3I6DA

Crystal structure of ppo from bacillus subtilis with af
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
466
structure length
414
Chain Sequence
KKHVVIIGGGITGLAAAFYMEKEIKEKNLPLELTLVEASPRVGGKIQTVKKDGYIIERGPDSFLERKKSAPQLVKDLGLEHLLVNNATGQSYVLVNRTLHPMPKSGKARAAMDFILPASKTKDDQSLGEFFRRRVGDEVVENLIEPLLSGIYAGDIDKLSLMSTFPQFYQFQTLSTGLQTLVEEIEKQLKLTKVYKGTKVTKLSHSGSCYSLELDNGVTLDADSVIVTAPHKAAAGMLSELPAISHLKNMHSTSVANVALGFPEGSVQMEHEGTGFVISRNSDFAITACTWTNKKWPHAAPEGKTLLRAYVGKAGDESIVDLSDNDIINIVLEDLKKVMNINGEPEMTCVTRWHESMPQYHVGHKQRIKELREALASAYPGVYMTGASFEGVGIPDCIDQGKAAVSDALTYLFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into unique properties of protoporphyrinogen oxidase from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
molecule keywords Protoporphyrinogen oxidase
total genus 118
structure length 414
sequence length 466
chains with identical sequence B
ec nomenclature ec 1.3.3.4: Protoporphyrinogen oxidase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3110.20 Mainly Alpha Orthogonal Bundle protoporphyrinogen ix oxidase, domain 3 protoporphyrinogen ix oxidase, domain 3 3i6dA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3i6dA01
3.90.660.20 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Protoporphyrinogen oxidase, mitochondrial; domain 2 3i6dA02
3QSMA 4C3XA 3NRNA 4H2NA 2BK4A 2B7SA 1XDIA 1NDAA 5GRTA 4UP3A 1E6EA 2C72A 1NHSA 2XLSA 3DJJA 3EF6A 4H4VA 3CGDA 3NG7X 1YQZA 2C76A 2EQ9A 3CGCA 1DJQA 4A9WA 2WU5A 4Z26A 1LVLA 2C3DA 2OLOA 3HZLA 1ZDLA 1H81A 1K4QA 1B8SA 1CL0A 4BK2A 1JOAA 3GMBA 1S3EA 5U1OA 4FK1A 2JAEA 1D4EA 1LPFA 3ITJA 4REKA 2X8HA 3AEBA 3CGEA 3NNEA 2BK3A 1B4VA 2WESA 1D4DA 2OA1A 3CNJA 5EOWA 2XVHA 3IF9A 4A65A 4NTDA 1DXLA 4CY8A 3AE2A 1TYPA 3CNSA 3P1WA 2AR8A 2IVDA 1TDFA 2E4GA 2VVLA 2XYOA 1TDOA 3AWIA 4CBQA 2I0ZA 4O5UA 2BXSA 2WQYA 4Z2TA 4YWOA 4YTNA 1F3PA 4ZN0A 5KXJA 2ARDA 1ELIA 1BGJA 1VQWA 1Y56A 3D8XA 3AEFA 3NYCA 4BV6A 1Z6LA 3IC9A 3GYIA 1JNRA 1GV4A 4YSHA 5J7XA 3O0HA 1Q1RA 5EB4A 2EQ8A 2A89A 1F8RA 2CULA 4YKGA 1IUXA 3FIMB 4J2WA 3ABVA 4Z24A 3NKSA 1PXAA 3KD9A 4TLXA 3AD7B 3P4PA 1LTXR 3GDPA 4J57A 3SQPA 4EQRA 3DGHA 1NHPA 5GSNA 4M52A 1E1NA 3QSEA 1GRBA 1VDCA 1N4VA 4EMWA 5HYMA 3K7MX 2EQ6A 1GPEA 4USQA 5FS7A 2B9WA 4OPLA 3AXBA 3UKFA 1PBEA 3NN6X 3UTGA 2GQWA 4CNKA 1TRBA 4HA6A 2AQJA 1XHCA 4CCRA 1VG9A 1VRQB 1GRHA 5EBKA 1XANA 2YG3A 2FJAA 3DK4A 5KOXA 2GMJA 2JB3A 3CPIG 3FBSA 2V5ZA 2DKIA 3L8KA 3G5QA 3FPZA 4K8DA 3UOVA 3DGZA 4OPGA 1GEUA 3NTDA 2XLPA 1JRXA 3GDNA 1JRYA 1DJNA 1F6MA 3GD4A 5ER0A 1KSUA 1S2YA 2BS2A 4X9NA 3C4NA 3SGLA 1V59A 3AECA 4U8LA 2RGOA 1OJTA 3AE4A 4GUVA 3UKKA 2XVEA 3UOXA 3AD8B 3NK2X 4JNQA 3UTHA 2BC0A 4B66A 4H4XA 2WEUA 3JSKA 4JY3A 4Z44A 3H4KA 3ISHA 4B63A 2BS4A 2WOWA 1LJ1A 3L1RA 4U8IA 4P9SA 1GREA 4A5LA 3LOVA 2FBWA 2YWLA 2GH5A 2BACA 4B64A 1QLBA 2BCPA 5HXIA 1Y56B 1BF3A 4FDCB 1IUWA 4RSLA 4YTPA 2QCUA 1GETA 1H84A 3CIRA 3ALJA 1OJ9A 3EAOA 3EPTA 4K5SA 2UZZA 3BI2A 3GWDA 2CFYA 2VQBA 4K22A 4UDRA 3UKPA 2PHHA 1BKWA 5IQ1A 1YKJA 2R0CA 4IVMB 2GR1A 2GMHA 2VRLA 3H8IA 3K7TA 3VQRA 4YTMA 5U25A 1PS9A 2YLSA 3LB8A 3GYJA 4RG3A 1NHQA 3DJGX 1TDEA 5C3JA 4ADWA 1PJ7A 4ZCDA 5C2TA 1BZLA 3CNPA 2WDQA 2WPFA 1EL5A 1M6IA 1B5QA 2VVMA 3QJ4A 5FS9A 3DJEA 4H2RA 4H4UA 1GSNA 4H4ZA 4Z2UA 4CY6A 3EANA 2ZZBA 4EIQA 5KVIA 1CJ2A 1O95A 1EBDA 3T37A 3AE6A 2C7GA 4UDPA 1LV0A 3NIXA 4GDEA 2RGHA 2E5VA 3NYFA 4IV9A 2GV8A 1LQTA 1ZP0A 1E1MA 3AEAA 4XWZA 4H7UA 3AYLA 2WHDA 4NEVA 3F8DA 2GR3A 1Y0PA 3UP5A 3PVCA 3VR8A 2XVFA 3P9UA 2BCGG 3NGCX 2BA9A 4H2QA 1GRFA 1E1KA 1NEKA 2PYXA 1COYA 5IQ4A 3S5WA 4J31A 4JN9A 1O5WA 1F8WA 3UCLA 2V3BA 5KOWA 1K0JA 1N4WA 1Q9IA 1NENA 1JU2A 2RGJA 4XXGA 4TM3A 3NN0X 5JCKA 3KU9A 3D1CA 1BWCA 2BS3A 1GOSA 2QA2A 1PBDA 3AE7A 2WS3A 3AEDA 1OJCA 3IWAA 4EQSA 2JB2A 2Q6UA 4I59A 4UDQA 2JK6A 1BGNA 1KF6A 3OC4A 4K2XA 3AE9A 4YSYA 4U8OA 2XLUA 3CN8A 2GEWA 3OZ2A 4AT0A 1IUTA 2R9ZA 3R9UA 1CC6A 4LIIA 4J34A 4KX6A 1IUSA 2NPXA 5HY5A 5LV9A 4H2PA 4ECHA 2AAQA 4GCMA 4BK1A 1AOGA 4AOSA 3CPHG 4NTEA 4U8KA 2XFUA 1RSGA 2YG5A 4U8NA 4EIPA 3C4AA 3I3LA 3PS9A 1QO8A 2X99A 2IIDA 4AP3A 3F8PA 1OJAA 2GR2A 2H89A 3GRSA 4U2SA 1ONFA 4YKFA 3NK0X 3G5RA 1D5TA 4YSZA 1ZY8A 5BVAA 2VVLG 2WU2A 2WOIA 5KVHA 1ZOVA 4OCGA 4XWRA 1KSSA 1CC2A 1PJ6A 3VR9A 3LJPA 2BYBA 4OPUA 2YG4A 3FMWA 2X8GA 3AE3A 3DA1A 4B1BA 5BUKA 4YXDA 1DOBA 1D7LA 2B9YA 3CNDA 3KKJA 2WPCA 3DK9A 2C66A 3AD9B 2R4EA 4MJWA 4BURA 3CNTA 4CNJA 3GMCA 4JDRA 4EM4A 1EL8A 4H50A 2WP6A 4TM4A 5M10A 1ZKQA 1CC4A 3CTYA 1JRZA 3BI5A 5BRTA 4U8MA 2OAMA 2TMDA 3AEEA 1IJHA 1ZOYA 2B76A 5DBJA 2X50A 2C67A 3NHOX 1GRTA 4RG4A 3P4RA 4X4JA 3NT6A 4PABA 4WCTA 1GRGA 2EQ7A 4EM3A 3QVRA 1H6VA 4Z2RA 3ZDNA 1CHUA 2RABA 4AP1A 4KPRA 3V3OA 5FMHA 4DGKA 2Y6QA 2V60A 4H4QA 1NHRA 3URHA 1W4XA 1FEBA 3QSSA 1PN0A 2XVIA 5JCLA 2QA1A 4TM0A 1PXCA 3CPJG 2JBVA 2GVCA 3ALMA 4D03A 4H4YA 3NTAA 4USRA 1YQ4A 3E1TA 3LADA 4NZHA 1CF3A 1NG3A 1TDKA 3H8LA 3ATQA 3GD3A 2YVJA 2XFQA 2CVJA 2YR4A 4DNAA 2GQFA 1PXBA 2YAUA 1E1LA 1GNDA 2BC1A 1DOCA 2WOVA 2YG7A 2C73A 5EB5A 2BABA 2A87A 2YQUA 1E39A 2XFOA 3II4A 5FS8A 5U63A 4C3YA 4U8JA 5CQFA 1FL2A 3UTEA 3AB1A 3RNMA 2OLNA 3BNMA 3NK1X 1H83A 1L9DA 2YR6A 1CJCA 2W0HA 4GRTA 4A6NA 2WPEA 4BK3A 1B37A 4NTCA 5JCMA 1O94A 3M12A 1KNPA 4JQ9A 2H88A 1H82A 3Q9TA 1D4CA 3M0OA 1OJDA 3KLJA 2V6OA 1TDNA 1K0LA 2YM2A 5JCNA 4Y4LA 1P2EA 2GB0A 4HB9A 4IVOB 3UOZA 1GERA 2GRTA 3RP7A 2TPRA 1PBCA 4Z43A 1PBFA 4LU6A 4OPDA 4B69A 1PHHA 2VRMA 5J60A 2HQMA 2JB1A 4OPCA 4N9XA 4X9MA 3SFDA 4OPTA 2YLXA 2Q0LA 3QFAA 3DH9A 4FK1C 2XLRA 2R45A 4H4TA 3KA7A 3VRAA 3NLCA 3UKAA 3UOYA 4CRTA 3GRTA 1CJ3A 3DMEA 1NG4A 3DJDA 2WBAA 1CJ4A 1GALA 1VG0A 2Z5XA 4B65A 2GF3A 4J56A 1DODA 1L9EA 1X31B 1PJ5A 4GR1A 4B67A 2R4JA 3RHAA 1KDGA 1UKVG 2WDRA 3V3NA 4FX9A 5FS6A 2C75A 4IA5A 3I6DA 2YVFA 3Q6JA 2VOUA 2WETA 1H7XA 3GSIA 2Q7VA 4AOXA 1PDHA 4IA6A 1N4UA 3C96A 2FJDA 3NYEA 1HYUA 4H4RA 4E0VA 4EMIA 2E1MA 1ZMCA 4PAAA 2ZZCA 2Q0KA 1ZMDA 4B68A 3DK8A 3VRBA 3BNUA 4LA1A 3UKQA 1NPXA 1H7WA 1RP0A 2B7RA 1MO9A 4DSHA 1GTEA 4TM1A 1REOA 4ZCCA 2XCGA 3S61A 1Q1WA 1RYIA 5M0ZA 2XLTA 4A7AA 4TLZA 2YLRA 4U2TA 1L0VA 4K5RA 1H86A 4J33A 4ICYA 3BI4A 2Y6RA 2OALA 3VRDB 3K7QX 2C65A 2YLTA 1QJDA 2ACZA 1L9CA 1GTHA 2XFNA 1IUVA 3LZXA 3NH3X 2WDVA 3BHFA 4H4PA 4C77A 4NEWA 4YSXA 4OVIA 3LZWA 1F8SA 1GT8A 3CGBA 3AEGA 3GWFA 3KVEA 4EMJA 2B9XA 1IUUA 1FCDA 1FECA 3AE5A 3UP4A 1MXTA 3AE1A 3UKHA 2YVGA 2YR5A 2BXRA 1P2HA 2FJEA 3ICTA 1PBBA 3ATRA 4DSGA 2NVKX 2CDUA 4CCQA 2VZ2A 1S3BA 4U8PA 3UTFA 1NAAA 2R0GA 2Z5YA 3IHMA 3PO7A 2GAGB 4YT0A 4BJZA 4GF7A 4Z25A 5TR3A 1ZK7A 2JKCA 3M13A 4H4WA 4D04A 4EQXA 2IVEA 3K30A 5CKUA 1DNCA 3QVPA 1LQUA 1TYTA 3ALLA 4Y4MA 1YQ3A 3COXA 1KNRA 3KPFA 1E7PA 4WX1A 2XFPA 2GR0A 1D7YA 1EL9A 2WP9A 1GXFA 2A8XA 4J36A 4OPIA 1YY5A 3FG2P 4U2LA 3REDA 3ICSA 4JNAA 4BJYA 4K7ZA 5HHFA 2GAHB 3RP6A 4A99A 2VQ7A 3F8RA 5KRQA 4EQWA 1S2QA 3ADAB 4O5QA 3QFBA 3SM8A 4A79A 3LXDA 5IPYA 2C3CA 2QAEA 4H4SA 1SEZA 2O9ZA 1FOHA 2C70A 3V76A 3AYJA 4GDPA 3UKLA 2YM1A 1ZX9A 2YLZA 2XDOA 3AYIA 3ICRA 2YLWA 3P4QA 2WP5A 3WE0A 1DOEA 5KWFA 3G5SA 4C5OA 2ZZ0A 3AE8A 4A6NB 2ZBWA 1JEHA 3P4SA 1EL7A 1KFYA 2X3NA 2BK5A 2J3NA 3IHGA 4JY2A 3RP8A 3ZYXA 5JCIA 1K0IA 1GESA 2DKHA 3BHKA 1N1PA 1JNZA 1GRAA 2F5ZA 2C64A 2V3AA 4APNA 1XPQA 2R0PA 1FEAA 5L46A 2APGA 1CBOA 2X8CA 2V61A 1MOKA 2R46A 2FJBA 2YG6A 3B3RA 4Y4NA 4I58A 4AT2A 3SFEA 5BULA 1M64A 2XVJA 4C74A 3B6DA
chains in the Genus database with same CATH superfamily
3QSMA 4C3XA 3SZWA 3NRNA 4H2NA 2BK4A 2B7SA 1XDIA 1NDAA 5GRTA 4UP3A 1E6EA 3SY4A 2C72A 1NHSA 2XLSA 3DJJA 3EF6A 4H4VA 3CGDA 3NG7X 1YQZA 2C76A 2EQ9A 3CGCA 1DJQA 3HYVA 4A9WA 2WU5A 4Z26A 1LVLA 2C3DA 2OLOA 3HZLA 1ZDLA 1H81A 1K4QA 1B8SA 1CL0A 4BK2A 1JOAA 3GMBA 1S3EA 5U1OA 4FK1A 2JAEA 1D4EA 1LPFA 3ITJA 4REKA 2X8HA 3AEBA 3CGEA 3NNEA 2BK3A 1B4VA 2WESA 1D4DA 2OA1A 3CNJA 5EOWA 2XVHA 3IF9A 4GAVA 4NTDA 1DXLA 4A65A 3AE2A 4CY8A 1TYPA 3CNSA 3P1WA 2AR8A 2IVDA 1TDFA 2E4GA 2VVLA 2XYOA 1TDOA 3AWIA 4CBQA 2I0ZA 4O5UA 2BXSA 2WQYA 4Z2TA 4YWOA 4YTNA 1F3PA 4ZN0A 5KXJA 2ARDA 1ELIA 1BGJA 1VQWA 1Y56A 3D8XA 3AEFA 3NYCA 4BV6A 1Z6LA 3IC9A 3GYIA 1JNRA 1GV4A 4YSHA 5J7XA 3O0HA 1Q1RA 5EB4A 2EQ8A 2A89A 3T31A 5KMRA 1F8RA 2CULA 5KMQA 4YKGA 1IUXA 3FIMB 4J2WA 3ABVA 4Z24A 3NKSA 1PXAA 3KD9A 4TLXA 3AD7B 3P4PA 1LTXR 3GDPA 4J57A 3SQPA 4EQRA 3DGHA 1NHPA 5GSNA 4M52A 1E1NA 3QSEA 1GRBA 1VDCA 1N4VA 4EMWA 5HYMA 3K7MX 2EQ6A 1GPEA 4USQA 5FS7A 2B9WA 4OPLA 3AXBA 3UKFA 1PBEA 3NN6X 3UTGA 2GQWA 4CNKA 1TRBA 4HA6A 2AQJA 1XHCA 4CCRA 1VG9A 4G74A 1VRQB 1GRHA 5EBKA 1XANA 2YG3A 2FJAA 3DK4A 5KOXA 2GMJA 2JB3A 3CPIG 3FBSA 2V5ZA 2DKIA 3L8KA 3G5QA 3FPZA 4K8DA 3UOVA 3DGZA 4OPGA 1GEUA 3T2ZA 3NTDA 2XLPA 1JRXA 3GDNA 1JRYA 1DJNA 1F6MA 3GD4A 5ER0A 1KSUA 1S2YA 2BS2A 4X9NA 3C4NA 3SGLA 1V59A 3AECA 4U8LA 2RGOA 1OJTA 3AE4A 4GUVA 3UKKA 2XVEA 3UOXA 3AD8B 3NK2X 4JNQA 3UTHA 2BC0A 4B66A 4H4XA 2WEUA 3JSKA 4JY3A 4Z44A 3H4KA 3ISHA 4B63A 2BS4A 2WOWA 1LJ1A 3L1RA 4U8IA 4P9SA 1GREA 4A5LA 3LOVA 2FBWA 2YWLA 2GH5A 2BACA 4B64A 1QLBA 2BCPA 4II2A 5HXIA 1Y56B 1BF3A 4FDCB 1IUWA 4RSLA 4YTPA 2QCUA 1GETA 1H84A 3CIRA 3ALJA 1OJ9A 3EAOA 3EPTA 4K5SA 2UZZA 3BI2A 3GWDA 2CFYA 2VQBA 4K22A 4UDRA 3UKPA 2PHHA 1BKWA 5IQ1A 1YKJA 2R0CA 4IVMB 2GR1A 2GMHA 2VRLA 3H8IA 3K7TA 3VQRA 5KMPA 4YTMA 5U25A 1PS9A 2YLSA 3T2KA 3LB8A 3GYJA 4RG3A 1NHQA 3DJGX 1TDEA 5C3JA 4ADWA 1PJ7A 4ZCDA 5C2TA 1BZLA 3CNPA 2WDQA 2WPFA 1EL5A 1M6IA 5KNLA 1B5QA 2VVMA 3QJ4A 5FS9A 3DJEA 4H2RA 4H4UA 1GSNA 4H4ZA 4Z2UA 4CY6A 3KPKA 3EANA 2ZZBA 4G9KA 4EIQA 5KVIA 1CJ2A 1O95A 1EBDA 3T37A 3AE6A 2C7GA 4UDPA 1LV0A 3NIXA 4GDEA 2RGHA 2E5VA 3NYFA 4IV9A 5KMSA 2GV8A 1LQTA 1ZP0A 1E1MA 3AEAA 4XWZA 4H7UA 3AYLA 2WHDA 4NEVA 3F8DA 2GR3A 1Y0PA 3UP5A 3PVCA 3VR8A 2XVFA 3P9UA 2BCGG 3NGCX 2BA9A 4H2QA 1GRFA 1E1KA 1NEKA 2PYXA 1COYA 5IQ4A 3S5WA 2C4CA 4J31A 4JN9A 1O5WA 1F8WA 3UCLA 2V3BA 5KOWA 1K0JA 1N4WA 3GYXA 1Q9IA 1NENA 1JU2A 2RGJA 4XXGA 4TM3A 3NN0X 5JCKA 3KU9A 3D1CA 1BWCA 2BS3A 1GOSA 2QA2A 1PBDA 3AE7A 2WS3A 3AEDA 1OJCA 3IWAA 4EQSA 2JB2A 2Q6UA 3SZ0A 4I59A 4UDQA 2JK6A 1BGNA 1KF6A 4G73A 3OC4A 4K2XA 3AE9A 4YSYA 4U8OA 2XLUA 3CN8A 2GEWA 3OZ2A 4AT0A 1IUTA 2R9ZA 3R9UA 1CC6A 4LIIA 4J34A 4KX6A 1IUSA 2NPXA 5HY5A 5LV9A 4H2PA 4ECHA 2AAQA 4GCMA 3SXIA 4BK1A 1AOGA 4AOSA 3CPHG 4NTEA 4U8KA 2XFUA 1RSGA 2YG5A 4U8NA 4EIPA 3C4AA 3I3LA 3PS9A 1QO8A 2X99A 2IIDA 4AP3A 3F8PA 1OJAA 2GR2A 2H89A 3GRSA 4U2SA 1ONFA 4YKFA 3NK0X 3G5RA 1D5TA 4YSZA 1ZY8A 5BVAA 2VVLG 2WU2A 2WOIA 5KVHA 1ZOVA 4OCGA 4XWRA 1KSSA 1CC2A 1PJ6A 3VR9A 3LJPA 2BYBA 4OPUA 3SYIA 2YG4A 3FMWA 2X8GA 3AE3A 3DA1A 4B1BA 5BUKA 4YXDA 1DOBA 1D7LA 2B9YA 3CNDA 3KKJA 2WPCA 3DK9A 2C66A 3AD9B 2R4EA 4MJWA 4BURA 3CNTA 4CNJA 3GMCA 4JDRA 4EM4A 1EL8A 4H50A 2WP6A 4TM4A 5M10A 1ZKQA 1CC4A 3CTYA 1JRZA 3BI5A 5BRTA 4U8MA 2OAMA 2TMDA 3AEEA 1IJHA 1ZOYA 2B76A 5DBJA 2X50A 2C67A 3NHOX 1GRTA 4RG4A 3P4RA 4X4JA 3NT6A 4PABA 4WCTA 1GRGA 2EQ7A 4EM3A 4GAPA 3QVRA 1H6VA 4Z2RA 3ZDNA 1CHUA 2RABA 4AP1A 4KPRA 3V3OA 5FMHA 4DGKA 2Y6QA 2V60A 4H4QA 1NHRA 3URHA 1W4XA 1FEBA 3QSSA 1PN0A 2XVIA 5JCLA 2QA1A 4TM0A 1PXCA 3CPJG 2JBVA 2GVCA 3ALMA 4D03A 4H4YA 3NTAA 4USRA 1YQ4A 3E1TA 3LADA 4II3A 4NZHA 1CF3A 1NG3A 1TDKA 3H8LA 3ATQA 3GD3A 2YVJA 2XFQA 2CVJA 2YR4A 4DNAA 2GQFA 1PXBA 2YAUA 3HYXA 1E1LA 1GNDA 2BC1A 1DOCA 2WOVA 2YG7A 2C73A 5EB5A 2BABA 2A87A 2YQUA 1E39A 2XFOA 3II4A 5FS8A 5U63A 4C3YA 4U8JA 5CQFA 1FL2A 3UTEA 3AB1A 3RNMA 2OLNA 3BNMA 3NK1X 1H83A 1L9DA 2YR6A 1CJCA 2W0HA 4GRTA 4A6NA 2WPEA 4BK3A 1B37A 4NTCA 5JCMA 1O94A 3M12A 1KNPA 4JQ9A 2H88A 1H82A 3Q9TA 1D4CA 3M0OA 1OJDA 3KLJA 2V6OA 3CMMA 1TDNA 1K0LA 2YM2A 5JCNA 4Y4LA 3T2YA 1P2EA 2GB0A 4HB9A 4IVOB 3UOZA 1GERA 2GRTA 3RP7A 2TPRA 1PBCA 4Z43A 1PBFA 4LU6A 4OPDA 4B69A 1PHHA 2VRMA 5J60A 2HQMA 2JB1A 4OPCA 4N9XA 4X9MA 3SFDA 4OPTA 2YLXA 2Q0LA 3QFAA 3DH9A 4FK1C 2XLRA 2R45A 4H4TA 3KA7A 3VRAA 3NLCA 3UKAA 3UOYA 4CRTA 3GRTA 1CJ3A 3DMEA 1NG4A 3DJDA 2WBAA 1CJ4A 1GALA 1VG0A 2Z5XA 4B65A 2GF3A 4J56A 1DODA 1L9EA 1X31B 1PJ5A 4GR1A 4B67A 2R4JA 3RHAA 1KDGA 1UKVG 2WDRA 3V3NA 4FX9A 5FS6A 2C75A 4IA5A 3I6DA 2YVFA 3Q6JA 2VOUA 2WETA 4G6HA 1H7XA 3GSIA 2Q7VA 4AOXA 1PDHA 4IA6A 1N4UA 3C96A 2FJDA 3NYEA 1HYUA 4H4RA 4E0VA 4EMIA 2E1MA 4NNJA 1ZMCA 4PAAA 2ZZCA 2Q0KA 1ZMDA 4B68A 3DK8A 3VRBA 3BNUA 4LA1A 3UKQA 1NPXA 1H7WA 1RP0A 2B7RA 1MO9A 4DSHA 1GTEA 4TM1A 1REOA 4ZCCA 2XCGA 3S61A 1Q1WA 1RYIA 5M0ZA 2XLTA 3SZCA 4A7AA 4TLZA 2YLRA 4U2TA 1L0VA 4K5RA 1H86A 4J33A 4ICYA 3BI4A 2Y6RA 2OALA 3VRDB 3K7QX 2C65A 2YLTA 1QJDA 2ACZA 4G6GA 1L9CA 1GTHA 2XFNA 1IUVA 3LZXA 3NH3X 2WDVA 3BHFA 4H4PA 4C77A 4NEWA 4YSXA 4OVIA 3LZWA 1F8SA 1GT8A 3CGBA 3SX6A 4NWZA 3AEGA 3GWFA 3KVEA 4EMJA 2B9XA 1IUUA 1FCDA 1FECA 3AE5A 3UP4A 1MXTA 3AE1A 3UKHA 2YVGA 2YR5A 2BXRA 1P2HA 2FJEA 3ICTA 1PBBA 3ATRA 4DSGA 2NVKX 2CDUA 3HYWA 4CCQA 2VZ2A 1S3BA 4U8PA 3UTFA 1NAAA 2R0GA 2Z5YA 3IHMA 3PO7A 2BRAA 2GAGB 4YT0A 4BJZA 4GF7A 4Z25A 5TR3A 1ZK7A 2JKCA 3M13A 4H4WA 4D04A 4EQXA 2IVEA 3K30A 5CKUA 1DNCA 3QVPA 1LQUA 1TYTA 3ALLA 4Y4MA 3SZFA 1YQ3A 3COXA 1KNRA 3KPFA 1E7PA 2BRYA 4WX1A 2XFPA 2GR0A 1D7YA 1EL9A 2WP9A 1GXFA 2A8XA 4J36A 4OPIA 1YY5A 3FG2P 4U2LA 3REDA 3ICSA 4JNAA 4BJYA 4K7ZA 5HHFA 2GAHB 3RP6A 4A99A 2VQ7A 3F8RA 5KRQA 4EQWA 1S2QA 3ADAB 3T14A 4O5QA 3QFBA 3SM8A 4A79A 3LXDA 5IPYA 2C3CA 2QAEA 4H4SA 1SEZA 2O9ZA 1FOHA 2C70A 3V76A 3AYJA 4GDPA 3UKLA 3T0KA 2YM1A 1ZX9A 2YLZA 2XDOA 3AYIA 3ICRA 2YLWA 3P4QA 2WP5A 3WE0A 1DOEA 5KWFA 3G5SA 4C5OA 2ZZ0A 3AE8A 4A6NB 2ZBWA 1JEHA 3P4SA 1EL7A 1KFYA 2X3NA 2BK5A 2J3NA 3IHGA 4JY2A 3RP8A 3ZYXA 5JCIA 1K0IA 1GESA 2DKHA 3BHKA 1N1PA 1JNZA 1GRAA 2F5ZA 2C64A 2V3AA 4APNA 1XPQA 2R0PA 1FEAA 5L46A 2APGA 1CBOA 2X8CA 2V61A 1MOKA 2R46A 2FJBA 2YG6A 3B3RA 4Y4NA 4I58A 4AT2A 3SFEA 5BULA 1M64A 2XVJA 4C74A 3B6DA
chains in the Genus database with same CATH topology
3QSMA 4C3XA 3SZWA 3NRNA 4H2NA 2BK4A 2B7SA 1XDIA 1NDAA 5GRTA 4UP3A 1E6EA 3SY4A 2C72A 1NHSA 2XLSA 3DJJA 3EF6A 4H4VA 3CGDA 3NG7X 1YQZA 2C76A 2EQ9A 3CGCA 1DJQA 3HYVA 4A9WA 2WU5A 4Z26A 1LVLA 2C3DA 2OLOA 3HZLA 1ZDLA 1H81A 1K4QA 1B8SA 1CL0A 4BK2A 1JOAA 3GMBA 1S3EA 5U1OA 4FK1A 2JAEA 1D4EA 1LPFA 3ITJA 4REKA 2X8HA 3AEBA 3CGEA 3NNEA 2BK3A 1B4VA 2WESA 1D4DA 2OA1A 3CNJA 5EOWA 2XVHA 3IF9A 4GAVA 4NTDA 1DXLA 4A65A 3AE2A 4CY8A 1TYPA 3CNSA 3P1WA 2AR8A 2IVDA 1TDFA 2E4GA 2VVLA 2XYOA 1TDOA 3AWIA 4CBQA 2I0ZA 4O5UA 2BXSA 2WQYA 4Z2TA 4YWOA 4YTNA 1F3PA 4ZN0A 5KXJA 2ARDA 1ELIA 1BGJA 1VQWA 1Y56A 3D8XA 3AEFA 3NYCA 4BV6A 1Z6LA 3IC9A 3GYIA 1JNRA 1GV4A 4YSHA 5J7XA 3O0HA 1Q1RA 5EB4A 2EQ8A 2A89A 3T31A 5KMRA 1F8RA 2CULA 5KMQA 4YKGA 1IUXA 3FIMB 4J2WA 3ABVA 4Z24A 3NKSA 1PXAA 3KD9A 4TLXA 3AD7B 3P4PA 1LTXR 3GDPA 4J57A 3SQPA 4EQRA 3DGHA 1NHPA 5GSNA 4M52A 1E1NA 3QSEA 1GRBA 1VDCA 1N4VA 4EMWA 5HYMA 3K7MX 2EQ6A 1GPEA 4USQA 5FS7A 2B9WA 4OPLA 3AXBA 3UKFA 1PBEA 3NN6X 3UTGA 2GQWA 4CNKA 1TRBA 4HA6A 2AQJA 1XHCA 4CCRA 1VG9A 4G74A 1VRQB 1GRHA 5EBKA 1XANA 2YG3A 2FJAA 3DK4A 5KOXA 2GMJA 2JB3A 3CPIG 3FBSA 2V5ZA 2DKIA 3L8KA 3G5QA 3FPZA 4K8DA 3UOVA 3DGZA 4OPGA 1GEUA 3T2ZA 3NTDA 2XLPA 1JRXA 3GDNA 1JRYA 1DJNA 1F6MA 3GD4A 5ER0A 1KSUA 1S2YA 2BS2A 4X9NA 3C4NA 3SGLA 1V59A 3AECA 4U8LA 2RGOA 1OJTA 3AE4A 4GUVA 3UKKA 2XVEA 3UOXA 3AD8B 3NK2X 4JNQA 3UTHA 2BC0A 4B66A 4H4XA 2WEUA 3JSKA 4JY3A 4Z44A 3H4KA 3ISHA 4B63A 2BS4A 2WOWA 1LJ1A 3L1RA 4U8IA 4P9SA 1GREA 4A5LA 3LOVA 2FBWA 2YWLA 2GH5A 2BACA 4B64A 1QLBA 2BCPA 4II2A 5HXIA 1Y56B 1BF3A 4FDCB 1IUWA 4RSLA 4YTPA 2QCUA 1GETA 1H84A 3CIRA 3ALJA 1OJ9A 3EAOA 3EPTA 4K5SA 2UZZA 3BI2A 3GWDA 2CFYA 2VQBA 4K22A 4UDRA 3UKPA 2PHHA 1BKWA 5IQ1A 1YKJA 2R0CA 4IVMB 2GR1A 2GMHA 2VRLA 3H8IA 3K7TA 3VQRA 5KMPA 4YTMA 5U25A 1PS9A 2YLSA 3T2KA 3LB8A 3GYJA 4RG3A 1NHQA 3DJGX 1TDEA 5C3JA 4ADWA 1PJ7A 4ZCDA 5C2TA 1BZLA 3CNPA 2WDQA 2WPFA 1EL5A 1M6IA 5KNLA 1B5QA 2VVMA 3QJ4A 5FS9A 3DJEA 4H2RA 4H4UA 1GSNA 4H4ZA 4Z2UA 4CY6A 3KPKA 3EANA 2ZZBA 4G9KA 4EIQA 5KVIA 1CJ2A 1O95A 1EBDA 3T37A 3AE6A 2C7GA 4UDPA 1LV0A 3NIXA 4GDEA 2RGHA 2E5VA 3NYFA 4IV9A 5KMSA 2GV8A 1LQTA 1ZP0A 1E1MA 3AEAA 4XWZA 4H7UA 3AYLA 2WHDA 4NEVA 3F8DA 2GR3A 1Y0PA 3UP5A 3PVCA 3VR8A 2XVFA 3P9UA 2BCGG 3NGCX 2BA9A 4H2QA 1GRFA 1E1KA 1NEKA 2PYXA 1COYA 5IQ4A 3S5WA 2C4CA 4J31A 4JN9A 1O5WA 1F8WA 3UCLA 2V3BA 5KOWA 1K0JA 1N4WA 3GYXA 1Q9IA 1NENA 1JU2A 2RGJA 4XXGA 4TM3A 3NN0X 5JCKA 3KU9A 3D1CA 1BWCA 2BS3A 1GOSA 2QA2A 1PBDA 3AE7A 2WS3A 3AEDA 1OJCA 3IWAA 4EQSA 2JB2A 2Q6UA 3SZ0A 4I59A 4UDQA 2JK6A 1BGNA 1KF6A 4G73A 3OC4A 4K2XA 3AE9A 4YSYA 4U8OA 2XLUA 3CN8A 2GEWA 3OZ2A 4AT0A 1IUTA 2R9ZA 3R9UA 1CC6A 4LIIA 4J34A 4KX6A 1IUSA 2NPXA 5HY5A 5LV9A 4H2PA 4ECHA 2AAQA 4GCMA 3SXIA 4BK1A 1AOGA 4AOSA 3CPHG 4NTEA 4U8KA 2XFUA 1RSGA 2YG5A 4U8NA 4EIPA 3C4AA 3I3LA 3PS9A 1QO8A 2X99A 2IIDA 4AP3A 3F8PA 1OJAA 2GR2A 2H89A 3GRSA 4U2SA 1ONFA 4YKFA 3NK0X 3G5RA 1D5TA 4YSZA 1ZY8A 5BVAA 2VVLG 2WU2A 2WOIA 5KVHA 1ZOVA 4OCGA 4XWRA 1KSSA 1CC2A 1PJ6A 3VR9A 3LJPA 2BYBA 4OPUA 3SYIA 2YG4A 3FMWA 2X8GA 3AE3A 3DA1A 4B1BA 5BUKA 4YXDA 1DOBA 1D7LA 2B9YA 3CNDA 3KKJA 2WPCA 3DK9A 2C66A 3AD9B 2R4EA 4MJWA 4BURA 3CNTA 4CNJA 3GMCA 4JDRA 4EM4A 1EL8A 4H50A 2WP6A 4TM4A 5M10A 1ZKQA 1CC4A 3CTYA 1JRZA 3BI5A 5BRTA 4U8MA 2OAMA 2TMDA 3AEEA 1IJHA 1ZOYA 2B76A 5DBJA 2X50A 2C67A 3NHOX 1GRTA 4RG4A 3P4RA 4X4JA 3NT6A 4PABA 4WCTA 1GRGA 2EQ7A 4EM3A 4GAPA 3QVRA 1H6VA 4Z2RA 3ZDNA 1CHUA 2RABA 4AP1A 4KPRA 3V3OA 5FMHA 4DGKA 2Y6QA 2V60A 4H4QA 1NHRA 3URHA 1W4XA 1FEBA 3QSSA 1PN0A 2XVIA 5JCLA 2QA1A 4TM0A 1PXCA 3CPJG 2JBVA 2GVCA 3ALMA 4D03A 4H4YA 3NTAA 4USRA 1YQ4A 3E1TA 3LADA 4II3A 4NZHA 1CF3A 1NG3A 1TDKA 3H8LA 3ATQA 3GD3A 2YVJA 2XFQA 2CVJA 2YR4A 4DNAA 2GQFA 1PXBA 2YAUA 3HYXA 1E1LA 1GNDA 2BC1A 1DOCA 2WOVA 2YG7A 2C73A 5EB5A 2BABA 2A87A 2YQUA 1E39A 2XFOA 3II4A 5FS8A 5U63A 4C3YA 4U8JA 5CQFA 1FL2A 3UTEA 3AB1A 3RNMA 2OLNA 3BNMA 3NK1X 1H83A 1L9DA 2YR6A 1CJCA 2W0HA 4GRTA 4A6NA 2WPEA 4BK3A 1B37A 4NTCA 5JCMA 1O94A 3M12A 1KNPA 4JQ9A 2H88A 1H82A 3Q9TA 1D4CA 3M0OA 1OJDA 3KLJA 2V6OA 3CMMA 1TDNA 1K0LA 2YM2A 5JCNA 4Y4LA 3T2YA 1P2EA 2GB0A 4HB9A 4IVOB 3UOZA 1GERA 2GRTA 3RP7A 2TPRA 1PBCA 4Z43A 1PBFA 4LU6A 4OPDA 4B69A 1PHHA 2VRMA 5J60A 2HQMA 2JB1A 4OPCA 4N9XA 4X9MA 3SFDA 4OPTA 2YLXA 2Q0LA 3QFAA 3DH9A 4FK1C 2XLRA 2R45A 4H4TA 3KA7A 3VRAA 3NLCA 3UKAA 3UOYA 4CRTA 3GRTA 1CJ3A 3DMEA 1NG4A 3DJDA 2WBAA 1CJ4A 1GALA 1VG0A 2Z5XA 4B65A 2GF3A 4J56A 1DODA 1L9EA 1X31B 1PJ5A 4GR1A 4B67A 2R4JA 3RHAA 1KDGA 1UKVG 2WDRA 3V3NA 4FX9A 5FS6A 2C75A 4IA5A 3I6DA 2YVFA 3Q6JA 2VOUA 2WETA 4G6HA 1H7XA 3GSIA 2Q7VA 4AOXA 1PDHA 4IA6A 1N4UA 3C96A 2FJDA 3NYEA 1HYUA 4H4RA 4E0VA 4EMIA 2E1MA 4NNJA 1ZMCA 4PAAA 2ZZCA 2Q0KA 1ZMDA 4B68A 3DK8A 3VRBA 3BNUA 4LA1A 3UKQA 1NPXA 1H7WA 1RP0A 2B7RA 1MO9A 4DSHA 1GTEA 4TM1A 1REOA 4ZCCA 2XCGA 3S61A 1Q1WA 1RYIA 5M0ZA 2XLTA 3SZCA 4A7AA 4TLZA 2YLRA 4U2TA 1L0VA 4K5RA 1H86A 4J33A 4ICYA 3BI4A 2Y6RA 2OALA 3VRDB 3K7QX 2C65A 2YLTA 1QJDA 2ACZA 4G6GA 1L9CA 1GTHA 2XFNA 1IUVA 3LZXA 3NH3X 2WDVA 3BHFA 4H4PA 4C77A 4NEWA 4YSXA 4OVIA 3LZWA 1F8SA 1GT8A 3CGBA 3SX6A 4NWZA 3AEGA 3GWFA 3KVEA 4EMJA 2B9XA 1IUUA 1FCDA 1FECA 3AE5A 3UP4A 1MXTA 3AE1A 3UKHA 2YVGA 2YR5A 2BXRA 1P2HA 2FJEA 3ICTA 1PBBA 3ATRA 4DSGA 2NVKX 2CDUA 3HYWA 4CCQA 2VZ2A 1S3BA 4U8PA 3UTFA 1NAAA 2R0GA 2Z5YA 3IHMA 3PO7A 2BRAA 2GAGB 4YT0A 4BJZA 4GF7A 4Z25A 5TR3A 1ZK7A 2JKCA 3M13A 4H4WA 4D04A 4EQXA 2IVEA 3K30A 5CKUA 1DNCA 3QVPA 1LQUA 1TYTA 3ALLA 4Y4MA 3SZFA 1YQ3A 3COXA 1KNRA 3KPFA 1E7PA 2BRYA 4WX1A 2XFPA 2GR0A 1D7YA 1EL9A 2WP9A 1GXFA 2A8XA 4J36A 4OPIA 1YY5A 3FG2P 4U2LA 3REDA 3ICSA 4JNAA 4BJYA 4K7ZA 5HHFA 2GAHB 3RP6A 4A99A 2VQ7A 3F8RA 5KRQA 4EQWA 1S2QA 3ADAB 3T14A 4O5QA 3QFBA 3SM8A 4A79A 3LXDA 5IPYA 2C3CA 2QAEA 4H4SA 1SEZA 2O9ZA 1FOHA 2C70A 3V76A 3AYJA 4GDPA 3UKLA 3T0KA 2YM1A 1ZX9A 2YLZA 2XDOA 3AYIA 3ICRA 2YLWA 3P4QA 2WP5A 3WE0A 1DOEA 5KWFA 3G5SA 4C5OA 2ZZ0A 3AE8A 4A6NB 2ZBWA 1JEHA 3P4SA 1EL7A 1KFYA 2X3NA 2BK5A 2J3NA 3IHGA 4JY2A 3RP8A 3ZYXA 5JCIA 1K0IA 1GESA 2DKHA 3BHKA 1N1PA 1JNZA 1GRAA 2F5ZA 2C64A 2V3AA 4APNA 1XPQA 2R0PA 1FEAA 5L46A 2APGA 1CBOA 2X8CA 2V61A 1MOKA 2R46A 2FJBA 2YG6A 3B3RA 4Y4NA 4I58A 4AT2A 3SFEA 5BULA 1M64A 2XVJA 4C74A 3B6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QSM A;  4C3X A;  3NRN A;  4H2N A;  2BK4 A;  2B7S A;  1XDI A;  1NDA A;  5GRT A;  4UP3 A;  1E6E A;  2C72 A;  1NHS A;  2XLS A;  3DJJ A;  3EF6 A;  4H4V A;  3CGD A;  3NG7 X;  1YQZ A;  2C76 A;  2EQ9 A;  3CGC A;  1DJQ A;  4A9W A;  2WU5 A;  4Z26 A;  1LVL A;  2C3D A;  2OLO A;  3HZL A;  1ZDL A;  1H81 A;  1K4Q A;  1B8S A;  1CL0 A;  4BK2 A;  1JOA A;  3GMB A;  1S3E A;  5U1O A;  4FK1 A;  2JAE A;  1D4E A;  1LPF A;  3ITJ A;  4REK A;  2X8H A;  3AEB A;  3CGE A;  3NNE A;  2BK3 A;  1B4V A;  2WES A;  1D4D A;  2OA1 A;  3CNJ A;  5EOW A;  2XVH A;  3IF9 A;  4A65 A;  4NTD A;  1DXL A;  4CY8 A;  3AE2 A;  1TYP A;  3CNS A;  3P1W A;  2AR8 A;  2IVD A;  1TDF A;  2E4G A;  2VVL A;  2XYO A;  1TDO A;  3AWI A;  4CBQ A;  2I0Z A;  4O5U A;  2BXS A;  2WQY A;  4Z2T A;  4YWO A;  4YTN A;  1F3P A;  4ZN0 A;  5KXJ A;  2ARD A;  1ELI A;  1BGJ A;  1VQW A;  1Y56 A;  3D8X A;  3AEF A;  3NYC A;  4BV6 A;  1Z6L A;  3IC9 A;  3GYI A;  1JNR A;  1GV4 A;  4YSH A;  5J7X A;  3O0H A;  1Q1R A;  5EB4 A;  2EQ8 A;  2A89 A;  1F8R A;  2CUL A;  4YKG A;  1IUX A;  3FIM B;  4J2W A;  3ABV A;  4Z24 A;  3NKS A;  1PXA A;  3KD9 A;  4TLX A;  3AD7 B;  3P4P A;  1LTX R;  3GDP A;  4J57 A;  3SQP A;  4EQR A;  3DGH A;  1NHP A;  5GSN A;  4M52 A;  1E1N A;  3QSE A;  1GRB A;  1VDC A;  1N4V A;  4EMW A;  5HYM A;  3K7M X;  2EQ6 A;  1GPE A;  4USQ A;  5FS7 A;  2B9W A;  4OPL A;  3AXB A;  3UKF A;  1PBE A;  3NN6 X;  3UTG A;  2GQW A;  4CNK A;  1TRB A;  4HA6 A;  2AQJ A;  1XHC A;  4CCR A;  1VG9 A;  1VRQ B;  1GRH A;  5EBK A;  1XAN A;  2YG3 A;  2FJA A;  3DK4 A;  5KOX A;  2GMJ A;  2JB3 A;  3CPI G;  3FBS A;  2V5Z A;  2DKI A;  3L8K A;  3G5Q A;  3FPZ A;  4K8D A;  3UOV A;  3DGZ A;  4OPG A;  1GEU A;  3NTD A;  2XLP A;  1JRX A;  3GDN A;  1JRY A;  1DJN A;  1F6M A;  3GD4 A;  5ER0 A;  1KSU A;  1S2Y A;  2BS2 A;  4X9N A;  3C4N A;  3SGL A;  1V59 A;  3AEC A;  4U8L A;  2RGO A;  1OJT A;  3AE4 A;  4GUV A;  3UKK A;  2XVE A;  3UOX A;  3AD8 B;  3NK2 X;  4JNQ A;  3UTH A;  2BC0 A;  4B66 A;  4H4X A;  2WEU A;  3JSK A;  4JY3 A;  4Z44 A;  3H4K A;  3ISH A;  4B63 A;  2BS4 A;  2WOW A;  1LJ1 A;  3L1R A;  4U8I A;  4P9S A;  1GRE A;  4A5L A;  3LOV A;  2FBW A;  2YWL A;  2GH5 A;  2BAC A;  4B64 A;  1QLB A;  2BCP A;  5HXI A;  1Y56 B;  1BF3 A;  4FDC B;  1IUW A;  4RSL A;  4YTP A;  2QCU A;  1GET A;  1H84 A;  3CIR A;  3ALJ A;  1OJ9 A;  3EAO A;  3EPT A;  4K5S A;  2UZZ A;  3BI2 A;  3GWD A;  2CFY A;  2VQB A;  4K22 A;  4UDR A;  3UKP A;  2PHH A;  1BKW A;  5IQ1 A;  1YKJ A;  2R0C A;  4IVM B;  2GR1 A;  2GMH A;  2VRL A;  3H8I A;  3K7T A;  3VQR A;  4YTM A;  5U25 A;  1PS9 A;  2YLS A;  3LB8 A;  3GYJ A;  4RG3 A;  1NHQ A;  3DJG X;  1TDE A;  5C3J A;  4ADW A;  1PJ7 A;  4ZCD A;  5C2T A;  1BZL A;  3CNP A;  2WDQ A;  2WPF A;  1EL5 A;  1M6I A;  1B5Q A;  2VVM A;  3QJ4 A;  5FS9 A;  3DJE A;  4H2R A;  4H4U A;  1GSN A;  4H4Z A;  4Z2U A;  4CY6 A;  3EAN A;  2ZZB A;  4EIQ A;  5KVI A;  1CJ2 A;  1O95 A;  1EBD A;  3T37 A;  3AE6 A;  2C7G A;  4UDP A;  1LV0 A;  3NIX A;  4GDE A;  2RGH A;  2E5V A;  3NYF A;  4IV9 A;  2GV8 A;  1LQT A;  1ZP0 A;  1E1M A;  3AEA A;  4XWZ A;  4H7U A;  3AYL A;  2WHD A;  4NEV A;  3F8D A;  2GR3 A;  1Y0P A;  3UP5 A;  3PVC A;  3VR8 A;  2XVF A;  3P9U A;  2BCG G;  3NGC X;  2BA9 A;  4H2Q A;  1GRF A;  1E1K A;  1NEK A;  2PYX A;  1COY A;  5IQ4 A;  3S5W A;  4J31 A;  4JN9 A;  1O5W A;  1F8W A;  3UCL A;  2V3B A;  5KOW A;  1K0J A;  1N4W A;  1Q9I A;  1NEN A;  1JU2 A;  2RGJ A;  4XXG A;  4TM3 A;  3NN0 X;  5JCK A;  3KU9 A;  3D1C A;  1BWC A;  2BS3 A;  1GOS A;  2QA2 A;  1PBD A;  3AE7 A;  2WS3 A;  3AED A;  1OJC A;  3IWA A;  4EQS A;  2JB2 A;  2Q6U A;  4I59 A;  4UDQ A;  2JK6 A;  1BGN A;  1KF6 A;  3OC4 A;  4K2X A;  3AE9 A;  4YSY A;  4U8O A;  2XLU A;  3CN8 A;  2GEW A;  3OZ2 A;  4AT0 A;  1IUT A;  2R9Z A;  3R9U A;  1CC6 A;  4LII A;  4J34 A;  4KX6 A;  1IUS A;  2NPX A;  5HY5 A;  5LV9 A;  4H2P A;  4ECH A;  2AAQ A;  4GCM A;  4BK1 A;  1AOG A;  4AOS A;  3CPH G;  4NTE A;  4U8K A;  2XFU A;  1RSG A;  2YG5 A;  4U8N A;  4EIP A;  3C4A A;  3I3L A;  3PS9 A;  1QO8 A;  2X99 A;  2IID A;  4AP3 A;  3F8P A;  1OJA A;  2GR2 A;  2H89 A;  3GRS A;  4U2S A;  1ONF A;  4YKF A;  3NK0 X;  3G5R A;  1D5T A;  4YSZ A;  1ZY8 A;  5BVA A;  2VVL G;  2WU2 A;  2WOI A;  5KVH A;  1ZOV A;  4OCG A;  4XWR A;  1KSS A;  1CC2 A;  1PJ6 A;  3VR9 A;  3LJP A;  2BYB A;  4OPU A;  2YG4 A;  3FMW A;  2X8G A;  3AE3 A;  3DA1 A;  4B1B A;  5BUK A;  4YXD A;  1DOB A;  1D7L A;  2B9Y A;  3CND A;  3KKJ A;  2WPC A;  3DK9 A;  2C66 A;  3AD9 B;  2R4E A;  4MJW A;  4BUR A;  3CNT A;  4CNJ A;  3GMC A;  4JDR A;  4EM4 A;  1EL8 A;  4H50 A;  2WP6 A;  4TM4 A;  5M10 A;  1ZKQ A;  1CC4 A;  3CTY A;  1JRZ A;  3BI5 A;  5BRT A;  4U8M A;  2OAM A;  2TMD A;  3AEE A;  1IJH A;  1ZOY A;  2B76 A;  5DBJ A;  2X50 A;  2C67 A;  3NHO X;  1GRT A;  4RG4 A;  3P4R A;  4X4J A;  3NT6 A;  4PAB A;  4WCT A;  1GRG A;  2EQ7 A;  4EM3 A;  3QVR A;  1H6V A;  4Z2R A;  3ZDN A;  1CHU A;  2RAB A;  4AP1 A;  4KPR A;  3V3O A;  5FMH A;  4DGK A;  2Y6Q A;  2V60 A;  4H4Q A;  1NHR A;  3URH A;  1W4X A;  1FEB A;  3QSS A;  1PN0 A;  2XVI A;  5JCL A;  2QA1 A;  4TM0 A;  1PXC A;  3CPJ G;  2JBV A;  2GVC A;  3ALM A;  4D03 A;  4H4Y A;  3NTA A;  4USR A;  1YQ4 A;  3E1T A;  3LAD A;  4NZH A;  1CF3 A;  1NG3 A;  1TDK A;  3H8L A;  3ATQ A;  3GD3 A;  2YVJ A;  2XFQ A;  2CVJ A;  2YR4 A;  4DNA A;  2GQF A;  1PXB A;  2YAU A;  1E1L A;  1GND A;  2BC1 A;  1DOC A;  2WOV A;  2YG7 A;  2C73 A;  5EB5 A;  2BAB A;  2A87 A;  2YQU A;  1E39 A;  2XFO A;  3II4 A;  5FS8 A;  5U63 A;  4C3Y A;  4U8J A;  5CQF A;  1FL2 A;  3UTE A;  3AB1 A;  3RNM A;  2OLN A;  3BNM A;  3NK1 X;  1H83 A;  1L9D A;  2YR6 A;  1CJC A;  2W0H A;  4GRT A;  4A6N A;  2WPE A;  4BK3 A;  1B37 A;  4NTC A;  5JCM A;  1O94 A;  3M12 A;  1KNP A;  4JQ9 A;  2H88 A;  1H82 A;  3Q9T A;  1D4C A;  3M0O A;  1OJD A;  3KLJ A;  2V6O A;  1TDN A;  1K0L A;  2YM2 A;  5JCN A;  4Y4L A;  1P2E A;  2GB0 A;  4HB9 A;  4IVO B;  3UOZ A;  1GER A;  2GRT A;  3RP7 A;  2TPR A;  1PBC A;  4Z43 A;  1PBF A;  4LU6 A;  4OPD A;  4B69 A;  1PHH A;  2VRM A;  5J60 A;  2HQM A;  2JB1 A;  4OPC A;  4N9X A;  4X9M A;  3SFD A;  4OPT A;  2YLX A;  2Q0L A;  3QFA A;  3DH9 A;  4FK1 C;  2XLR A;  2R45 A;  4H4T A;  3KA7 A;  3VRA A;  3NLC A;  3UKA A;  3UOY A;  4CRT A;  3GRT A;  1CJ3 A;  3DME A;  1NG4 A;  3DJD A;  2WBA A;  1CJ4 A;  1GAL A;  1VG0 A;  2Z5X A;  4B65 A;  2GF3 A;  4J56 A;  1DOD A;  1L9E A;  1X31 B;  1PJ5 A;  4GR1 A;  4B67 A;  2R4J A;  3RHA A;  1KDG A;  1UKV G;  2WDR A;  3V3N A;  4FX9 A;  5FS6 A;  2C75 A;  4IA5 A;  3I6D A;  2YVF A;  3Q6J A;  2VOU A;  2WET A;  1H7X A;  3GSI A;  2Q7V A;  4AOX A;  1PDH A;  4IA6 A;  1N4U A;  3C96 A;  2FJD A;  3NYE A;  1HYU A;  4H4R A;  4E0V A;  4EMI A;  2E1M A;  1ZMC A;  4PAA A;  2ZZC A;  2Q0K A;  1ZMD A;  4B68 A;  3DK8 A;  3VRB A;  3BNU A;  4LA1 A;  3UKQ A;  1NPX A;  1H7W A;  1RP0 A;  2B7R A;  1MO9 A;  4DSH A;  1GTE A;  4TM1 A;  1REO A;  4ZCC A;  2XCG A;  3S61 A;  1Q1W A;  1RYI A;  5M0Z A;  2XLT A;  4A7A A;  4TLZ A;  2YLR A;  4U2T A;  1L0V A;  4K5R A;  1H86 A;  4J33 A;  4ICY A;  3BI4 A;  2Y6R A;  2OAL A;  3VRD B;  3K7Q X;  2C65 A;  2YLT A;  1QJD A;  2ACZ A;  1L9C A;  1GTH A;  2XFN A;  1IUV A;  3LZX A;  3NH3 X;  2WDV A;  3BHF A;  4H4P A;  4C77 A;  4NEW A;  4YSX A;  4OVI A;  3LZW A;  1F8S A;  1GT8 A;  3CGB A;  3AEG A;  3GWF A;  3KVE A;  4EMJ A;  2B9X A;  1IUU A;  1FCD A;  1FEC A;  3AE5 A;  3UP4 A;  1MXT A;  3AE1 A;  3UKH A;  2YVG A;  2YR5 A;  2BXR A;  1P2H A;  2FJE A;  3ICT A;  1PBB A;  3ATR A;  4DSG A;  2NVK X;  2CDU A;  4CCQ A;  2VZ2 A;  1S3B A;  4U8P A;  3UTF A;  1NAA A;  2R0G A;  2Z5Y A;  3IHM A;  3PO7 A;  2GAG B;  4YT0 A;  4BJZ A;  4GF7 A;  4Z25 A;  5TR3 A;  1ZK7 A;  2JKC A;  3M13 A;  4H4W A;  4D04 A;  4EQX A;  2IVE A;  3K30 A;  5CKU A;  1DNC A;  3QVP A;  1LQU A;  1TYT A;  3ALL A;  4Y4M A;  1YQ3 A;  3COX A;  1KNR A;  3KPF A;  1E7P A;  4WX1 A;  2XFP A;  2GR0 A;  1D7Y A;  1EL9 A;  2WP9 A;  1GXF A;  2A8X A;  4J36 A;  4OPI A;  1YY5 A;  3FG2 P;  4U2L A;  3RED A;  3ICS A;  4JNA A;  4BJY A;  4K7Z A;  5HHF A;  2GAH B;  3RP6 A;  4A99 A;  2VQ7 A;  3F8R A;  5KRQ A;  4EQW A;  1S2Q A;  3ADA B;  4O5Q A;  3QFB A;  3SM8 A;  4A79 A;  3LXD A;  5IPY A;  2C3C A;  2QAE A;  4H4S A;  1SEZ A;  2O9Z A;  1FOH A;  2C70 A;  3V76 A;  3AYJ A;  4GDP A;  3UKL A;  2YM1 A;  1ZX9 A;  2YLZ A;  2XDO A;  3AYI A;  3ICR A;  2YLW A;  3P4Q A;  2WP5 A;  3WE0 A;  1DOE A;  5KWF A;  3G5S A;  4C5O A;  2ZZ0 A;  3AE8 A;  4A6N B;  2ZBW A;  1JEH A;  3P4S A;  1EL7 A;  1KFY A;  2X3N A;  2BK5 A;  2J3N A;  3IHG A;  4JY2 A;  3RP8 A;  3ZYX A;  5JCI A;  1K0I A;  1GES A;  2DKH A;  3BHK A;  1N1P A;  1JNZ A;  1GRA A;  2F5Z A;  2C64 A;  2V3A A;  4APN A;  1XPQ A;  2R0P A;  1FEA A;  5L46 A;  2APG A;  1CBO A;  2X8C A;  2V61 A;  1MOK A;  2R46 A;  2FJB A;  2YG6 A;  3B3R A;  4Y4N A;  4I58 A;  4AT2 A;  3SFE A;  5BUL A;  1M64 A;  2XVJ A;  4C74 A;  3B6D A; 
#chains in the Genus database with same CATH topology
 3QSM A;  4C3X A;  3SZW A;  3NRN A;  4H2N A;  2BK4 A;  2B7S A;  1XDI A;  1NDA A;  5GRT A;  4UP3 A;  1E6E A;  3SY4 A;  2C72 A;  1NHS A;  2XLS A;  3DJJ A;  3EF6 A;  4H4V A;  3CGD A;  3NG7 X;  1YQZ A;  2C76 A;  2EQ9 A;  3CGC A;  1DJQ A;  3HYV A;  4A9W A;  2WU5 A;  4Z26 A;  1LVL A;  2C3D A;  2OLO A;  3HZL A;  1ZDL A;  1H81 A;  1K4Q A;  1B8S A;  1CL0 A;  4BK2 A;  1JOA A;  3GMB A;  1S3E A;  5U1O A;  4FK1 A;  2JAE A;  1D4E A;  1LPF A;  3ITJ A;  4REK A;  2X8H A;  3AEB A;  3CGE A;  3NNE A;  2BK3 A;  1B4V A;  2WES A;  1D4D A;  2OA1 A;  3CNJ A;  5EOW A;  2XVH A;  3IF9 A;  4GAV A;  4NTD A;  1DXL A;  4A65 A;  3AE2 A;  4CY8 A;  1TYP A;  3CNS A;  3P1W A;  2AR8 A;  2IVD A;  1TDF A;  2E4G A;  2VVL A;  2XYO A;  1TDO A;  3AWI A;  4CBQ A;  2I0Z A;  4O5U A;  2BXS A;  2WQY A;  4Z2T A;  4YWO A;  4YTN A;  1F3P A;  4ZN0 A;  5KXJ A;  2ARD A;  1ELI A;  1BGJ A;  1VQW A;  1Y56 A;  3D8X A;  3AEF A;  3NYC A;  4BV6 A;  1Z6L A;  3IC9 A;  3GYI A;  1JNR A;  1GV4 A;  4YSH A;  5J7X A;  3O0H A;  1Q1R A;  5EB4 A;  2EQ8 A;  2A89 A;  3T31 A;  5KMR A;  1F8R A;  2CUL A;  5KMQ A;  4YKG A;  1IUX A;  3FIM B;  4J2W A;  3ABV A;  4Z24 A;  3NKS A;  1PXA A;  3KD9 A;  4TLX A;  3AD7 B;  3P4P A;  1LTX R;  3GDP A;  4J57 A;  3SQP A;  4EQR A;  3DGH A;  1NHP A;  5GSN A;  4M52 A;  1E1N A;  3QSE A;  1GRB A;  1VDC A;  1N4V A;  4EMW A;  5HYM A;  3K7M X;  2EQ6 A;  1GPE A;  4USQ A;  5FS7 A;  2B9W A;  4OPL A;  3AXB A;  3UKF A;  1PBE A;  3NN6 X;  3UTG A;  2GQW A;  4CNK A;  1TRB A;  4HA6 A;  2AQJ A;  1XHC A;  4CCR A;  1VG9 A;  4G74 A;  1VRQ B;  1GRH A;  5EBK A;  1XAN A;  2YG3 A;  2FJA A;  3DK4 A;  5KOX A;  2GMJ A;  2JB3 A;  3CPI G;  3FBS A;  2V5Z A;  2DKI A;  3L8K A;  3G5Q A;  3FPZ A;  4K8D A;  3UOV A;  3DGZ A;  4OPG A;  1GEU A;  3T2Z A;  3NTD A;  2XLP A;  1JRX A;  3GDN A;  1JRY A;  1DJN A;  1F6M A;  3GD4 A;  5ER0 A;  1KSU A;  1S2Y A;  2BS2 A;  4X9N A;  3C4N A;  3SGL A;  1V59 A;  3AEC A;  4U8L A;  2RGO A;  1OJT A;  3AE4 A;  4GUV A;  3UKK A;  2XVE A;  3UOX A;  3AD8 B;  3NK2 X;  4JNQ A;  3UTH A;  2BC0 A;  4B66 A;  4H4X A;  2WEU A;  3JSK A;  4JY3 A;  4Z44 A;  3H4K A;  3ISH A;  4B63 A;  2BS4 A;  2WOW A;  1LJ1 A;  3L1R A;  4U8I A;  4P9S A;  1GRE A;  4A5L A;  3LOV A;  2FBW A;  2YWL A;  2GH5 A;  2BAC A;  4B64 A;  1QLB A;  2BCP A;  4II2 A;  5HXI A;  1Y56 B;  1BF3 A;  4FDC B;  1IUW A;  4RSL A;  4YTP A;  2QCU A;  1GET A;  1H84 A;  3CIR A;  3ALJ A;  1OJ9 A;  3EAO A;  3EPT A;  4K5S A;  2UZZ A;  3BI2 A;  3GWD A;  2CFY A;  2VQB A;  4K22 A;  4UDR A;  3UKP A;  2PHH A;  1BKW A;  5IQ1 A;  1YKJ A;  2R0C A;  4IVM B;  2GR1 A;  2GMH A;  2VRL A;  3H8I A;  3K7T A;  3VQR A;  5KMP A;  4YTM A;  5U25 A;  1PS9 A;  2YLS A;  3T2K A;  3LB8 A;  3GYJ A;  4RG3 A;  1NHQ A;  3DJG X;  1TDE A;  5C3J A;  4ADW A;  1PJ7 A;  4ZCD A;  5C2T A;  1BZL A;  3CNP A;  2WDQ A;  2WPF A;  1EL5 A;  1M6I A;  5KNL A;  1B5Q A;  2VVM A;  3QJ4 A;  5FS9 A;  3DJE A;  4H2R A;  4H4U A;  1GSN A;  4H4Z A;  4Z2U A;  4CY6 A;  3KPK A;  3EAN A;  2ZZB A;  4G9K A;  4EIQ A;  5KVI A;  1CJ2 A;  1O95 A;  1EBD A;  3T37 A;  3AE6 A;  2C7G A;  4UDP A;  1LV0 A;  3NIX A;  4GDE A;  2RGH A;  2E5V A;  3NYF A;  4IV9 A;  5KMS A;  2GV8 A;  1LQT A;  1ZP0 A;  1E1M A;  3AEA A;  4XWZ A;  4H7U A;  3AYL A;  2WHD A;  4NEV A;  3F8D A;  2GR3 A;  1Y0P A;  3UP5 A;  3PVC A;  3VR8 A;  2XVF A;  3P9U A;  2BCG G;  3NGC X;  2BA9 A;  4H2Q A;  1GRF A;  1E1K A;  1NEK A;  2PYX A;  1COY A;  5IQ4 A;  3S5W A;  2C4C A;  4J31 A;  4JN9 A;  1O5W A;  1F8W A;  3UCL A;  2V3B A;  5KOW A;  1K0J A;  1N4W A;  3GYX A;  1Q9I A;  1NEN A;  1JU2 A;  2RGJ A;  4XXG A;  4TM3 A;  3NN0 X;  5JCK A;  3KU9 A;  3D1C A;  1BWC A;  2BS3 A;  1GOS A;  2QA2 A;  1PBD A;  3AE7 A;  2WS3 A;  3AED A;  1OJC A;  3IWA A;  4EQS A;  2JB2 A;  2Q6U A;  3SZ0 A;  4I59 A;  4UDQ A;  2JK6 A;  1BGN A;  1KF6 A;  4G73 A;  3OC4 A;  4K2X A;  3AE9 A;  4YSY A;  4U8O A;  2XLU A;  3CN8 A;  2GEW A;  3OZ2 A;  4AT0 A;  1IUT A;  2R9Z A;  3R9U A;  1CC6 A;  4LII A;  4J34 A;  4KX6 A;  1IUS A;  2NPX A;  5HY5 A;  5LV9 A;  4H2P A;  4ECH A;  2AAQ A;  4GCM A;  3SXI A;  4BK1 A;  1AOG A;  4AOS A;  3CPH G;  4NTE A;  4U8K A;  2XFU A;  1RSG A;  2YG5 A;  4U8N A;  4EIP A;  3C4A A;  3I3L A;  3PS9 A;  1QO8 A;  2X99 A;  2IID A;  4AP3 A;  3F8P A;  1OJA A;  2GR2 A;  2H89 A;  3GRS A;  4U2S A;  1ONF A;  4YKF A;  3NK0 X;  3G5R A;  1D5T A;  4YSZ A;  1ZY8 A;  5BVA A;  2VVL G;  2WU2 A;  2WOI A;  5KVH A;  1ZOV A;  4OCG A;  4XWR A;  1KSS A;  1CC2 A;  1PJ6 A;  3VR9 A;  3LJP A;  2BYB A;  4OPU A;  3SYI A;  2YG4 A;  3FMW A;  2X8G A;  3AE3 A;  3DA1 A;  4B1B A;  5BUK A;  4YXD A;  1DOB A;  1D7L A;  2B9Y A;  3CND A;  3KKJ A;  2WPC A;  3DK9 A;  2C66 A;  3AD9 B;  2R4E A;  4MJW A;  4BUR A;  3CNT A;  4CNJ A;  3GMC A;  4JDR A;  4EM4 A;  1EL8 A;  4H50 A;  2WP6 A;  4TM4 A;  5M10 A;  1ZKQ A;  1CC4 A;  3CTY A;  1JRZ A;  3BI5 A;  5BRT A;  4U8M A;  2OAM A;  2TMD A;  3AEE A;  1IJH A;  1ZOY A;  2B76 A;  5DBJ A;  2X50 A;  2C67 A;  3NHO X;  1GRT A;  4RG4 A;  3P4R A;  4X4J A;  3NT6 A;  4PAB A;  4WCT A;  1GRG A;  2EQ7 A;  4EM3 A;  4GAP A;  3QVR A;  1H6V A;  4Z2R A;  3ZDN A;  1CHU A;  2RAB A;  4AP1 A;  4KPR A;  3V3O A;  5FMH A;  4DGK A;  2Y6Q A;  2V60 A;  4H4Q A;  1NHR A;  3URH A;  1W4X A;  1FEB A;  3QSS A;  1PN0 A;  2XVI A;  5JCL A;  2QA1 A;  4TM0 A;  1PXC A;  3CPJ G;  2JBV A;  2GVC A;  3ALM A;  4D03 A;  4H4Y A;  3NTA A;  4USR A;  1YQ4 A;  3E1T A;  3LAD A;  4II3 A;  4NZH A;  1CF3 A;  1NG3 A;  1TDK A;  3H8L A;  3ATQ A;  3GD3 A;  2YVJ A;  2XFQ A;  2CVJ A;  2YR4 A;  4DNA A;  2GQF A;  1PXB A;  2YAU A;  3HYX A;  1E1L A;  1GND A;  2BC1 A;  1DOC A;  2WOV A;  2YG7 A;  2C73 A;  5EB5 A;  2BAB A;  2A87 A;  2YQU A;  1E39 A;  2XFO A;  3II4 A;  5FS8 A;  5U63 A;  4C3Y A;  4U8J A;  5CQF A;  1FL2 A;  3UTE A;  3AB1 A;  3RNM A;  2OLN A;  3BNM A;  3NK1 X;  1H83 A;  1L9D A;  2YR6 A;  1CJC A;  2W0H A;  4GRT A;  4A6N A;  2WPE A;  4BK3 A;  1B37 A;  4NTC A;  5JCM A;  1O94 A;  3M12 A;  1KNP A;  4JQ9 A;  2H88 A;  1H82 A;  3Q9T A;  1D4C A;  3M0O A;  1OJD A;  3KLJ A;  2V6O A;  3CMM A;  1TDN A;  1K0L A;  2YM2 A;  5JCN A;  4Y4L A;  3T2Y A;  1P2E A;  2GB0 A;  4HB9 A;  4IVO B;  3UOZ A;  1GER A;  2GRT A;  3RP7 A;  2TPR A;  1PBC A;  4Z43 A;  1PBF A;  4LU6 A;  4OPD A;  4B69 A;  1PHH A;  2VRM A;  5J60 A;  2HQM A;  2JB1 A;  4OPC A;  4N9X A;  4X9M A;  3SFD A;  4OPT A;  2YLX A;  2Q0L A;  3QFA A;  3DH9 A;  4FK1 C;  2XLR A;  2R45 A;  4H4T A;  3KA7 A;  3VRA A;  3NLC A;  3UKA A;  3UOY A;  4CRT A;  3GRT A;  1CJ3 A;  3DME A;  1NG4 A;  3DJD A;  2WBA A;  1CJ4 A;  1GAL A;  1VG0 A;  2Z5X A;  4B65 A;  2GF3 A;  4J56 A;  1DOD A;  1L9E A;  1X31 B;  1PJ5 A;  4GR1 A;  4B67 A;  2R4J A;  3RHA A;  1KDG A;  1UKV G;  2WDR A;  3V3N A;  4FX9 A;  5FS6 A;  2C75 A;  4IA5 A;  3I6D A;  2YVF A;  3Q6J A;  2VOU A;  2WET A;  4G6H A;  1H7X A;  3GSI A;  2Q7V A;  4AOX A;  1PDH A;  4IA6 A;  1N4U A;  3C96 A;  2FJD A;  3NYE A;  1HYU A;  4H4R A;  4E0V A;  4EMI A;  2E1M A;  4NNJ A;  1ZMC A;  4PAA A;  2ZZC A;  2Q0K A;  1ZMD A;  4B68 A;  3DK8 A;  3VRB A;  3BNU A;  4LA1 A;  3UKQ A;  1NPX A;  1H7W A;  1RP0 A;  2B7R A;  1MO9 A;  4DSH A;  1GTE A;  4TM1 A;  1REO A;  4ZCC A;  2XCG A;  3S61 A;  1Q1W A;  1RYI A;  5M0Z A;  2XLT A;  3SZC A;  4A7A A;  4TLZ A;  2YLR A;  4U2T A;  1L0V A;  4K5R A;  1H86 A;  4J33 A;  4ICY A;  3BI4 A;  2Y6R A;  2OAL A;  3VRD B;  3K7Q X;  2C65 A;  2YLT A;  1QJD A;  2ACZ A;  4G6G A;  1L9C A;  1GTH A;  2XFN A;  1IUV A;  3LZX A;  3NH3 X;  2WDV A;  3BHF A;  4H4P A;  4C77 A;  4NEW A;  4YSX A;  4OVI A;  3LZW A;  1F8S A;  1GT8 A;  3CGB A;  3SX6 A;  4NWZ A;  3AEG A;  3GWF A;  3KVE A;  4EMJ A;  2B9X A;  1IUU A;  1FCD A;  1FEC A;  3AE5 A;  3UP4 A;  1MXT A;  3AE1 A;  3UKH A;  2YVG A;  2YR5 A;  2BXR A;  1P2H A;  2FJE A;  3ICT A;  1PBB A;  3ATR A;  4DSG A;  2NVK X;  2CDU A;  3HYW A;  4CCQ A;  2VZ2 A;  1S3B A;  4U8P A;  3UTF A;  1NAA A;  2R0G A;  2Z5Y A;  3IHM A;  3PO7 A;  2BRA A;  2GAG B;  4YT0 A;  4BJZ A;  4GF7 A;  4Z25 A;  5TR3 A;  1ZK7 A;  2JKC A;  3M13 A;  4H4W A;  4D04 A;  4EQX A;  2IVE A;  3K30 A;  5CKU A;  1DNC A;  3QVP A;  1LQU A;  1TYT A;  3ALL A;  4Y4M A;  3SZF A;  1YQ3 A;  3COX A;  1KNR A;  3KPF A;  1E7P A;  2BRY A;  4WX1 A;  2XFP A;  2GR0 A;  1D7Y A;  1EL9 A;  2WP9 A;  1GXF A;  2A8X A;  4J36 A;  4OPI A;  1YY5 A;  3FG2 P;  4U2L A;  3RED A;  3ICS A;  4JNA A;  4BJY A;  4K7Z A;  5HHF A;  2GAH B;  3RP6 A;  4A99 A;  2VQ7 A;  3F8R A;  5KRQ A;  4EQW A;  1S2Q A;  3ADA B;  3T14 A;  4O5Q A;  3QFB A;  3SM8 A;  4A79 A;  3LXD A;  5IPY A;  2C3C A;  2QAE A;  4H4S A;  1SEZ A;  2O9Z A;  1FOH A;  2C70 A;  3V76 A;  3AYJ A;  4GDP A;  3UKL A;  3T0K A;  2YM1 A;  1ZX9 A;  2YLZ A;  2XDO A;  3AYI A;  3ICR A;  2YLW A;  3P4Q A;  2WP5 A;  3WE0 A;  1DOE A;  5KWF A;  3G5S A;  4C5O A;  2ZZ0 A;  3AE8 A;  4A6N B;  2ZBW A;  1JEH A;  3P4S A;  1EL7 A;  1KFY A;  2X3N A;  2BK5 A;  2J3N A;  3IHG A;  4JY2 A;  3RP8 A;  3ZYX A;  5JCI A;  1K0I A;  1GES A;  2DKH A;  3BHK A;  1N1P A;  1JNZ A;  1GRA A;  2F5Z A;  2C64 A;  2V3A A;  4APN A;  1XPQ A;  2R0P A;  1FEA A;  5L46 A;  2APG A;  1CBO A;  2X8C A;  2V61 A;  1MOK A;  2R46 A;  2FJB A;  2YG6 A;  3B3R A;  4Y4N A;  4I58 A;  4AT2 A;  3SFE A;  5BUL A;  1M64 A;  2XVJ A;  4C74 A;  3B6D A; 
#chains in the Genus database with same CATH homology
 3QSM A;  4C3X A;  3SZW A;  3NRN A;  4H2N A;  2BK4 A;  2B7S A;  1XDI A;  1NDA A;  5GRT A;  4UP3 A;  1E6E A;  3SY4 A;  2C72 A;  1NHS A;  2XLS A;  3DJJ A;  3EF6 A;  4H4V A;  3CGD A;  3NG7 X;  1YQZ A;  2C76 A;  2EQ9 A;  3CGC A;  1DJQ A;  3HYV A;  4A9W A;  2WU5 A;  4Z26 A;  1LVL A;  2C3D A;  2OLO A;  3HZL A;  1ZDL A;  1H81 A;  1K4Q A;  1B8S A;  1CL0 A;  4BK2 A;  1JOA A;  3GMB A;  1S3E A;  5U1O A;  4FK1 A;  2JAE A;  1D4E A;  1LPF A;  3ITJ A;  4REK A;  2X8H A;  3AEB A;  3CGE A;  3NNE A;  2BK3 A;  1B4V A;  2WES A;  1D4D A;  2OA1 A;  3CNJ A;  5EOW A;  2XVH A;  3IF9 A;  4GAV A;  4NTD A;  1DXL A;  4A65 A;  3AE2 A;  4CY8 A;  1TYP A;  3CNS A;  3P1W A;  2AR8 A;  2IVD A;  1TDF A;  2E4G A;  2VVL A;  2XYO A;  1TDO A;  3AWI A;  4CBQ A;  2I0Z A;  4O5U A;  2BXS A;  2WQY A;  4Z2T A;  4YWO A;  4YTN A;  1F3P A;  4ZN0 A;  5KXJ A;  2ARD A;  1ELI A;  1BGJ A;  1VQW A;  1Y56 A;  3D8X A;  3AEF A;  3NYC A;  4BV6 A;  1Z6L A;  3IC9 A;  3GYI A;  1JNR A;  1GV4 A;  4YSH A;  5J7X A;  3O0H A;  1Q1R A;  5EB4 A;  2EQ8 A;  2A89 A;  3T31 A;  5KMR A;  1F8R A;  2CUL A;  5KMQ A;  4YKG A;  1IUX A;  3FIM B;  4J2W A;  3ABV A;  4Z24 A;  3NKS A;  1PXA A;  3KD9 A;  4TLX A;  3AD7 B;  3P4P A;  1LTX R;  3GDP A;  4J57 A;  3SQP A;  4EQR A;  3DGH A;  1NHP A;  5GSN A;  4M52 A;  1E1N A;  3QSE A;  1GRB A;  1VDC A;  1N4V A;  4EMW A;  5HYM A;  3K7M X;  2EQ6 A;  1GPE A;  4USQ A;  5FS7 A;  2B9W A;  4OPL A;  3AXB A;  3UKF A;  1PBE A;  3NN6 X;  3UTG A;  2GQW A;  4CNK A;  1TRB A;  4HA6 A;  2AQJ A;  1XHC A;  4CCR A;  1VG9 A;  4G74 A;  1VRQ B;  1GRH A;  5EBK A;  1XAN A;  2YG3 A;  2FJA A;  3DK4 A;  5KOX A;  2GMJ A;  2JB3 A;  3CPI G;  3FBS A;  2V5Z A;  2DKI A;  3L8K A;  3G5Q A;  3FPZ A;  4K8D A;  3UOV A;  3DGZ A;  4OPG A;  1GEU A;  3T2Z A;  3NTD A;  2XLP A;  1JRX A;  3GDN A;  1JRY A;  1DJN A;  1F6M A;  3GD4 A;  5ER0 A;  1KSU A;  1S2Y A;  2BS2 A;  4X9N A;  3C4N A;  3SGL A;  1V59 A;  3AEC A;  4U8L A;  2RGO A;  1OJT A;  3AE4 A;  4GUV A;  3UKK A;  2XVE A;  3UOX A;  3AD8 B;  3NK2 X;  4JNQ A;  3UTH A;  2BC0 A;  4B66 A;  4H4X A;  2WEU A;  3JSK A;  4JY3 A;  4Z44 A;  3H4K A;  3ISH A;  4B63 A;  2BS4 A;  2WOW A;  1LJ1 A;  3L1R A;  4U8I A;  4P9S A;  1GRE A;  4A5L A;  3LOV A;  2FBW A;  2YWL A;  2GH5 A;  2BAC A;  4B64 A;  1QLB A;  2BCP A;  4II2 A;  5HXI A;  1Y56 B;  1BF3 A;  4FDC B;  1IUW A;  4RSL A;  4YTP A;  2QCU A;  1GET A;  1H84 A;  3CIR A;  3ALJ A;  1OJ9 A;  3EAO A;  3EPT A;  4K5S A;  2UZZ A;  3BI2 A;  3GWD A;  2CFY A;  2VQB A;  4K22 A;  4UDR A;  3UKP A;  2PHH A;  1BKW A;  5IQ1 A;  1YKJ A;  2R0C A;  4IVM B;  2GR1 A;  2GMH A;  2VRL A;  3H8I A;  3K7T A;  3VQR A;  5KMP A;  4YTM A;  5U25 A;  1PS9 A;  2YLS A;  3T2K A;  3LB8 A;  3GYJ A;  4RG3 A;  1NHQ A;  3DJG X;  1TDE A;  5C3J A;  4ADW A;  1PJ7 A;  4ZCD A;  5C2T A;  1BZL A;  3CNP A;  2WDQ A;  2WPF A;  1EL5 A;  1M6I A;  5KNL A;  1B5Q A;  2VVM A;  3QJ4 A;  5FS9 A;  3DJE A;  4H2R A;  4H4U A;  1GSN A;  4H4Z A;  4Z2U A;  4CY6 A;  3KPK A;  3EAN A;  2ZZB A;  4G9K A;  4EIQ A;  5KVI A;  1CJ2 A;  1O95 A;  1EBD A;  3T37 A;  3AE6 A;  2C7G A;  4UDP A;  1LV0 A;  3NIX A;  4GDE A;  2RGH A;  2E5V A;  3NYF A;  4IV9 A;  5KMS A;  2GV8 A;  1LQT A;  1ZP0 A;  1E1M A;  3AEA A;  4XWZ A;  4H7U A;  3AYL A;  2WHD A;  4NEV A;  3F8D A;  2GR3 A;  1Y0P A;  3UP5 A;  3PVC A;  3VR8 A;  2XVF A;  3P9U A;  2BCG G;  3NGC X;  2BA9 A;  4H2Q A;  1GRF A;  1E1K A;  1NEK A;  2PYX A;  1COY A;  5IQ4 A;  3S5W A;  2C4C A;  4J31 A;  4JN9 A;  1O5W A;  1F8W A;  3UCL A;  2V3B A;  5KOW A;  1K0J A;  1N4W A;  3GYX A;  1Q9I A;  1NEN A;  1JU2 A;  2RGJ A;  4XXG A;  4TM3 A;  3NN0 X;  5JCK A;  3KU9 A;  3D1C A;  1BWC A;  2BS3 A;  1GOS A;  2QA2 A;  1PBD A;  3AE7 A;  2WS3 A;  3AED A;  1OJC A;  3IWA A;  4EQS A;  2JB2 A;  2Q6U A;  3SZ0 A;  4I59 A;  4UDQ A;  2JK6 A;  1BGN A;  1KF6 A;  4G73 A;  3OC4 A;  4K2X A;  3AE9 A;  4YSY A;  4U8O A;  2XLU A;  3CN8 A;  2GEW A;  3OZ2 A;  4AT0 A;  1IUT A;  2R9Z A;  3R9U A;  1CC6 A;  4LII A;  4J34 A;  4KX6 A;  1IUS A;  2NPX A;  5HY5 A;  5LV9 A;  4H2P A;  4ECH A;  2AAQ A;  4GCM A;  3SXI A;  4BK1 A;  1AOG A;  4AOS A;  3CPH G;  4NTE A;  4U8K A;  2XFU A;  1RSG A;  2YG5 A;  4U8N A;  4EIP A;  3C4A A;  3I3L A;  3PS9 A;  1QO8 A;  2X99 A;  2IID A;  4AP3 A;  3F8P A;  1OJA A;  2GR2 A;  2H89 A;  3GRS A;  4U2S A;  1ONF A;  4YKF A;  3NK0 X;  3G5R A;  1D5T A;  4YSZ A;  1ZY8 A;  5BVA A;  2VVL G;  2WU2 A;  2WOI A;  5KVH A;  1ZOV A;  4OCG A;  4XWR A;  1KSS A;  1CC2 A;  1PJ6 A;  3VR9 A;  3LJP A;  2BYB A;  4OPU A;  3SYI A;  2YG4 A;  3FMW A;  2X8G A;  3AE3 A;  3DA1 A;  4B1B A;  5BUK A;  4YXD A;  1DOB A;  1D7L A;  2B9Y A;  3CND A;  3KKJ A;  2WPC A;  3DK9 A;  2C66 A;  3AD9 B;  2R4E A;  4MJW A;  4BUR A;  3CNT A;  4CNJ A;  3GMC A;  4JDR A;  4EM4 A;  1EL8 A;  4H50 A;  2WP6 A;  4TM4 A;  5M10 A;  1ZKQ A;  1CC4 A;  3CTY A;  1JRZ A;  3BI5 A;  5BRT A;  4U8M A;  2OAM A;  2TMD A;  3AEE A;  1IJH A;  1ZOY A;  2B76 A;  5DBJ A;  2X50 A;  2C67 A;  3NHO X;  1GRT A;  4RG4 A;  3P4R A;  4X4J A;  3NT6 A;  4PAB A;  4WCT A;  1GRG A;  2EQ7 A;  4EM3 A;  4GAP A;  3QVR A;  1H6V A;  4Z2R A;  3ZDN A;  1CHU A;  2RAB A;  4AP1 A;  4KPR A;  3V3O A;  5FMH A;  4DGK A;  2Y6Q A;  2V60 A;  4H4Q A;  1NHR A;  3URH A;  1W4X A;  1FEB A;  3QSS A;  1PN0 A;  2XVI A;  5JCL A;  2QA1 A;  4TM0 A;  1PXC A;  3CPJ G;  2JBV A;  2GVC A;  3ALM A;  4D03 A;  4H4Y A;  3NTA A;  4USR A;  1YQ4 A;  3E1T A;  3LAD A;  4II3 A;  4NZH A;  1CF3 A;  1NG3 A;  1TDK A;  3H8L A;  3ATQ A;  3GD3 A;  2YVJ A;  2XFQ A;  2CVJ A;  2YR4 A;  4DNA A;  2GQF A;  1PXB A;  2YAU A;  3HYX A;  1E1L A;  1GND A;  2BC1 A;  1DOC A;  2WOV A;  2YG7 A;  2C73 A;  5EB5 A;  2BAB A;  2A87 A;  2YQU A;  1E39 A;  2XFO A;  3II4 A;  5FS8 A;  5U63 A;  4C3Y A;  4U8J A;  5CQF A;  1FL2 A;  3UTE A;  3AB1 A;  3RNM A;  2OLN A;  3BNM A;  3NK1 X;  1H83 A;  1L9D A;  2YR6 A;  1CJC A;  2W0H A;  4GRT A;  4A6N A;  2WPE A;  4BK3 A;  1B37 A;  4NTC A;  5JCM A;  1O94 A;  3M12 A;  1KNP A;  4JQ9 A;  2H88 A;  1H82 A;  3Q9T A;  1D4C A;  3M0O A;  1OJD A;  3KLJ A;  2V6O A;  3CMM A;  1TDN A;  1K0L A;  2YM2 A;  5JCN A;  4Y4L A;  3T2Y A;  1P2E A;  2GB0 A;  4HB9 A;  4IVO B;  3UOZ A;  1GER A;  2GRT A;  3RP7 A;  2TPR A;  1PBC A;  4Z43 A;  1PBF A;  4LU6 A;  4OPD A;  4B69 A;  1PHH A;  2VRM A;  5J60 A;  2HQM A;  2JB1 A;  4OPC A;  4N9X A;  4X9M A;  3SFD A;  4OPT A;  2YLX A;  2Q0L A;  3QFA A;  3DH9 A;  4FK1 C;  2XLR A;  2R45 A;  4H4T A;  3KA7 A;  3VRA A;  3NLC A;  3UKA A;  3UOY A;  4CRT A;  3GRT A;  1CJ3 A;  3DME A;  1NG4 A;  3DJD A;  2WBA A;  1CJ4 A;  1GAL A;  1VG0 A;  2Z5X A;  4B65 A;  2GF3 A;  4J56 A;  1DOD A;  1L9E A;  1X31 B;  1PJ5 A;  4GR1 A;  4B67 A;  2R4J A;  3RHA A;  1KDG A;  1UKV G;  2WDR A;  3V3N A;  4FX9 A;  5FS6 A;  2C75 A;  4IA5 A;  3I6D A;  2YVF A;  3Q6J A;  2VOU A;  2WET A;  4G6H A;  1H7X A;  3GSI A;  2Q7V A;  4AOX A;  1PDH A;  4IA6 A;  1N4U A;  3C96 A;  2FJD A;  3NYE A;  1HYU A;  4H4R A;  4E0V A;  4EMI A;  2E1M A;  4NNJ A;  1ZMC A;  4PAA A;  2ZZC A;  2Q0K A;  1ZMD A;  4B68 A;  3DK8 A;  3VRB A;  3BNU A;  4LA1 A;  3UKQ A;  1NPX A;  1H7W A;  1RP0 A;  2B7R A;  1MO9 A;  4DSH A;  1GTE A;  4TM1 A;  1REO A;  4ZCC A;  2XCG A;  3S61 A;  1Q1W A;  1RYI A;  5M0Z A;  2XLT A;  3SZC A;  4A7A A;  4TLZ A;  2YLR A;  4U2T A;  1L0V A;  4K5R A;  1H86 A;  4J33 A;  4ICY A;  3BI4 A;  2Y6R A;  2OAL A;  3VRD B;  3K7Q X;  2C65 A;  2YLT A;  1QJD A;  2ACZ A;  4G6G A;  1L9C A;  1GTH A;  2XFN A;  1IUV A;  3LZX A;  3NH3 X;  2WDV A;  3BHF A;  4H4P A;  4C77 A;  4NEW A;  4YSX A;  4OVI A;  3LZW A;  1F8S A;  1GT8 A;  3CGB A;  3SX6 A;  4NWZ A;  3AEG A;  3GWF A;  3KVE A;  4EMJ A;  2B9X A;  1IUU A;  1FCD A;  1FEC A;  3AE5 A;  3UP4 A;  1MXT A;  3AE1 A;  3UKH A;  2YVG A;  2YR5 A;  2BXR A;  1P2H A;  2FJE A;  3ICT A;  1PBB A;  3ATR A;  4DSG A;  2NVK X;  2CDU A;  3HYW A;  4CCQ A;  2VZ2 A;  1S3B A;  4U8P A;  3UTF A;  1NAA A;  2R0G A;  2Z5Y A;  3IHM A;  3PO7 A;  2BRA A;  2GAG B;  4YT0 A;  4BJZ A;  4GF7 A;  4Z25 A;  5TR3 A;  1ZK7 A;  2JKC A;  3M13 A;  4H4W A;  4D04 A;  4EQX A;  2IVE A;  3K30 A;  5CKU A;  1DNC A;  3QVP A;  1LQU A;  1TYT A;  3ALL A;  4Y4M A;  3SZF A;  1YQ3 A;  3COX A;  1KNR A;  3KPF A;  1E7P A;  2BRY A;  4WX1 A;  2XFP A;  2GR0 A;  1D7Y A;  1EL9 A;  2WP9 A;  1GXF A;  2A8X A;  4J36 A;  4OPI A;  1YY5 A;  3FG2 P;  4U2L A;  3RED A;  3ICS A;  4JNA A;  4BJY A;  4K7Z A;  5HHF A;  2GAH B;  3RP6 A;  4A99 A;  2VQ7 A;  3F8R A;  5KRQ A;  4EQW A;  1S2Q A;  3ADA B;  3T14 A;  4O5Q A;  3QFB A;  3SM8 A;  4A79 A;  3LXD A;  5IPY A;  2C3C A;  2QAE A;  4H4S A;  1SEZ A;  2O9Z A;  1FOH A;  2C70 A;  3V76 A;  3AYJ A;  4GDP A;  3UKL A;  3T0K A;  2YM1 A;  1ZX9 A;  2YLZ A;  2XDO A;  3AYI A;  3ICR A;  2YLW A;  3P4Q A;  2WP5 A;  3WE0 A;  1DOE A;  5KWF A;  3G5S A;  4C5O A;  2ZZ0 A;  3AE8 A;  4A6N B;  2ZBW A;  1JEH A;  3P4S A;  1EL7 A;  1KFY A;  2X3N A;  2BK5 A;  2J3N A;  3IHG A;  4JY2 A;  3RP8 A;  3ZYX A;  5JCI A;  1K0I A;  1GES A;  2DKH A;  3BHK A;  1N1P A;  1JNZ A;  1GRA A;  2F5Z A;  2C64 A;  2V3A A;  4APN A;  1XPQ A;  2R0P A;  1FEA A;  5L46 A;  2APG A;  1CBO A;  2X8C A;  2V61 A;  1MOK A;  2R46 A;  2FJB A;  2YG6 A;  3B3R A;  4Y4N A;  4I58 A;  4AT2 A;  3SFE A;  5BUL A;  1M64 A;  2XVJ A;  4C74 A;  3B6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...