  4U8K A;  5FS6 A;  1E1K A;  4BK1 A;  5JCN A;  3PVC A;  2R9Z A;  1VG0 A;  3GDP A;  1E7P A;  4Z2U A;  1NHR A;  3M13 A;  4JDR A;  3SQP A;  3VQR A;  4YSX A;  4AP1 A;  3DGZ A;  4UDP A;  1V59 A;  3AEC A;  2WPE A;  3AD8 B;  3DJJ A;  5J60 A;  4OPD A;  2GAG B;  1GRT A;  1KF6 A;  2NVK X;  3GYI A;  2C3C A;  3NYC A;  1BWC A;  3NTD A;  3KVE A;  2VOU A;  4P9S A;  2WPC A;  1FEA A;  4JY2 A;  2RGH A;  2GMJ A;  4A7A A;  2QA2 A;  4C77 A;  3EF6 A;  3L1R A;  2CUL A;  2C65 A;  1PXA A;  1NPX A;  5JCI A;  5C2T A;  2E4G A;  1H83 A;  4H4X A;  3AYI A;  1PHH A;  1LVL A;  2VQB A;  3SM8 A;  2BS3 A;  4Y4N A;  5ER0 A;  1NEN A;  1GAL A;  3NN0 X;  4OPU A;  1FCD A;  3G5R A;  2GB0 A;  4JN9 A;  4NTE A;  4JNQ A;  5JCK A;  3AE3 A;  1GEU A;  2ZBW A;  1AOG A;  2YLT A;  1CC6 A;  1P2E A;  4TM1 A;  3ZYX A;  3ALL A;  2BS4 A;  2YAU A;  2DKI A;  5FMH A;  2GR2 A;  2QAE A;  3SZ0 A;  4REK A;  2RGO A;  1F6M A;  2C76 A;  2XVE A;  2YR6 A;  4TLZ A;  3I6D A;  2X8G A;  1K0I A;  3EAN A;  2DKH A;  4Z25 A;  3AEF A;  2GF3 A;  4RSL A;  3CNS A;  2A8X A;  1HYU A;  1JRZ A;  4CRT A;  3DJG X;  3LB8 A;  2YG4 A;  2YQU A;  1M6I A;  3GRS A;  4RG3 A;  3SXI A;  5HY5 A;  4U2T A;  3SZF A;  2BK5 A;  4C3Y A;  4YSZ A;  5KVH A;  2Q0L A;  5EOW A;  3DK8 A;  2XVI A;  1JU2 A;  5M0Z A;  4A9W A;  4DSG A;  2ZZC A;  1LQT A;  1F8W A;  3URH A;  4GDE A;  3CTY A;  1PJ6 A;  1XDI A;  2A89 A;  1CHU A;  4AOX A;  4B67 A;  4YXD A;  1H86 A;  2Y6Q A;  1COY A;  2R0C A;  3GRT A;  5FS7 A;  3T0K A;  2BRY A;  3SFD A;  1TDN A;  1DOE A;  2V5Z A;  1Q1W A;  2V6O A;  4PAB A;  2OLN A;  3V3N A;  4N9X A;  4NWZ A;  4BK2 A;  2H89 A;  3KKJ A;  3IHG A;  3BNM A;  3SZW A;  2R0P A;  4OCG A;  4YT0 A;  1ZOV A;  2PYX A;  1GTE A;  1ZDL A;  3ABV A;  4A5L A;  4DNA A;  1PBF A;  3UKP A;  5BUL A;  3FMW A;  5JCL A;  1L9E A;  1NEK A;  3ADA B;  2BAC A;  1PXB A;  4CY6 A;  4B66 A;  3DK4 A;  4A99 A;  3BI4 A;  4A79 A;  2WQY A;  2VZ2 A;  3BI5 A;  1OJD A;  3DH9 A;  3QFB A;  3QVP A;  1MO9 A;  1IJH A;  3HYW A;  4YKG A;  3NLC A;  2A87 A;  2BCP A;  3P4S A;  3K7T A;  2RAB A;  3HYV A;  1XHC A;  5LV9 A;  1PJ7 A;  2E5V A;  4A65 A;  4K5S A;  1KDG A;  1YQ3 A;  3BI2 A;  2C67 A;  1S2Y A;  2E1M A;  1FEC A;  2BXR A;  1Z6L A;  4AP3 A;  2C3D A;  1ZP0 A;  1GXF A;  1M64 A;  1IUX A;  1YY5 A;  3Q9T A;  2VVL G;  1ZOY A;  1PJ5 A;  1NHP A;  1W4X A;  1YQ4 A;  1DNC A;  2YR4 A;  3P9U A;  4WCT A;  3LZW A;  2XVF A;  4Z26 A;  2GAH B;  4U8O A;  3CPI G;  3QSE A;  2Y6R A;  1H6V A;  2TMD A;  1FOH A;  2C73 A;  2GQW A;  3GD4 A;  3NK0 X;  1QO8 A;  2B7R A;  2GR1 A;  3S5W A;  4H4W A;  4CCR A;  4PAA A;  1L9D A;  4LA1 A;  1PBD A;  4D03 A;  4NTD A;  3COX A;  1H7X A;  4U8N A;  2EQ6 A;  1SEZ A;  3AD7 B;  4J56 A;  4ADW A;  2B76 A;  2RGJ A;  3AEA A;  1IUV A;  3NT6 A;  3CMM A;  2CFY A;  1KSS A;  3H8L A;  1PXC A;  3WE0 A;  2BA9 A;  4EIQ A;  5BRT A;  5C3J A;  4H4R A;  3UKQ A;  3F8P A;  1H82 A;  3UOV A;  1JEH A;  5EB4 A;  1BGN A;  4CNK A;  3AYL A;  1JOA A;  2W0H A;  2BK3 A;  4J33 A;  4OPT A;  3B6D A;  3C96 A;  1K0L A;  3NH3 X;  3C4A A;  4TM0 A;  3UKH A;  2ARD A;  1JRY A;  3AE6 A;  4O5Q A;  2JB1 A;  4G9K A;  2FJE A;  4XWZ A;  2BAB A;  1BKW A;  4ZN0 A;  2GH5 A;  3UTE A;  1D7Y A;  3T14 A;  2Q0K A;  4UDQ A;  4CNJ A;  2C72 A;  4FX9 A;  3UKL A;  4EQX A;  4X9N A;  1GV4 A;  3G5S A;  5U25 A;  3C4N A;  1NDA A;  2VVM A;  1TYT A;  2V60 A;  1N4W A;  4MJW A;  2X8C A;  3GMC A;  4OPL A;  3T2Z A;  1YKJ A;  4ZCD A;  4ZCC A;  1GND A;  5FS9 A;  1EL9 A;  2WET A;  4UDR A;  5KMP A;  4CBQ A;  1L9C A;  3I3L A;  4H50 A;  3BHK A;  1CJ2 A;  1LTX R;  3K30 A;  3D1C A;  1O5W A;  2YM2 A;  3NG7 X;  5U1O A;  1DOD A;  3FIM B;  5KMQ A;  1P2H A;  1NG3 A;  2GRT A;  2WS3 A;  2YG7 A;  3GMB A;  4NNJ A;  2IVD A;  2GV8 A;  3OZ2 A;  2X8H A;  4EQS A;  2APG A;  2YVG A;  1D7L A;  3H8I A;  3T2K A;  2ACZ A;  1NAA A;  1ONF A;  5HYM A;  1IUS A;  3AEG A;  2VQ7 A;  3IF9 A;  4RG4 A;  4J57 A;  3CPH G;  2VRM A;  4K7Z A;  1K0J A;  5IQ4 A;  2BRA A;  2NPX A;  3EAO A;  4JY3 A;  3NGC X;  1S2Q A;  2JB3 A;  4YSY A;  1GRH A;  4UP3 A;  2XVH A;  1DXL A;  3P4Q A;  4Z2T A;  2JB2 A;  3P4R A;  4HB9 A;  5FS8 A;  1N4V A;  4H2P A;  3KU9 A;  4H4Z A;  1DOB A;  5EB5 A;  2XDO A;  4BV6 A;  3DJE A;  1LPF A;  3CND A;  3JSK A;  3AD9 B;  2WP6 A;  3NIX A;  3CPJ G;  3QFA A;  1CL0 A;  4KX6 A;  1DJQ A;  1GRA A;  4K22 A;  3RP8 A;  3UTH A;  4EM3 A;  1D4D A;  1GRB A;  1D5T A;  3E1T A;  4II2 A;  4J36 A;  1VG9 A;  4G73 A;  1TRB A;  1EL7 A;  1BF3 A;  1BGJ A;  3K7Q X;  1NHS A;  3ALM A;  3V3O A;  4H2R A;  1LV0 A;  2PHH A;  3UTG A;  2BS2 A;  2OLO A;  4AT0 A;  3SX6 A;  2GMH A;  3QSS A;  4J31 A;  3P1W A;  4Z24 A;  2R46 A;  2JK6 A;  1F3P A;  2JBV A;  3AXB A;  4IVM B;  2WOW A;  1D4C A;  2WOI A;  3GD3 A;  2R0G A;  3PO7 A;  1H7W A;  3AE2 A;  1GSN A;  2XLT A;  3NKS A;  4H4T A;  1GRE A;  3GWF A;  1CJ4 A;  1OJ9 A;  3AE5 A;  1GES A;  1S3E A;  4WX1 A;  2YLX A;  3AE4 A;  1Y56 A;  4IA5 A;  3SGL A;  4C3X A;  2XVJ A;  3GSI A;  4U8L A;  3SYI A;  4XXG A;  1N4U A;  2VVL A;  2BXS A;  3F8R A;  3ATQ A;  2WDR A;  4EQW A;  3RHA A;  3SY4 A;  1E39 A;  2C7G A;  4YTP A;  5KMR A;  3VRD B;  2XLU A;  1MXT A;  3AWI A;  5J7X A;  3UP5 A;  3OC4 A;  2IVE A;  3CNP A;  2Z5X A;  2X50 A;  3L8K A;  1B4V A;  4GDP A;  4G6H A;  4YKF A;  1LJ1 A;  2C64 A;  4YTM A;  4B65 A;  1VDC A;  3IHM A;  1PDH A;  4NZH A;  2YG6 A;  2YG3 A;  1CJ3 A;  1EBD A;  2F5Z A;  2WDQ A;  5CKU A;  3ICS A;  1D4E A;  3HZL A;  3KLJ A;  1NG4 A;  1JRX A;  1L0V A;  4TM4 A;  4H4V A;  4H4Q A;  3VRA A;  4NEV A;  4B1B A;  2X3N A;  3UKF A;  1K4Q A;  1CF3 A;  2YG5 A;  1GOS A;  3CIR A;  4BK3 A;  3FG2 P;  3UKK A;  1KFY A;  3D8X A;  2CDU A;  2YVF A;  4H7U A;  1H84 A;  1O95 A;  2V3A A;  3GYX A;  3QSM A;  4TLX A;  3RED A;  5KXJ A;  5KNL A;  4OPI A;  4GUV A;  2V61 A;  3AYJ A;  2XYO A;  1ZKQ A;  2ZZ0 A;  2H88 A;  1EL5 A;  2OA1 A;  3AEB A;  3QJ4 A;  4X9M A;  1E1N A;  4GAP A;  2AAQ A;  4BUR A;  1JNR A;  1E1M A;  4ICY A;  1TDO A;  2XLP A;  1ZMC A;  3ITJ A;  5IQ1 A;  4AT2 A;  5BVA A;  4USQ A;  4USR A;  3VRB A;  3KPF A;  5KMS A;  2GVC A;  2XFU A;  2JKC A;  3UP4 A;  1NHQ A;  2EQ8 A;  1KSU A;  1Q1R A;  1GRG A;  2OAL A;  1TDK A;  2YM1 A;  3V76 A;  3VR9 A;  2XCG A;  1JNZ A;  4G74 A;  4U8P A;  1ZY8 A;  3DJD A;  4GF7 A;  4B64 A;  2WEU A;  2C75 A;  2FBW A;  3NRN A;  4K5R A;  5CQF A;  3NNE A;  2QA1 A;  3M0O A;  3UOZ A;  4M52 A;  2WES A;  4CY8 A;  1CC2 A;  5IPY A;  2VRL A;  1GPE A;  2TPR A;  1PN0 A;  3AE1 A;  4NEW A;  3S61 A;  4I58 A;  3IC9 A;  1REO A;  5HXI A;  4FK1 A;  4II3 A;  2WPF A;  2FJA A;  2X99 A;  3AEE A;  1MOK A;  1GET A;  3LAD A;  5KVI A;  1ZK7 A;  4Y4M A;  3IWA A;  3UCL A;  3G5Q A;  3CGE A;  4OVI A;  3UTF A;  2HQM A;  4ECH A;  5GSN A;  3BNU A;  2O9Z A;  4H2N A;  2XLR A;  1IUU A;  2I0Z A;  2XFP A;  4YTN A;  4IVO B;  4LII A;  2BYB A;  2B9X A;  2BC1 A;  4EM4 A;  1PBB A;  1UKV G;  4NTC A;  1PS9 A;  1H81 A;  4C5O A;  3UOX A;  1N1P A;  3KA7 A;  3AE7 A;  3DK9 A;  4K2X A;  4X4J A;  3LZX A;  2C4C A;  3NYE A;  4LU6 A;  3M12 A;  2WU2 A;  5HHF A;  3FPZ A;  1O94 A;  1RYI A;  2BCG G;  4Z44 A;  1OJA A;  1RSG A;  2WP5 A;  5DBJ A;  3SZC A;  3B3R A;  4IA6 A;  4H4U A;  4U2L A;  4EIP A;  1BZL A;  2C66 A;  4C74 A;  2WHD A;  2GR3 A;  3NK1 X;  3AE9 A;  3AE8 A;  3CNT A;  2R45 A;  4A6N B;  4BJZ A;  5U63 A;  2YLS A;  3ICT A;  3R9U A;  4EMJ A;  1Y56 B;  4OPG A;  5KWF A;  4AOS A;  2C70 A;  3II4 A;  3ZDN A;  5KRQ A;  3UOY A;  4JQ9 A;  2EQ7 A;  2JAE A;  4J34 A;  3T2Y A;  2GR0 A;  3KD9 A;  4E0V A;  4FK1 C;  5GRT A;  4KPR A;  4GCM A;  3KPK A;  3F8D A;  1X31 B;  3DME A;  2YVJ A;  4GAV A;  5KOX A;  1PBE A;  3O0H A;  2UZZ A;  2BC0 A;  2GEW A;  4H4S A;  1VQW A;  5KOW A;  3CGC A;  1LQU A;  1F8S A;  3CNJ A;  2FJD A;  1XPQ A;  4H4P A;  3P4P A;  5EBK A;  3RP7 A;  3T31 A;  4O5U A;  3VR8 A;  3ALJ A;  1E1L A;  3Q6J A;  1YQZ A;  2AR8 A;  2FJB A;  2IID A;  1Y0P A;  3GYJ A;  4H4Y A;  4OPC A;  1ZX9 A;  5BUK A;  3CN8 A;  3PS9 A;  3RP6 A;  3ATR A;  3NTA A;  2XLS A;  3LJP A;  1OJT A;  4J2W A;  4IV9 A;  1ZMD A;  2XFO A;  3GDN A;  4FDC B;  1GT8 A;  2GQF A;  1DOC A;  2CVJ A;  1FL2 A;  2YLW A;  4JNA A;  4I59 A;  3UKA A;  4A6N A;  1KNP A;  3T37 A;  2YWL A;  4Z43 A;  3BHF A;  2Q6U A;  4B68 A; 
#chains in the Genus database with same CATH homology
 5TR3 A;  3K7M X;  4EQR A;  4B69 A;  4GRT A;  1GRF A;  1B5Q A;  3NK2 X;  3AB1 A;  4H2Q A;  2V3B A;  1GER A;  1QLB A;  1RP0 A;  2WBA A;  2WDV A;  2Z5Y A;  3ICR A;  4U2S A;  1GTH A;  3NHO X;  1B8S A;  1ELI A;  5L46 A;  2ZZB A;  4U8J A;  2EQ9 A;  1S3B A;  2YLZ A;  3LXD A;  1IUW A;  1FEB A;  3FBS A;  2R4E A;  3H4K A;  2OAM A;  1CC4 A;  4G6G A;  4B63 A;  4CCQ A;  4BJY A;  3DA1 A;  1CJC A;  2YR5 A;  2XFQ A;  4K8D A;  1KNR A;  1Q9I A;  2BK4 A;  4DGK A;  4DSH A;  1F8R A;  2B9W A;  4U8I A;  3ISH A;  4XWR A;  3HYX A;  2Q7V A;  1XAN A;  1EL8 A;  4HA6 A;  1PBC A;  3DGH A;  2R4J A;  2B9Y A;  1DJN A;  3CGD A;  2B7S A;  1IUT A;  4EMW A;  2QCU A;  2AQJ A;  3NN6 X;  4U8M A;  3QVR A;  4TM3 A;  1OJC A;  3SFE A;  3NYF A;  1TDF A;  1TDE A;  1VRQ B;  1QJD A;  1E6E A;  2WP9 A;  1CBO A;  2WU5 A;  4GR1 A;  4EMI A;  2XFN A;  3CGB A;  4YWO A;  1TYP A;  5JCM A;  3EPT A;  4APN A;  3GWD A;  4D04 A;  3AED A;  2J3N A;  3LOV A;  2YLR A;  3RNM A;  4Z2R A;  4YSH A;  5M10 A;  2WOV A;  1B37 A;  4Y4L A;  4U8K A;  5FS6 A;  1E1K A;  4BK1 A;  5JCN A;  3PVC A;  2R9Z A;  1VG0 A;  3GDP A;  1E7P A;  4Z2U A;  1NHR A;  3M13 A;  4JDR A;  3SQP A;  3VQR A;  4YSX A;  4AP1 A;  3DGZ A;  4UDP A;  1V59 A;  3AEC A;  2WPE A;  3AD8 B;  3DJJ A;  5J60 A;  4OPD A;  2GAG B;  1GRT A;  1KF6 A;  2NVK X;  3GYI A;  2C3C A;  3NYC A;  1BWC A;  3NTD A;  3KVE A;  2VOU A;  4P9S A;  2WPC A;  1FEA A;  4JY2 A;  2RGH A;  2GMJ A;  4A7A A;  2QA2 A;  4C77 A;  3EF6 A;  3L1R A;  2CUL A;  2C65 A;  1PXA A;  1NPX A;  5JCI A;  5C2T A;  2E4G A;  1H83 A;  4H4X A;  3AYI A;  1PHH A;  1LVL A;  2VQB A;  3SM8 A;  2BS3 A;  4Y4N A;  5ER0 A;  1NEN A;  1GAL A;  3NN0 X;  4OPU A;  1FCD A;  3G5R A;  2GB0 A;  4JN9 A;  4NTE A;  4JNQ A;  5JCK A;  3AE3 A;  1GEU A;  2ZBW A;  1AOG A;  2YLT A;  1CC6 A;  1P2E A;  4TM1 A;  3ZYX A;  3ALL A;  2BS4 A;  2YAU A;  2DKI A;  5FMH A;  2GR2 A;  2QAE A;  3SZ0 A;  4REK A;  2RGO A;  1F6M A;  2C76 A;  2XVE A;  2YR6 A;  4TLZ A;  3I6D A;  2X8G A;  1K0I A;  3EAN A;  2DKH A;  4Z25 A;  3AEF A;  2GF3 A;  4RSL A;  3CNS A;  2A8X A;  1HYU A;  1JRZ A;  4CRT A;  3DJG X;  3LB8 A;  2YG4 A;  2YQU A;  1M6I A;  3GRS A;  4RG3 A;  3SXI A;  5HY5 A;  4U2T A;  3SZF A;  2BK5 A;  4C3Y A;  4YSZ A;  5KVH A;  2Q0L A;  5EOW A;  3DK8 A;  2XVI A;  1JU2 A;  5M0Z A;  4A9W A;  4DSG A;  2ZZC A;  1LQT A;  1F8W A;  3URH A;  4GDE A;  3CTY A;  1PJ6 A;  1XDI A;  2A89 A;  1CHU A;  4AOX A;  4B67 A;  4YXD A;  1H86 A;  2Y6Q A;  1COY A;  2R0C A;  3GRT A;  5FS7 A;  3T0K A;  2BRY A;  3SFD A;  1TDN A;  1DOE A;  2V5Z A;  1Q1W A;  2V6O A;  4PAB A;  2OLN A;  3V3N A;  4N9X A;  4NWZ A;  4BK2 A;  2H89 A;  3KKJ A;  3IHG A;  3BNM A;  3SZW A;  2R0P A;  4OCG A;  4YT0 A;  1ZOV A;  2PYX A;  1GTE A;  1ZDL A;  3ABV A;  4A5L A;  4DNA A;  1PBF A;  3UKP A;  5BUL A;  3FMW A;  5JCL A;  1L9E A;  1NEK A;  3ADA B;  2BAC A;  1PXB A;  4CY6 A;  4B66 A;  3DK4 A;  4A99 A;  3BI4 A;  4A79 A;  2WQY A;  2VZ2 A;  3BI5 A;  1OJD A;  3DH9 A;  3QFB A;  3QVP A;  1MO9 A;  1IJH A;  3HYW A;  4YKG A;  3NLC A;  2A87 A;  2BCP A;  3P4S A;  3K7T A;  2RAB A;  3HYV A;  1XHC A;  5LV9 A;  1PJ7 A;  2E5V A;  4A65 A;  4K5S A;  1KDG A;  1YQ3 A;  3BI2 A;  2C67 A;  1S2Y A;  2E1M A;  1FEC A;  2BXR A;  1Z6L A;  4AP3 A;  2C3D A;  1ZP0 A;  1GXF A;  1M64 A;  1IUX A;  1YY5 A;  3Q9T A;  2VVL G;  1ZOY A;  1PJ5 A;  1NHP A;  1W4X A;  1YQ4 A;  1DNC A;  2YR4 A;  3P9U A;  4WCT A;  3LZW A;  2XVF A;  4Z26 A;  2GAH B;  4U8O A;  3CPI G;  3QSE A;  2Y6R A;  1H6V A;  2TMD A;  1FOH A;  2C73 A;  2GQW A;  3GD4 A;  3NK0 X;  1QO8 A;  2B7R A;  2GR1 A;  3S5W A;  4H4W A;  4CCR A;  4PAA A;  1L9D A;  4LA1 A;  1PBD A;  4D03 A;  4NTD A;  3COX A;  1H7X A;  4U8N A;  2EQ6 A;  1SEZ A;  3AD7 B;  4J56 A;  4ADW A;  2B76 A;  2RGJ A;  3AEA A;  1IUV A;  3NT6 A;  3CMM A;  2CFY A;  1KSS A;  3H8L A;  1PXC A;  3WE0 A;  2BA9 A;  4EIQ A;  5BRT A;  5C3J A;  4H4R A;  3UKQ A;  3F8P A;  1H82 A;  3UOV A;  1JEH A;  5EB4 A;  1BGN A;  4CNK A;  3AYL A;  1JOA A;  2W0H A;  2BK3 A;  4J33 A;  4OPT A;  3B6D A;  3C96 A;  1K0L A;  3NH3 X;  3C4A A;  4TM0 A;  3UKH A;  2ARD A;  1JRY A;  3AE6 A;  4O5Q A;  2JB1 A;  4G9K A;  2FJE A;  4XWZ A;  2BAB A;  1BKW A;  4ZN0 A;  2GH5 A;  3UTE A;  1D7Y A;  3T14 A;  2Q0K A;  4UDQ A;  4CNJ A;  2C72 A;  4FX9 A;  3UKL A;  4EQX A;  4X9N A;  1GV4 A;  3G5S A;  5U25 A;  3C4N A;  1NDA A;  2VVM A;  1TYT A;  2V60 A;  1N4W A;  4MJW A;  2X8C A;  3GMC A;  4OPL A;  3T2Z A;  1YKJ A;  4ZCD A;  4ZCC A;  1GND A;  5FS9 A;  1EL9 A;  2WET A;  4UDR A;  5KMP A;  4CBQ A;  1L9C A;  3I3L A;  4H50 A;  3BHK A;  1CJ2 A;  1LTX R;  3K30 A;  3D1C A;  1O5W A;  2YM2 A;  3NG7 X;  5U1O A;  1DOD A;  3FIM B;  5KMQ A;  1P2H A;  1NG3 A;  2GRT A;  2WS3 A;  2YG7 A;  3GMB A;  4NNJ A;  2IVD A;  2GV8 A;  3OZ2 A;  2X8H A;  4EQS A;  2APG A;  2YVG A;  1D7L A;  3H8I A;  3T2K A;  2ACZ A;  1NAA A;  1ONF A;  5HYM A;  1IUS A;  3AEG A;  2VQ7 A;  3IF9 A;  4RG4 A;  4J57 A;  3CPH G;  2VRM A;  4K7Z A;  1K0J A;  5IQ4 A;  2BRA A;  2NPX A;  3EAO A;  4JY3 A;  3NGC X;  1S2Q A;  2JB3 A;  4YSY A;  1GRH A;  4UP3 A;  2XVH A;  1DXL A;  3P4Q A;  4Z2T A;  2JB2 A;  3P4R A;  4HB9 A;  5FS8 A;  1N4V A;  4H2P A;  3KU9 A;  4H4Z A;  1DOB A;  5EB5 A;  2XDO A;  4BV6 A;  3DJE A;  1LPF A;  3CND A;  3JSK A;  3AD9 B;  2WP6 A;  3NIX A;  3CPJ G;  3QFA A;  1CL0 A;  4KX6 A;  1DJQ A;  1GRA A;  4K22 A;  3RP8 A;  3UTH A;  4EM3 A;  1D4D A;  1GRB A;  1D5T A;  3E1T A;  4II2 A;  4J36 A;  1VG9 A;  4G73 A;  1TRB A;  1EL7 A;  1BF3 A;  1BGJ A;  3K7Q X;  1NHS A;  3ALM A;  3V3O A;  4H2R A;  1LV0 A;  2PHH A;  3UTG A;  2BS2 A;  2OLO A;  4AT0 A;  3SX6 A;  2GMH A;  3QSS A;  4J31 A;  3P1W A;  4Z24 A;  2R46 A;  2JK6 A;  1F3P A;  2JBV A;  3AXB A;  4IVM B;  2WOW A;  1D4C A;  2WOI A;  3GD3 A;  2R0G A;  3PO7 A;  1H7W A;  3AE2 A;  1GSN A;  2XLT A;  3NKS A;  4H4T A;  1GRE A;  3GWF A;  1CJ4 A;  1OJ9 A;  3AE5 A;  1GES A;  1S3E A;  4WX1 A;  2YLX A;  3AE4 A;  1Y56 A;  4IA5 A;  3SGL A;  4C3X A;  2XVJ A;  3GSI A;  4U8L A;  3SYI A;  4XXG A;  1N4U A;  2VVL A;  2BXS A;  3F8R A;  3ATQ A;  2WDR A;  4EQW A;  3RHA A;  3SY4 A;  1E39 A;  2C7G A;  4YTP A;  5KMR A;  3VRD B;  2XLU A;  1MXT A;  3AWI A;  5J7X A;  3UP5 A;  3OC4 A;  2IVE A;  3CNP A;  2Z5X A;  2X50 A;  3L8K A;  1B4V A;  4GDP A;  4G6H A;  4YKF A;  1LJ1 A;  2C64 A;  4YTM A;  4B65 A;  1VDC A;  3IHM A;  1PDH A;  4NZH A;  2YG6 A;  2YG3 A;  1CJ3 A;  1EBD A;  2F5Z A;  2WDQ A;  5CKU A;  3ICS A;  1D4E A;  3HZL A;  3KLJ A;  1NG4 A;  1JRX A;  1L0V A;  4TM4 A;  4H4V A;  4H4Q A;  3VRA A;  4NEV A;  4B1B A;  2X3N A;  3UKF A;  1K4Q A;  1CF3 A;  2YG5 A;  1GOS A;  3CIR A;  4BK3 A;  3FG2 P;  3UKK A;  1KFY A;  3D8X A;  2CDU A;  2YVF A;  4H7U A;  1H84 A;  1O95 A;  2V3A A;  3GYX A;  3QSM A;  4TLX A;  3RED A;  5KXJ A;  5KNL A;  4OPI A;  4GUV A;  2V61 A;  3AYJ A;  2XYO A;  1ZKQ A;  2ZZ0 A;  2H88 A;  1EL5 A;  2OA1 A;  3AEB A;  3QJ4 A;  4X9M A;  1E1N A;  4GAP A;  2AAQ A;  4BUR A;  1JNR A;  1E1M A;  4ICY A;  1TDO A;  2XLP A;  1ZMC A;  3ITJ A;  5IQ1 A;  4AT2 A;  5BVA A;  4USQ A;  4USR A;  3VRB A;  3KPF A;  5KMS A;  2GVC A;  2XFU A;  2JKC A;  3UP4 A;  1NHQ A;  2EQ8 A;  1KSU A;  1Q1R A;  1GRG A;  2OAL A;  1TDK A;  2YM1 A;  3V76 A;  3VR9 A;  2XCG A;  1JNZ A;  4G74 A;  4U8P A;  1ZY8 A;  3DJD A;  4GF7 A;  4B64 A;  2WEU A;  2C75 A;  2FBW A;  3NRN A;  4K5R A;  5CQF A;  3NNE A;  2QA1 A;  3M0O A;  3UOZ A;  4M52 A;  2WES A;  4CY8 A;  1CC2 A;  5IPY A;  2VRL A;  1GPE A;  2TPR A;  1PN0 A;  3AE1 A;  4NEW A;  3S61 A;  4I58 A;  3IC9 A;  1REO A;  5HXI A;  4FK1 A;  4II3 A;  2WPF A;  2FJA A;  2X99 A;  3AEE A;  1MOK A;  1GET A;  3LAD A;  5KVI A;  1ZK7 A;  4Y4M A;  3IWA A;  3UCL A;  3G5Q A;  3CGE A;  4OVI A;  3UTF A;  2HQM A;  4ECH A;  5GSN A;  3BNU A;  2O9Z A;  4H2N A;  2XLR A;  1IUU A;  2I0Z A;  2XFP A;  4YTN A;  4IVO B;  4LII A;  2BYB A;  2B9X A;  2BC1 A;  4EM4 A;  1PBB A;  1UKV G;  4NTC A;  1PS9 A;  1H81 A;  4C5O A;  3UOX A;  1N1P A;  3KA7 A;  3AE7 A;  3DK9 A;  4K2X A;  4X4J A;  3LZX A;  2C4C A;  3NYE A;  4LU6 A;  3M12 A;  2WU2 A;  5HHF A;  3FPZ A;  1O94 A;  1RYI A;  2BCG G;  4Z44 A;  1OJA A;  1RSG A;  2WP5 A;  5DBJ A;  3SZC A;  3B3R A;  4IA6 A;  4H4U A;  4U2L A;  4EIP A;  1BZL A;  2C66 A;  4C74 A;  2WHD A;  2GR3 A;  3NK1 X;  3AE9 A;  3AE8 A;  3CNT A;  2R45 A;  4A6N B;  4BJZ A;  5U63 A;  2YLS A;  3ICT A;  3R9U A;  4EMJ A;  1Y56 B;  4OPG A;  5KWF A;  4AOS A;  2C70 A;  3II4 A;  3ZDN A;  5KRQ A;  3UOY A;  4JQ9 A;  2EQ7 A;  2JAE A;  4J34 A;  3T2Y A;  2GR0 A;  3KD9 A;  4E0V A;  4FK1 C;  5GRT A;  4KPR A;  4GCM A;  3KPK A;  3F8D A;  1X31 B;  3DME A;  2YVJ A;  4GAV A;  5KOX A;  1PBE A;  3O0H A;  2UZZ A;  2BC0 A;  2GEW A;  4H4S A;  1VQW A;  5KOW A;  3CGC A;  1LQU A;  1F8S A;  3CNJ A;  2FJD A;  1XPQ A;  4H4P A;  3P4P A;  5EBK A;  3RP7 A;  3T31 A;  4O5U A;  3VR8 A;  3ALJ A;  1E1L A;  3Q6J A;  1YQZ A;  2AR8 A;  2FJB A;  2IID A;  1Y0P A;  3GYJ A;  4H4Y A;  4OPC A;  1ZX9 A;  5BUK A;  3CN8 A;  3PS9 A;  3RP6 A;  3ATR A;  3NTA A;  2XLS A;  3LJP A;  1OJT A;  4J2W A;  4IV9 A;  1ZMD A;  2XFO A;  3GDN A;  4FDC B;  1GT8 A;  2GQF A;  1DOC A;  2CVJ A;  1FL2 A;  2YLW A;  4JNA A;  4I59 A;  3UKA A;  4A6N A;  1KNP A;  3T37 A;  2YWL A;  4Z43 A;  3BHF A;  2Q6U A;  4B68 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...