5BULA

Structure of flavin-dependent brominase bmp2 triple mutant y302s f306v a345w
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
397
structure length
392
Chain Sequence
HYDVVIIGSGPAGSLCGIECRKKGLSVLCIEKEQFPRFHIGESLTGNAGQIIRDLGLAEDMDAAGFPDKPGVNVIGSLSKNEFFIPILAPTWQVRRSDFDDMIKRKAVEHGVEYKLGMVTDVIKDGEKVVGALYKADGVEHQVRSKVLVDASGQNTFLSRKGVAGKRQIEFFSQQIASFAHYKGVERDLPPFSTNTTILYSKQYHWSWIIPISPDTDSLGVVIPKDLYYKECNPDDAIAWGMDHISPELKRRFKNAERQGDSQSMADFSYRIEPFVGDGWMCIGDAHRFLDPIFSSGVSVAMKEGIRAAEAIAQVVAGQDWKAPFYAYRDWSNGGQQIWADLIRYFWIYPIFFGYQMQNPRDEVIRLLGGCCFDGWKAPAIFRNAIEEYDRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces
molecule tags Hydrolase
molecule keywords flavin-dependent halogenase triple mutant
total genus 140
structure length 392
sequence length 397
ec nomenclature
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bulA00
2WP9A 1PBFA 2R45A 4JNQA 2R4JA 2GR3A 2Z5YA 2C3DA 4AT0A 2GEWA 2J3NA 2QAEA 3IHGA 4U8IA 5IQ1A 4Y4NA 4H2PA 3DGHA 1ZOVA 3DK4A 4GUVA 5FS7A 1IUWA 1N4WA 3H8IA 1IUTA 2FJEA 1YQ4A 2QA1A 4NEWA 3AE1A 3UKFA 1E1NA 1DOCA 3KD9A 4K8DA 4J33A 3KU9A 1CL0A 1GETA 1FL2A 1N1PA 1NG3A 4CBQA 4X9NA 1GTHA 2B9WA 4YT0A 2E4GA 4IVOB 5C3JA 2OLOA 3B3RA 4A65A 1PHHA 1ZK7A 3DK8A 3CNDA 1LV0A 2YVGA 3QJ4A 4UDRA 3ZDNA 3AXBA 3AE6A 1FOHA 3UKHA 5KOXA 2YLSA 1E39A 1SEZA 2YWLA 2YQUA 3M0OA 2XFOA 4TLZA 4USQA 2GR1A 5EB5A 1Y0PA 1CC2A 1DOBA 2C70A 1NHSA 3BNMA 5BULA 4D03A 2BYBA 5JCNA 3CGDA 1CF3A 4B65A 4YTNA 4JY3A 2X8CA 3NN0X 3LJPA 2EQ7A 2TPRA 1PDHA 3SFEA 1TRBA 3L8KA 4CCQA 1VDCA 4BK1A 4GR1A 4EMIA 2BACA 3AEDA 2XVJA 1S2YA 4FK1A 1YQ3A 4CNJA 2XLTA 1CBOA 4DSGA 3CGBA 2GF3A 5KWFA 1IUXA 4A99A 3VQRA 2B7SA 3REDA 1EBDA 1H6VA 3AEBA 4YXDA 4O5UA 3DJGX 3CGCA 3P4QA 2GRTA 4RSLA 2ACZA 4J36A 3RP7A 4EIQA 2A89A 2X3NA 1EL5A 2PHHA 2R0PA 3GRTA 3LXDA 4RG3A 1XHCA 4OPUA 1EL9A 4TM3A 2A87A 5HXIA 1B8SA 3H4KA 3UKQA 3AE7A 4YKFA 1PBBA 2JKCA 2AR8A 4OPCA 4OPTA 3RNMA 1IUSA 4JDRA 1KSSA 3VR9A 3GMCA 3PO7A 3ISHA 1ZKQA 4Z24A 3FMWA 3HZLA 2X99A 4Y4LA 4Z44A 3ATRA 3UTHA 4U8LA 2V3BA 1BGNA 4CRTA 1YY5A 3UOYA 1TDEA 1Q9IA 2R9ZA 4NTCA 2I0ZA 2E1MA 1NPXA 1MO9A 4A7AA 2ZBWA 3NLCA 3GD3A 1PN0A 2Q6UA 3Q9TA 1DXLA 2VVMA 4K2XA 1RYIA 1AOGA 2GV8A 4AP3A 4BURA 4BV6A 2C75A 2WDQA 3IHMA 3OZ2A 4YKGA 5HY5A 4YSYA 1K0LA 2NPXA 4E0VA 1DJQA 3P9UA 4YWOA 2WP5A 3BI2A 2UZZA 1ZP0A 2HQMA 3LZWA 3M13A 3F8RA 1KNPA 4H4PA 2GB0A 1XPQA 1N4UA 1UKVG 1KF6A 2Q7VA 3C96A 3CPHG 3IC9A 3NK0X 4OPGA 4ZN0A 3ICTA 4H4XA 5U1OA 1LQTA 2XFQA 5IQ4A 3O0HA 3GWFA 4JY2A 2XVFA 3AE8A 2JK6A 1TYPA 3ATQA 1CJ3A 2YLWA 1BZLA 1Y56A 1VG0A 1O5WA 3F8DA 3D1CA 4YSHA 2GAHB 4ECHA 3AEFA 2YG6A 2YLZA 2DKHA 1BWCA 4H50A 1NHQA 5CKUA 4IA5A 4B66A 4IA6A 2XLUA 4LIIA 1H7XA 3AEEA 3P4RA 3NTDA 1LTXR 2R0GA 4J56A 4YTMA 4C3XA 2YR5A 1E1LA 3AE3A 2A8XA 4Z43A 3SGLA 1NENA 2R4EA 1B5QA 3AYIA 3DK9A 2YM2A 1B37A 2BCPA 3SQPA 5JCMA 3UTEA 1FEBA 2CDUA 2JBVA 4EM3A 2X50A 1PXBA 1NAAA 3E1TA 4LA1A 3UOZA 1MXTA 5EB4A 4BJZA 1GRTA 2AAQA 3FG2P 4H4SA 5JCIA 3AE2A 1L9EA 3GRSA 1L9CA 3GSIA 3CIRA 1M6IA 4H7UA 2B76A 5GSNA 3I6DA 3IWAA 3NGCX 1GRHA 2YG3A 3C4NA 4K5RA 1JU2A 2ZZCA 2BA9A 2WHDA 4BK2A 1QLBA 2VVLG 4CY6A 3QVRA 3D8XA 3KKJA 4U2TA 1REOA 2ZZ0A 3CNTA 2C67A 4DSHA 2YM1A 5J7XA 2XVHA 3GDPA 3CNSA 1H7WA 2GAGB 3FIMB 4FDCB 1GT8A 3NG7X 5HHFA 1D4DA 1OJDA 4FX9A 3AEAA 4EQXA 1O95A 1K0IA 3QSEA 2B9XA 2XYOA 4EQWA 2YG5A 3P1WA 3EPTA 2BK5A 2BS2A 3KLJA 3QVPA 3V3OA 3KA7A 4MJWA 1GSNA 5M0ZA 4B63A 1OJTA 4PAAA 2GR2A 2NVKX 2C72A 4I59A 3K7TA 2FJBA 2OA1A 1ONFA 1GV4A 4A79A 4CY8A 1F8SA 2GH5A 4HA6A 2EQ8A 1ZX9A 3V76A 3T37A 2BS4A 1D4EA 5FS9A 2GVCA 4B1BA 5IPYA 1YQZA 2RABA 4H2QA 3WE0A 4EQSA 2BS3A 4TM1A 5KXJA 4H2NA 3AD8B 4H4RA 2YR6A 3ALJA 3NK2X 4USRA 3QSSA 2EQ6A 5FMHA 4C5OA 3NH3X 4GDEA 1BF3A 3AYLA 4UDQA 1Q1WA 2C7GA 1EL8A 5EBKA 1NHRA 2XLRA 4DNAA 3L1RA 2WPCA 2YVJA 5BUKA 1GEUA 3CNJA 4IVMB 4P9SA 4DGKA 1DNCA 1E1KA 5JCKA 2BXRA 3GD4A 3VRDB 4I58A 2JAEA 2WU5A 1CC4A 3FPZA 5HYMA 1X31B 4U2LA 2YAUA 1H82A 4EMWA 2QCUA 4H4WA 4A5LA 1OJAA 4NTEA 3S61A 1BGJA 1K0JA 5JCLA 3UOVA 1KDGA 3UKPA 3UP5A 3CGEA 1GRAA 3EAOA 4CNKA 1NDAA 4H4UA 1GERA 1MOKA 2XLPA 4A6NA 1GREA 4PABA 4TM4A 5BRTA 1PBEA 2WOVA 4Z2TA 3RHAA 2O9ZA 3DJEA 4AT2A 5KVHA 1JNRA 1GOSA 1GESA 1TDKA 3H8LA 2Q0KA 4C74A 5FS8A 2VVLA 2RGJA 3VR8A 4B67A 1RP0A 3ABVA 3BI5A 4U8JA 2W0HA 3VRAA 2BCGG 3PS9A 4A6NB 4GCMA 2WEUA 2WBAA 2PYXA 1GRBA 4AOXA 4Z25A 4H4VA 5TR3A 1B4VA 1Y56B 1Q1RA 2XVIA 3BHKA 4U8MA 1LPFA 1NEKA 2QA2A 3IF9A 1TYTA 1EL7A 1ZY8A 1LVLA 2JB3A 2WESA 2WP6A 3BI4A 3LZXA 4OVIA 4AP1A 2BC1A 1P2HA 3UKKA 2V6OA 2WPFA 3K30A 2H88A 4XWRA 5GRTA 3ALLA 4EIPA 1YKJA 5DBJA 4H4YA 5M10A 3V3NA 1E1MA 1CJCA 3R9UA 3VRBA 3CTYA 1GRGA 3LOVA 1IJHA 2TMDA 1TDNA 2IIDA 3ITJA 4YTPA 2RGOA 3AYJA 1IUVA 4H4TA 2WOWA 3Q6JA 3QFAA 1ZMCA 4TM0A 3UOXA 4Z2RA 5KRQA 3AEGA 4XWZA 4ICYA 4K5SA 1IUUA 1M64A 4ADWA 5EOWA 2AQJA 1ELIA 2FJDA 4B68A 3UTFA 1K4QA 1FECA 1DOEA 1XANA 2WDVA 1VQWA 3EF6A 4LU6A 3RP8A 4JN9A 4X9MA 1GPEA 4OPLA 4REKA 1NG4A 1FEAA 4U2SA 3ICRA 4WCTA 2WDRA 4ZCDA 2Y6QA 4N9XA 2YG7A 3NK1X 2V60A 2YLRA 1ZMDA 2XCGA 3JSKA 4YSZA 3QFBA 3GMBA 3NRNA 2Z5XA 4BK3A 3UTGA 1GRFA 1OJCA 3I3LA 4Z26A 5KVIA 4B69A 2FJAA 3NYCA 4EM4A 1JRXA 3G5RA 2XFUA 2C76A 2FBWA 2VQ7A 3F8PA 3ICSA 3BNUA 3DJJA 1XDIA 5C2TA 3NTAA 4EMJA 4J57A 4M52A 1PJ6A 1F6MA 3C4AA 1GXFA 1P2EA 4APNA 2EQ9A 3AE9A 3CN8A 3P4PA 3UKLA 2BABA 1KFYA 3NNEA 2B7RA 1DJNA 4IV9A 2RGHA 2C3CA 2WQYA 4KPRA 2YVFA 2E5VA 3DMEA 1PS9A 2XLSA 5U63A 2R0CA 2WETA 3UCLA 1E7PA 4OPDA 1JRYA 2F5ZA 3NHOX 2GQWA 3AECA 1PJ7A 3FBSA 2GMHA 2JB2A 3KPFA 4X4JA 1V59A 4K22A 3SFDA 1D7LA 2B9YA 3NKSA 4GDPA 4NTDA 4U8NA 4A9WA 1ZOYA 5FS6A 3GDNA 2BXSA 4OPIA 4YSXA 3P4SA 1D4CA 4J2WA 1PXCA 3S5WA 3BHFA 2WS3A 2X8GA 1L9DA 1F3PA 2C73A 1QJDA 4AOSA 2IVEA 2XVEA 5L46A 3CNPA 1FCDA 4BJYA 4U8PA 1H83A 1GNDA 3AD7B 3AD9B 3G5QA 4B64A 3COXA 1GALA 4U8KA 4OCGA 3CPIG 1PBCA 2V61A 3NT6A 4J31A 2VRMA 1TDFA 2WOIA 4NZHA 1JEHA 2XFPA 1D7YA 2C66A 2ZZBA 2YG4A 1S2QA 4NEVA 4U8OA 1QO8A 2VOUA 3NYFA 4HB9A 3ALMA 1GTEA 2R46A 4Y4MA 2WPEA 3OC4A 3AE4A 5U25A 3LB8A 2APGA 2CVJA 1HYUA 4GRTA 1RSGA 3GYIA 4ZCCA 2BK4A 4TLXA 1Z6LA 2CULA 3AB1A 1VRQB 2BC0A 3DA1A 1L0VA 3NYEA 1COYA 1TDOA 2OALA 1H81A 5J60A 2ARDA 1PJ5A 3GYJA 4UP3A 4D04A 4EQRA 2CFYA 1VG9A 1JNZA 1CHUA 5BVAA 1O94A 1JOAA 3NIXA 3M12A 2H89A 1ZDLA 2JB1A 3PVCA 4H2RA 2BK3A 2GQFA 1W4XA 4UDPA 3NN6X 2V5ZA 2DKIA 4WX1A 5CQFA 1S3EA 4C3YA 3AE5A 1PBDA 5ER0A 1OJ9A 3ZYXA 1KSUA 2C65A 2OAMA 3K7QX 2VRLA 3DJDA 2Q0LA 2Y6RA 3GWDA 3AWIA 2C64A 2X8HA 4JNAA 3URHA 4C77A 1S3BA 1DODA 3G5SA 3DGZA 3UKAA 2VQBA 5LV9A 4Z2UA 2YLXA 3KVEA 1F8WA 1E6EA 1JRZA 2OLNA 2XDOA 3CPJG 2YR4A 1H86A 4JQ9A 2IVDA 5KOWA 2XFNA 3RP6A 1KNRA 2YLTA 4XXGA 1D5TA 4GF7A 4H4ZA 1H84A 4FK1C 1N4VA 4O5QA 2WU2A 1CJ2A 1CJ4A 3QSMA 3ADAB 3EANA 1CC6A 1F8RA 3K7MX 4J34A 3II4A 1PXAA 4KX6A 1LJ1A 4CCRA 3SM8A 2VZ2A 2GMJA 3LADA 3DH9A 3UP4A 1NHPA 2V3AA 4H4QA 4RG4A 1LQUA 1BKWA 4K7ZA 3B6DA 2GR0A
chains in the Genus database with same CATH superfamily
2WP9A 1PBFA 2R45A 4JNQA 4II2A 2R4JA 2GR3A 2Z5YA 2C3DA 4AT0A 2GEWA 2J3NA 2QAEA 3IHGA 4U8IA 5IQ1A 4Y4NA 4H2PA 3DGHA 1ZOVA 3DK4A 4GUVA 5FS7A 1IUWA 1N4WA 3H8IA 1IUTA 2FJEA 1YQ4A 2QA1A 4NEWA 3AE1A 3UKFA 1E1NA 1DOCA 3KD9A 4K8DA 4J33A 3KU9A 1CL0A 1GETA 1FL2A 1N1PA 1NG3A 4CBQA 4X9NA 1GTHA 2B9WA 4YT0A 2E4GA 4IVOB 5C3JA 2OLOA 3B3RA 4A65A 1PHHA 1ZK7A 3DK8A 3CNDA 1LV0A 2YVGA 3QJ4A 4UDRA 3ZDNA 3AXBA 3AE6A 1FOHA 3UKHA 5KOXA 2YLSA 1E39A 1SEZA 2YWLA 2YQUA 3M0OA 2XFOA 4TLZA 4USQA 2GR1A 5EB5A 1Y0PA 1CC2A 1DOBA 2C70A 1NHSA 3BNMA 5BULA 4D03A 2BYBA 5JCNA 3CGDA 1CF3A 3CMMA 5KNLA 4B65A 4YTNA 4JY3A 2X8CA 3NN0X 3LJPA 2EQ7A 2TPRA 1PDHA 3SFEA 1TRBA 3L8KA 4CCQA 1VDCA 4BK1A 4GR1A 4EMIA 2BACA 3AEDA 2XVJA 1S2YA 4FK1A 1YQ3A 3KPKA 4II3A 4CNJA 2XLTA 1CBOA 4DSGA 3CGBA 2GF3A 5KWFA 1IUXA 4A99A 3VQRA 2B7SA 3REDA 1EBDA 1H6VA 3AEBA 4YXDA 4O5UA 3T2YA 3DJGX 3CGCA 3P4QA 2GRTA 4RSLA 2ACZA 4J36A 3RP7A 4EIQA 2A89A 2X3NA 1EL5A 2PHHA 2R0PA 3GRTA 3LXDA 4RG3A 1XHCA 4OPUA 1EL9A 4TM3A 2A87A 5HXIA 1B8SA 3H4KA 3UKQA 3AE7A 4YKFA 1PBBA 2JKCA 2AR8A 4OPCA 4OPTA 3RNMA 1IUSA 4JDRA 1KSSA 3VR9A 3GMCA 3PO7A 3ISHA 1ZKQA 4Z24A 3FMWA 3HZLA 3SY4A 2X99A 4Y4LA 4Z44A 3ATRA 3UTHA 4U8LA 2V3BA 1BGNA 3GYXA 4G6HA 1YY5A 3UOYA 4CRTA 1TDEA 1Q9IA 2R9ZA 4NTCA 2I0ZA 2E1MA 1NPXA 1MO9A 4A7AA 2ZBWA 3NLCA 3GD3A 1PN0A 2Q6UA 3Q9TA 1DXLA 2VVMA 4K2XA 1RYIA 1AOGA 2GV8A 4AP3A 4BURA 4BV6A 2C75A 2WDQA 3IHMA 3OZ2A 4YKGA 5HY5A 4YSYA 1K0LA 2NPXA 4E0VA 1DJQA 3P9UA 4YWOA 2WP5A 3BI2A 2UZZA 1ZP0A 2HQMA 3LZWA 3M13A 3F8RA 1KNPA 4H4PA 2GB0A 1XPQA 1N4UA 4G74A 1UKVG 1KF6A 2Q7VA 3C96A 3CPHG 3IC9A 3NK0X 4OPGA 4ZN0A 3ICTA 4H4XA 5U1OA 1LQTA 2XFQA 5IQ4A 3O0HA 3GWFA 4JY2A 2XVFA 3AE8A 2JK6A 1TYPA 3ATQA 1CJ3A 2YLWA 1BZLA 5KMPA 1Y56A 1VG0A 1O5WA 3F8DA 3D1CA 4YSHA 2GAHB 4ECHA 3AEFA 2YG6A 3SZ0A 2YLZA 2DKHA 1BWCA 4H50A 1NHQA 5CKUA 3SXIA 4IA5A 4B66A 4IA6A 2XLUA 4LIIA 1H7XA 3AEEA 3P4RA 3SZFA 3NTDA 1LTXR 2R0GA 4J56A 4YTMA 4C3XA 2YR5A 1E1LA 3AE3A 2A8XA 4Z43A 3SGLA 1NENA 2R4EA 1B5QA 3AYIA 3DK9A 2YM2A 1B37A 2BCPA 3SQPA 5JCMA 3UTEA 1FEBA 4NWZA 2CDUA 2JBVA 4EM3A 2X50A 1PXBA 1NAAA 3E1TA 4LA1A 3UOZA 1MXTA 5EB4A 4BJZA 1GRTA 2AAQA 3FG2P 4H4SA 5JCIA 3AE2A 1L9EA 3GRSA 1L9CA 3GSIA 3CIRA 1M6IA 4H7UA 2B76A 5GSNA 3I6DA 3IWAA 3NGCX 1GRHA 2YG3A 3C4NA 4K5RA 1JU2A 2ZZCA 2BA9A 2WHDA 4GAPA 1QLBA 2VVLG 4CY6A 3QVRA 3D8XA 3KKJA 4U2TA 1REOA 2ZZ0A 3CNTA 2C67A 4DSHA 2YM1A 5J7XA 2XVHA 3GDPA 3CNSA 1H7WA 2GAGB 3FIMB 4FDCB 1GT8A 3NG7X 5HHFA 1D4DA 1OJDA 3SX6A 4FX9A 3AEAA 4EQXA 1O95A 1K0IA 3QSEA 2B9XA 2XYOA 4EQWA 2YG5A 3P1WA 3EPTA 2BK5A 2BS2A 3KLJA 3QVPA 3V3OA 3KA7A 4MJWA 1GSNA 5M0ZA 4B63A 1OJTA 4PAAA 2GR2A 2NVKX 4NNJA 2C72A 3T14A 4I59A 3K7TA 2FJBA 2OA1A 1ONFA 1GV4A 3T31A 4A79A 4CY8A 1F8SA 2GH5A 4HA6A 2EQ8A 1ZX9A 3V76A 3T37A 2BS4A 1D4EA 5FS9A 2GVCA 4B1BA 5IPYA 1YQZA 2RABA 4H2QA 3WE0A 4EQSA 2BS3A 4TM1A 5KXJA 4H2NA 3AD8B 4H4RA 2YR6A 3ALJA 3NK2X 4USRA 3QSSA 2EQ6A 5FMHA 4C5OA 3NH3X 4GDEA 1BF3A 3AYLA 4UDQA 1Q1WA 2C7GA 1EL8A 5EBKA 1NHRA 2XLRA 5KMQA 4DNAA 3L1RA 2WPCA 2YVJA 5BUKA 1GEUA 3CNJA 4IVMB 4P9SA 4DGKA 1DNCA 1E1KA 5JCKA 2BXRA 3GD4A 3VRDB 3SZWA 4I58A 5KMSA 2JAEA 2WU5A 1CC4A 3FPZA 5HYMA 1X31B 4U2LA 2YAUA 1H82A 4EMWA 2QCUA 4H4WA 4A5LA 1OJAA 4NTEA 3S61A 1BGJA 1K0JA 5JCLA 3UOVA 1KDGA 3UKPA 3UP5A 3CGEA 1GRAA 3EAOA 4CNKA 1NDAA 4H4UA 1GERA 1MOKA 2XLPA 4A6NA 1GREA 4PABA 4TM4A 5BRTA 1PBEA 2WOVA 4Z2TA 3RHAA 2O9ZA 3DJEA 4AT2A 5KVHA 1JNRA 1GOSA 1GESA 1TDKA 3H8LA 2Q0KA 4C74A 5FS8A 2VVLA 2RGJA 3VR8A 4B67A 1RP0A 3ABVA 3BI5A 4U8JA 2W0HA 3VRAA 2BCGG 3PS9A 4A6NB 4GCMA 2WEUA 2WBAA 2PYXA 1GRBA 4AOXA 4Z25A 3HYWA 4H4VA 5TR3A 1B4VA 1Y56B 1Q1RA 2XVIA 3BHKA 4U8MA 1LPFA 1NEKA 2QA2A 3IF9A 1TYTA 1EL7A 1ZY8A 1LVLA 2JB3A 2WESA 2WP6A 3BI4A 3LZXA 4OVIA 4AP1A 2BC1A 1P2HA 3UKKA 2V6OA 2WPFA 3K30A 3T2ZA 2H88A 4XWRA 5GRTA 3ALLA 4EIPA 1YKJA 5DBJA 4H4YA 5M10A 3V3NA 1E1MA 3SYIA 1CJCA 3R9UA 3VRBA 3CTYA 1GRGA 3LOVA 1IJHA 2TMDA 1TDNA 2IIDA 3ITJA 4G9KA 4YTPA 2RGOA 3AYJA 1IUVA 4H4TA 2WOWA 3Q6JA 3QFAA 1ZMCA 4TM0A 3UOXA 4Z2RA 5KRQA 3AEGA 4XWZA 4ICYA 4K5SA 1IUUA 1M64A 4ADWA 5EOWA 2AQJA 1ELIA 2FJDA 4B68A 3UTFA 1K4QA 1FECA 1DOEA 1XANA 2WDVA 1VQWA 3EF6A 4LU6A 3RP8A 4JN9A 4X9MA 2C4CA 1GPEA 4OPLA 4REKA 1NG4A 1FEAA 4U2SA 3ICRA 4WCTA 2WDRA 4ZCDA 2Y6QA 4N9XA 2YG7A 3NK1X 2V60A 2YLRA 1ZMDA 2XCGA 3JSKA 4YSZA 3QFBA 3GMBA 3NRNA 2Z5XA 4BK3A 3UTGA 1GRFA 1OJCA 3I3LA 4Z26A 5KVIA 4B69A 2FJAA 3NYCA 4EM4A 1JRXA 3G5RA 2XFUA 2C76A 2FBWA 2VQ7A 3F8PA 3ICSA 4GAVA 3BNUA 3DJJA 1XDIA 5C2TA 3NTAA 4EMJA 4J57A 4M52A 1PJ6A 1F6MA 3C4AA 1GXFA 1P2EA 4APNA 2EQ9A 3AE9A 3CN8A 3P4PA 3UKLA 2BABA 1KFYA 3NNEA 2B7RA 3SZCA 1DJNA 4IV9A 2RGHA 2C3CA 5KMRA 2WQYA 4KPRA 2YVFA 2E5VA 3DMEA 1PS9A 2XLSA 5U63A 2R0CA 2WETA 3UCLA 1E7PA 4OPDA 1JRYA 2F5ZA 3NHOX 2GQWA 3AECA 1PJ7A 3FBSA 2GMHA 2JB2A 3KPFA 4X4JA 1V59A 4K22A 3SFDA 1D7LA 2B9YA 3NKSA 4GDPA 4NTDA 4U8NA 4A9WA 1ZOYA 5FS6A 4BK2A 3GDNA 2BXSA 4OPIA 4YSXA 3P4SA 1D4CA 4J2WA 1PXCA 3S5WA 3BHFA 2WS3A 2X8GA 1L9DA 1F3PA 2BRAA 2C73A 1QJDA 4AOSA 2IVEA 2XVEA 5L46A 3CNPA 1FCDA 4BJYA 4U8PA 1H83A 1GNDA 3AD7B 3AD9B 3G5QA 4B64A 3COXA 1GALA 4U8KA 4OCGA 3CPIG 1PBCA 2V61A 3NT6A 4J31A 3T0KA 2VRMA 1TDFA 2WOIA 4NZHA 3HYXA 1JEHA 2XFPA 1D7YA 2C66A 2ZZBA 2BRYA 2YG4A 1S2QA 4NEVA 4U8OA 1QO8A 2VOUA 3NYFA 4HB9A 3ALMA 1GTEA 2R46A 4Y4MA 2WPEA 3OC4A 3AE4A 5U25A 3LB8A 2APGA 2CVJA 1HYUA 4GRTA 1RSGA 3GYIA 4ZCCA 2BK4A 4TLXA 1Z6LA 2CULA 3AB1A 1VRQB 2BC0A 3DA1A 4G73A 3NYEA 1L0VA 1COYA 1TDOA 2OALA 1H81A 4G6GA 2ARDA 1PJ5A 5J60A 3GYJA 4UP3A 4D04A 4EQRA 2CFYA 1VG9A 1JNZA 1CHUA 5BVAA 1O94A 1JOAA 3NIXA 3M12A 2H89A 1ZDLA 2JB1A 3PVCA 4H2RA 2BK3A 2GQFA 1W4XA 4UDPA 3NN6X 2V5ZA 2DKIA 4WX1A 5CQFA 1S3EA 4C3YA 3AE5A 1PBDA 5ER0A 1OJ9A 3ZYXA 1KSUA 2C65A 2OAMA 3K7QX 2VRLA 3DJDA 2Q0LA 2Y6RA 3GWDA 3AWIA 2C64A 2X8HA 4JNAA 3URHA 4C77A 1S3BA 1DODA 3G5SA 3DGZA 3UKAA 2VQBA 5LV9A 4Z2UA 2YLXA 3KVEA 3T2KA 1F8WA 1E6EA 1JRZA 2OLNA 2XDOA 3CPJG 2YR4A 1H86A 4JQ9A 2IVDA 5KOWA 2XFNA 3RP6A 1KNRA 2YLTA 4XXGA 1D5TA 4GF7A 3HYVA 4H4ZA 1H84A 4FK1C 1N4VA 4O5QA 2WU2A 1CJ2A 1CJ4A 3QSMA 3ADAB 3EANA 1CC6A 1F8RA 3K7MX 4J34A 3II4A 1PXAA 4KX6A 1LJ1A 4CCRA 3SM8A 2VZ2A 2GMJA 3LADA 3DH9A 3UP4A 1NHPA 2V3AA 4H4QA 4RG4A 1LQUA 1BKWA 4K7ZA 3B6DA 2GR0A
chains in the Genus database with same CATH topology
2WP9A 1PBFA 2R45A 4JNQA 4II2A 2R4JA 2GR3A 2Z5YA 2C3DA 4AT0A 2GEWA 2J3NA 2QAEA 3IHGA 4U8IA 5IQ1A 4Y4NA 4H2PA 3DGHA 1ZOVA 3DK4A 4GUVA 5FS7A 1IUWA 1N4WA 3H8IA 1IUTA 2FJEA 1YQ4A 2QA1A 4NEWA 3AE1A 3UKFA 1E1NA 1DOCA 3KD9A 4K8DA 4J33A 3KU9A 1CL0A 1GETA 1FL2A 1N1PA 1NG3A 4CBQA 4X9NA 1GTHA 2B9WA 4YT0A 2E4GA 4IVOB 5C3JA 2OLOA 3B3RA 4A65A 1PHHA 1ZK7A 3DK8A 3CNDA 1LV0A 2YVGA 3QJ4A 4UDRA 3ZDNA 3AXBA 3AE6A 1FOHA 3UKHA 5KOXA 2YLSA 1E39A 1SEZA 2YWLA 2YQUA 3M0OA 2XFOA 4TLZA 4USQA 2GR1A 5EB5A 1Y0PA 1CC2A 1DOBA 2C70A 1NHSA 3BNMA 5BULA 4D03A 2BYBA 5JCNA 3CGDA 1CF3A 3CMMA 5KNLA 4B65A 4YTNA 4JY3A 2X8CA 3NN0X 3LJPA 2EQ7A 2TPRA 1PDHA 3SFEA 1TRBA 3L8KA 4CCQA 1VDCA 4BK1A 4GR1A 4EMIA 2BACA 3AEDA 2XVJA 1S2YA 4FK1A 1YQ3A 3KPKA 4II3A 4CNJA 2XLTA 1CBOA 4DSGA 3CGBA 2GF3A 5KWFA 1IUXA 4A99A 3VQRA 2B7SA 3REDA 1EBDA 1H6VA 3AEBA 4YXDA 4O5UA 3T2YA 3DJGX 3CGCA 3P4QA 2GRTA 4RSLA 2ACZA 4J36A 3RP7A 4EIQA 2A89A 2X3NA 1EL5A 2PHHA 2R0PA 3GRTA 3LXDA 4RG3A 1XHCA 4OPUA 1EL9A 4TM3A 2A87A 5HXIA 1B8SA 3H4KA 3UKQA 3AE7A 4YKFA 1PBBA 2JKCA 2AR8A 4OPCA 4OPTA 3RNMA 1IUSA 4JDRA 1KSSA 3VR9A 3GMCA 3PO7A 3ISHA 1ZKQA 4Z24A 3FMWA 3HZLA 3SY4A 2X99A 4Y4LA 4Z44A 3ATRA 3UTHA 4U8LA 2V3BA 1BGNA 3GYXA 4G6HA 1YY5A 3UOYA 4CRTA 1TDEA 1Q9IA 2R9ZA 4NTCA 2I0ZA 2E1MA 1NPXA 1MO9A 4A7AA 2ZBWA 3NLCA 3GD3A 1PN0A 2Q6UA 3Q9TA 1DXLA 2VVMA 4K2XA 1RYIA 1AOGA 2GV8A 4AP3A 4BURA 4BV6A 2C75A 2WDQA 3IHMA 3OZ2A 4YKGA 5HY5A 4YSYA 1K0LA 2NPXA 4E0VA 1DJQA 3P9UA 4YWOA 2WP5A 3BI2A 2UZZA 1ZP0A 2HQMA 3LZWA 3M13A 3F8RA 1KNPA 4H4PA 2GB0A 1XPQA 1N4UA 4G74A 1UKVG 1KF6A 2Q7VA 3C96A 3CPHG 3IC9A 3NK0X 4OPGA 4ZN0A 3ICTA 4H4XA 5U1OA 1LQTA 2XFQA 5IQ4A 3O0HA 3GWFA 4JY2A 2XVFA 3AE8A 2JK6A 1TYPA 3ATQA 1CJ3A 2YLWA 1BZLA 5KMPA 1Y56A 1VG0A 1O5WA 3F8DA 3D1CA 4YSHA 2GAHB 4ECHA 3AEFA 2YG6A 3SZ0A 2YLZA 2DKHA 1BWCA 4H50A 1NHQA 5CKUA 3SXIA 4IA5A 4B66A 4IA6A 2XLUA 4LIIA 1H7XA 3AEEA 3P4RA 3SZFA 3NTDA 1LTXR 2R0GA 4J56A 4YTMA 4C3XA 2YR5A 1E1LA 3AE3A 2A8XA 4Z43A 3SGLA 1NENA 2R4EA 1B5QA 3AYIA 3DK9A 2YM2A 1B37A 2BCPA 3SQPA 5JCMA 3UTEA 1FEBA 4NWZA 2CDUA 2JBVA 4EM3A 2X50A 1PXBA 1NAAA 3E1TA 4LA1A 3UOZA 1MXTA 5EB4A 4BJZA 1GRTA 2AAQA 3FG2P 4H4SA 5JCIA 3AE2A 1L9EA 3GRSA 1L9CA 3GSIA 3CIRA 1M6IA 4H7UA 2B76A 5GSNA 3I6DA 3IWAA 3NGCX 1GRHA 2YG3A 3C4NA 4K5RA 1JU2A 2ZZCA 2BA9A 2WHDA 4GAPA 1QLBA 2VVLG 4CY6A 3QVRA 3D8XA 3KKJA 4U2TA 1REOA 2ZZ0A 3CNTA 2C67A 4DSHA 2YM1A 5J7XA 2XVHA 3GDPA 3CNSA 1H7WA 2GAGB 3FIMB 4FDCB 1GT8A 3NG7X 5HHFA 1D4DA 1OJDA 3SX6A 4FX9A 3AEAA 4EQXA 1O95A 1K0IA 3QSEA 2B9XA 2XYOA 4EQWA 2YG5A 3P1WA 3EPTA 2BK5A 2BS2A 3KLJA 3QVPA 3V3OA 3KA7A 4MJWA 1GSNA 5M0ZA 4B63A 1OJTA 4PAAA 2GR2A 2NVKX 4NNJA 2C72A 3T14A 4I59A 3K7TA 2FJBA 2OA1A 1ONFA 1GV4A 3T31A 4A79A 4CY8A 1F8SA 2GH5A 4HA6A 2EQ8A 1ZX9A 3V76A 3T37A 2BS4A 1D4EA 5FS9A 2GVCA 4B1BA 5IPYA 1YQZA 2RABA 4H2QA 3WE0A 4EQSA 2BS3A 4TM1A 5KXJA 4H2NA 3AD8B 4H4RA 2YR6A 3ALJA 3NK2X 4USRA 3QSSA 2EQ6A 5FMHA 4C5OA 3NH3X 4GDEA 1BF3A 3AYLA 4UDQA 1Q1WA 2C7GA 1EL8A 5EBKA 1NHRA 2XLRA 5KMQA 4DNAA 3L1RA 2WPCA 2YVJA 5BUKA 1GEUA 3CNJA 4IVMB 4P9SA 4DGKA 1DNCA 1E1KA 5JCKA 2BXRA 3GD4A 3VRDB 3SZWA 4I58A 5KMSA 2JAEA 2WU5A 1CC4A 3FPZA 5HYMA 1X31B 4U2LA 2YAUA 1H82A 4EMWA 2QCUA 4H4WA 4A5LA 1OJAA 4NTEA 3S61A 1BGJA 1K0JA 5JCLA 3UOVA 1KDGA 3UKPA 3UP5A 3CGEA 1GRAA 3EAOA 4CNKA 1NDAA 4H4UA 1GERA 1MOKA 2XLPA 4A6NA 1GREA 4PABA 4TM4A 5BRTA 1PBEA 2WOVA 4Z2TA 3RHAA 2O9ZA 3DJEA 4AT2A 5KVHA 1JNRA 1GOSA 1GESA 1TDKA 3H8LA 2Q0KA 4C74A 5FS8A 2VVLA 2RGJA 3VR8A 4B67A 1RP0A 3ABVA 3BI5A 4U8JA 2W0HA 3VRAA 2BCGG 3PS9A 4A6NB 4GCMA 2WEUA 2WBAA 2PYXA 1GRBA 4AOXA 4Z25A 3HYWA 4H4VA 5TR3A 1B4VA 1Y56B 1Q1RA 2XVIA 3BHKA 4U8MA 1LPFA 1NEKA 2QA2A 3IF9A 1TYTA 1EL7A 1ZY8A 1LVLA 2JB3A 2WESA 2WP6A 3BI4A 3LZXA 4OVIA 4AP1A 2BC1A 1P2HA 3UKKA 2V6OA 2WPFA 3K30A 3T2ZA 2H88A 4XWRA 5GRTA 3ALLA 4EIPA 1YKJA 5DBJA 4H4YA 5M10A 3V3NA 1E1MA 3SYIA 1CJCA 3R9UA 3VRBA 3CTYA 1GRGA 3LOVA 1IJHA 2TMDA 1TDNA 2IIDA 3ITJA 4G9KA 4YTPA 2RGOA 3AYJA 1IUVA 4H4TA 2WOWA 3Q6JA 3QFAA 1ZMCA 4TM0A 3UOXA 4Z2RA 5KRQA 3AEGA 4XWZA 4ICYA 4K5SA 1IUUA 1M64A 4ADWA 5EOWA 2AQJA 1ELIA 2FJDA 4B68A 3UTFA 1K4QA 1FECA 1DOEA 1XANA 2WDVA 1VQWA 3EF6A 4LU6A 3RP8A 4JN9A 4X9MA 2C4CA 1GPEA 4OPLA 4REKA 1NG4A 1FEAA 4U2SA 3ICRA 4WCTA 2WDRA 4ZCDA 2Y6QA 4N9XA 2YG7A 3NK1X 2V60A 2YLRA 1ZMDA 2XCGA 3JSKA 4YSZA 3QFBA 3GMBA 3NRNA 2Z5XA 4BK3A 3UTGA 1GRFA 1OJCA 3I3LA 4Z26A 5KVIA 4B69A 2FJAA 3NYCA 4EM4A 1JRXA 3G5RA 2XFUA 2C76A 2FBWA 2VQ7A 3F8PA 3ICSA 4GAVA 3BNUA 3DJJA 1XDIA 5C2TA 3NTAA 4EMJA 4J57A 4M52A 1PJ6A 1F6MA 3C4AA 1GXFA 1P2EA 4APNA 2EQ9A 3AE9A 3CN8A 3P4PA 3UKLA 2BABA 1KFYA 3NNEA 2B7RA 3SZCA 1DJNA 4IV9A 2RGHA 2C3CA 5KMRA 2WQYA 4KPRA 2YVFA 2E5VA 3DMEA 1PS9A 2XLSA 5U63A 2R0CA 2WETA 3UCLA 1E7PA 4OPDA 1JRYA 2F5ZA 3NHOX 2GQWA 3AECA 1PJ7A 3FBSA 2GMHA 2JB2A 3KPFA 4X4JA 1V59A 4K22A 3SFDA 1D7LA 2B9YA 3NKSA 4GDPA 4NTDA 4U8NA 4A9WA 1ZOYA 5FS6A 4BK2A 3GDNA 2BXSA 4OPIA 4YSXA 3P4SA 1D4CA 4J2WA 1PXCA 3S5WA 3BHFA 2WS3A 2X8GA 1L9DA 1F3PA 2BRAA 2C73A 1QJDA 4AOSA 2IVEA 2XVEA 5L46A 3CNPA 1FCDA 4BJYA 4U8PA 1H83A 1GNDA 3AD7B 3AD9B 3G5QA 4B64A 3COXA 1GALA 4U8KA 4OCGA 3CPIG 1PBCA 2V61A 3NT6A 4J31A 3T0KA 2VRMA 1TDFA 2WOIA 4NZHA 3HYXA 1JEHA 2XFPA 1D7YA 2C66A 2ZZBA 2BRYA 2YG4A 1S2QA 4NEVA 4U8OA 1QO8A 2VOUA 3NYFA 4HB9A 3ALMA 1GTEA 2R46A 4Y4MA 2WPEA 3OC4A 3AE4A 5U25A 3LB8A 2APGA 2CVJA 1HYUA 4GRTA 1RSGA 3GYIA 4ZCCA 2BK4A 4TLXA 1Z6LA 2CULA 3AB1A 1VRQB 2BC0A 3DA1A 4G73A 3NYEA 1L0VA 1COYA 1TDOA 2OALA 1H81A 4G6GA 2ARDA 1PJ5A 5J60A 3GYJA 4UP3A 4D04A 4EQRA 2CFYA 1VG9A 1JNZA 1CHUA 5BVAA 1O94A 1JOAA 3NIXA 3M12A 2H89A 1ZDLA 2JB1A 3PVCA 4H2RA 2BK3A 2GQFA 1W4XA 4UDPA 3NN6X 2V5ZA 2DKIA 4WX1A 5CQFA 1S3EA 4C3YA 3AE5A 1PBDA 5ER0A 1OJ9A 3ZYXA 1KSUA 2C65A 2OAMA 3K7QX 2VRLA 3DJDA 2Q0LA 2Y6RA 3GWDA 3AWIA 2C64A 2X8HA 4JNAA 3URHA 4C77A 1S3BA 1DODA 3G5SA 3DGZA 3UKAA 2VQBA 5LV9A 4Z2UA 2YLXA 3KVEA 3T2KA 1F8WA 1E6EA 1JRZA 2OLNA 2XDOA 3CPJG 2YR4A 1H86A 4JQ9A 2IVDA 5KOWA 2XFNA 3RP6A 1KNRA 2YLTA 4XXGA 1D5TA 4GF7A 3HYVA 4H4ZA 1H84A 4FK1C 1N4VA 4O5QA 2WU2A 1CJ2A 1CJ4A 3QSMA 3ADAB 3EANA 1CC6A 1F8RA 3K7MX 4J34A 3II4A 1PXAA 4KX6A 1LJ1A 4CCRA 3SM8A 2VZ2A 2GMJA 3LADA 3DH9A 3UP4A 1NHPA 2V3AA 4H4QA 4RG4A 1LQUA 1BKWA 4K7ZA 3B6DA 2GR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 A;  1PBF A;  2R45 A;  4JNQ A;  2R4J A;  2GR3 A;  2Z5Y A;  2C3D A;  4AT0 A;  2GEW A;  2J3N A;  2QAE A;  3IHG A;  4U8I A;  5IQ1 A;  4Y4N A;  4H2P A;  3DGH A;  1ZOV A;  3DK4 A;  4GUV A;  5FS7 A;  1IUW A;  1N4W A;  3H8I A;  1IUT A;  2FJE A;  1YQ4 A;  2QA1 A;  4NEW A;  3AE1 A;  3UKF A;  1E1N A;  1DOC A;  3KD9 A;  4K8D A;  4J33 A;  3KU9 A;  1CL0 A;  1GET A;  1FL2 A;  1N1P A;  1NG3 A;  4CBQ A;  4X9N A;  1GTH A;  2B9W A;  4YT0 A;  2E4G A;  4IVO B;  5C3J A;  2OLO A;  3B3R A;  4A65 A;  1PHH A;  1ZK7 A;  3DK8 A;  3CND A;  1LV0 A;  2YVG A;  3QJ4 A;  4UDR A;  3ZDN A;  3AXB A;  3AE6 A;  1FOH A;  3UKH A;  5KOX A;  2YLS A;  1E39 A;  1SEZ A;  2YWL A;  2YQU A;  3M0O A;  2XFO A;  4TLZ A;  4USQ A;  2GR1 A;  5EB5 A;  1Y0P A;  1CC2 A;  1DOB A;  2C70 A;  1NHS A;  3BNM A;  5BUL A;  4D03 A;  2BYB A;  5JCN A;  3CGD A;  1CF3 A;  4B65 A;  4YTN A;  4JY3 A;  2X8C A;  3NN0 X;  3LJP A;  2EQ7 A;  2TPR A;  1PDH A;  3SFE A;  1TRB A;  3L8K A;  4CCQ A;  1VDC A;  4BK1 A;  4GR1 A;  4EMI A;  2BAC A;  3AED A;  2XVJ A;  1S2Y A;  4FK1 A;  1YQ3 A;  4CNJ A;  2XLT A;  1CBO A;  4DSG A;  3CGB A;  2GF3 A;  5KWF A;  1IUX A;  4A99 A;  3VQR A;  2B7S A;  3RED A;  1EBD A;  1H6V A;  3AEB A;  4YXD A;  4O5U A;  3DJG X;  3CGC A;  3P4Q A;  2GRT A;  4RSL A;  2ACZ A;  4J36 A;  3RP7 A;  4EIQ A;  2A89 A;  2X3N A;  1EL5 A;  2PHH A;  2R0P A;  3GRT A;  3LXD A;  4RG3 A;  1XHC A;  4OPU A;  1EL9 A;  4TM3 A;  2A87 A;  5HXI A;  1B8S A;  3H4K A;  3UKQ A;  3AE7 A;  4YKF A;  1PBB A;  2JKC A;  2AR8 A;  4OPC A;  4OPT A;  3RNM A;  1IUS A;  4JDR A;  1KSS A;  3VR9 A;  3GMC A;  3PO7 A;  3ISH A;  1ZKQ A;  4Z24 A;  3FMW A;  3HZL A;  2X99 A;  4Y4L A;  4Z44 A;  3ATR A;  3UTH A;  4U8L A;  2V3B A;  1BGN A;  4CRT A;  1YY5 A;  3UOY A;  1TDE A;  1Q9I A;  2R9Z A;  4NTC A;  2I0Z A;  2E1M A;  1NPX A;  1MO9 A;  4A7A A;  2ZBW A;  3NLC A;  3GD3 A;  1PN0 A;  2Q6U A;  3Q9T A;  1DXL A;  2VVM A;  4K2X A;  1RYI A;  1AOG A;  2GV8 A;  4AP3 A;  4BUR A;  4BV6 A;  2C75 A;  2WDQ A;  3IHM A;  3OZ2 A;  4YKG A;  5HY5 A;  4YSY A;  1K0L A;  2NPX A;  4E0V A;  1DJQ A;  3P9U A;  4YWO A;  2WP5 A;  3BI2 A;  2UZZ A;  1ZP0 A;  2HQM A;  3LZW A;  3M13 A;  3F8R A;  1KNP A;  4H4P A;  2GB0 A;  1XPQ A;  1N4U A;  1UKV G;  1KF6 A;  2Q7V A;  3C96 A;  3CPH G;  3IC9 A;  3NK0 X;  4OPG A;  4ZN0 A;  3ICT A;  4H4X A;  5U1O A;  1LQT A;  2XFQ A;  5IQ4 A;  3O0H A;  3GWF A;  4JY2 A;  2XVF A;  3AE8 A;  2JK6 A;  1TYP A;  3ATQ A;  1CJ3 A;  2YLW A;  1BZL A;  1Y56 A;  1VG0 A;  1O5W A;  3F8D A;  3D1C A;  4YSH A;  2GAH B;  4ECH A;  3AEF A;  2YG6 A;  2YLZ A;  2DKH A;  1BWC A;  4H50 A;  1NHQ A;  5CKU A;  4IA5 A;  4B66 A;  4IA6 A;  2XLU A;  4LII A;  1H7X A;  3AEE A;  3P4R A;  3NTD A;  1LTX R;  2R0G A;  4J56 A;  4YTM A;  4C3X A;  2YR5 A;  1E1L A;  3AE3 A;  2A8X A;  4Z43 A;  3SGL A;  1NEN A;  2R4E A;  1B5Q A;  3AYI A;  3DK9 A;  2YM2 A;  1B37 A;  2BCP A;  3SQP A;  5JCM A;  3UTE A;  1FEB A;  2CDU A;  2JBV A;  4EM3 A;  2X50 A;  1PXB A;  1NAA A;  3E1T A;  4LA1 A;  3UOZ A;  1MXT A;  5EB4 A;  4BJZ A;  1GRT A;  2AAQ A;  3FG2 P;  4H4S A;  5JCI A;  3AE2 A;  1L9E A;  3GRS A;  1L9C A;  3GSI A;  3CIR A;  1M6I A;  4H7U A;  2B76 A;  5GSN A;  3I6D A;  3IWA A;  3NGC X;  1GRH A;  2YG3 A;  3C4N A;  4K5R A;  1JU2 A;  2ZZC A;  2BA9 A;  2WHD A;  4BK2 A;  1QLB A;  2VVL G;  4CY6 A;  3QVR A;  3D8X A;  3KKJ A;  4U2T A;  1REO A;  2ZZ0 A;  3CNT A;  2C67 A;  4DSH A;  2YM1 A;  5J7X A;  2XVH A;  3GDP A;  3CNS A;  1H7W A;  2GAG B;  3FIM B;  4FDC B;  1GT8 A;  3NG7 X;  5HHF A;  1D4D A;  1OJD A;  4FX9 A;  3AEA A;  4EQX A;  1O95 A;  1K0I A;  3QSE A;  2B9X A;  2XYO A;  4EQW A;  2YG5 A;  3P1W A;  3EPT A;  2BK5 A;  2BS2 A;  3KLJ A;  3QVP A;  3V3O A;  3KA7 A;  4MJW A;  1GSN A;  5M0Z A;  4B63 A;  1OJT A;  4PAA A;  2GR2 A;  2NVK X;  2C72 A;  4I59 A;  3K7T A;  2FJB A;  2OA1 A;  1ONF A;  1GV4 A;  4A79 A;  4CY8 A;  1F8S A;  2GH5 A;  4HA6 A;  2EQ8 A;  1ZX9 A;  3V76 A;  3T37 A;  2BS4 A;  1D4E A;  5FS9 A;  2GVC A;  4B1B A;  5IPY A;  1YQZ A;  2RAB A;  4H2Q A;  3WE0 A;  4EQS A;  2BS3 A;  4TM1 A;  5KXJ A;  4H2N A;  3AD8 B;  4H4R A;  2YR6 A;  3ALJ A;  3NK2 X;  4USR A;  3QSS A;  2EQ6 A;  5FMH A;  4C5O A;  3NH3 X;  4GDE A;  1BF3 A;  3AYL A;  4UDQ A;  1Q1W A;  2C7G A;  1EL8 A;  5EBK A;  1NHR A;  2XLR A;  4DNA A;  3L1R A;  2WPC A;  2YVJ A;  5BUK A;  1GEU A;  3CNJ A;  4IVM B;  4P9S A;  4DGK A;  1DNC A;  1E1K A;  5JCK A;  2BXR A;  3GD4 A;  3VRD B;  4I58 A;  2JAE A;  2WU5 A;  1CC4 A;  3FPZ A;  5HYM A;  1X31 B;  4U2L A;  2YAU A;  1H82 A;  4EMW A;  2QCU A;  4H4W A;  4A5L A;  1OJA A;  4NTE A;  3S61 A;  1BGJ A;  1K0J A;  5JCL A;  3UOV A;  1KDG A;  3UKP A;  3UP5 A;  3CGE A;  1GRA A;  3EAO A;  4CNK A;  1NDA A;  4H4U A;  1GER A;  1MOK A;  2XLP A;  4A6N A;  1GRE A;  4PAB A;  4TM4 A;  5BRT A;  1PBE A;  2WOV A;  4Z2T A;  3RHA A;  2O9Z A;  3DJE A;  4AT2 A;  5KVH A;  1JNR A;  1GOS A;  1GES A;  1TDK A;  3H8L A;  2Q0K A;  4C74 A;  5FS8 A;  2VVL A;  2RGJ A;  3VR8 A;  4B67 A;  1RP0 A;  3ABV A;  3BI5 A;  4U8J A;  2W0H A;  3VRA A;  2BCG G;  3PS9 A;  4A6N B;  4GCM A;  2WEU A;  2WBA A;  2PYX A;  1GRB A;  4AOX A;  4Z25 A;  4H4V A;  5TR3 A;  1B4V A;  1Y56 B;  1Q1R A;  2XVI A;  3BHK A;  4U8M A;  1LPF A;  1NEK A;  2QA2 A;  3IF9 A;  1TYT A;  1EL7 A;  1ZY8 A;  1LVL A;  2JB3 A;  2WES A;  2WP6 A;  3BI4 A;  3LZX A;  4OVI A;  4AP1 A;  2BC1 A;  1P2H A;  3UKK A;  2V6O A;  2WPF A;  3K30 A;  2H88 A;  4XWR A;  5GRT A;  3ALL A;  4EIP A;  1YKJ A;  5DBJ A;  4H4Y A;  5M10 A;  3V3N A;  1E1M A;  1CJC A;  3R9U A;  3VRB A;  3CTY A;  1GRG A;  3LOV A;  1IJH A;  2TMD A;  1TDN A;  2IID A;  3ITJ A;  4YTP A;  2RGO A;  3AYJ A;  1IUV A;  4H4T A;  2WOW A;  3Q6J A;  3QFA A;  1ZMC A;  4TM0 A;  3UOX A;  4Z2R A;  5KRQ A;  3AEG A;  4XWZ A;  4ICY A;  4K5S A;  1IUU A;  1M64 A;  4ADW A;  5EOW A;  2AQJ A;  1ELI A;  2FJD A;  4B68 A;  3UTF A;  1K4Q A;  1FEC A;  1DOE A;  1XAN A;  2WDV A;  1VQW A;  3EF6 A;  4LU6 A;  3RP8 A;  4JN9 A;  4X9M A;  1GPE A;  4OPL A;  4REK A;  1NG4 A;  1FEA A;  4U2S A;  3ICR A;  4WCT A;  2WDR A;  4ZCD A;  2Y6Q A;  4N9X A;  2YG7 A;  3NK1 X;  2V60 A;  2YLR A;  1ZMD A;  2XCG A;  3JSK A;  4YSZ A;  3QFB A;  3GMB A;  3NRN A;  2Z5X A;  4BK3 A;  3UTG A;  1GRF A;  1OJC A;  3I3L A;  4Z26 A;  5KVI A;  4B69 A;  2FJA A;  3NYC A;  4EM4 A;  1JRX A;  3G5R A;  2XFU A;  2C76 A;  2FBW A;  2VQ7 A;  3F8P A;  3ICS A;  3BNU A;  3DJJ A;  1XDI A;  5C2T A;  3NTA A;  4EMJ A;  4J57 A;  4M52 A;  1PJ6 A;  1F6M A;  3C4A A;  1GXF A;  1P2E A;  4APN A;  2EQ9 A;  3AE9 A;  3CN8 A;  3P4P A;  3UKL A;  2BAB A;  1KFY A;  3NNE A;  2B7R A;  1DJN A;  4IV9 A;  2RGH A;  2C3C A;  2WQY A;  4KPR A;  2YVF A;  2E5V A;  3DME A;  1PS9 A;  2XLS A;  5U63 A;  2R0C A;  2WET A;  3UCL A;  1E7P A;  4OPD A;  1JRY A;  2F5Z A;  3NHO X;  2GQW A;  3AEC A;  1PJ7 A;  3FBS A;  2GMH A;  2JB2 A;  3KPF A;  4X4J A;  1V59 A;  4K22 A;  3SFD A;  1D7L A;  2B9Y A;  3NKS A;  4GDP A;  4NTD A;  4U8N A;  4A9W A;  1ZOY A;  5FS6 A;  3GDN A;  2BXS A;  4OPI A;  4YSX A;  3P4S A;  1D4C A;  4J2W A;  1PXC A;  3S5W A;  3BHF A;  2WS3 A;  2X8G A;  1L9D A;  1F3P A;  2C73 A;  1QJD A;  4AOS A;  2IVE A;  2XVE A;  5L46 A;  3CNP A;  1FCD A;  4BJY A;  4U8P A;  1H83 A;  1GND A;  3AD7 B;  3AD9 B;  3G5Q A;  4B64 A;  3COX A;  1GAL A;  4U8K A;  4OCG A;  3CPI G;  1PBC A;  2V61 A;  3NT6 A;  4J31 A;  2VRM A;  1TDF A;  2WOI A;  4NZH A;  1JEH A;  2XFP A;  1D7Y A;  2C66 A;  2ZZB A;  2YG4 A;  1S2Q A;  4NEV A;  4U8O A;  1QO8 A;  2VOU A;  3NYF A;  4HB9 A;  3ALM A;  1GTE A;  2R46 A;  4Y4M A;  2WPE A;  3OC4 A;  3AE4 A;  5U25 A;  3LB8 A;  2APG A;  2CVJ A;  1HYU A;  4GRT A;  1RSG A;  3GYI A;  4ZCC A;  2BK4 A;  4TLX A;  1Z6L A;  2CUL A;  3AB1 A;  1VRQ B;  2BC0 A;  3DA1 A;  1L0V A;  3NYE A;  1COY A;  1TDO A;  2OAL A;  1H81 A;  5J60 A;  2ARD A;  1PJ5 A;  3GYJ A;  4UP3 A;  4D04 A;  4EQR A;  2CFY A;  1VG9 A;  1JNZ A;  1CHU A;  5BVA A;  1O94 A;  1JOA A;  3NIX A;  3M12 A;  2H89 A;  1ZDL A;  2JB1 A;  3PVC A;  4H2R A;  2BK3 A;  2GQF A;  1W4X A;  4UDP A;  3NN6 X;  2V5Z A;  2DKI A;  4WX1 A;  5CQF A;  1S3E A;  4C3Y A;  3AE5 A;  1PBD A;  5ER0 A;  1OJ9 A;  3ZYX A;  1KSU A;  2C65 A;  2OAM A;  3K7Q X;  2VRL A;  3DJD A;  2Q0L A;  2Y6R A;  3GWD A;  3AWI A;  2C64 A;  2X8H A;  4JNA A;  3URH A;  4C77 A;  1S3B A;  1DOD A;  3G5S A;  3DGZ A;  3UKA A;  2VQB A;  5LV9 A;  4Z2U A;  2YLX A;  3KVE A;  1F8W A;  1E6E A;  1JRZ A;  2OLN A;  2XDO A;  3CPJ G;  2YR4 A;  1H86 A;  4JQ9 A;  2IVD A;  5KOW A;  2XFN A;  3RP6 A;  1KNR A;  2YLT A;  4XXG A;  1D5T A;  4GF7 A;  4H4Z A;  1H84 A;  4FK1 C;  1N4V A;  4O5Q A;  2WU2 A;  1CJ2 A;  1CJ4 A;  3QSM A;  3ADA B;  3EAN A;  1CC6 A;  1F8R A;  3K7M X;  4J34 A;  3II4 A;  1PXA A;  4KX6 A;  1LJ1 A;  4CCR A;  3SM8 A;  2VZ2 A;  2GMJ A;  3LAD A;  3DH9 A;  3UP4 A;  1NHP A;  2V3A A;  4H4Q A;  4RG4 A;  1LQU A;  1BKW A;  4K7Z A;  3B6D A;  2GR0 A; 
#chains in the Genus database with same CATH topology
 2WP9 A;  1PBF A;  2R45 A;  4JNQ A;  4II2 A;  2R4J A;  2GR3 A;  2Z5Y A;  2C3D A;  4AT0 A;  2GEW A;  2J3N A;  2QAE A;  3IHG A;  4U8I A;  5IQ1 A;  4Y4N A;  4H2P A;  3DGH A;  1ZOV A;  3DK4 A;  4GUV A;  5FS7 A;  1IUW A;  1N4W A;  3H8I A;  1IUT A;  2FJE A;  1YQ4 A;  2QA1 A;  4NEW A;  3AE1 A;  3UKF A;  1E1N A;  1DOC A;  3KD9 A;  4K8D A;  4J33 A;  3KU9 A;  1CL0 A;  1GET A;  1FL2 A;  1N1P A;  1NG3 A;  4CBQ A;  4X9N A;  1GTH A;  2B9W A;  4YT0 A;  2E4G A;  4IVO B;  5C3J A;  2OLO A;  3B3R A;  4A65 A;  1PHH A;  1ZK7 A;  3DK8 A;  3CND A;  1LV0 A;  2YVG A;  3QJ4 A;  4UDR A;  3ZDN A;  3AXB A;  3AE6 A;  1FOH A;  3UKH A;  5KOX A;  2YLS A;  1E39 A;  1SEZ A;  2YWL A;  2YQU A;  3M0O A;  2XFO A;  4TLZ A;  4USQ A;  2GR1 A;  5EB5 A;  1Y0P A;  1CC2 A;  1DOB A;  2C70 A;  1NHS A;  3BNM A;  5BUL A;  4D03 A;  2BYB A;  5JCN A;  3CGD A;  1CF3 A;  3CMM A;  5KNL A;  4B65 A;  4YTN A;  4JY3 A;  2X8C A;  3NN0 X;  3LJP A;  2EQ7 A;  2TPR A;  1PDH A;  3SFE A;  1TRB A;  3L8K A;  4CCQ A;  1VDC A;  4BK1 A;  4GR1 A;  4EMI A;  2BAC A;  3AED A;  2XVJ A;  1S2Y A;  4FK1 A;  1YQ3 A;  3KPK A;  4II3 A;  4CNJ A;  2XLT A;  1CBO A;  4DSG A;  3CGB A;  2GF3 A;  5KWF A;  1IUX A;  4A99 A;  3VQR A;  2B7S A;  3RED A;  1EBD A;  1H6V A;  3AEB A;  4YXD A;  4O5U A;  3T2Y A;  3DJG X;  3CGC A;  3P4Q A;  2GRT A;  4RSL A;  2ACZ A;  4J36 A;  3RP7 A;  4EIQ A;  2A89 A;  2X3N A;  1EL5 A;  2PHH A;  2R0P A;  3GRT A;  3LXD A;  4RG3 A;  1XHC A;  4OPU A;  1EL9 A;  4TM3 A;  2A87 A;  5HXI A;  1B8S A;  3H4K A;  3UKQ A;  3AE7 A;  4YKF A;  1PBB A;  2JKC A;  2AR8 A;  4OPC A;  4OPT A;  3RNM A;  1IUS A;  4JDR A;  1KSS A;  3VR9 A;  3GMC A;  3PO7 A;  3ISH A;  1ZKQ A;  4Z24 A;  3FMW A;  3HZL A;  3SY4 A;  2X99 A;  4Y4L A;  4Z44 A;  3ATR A;  3UTH A;  4U8L A;  2V3B A;  1BGN A;  3GYX A;  4G6H A;  1YY5 A;  3UOY A;  4CRT A;  1TDE A;  1Q9I A;  2R9Z A;  4NTC A;  2I0Z A;  2E1M A;  1NPX A;  1MO9 A;  4A7A A;  2ZBW A;  3NLC A;  3GD3 A;  1PN0 A;  2Q6U A;  3Q9T A;  1DXL A;  2VVM A;  4K2X A;  1RYI A;  1AOG A;  2GV8 A;  4AP3 A;  4BUR A;  4BV6 A;  2C75 A;  2WDQ A;  3IHM A;  3OZ2 A;  4YKG A;  5HY5 A;  4YSY A;  1K0L A;  2NPX A;  4E0V A;  1DJQ A;  3P9U A;  4YWO A;  2WP5 A;  3BI2 A;  2UZZ A;  1ZP0 A;  2HQM A;  3LZW A;  3M13 A;  3F8R A;  1KNP A;  4H4P A;  2GB0 A;  1XPQ A;  1N4U A;  4G74 A;  1UKV G;  1KF6 A;  2Q7V A;  3C96 A;  3CPH G;  3IC9 A;  3NK0 X;  4OPG A;  4ZN0 A;  3ICT A;  4H4X A;  5U1O A;  1LQT A;  2XFQ A;  5IQ4 A;  3O0H A;  3GWF A;  4JY2 A;  2XVF A;  3AE8 A;  2JK6 A;  1TYP A;  3ATQ A;  1CJ3 A;  2YLW A;  1BZL A;  5KMP A;  1Y56 A;  1VG0 A;  1O5W A;  3F8D A;  3D1C A;  4YSH A;  2GAH B;  4ECH A;  3AEF A;  2YG6 A;  3SZ0 A;  2YLZ A;  2DKH A;  1BWC A;  4H50 A;  1NHQ A;  5CKU A;  3SXI A;  4IA5 A;  4B66 A;  4IA6 A;  2XLU A;  4LII A;  1H7X A;  3AEE A;  3P4R A;  3SZF A;  3NTD A;  1LTX R;  2R0G A;  4J56 A;  4YTM A;  4C3X A;  2YR5 A;  1E1L A;  3AE3 A;  2A8X A;  4Z43 A;  3SGL A;  1NEN A;  2R4E A;  1B5Q A;  3AYI A;  3DK9 A;  2YM2 A;  1B37 A;  2BCP A;  3SQP A;  5JCM A;  3UTE A;  1FEB A;  4NWZ A;  2CDU A;  2JBV A;  4EM3 A;  2X50 A;  1PXB A;  1NAA A;  3E1T A;  4LA1 A;  3UOZ A;  1MXT A;  5EB4 A;  4BJZ A;  1GRT A;  2AAQ A;  3FG2 P;  4H4S A;  5JCI A;  3AE2 A;  1L9E A;  3GRS A;  1L9C A;  3GSI A;  3CIR A;  1M6I A;  4H7U A;  2B76 A;  5GSN A;  3I6D A;  3IWA A;  3NGC X;  1GRH A;  2YG3 A;  3C4N A;  4K5R A;  1JU2 A;  2ZZC A;  2BA9 A;  2WHD A;  4GAP A;  1QLB A;  2VVL G;  4CY6 A;  3QVR A;  3D8X A;  3KKJ A;  4U2T A;  1REO A;  2ZZ0 A;  3CNT A;  2C67 A;  4DSH A;  2YM1 A;  5J7X A;  2XVH A;  3GDP A;  3CNS A;  1H7W A;  2GAG B;  3FIM B;  4FDC B;  1GT8 A;  3NG7 X;  5HHF A;  1D4D A;  1OJD A;  3SX6 A;  4FX9 A;  3AEA A;  4EQX A;  1O95 A;  1K0I A;  3QSE A;  2B9X A;  2XYO A;  4EQW A;  2YG5 A;  3P1W A;  3EPT A;  2BK5 A;  2BS2 A;  3KLJ A;  3QVP A;  3V3O A;  3KA7 A;  4MJW A;  1GSN A;  5M0Z A;  4B63 A;  1OJT A;  4PAA A;  2GR2 A;  2NVK X;  4NNJ A;  2C72 A;  3T14 A;  4I59 A;  3K7T A;  2FJB A;  2OA1 A;  1ONF A;  1GV4 A;  3T31 A;  4A79 A;  4CY8 A;  1F8S A;  2GH5 A;  4HA6 A;  2EQ8 A;  1ZX9 A;  3V76 A;  3T37 A;  2BS4 A;  1D4E A;  5FS9 A;  2GVC A;  4B1B A;  5IPY A;  1YQZ A;  2RAB A;  4H2Q A;  3WE0 A;  4EQS A;  2BS3 A;  4TM1 A;  5KXJ A;  4H2N A;  3AD8 B;  4H4R A;  2YR6 A;  3ALJ A;  3NK2 X;  4USR A;  3QSS A;  2EQ6 A;  5FMH A;  4C5O A;  3NH3 X;  4GDE A;  1BF3 A;  3AYL A;  4UDQ A;  1Q1W A;  2C7G A;  1EL8 A;  5EBK A;  1NHR A;  2XLR A;  5KMQ A;  4DNA A;  3L1R A;  2WPC A;  2YVJ A;  5BUK A;  1GEU A;  3CNJ A;  4IVM B;  4P9S A;  4DGK A;  1DNC A;  1E1K A;  5JCK A;  2BXR A;  3GD4 A;  3VRD B;  3SZW A;  4I58 A;  5KMS A;  2JAE A;  2WU5 A;  1CC4 A;  3FPZ A;  5HYM A;  1X31 B;  4U2L A;  2YAU A;  1H82 A;  4EMW A;  2QCU A;  4H4W A;  4A5L A;  1OJA A;  4NTE A;  3S61 A;  1BGJ A;  1K0J A;  5JCL A;  3UOV A;  1KDG A;  3UKP A;  3UP5 A;  3CGE A;  1GRA A;  3EAO A;  4CNK A;  1NDA A;  4H4U A;  1GER A;  1MOK A;  2XLP A;  4A6N A;  1GRE A;  4PAB A;  4TM4 A;  5BRT A;  1PBE A;  2WOV A;  4Z2T A;  3RHA A;  2O9Z A;  3DJE A;  4AT2 A;  5KVH A;  1JNR A;  1GOS A;  1GES A;  1TDK A;  3H8L A;  2Q0K A;  4C74 A;  5FS8 A;  2VVL A;  2RGJ A;  3VR8 A;  4B67 A;  1RP0 A;  3ABV A;  3BI5 A;  4U8J A;  2W0H A;  3VRA A;  2BCG G;  3PS9 A;  4A6N B;  4GCM A;  2WEU A;  2WBA A;  2PYX A;  1GRB A;  4AOX A;  4Z25 A;  3HYW A;  4H4V A;  5TR3 A;  1B4V A;  1Y56 B;  1Q1R A;  2XVI A;  3BHK A;  4U8M A;  1LPF A;  1NEK A;  2QA2 A;  3IF9 A;  1TYT A;  1EL7 A;  1ZY8 A;  1LVL A;  2JB3 A;  2WES A;  2WP6 A;  3BI4 A;  3LZX A;  4OVI A;  4AP1 A;  2BC1 A;  1P2H A;  3UKK A;  2V6O A;  2WPF A;  3K30 A;  3T2Z A;  2H88 A;  4XWR A;  5GRT A;  3ALL A;  4EIP A;  1YKJ A;  5DBJ A;  4H4Y A;  5M10 A;  3V3N A;  1E1M A;  3SYI A;  1CJC A;  3R9U A;  3VRB A;  3CTY A;  1GRG A;  3LOV A;  1IJH A;  2TMD A;  1TDN A;  2IID A;  3ITJ A;  4G9K A;  4YTP A;  2RGO A;  3AYJ A;  1IUV A;  4H4T A;  2WOW A;  3Q6J A;  3QFA A;  1ZMC A;  4TM0 A;  3UOX A;  4Z2R A;  5KRQ A;  3AEG A;  4XWZ A;  4ICY A;  4K5S A;  1IUU A;  1M64 A;  4ADW A;  5EOW A;  2AQJ A;  1ELI A;  2FJD A;  4B68 A;  3UTF A;  1K4Q A;  1FEC A;  1DOE A;  1XAN A;  2WDV A;  1VQW A;  3EF6 A;  4LU6 A;  3RP8 A;  4JN9 A;  4X9M A;  2C4C A;  1GPE A;  4OPL A;  4REK A;  1NG4 A;  1FEA A;  4U2S A;  3ICR A;  4WCT A;  2WDR A;  4ZCD A;  2Y6Q A;  4N9X A;  2YG7 A;  3NK1 X;  2V60 A;  2YLR A;  1ZMD A;  2XCG A;  3JSK A;  4YSZ A;  3QFB A;  3GMB A;  3NRN A;  2Z5X A;  4BK3 A;  3UTG A;  1GRF A;  1OJC A;  3I3L A;  4Z26 A;  5KVI A;  4B69 A;  2FJA A;  3NYC A;  4EM4 A;  1JRX A;  3G5R A;  2XFU A;  2C76 A;  2FBW A;  2VQ7 A;  3F8P A;  3ICS A;  4GAV A;  3BNU A;  3DJJ A;  1XDI A;  5C2T A;  3NTA A;  4EMJ A;  4J57 A;  4M52 A;  1PJ6 A;  1F6M A;  3C4A A;  1GXF A;  1P2E A;  4APN A;  2EQ9 A;  3AE9 A;  3CN8 A;  3P4P A;  3UKL A;  2BAB A;  1KFY A;  3NNE A;  2B7R A;  3SZC A;  1DJN A;  4IV9 A;  2RGH A;  2C3C A;  5KMR A;  2WQY A;  4KPR A;  2YVF A;  2E5V A;  3DME A;  1PS9 A;  2XLS A;  5U63 A;  2R0C A;  2WET A;  3UCL A;  1E7P A;  4OPD A;  1JRY A;  2F5Z A;  3NHO X;  2GQW A;  3AEC A;  1PJ7 A;  3FBS A;  2GMH A;  2JB2 A;  3KPF A;  4X4J A;  1V59 A;  4K22 A;  3SFD A;  1D7L A;  2B9Y A;  3NKS A;  4GDP A;  4NTD A;  4U8N A;  4A9W A;  1ZOY A;  5FS6 A;  4BK2 A;  3GDN A;  2BXS A;  4OPI A;  4YSX A;  3P4S A;  1D4C A;  4J2W A;  1PXC A;  3S5W A;  3BHF A;  2WS3 A;  2X8G A;  1L9D A;  1F3P A;  2BRA A;  2C73 A;  1QJD A;  4AOS A;  2IVE A;  2XVE A;  5L46 A;  3CNP A;  1FCD A;  4BJY A;  4U8P A;  1H83 A;  1GND A;  3AD7 B;  3AD9 B;  3G5Q A;  4B64 A;  3COX A;  1GAL A;  4U8K A;  4OCG A;  3CPI G;  1PBC A;  2V61 A;  3NT6 A;  4J31 A;  3T0K A;  2VRM A;  1TDF A;  2WOI A;  4NZH A;  3HYX A;  1JEH A;  2XFP A;  1D7Y A;  2C66 A;  2ZZB A;  2BRY A;  2YG4 A;  1S2Q A;  4NEV A;  4U8O A;  1QO8 A;  2VOU A;  3NYF A;  4HB9 A;  3ALM A;  1GTE A;  2R46 A;  4Y4M A;  2WPE A;  3OC4 A;  3AE4 A;  5U25 A;  3LB8 A;  2APG A;  2CVJ A;  1HYU A;  4GRT A;  1RSG A;  3GYI A;  4ZCC A;  2BK4 A;  4TLX A;  1Z6L A;  2CUL A;  3AB1 A;  1VRQ B;  2BC0 A;  3DA1 A;  4G73 A;  3NYE A;  1L0V A;  1COY A;  1TDO A;  2OAL A;  1H81 A;  4G6G A;  2ARD A;  1PJ5 A;  5J60 A;  3GYJ A;  4UP3 A;  4D04 A;  4EQR A;  2CFY A;  1VG9 A;  1JNZ A;  1CHU A;  5BVA A;  1O94 A;  1JOA A;  3NIX A;  3M12 A;  2H89 A;  1ZDL A;  2JB1 A;  3PVC A;  4H2R A;  2BK3 A;  2GQF A;  1W4X A;  4UDP A;  3NN6 X;  2V5Z A;  2DKI A;  4WX1 A;  5CQF A;  1S3E A;  4C3Y A;  3AE5 A;  1PBD A;  5ER0 A;  1OJ9 A;  3ZYX A;  1KSU A;  2C65 A;  2OAM A;  3K7Q X;  2VRL A;  3DJD A;  2Q0L A;  2Y6R A;  3GWD A;  3AWI A;  2C64 A;  2X8H A;  4JNA A;  3URH A;  4C77 A;  1S3B A;  1DOD A;  3G5S A;  3DGZ A;  3UKA A;  2VQB A;  5LV9 A;  4Z2U A;  2YLX A;  3KVE A;  3T2K A;  1F8W A;  1E6E A;  1JRZ A;  2OLN A;  2XDO A;  3CPJ G;  2YR4 A;  1H86 A;  4JQ9 A;  2IVD A;  5KOW A;  2XFN A;  3RP6 A;  1KNR A;  2YLT A;  4XXG A;  1D5T A;  4GF7 A;  3HYV A;  4H4Z A;  1H84 A;  4FK1 C;  1N4V A;  4O5Q A;  2WU2 A;  1CJ2 A;  1CJ4 A;  3QSM A;  3ADA B;  3EAN A;  1CC6 A;  1F8R A;  3K7M X;  4J34 A;  3II4 A;  1PXA A;  4KX6 A;  1LJ1 A;  4CCR A;  3SM8 A;  2VZ2 A;  2GMJ A;  3LAD A;  3DH9 A;  3UP4 A;  1NHP A;  2V3A A;  4H4Q A;  4RG4 A;  1LQU A;  1BKW A;  4K7Z A;  3B6D A;  2GR0 A; 
#chains in the Genus database with same CATH homology
 2WP9 A;  1PBF A;  2R45 A;  4JNQ A;  4II2 A;  2R4J A;  2GR3 A;  2Z5Y A;  2C3D A;  4AT0 A;  2GEW A;  2J3N A;  2QAE A;  3IHG A;  4U8I A;  5IQ1 A;  4Y4N A;  4H2P A;  3DGH A;  1ZOV A;  3DK4 A;  4GUV A;  5FS7 A;  1IUW A;  1N4W A;  3H8I A;  1IUT A;  2FJE A;  1YQ4 A;  2QA1 A;  4NEW A;  3AE1 A;  3UKF A;  1E1N A;  1DOC A;  3KD9 A;  4K8D A;  4J33 A;  3KU9 A;  1CL0 A;  1GET A;  1FL2 A;  1N1P A;  1NG3 A;  4CBQ A;  4X9N A;  1GTH A;  2B9W A;  4YT0 A;  2E4G A;  4IVO B;  5C3J A;  2OLO A;  3B3R A;  4A65 A;  1PHH A;  1ZK7 A;  3DK8 A;  3CND A;  1LV0 A;  2YVG A;  3QJ4 A;  4UDR A;  3ZDN A;  3AXB A;  3AE6 A;  1FOH A;  3UKH A;  5KOX A;  2YLS A;  1E39 A;  1SEZ A;  2YWL A;  2YQU A;  3M0O A;  2XFO A;  4TLZ A;  4USQ A;  2GR1 A;  5EB5 A;  1Y0P A;  1CC2 A;  1DOB A;  2C70 A;  1NHS A;  3BNM A;  5BUL A;  4D03 A;  2BYB A;  5JCN A;  3CGD A;  1CF3 A;  3CMM A;  5KNL A;  4B65 A;  4YTN A;  4JY3 A;  2X8C A;  3NN0 X;  3LJP A;  2EQ7 A;  2TPR A;  1PDH A;  3SFE A;  1TRB A;  3L8K A;  4CCQ A;  1VDC A;  4BK1 A;  4GR1 A;  4EMI A;  2BAC A;  3AED A;  2XVJ A;  1S2Y A;  4FK1 A;  1YQ3 A;  3KPK A;  4II3 A;  4CNJ A;  2XLT A;  1CBO A;  4DSG A;  3CGB A;  2GF3 A;  5KWF A;  1IUX A;  4A99 A;  3VQR A;  2B7S A;  3RED A;  1EBD A;  1H6V A;  3AEB A;  4YXD A;  4O5U A;  3T2Y A;  3DJG X;  3CGC A;  3P4Q A;  2GRT A;  4RSL A;  2ACZ A;  4J36 A;  3RP7 A;  4EIQ A;  2A89 A;  2X3N A;  1EL5 A;  2PHH A;  2R0P A;  3GRT A;  3LXD A;  4RG3 A;  1XHC A;  4OPU A;  1EL9 A;  4TM3 A;  2A87 A;  5HXI A;  1B8S A;  3H4K A;  3UKQ A;  3AE7 A;  4YKF A;  1PBB A;  2JKC A;  2AR8 A;  4OPC A;  4OPT A;  3RNM A;  1IUS A;  4JDR A;  1KSS A;  3VR9 A;  3GMC A;  3PO7 A;  3ISH A;  1ZKQ A;  4Z24 A;  3FMW A;  3HZL A;  3SY4 A;  2X99 A;  4Y4L A;  4Z44 A;  3ATR A;  3UTH A;  4U8L A;  2V3B A;  1BGN A;  3GYX A;  4G6H A;  1YY5 A;  3UOY A;  4CRT A;  1TDE A;  1Q9I A;  2R9Z A;  4NTC A;  2I0Z A;  2E1M A;  1NPX A;  1MO9 A;  4A7A A;  2ZBW A;  3NLC A;  3GD3 A;  1PN0 A;  2Q6U A;  3Q9T A;  1DXL A;  2VVM A;  4K2X A;  1RYI A;  1AOG A;  2GV8 A;  4AP3 A;  4BUR A;  4BV6 A;  2C75 A;  2WDQ A;  3IHM A;  3OZ2 A;  4YKG A;  5HY5 A;  4YSY A;  1K0L A;  2NPX A;  4E0V A;  1DJQ A;  3P9U A;  4YWO A;  2WP5 A;  3BI2 A;  2UZZ A;  1ZP0 A;  2HQM A;  3LZW A;  3M13 A;  3F8R A;  1KNP A;  4H4P A;  2GB0 A;  1XPQ A;  1N4U A;  4G74 A;  1UKV G;  1KF6 A;  2Q7V A;  3C96 A;  3CPH G;  3IC9 A;  3NK0 X;  4OPG A;  4ZN0 A;  3ICT A;  4H4X A;  5U1O A;  1LQT A;  2XFQ A;  5IQ4 A;  3O0H A;  3GWF A;  4JY2 A;  2XVF A;  3AE8 A;  2JK6 A;  1TYP A;  3ATQ A;  1CJ3 A;  2YLW A;  1BZL A;  5KMP A;  1Y56 A;  1VG0 A;  1O5W A;  3F8D A;  3D1C A;  4YSH A;  2GAH B;  4ECH A;  3AEF A;  2YG6 A;  3SZ0 A;  2YLZ A;  2DKH A;  1BWC A;  4H50 A;  1NHQ A;  5CKU A;  3SXI A;  4IA5 A;  4B66 A;  4IA6 A;  2XLU A;  4LII A;  1H7X A;  3AEE A;  3P4R A;  3SZF A;  3NTD A;  1LTX R;  2R0G A;  4J56 A;  4YTM A;  4C3X A;  2YR5 A;  1E1L A;  3AE3 A;  2A8X A;  4Z43 A;  3SGL A;  1NEN A;  2R4E A;  1B5Q A;  3AYI A;  3DK9 A;  2YM2 A;  1B37 A;  2BCP A;  3SQP A;  5JCM A;  3UTE A;  1FEB A;  4NWZ A;  2CDU A;  2JBV A;  4EM3 A;  2X50 A;  1PXB A;  1NAA A;  3E1T A;  4LA1 A;  3UOZ A;  1MXT A;  5EB4 A;  4BJZ A;  1GRT A;  2AAQ A;  3FG2 P;  4H4S A;  5JCI A;  3AE2 A;  1L9E A;  3GRS A;  1L9C A;  3GSI A;  3CIR A;  1M6I A;  4H7U A;  2B76 A;  5GSN A;  3I6D A;  3IWA A;  3NGC X;  1GRH A;  2YG3 A;  3C4N A;  4K5R A;  1JU2 A;  2ZZC A;  2BA9 A;  2WHD A;  4GAP A;  1QLB A;  2VVL G;  4CY6 A;  3QVR A;  3D8X A;  3KKJ A;  4U2T A;  1REO A;  2ZZ0 A;  3CNT A;  2C67 A;  4DSH A;  2YM1 A;  5J7X A;  2XVH A;  3GDP A;  3CNS A;  1H7W A;  2GAG B;  3FIM B;  4FDC B;  1GT8 A;  3NG7 X;  5HHF A;  1D4D A;  1OJD A;  3SX6 A;  4FX9 A;  3AEA A;  4EQX A;  1O95 A;  1K0I A;  3QSE A;  2B9X A;  2XYO A;  4EQW A;  2YG5 A;  3P1W A;  3EPT A;  2BK5 A;  2BS2 A;  3KLJ A;  3QVP A;  3V3O A;  3KA7 A;  4MJW A;  1GSN A;  5M0Z A;  4B63 A;  1OJT A;  4PAA A;  2GR2 A;  2NVK X;  4NNJ A;  2C72 A;  3T14 A;  4I59 A;  3K7T A;  2FJB A;  2OA1 A;  1ONF A;  1GV4 A;  3T31 A;  4A79 A;  4CY8 A;  1F8S A;  2GH5 A;  4HA6 A;  2EQ8 A;  1ZX9 A;  3V76 A;  3T37 A;  2BS4 A;  1D4E A;  5FS9 A;  2GVC A;  4B1B A;  5IPY A;  1YQZ A;  2RAB A;  4H2Q A;  3WE0 A;  4EQS A;  2BS3 A;  4TM1 A;  5KXJ A;  4H2N A;  3AD8 B;  4H4R A;  2YR6 A;  3ALJ A;  3NK2 X;  4USR A;  3QSS A;  2EQ6 A;  5FMH A;  4C5O A;  3NH3 X;  4GDE A;  1BF3 A;  3AYL A;  4UDQ A;  1Q1W A;  2C7G A;  1EL8 A;  5EBK A;  1NHR A;  2XLR A;  5KMQ A;  4DNA A;  3L1R A;  2WPC A;  2YVJ A;  5BUK A;  1GEU A;  3CNJ A;  4IVM B;  4P9S A;  4DGK A;  1DNC A;  1E1K A;  5JCK A;  2BXR A;  3GD4 A;  3VRD B;  3SZW A;  4I58 A;  5KMS A;  2JAE A;  2WU5 A;  1CC4 A;  3FPZ A;  5HYM A;  1X31 B;  4U2L A;  2YAU A;  1H82 A;  4EMW A;  2QCU A;  4H4W A;  4A5L A;  1OJA A;  4NTE A;  3S61 A;  1BGJ A;  1K0J A;  5JCL A;  3UOV A;  1KDG A;  3UKP A;  3UP5 A;  3CGE A;  1GRA A;  3EAO A;  4CNK A;  1NDA A;  4H4U A;  1GER A;  1MOK A;  2XLP A;  4A6N A;  1GRE A;  4PAB A;  4TM4 A;  5BRT A;  1PBE A;  2WOV A;  4Z2T A;  3RHA A;  2O9Z A;  3DJE A;  4AT2 A;  5KVH A;  1JNR A;  1GOS A;  1GES A;  1TDK A;  3H8L A;  2Q0K A;  4C74 A;  5FS8 A;  2VVL A;  2RGJ A;  3VR8 A;  4B67 A;  1RP0 A;  3ABV A;  3BI5 A;  4U8J A;  2W0H A;  3VRA A;  2BCG G;  3PS9 A;  4A6N B;  4GCM A;  2WEU A;  2WBA A;  2PYX A;  1GRB A;  4AOX A;  4Z25 A;  3HYW A;  4H4V A;  5TR3 A;  1B4V A;  1Y56 B;  1Q1R A;  2XVI A;  3BHK A;  4U8M A;  1LPF A;  1NEK A;  2QA2 A;  3IF9 A;  1TYT A;  1EL7 A;  1ZY8 A;  1LVL A;  2JB3 A;  2WES A;  2WP6 A;  3BI4 A;  3LZX A;  4OVI A;  4AP1 A;  2BC1 A;  1P2H A;  3UKK A;  2V6O A;  2WPF A;  3K30 A;  3T2Z A;  2H88 A;  4XWR A;  5GRT A;  3ALL A;  4EIP A;  1YKJ A;  5DBJ A;  4H4Y A;  5M10 A;  3V3N A;  1E1M A;  3SYI A;  1CJC A;  3R9U A;  3VRB A;  3CTY A;  1GRG A;  3LOV A;  1IJH A;  2TMD A;  1TDN A;  2IID A;  3ITJ A;  4G9K A;  4YTP A;  2RGO A;  3AYJ A;  1IUV A;  4H4T A;  2WOW A;  3Q6J A;  3QFA A;  1ZMC A;  4TM0 A;  3UOX A;  4Z2R A;  5KRQ A;  3AEG A;  4XWZ A;  4ICY A;  4K5S A;  1IUU A;  1M64 A;  4ADW A;  5EOW A;  2AQJ A;  1ELI A;  2FJD A;  4B68 A;  3UTF A;  1K4Q A;  1FEC A;  1DOE A;  1XAN A;  2WDV A;  1VQW A;  3EF6 A;  4LU6 A;  3RP8 A;  4JN9 A;  4X9M A;  2C4C A;  1GPE A;  4OPL A;  4REK A;  1NG4 A;  1FEA A;  4U2S A;  3ICR A;  4WCT A;  2WDR A;  4ZCD A;  2Y6Q A;  4N9X A;  2YG7 A;  3NK1 X;  2V60 A;  2YLR A;  1ZMD A;  2XCG A;  3JSK A;  4YSZ A;  3QFB A;  3GMB A;  3NRN A;  2Z5X A;  4BK3 A;  3UTG A;  1GRF A;  1OJC A;  3I3L A;  4Z26 A;  5KVI A;  4B69 A;  2FJA A;  3NYC A;  4EM4 A;  1JRX A;  3G5R A;  2XFU A;  2C76 A;  2FBW A;  2VQ7 A;  3F8P A;  3ICS A;  4GAV A;  3BNU A;  3DJJ A;  1XDI A;  5C2T A;  3NTA A;  4EMJ A;  4J57 A;  4M52 A;  1PJ6 A;  1F6M A;  3C4A A;  1GXF A;  1P2E A;  4APN A;  2EQ9 A;  3AE9 A;  3CN8 A;  3P4P A;  3UKL A;  2BAB A;  1KFY A;  3NNE A;  2B7R A;  3SZC A;  1DJN A;  4IV9 A;  2RGH A;  2C3C A;  5KMR A;  2WQY A;  4KPR A;  2YVF A;  2E5V A;  3DME A;  1PS9 A;  2XLS A;  5U63 A;  2R0C A;  2WET A;  3UCL A;  1E7P A;  4OPD A;  1JRY A;  2F5Z A;  3NHO X;  2GQW A;  3AEC A;  1PJ7 A;  3FBS A;  2GMH A;  2JB2 A;  3KPF A;  4X4J A;  1V59 A;  4K22 A;  3SFD A;  1D7L A;  2B9Y A;  3NKS A;  4GDP A;  4NTD A;  4U8N A;  4A9W A;  1ZOY A;  5FS6 A;  4BK2 A;  3GDN A;  2BXS A;  4OPI A;  4YSX A;  3P4S A;  1D4C A;  4J2W A;  1PXC A;  3S5W A;  3BHF A;  2WS3 A;  2X8G A;  1L9D A;  1F3P A;  2BRA A;  2C73 A;  1QJD A;  4AOS A;  2IVE A;  2XVE A;  5L46 A;  3CNP A;  1FCD A;  4BJY A;  4U8P A;  1H83 A;  1GND A;  3AD7 B;  3AD9 B;  3G5Q A;  4B64 A;  3COX A;  1GAL A;  4U8K A;  4OCG A;  3CPI G;  1PBC A;  2V61 A;  3NT6 A;  4J31 A;  3T0K A;  2VRM A;  1TDF A;  2WOI A;  4NZH A;  3HYX A;  1JEH A;  2XFP A;  1D7Y A;  2C66 A;  2ZZB A;  2BRY A;  2YG4 A;  1S2Q A;  4NEV A;  4U8O A;  1QO8 A;  2VOU A;  3NYF A;  4HB9 A;  3ALM A;  1GTE A;  2R46 A;  4Y4M A;  2WPE A;  3OC4 A;  3AE4 A;  5U25 A;  3LB8 A;  2APG A;  2CVJ A;  1HYU A;  4GRT A;  1RSG A;  3GYI A;  4ZCC A;  2BK4 A;  4TLX A;  1Z6L A;  2CUL A;  3AB1 A;  1VRQ B;  2BC0 A;  3DA1 A;  4G73 A;  3NYE A;  1L0V A;  1COY A;  1TDO A;  2OAL A;  1H81 A;  4G6G A;  2ARD A;  1PJ5 A;  5J60 A;  3GYJ A;  4UP3 A;  4D04 A;  4EQR A;  2CFY A;  1VG9 A;  1JNZ A;  1CHU A;  5BVA A;  1O94 A;  1JOA A;  3NIX A;  3M12 A;  2H89 A;  1ZDL A;  2JB1 A;  3PVC A;  4H2R A;  2BK3 A;  2GQF A;  1W4X A;  4UDP A;  3NN6 X;  2V5Z A;  2DKI A;  4WX1 A;  5CQF A;  1S3E A;  4C3Y A;  3AE5 A;  1PBD A;  5ER0 A;  1OJ9 A;  3ZYX A;  1KSU A;  2C65 A;  2OAM A;  3K7Q X;  2VRL A;  3DJD A;  2Q0L A;  2Y6R A;  3GWD A;  3AWI A;  2C64 A;  2X8H A;  4JNA A;  3URH A;  4C77 A;  1S3B A;  1DOD A;  3G5S A;  3DGZ A;  3UKA A;  2VQB A;  5LV9 A;  4Z2U A;  2YLX A;  3KVE A;  3T2K A;  1F8W A;  1E6E A;  1JRZ A;  2OLN A;  2XDO A;  3CPJ G;  2YR4 A;  1H86 A;  4JQ9 A;  2IVD A;  5KOW A;  2XFN A;  3RP6 A;  1KNR A;  2YLT A;  4XXG A;  1D5T A;  4GF7 A;  3HYV A;  4H4Z A;  1H84 A;  4FK1 C;  1N4V A;  4O5Q A;  2WU2 A;  1CJ2 A;  1CJ4 A;  3QSM A;  3ADA B;  3EAN A;  1CC6 A;  1F8R A;  3K7M X;  4J34 A;  3II4 A;  1PXA A;  4KX6 A;  1LJ1 A;  4CCR A;  3SM8 A;  2VZ2 A;  2GMJ A;  3LAD A;  3DH9 A;  3UP4 A;  1NHP A;  2V3A A;  4H4Q A;  4RG4 A;  1LQU A;  1BKW A;  4K7Z A;  3B6D A;  2GR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...