3I6DA

Crystal structure of ppo from bacillus subtilis with af
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
466
structure length
414
Chain Sequence
KKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYIIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGDIDKLSLMSTFPQFYQFQTLSTGLQTLVEEIEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAISHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGKTLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGHKQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Protoporphyrinogen oxidase
publication title Structural insight into unique properties of protoporphyrinogen oxidase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 118
structure length 414
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.3.3.4: Protoporphyrinogen oxidase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3110.20 Mainly Alpha Orthogonal Bundle protoporphyrinogen ix oxidase, domain 3 protoporphyrinogen ix oxidase, domain 3 3i6dA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3i6dA01
3.90.660.20 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Protoporphyrinogen oxidase, mitochondrial; domain 2 3i6dA02
3NIXA 3UKPA 1FECA 2VQBA 4JNQA 1VRQB 3QFBA 1DODA 2YG6A 2YG4A 2H89A 3NK0X 1ZOYA 2C65A 3UTEA 3DK4A 2GR2A 1F8WA 2OAMA 3LZWA 4IA5A 2VQ7A 2ZZ0A 3UOVA 2BA9A 2XVFA 2Y6RA 2A89A 1ZX9A 3CTYA 1VDCA 3P4QA 1GNDA 1JNZA 3BI2A 3G5RA 3ICSA 3UKKA 3RHAA 2JB1A 4CY6A 1CC6A 5LV9A 2A87A 3CGBA 4AP3A 4EQRA 2FJAA 4J33A 3UOXA 1TDOA 2RABA 3GD3A 2WDRA 4IVOB 4CCRA 3VRAA 1P2HA 1HYUA 1MO9A 2C64A 2R0GA 2YR5A 3CGEA 4U8KA 5EB5A 2C75A 3DJEA 3ZDNA 3LB8A 3S61A 2AQJA 4B68A 1IUWA 2I0ZA 4OCGA 2TMDA 2UZZA 1PDHA 1PBBA 2X99A 1B37A 1ONFA 3SFDA 3AEEA 3P4SA 2V61A 1GETA 4EMWA 2YM1A 2WHDA 4O5UA 1PJ6A 2OLOA 2FBWA 3GRSA 1JNRA 4TLZA 4JDRA 2EQ8A 3UCLA 4NEVA 2H88A 4OPLA 2AAQA 3M13A 4K7ZA 5IPYA 2RGOA 1NPXA 2GF3A 1NHQA 3QSSA 4HB9A 3AE3A 3DA1A 2XLTA 1GRGA 1M64A 1ZK7A 3NN6X 4U2LA 3Q9TA 3AYIA 3BHFA 4A7AA 3KVEA 2WU2A 3AE6A 2YLTA 1VG9A 2WPEA 4AT2A 1F3PA 1MOKA 2BK3A 2VVLA 3CPIG 4H2QA 1L0VA 2E4GA 4FX9A 3NK2X 2B9YA 3AE5A 2XFUA 2WESA 1O5WA 1FEAA 3NLCA 1EL7A 4U8JA 1Y56B 1H7WA 3K7QX 1GPEA 1XPQA 2X50A 5U1OA 1K0IA 3ITJA 3ATRA 4IVMB 4OPTA 2WDVA 4RG3A 1XHCA 2YLZA 4GF7A 1S2QA 4YT0A 1X31B 3KKJA 1Q9IA 3GD4A 4BV6A 3EPTA 2Q0KA 2JKCA 3PO7A 1CJ4A 4UP3A 4ZCCA 1H82A 2YLWA 1GERA 5HHFA 3UKQA 2JAEA 2WP5A 3GMCA 2CFYA 2JBVA 4X9MA 1YY5A 4H4RA 5FS7A 4YTNA 1IUUA 2XLPA 4FK1C 2BCPA 2R0PA 2XFOA 2YVGA 2GQWA 3CNTA 4EM3A 2BCGG 1D7YA 2R4EA 2YVFA 4DSGA 4BK3A 4H4YA 3C4NA 4A79A 4B69A 3DGHA 4A65A 3AXBA 4DNAA 5HY5A 3GWDA 2C70A 3AE2A 1NG4A 3LXDA 4B63A 4C3YA 3NH3X 4HA6A 4M52A 2WETA 3QSMA 4OVIA 3AEAA 3AE1A 1GXFA 3SQPA 3FG2P 1PBFA 2XLUA 3WE0A 2GMHA 1TDFA 3DGZA 2Q7VA 4H4SA 2AR8A 3P9UA 1JEHA 2BK4A 2YLSA 1NAAA 2Z5YA 2NVKX 4B64A 2CVJA 4YKFA 4J36A 4YWOA 4UDRA 2Y6QA 1FOHA 3IHMA 3F8DA 3ISHA 4XXGA 1TYTA 2X3NA 3REDA 4U8IA 1ZKQA 4H4XA 1PN0A 3AE9A 2RGJA 3NN0X 5FS8A 4ADWA 4H2PA 1LTXR 1DJNA 2V3AA 2EQ9A 1QO8A 1KF6A 2ARDA 3COXA 4APNA 2B76A 4GCMA 4D04A 4EM4A 2JB3A 1GRTA 3BHKA 3GYIA 3L1RA 1H84A 2B9XA 1LJ1A 2WOIA 2C67A 4E0VA 1L9DA 1E39A 3DK9A 3AD7B 4K22A 1F8SA 3BI4A 3H4KA 3LJPA 3NK1X 2APGA 2YAUA 1CC2A 2WDQA 4XWRA 1B8SA 2WEUA 4NTEA 1K0JA 3ICTA 1D7LA 3NYCA 4H2RA 3KA7A 5BRTA 2XCGA 1H86A 1TDKA 5EOWA 5IQ4A 3UTHA 3R9UA 4RSLA 2R9ZA 2XVIA 4J57A 1IUVA 4NZHA 1DXLA 4K5RA 4TM1A 2BACA 4EMJA 1KFYA 4NTCA 4BJYA 3CNDA 1IUSA 1CF3A 3CN8A 3LOVA 4GDEA 4C3XA 5BULA 3AEBA 1EL8A 2OA1A 1NHSA 1S3BA 5M0ZA 4JNAA 1IUXA 1VQWA 4NTDA 4X9NA 3GDPA 4CCQA 2GH5A 3G5SA 3DJGX 2B7SA 4USQA 4FDCB 4YTMA 1TDEA 4Z43A 5KRQA 3DH9A 4I59A 3IHGA 4GRTA 3AE8A 3NT6A 2WS3A 1GEUA 1REOA 1GRHA 3ADAB 5KOXA 2J3NA 4H4QA 1CHUA 1N4WA 1RSGA 2XVEA 3GWFA 2FJDA 4Y4LA 4J2WA 4REKA 4C77A 1JRXA 1KSUA 2W0HA 2QA1A 3C4AA 3B3RA 2XLRA 3URHA 3ABVA 1D4DA 3AD8B 1B5QA 5IQ1A 3AWIA 2B7RA 4U2TA 1JU2A 3ALLA 4OPGA 1KNRA 1COYA 3VRBA 2OLNA 2GAHB 4GR1A 5CQFA 5FMHA 5KVIA 5HXIA 3RNMA 3UOZA 3VR8A 4A9WA 2BXSA 2CDUA 1GRBA 4UDQA 3GDNA 3K7MX 4RG4A 1GESA 1PXBA 1BGNA 1D4CA 1OJAA 2X8CA 4A6NA 1EL9A 3O0HA 3UKFA 3FIMB 1LV0A 3FPZA 2YQUA 4H4PA 3UP5A 1MXTA 2GVCA 5GSNA 4LA1A 1LQTA 2IIDA 3IWAA 4K2XA 3OZ2A 4PAAA 3RP7A 1IJHA 4YSZA 1GRAA 3II4A 2EQ6A 1H81A 1JRZA 2WBAA 3D8XA 4D03A 4JY2A 2YG5A 4YKGA 2XYOA 2R46A 4BK1A 1L9CA 3DK8A 3AB1A 3AEGA 3SGLA 3AYLA 4IV9A 3E1TA 2BC1A 1GSNA 3Q6JA 2WU5A 4EMIA 3GMBA 1JRYA 2VVLG 5ER0A 4UDPA 5FS6A 4BURA 1O94A 3G5QA 4C5OA 1QLBA 3AE7A 2NPXA 4OPCA 4ZCDA 2R45A 1CBOA 1DOCA 1NENA 2VZ2A 1K4QA 4H4VA 1YQ3A 1NDAA 1W4XA 1Z6LA 4CRTA 3H8LA 1FL2A 1EBDA 1H7XA 2C73A 3P1WA 4B1BA 5JCNA 1BKWA 2Q0LA 4JN9A 1B4VA 4YXDA 2FJEA 2OALA 3BI5A 4OPUA 1OJTA 4CNKA 2GMJA 2YLRA 5EB4A 3VQRA 1IUTA 4Z44A 2YVJA 4YSXA 1S3EA 2XVJA 4WCTA 4Z2TA 2GEWA 4A99A 3HZLA 1CL0A 4ICYA 4TM3A 4NEWA 2VVMA 3ALJA 2YM2A 1GTHA 2FJBA 1NEKA 2YWLA 2V6OA 3GYJA 3CGDA 3GRTA 5HYMA 1VG0A 1V59A 2V60A 4EQWA 2ZBWA 2WPFA 4XWZA 2XVHA 4JY3A 4U8MA 4Z25A 3IC9A 4X4JA 4IA6A 2E5VA 1DOEA 3QVPA 3C96A 3KU9A 2C7GA 1E7PA 3AE4A 1SEZA 5U25A 2BS2A 1M6IA 3LADA 4J31A 1PBEA 1XANA 4P9SA 4Y4NA 3VR9A 2XLSA 4U2SA 4AT0A 4J56A 2DKIA 3UKAA 3UKLA 3L8KA 5BVAA 3RP8A 3F8PA 3NRNA 5DBJA 3IF9A 2WP6A 4H4UA 4TM0A 2BYBA 1TYPA 4YTPA 4Y4MA 5M10A 1GOSA 2X8GA 4CNJA 1D4EA 2VRMA 1EL5A 3NYFA 2JB2A 1BWCA 2YG7A 1GRFA 2C3DA 1KDGA 2BK5A 2PYXA 3CNJA 3NTAA 4TLXA 3V3OA 4U8NA 4EIQA 1N4UA 2JK6A 4CBQA 4K5SA 1OJDA 3SFEA 3UTFA 4N9XA 2GR3A 2ZZBA 5GRTA 3UTGA 1LVLA 3CPHG 2GV8A 2ZZCA 2YR4A 1GV4A 3P4PA 1PHHA 1CJ3A 1P2EA 3EAOA 5JCMA 1E6EA 4EQXA 3CGCA 2Z5XA 1TRBA 3DJJA 5FS9A 2C66A 2HQMA 1PJ5A 3NTDA 1PS9A 1ZDLA 3I6DA 4ECHA 1CJ2A 2YG3A 3B6DA 1AOGA 4H2NA 3M0OA 5KWFA 3CIRA 3QFAA 1O95A 1N1PA 2GQFA 3AECA 5EBKA 5KXJA 4H7UA 4KX6A 4USRA 3VRDB 4A5LA 1ELIA 2WOVA 5JCIA 5TR3A 1H83A 1PJ7A 3QVRA 2TPRA 3CNPA 1QJDA 4FK1A 3OC4A 3NHOX 1KSSA 1PXAA 4H4TA 4J34A 3D1CA 3AD9B 2VOUA 2GAGB 4U8LA 2BS4A 1K0LA 3FMWA 4KPRA 3NKSA 2C76A 2E1MA 3UKHA 1NHRA 2V5ZA 1Y56A 4ZN0A 3NNEA 4PABA 4EIPA 4Z26A 3ALMA 1JOAA 5KOWA 1OJ9A 2QCUA 3DJDA 1OJCA 4TM4A 5C2TA 4H4ZA 3V76A 2ACZA 5C3JA 3AEDA 1RYIA 2XFQA 2GB0A 2V3BA 4YSYA 3F8RA 5KVHA 2YLXA 1CJCA 2BXRA 1GREA 3BNMA 3KLJA 1F6MA 1H6VA 3EANA 2RGHA 4GDPA 1ZMDA 3LZXA 1E1NA 2GR1A 1DNCA 3RP6A 3ATQA 1YQ4A 2QA2A 3K30A 2VRLA 2PHHA 4AP1A 4A6NB 3H8IA 2WPCA 5JCLA 2XDOA 1PXCA 1PBCA 3V3NA 4DSHA 1UKVG 1E1LA 3NYEA 4B67A 4DGKA 4Z2RA 4OPIA 3QJ4A 3JSKA 3CNSA 1TDNA 3FBSA 3PS9A 4AOXA 4B66A 4YSHA 4U8PA 5BUKA 2Q6UA 4JQ9A 3K7TA 4C74A 5CKUA 4O5QA 2A8XA 2R0CA 3KD9A 4WX1A 1GT8A 5J60A 2DKHA 2WOWA 3P4RA 1DJQA 4BK2A 3CPJG 2R4JA 1Y0PA 2XFPA 4Z2UA 2CULA 1BF3A 1BZLA 3AYJA 1ZP0A 2IVDA 4CY8A 3S5WA 3UP4A 3BNUA 1DOBA 1F8RA 1GTEA 1KNPA 1ZOVA 4H4WA 1LQUA 2C3CA 5J7XA 2GR0A 4MJWA 3M12A 1ZMCA 2XFNA 3NG7X 1NG3A 1FEBA 2GRTA 4LU6A 1S2YA 3KPFA 4B65A 1GALA 3SM8A 4EQSA 1E1MA 4AOSA 4OPDA 2YR6A 2X8HA 1FCDA 5JCKA 1L9EA 2C72A 4BJZA 3QSEA 4Z24A 3NGCX 2EQ7A 3PVCA 4H50A 1YQZA 2WQYA 4LIIA 3I3LA 1BGJA 1D5TA 1NHPA 1XDIA 2WP9A 4K8DA 1PBDA 5U63A 3GSIA 1Q1RA 3DMEA 2O9ZA 1Q1WA 2QAEA 3UOYA 3ICRA 1ZY8A 3ZYXA 4I58A 2F5ZA 2B9WA 5L46A 2BABA 1RP0A 1CC4A 1YKJA 1N4VA 4U8OA 3T37A 4GUVA 3AEFA 1LPFA 2BS3A 3EF6A 2BC0A 2IVEA 1E1KA
chains in the Genus database with same CATH superfamily
3NIXA 3UKPA 5KMRA 1FECA 2VQBA 4JNQA 1VRQB 3QFBA 1DODA 2YG6A 2YG4A 2H89A 3NK0X 1ZOYA 2C65A 3UTEA 3DK4A 2GR2A 1F8WA 2OAMA 3LZWA 4II2A 4IA5A 2VQ7A 2ZZ0A 3UOVA 2BA9A 2XVFA 2Y6RA 2A89A 1ZX9A 3CTYA 1VDCA 3P4QA 1GNDA 1JNZA 3BI2A 3G5RA 3ICSA 3UKKA 3RHAA 2JB1A 4CY6A 1CC6A 2BRAA 5LV9A 2A87A 3CGBA 4AP3A 4EQRA 2FJAA 4J33A 3UOXA 1TDOA 2RABA 3GD3A 2WDRA 4IVOB 4CCRA 3VRAA 1P2HA 1HYUA 1MO9A 2C64A 2R0GA 2YR5A 3CGEA 4U8KA 5EB5A 2C75A 3DJEA 3ZDNA 3LB8A 3S61A 2AQJA 4B68A 1IUWA 2I0ZA 4OCGA 2TMDA 2UZZA 1PDHA 1PBBA 2X99A 1B37A 1ONFA 3SFDA 3AEEA 3P4SA 2V61A 1GETA 4EMWA 2YM1A 2WHDA 3SZWA 4O5UA 1PJ6A 2OLOA 2FBWA 3GRSA 1JNRA 4TLZA 4JDRA 2EQ8A 3UCLA 3GYXA 4NEVA 2H88A 4OPLA 2AAQA 4GAVA 3M13A 4K7ZA 5IPYA 2RGOA 1NPXA 2GF3A 1NHQA 3QSSA 4HB9A 3AE3A 3DA1A 2XLTA 1GRGA 1M64A 1ZK7A 3NN6X 4U2LA 3Q9TA 3AYIA 3BHFA 3SX6A 4A7AA 3KVEA 2WU2A 3AE6A 2YLTA 1VG9A 2WPEA 4AT2A 3KPKA 1F3PA 1MOKA 2BK3A 2VVLA 3CPIG 4H2QA 1L0VA 2E4GA 4FX9A 3NK2X 2B9YA 3AE5A 2XFUA 2WESA 1O5WA 1FEAA 3NLCA 3SY4A 1EL7A 4U8JA 1Y56B 1H7WA 3K7QX 1GPEA 1XPQA 2X50A 5U1OA 1K0IA 3ITJA 3ATRA 4IVMB 4OPTA 2WDVA 4RG3A 1XHCA 3T2ZA 2YLZA 4GF7A 1S2QA 4YT0A 1X31B 3KKJA 1Q9IA 3GD4A 4BV6A 3EPTA 2Q0KA 2JKCA 3PO7A 1CJ4A 4UP3A 4ZCCA 1H82A 3T14A 5KMSA 2YLWA 1GERA 5HHFA 3UKQA 2JAEA 2WP5A 3GMCA 2CFYA 2JBVA 4X9MA 1YY5A 4H4RA 5FS7A 4YTNA 1IUUA 2XLPA 4FK1C 2BCPA 2R0PA 2XFOA 2YVGA 2GQWA 3CNTA 4EM3A 2BCGG 1D7YA 2R4EA 2YVFA 4DSGA 4BK3A 4H4YA 3C4NA 4A79A 4B69A 3DGHA 4A65A 3AXBA 4DNAA 5HY5A 3GWDA 2C70A 4II3A 3AE2A 1NG4A 3LXDA 4B63A 4C3YA 3NH3X 4HA6A 4M52A 2WETA 3QSMA 3HYVA 4OVIA 3AEAA 3AE1A 1GXFA 3SQPA 3FG2P 1PBFA 2XLUA 3WE0A 2GMHA 1TDFA 3DGZA 5KMQA 2Q7VA 4H4SA 2AR8A 3P9UA 1JEHA 2BK4A 2YLSA 1NAAA 2Z5YA 2NVKX 4B64A 2CVJA 4YKFA 4J36A 4YWOA 4UDRA 2Y6QA 1FOHA 3IHMA 3F8DA 3ISHA 4XXGA 1TYTA 2X3NA 3REDA 4U8IA 1ZKQA 4H4XA 1PN0A 3AE9A 2RGJA 3NN0X 5FS8A 4ADWA 4H2PA 1LTXR 1DJNA 2V3AA 3SZFA 2EQ9A 1QO8A 1KF6A 2ARDA 3COXA 4APNA 2B76A 4GCMA 4D04A 4EM4A 2JB3A 1GRTA 3BHKA 4GAPA 3GYIA 3L1RA 1H84A 2B9XA 1LJ1A 2WOIA 2C67A 4E0VA 1L9DA 1E39A 3DK9A 3AD7B 4G73A 4K22A 1F8SA 3BI4A 3H4KA 3LJPA 3NK1X 2APGA 2YAUA 1CC2A 2WDQA 4XWRA 1B8SA 2WEUA 4NTEA 1K0JA 3ICTA 1D7LA 3NYCA 4H2RA 3KA7A 5BRTA 2XCGA 1H86A 1TDKA 5EOWA 5IQ4A 3UTHA 3R9UA 4RSLA 2R9ZA 2XVIA 4J57A 1IUVA 4NZHA 1DXLA 4K5RA 4TM1A 2BACA 3T0KA 4EMJA 1KFYA 4NTCA 4BJYA 3CNDA 2BRYA 1IUSA 1CF3A 3CN8A 3LOVA 4GDEA 4C3XA 5BULA 3AEBA 1EL8A 2OA1A 1NHSA 1S3BA 5M0ZA 4JNAA 1IUXA 1VQWA 4NTDA 4X9NA 3GDPA 4CCQA 2GH5A 3G5SA 3DJGX 2B7SA 4USQA 4FDCB 4YTMA 1TDEA 4G9KA 4Z43A 5KRQA 3DH9A 4I59A 3IHGA 4GRTA 3AE8A 3NT6A 2WS3A 1GEUA 1REOA 1GRHA 3ADAB 5KOXA 2J3NA 4H4QA 1CHUA 1N4WA 1RSGA 2XVEA 3GWFA 2FJDA 4Y4LA 4J2WA 4REKA 4C77A 1JRXA 1KSUA 2W0HA 2QA1A 3C4AA 3B3RA 2XLRA 3URHA 3ABVA 1D4DA 3AD8B 1B5QA 5IQ1A 3AWIA 2B7RA 4U2TA 1JU2A 3ALLA 4OPGA 4NWZA 1KNRA 1COYA 3SXIA 3VRBA 2OLNA 2GAHB 4GR1A 5CQFA 3SYIA 5FMHA 5KVIA 5HXIA 3RNMA 3UOZA 3VR8A 4A9WA 2BXSA 2CDUA 1GRBA 4UDQA 3GDNA 3K7MX 4RG4A 4NNJA 1GESA 1PXBA 1BGNA 1D4CA 1OJAA 2X8CA 4A6NA 1EL9A 3O0HA 3UKFA 4G6HA 3FIMB 1LV0A 3FPZA 2YQUA 4H4PA 3UP5A 1MXTA 2GVCA 5GSNA 4LA1A 1LQTA 2IIDA 3IWAA 4K2XA 3OZ2A 4PAAA 3RP7A 1IJHA 4YSZA 1GRAA 3II4A 2EQ6A 1H81A 1JRZA 2WBAA 3D8XA 4D03A 5KMPA 4JY2A 2YG5A 4YKGA 2XYOA 3SZCA 2R46A 4BK1A 1L9CA 3DK8A 3AB1A 3AEGA 3SGLA 3AYLA 4IV9A 3E1TA 2BC1A 1GSNA 3Q6JA 2WU5A 4EMIA 3GMBA 1JRYA 2VVLG 5ER0A 4UDPA 5FS6A 4BURA 1O94A 3G5QA 4C5OA 1QLBA 3AE7A 2NPXA 4OPCA 4ZCDA 2R45A 1CBOA 1DOCA 1NENA 2VZ2A 1K4QA 4H4VA 1YQ3A 1NDAA 1W4XA 1Z6LA 4CRTA 3H8LA 1FL2A 1EBDA 1H7XA 2C73A 3P1WA 4B1BA 5JCNA 1BKWA 2Q0LA 2C4CA 4JN9A 1B4VA 3HYWA 4G74A 4YXDA 2FJEA 2OALA 3BI5A 4OPUA 1OJTA 4CNKA 2GMJA 2YLRA 5EB4A 3VQRA 1IUTA 4Z44A 2YVJA 4YSXA 1S3EA 2XVJA 4WCTA 4Z2TA 2GEWA 4A99A 3HZLA 1CL0A 4ICYA 4TM3A 4NEWA 2VVMA 3ALJA 2YM2A 1GTHA 2FJBA 1NEKA 2YWLA 2V6OA 3GYJA 3CGDA 3GRTA 5HYMA 1VG0A 1V59A 2V60A 4EQWA 2ZBWA 2WPFA 4XWZA 2XVHA 4JY3A 4U8MA 4Z25A 3IC9A 4X4JA 4IA6A 2E5VA 1DOEA 3QVPA 3C96A 3KU9A 2C7GA 1E7PA 3AE4A 1SEZA 5U25A 2BS2A 1M6IA 3LADA 4J31A 1PBEA 1XANA 4P9SA 4Y4NA 3VR9A 2XLSA 4U2SA 4AT0A 4J56A 2DKIA 3UKAA 3UKLA 3L8KA 5BVAA 5KNLA 3RP8A 3F8PA 3NRNA 5DBJA 3IF9A 2WP6A 4H4UA 4TM0A 2BYBA 1TYPA 4YTPA 4Y4MA 5M10A 1GOSA 2X8GA 4CNJA 1D4EA 2VRMA 1EL5A 3NYFA 2JB2A 1BWCA 2YG7A 1GRFA 2C3DA 1KDGA 2BK5A 2PYXA 3CNJA 3NTAA 4TLXA 3V3OA 4U8NA 4EIQA 1N4UA 2JK6A 4CBQA 4K5SA 1OJDA 3SFEA 3UTFA 4N9XA 2GR3A 2ZZBA 5GRTA 3UTGA 1LVLA 3CPHG 2GV8A 2ZZCA 2YR4A 1GV4A 3P4PA 1PHHA 1CJ3A 1P2EA 3EAOA 5JCMA 1E6EA 4EQXA 3CGCA 2Z5XA 1TRBA 3DJJA 5FS9A 2C66A 2HQMA 1PJ5A 3NTDA 1PS9A 1ZDLA 3I6DA 4ECHA 1CJ2A 2YG3A 3B6DA 1AOGA 4H2NA 3M0OA 5KWFA 3CIRA 3QFAA 1O95A 1N1PA 2GQFA 3AECA 5EBKA 5KXJA 4H7UA 4KX6A 4USRA 3VRDB 4A5LA 1ELIA 2WOVA 5JCIA 5TR3A 1H83A 1PJ7A 3QVRA 2TPRA 3CNPA 1QJDA 4FK1A 3OC4A 3NHOX 1KSSA 1PXAA 4H4TA 4J34A 3D1CA 3AD9B 2VOUA 2GAGB 4U8LA 2BS4A 1K0LA 3FMWA 4KPRA 3NKSA 2C76A 2E1MA 3UKHA 1NHRA 2V5ZA 1Y56A 4ZN0A 3NNEA 4PABA 4EIPA 4Z26A 3ALMA 1JOAA 5KOWA 1OJ9A 2QCUA 3DJDA 1OJCA 4TM4A 5C2TA 4H4ZA 3V76A 2ACZA 5C3JA 3AEDA 1RYIA 2XFQA 2GB0A 2V3BA 4YSYA 3F8RA 5KVHA 2YLXA 1CJCA 2BXRA 1GREA 3BNMA 3KLJA 1F6MA 1H6VA 3EANA 2RGHA 4GDPA 1ZMDA 3LZXA 1E1NA 2GR1A 1DNCA 3RP6A 3ATQA 1YQ4A 2QA2A 3K30A 2VRLA 2PHHA 4AP1A 4A6NB 3H8IA 2WPCA 5JCLA 2XDOA 1PXCA 1PBCA 3V3NA 3CMMA 4DSHA 1UKVG 1E1LA 3NYEA 3T2KA 4B67A 4DGKA 4Z2RA 4OPIA 3QJ4A 3JSKA 3CNSA 1TDNA 3FBSA 3PS9A 4AOXA 4B66A 4YSHA 4U8PA 3HYXA 5BUKA 2Q6UA 4JQ9A 3K7TA 4C74A 5CKUA 4O5QA 2A8XA 2R0CA 3KD9A 4WX1A 1GT8A 5J60A 2DKHA 2WOWA 3P4RA 4G6GA 1DJQA 4BK2A 3CPJG 2R4JA 1Y0PA 2XFPA 4Z2UA 2CULA 1BF3A 1BZLA 3AYJA 1ZP0A 2IVDA 4CY8A 3S5WA 3UP4A 3BNUA 1DOBA 1F8RA 1GTEA 1KNPA 1ZOVA 4H4WA 3SZ0A 1LQUA 2C3CA 5J7XA 2GR0A 4MJWA 3M12A 1ZMCA 2XFNA 3NG7X 1NG3A 1FEBA 2GRTA 4LU6A 1S2YA 3KPFA 4B65A 1GALA 3SM8A 4EQSA 1E1MA 4AOSA 4OPDA 2YR6A 2X8HA 1FCDA 5JCKA 1L9EA 2C72A 4BJZA 3QSEA 4Z24A 3NGCX 2EQ7A 3PVCA 4H50A 1YQZA 2WQYA 4LIIA 3I3LA 1BGJA 1D5TA 1NHPA 1XDIA 2WP9A 4K8DA 1PBDA 5U63A 3GSIA 1Q1RA 3DMEA 2O9ZA 1Q1WA 2QAEA 3T31A 3UOYA 3ICRA 1ZY8A 3ZYXA 4I58A 2F5ZA 2B9WA 5L46A 2BABA 1RP0A 1CC4A 1YKJA 1N4VA 4U8OA 3T37A 3T2YA 4GUVA 3AEFA 1LPFA 2BS3A 3EF6A 2BC0A 2IVEA 1E1KA
chains in the Genus database with same CATH topology
3NIXA 3UKPA 5KMRA 1FECA 2VQBA 4JNQA 1VRQB 3QFBA 1DODA 2YG6A 2YG4A 2H89A 3NK0X 1ZOYA 2C65A 3UTEA 3DK4A 2GR2A 1F8WA 2OAMA 3LZWA 4II2A 4IA5A 2VQ7A 2ZZ0A 3UOVA 2BA9A 2XVFA 2Y6RA 2A89A 1ZX9A 3CTYA 1VDCA 3P4QA 1GNDA 1JNZA 3BI2A 3G5RA 3ICSA 3UKKA 3RHAA 2JB1A 4CY6A 1CC6A 2BRAA 5LV9A 2A87A 3CGBA 4AP3A 4EQRA 2FJAA 4J33A 3UOXA 1TDOA 2RABA 3GD3A 2WDRA 4IVOB 4CCRA 3VRAA 1P2HA 1HYUA 1MO9A 2C64A 2R0GA 2YR5A 3CGEA 4U8KA 5EB5A 2C75A 3DJEA 3ZDNA 3LB8A 3S61A 2AQJA 4B68A 1IUWA 2I0ZA 4OCGA 2TMDA 2UZZA 1PDHA 1PBBA 2X99A 1B37A 1ONFA 3SFDA 3AEEA 3P4SA 2V61A 1GETA 4EMWA 2YM1A 2WHDA 3SZWA 4O5UA 1PJ6A 2OLOA 2FBWA 3GRSA 1JNRA 4TLZA 4JDRA 2EQ8A 3UCLA 3GYXA 4NEVA 2H88A 4OPLA 2AAQA 4GAVA 3M13A 4K7ZA 5IPYA 2RGOA 1NPXA 2GF3A 1NHQA 3QSSA 4HB9A 3AE3A 3DA1A 2XLTA 1GRGA 1M64A 1ZK7A 3NN6X 4U2LA 3Q9TA 3AYIA 3BHFA 3SX6A 4A7AA 3KVEA 2WU2A 3AE6A 2YLTA 1VG9A 2WPEA 4AT2A 3KPKA 1F3PA 1MOKA 2BK3A 2VVLA 3CPIG 4H2QA 1L0VA 2E4GA 4FX9A 3NK2X 2B9YA 3AE5A 2XFUA 2WESA 1O5WA 1FEAA 3NLCA 3SY4A 1EL7A 4U8JA 1Y56B 1H7WA 3K7QX 1GPEA 1XPQA 2X50A 5U1OA 1K0IA 3ITJA 3ATRA 4IVMB 4OPTA 2WDVA 4RG3A 1XHCA 3T2ZA 2YLZA 4GF7A 1S2QA 4YT0A 1X31B 3KKJA 1Q9IA 3GD4A 4BV6A 3EPTA 2Q0KA 2JKCA 3PO7A 1CJ4A 4UP3A 4ZCCA 1H82A 3T14A 5KMSA 2YLWA 1GERA 5HHFA 3UKQA 2JAEA 2WP5A 3GMCA 2CFYA 2JBVA 4X9MA 1YY5A 4H4RA 5FS7A 4YTNA 1IUUA 2XLPA 4FK1C 2BCPA 2R0PA 2XFOA 2YVGA 2GQWA 3CNTA 4EM3A 2BCGG 1D7YA 2R4EA 2YVFA 4DSGA 4BK3A 4H4YA 3C4NA 4A79A 4B69A 3DGHA 4A65A 3AXBA 4DNAA 5HY5A 3GWDA 2C70A 4II3A 3AE2A 1NG4A 3LXDA 4B63A 4C3YA 3NH3X 4HA6A 4M52A 2WETA 3QSMA 3HYVA 4OVIA 3AEAA 3AE1A 1GXFA 3SQPA 3FG2P 1PBFA 2XLUA 3WE0A 2GMHA 1TDFA 3DGZA 5KMQA 2Q7VA 4H4SA 2AR8A 3P9UA 1JEHA 2BK4A 2YLSA 1NAAA 2Z5YA 2NVKX 4B64A 2CVJA 4YKFA 4J36A 4YWOA 4UDRA 2Y6QA 1FOHA 3IHMA 3F8DA 3ISHA 4XXGA 1TYTA 2X3NA 3REDA 4U8IA 1ZKQA 4H4XA 1PN0A 3AE9A 2RGJA 3NN0X 5FS8A 4ADWA 4H2PA 1LTXR 1DJNA 2V3AA 3SZFA 2EQ9A 1QO8A 1KF6A 2ARDA 3COXA 4APNA 2B76A 4GCMA 4D04A 4EM4A 2JB3A 1GRTA 3BHKA 4GAPA 3GYIA 3L1RA 1H84A 2B9XA 1LJ1A 2WOIA 2C67A 4E0VA 1L9DA 1E39A 3DK9A 3AD7B 4G73A 4K22A 1F8SA 3BI4A 3H4KA 3LJPA 3NK1X 2APGA 2YAUA 1CC2A 2WDQA 4XWRA 1B8SA 2WEUA 4NTEA 1K0JA 3ICTA 1D7LA 3NYCA 4H2RA 3KA7A 5BRTA 2XCGA 1H86A 1TDKA 5EOWA 5IQ4A 3UTHA 3R9UA 4RSLA 2R9ZA 2XVIA 4J57A 1IUVA 4NZHA 1DXLA 4K5RA 4TM1A 2BACA 3T0KA 4EMJA 1KFYA 4NTCA 4BJYA 3CNDA 2BRYA 1IUSA 1CF3A 3CN8A 3LOVA 4GDEA 4C3XA 5BULA 3AEBA 1EL8A 2OA1A 1NHSA 1S3BA 5M0ZA 4JNAA 1IUXA 1VQWA 4NTDA 4X9NA 3GDPA 4CCQA 2GH5A 3G5SA 3DJGX 2B7SA 4USQA 4FDCB 4YTMA 1TDEA 4G9KA 4Z43A 5KRQA 3DH9A 4I59A 3IHGA 4GRTA 3AE8A 3NT6A 2WS3A 1GEUA 1REOA 1GRHA 3ADAB 5KOXA 2J3NA 4H4QA 1CHUA 1N4WA 1RSGA 2XVEA 3GWFA 2FJDA 4Y4LA 4J2WA 4REKA 4C77A 1JRXA 1KSUA 2W0HA 2QA1A 3C4AA 3B3RA 2XLRA 3URHA 3ABVA 1D4DA 3AD8B 1B5QA 5IQ1A 3AWIA 2B7RA 4U2TA 1JU2A 3ALLA 4OPGA 4NWZA 1KNRA 1COYA 3SXIA 3VRBA 2OLNA 2GAHB 4GR1A 5CQFA 3SYIA 5FMHA 5KVIA 5HXIA 3RNMA 3UOZA 3VR8A 4A9WA 2BXSA 2CDUA 1GRBA 4UDQA 3GDNA 3K7MX 4RG4A 4NNJA 1GESA 1PXBA 1BGNA 1D4CA 1OJAA 2X8CA 4A6NA 1EL9A 3O0HA 3UKFA 4G6HA 3FIMB 1LV0A 3FPZA 2YQUA 4H4PA 3UP5A 1MXTA 2GVCA 5GSNA 4LA1A 1LQTA 2IIDA 3IWAA 4K2XA 3OZ2A 4PAAA 3RP7A 1IJHA 4YSZA 1GRAA 3II4A 2EQ6A 1H81A 1JRZA 2WBAA 3D8XA 4D03A 5KMPA 4JY2A 2YG5A 4YKGA 2XYOA 3SZCA 2R46A 4BK1A 1L9CA 3DK8A 3AB1A 3AEGA 3SGLA 3AYLA 4IV9A 3E1TA 2BC1A 1GSNA 3Q6JA 2WU5A 4EMIA 3GMBA 1JRYA 2VVLG 5ER0A 4UDPA 5FS6A 4BURA 1O94A 3G5QA 4C5OA 1QLBA 3AE7A 2NPXA 4OPCA 4ZCDA 2R45A 1CBOA 1DOCA 1NENA 2VZ2A 1K4QA 4H4VA 1YQ3A 1NDAA 1W4XA 1Z6LA 4CRTA 3H8LA 1FL2A 1EBDA 1H7XA 2C73A 3P1WA 4B1BA 5JCNA 1BKWA 2Q0LA 2C4CA 4JN9A 1B4VA 3HYWA 4G74A 4YXDA 2FJEA 2OALA 3BI5A 4OPUA 1OJTA 4CNKA 2GMJA 2YLRA 5EB4A 3VQRA 1IUTA 4Z44A 2YVJA 4YSXA 1S3EA 2XVJA 4WCTA 4Z2TA 2GEWA 4A99A 3HZLA 1CL0A 4ICYA 4TM3A 4NEWA 2VVMA 3ALJA 2YM2A 1GTHA 2FJBA 1NEKA 2YWLA 2V6OA 3GYJA 3CGDA 3GRTA 5HYMA 1VG0A 1V59A 2V60A 4EQWA 2ZBWA 2WPFA 4XWZA 2XVHA 4JY3A 4U8MA 4Z25A 3IC9A 4X4JA 4IA6A 2E5VA 1DOEA 3QVPA 3C96A 3KU9A 2C7GA 1E7PA 3AE4A 1SEZA 5U25A 2BS2A 1M6IA 3LADA 4J31A 1PBEA 1XANA 4P9SA 4Y4NA 3VR9A 2XLSA 4U2SA 4AT0A 4J56A 2DKIA 3UKAA 3UKLA 3L8KA 5BVAA 5KNLA 3RP8A 3F8PA 3NRNA 5DBJA 3IF9A 2WP6A 4H4UA 4TM0A 2BYBA 1TYPA 4YTPA 4Y4MA 5M10A 1GOSA 2X8GA 4CNJA 1D4EA 2VRMA 1EL5A 3NYFA 2JB2A 1BWCA 2YG7A 1GRFA 2C3DA 1KDGA 2BK5A 2PYXA 3CNJA 3NTAA 4TLXA 3V3OA 4U8NA 4EIQA 1N4UA 2JK6A 4CBQA 4K5SA 1OJDA 3SFEA 3UTFA 4N9XA 2GR3A 2ZZBA 5GRTA 3UTGA 1LVLA 3CPHG 2GV8A 2ZZCA 2YR4A 1GV4A 3P4PA 1PHHA 1CJ3A 1P2EA 3EAOA 5JCMA 1E6EA 4EQXA 3CGCA 2Z5XA 1TRBA 3DJJA 5FS9A 2C66A 2HQMA 1PJ5A 3NTDA 1PS9A 1ZDLA 3I6DA 4ECHA 1CJ2A 2YG3A 3B6DA 1AOGA 4H2NA 3M0OA 5KWFA 3CIRA 3QFAA 1O95A 1N1PA 2GQFA 3AECA 5EBKA 5KXJA 4H7UA 4KX6A 4USRA 3VRDB 4A5LA 1ELIA 2WOVA 5JCIA 5TR3A 1H83A 1PJ7A 3QVRA 2TPRA 3CNPA 1QJDA 4FK1A 3OC4A 3NHOX 1KSSA 1PXAA 4H4TA 4J34A 3D1CA 3AD9B 2VOUA 2GAGB 4U8LA 2BS4A 1K0LA 3FMWA 4KPRA 3NKSA 2C76A 2E1MA 3UKHA 1NHRA 2V5ZA 1Y56A 4ZN0A 3NNEA 4PABA 4EIPA 4Z26A 3ALMA 1JOAA 5KOWA 1OJ9A 2QCUA 3DJDA 1OJCA 4TM4A 5C2TA 4H4ZA 3V76A 2ACZA 5C3JA 3AEDA 1RYIA 2XFQA 2GB0A 2V3BA 4YSYA 3F8RA 5KVHA 2YLXA 1CJCA 2BXRA 1GREA 3BNMA 3KLJA 1F6MA 1H6VA 3EANA 2RGHA 4GDPA 1ZMDA 3LZXA 1E1NA 2GR1A 1DNCA 3RP6A 3ATQA 1YQ4A 2QA2A 3K30A 2VRLA 2PHHA 4AP1A 4A6NB 3H8IA 2WPCA 5JCLA 2XDOA 1PXCA 1PBCA 3V3NA 3CMMA 4DSHA 1UKVG 1E1LA 3NYEA 3T2KA 4B67A 4DGKA 4Z2RA 4OPIA 3QJ4A 3JSKA 3CNSA 1TDNA 3FBSA 3PS9A 4AOXA 4B66A 4YSHA 4U8PA 3HYXA 5BUKA 2Q6UA 4JQ9A 3K7TA 4C74A 5CKUA 4O5QA 2A8XA 2R0CA 3KD9A 4WX1A 1GT8A 5J60A 2DKHA 2WOWA 3P4RA 4G6GA 1DJQA 4BK2A 3CPJG 2R4JA 1Y0PA 2XFPA 4Z2UA 2CULA 1BF3A 1BZLA 3AYJA 1ZP0A 2IVDA 4CY8A 3S5WA 3UP4A 3BNUA 1DOBA 1F8RA 1GTEA 1KNPA 1ZOVA 4H4WA 3SZ0A 1LQUA 2C3CA 5J7XA 2GR0A 4MJWA 3M12A 1ZMCA 2XFNA 3NG7X 1NG3A 1FEBA 2GRTA 4LU6A 1S2YA 3KPFA 4B65A 1GALA 3SM8A 4EQSA 1E1MA 4AOSA 4OPDA 2YR6A 2X8HA 1FCDA 5JCKA 1L9EA 2C72A 4BJZA 3QSEA 4Z24A 3NGCX 2EQ7A 3PVCA 4H50A 1YQZA 2WQYA 4LIIA 3I3LA 1BGJA 1D5TA 1NHPA 1XDIA 2WP9A 4K8DA 1PBDA 5U63A 3GSIA 1Q1RA 3DMEA 2O9ZA 1Q1WA 2QAEA 3T31A 3UOYA 3ICRA 1ZY8A 3ZYXA 4I58A 2F5ZA 2B9WA 5L46A 2BABA 1RP0A 1CC4A 1YKJA 1N4VA 4U8OA 3T37A 3T2YA 4GUVA 3AEFA 1LPFA 2BS3A 3EF6A 2BC0A 2IVEA 1E1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NIX A;  3UKP A;  1FEC A;  2VQB A;  4JNQ A;  1VRQ B;  3QFB A;  1DOD A;  2YG6 A;  2YG4 A;  2H89 A;  3NK0 X;  1ZOY A;  2C65 A;  3UTE A;  3DK4 A;  2GR2 A;  1F8W A;  2OAM A;  3LZW A;  4IA5 A;  2VQ7 A;  2ZZ0 A;  3UOV A;  2BA9 A;  2XVF A;  2Y6R A;  2A89 A;  1ZX9 A;  3CTY A;  1VDC A;  3P4Q A;  1GND A;  1JNZ A;  3BI2 A;  3G5R A;  3ICS A;  3UKK A;  3RHA A;  2JB1 A;  4CY6 A;  1CC6 A;  5LV9 A;  2A87 A;  3CGB A;  4AP3 A;  4EQR A;  2FJA A;  4J33 A;  3UOX A;  1TDO A;  2RAB A;  3GD3 A;  2WDR A;  4IVO B;  4CCR A;  3VRA A;  1P2H A;  1HYU A;  1MO9 A;  2C64 A;  2R0G A;  2YR5 A;  3CGE A;  4U8K A;  5EB5 A;  2C75 A;  3DJE A;  3ZDN A;  3LB8 A;  3S61 A;  2AQJ A;  4B68 A;  1IUW A;  2I0Z A;  4OCG A;  2TMD A;  2UZZ A;  1PDH A;  1PBB A;  2X99 A;  1B37 A;  1ONF A;  3SFD A;  3AEE A;  3P4S A;  2V61 A;  1GET A;  4EMW A;  2YM1 A;  2WHD A;  4O5U A;  1PJ6 A;  2OLO A;  2FBW A;  3GRS A;  1JNR A;  4TLZ A;  4JDR A;  2EQ8 A;  3UCL A;  4NEV A;  2H88 A;  4OPL A;  2AAQ A;  3M13 A;  4K7Z A;  5IPY A;  2RGO A;  1NPX A;  2GF3 A;  1NHQ A;  3QSS A;  4HB9 A;  3AE3 A;  3DA1 A;  2XLT A;  1GRG A;  1M64 A;  1ZK7 A;  3NN6 X;  4U2L A;  3Q9T A;  3AYI A;  3BHF A;  4A7A A;  3KVE A;  2WU2 A;  3AE6 A;  2YLT A;  1VG9 A;  2WPE A;  4AT2 A;  1F3P A;  1MOK A;  2BK3 A;  2VVL A;  3CPI G;  4H2Q A;  1L0V A;  2E4G A;  4FX9 A;  3NK2 X;  2B9Y A;  3AE5 A;  2XFU A;  2WES A;  1O5W A;  1FEA A;  3NLC A;  1EL7 A;  4U8J A;  1Y56 B;  1H7W A;  3K7Q X;  1GPE A;  1XPQ A;  2X50 A;  5U1O A;  1K0I A;  3ITJ A;  3ATR A;  4IVM B;  4OPT A;  2WDV A;  4RG3 A;  1XHC A;  2YLZ A;  4GF7 A;  1S2Q A;  4YT0 A;  1X31 B;  3KKJ A;  1Q9I A;  3GD4 A;  4BV6 A;  3EPT A;  2Q0K A;  2JKC A;  3PO7 A;  1CJ4 A;  4UP3 A;  4ZCC A;  1H82 A;  2YLW A;  1GER A;  5HHF A;  3UKQ A;  2JAE A;  2WP5 A;  3GMC A;  2CFY A;  2JBV A;  4X9M A;  1YY5 A;  4H4R A;  5FS7 A;  4YTN A;  1IUU A;  2XLP A;  4FK1 C;  2BCP A;  2R0P A;  2XFO A;  2YVG A;  2GQW A;  3CNT A;  4EM3 A;  2BCG G;  1D7Y A;  2R4E A;  2YVF A;  4DSG A;  4BK3 A;  4H4Y A;  3C4N A;  4A79 A;  4B69 A;  3DGH A;  4A65 A;  3AXB A;  4DNA A;  5HY5 A;  3GWD A;  2C70 A;  3AE2 A;  1NG4 A;  3LXD A;  4B63 A;  4C3Y A;  3NH3 X;  4HA6 A;  4M52 A;  2WET A;  3QSM A;  4OVI A;  3AEA A;  3AE1 A;  1GXF A;  3SQP A;  3FG2 P;  1PBF A;  2XLU A;  3WE0 A;  2GMH A;  1TDF A;  3DGZ A;  2Q7V A;  4H4S A;  2AR8 A;  3P9U A;  1JEH A;  2BK4 A;  2YLS A;  1NAA A;  2Z5Y A;  2NVK X;  4B64 A;  2CVJ A;  4YKF A;  4J36 A;  4YWO A;  4UDR A;  2Y6Q A;  1FOH A;  3IHM A;  3F8D A;  3ISH A;  4XXG A;  1TYT A;  2X3N A;  3RED A;  4U8I A;  1ZKQ A;  4H4X A;  1PN0 A;  3AE9 A;  2RGJ A;  3NN0 X;  5FS8 A;  4ADW A;  4H2P A;  1LTX R;  1DJN A;  2V3A A;  2EQ9 A;  1QO8 A;  1KF6 A;  2ARD A;  3COX A;  4APN A;  2B76 A;  4GCM A;  4D04 A;  4EM4 A;  2JB3 A;  1GRT A;  3BHK A;  3GYI A;  3L1R A;  1H84 A;  2B9X A;  1LJ1 A;  2WOI A;  2C67 A;  4E0V A;  1L9D A;  1E39 A;  3DK9 A;  3AD7 B;  4K22 A;  1F8S A;  3BI4 A;  3H4K A;  3LJP A;  3NK1 X;  2APG A;  2YAU A;  1CC2 A;  2WDQ A;  4XWR A;  1B8S A;  2WEU A;  4NTE A;  1K0J A;  3ICT A;  1D7L A;  3NYC A;  4H2R A;  3KA7 A;  5BRT A;  2XCG A;  1H86 A;  1TDK A;  5EOW A;  5IQ4 A;  3UTH A;  3R9U A;  4RSL A;  2R9Z A;  2XVI A;  4J57 A;  1IUV A;  4NZH A;  1DXL A;  4K5R A;  4TM1 A;  2BAC A;  4EMJ A;  1KFY A;  4NTC A;  4BJY A;  3CND A;  1IUS A;  1CF3 A;  3CN8 A;  3LOV A;  4GDE A;  4C3X A;  5BUL A;  3AEB A;  1EL8 A;  2OA1 A;  1NHS A;  1S3B A;  5M0Z A;  4JNA A;  1IUX A;  1VQW A;  4NTD A;  4X9N A;  3GDP A;  4CCQ A;  2GH5 A;  3G5S A;  3DJG X;  2B7S A;  4USQ A;  4FDC B;  4YTM A;  1TDE A;  4Z43 A;  5KRQ A;  3DH9 A;  4I59 A;  3IHG A;  4GRT A;  3AE8 A;  3NT6 A;  2WS3 A;  1GEU A;  1REO A;  1GRH A;  3ADA B;  5KOX A;  2J3N A;  4H4Q A;  1CHU A;  1N4W A;  1RSG A;  2XVE A;  3GWF A;  2FJD A;  4Y4L A;  4J2W A;  4REK A;  4C77 A;  1JRX A;  1KSU A;  2W0H A;  2QA1 A;  3C4A A;  3B3R A;  2XLR A;  3URH A;  3ABV A;  1D4D A;  3AD8 B;  1B5Q A;  5IQ1 A;  3AWI A;  2B7R A;  4U2T A;  1JU2 A;  3ALL A;  4OPG A;  1KNR A;  1COY A;  3VRB A;  2OLN A;  2GAH B;  4GR1 A;  5CQF A;  5FMH A;  5KVI A;  5HXI A;  3RNM A;  3UOZ A;  3VR8 A;  4A9W A;  2BXS A;  2CDU A;  1GRB A;  4UDQ A;  3GDN A;  3K7M X;  4RG4 A;  1GES A;  1PXB A;  1BGN A;  1D4C A;  1OJA A;  2X8C A;  4A6N A;  1EL9 A;  3O0H A;  3UKF A;  3FIM B;  1LV0 A;  3FPZ A;  2YQU A;  4H4P A;  3UP5 A;  1MXT A;  2GVC A;  5GSN A;  4LA1 A;  1LQT A;  2IID A;  3IWA A;  4K2X A;  3OZ2 A;  4PAA A;  3RP7 A;  1IJH A;  4YSZ A;  1GRA A;  3II4 A;  2EQ6 A;  1H81 A;  1JRZ A;  2WBA A;  3D8X A;  4D03 A;  4JY2 A;  2YG5 A;  4YKG A;  2XYO A;  2R46 A;  4BK1 A;  1L9C A;  3DK8 A;  3AB1 A;  3AEG A;  3SGL A;  3AYL A;  4IV9 A;  3E1T A;  2BC1 A;  1GSN A;  3Q6J A;  2WU5 A;  4EMI A;  3GMB A;  1JRY A;  2VVL G;  5ER0 A;  4UDP A;  5FS6 A;  4BUR A;  1O94 A;  3G5Q A;  4C5O A;  1QLB A;  3AE7 A;  2NPX A;  4OPC A;  4ZCD A;  2R45 A;  1CBO A;  1DOC A;  1NEN A;  2VZ2 A;  1K4Q A;  4H4V A;  1YQ3 A;  1NDA A;  1W4X A;  1Z6L A;  4CRT A;  3H8L A;  1FL2 A;  1EBD A;  1H7X A;  2C73 A;  3P1W A;  4B1B A;  5JCN A;  1BKW A;  2Q0L A;  4JN9 A;  1B4V A;  4YXD A;  2FJE A;  2OAL A;  3BI5 A;  4OPU A;  1OJT A;  4CNK A;  2GMJ A;  2YLR A;  5EB4 A;  3VQR A;  1IUT A;  4Z44 A;  2YVJ A;  4YSX A;  1S3E A;  2XVJ A;  4WCT A;  4Z2T A;  2GEW A;  4A99 A;  3HZL A;  1CL0 A;  4ICY A;  4TM3 A;  4NEW A;  2VVM A;  3ALJ A;  2YM2 A;  1GTH A;  2FJB A;  1NEK A;  2YWL A;  2V6O A;  3GYJ A;  3CGD A;  3GRT A;  5HYM A;  1VG0 A;  1V59 A;  2V60 A;  4EQW A;  2ZBW A;  2WPF A;  4XWZ A;  2XVH A;  4JY3 A;  4U8M A;  4Z25 A;  3IC9 A;  4X4J A;  4IA6 A;  2E5V A;  1DOE A;  3QVP A;  3C96 A;  3KU9 A;  2C7G A;  1E7P A;  3AE4 A;  1SEZ A;  5U25 A;  2BS2 A;  1M6I A;  3LAD A;  4J31 A;  1PBE A;  1XAN A;  4P9S A;  4Y4N A;  3VR9 A;  2XLS A;  4U2S A;  4AT0 A;  4J56 A;  2DKI A;  3UKA A;  3UKL A;  3L8K A;  5BVA A;  3RP8 A;  3F8P A;  3NRN A;  5DBJ A;  3IF9 A;  2WP6 A;  4H4U A;  4TM0 A;  2BYB A;  1TYP A;  4YTP A;  4Y4M A;  5M10 A;  1GOS A;  2X8G A;  4CNJ A;  1D4E A;  2VRM A;  1EL5 A;  3NYF A;  2JB2 A;  1BWC A;  2YG7 A;  1GRF A;  2C3D A;  1KDG A;  2BK5 A;  2PYX A;  3CNJ A;  3NTA A;  4TLX A;  3V3O A;  4U8N A;  4EIQ A;  1N4U A;  2JK6 A;  4CBQ A;  4K5S A;  1OJD A;  3SFE A;  3UTF A;  4N9X A;  2GR3 A;  2ZZB A;  5GRT A;  3UTG A;  1LVL A;  3CPH G;  2GV8 A;  2ZZC A;  2YR4 A;  1GV4 A;  3P4P A;  1PHH A;  1CJ3 A;  1P2E A;  3EAO A;  5JCM A;  1E6E A;  4EQX A;  3CGC A;  2Z5X A;  1TRB A;  3DJJ A;  5FS9 A;  2C66 A;  2HQM A;  1PJ5 A;  3NTD A;  1PS9 A;  1ZDL A;  3I6D A;  4ECH A;  1CJ2 A;  2YG3 A;  3B6D A;  1AOG A;  4H2N A;  3M0O A;  5KWF A;  3CIR A;  3QFA A;  1O95 A;  1N1P A;  2GQF A;  3AEC A;  5EBK A;  5KXJ A;  4H7U A;  4KX6 A;  4USR A;  3VRD B;  4A5L A;  1ELI A;  2WOV A;  5JCI A;  5TR3 A;  1H83 A;  1PJ7 A;  3QVR A;  2TPR A;  3CNP A;  1QJD A;  4FK1 A;  3OC4 A;  3NHO X;  1KSS A;  1PXA A;  4H4T A;  4J34 A;  3D1C A;  3AD9 B;  2VOU A;  2GAG B;  4U8L A;  2BS4 A;  1K0L A;  3FMW A;  4KPR A;  3NKS A;  2C76 A;  2E1M A;  3UKH A;  1NHR A;  2V5Z A;  1Y56 A;  4ZN0 A;  3NNE A;  4PAB A;  4EIP A;  4Z26 A;  3ALM A;  1JOA A;  5KOW A;  1OJ9 A;  2QCU A;  3DJD A;  1OJC A;  4TM4 A;  5C2T A;  4H4Z A;  3V76 A;  2ACZ A;  5C3J A;  3AED A;  1RYI A;  2XFQ A;  2GB0 A;  2V3B A;  4YSY A;  3F8R A;  5KVH A;  2YLX A;  1CJC A;  2BXR A;  1GRE A;  3BNM A;  3KLJ A;  1F6M A;  1H6V A;  3EAN A;  2RGH A;  4GDP A;  1ZMD A;  3LZX A;  1E1N A;  2GR1 A;  1DNC A;  3RP6 A;  3ATQ A;  1YQ4 A;  2QA2 A;  3K30 A;  2VRL A;  2PHH A;  4AP1 A;  4A6N B;  3H8I A;  2WPC A;  5JCL A;  2XDO A;  1PXC A;  1PBC A;  3V3N A;  4DSH A;  1UKV G;  1E1L A;  3NYE A;  4B67 A;  4DGK A;  4Z2R A;  4OPI A;  3QJ4 A;  3JSK A;  3CNS A;  1TDN A;  3FBS A;  3PS9 A;  4AOX A;  4B66 A;  4YSH A;  4U8P A;  5BUK A;  2Q6U A;  4JQ9 A;  3K7T A;  4C74 A;  5CKU A;  4O5Q A;  2A8X A;  2R0C A;  3KD9 A;  4WX1 A;  1GT8 A;  5J60 A;  2DKH A;  2WOW A;  3P4R A;  1DJQ A;  4BK2 A;  3CPJ G;  2R4J A;  1Y0P A;  2XFP A;  4Z2U A;  2CUL A;  1BF3 A;  1BZL A;  3AYJ A;  1ZP0 A;  2IVD A;  4CY8 A;  3S5W A;  3UP4 A;  3BNU A;  1DOB A;  1F8R A;  1GTE A;  1KNP A;  1ZOV A;  4H4W A;  1LQU A;  2C3C A;  5J7X A;  2GR0 A;  4MJW A;  3M12 A;  1ZMC A;  2XFN A;  3NG7 X;  1NG3 A;  1FEB A;  2GRT A;  4LU6 A;  1S2Y A;  3KPF A;  4B65 A;  1GAL A;  3SM8 A;  4EQS A;  1E1M A;  4AOS A;  4OPD A;  2YR6 A;  2X8H A;  1FCD A;  5JCK A;  1L9E A;  2C72 A;  4BJZ A;  3QSE A;  4Z24 A;  3NGC X;  2EQ7 A;  3PVC A;  4H50 A;  1YQZ A;  2WQY A;  4LII A;  3I3L A;  1BGJ A;  1D5T A;  1NHP A;  1XDI A;  2WP9 A;  4K8D A;  1PBD A;  5U63 A;  3GSI A;  1Q1R A;  3DME A;  2O9Z A;  1Q1W A;  2QAE A;  3UOY A;  3ICR A;  1ZY8 A;  3ZYX A;  4I58 A;  2F5Z A;  2B9W A;  5L46 A;  2BAB A;  1RP0 A;  1CC4 A;  1YKJ A;  1N4V A;  4U8O A;  3T37 A;  4GUV A;  3AEF A;  1LPF A;  2BS3 A;  3EF6 A;  2BC0 A;  2IVE A;  1E1K A; 
#chains in the Genus database with same CATH topology
 3NIX A;  3UKP A;  5KMR A;  1FEC A;  2VQB A;  4JNQ A;  1VRQ B;  3QFB A;  1DOD A;  2YG6 A;  2YG4 A;  2H89 A;  3NK0 X;  1ZOY A;  2C65 A;  3UTE A;  3DK4 A;  2GR2 A;  1F8W A;  2OAM A;  3LZW A;  4II2 A;  4IA5 A;  2VQ7 A;  2ZZ0 A;  3UOV A;  2BA9 A;  2XVF A;  2Y6R A;  2A89 A;  1ZX9 A;  3CTY A;  1VDC A;  3P4Q A;  1GND A;  1JNZ A;  3BI2 A;  3G5R A;  3ICS A;  3UKK A;  3RHA A;  2JB1 A;  4CY6 A;  1CC6 A;  2BRA A;  5LV9 A;  2A87 A;  3CGB A;  4AP3 A;  4EQR A;  2FJA A;  4J33 A;  3UOX A;  1TDO A;  2RAB A;  3GD3 A;  2WDR A;  4IVO B;  4CCR A;  3VRA A;  1P2H A;  1HYU A;  1MO9 A;  2C64 A;  2R0G A;  2YR5 A;  3CGE A;  4U8K A;  5EB5 A;  2C75 A;  3DJE A;  3ZDN A;  3LB8 A;  3S61 A;  2AQJ A;  4B68 A;  1IUW A;  2I0Z A;  4OCG A;  2TMD A;  2UZZ A;  1PDH A;  1PBB A;  2X99 A;  1B37 A;  1ONF A;  3SFD A;  3AEE A;  3P4S A;  2V61 A;  1GET A;  4EMW A;  2YM1 A;  2WHD A;  3SZW A;  4O5U A;  1PJ6 A;  2OLO A;  2FBW A;  3GRS A;  1JNR A;  4TLZ A;  4JDR A;  2EQ8 A;  3UCL A;  3GYX A;  4NEV A;  2H88 A;  4OPL A;  2AAQ A;  4GAV A;  3M13 A;  4K7Z A;  5IPY A;  2RGO A;  1NPX A;  2GF3 A;  1NHQ A;  3QSS A;  4HB9 A;  3AE3 A;  3DA1 A;  2XLT A;  1GRG A;  1M64 A;  1ZK7 A;  3NN6 X;  4U2L A;  3Q9T A;  3AYI A;  3BHF A;  3SX6 A;  4A7A A;  3KVE A;  2WU2 A;  3AE6 A;  2YLT A;  1VG9 A;  2WPE A;  4AT2 A;  3KPK A;  1F3P A;  1MOK A;  2BK3 A;  2VVL A;  3CPI G;  4H2Q A;  1L0V A;  2E4G A;  4FX9 A;  3NK2 X;  2B9Y A;  3AE5 A;  2XFU A;  2WES A;  1O5W A;  1FEA A;  3NLC A;  3SY4 A;  1EL7 A;  4U8J A;  1Y56 B;  1H7W A;  3K7Q X;  1GPE A;  1XPQ A;  2X50 A;  5U1O A;  1K0I A;  3ITJ A;  3ATR A;  4IVM B;  4OPT A;  2WDV A;  4RG3 A;  1XHC A;  3T2Z A;  2YLZ A;  4GF7 A;  1S2Q A;  4YT0 A;  1X31 B;  3KKJ A;  1Q9I A;  3GD4 A;  4BV6 A;  3EPT A;  2Q0K A;  2JKC A;  3PO7 A;  1CJ4 A;  4UP3 A;  4ZCC A;  1H82 A;  3T14 A;  5KMS A;  2YLW A;  1GER A;  5HHF A;  3UKQ A;  2JAE A;  2WP5 A;  3GMC A;  2CFY A;  2JBV A;  4X9M A;  1YY5 A;  4H4R A;  5FS7 A;  4YTN A;  1IUU A;  2XLP A;  4FK1 C;  2BCP A;  2R0P A;  2XFO A;  2YVG A;  2GQW A;  3CNT A;  4EM3 A;  2BCG G;  1D7Y A;  2R4E A;  2YVF A;  4DSG A;  4BK3 A;  4H4Y A;  3C4N A;  4A79 A;  4B69 A;  3DGH A;  4A65 A;  3AXB A;  4DNA A;  5HY5 A;  3GWD A;  2C70 A;  4II3 A;  3AE2 A;  1NG4 A;  3LXD A;  4B63 A;  4C3Y A;  3NH3 X;  4HA6 A;  4M52 A;  2WET A;  3QSM A;  3HYV A;  4OVI A;  3AEA A;  3AE1 A;  1GXF A;  3SQP A;  3FG2 P;  1PBF A;  2XLU A;  3WE0 A;  2GMH A;  1TDF A;  3DGZ A;  5KMQ A;  2Q7V A;  4H4S A;  2AR8 A;  3P9U A;  1JEH A;  2BK4 A;  2YLS A;  1NAA A;  2Z5Y A;  2NVK X;  4B64 A;  2CVJ A;  4YKF A;  4J36 A;  4YWO A;  4UDR A;  2Y6Q A;  1FOH A;  3IHM A;  3F8D A;  3ISH A;  4XXG A;  1TYT A;  2X3N A;  3RED A;  4U8I A;  1ZKQ A;  4H4X A;  1PN0 A;  3AE9 A;  2RGJ A;  3NN0 X;  5FS8 A;  4ADW A;  4H2P A;  1LTX R;  1DJN A;  2V3A A;  3SZF A;  2EQ9 A;  1QO8 A;  1KF6 A;  2ARD A;  3COX A;  4APN A;  2B76 A;  4GCM A;  4D04 A;  4EM4 A;  2JB3 A;  1GRT A;  3BHK A;  4GAP A;  3GYI A;  3L1R A;  1H84 A;  2B9X A;  1LJ1 A;  2WOI A;  2C67 A;  4E0V A;  1L9D A;  1E39 A;  3DK9 A;  3AD7 B;  4G73 A;  4K22 A;  1F8S A;  3BI4 A;  3H4K A;  3LJP A;  3NK1 X;  2APG A;  2YAU A;  1CC2 A;  2WDQ A;  4XWR A;  1B8S A;  2WEU A;  4NTE A;  1K0J A;  3ICT A;  1D7L A;  3NYC A;  4H2R A;  3KA7 A;  5BRT A;  2XCG A;  1H86 A;  1TDK A;  5EOW A;  5IQ4 A;  3UTH A;  3R9U A;  4RSL A;  2R9Z A;  2XVI A;  4J57 A;  1IUV A;  4NZH A;  1DXL A;  4K5R A;  4TM1 A;  2BAC A;  3T0K A;  4EMJ A;  1KFY A;  4NTC A;  4BJY A;  3CND A;  2BRY A;  1IUS A;  1CF3 A;  3CN8 A;  3LOV A;  4GDE A;  4C3X A;  5BUL A;  3AEB A;  1EL8 A;  2OA1 A;  1NHS A;  1S3B A;  5M0Z A;  4JNA A;  1IUX A;  1VQW A;  4NTD A;  4X9N A;  3GDP A;  4CCQ A;  2GH5 A;  3G5S A;  3DJG X;  2B7S A;  4USQ A;  4FDC B;  4YTM A;  1TDE A;  4G9K A;  4Z43 A;  5KRQ A;  3DH9 A;  4I59 A;  3IHG A;  4GRT A;  3AE8 A;  3NT6 A;  2WS3 A;  1GEU A;  1REO A;  1GRH A;  3ADA B;  5KOX A;  2J3N A;  4H4Q A;  1CHU A;  1N4W A;  1RSG A;  2XVE A;  3GWF A;  2FJD A;  4Y4L A;  4J2W A;  4REK A;  4C77 A;  1JRX A;  1KSU A;  2W0H A;  2QA1 A;  3C4A A;  3B3R A;  2XLR A;  3URH A;  3ABV A;  1D4D A;  3AD8 B;  1B5Q A;  5IQ1 A;  3AWI A;  2B7R A;  4U2T A;  1JU2 A;  3ALL A;  4OPG A;  4NWZ A;  1KNR A;  1COY A;  3SXI A;  3VRB A;  2OLN A;  2GAH B;  4GR1 A;  5CQF A;  3SYI A;  5FMH A;  5KVI A;  5HXI A;  3RNM A;  3UOZ A;  3VR8 A;  4A9W A;  2BXS A;  2CDU A;  1GRB A;  4UDQ A;  3GDN A;  3K7M X;  4RG4 A;  4NNJ A;  1GES A;  1PXB A;  1BGN A;  1D4C A;  1OJA A;  2X8C A;  4A6N A;  1EL9 A;  3O0H A;  3UKF A;  4G6H A;  3FIM B;  1LV0 A;  3FPZ A;  2YQU A;  4H4P A;  3UP5 A;  1MXT A;  2GVC A;  5GSN A;  4LA1 A;  1LQT A;  2IID A;  3IWA A;  4K2X A;  3OZ2 A;  4PAA A;  3RP7 A;  1IJH A;  4YSZ A;  1GRA A;  3II4 A;  2EQ6 A;  1H81 A;  1JRZ A;  2WBA A;  3D8X A;  4D03 A;  5KMP A;  4JY2 A;  2YG5 A;  4YKG A;  2XYO A;  3SZC A;  2R46 A;  4BK1 A;  1L9C A;  3DK8 A;  3AB1 A;  3AEG A;  3SGL A;  3AYL A;  4IV9 A;  3E1T A;  2BC1 A;  1GSN A;  3Q6J A;  2WU5 A;  4EMI A;  3GMB A;  1JRY A;  2VVL G;  5ER0 A;  4UDP A;  5FS6 A;  4BUR A;  1O94 A;  3G5Q A;  4C5O A;  1QLB A;  3AE7 A;  2NPX A;  4OPC A;  4ZCD A;  2R45 A;  1CBO A;  1DOC A;  1NEN A;  2VZ2 A;  1K4Q A;  4H4V A;  1YQ3 A;  1NDA A;  1W4X A;  1Z6L A;  4CRT A;  3H8L A;  1FL2 A;  1EBD A;  1H7X A;  2C73 A;  3P1W A;  4B1B A;  5JCN A;  1BKW A;  2Q0L A;  2C4C A;  4JN9 A;  1B4V A;  3HYW A;  4G74 A;  4YXD A;  2FJE A;  2OAL A;  3BI5 A;  4OPU A;  1OJT A;  4CNK A;  2GMJ A;  2YLR A;  5EB4 A;  3VQR A;  1IUT A;  4Z44 A;  2YVJ A;  4YSX A;  1S3E A;  2XVJ A;  4WCT A;  4Z2T A;  2GEW A;  4A99 A;  3HZL A;  1CL0 A;  4ICY A;  4TM3 A;  4NEW A;  2VVM A;  3ALJ A;  2YM2 A;  1GTH A;  2FJB A;  1NEK A;  2YWL A;  2V6O A;  3GYJ A;  3CGD A;  3GRT A;  5HYM A;  1VG0 A;  1V59 A;  2V60 A;  4EQW A;  2ZBW A;  2WPF A;  4XWZ A;  2XVH A;  4JY3 A;  4U8M A;  4Z25 A;  3IC9 A;  4X4J A;  4IA6 A;  2E5V A;  1DOE A;  3QVP A;  3C96 A;  3KU9 A;  2C7G A;  1E7P A;  3AE4 A;  1SEZ A;  5U25 A;  2BS2 A;  1M6I A;  3LAD A;  4J31 A;  1PBE A;  1XAN A;  4P9S A;  4Y4N A;  3VR9 A;  2XLS A;  4U2S A;  4AT0 A;  4J56 A;  2DKI A;  3UKA A;  3UKL A;  3L8K A;  5BVA A;  5KNL A;  3RP8 A;  3F8P A;  3NRN A;  5DBJ A;  3IF9 A;  2WP6 A;  4H4U A;  4TM0 A;  2BYB A;  1TYP A;  4YTP A;  4Y4M A;  5M10 A;  1GOS A;  2X8G A;  4CNJ A;  1D4E A;  2VRM A;  1EL5 A;  3NYF A;  2JB2 A;  1BWC A;  2YG7 A;  1GRF A;  2C3D A;  1KDG A;  2BK5 A;  2PYX A;  3CNJ A;  3NTA A;  4TLX A;  3V3O A;  4U8N A;  4EIQ A;  1N4U A;  2JK6 A;  4CBQ A;  4K5S A;  1OJD A;  3SFE A;  3UTF A;  4N9X A;  2GR3 A;  2ZZB A;  5GRT A;  3UTG A;  1LVL A;  3CPH G;  2GV8 A;  2ZZC A;  2YR4 A;  1GV4 A;  3P4P A;  1PHH A;  1CJ3 A;  1P2E A;  3EAO A;  5JCM A;  1E6E A;  4EQX A;  3CGC A;  2Z5X A;  1TRB A;  3DJJ A;  5FS9 A;  2C66 A;  2HQM A;  1PJ5 A;  3NTD A;  1PS9 A;  1ZDL A;  3I6D A;  4ECH A;  1CJ2 A;  2YG3 A;  3B6D A;  1AOG A;  4H2N A;  3M0O A;  5KWF A;  3CIR A;  3QFA A;  1O95 A;  1N1P A;  2GQF A;  3AEC A;  5EBK A;  5KXJ A;  4H7U A;  4KX6 A;  4USR A;  3VRD B;  4A5L A;  1ELI A;  2WOV A;  5JCI A;  5TR3 A;  1H83 A;  1PJ7 A;  3QVR A;  2TPR A;  3CNP A;  1QJD A;  4FK1 A;  3OC4 A;  3NHO X;  1KSS A;  1PXA A;  4H4T A;  4J34 A;  3D1C A;  3AD9 B;  2VOU A;  2GAG B;  4U8L A;  2BS4 A;  1K0L A;  3FMW A;  4KPR A;  3NKS A;  2C76 A;  2E1M A;  3UKH A;  1NHR A;  2V5Z A;  1Y56 A;  4ZN0 A;  3NNE A;  4PAB A;  4EIP A;  4Z26 A;  3ALM A;  1JOA A;  5KOW A;  1OJ9 A;  2QCU A;  3DJD A;  1OJC A;  4TM4 A;  5C2T A;  4H4Z A;  3V76 A;  2ACZ A;  5C3J A;  3AED A;  1RYI A;  2XFQ A;  2GB0 A;  2V3B A;  4YSY A;  3F8R A;  5KVH A;  2YLX A;  1CJC A;  2BXR A;  1GRE A;  3BNM A;  3KLJ A;  1F6M A;  1H6V A;  3EAN A;  2RGH A;  4GDP A;  1ZMD A;  3LZX A;  1E1N A;  2GR1 A;  1DNC A;  3RP6 A;  3ATQ A;  1YQ4 A;  2QA2 A;  3K30 A;  2VRL A;  2PHH A;  4AP1 A;  4A6N B;  3H8I A;  2WPC A;  5JCL A;  2XDO A;  1PXC A;  1PBC A;  3V3N A;  3CMM A;  4DSH A;  1UKV G;  1E1L A;  3NYE A;  3T2K A;  4B67 A;  4DGK A;  4Z2R A;  4OPI A;  3QJ4 A;  3JSK A;  3CNS A;  1TDN A;  3FBS A;  3PS9 A;  4AOX A;  4B66 A;  4YSH A;  4U8P A;  3HYX A;  5BUK A;  2Q6U A;  4JQ9 A;  3K7T A;  4C74 A;  5CKU A;  4O5Q A;  2A8X A;  2R0C A;  3KD9 A;  4WX1 A;  1GT8 A;  5J60 A;  2DKH A;  2WOW A;  3P4R A;  4G6G A;  1DJQ A;  4BK2 A;  3CPJ G;  2R4J A;  1Y0P A;  2XFP A;  4Z2U A;  2CUL A;  1BF3 A;  1BZL A;  3AYJ A;  1ZP0 A;  2IVD A;  4CY8 A;  3S5W A;  3UP4 A;  3BNU A;  1DOB A;  1F8R A;  1GTE A;  1KNP A;  1ZOV A;  4H4W A;  3SZ0 A;  1LQU A;  2C3C A;  5J7X A;  2GR0 A;  4MJW A;  3M12 A;  1ZMC A;  2XFN A;  3NG7 X;  1NG3 A;  1FEB A;  2GRT A;  4LU6 A;  1S2Y A;  3KPF A;  4B65 A;  1GAL A;  3SM8 A;  4EQS A;  1E1M A;  4AOS A;  4OPD A;  2YR6 A;  2X8H A;  1FCD A;  5JCK A;  1L9E A;  2C72 A;  4BJZ A;  3QSE A;  4Z24 A;  3NGC X;  2EQ7 A;  3PVC A;  4H50 A;  1YQZ A;  2WQY A;  4LII A;  3I3L A;  1BGJ A;  1D5T A;  1NHP A;  1XDI A;  2WP9 A;  4K8D A;  1PBD A;  5U63 A;  3GSI A;  1Q1R A;  3DME A;  2O9Z A;  1Q1W A;  2QAE A;  3T31 A;  3UOY A;  3ICR A;  1ZY8 A;  3ZYX A;  4I58 A;  2F5Z A;  2B9W A;  5L46 A;  2BAB A;  1RP0 A;  1CC4 A;  1YKJ A;  1N4V A;  4U8O A;  3T37 A;  3T2Y A;  4GUV A;  3AEF A;  1LPF A;  2BS3 A;  3EF6 A;  2BC0 A;  2IVE A;  1E1K A; 
#chains in the Genus database with same CATH homology
 3NIX A;  3UKP A;  5KMR A;  1FEC A;  2VQB A;  4JNQ A;  1VRQ B;  3QFB A;  1DOD A;  2YG6 A;  2YG4 A;  2H89 A;  3NK0 X;  1ZOY A;  2C65 A;  3UTE A;  3DK4 A;  2GR2 A;  1F8W A;  2OAM A;  3LZW A;  4II2 A;  4IA5 A;  2VQ7 A;  2ZZ0 A;  3UOV A;  2BA9 A;  2XVF A;  2Y6R A;  2A89 A;  1ZX9 A;  3CTY A;  1VDC A;  3P4Q A;  1GND A;  1JNZ A;  3BI2 A;  3G5R A;  3ICS A;  3UKK A;  3RHA A;  2JB1 A;  4CY6 A;  1CC6 A;  2BRA A;  5LV9 A;  2A87 A;  3CGB A;  4AP3 A;  4EQR A;  2FJA A;  4J33 A;  3UOX A;  1TDO A;  2RAB A;  3GD3 A;  2WDR A;  4IVO B;  4CCR A;  3VRA A;  1P2H A;  1HYU A;  1MO9 A;  2C64 A;  2R0G A;  2YR5 A;  3CGE A;  4U8K A;  5EB5 A;  2C75 A;  3DJE A;  3ZDN A;  3LB8 A;  3S61 A;  2AQJ A;  4B68 A;  1IUW A;  2I0Z A;  4OCG A;  2TMD A;  2UZZ A;  1PDH A;  1PBB A;  2X99 A;  1B37 A;  1ONF A;  3SFD A;  3AEE A;  3P4S A;  2V61 A;  1GET A;  4EMW A;  2YM1 A;  2WHD A;  3SZW A;  4O5U A;  1PJ6 A;  2OLO A;  2FBW A;  3GRS A;  1JNR A;  4TLZ A;  4JDR A;  2EQ8 A;  3UCL A;  3GYX A;  4NEV A;  2H88 A;  4OPL A;  2AAQ A;  4GAV A;  3M13 A;  4K7Z A;  5IPY A;  2RGO A;  1NPX A;  2GF3 A;  1NHQ A;  3QSS A;  4HB9 A;  3AE3 A;  3DA1 A;  2XLT A;  1GRG A;  1M64 A;  1ZK7 A;  3NN6 X;  4U2L A;  3Q9T A;  3AYI A;  3BHF A;  3SX6 A;  4A7A A;  3KVE A;  2WU2 A;  3AE6 A;  2YLT A;  1VG9 A;  2WPE A;  4AT2 A;  3KPK A;  1F3P A;  1MOK A;  2BK3 A;  2VVL A;  3CPI G;  4H2Q A;  1L0V A;  2E4G A;  4FX9 A;  3NK2 X;  2B9Y A;  3AE5 A;  2XFU A;  2WES A;  1O5W A;  1FEA A;  3NLC A;  3SY4 A;  1EL7 A;  4U8J A;  1Y56 B;  1H7W A;  3K7Q X;  1GPE A;  1XPQ A;  2X50 A;  5U1O A;  1K0I A;  3ITJ A;  3ATR A;  4IVM B;  4OPT A;  2WDV A;  4RG3 A;  1XHC A;  3T2Z A;  2YLZ A;  4GF7 A;  1S2Q A;  4YT0 A;  1X31 B;  3KKJ A;  1Q9I A;  3GD4 A;  4BV6 A;  3EPT A;  2Q0K A;  2JKC A;  3PO7 A;  1CJ4 A;  4UP3 A;  4ZCC A;  1H82 A;  3T14 A;  5KMS A;  2YLW A;  1GER A;  5HHF A;  3UKQ A;  2JAE A;  2WP5 A;  3GMC A;  2CFY A;  2JBV A;  4X9M A;  1YY5 A;  4H4R A;  5FS7 A;  4YTN A;  1IUU A;  2XLP A;  4FK1 C;  2BCP A;  2R0P A;  2XFO A;  2YVG A;  2GQW A;  3CNT A;  4EM3 A;  2BCG G;  1D7Y A;  2R4E A;  2YVF A;  4DSG A;  4BK3 A;  4H4Y A;  3C4N A;  4A79 A;  4B69 A;  3DGH A;  4A65 A;  3AXB A;  4DNA A;  5HY5 A;  3GWD A;  2C70 A;  4II3 A;  3AE2 A;  1NG4 A;  3LXD A;  4B63 A;  4C3Y A;  3NH3 X;  4HA6 A;  4M52 A;  2WET A;  3QSM A;  3HYV A;  4OVI A;  3AEA A;  3AE1 A;  1GXF A;  3SQP A;  3FG2 P;  1PBF A;  2XLU A;  3WE0 A;  2GMH A;  1TDF A;  3DGZ A;  5KMQ A;  2Q7V A;  4H4S A;  2AR8 A;  3P9U A;  1JEH A;  2BK4 A;  2YLS A;  1NAA A;  2Z5Y A;  2NVK X;  4B64 A;  2CVJ A;  4YKF A;  4J36 A;  4YWO A;  4UDR A;  2Y6Q A;  1FOH A;  3IHM A;  3F8D A;  3ISH A;  4XXG A;  1TYT A;  2X3N A;  3RED A;  4U8I A;  1ZKQ A;  4H4X A;  1PN0 A;  3AE9 A;  2RGJ A;  3NN0 X;  5FS8 A;  4ADW A;  4H2P A;  1LTX R;  1DJN A;  2V3A A;  3SZF A;  2EQ9 A;  1QO8 A;  1KF6 A;  2ARD A;  3COX A;  4APN A;  2B76 A;  4GCM A;  4D04 A;  4EM4 A;  2JB3 A;  1GRT A;  3BHK A;  4GAP A;  3GYI A;  3L1R A;  1H84 A;  2B9X A;  1LJ1 A;  2WOI A;  2C67 A;  4E0V A;  1L9D A;  1E39 A;  3DK9 A;  3AD7 B;  4G73 A;  4K22 A;  1F8S A;  3BI4 A;  3H4K A;  3LJP A;  3NK1 X;  2APG A;  2YAU A;  1CC2 A;  2WDQ A;  4XWR A;  1B8S A;  2WEU A;  4NTE A;  1K0J A;  3ICT A;  1D7L A;  3NYC A;  4H2R A;  3KA7 A;  5BRT A;  2XCG A;  1H86 A;  1TDK A;  5EOW A;  5IQ4 A;  3UTH A;  3R9U A;  4RSL A;  2R9Z A;  2XVI A;  4J57 A;  1IUV A;  4NZH A;  1DXL A;  4K5R A;  4TM1 A;  2BAC A;  3T0K A;  4EMJ A;  1KFY A;  4NTC A;  4BJY A;  3CND A;  2BRY A;  1IUS A;  1CF3 A;  3CN8 A;  3LOV A;  4GDE A;  4C3X A;  5BUL A;  3AEB A;  1EL8 A;  2OA1 A;  1NHS A;  1S3B A;  5M0Z A;  4JNA A;  1IUX A;  1VQW A;  4NTD A;  4X9N A;  3GDP A;  4CCQ A;  2GH5 A;  3G5S A;  3DJG X;  2B7S A;  4USQ A;  4FDC B;  4YTM A;  1TDE A;  4G9K A;  4Z43 A;  5KRQ A;  3DH9 A;  4I59 A;  3IHG A;  4GRT A;  3AE8 A;  3NT6 A;  2WS3 A;  1GEU A;  1REO A;  1GRH A;  3ADA B;  5KOX A;  2J3N A;  4H4Q A;  1CHU A;  1N4W A;  1RSG A;  2XVE A;  3GWF A;  2FJD A;  4Y4L A;  4J2W A;  4REK A;  4C77 A;  1JRX A;  1KSU A;  2W0H A;  2QA1 A;  3C4A A;  3B3R A;  2XLR A;  3URH A;  3ABV A;  1D4D A;  3AD8 B;  1B5Q A;  5IQ1 A;  3AWI A;  2B7R A;  4U2T A;  1JU2 A;  3ALL A;  4OPG A;  4NWZ A;  1KNR A;  1COY A;  3SXI A;  3VRB A;  2OLN A;  2GAH B;  4GR1 A;  5CQF A;  3SYI A;  5FMH A;  5KVI A;  5HXI A;  3RNM A;  3UOZ A;  3VR8 A;  4A9W A;  2BXS A;  2CDU A;  1GRB A;  4UDQ A;  3GDN A;  3K7M X;  4RG4 A;  4NNJ A;  1GES A;  1PXB A;  1BGN A;  1D4C A;  1OJA A;  2X8C A;  4A6N A;  1EL9 A;  3O0H A;  3UKF A;  4G6H A;  3FIM B;  1LV0 A;  3FPZ A;  2YQU A;  4H4P A;  3UP5 A;  1MXT A;  2GVC A;  5GSN A;  4LA1 A;  1LQT A;  2IID A;  3IWA A;  4K2X A;  3OZ2 A;  4PAA A;  3RP7 A;  1IJH A;  4YSZ A;  1GRA A;  3II4 A;  2EQ6 A;  1H81 A;  1JRZ A;  2WBA A;  3D8X A;  4D03 A;  5KMP A;  4JY2 A;  2YG5 A;  4YKG A;  2XYO A;  3SZC A;  2R46 A;  4BK1 A;  1L9C A;  3DK8 A;  3AB1 A;  3AEG A;  3SGL A;  3AYL A;  4IV9 A;  3E1T A;  2BC1 A;  1GSN A;  3Q6J A;  2WU5 A;  4EMI A;  3GMB A;  1JRY A;  2VVL G;  5ER0 A;  4UDP A;  5FS6 A;  4BUR A;  1O94 A;  3G5Q A;  4C5O A;  1QLB A;  3AE7 A;  2NPX A;  4OPC A;  4ZCD A;  2R45 A;  1CBO A;  1DOC A;  1NEN A;  2VZ2 A;  1K4Q A;  4H4V A;  1YQ3 A;  1NDA A;  1W4X A;  1Z6L A;  4CRT A;  3H8L A;  1FL2 A;  1EBD A;  1H7X A;  2C73 A;  3P1W A;  4B1B A;  5JCN A;  1BKW A;  2Q0L A;  2C4C A;  4JN9 A;  1B4V A;  3HYW A;  4G74 A;  4YXD A;  2FJE A;  2OAL A;  3BI5 A;  4OPU A;  1OJT A;  4CNK A;  2GMJ A;  2YLR A;  5EB4 A;  3VQR A;  1IUT A;  4Z44 A;  2YVJ A;  4YSX A;  1S3E A;  2XVJ A;  4WCT A;  4Z2T A;  2GEW A;  4A99 A;  3HZL A;  1CL0 A;  4ICY A;  4TM3 A;  4NEW A;  2VVM A;  3ALJ A;  2YM2 A;  1GTH A;  2FJB A;  1NEK A;  2YWL A;  2V6O A;  3GYJ A;  3CGD A;  3GRT A;  5HYM A;  1VG0 A;  1V59 A;  2V60 A;  4EQW A;  2ZBW A;  2WPF A;  4XWZ A;  2XVH A;  4JY3 A;  4U8M A;  4Z25 A;  3IC9 A;  4X4J A;  4IA6 A;  2E5V A;  1DOE A;  3QVP A;  3C96 A;  3KU9 A;  2C7G A;  1E7P A;  3AE4 A;  1SEZ A;  5U25 A;  2BS2 A;  1M6I A;  3LAD A;  4J31 A;  1PBE A;  1XAN A;  4P9S A;  4Y4N A;  3VR9 A;  2XLS A;  4U2S A;  4AT0 A;  4J56 A;  2DKI A;  3UKA A;  3UKL A;  3L8K A;  5BVA A;  5KNL A;  3RP8 A;  3F8P A;  3NRN A;  5DBJ A;  3IF9 A;  2WP6 A;  4H4U A;  4TM0 A;  2BYB A;  1TYP A;  4YTP A;  4Y4M A;  5M10 A;  1GOS A;  2X8G A;  4CNJ A;  1D4E A;  2VRM A;  1EL5 A;  3NYF A;  2JB2 A;  1BWC A;  2YG7 A;  1GRF A;  2C3D A;  1KDG A;  2BK5 A;  2PYX A;  3CNJ A;  3NTA A;  4TLX A;  3V3O A;  4U8N A;  4EIQ A;  1N4U A;  2JK6 A;  4CBQ A;  4K5S A;  1OJD A;  3SFE A;  3UTF A;  4N9X A;  2GR3 A;  2ZZB A;  5GRT A;  3UTG A;  1LVL A;  3CPH G;  2GV8 A;  2ZZC A;  2YR4 A;  1GV4 A;  3P4P A;  1PHH A;  1CJ3 A;  1P2E A;  3EAO A;  5JCM A;  1E6E A;  4EQX A;  3CGC A;  2Z5X A;  1TRB A;  3DJJ A;  5FS9 A;  2C66 A;  2HQM A;  1PJ5 A;  3NTD A;  1PS9 A;  1ZDL A;  3I6D A;  4ECH A;  1CJ2 A;  2YG3 A;  3B6D A;  1AOG A;  4H2N A;  3M0O A;  5KWF A;  3CIR A;  3QFA A;  1O95 A;  1N1P A;  2GQF A;  3AEC A;  5EBK A;  5KXJ A;  4H7U A;  4KX6 A;  4USR A;  3VRD B;  4A5L A;  1ELI A;  2WOV A;  5JCI A;  5TR3 A;  1H83 A;  1PJ7 A;  3QVR A;  2TPR A;  3CNP A;  1QJD A;  4FK1 A;  3OC4 A;  3NHO X;  1KSS A;  1PXA A;  4H4T A;  4J34 A;  3D1C A;  3AD9 B;  2VOU A;  2GAG B;  4U8L A;  2BS4 A;  1K0L A;  3FMW A;  4KPR A;  3NKS A;  2C76 A;  2E1M A;  3UKH A;  1NHR A;  2V5Z A;  1Y56 A;  4ZN0 A;  3NNE A;  4PAB A;  4EIP A;  4Z26 A;  3ALM A;  1JOA A;  5KOW A;  1OJ9 A;  2QCU A;  3DJD A;  1OJC A;  4TM4 A;  5C2T A;  4H4Z A;  3V76 A;  2ACZ A;  5C3J A;  3AED A;  1RYI A;  2XFQ A;  2GB0 A;  2V3B A;  4YSY A;  3F8R A;  5KVH A;  2YLX A;  1CJC A;  2BXR A;  1GRE A;  3BNM A;  3KLJ A;  1F6M A;  1H6V A;  3EAN A;  2RGH A;  4GDP A;  1ZMD A;  3LZX A;  1E1N A;  2GR1 A;  1DNC A;  3RP6 A;  3ATQ A;  1YQ4 A;  2QA2 A;  3K30 A;  2VRL A;  2PHH A;  4AP1 A;  4A6N B;  3H8I A;  2WPC A;  5JCL A;  2XDO A;  1PXC A;  1PBC A;  3V3N A;  3CMM A;  4DSH A;  1UKV G;  1E1L A;  3NYE A;  3T2K A;  4B67 A;  4DGK A;  4Z2R A;  4OPI A;  3QJ4 A;  3JSK A;  3CNS A;  1TDN A;  3FBS A;  3PS9 A;  4AOX A;  4B66 A;  4YSH A;  4U8P A;  3HYX A;  5BUK A;  2Q6U A;  4JQ9 A;  3K7T A;  4C74 A;  5CKU A;  4O5Q A;  2A8X A;  2R0C A;  3KD9 A;  4WX1 A;  1GT8 A;  5J60 A;  2DKH A;  2WOW A;  3P4R A;  4G6G A;  1DJQ A;  4BK2 A;  3CPJ G;  2R4J A;  1Y0P A;  2XFP A;  4Z2U A;  2CUL A;  1BF3 A;  1BZL A;  3AYJ A;  1ZP0 A;  2IVD A;  4CY8 A;  3S5W A;  3UP4 A;  3BNU A;  1DOB A;  1F8R A;  1GTE A;  1KNP A;  1ZOV A;  4H4W A;  3SZ0 A;  1LQU A;  2C3C A;  5J7X A;  2GR0 A;  4MJW A;  3M12 A;  1ZMC A;  2XFN A;  3NG7 X;  1NG3 A;  1FEB A;  2GRT A;  4LU6 A;  1S2Y A;  3KPF A;  4B65 A;  1GAL A;  3SM8 A;  4EQS A;  1E1M A;  4AOS A;  4OPD A;  2YR6 A;  2X8H A;  1FCD A;  5JCK A;  1L9E A;  2C72 A;  4BJZ A;  3QSE A;  4Z24 A;  3NGC X;  2EQ7 A;  3PVC A;  4H50 A;  1YQZ A;  2WQY A;  4LII A;  3I3L A;  1BGJ A;  1D5T A;  1NHP A;  1XDI A;  2WP9 A;  4K8D A;  1PBD A;  5U63 A;  3GSI A;  1Q1R A;  3DME A;  2O9Z A;  1Q1W A;  2QAE A;  3T31 A;  3UOY A;  3ICR A;  1ZY8 A;  3ZYX A;  4I58 A;  2F5Z A;  2B9W A;  5L46 A;  2BAB A;  1RP0 A;  1CC4 A;  1YKJ A;  1N4V A;  4U8O A;  3T37 A;  3T2Y A;  4GUV A;  3AEF A;  1LPF A;  2BS3 A;  3EF6 A;  2BC0 A;  2IVE A;  1E1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...