5BULA

Structure of flavin-dependent brominase bmp2 triple mutant y302s f306v a345w
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
397
structure length
392
Chain Sequence
HYDVVIIGSGPAGSLCGIECRKKGLSVLCIEKEQFPRFHIGESLTGNAGQIIRDLGLAEDMDAAGFPDKPGVNVIGSLSKNEFFIPILAPTWQVRRSDFDDMIKRKAVEHGVEYKLGMVTDVIKDGEKVVGALYKADGVEHQVRSKVLVDASGQNTFLSRKGVAGKRQIEFFSQQIASFAHYKGVERDLPPFSTNTTILYSKQYHWSWIIPISPDTDSLGVVIPKDLYYKECNPDDAIAWGMDHISPELKRRFKNAERQGDSQSMADFSYRIEPFVGDGWMCIGDAHRFLDPIFSSGVSVAMKEGIRAAEAIAQVVAGQDWKAPFYAYRDWSNGGQQIWADLIRYFWIYPIFFGYQMQNPRDEVIRLLGGCCFDGWKAPAIFRNAIEEYDRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords flavin-dependent halogenase triple mutant
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces
total genus 140
structure length 392
sequence length 397
ec nomenclature
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bulA00
3V76A 3ITJA 3UKAA 4EQXA 3LB8A 1JNRA 1PS9A 1ZOYA 1S2YA 4K5SA 4TM1A 4EIQA 3QFAA 4I59A 2WBAA 3AECA 3NGCX 2A89A 3RP7A 1KDGA 1KSSA 5HHFA 4OPTA 2WPEA 1EL9A 1REOA 2J3NA 3GWFA 4B69A 2XYOA 3CGBA 1B8SA 1ONFA 1E7PA 2WU5A 3UTEA 3ALJA 3AD9B 1TDFA 3K7MX 1E1LA 4RG4A 4CY6A 2V6OA 2X99A 4YKFA 4ZN0A 3DH9A 3GMCA 3CGEA 4YTNA 1W4XA 2NPXA 2X8HA 1NG4A 2TMDA 3H4KA 4CCQA 2GR1A 1GRGA 1ZY8A 1ZOVA 2C65A 2NVKX 2OLNA 4H4PA 3UCLA 2YLZA 1O94A 2OAMA 4Z2TA 3PVCA 3FIMB 4BV6A 3Q9TA 3CNPA 4X9NA 1GETA 1NHPA 4B1BA 4GF7A 3SM8A 1H7XA 5KRQA 4UDPA 1F8SA 1UKVG 4EM4A 1DOEA 1Y56A 4Z2RA 2Y6QA 4JDRA 1M64A 2YG4A 4FX9A 3G5QA 5JCLA 1ZMCA 4YSXA 3GWDA 3G5SA 1L9DA 3O0HA 3UOXA 1H86A 2YLTA 5IQ4A 3NYFA 2YG5A 3L1RA 3ATRA 2VVMA 4U2SA 3CTYA 5JCMA 4CCRA 4NEWA 3QSSA 2PYXA 2QAEA 3NIXA 3GMBA 4JN9A 2X3NA 3EAOA 3FBSA 3M0OA 1PBCA 2X8GA 2YG6A 1GT8A 4LA1A 2YLSA 3KA7A 2JB3A 3AE3A 1VG9A 1ELIA 2FJEA 3NK0X 2R0CA 2XVEA 5JCNA 2EQ7A 1H7WA 2OALA 2XDOA 3H8LA 3NN0X 3RP8A 2VRMA 4WX1A 2BA9A 3DJEA 2CFYA 4UDQA 2JB2A 2H88A 2RABA 1IUSA 3NNEA 4J31A 1GRHA 2GF3A 4BURA 4YSHA 4BK3A 3LXDA 1IJHA 3ICRA 1VQWA 1S3EA 1TRBA 3AE2A 3GYIA 4RSLA 1GNDA 3V3OA 1K0IA 3ADAB 3K7TA 5KXJA 2XVFA 3NT6A 1RSGA 3LOVA 4TLZA 2EQ6A 3NN6X 5DBJA 3UKQA 4EQWA 3EPTA 1DNCA 3UOYA 4H4XA 4JNAA 3P4SA 2C64A 1KF6A 4DGKA 1PJ6A 2W0HA 3KKJA 4J36A 3AE4A 4YKGA 3F8RA 4AT2A 4BK1A 3AD8B 1GTEA 5LV9A 2EQ8A 1CC2A 3SFDA 1PBBA 1NPXA 5BULA 3CPIG 1KNRA 2O9ZA 1CHUA 4LIIA 1D4EA 1OJDA 4H4TA 1PXBA 3NLCA 2YLRA 2OLOA 4YSYA 1Z6LA 1RYIA 3ALMA 3SGLA 3NK2X 3NRNA 4JNQA 1E1MA 4K22A 4TM0A 2YAUA 1CJCA 2XFOA 2CVJA 1P2EA 2JKCA 1EBDA 4CNKA 3BNMA 1N4WA 1JNZA 4EMJA 2VVLG 4PABA 2YG7A 4K2XA 1PXAA 3DJDA 3ICSA 1D5TA 1IUWA 2RGOA 3BNUA 4Y4MA 4A99A 3ICTA 1IUVA 3KVEA 2DKHA 3FPZA 4GR1A 4TLXA 4B65A 5EB5A 3CGCA 4U8JA 3AEFA 3CGDA 3SFEA 2BXRA 1HYUA 1NHSA 1GOSA 2VZ2A 1GRFA 3LJPA 1PDHA 5FS8A 3NH3X 3S5WA 1ZK7A 4YSZA 3VR8A 1CJ2A 2B9XA 4OPCA 2GB0A 4A79A 1DJNA 1GSNA 5HY5A 2AR8A 2QA2A 1BF3A 2C73A 1JEHA 4OPIA 1MO9A 2YR6A 2WDQA 3C4AA 5U25A 2JBVA 3UKPA 2Q6UA 2WEUA 4U2TA 1H82A 2V3AA 1EL8A 2RGHA 1L9EA 2GMHA 2YR4A 4A65A 4CBQA 4A6NB 5IQ1A 1ZP0A 2IIDA 1TYTA 2C67A 2XLPA 3FG2P 4A5LA 1FL2A 4BK2A 3UOVA 2OA1A 1YQ3A 2WOIA 3AYIA 3ISHA 3AE1A 4MJWA 4NTCA 5HYMA 2GAGB 1PN0A 3AD7B 4NTDA 1CC6A 3AXBA 4C74A 1BZLA 2WPCA 3ABVA 1BWCA 4X4JA 3BHKA 2IVDA 1CJ4A 3OZ2A 3ALLA 4LU6A 4U8KA 5EB4A 4J56A 4TM3A 4XWRA 2FJBA 5KVIA 2APGA 1BGJA 2BABA 4AOXA 4CNJA 2B9WA 3F8PA 3AE6A 4H2NA 1NHRA 2GAHB 3UKKA 2ZBWA 3URHA 4EMWA 1QJDA 2B9YA 2PHHA 5U1OA 2WP6A 2GQFA 2A8XA 1D4DA 2BCGG 3P4RA 2Z5YA 1PHHA 2R46A 3IC9A 1JOAA 1LQTA 3QSEA 4YWOA 3GDPA 4C3XA 2Q0LA 3AEBA 1JU2A 1AOGA 2WHDA 3BI4A 2YM2A 4U8LA 4BJYA 3NKSA 2YVJA 3AYJA 2XLSA 3UOZA 2XFNA 1ZDLA 1H81A 4H4UA 1TDEA 4K5RA 1S3BA 1Q1WA 1QO8A 3VR9A 2GRTA 4J34A 2EQ9A 3CNSA 2XLRA 2YG3A 3CPJG 2E4GA 4ECHA 2WESA 3II4A 5FS7A 3NTDA 2E5VA 4AP1A 1LJ1A 3CNJA 1VDCA 1LQUA 1L9CA 3B3RA 1EL7A 3KLJA 1Y0PA 4Z26A 4A6NA 3CN8A 4IVMB 3G5RA 2BCPA 4B68A 4FDCB 1F3PA 1CF3A 2XFQA 3VRDB 1GERA 2BXSA 3B6DA 3H8IA 3OC4A 4AOSA 5KVHA 1O5WA 4OPGA 4U8PA 1P2HA 1D4CA 2BS2A 4M52A 2GH5A 4A9WA 2R45A 4JY3A 4OPDA 3Q6JA 4U8NA 4PAAA 1K0LA 4H2RA 4YTPA 2VQBA 3EANA 4H4ZA 1NDAA 1LTXR 4NEVA 3DJGX 3ZYXA 3GD4A 4REKA 5GRTA 4ADWA 3AYLA 4N9XA 3P1WA 1SEZA 3R9UA 1GREA 3V3NA 3P9UA 4HB9A 1FEAA 1IUXA 3QJ4A 5KWFA 3DMEA 4KPRA 3UKHA 3AEAA 2IVEA 2YWLA 1DODA 2WPFA 2ARDA 2WP5A 4TM4A 3P4QA 3QSMA 1PBFA 1X31B 5KOWA 1JRXA 1CJ3A 4YT0A 1GV4A 4ZCCA 4H2PA 5TR3A 4CY8A 1E1KA 1TYPA 1XDIA 2CULA 2XVJA 3AE8A 1YQZA 2YR5A 3DJJA 2B76A 2C7GA 1MOKA 1E39A 1BKWA 3CNTA 1OJTA 3FMWA 1JRYA 2WOWA 3KU9A 2RGJA 2FJAA 4H4VA 2X50A 1BGNA 4YXDA 2GEWA 2Y6RA 3UP4A 2R9ZA 4D03A 4K7ZA 1IUUA 4GCMA 2XFUA 2YLXA 1KSUA 2XLTA 2WDVA 3IF9A 4DSHA 1Y56B 3CIRA 3LZXA 1O95A 4J2WA 4U2LA 1NAAA 2DKIA 5FMHA 4H4SA 1PXCA 1YY5A 4NZHA 3VQRA 4OCGA 1FEBA 1N1PA 4ICYA 1L0VA 1GRAA 4H4WA 2R0GA 1TDKA 4B66A 2BS3A 2YQUA 5L46A 3DA1A 1OJAA 5FS6A 1D7LA 3NK1X 2C3CA 3UTHA 4GRTA 1IUTA 2A87A 4UP3A 4USQA 3VRAA 2YLWA 2V60A 4IA6A 4Z2UA 3QVRA 5BUKA 4P9SA 3F8DA 3SQPA 1VG0A 1XHCA 3IHMA 1DOCA 3NYEA 4X9MA 1N4VA 1S2QA 4B63A 3L8KA 1OJ9A 2BK4A 2C70A 2FJDA 1GXFA 5HXIA 2VVLA 2JAEA 2WDRA 3P4PA 4C3YA 2C72A 1CC4A 2Q7VA 3BHFA 1M6IA 5BVAA 2GVCA 1E1NA 1N4UA 1LVLA 2ACZA 1K4QA 2V61A 3BI2A 1NENA 3NG7X 3CPHG 5M0ZA 3HZLA 3EF6A 1F6MA 3S61A 2AAQA 3GDNA 4WCTA 4EM3A 2XCGA 5CKUA 1JRZA 2VRLA 2JB1A 2GQWA 3AWIA 3NYCA 4U8MA 3ZDNA 4C77A 1E6EA 4UDRA 2XFPA 2XLUA 2GMJA 5U63A 5JCKA 3I3LA 1GTHA 4IV9A 4A7AA 4IVOB 1XPQA 1OJCA 2R4JA 1NG3A 1YKJA 2WP9A 5J7XA 3D8XA 1GEUA 2BC1A 2BK5A 2YVGA 3QVPA 5ER0A 1D7YA 4D04A 3UTFA 3NTAA 3WE0A 1GESA 5C2TA 1VRQB 1XANA 3COXA 3PS9A 4OPLA 3AEGA 5CQFA 1H84A 3BI5A 5C3JA 2ZZCA 3C96A 1FECA 4KX6A 1EL5A 3RNMA 1ZMDA 2B7SA 1B5QA 2XVIA 2BS4A 3DK8A 2BC0A 3M12A 2ZZBA 2WOVA 2BACA 3GSIA 1K0JA 2QCUA 3K7QX 4NTEA 1KFYA 1GALA 3AE9A 1QLBA 2WS3A 4H4RA 4FK1A 4J33A 1FOHA 1PBEA 3IHGA 3REDA 4H2QA 4CRTA 2B7RA 1Q1RA 1TDNA 2H89A 2TPRA 4O5QA 4E0VA 3VRBA 3ATQA 2V3BA 2VOUA 2XVHA 4Y4LA 4BJZA 3K30A 3JSKA 1KNPA 3DGHA 4YTMA 4XWZA 1PJ5A 5J60A 1H83A 2UZZA 1PJ7A 3AEEA 3DGZA 2C66A 3GRSA 4H4QA 4Z43A 2C75A 2HQMA 3T37A 2Q0KA 4FK1C 4C5OA 1GPEA 4Z24A 4IA5A 2ZZ0A 2JK6A 4B67A 1RP0A 2WU2A 1FCDA 3M13A 2GR3A 5FS9A 4EQSA 4GDEA 3UP5A 3UTGA 3KD9A 4Z44A 3PO7A 4I58A 2AQJA 4JY2A 1DJQA 4OPUA 2BK3A 3LZWA 5M10A 1DOBA 2Z5XA 1MXTA 2CDUA 4O5UA 4ZCDA 1GRBA 3KPFA 5GSNA 3I6DA 3DK9A 4GUVA 1ZKQA 1LPFA 2BYBA 3AB1A 3UKFA 1CBOA 3QFBA 2R4EA 4H7UA 4B64A 1H6VA 1NHQA 2GR2A 5IPYA 4EIPA 5KOXA 4GDPA 3DK4A 5JCIA 5EOWA 3C4NA 2X8CA 1LV0A 3E1TA 1F8RA 4USRA 2E1MA 2VQ7A 4DSGA 2GR0A 4APNA 4HA6A 2YVFA 1PBDA 3AEDA 1TDOA 2GV8A 3GD3A 5EBKA 4EQRA 1B4VA 4K8DA 1V59A 1F8WA 1DXLA 4RG3A 3UKLA 2QA1A 1CL0A 1YQ4A 4OVIA 1ZX9A 2I0ZA 4Z25A 1Q9IA 3CNDA 3AE5A 3GRTA 3RHAA 2C3DA 4DNAA 5BRTA 1COYA 4AT0A 2F5ZA 4U8IA 2R0PA 4Y4NA 1B37A 3D1CA 2WETA 3IWAA 4XXGA 4AP3A 2YM1A 3RP6A 3GYJA 1NEKA 4U8OA 4JQ9A 2WQYA 4J57A 3NHOX 4EMIA 3AE7A 2C76A 2FBWA 4H4YA 4H50A 1GRTA 3LADA 2V5ZA
chains in the Genus database with same CATH superfamily
3V76A 3ITJA 3UKAA 4EQXA 3LB8A 1JNRA 1PS9A 1ZOYA 1S2YA 4K5SA 4TM1A 4EIQA 3QFAA 4I59A 2WBAA 3AECA 3NGCX 2A89A 3RP7A 1KDGA 1KSSA 5HHFA 4OPTA 2WPEA 1EL9A 1REOA 2J3NA 3GWFA 3SXIA 4B69A 2XYOA 3CGBA 5KNLA 1B8SA 1ONFA 1E7PA 2WU5A 3UTEA 3ALJA 3AD9B 1TDFA 3K7MX 1E1LA 4RG4A 4CY6A 2V6OA 2X99A 4YKFA 4ZN0A 3DH9A 3GMCA 3CGEA 4YTNA 1W4XA 2NPXA 2X8HA 1NG4A 2TMDA 3H4KA 4CCQA 2GR1A 1GRGA 1ZY8A 1ZOVA 2C65A 2NVKX 2OLNA 4H4PA 3UCLA 2YLZA 3GYXA 1O94A 2OAMA 4Z2TA 3PVCA 3FIMB 4BV6A 3Q9TA 3CNPA 4X9NA 1GETA 1NHPA 4B1BA 4GF7A 3SM8A 1H7XA 5KRQA 4UDPA 1F8SA 1UKVG 4EM4A 1DOEA 1Y56A 4Z2RA 2Y6QA 4JDRA 1M64A 2YG4A 4FX9A 3G5QA 3HYWA 5JCLA 1ZMCA 4YSXA 3GWDA 3G5SA 5KMSA 1L9DA 3O0HA 3UOXA 1H86A 2YLTA 5IQ4A 3NYFA 2YG5A 3L1RA 3ATRA 2VVMA 4U2SA 3CTYA 5JCMA 4CCRA 4NEWA 3QSSA 2PYXA 2QAEA 3NIXA 3GMBA 4JN9A 2X3NA 3EAOA 3FBSA 3M0OA 1PBCA 2X8GA 2YG6A 1GT8A 4LA1A 2YLSA 3KA7A 2JB3A 3AE3A 1VG9A 1ELIA 2FJEA 3NK0X 2R0CA 2XVEA 5JCNA 2EQ7A 1H7WA 2OALA 2XDOA 3H8LA 3NN0X 3RP8A 2VRMA 4WX1A 2BA9A 3DJEA 2CFYA 4UDQA 2JB2A 2H88A 2RABA 1IUSA 3NNEA 4J31A 1GRHA 2GF3A 4BURA 4YSHA 4BK3A 3LXDA 1IJHA 3ICRA 1VQWA 1S3EA 1TRBA 3AE2A 3GYIA 4RSLA 1GNDA 3V3OA 1K0IA 4G73A 3ADAB 3K7TA 5KXJA 2XVFA 3NT6A 1RSGA 3LOVA 4TLZA 4II3A 2EQ6A 3NN6X 5DBJA 3UKQA 4EQWA 3EPTA 1DNCA 3UOYA 4H4XA 4JNAA 3P4SA 2C64A 1KF6A 4DGKA 1PJ6A 2W0HA 3KKJA 4J36A 3AE4A 4YKGA 3F8RA 4AT2A 4BK1A 3AD8B 1GTEA 5LV9A 2EQ8A 1CC2A 3SFDA 1PBBA 1NPXA 5BULA 3CPIG 1KNRA 2O9ZA 1CHUA 4LIIA 1D4EA 1OJDA 4H4TA 1PXBA 3NLCA 2YLRA 2OLOA 4YSYA 1Z6LA 1RYIA 3ALMA 3SGLA 3NK2X 3NRNA 4JNQA 1E1MA 4K22A 4TM0A 2YAUA 1CJCA 2XFOA 2CVJA 1P2EA 2JKCA 1EBDA 4CNKA 3BNMA 1N4WA 1JNZA 4EMJA 2VVLG 4PABA 2YG7A 4K2XA 1PXAA 3DJDA 3ICSA 1D5TA 1IUWA 2RGOA 3BNUA 4Y4MA 4A99A 3ICTA 1IUVA 3KVEA 5KMPA 2DKHA 3FPZA 4GR1A 4TLXA 4B65A 5EB5A 3CGCA 4U8JA 3AEFA 3CGDA 3SFEA 2BXRA 1HYUA 1NHSA 1GOSA 2VZ2A 1GRFA 3LJPA 1PDHA 5FS8A 3NH3X 3S5WA 1ZK7A 4YSZA 3VR8A 1CJ2A 2B9XA 3KPKA 4OPCA 2GB0A 4A79A 1DJNA 1GSNA 5HY5A 2AR8A 2QA2A 3SZWA 1BF3A 2C73A 1JEHA 4OPIA 1MO9A 2YR6A 3T2YA 2WDQA 3C4AA 5U25A 2JBVA 3UKPA 2Q6UA 2WEUA 4U2TA 1H82A 2V3AA 1EL8A 2RGHA 1L9EA 2GMHA 2YR4A 4A65A 4CBQA 4A6NB 5IQ1A 1ZP0A 2IIDA 5KMRA 1TYTA 2C67A 2XLPA 3FG2P 4A5LA 1FL2A 4BK2A 3UOVA 2OA1A 1YQ3A 2WOIA 3AYIA 3ISHA 3AE1A 4MJWA 4NTCA 5HYMA 2GAGB 1PN0A 3AD7B 4NTDA 1CC6A 3AXBA 4C74A 1BZLA 2WPCA 3ABVA 1BWCA 4X4JA 3BHKA 2IVDA 1CJ4A 3OZ2A 3ALLA 4LU6A 4U8KA 5EB4A 4J56A 4TM3A 4XWRA 2FJBA 5KVIA 2APGA 1BGJA 2BABA 4AOXA 4CNJA 2B9WA 5KMQA 3F8PA 3AE6A 4H2NA 1NHRA 2GAHB 3UKKA 2ZBWA 3URHA 4EMWA 1QJDA 2B9YA 2PHHA 5U1OA 2WP6A 2GQFA 2A8XA 1D4DA 2BCGG 3P4RA 2Z5YA 1PHHA 2R46A 3IC9A 1JOAA 1LQTA 3QSEA 4YWOA 3GDPA 4C3XA 2Q0LA 3AEBA 1JU2A 1AOGA 2WHDA 3BI4A 2YM2A 4U8LA 4BJYA 3NKSA 2YVJA 3AYJA 4G9KA 2XLSA 3UOZA 2XFNA 1ZDLA 1H81A 4H4UA 1TDEA 4K5RA 4NNJA 1S3BA 1Q1WA 1QO8A 3VR9A 2GRTA 4J34A 2EQ9A 3CNSA 2XLRA 2YG3A 3CPJG 2E4GA 2BRAA 4ECHA 2WESA 3II4A 5FS7A 3NTDA 2E5VA 4AP1A 1LJ1A 3CNJA 1VDCA 1LQUA 1L9CA 3B3RA 1EL7A 3KLJA 1Y0PA 4Z26A 4A6NA 3CN8A 4IVMB 3G5RA 2BCPA 4B68A 4FDCB 1F3PA 1CF3A 2XFQA 3VRDB 1GERA 2BXSA 3B6DA 3H8IA 3OC4A 4AOSA 5KVHA 1O5WA 4OPGA 4U8PA 1P2HA 1D4CA 2BS2A 4M52A 2GH5A 4A9WA 2R45A 4JY3A 4OPDA 3Q6JA 4U8NA 4PAAA 1K0LA 4H2RA 4YTPA 2VQBA 3EANA 4H4ZA 1NDAA 1LTXR 4NEVA 3DJGX 3ZYXA 3GD4A 4REKA 5GRTA 4ADWA 3AYLA 4N9XA 3P1WA 1SEZA 3R9UA 1GREA 3V3NA 3P9UA 4HB9A 1FEAA 1IUXA 3QJ4A 5KWFA 3DMEA 4KPRA 3UKHA 3AEAA 3SX6A 3T31A 2IVEA 2YWLA 1DODA 2WPFA 2ARDA 2WP5A 4TM4A 3P4QA 3QSMA 1PBFA 1X31B 5KOWA 1JRXA 1CJ3A 4YT0A 1GV4A 4ZCCA 4H2PA 5TR3A 4CY8A 1E1KA 1TYPA 1XDIA 2CULA 2XVJA 3AE8A 1YQZA 2YR5A 3DJJA 2B76A 2C7GA 1MOKA 1E39A 1BKWA 3CNTA 1OJTA 3FMWA 1JRYA 2WOWA 3KU9A 2RGJA 2FJAA 4H4VA 2X50A 1BGNA 4YXDA 2GEWA 2Y6RA 3UP4A 2R9ZA 4D03A 4K7ZA 1IUUA 4GCMA 2XFUA 3SZ0A 2YLXA 1KSUA 2XLTA 2WDVA 3IF9A 4DSHA 1Y56B 3CIRA 3LZXA 1O95A 4J2WA 4U2LA 1NAAA 2DKIA 5FMHA 4H4SA 1PXCA 1YY5A 4NZHA 3VQRA 4OCGA 1FEBA 1N1PA 4ICYA 1L0VA 1GRAA 4H4WA 2R0GA 1TDKA 4B66A 2BS3A 2YQUA 5L46A 3DA1A 1OJAA 5FS6A 1D7LA 3NK1X 2C3CA 3UTHA 2C4CA 4GRTA 1IUTA 2A87A 4UP3A 4USQA 3VRAA 2YLWA 2V60A 4IA6A 4Z2UA 3QVRA 5BUKA 4P9SA 3F8DA 3SQPA 1VG0A 1XHCA 3IHMA 2BRYA 1DOCA 3NYEA 4X9MA 1N4VA 1S2QA 3T2ZA 4B63A 3L8KA 1OJ9A 2BK4A 2C70A 2FJDA 1GXFA 5HXIA 2VVLA 2JAEA 2WDRA 3P4PA 4C3YA 3T2KA 2C72A 1CC4A 2Q7VA 3BHFA 1M6IA 5BVAA 2GVCA 1E1NA 1N4UA 1LVLA 2ACZA 1K4QA 2V61A 3BI2A 1NENA 3NG7X 3CPHG 4II2A 3HZLA 3EF6A 5M0ZA 1F6MA 3S61A 2AAQA 3GDNA 4WCTA 4EM3A 2XCGA 5CKUA 1JRZA 2VRLA 2JB1A 2GQWA 3AWIA 3NYCA 4U8MA 3ZDNA 4C77A 1E6EA 3HYXA 4UDRA 2XFPA 2XLUA 2GMJA 4NWZA 5U63A 3I3LA 1GTHA 4IV9A 4A7AA 4IVOB 1XPQA 1OJCA 2R4JA 1NG3A 1YKJA 2WP9A 5J7XA 3D8XA 1GEUA 2BC1A 2BK5A 2YVGA 3QVPA 5ER0A 1D7YA 4D04A 3UTFA 3NTAA 3WE0A 1GESA 5C2TA 1VRQB 1XANA 3COXA 3PS9A 4OPLA 3AEGA 5CQFA 1H84A 3BI5A 5C3JA 2ZZCA 3C96A 1FECA 4KX6A 1EL5A 3RNMA 1ZMDA 4G74A 2B7SA 1B5QA 2XVIA 2BS4A 3DK8A 2BC0A 3M12A 2ZZBA 2WOVA 2BACA 3GSIA 1K0JA 2QCUA 3K7QX 4NTEA 1KFYA 1GALA 3AE9A 1QLBA 2WS3A 4H4RA 4FK1A 4J33A 1FOHA 1PBEA 3IHGA 3REDA 4H2QA 4CRTA 2B7RA 1Q1RA 1TDNA 2H89A 2TPRA 4O5QA 3CMMA 4E0VA 3VRBA 3ATQA 2V3BA 2VOUA 2XVHA 4Y4LA 4BJZA 3K30A 3JSKA 1KNPA 3DGHA 4YTMA 4XWZA 1PJ5A 5J60A 1H83A 2UZZA 1PJ7A 3AEEA 3DGZA 2C66A 3GRSA 4H4QA 4Z43A 2C75A 2HQMA 3T14A 3T37A 2Q0KA 4FK1C 4G6HA 4C5OA 5JCKA 1GPEA 4Z24A 4IA5A 2ZZ0A 2JK6A 4B67A 1RP0A 2WU2A 1FCDA 3M13A 2GR3A 5FS9A 4EQSA 4GDEA 3UP5A 3UTGA 3KD9A 4Z44A 3SZFA 3PO7A 4I58A 2AQJA 4G6GA 1DJQA 4JY2A 4OPUA 2BK3A 3LZWA 5M10A 1DOBA 2Z5XA 1MXTA 2CDUA 3SZCA 4O5UA 4ZCDA 1GRBA 3KPFA 5GSNA 3HYVA 3I6DA 3DK9A 4GUVA 1ZKQA 1LPFA 2BYBA 3AB1A 3UKFA 1CBOA 3QFBA 2R4EA 4H7UA 4B64A 1H6VA 1NHQA 2GR2A 5IPYA 4EIPA 5KOXA 4GDPA 3DK4A 5JCIA 5EOWA 3C4NA 2X8CA 1LV0A 3E1TA 1F8RA 4USRA 2E1MA 2VQ7A 4DSGA 2GR0A 4APNA 4HA6A 2YVFA 1PBDA 3AEDA 1TDOA 2GV8A 3GD3A 5EBKA 4EQRA 1B4VA 4K8DA 1V59A 1F8WA 1DXLA 4RG3A 3UKLA 2QA1A 1CL0A 1YQ4A 4OVIA 1ZX9A 2I0ZA 4Z25A 1Q9IA 3CNDA 3AE5A 3GRTA 3RHAA 2C3DA 4DNAA 5BRTA 1COYA 4AT0A 2F5ZA 4U8IA 2R0PA 4Y4NA 1B37A 3SY4A 3D1CA 2WETA 3IWAA 4GAVA 4XXGA 4AP3A 2YM1A 3RP6A 3GYJA 1NEKA 4U8OA 4JQ9A 2WQYA 4J57A 3NHOX 3SYIA 4EMIA 3AE7A 2C76A 2FBWA 4GAPA 4H4YA 4H50A 3T0KA 1GRTA 3LADA 2V5ZA
chains in the Genus database with same CATH topology
3V76A 3ITJA 3UKAA 4EQXA 3LB8A 1JNRA 1PS9A 1ZOYA 1S2YA 4K5SA 4TM1A 4EIQA 3QFAA 4I59A 2WBAA 3AECA 3NGCX 2A89A 3RP7A 1KDGA 1KSSA 5HHFA 4OPTA 2WPEA 1EL9A 1REOA 2J3NA 3GWFA 3SXIA 4B69A 2XYOA 3CGBA 5KNLA 1B8SA 1ONFA 1E7PA 2WU5A 3UTEA 3ALJA 3AD9B 1TDFA 3K7MX 1E1LA 4RG4A 4CY6A 2V6OA 2X99A 4YKFA 4ZN0A 3DH9A 3GMCA 3CGEA 4YTNA 1W4XA 2NPXA 2X8HA 1NG4A 2TMDA 3H4KA 4CCQA 2GR1A 1GRGA 1ZY8A 1ZOVA 2C65A 2NVKX 2OLNA 4H4PA 3UCLA 2YLZA 3GYXA 1O94A 2OAMA 4Z2TA 3PVCA 3FIMB 4BV6A 3Q9TA 3CNPA 4X9NA 1GETA 1NHPA 4B1BA 4GF7A 3SM8A 1H7XA 5KRQA 4UDPA 1F8SA 1UKVG 4EM4A 1DOEA 1Y56A 4Z2RA 2Y6QA 4JDRA 1M64A 2YG4A 4FX9A 3G5QA 3HYWA 5JCLA 1ZMCA 4YSXA 3GWDA 3G5SA 5KMSA 1L9DA 3O0HA 3UOXA 1H86A 2YLTA 5IQ4A 3NYFA 2YG5A 3L1RA 3ATRA 2VVMA 4U2SA 3CTYA 5JCMA 4CCRA 4NEWA 3QSSA 2PYXA 2QAEA 3NIXA 3GMBA 4JN9A 2X3NA 3EAOA 3FBSA 3M0OA 1PBCA 2X8GA 2YG6A 1GT8A 4LA1A 2YLSA 3KA7A 2JB3A 3AE3A 1VG9A 1ELIA 2FJEA 3NK0X 2R0CA 2XVEA 5JCNA 2EQ7A 1H7WA 2OALA 2XDOA 3H8LA 3NN0X 3RP8A 2VRMA 4WX1A 2BA9A 3DJEA 2CFYA 4UDQA 2JB2A 2H88A 2RABA 1IUSA 3NNEA 4J31A 1GRHA 2GF3A 4BURA 4YSHA 4BK3A 3LXDA 1IJHA 3ICRA 1VQWA 1S3EA 1TRBA 3AE2A 3GYIA 4RSLA 1GNDA 3V3OA 1K0IA 4G73A 3ADAB 3K7TA 5KXJA 2XVFA 3NT6A 1RSGA 3LOVA 4TLZA 4II3A 2EQ6A 3NN6X 5DBJA 3UKQA 4EQWA 3EPTA 1DNCA 3UOYA 4H4XA 4JNAA 3P4SA 2C64A 1KF6A 4DGKA 1PJ6A 2W0HA 3KKJA 4J36A 3AE4A 4YKGA 3F8RA 4AT2A 4BK1A 3AD8B 1GTEA 5LV9A 2EQ8A 1CC2A 3SFDA 1PBBA 1NPXA 5BULA 3CPIG 1KNRA 2O9ZA 1CHUA 4LIIA 1D4EA 1OJDA 4H4TA 1PXBA 3NLCA 2YLRA 2OLOA 4YSYA 1Z6LA 1RYIA 3ALMA 3SGLA 3NK2X 3NRNA 4JNQA 1E1MA 4K22A 4TM0A 2YAUA 1CJCA 2XFOA 2CVJA 1P2EA 2JKCA 1EBDA 4CNKA 3BNMA 1N4WA 1JNZA 4EMJA 2VVLG 4PABA 2YG7A 4K2XA 1PXAA 3DJDA 3ICSA 1D5TA 1IUWA 2RGOA 3BNUA 4Y4MA 4A99A 3ICTA 1IUVA 3KVEA 5KMPA 2DKHA 3FPZA 4GR1A 4TLXA 4B65A 5EB5A 3CGCA 4U8JA 3AEFA 3CGDA 3SFEA 2BXRA 1HYUA 1NHSA 1GOSA 2VZ2A 1GRFA 3LJPA 1PDHA 5FS8A 3NH3X 3S5WA 1ZK7A 4YSZA 3VR8A 1CJ2A 2B9XA 3KPKA 4OPCA 2GB0A 4A79A 1DJNA 1GSNA 5HY5A 2AR8A 2QA2A 3SZWA 1BF3A 2C73A 1JEHA 4OPIA 1MO9A 2YR6A 3T2YA 2WDQA 3C4AA 5U25A 2JBVA 3UKPA 2Q6UA 2WEUA 4U2TA 1H82A 2V3AA 1EL8A 2RGHA 1L9EA 2GMHA 2YR4A 4A65A 4CBQA 4A6NB 5IQ1A 1ZP0A 2IIDA 5KMRA 1TYTA 2C67A 2XLPA 3FG2P 4A5LA 1FL2A 4BK2A 3UOVA 2OA1A 1YQ3A 2WOIA 3AYIA 3ISHA 3AE1A 4MJWA 4NTCA 5HYMA 2GAGB 1PN0A 3AD7B 4NTDA 1CC6A 3AXBA 4C74A 1BZLA 2WPCA 3ABVA 1BWCA 4X4JA 3BHKA 2IVDA 1CJ4A 3OZ2A 3ALLA 4LU6A 4U8KA 5EB4A 4J56A 4TM3A 4XWRA 2FJBA 5KVIA 2APGA 1BGJA 2BABA 4AOXA 4CNJA 2B9WA 5KMQA 3F8PA 3AE6A 4H2NA 1NHRA 2GAHB 3UKKA 2ZBWA 3URHA 4EMWA 1QJDA 2B9YA 2PHHA 5U1OA 2WP6A 2GQFA 2A8XA 1D4DA 2BCGG 3P4RA 2Z5YA 1PHHA 2R46A 3IC9A 1JOAA 1LQTA 3QSEA 4YWOA 3GDPA 4C3XA 2Q0LA 3AEBA 1JU2A 1AOGA 2WHDA 3BI4A 2YM2A 4U8LA 4BJYA 3NKSA 2YVJA 3AYJA 4G9KA 2XLSA 3UOZA 2XFNA 1ZDLA 1H81A 4H4UA 1TDEA 4K5RA 4NNJA 1S3BA 1Q1WA 1QO8A 3VR9A 2GRTA 4J34A 2EQ9A 3CNSA 2XLRA 2YG3A 3CPJG 2E4GA 2BRAA 4ECHA 2WESA 3II4A 5FS7A 3NTDA 2E5VA 4AP1A 1LJ1A 3CNJA 1VDCA 1LQUA 1L9CA 3B3RA 1EL7A 3KLJA 1Y0PA 4Z26A 4A6NA 3CN8A 4IVMB 3G5RA 2BCPA 4B68A 4FDCB 1F3PA 1CF3A 2XFQA 3VRDB 1GERA 2BXSA 3B6DA 3H8IA 3OC4A 4AOSA 5KVHA 1O5WA 4OPGA 4U8PA 1P2HA 1D4CA 2BS2A 4M52A 2GH5A 4A9WA 2R45A 4JY3A 4OPDA 3Q6JA 4U8NA 4PAAA 1K0LA 4H2RA 4YTPA 2VQBA 3EANA 4H4ZA 1NDAA 1LTXR 4NEVA 3DJGX 3ZYXA 3GD4A 4REKA 5GRTA 4ADWA 3AYLA 4N9XA 3P1WA 1SEZA 3R9UA 1GREA 3V3NA 3P9UA 4HB9A 1FEAA 1IUXA 3QJ4A 5KWFA 3DMEA 4KPRA 3UKHA 3AEAA 3SX6A 3T31A 2IVEA 2YWLA 1DODA 2WPFA 2ARDA 2WP5A 4TM4A 3P4QA 3QSMA 1PBFA 1X31B 5KOWA 1JRXA 1CJ3A 4YT0A 1GV4A 4ZCCA 4H2PA 5TR3A 4CY8A 1E1KA 1TYPA 1XDIA 2CULA 2XVJA 3AE8A 1YQZA 2YR5A 3DJJA 2B76A 2C7GA 1MOKA 1E39A 1BKWA 3CNTA 1OJTA 3FMWA 1JRYA 2WOWA 3KU9A 2RGJA 2FJAA 4H4VA 2X50A 1BGNA 4YXDA 2GEWA 2Y6RA 3UP4A 2R9ZA 4D03A 4K7ZA 1IUUA 4GCMA 2XFUA 3SZ0A 2YLXA 1KSUA 2XLTA 2WDVA 3IF9A 4DSHA 1Y56B 3CIRA 3LZXA 1O95A 4J2WA 4U2LA 1NAAA 2DKIA 5FMHA 4H4SA 1PXCA 1YY5A 4NZHA 3VQRA 4OCGA 1FEBA 1N1PA 4ICYA 1L0VA 1GRAA 4H4WA 2R0GA 1TDKA 4B66A 2BS3A 2YQUA 5L46A 3DA1A 1OJAA 5FS6A 1D7LA 3NK1X 2C3CA 3UTHA 2C4CA 4GRTA 1IUTA 2A87A 4UP3A 4USQA 3VRAA 2YLWA 2V60A 4IA6A 4Z2UA 3QVRA 5BUKA 4P9SA 3F8DA 3SQPA 1VG0A 1XHCA 3IHMA 2BRYA 1DOCA 3NYEA 4X9MA 1N4VA 1S2QA 3T2ZA 4B63A 3L8KA 1OJ9A 2BK4A 2C70A 2FJDA 1GXFA 5HXIA 2VVLA 2JAEA 2WDRA 3P4PA 4C3YA 3T2KA 2C72A 1CC4A 2Q7VA 3BHFA 1M6IA 5BVAA 2GVCA 1E1NA 1N4UA 1LVLA 2ACZA 1K4QA 2V61A 3BI2A 1NENA 3NG7X 3CPHG 4II2A 3HZLA 3EF6A 5M0ZA 1F6MA 3S61A 2AAQA 3GDNA 4WCTA 4EM3A 2XCGA 5CKUA 1JRZA 2VRLA 2JB1A 2GQWA 3AWIA 3NYCA 4U8MA 3ZDNA 4C77A 1E6EA 3HYXA 4UDRA 2XFPA 2XLUA 2GMJA 4NWZA 5U63A 3I3LA 1GTHA 4IV9A 4A7AA 4IVOB 1XPQA 1OJCA 2R4JA 1NG3A 1YKJA 2WP9A 5J7XA 3D8XA 1GEUA 2BC1A 2BK5A 2YVGA 3QVPA 5ER0A 1D7YA 4D04A 3UTFA 3NTAA 3WE0A 1GESA 5C2TA 1VRQB 1XANA 3COXA 3PS9A 4OPLA 3AEGA 5CQFA 1H84A 3BI5A 5C3JA 2ZZCA 3C96A 1FECA 4KX6A 1EL5A 3RNMA 1ZMDA 4G74A 2B7SA 1B5QA 2XVIA 2BS4A 3DK8A 2BC0A 3M12A 2ZZBA 2WOVA 2BACA 3GSIA 1K0JA 2QCUA 3K7QX 4NTEA 1KFYA 1GALA 3AE9A 1QLBA 2WS3A 4H4RA 4FK1A 4J33A 1FOHA 1PBEA 3IHGA 3REDA 4H2QA 4CRTA 2B7RA 1Q1RA 1TDNA 2H89A 2TPRA 4O5QA 3CMMA 4E0VA 3VRBA 3ATQA 2V3BA 2VOUA 2XVHA 4Y4LA 4BJZA 3K30A 3JSKA 1KNPA 3DGHA 4YTMA 4XWZA 1PJ5A 5J60A 1H83A 2UZZA 1PJ7A 3AEEA 3DGZA 2C66A 3GRSA 4H4QA 4Z43A 2C75A 2HQMA 3T14A 3T37A 2Q0KA 4FK1C 4G6HA 4C5OA 5JCKA 1GPEA 4Z24A 4IA5A 2ZZ0A 2JK6A 4B67A 1RP0A 2WU2A 1FCDA 3M13A 2GR3A 5FS9A 4EQSA 4GDEA 3UP5A 3UTGA 3KD9A 4Z44A 3SZFA 3PO7A 4I58A 2AQJA 4G6GA 1DJQA 4JY2A 4OPUA 2BK3A 3LZWA 5M10A 1DOBA 2Z5XA 1MXTA 2CDUA 3SZCA 4O5UA 4ZCDA 1GRBA 3KPFA 5GSNA 3HYVA 3I6DA 3DK9A 4GUVA 1ZKQA 1LPFA 2BYBA 3AB1A 3UKFA 1CBOA 3QFBA 2R4EA 4H7UA 4B64A 1H6VA 1NHQA 2GR2A 5IPYA 4EIPA 5KOXA 4GDPA 3DK4A 5JCIA 5EOWA 3C4NA 2X8CA 1LV0A 3E1TA 1F8RA 4USRA 2E1MA 2VQ7A 4DSGA 2GR0A 4APNA 4HA6A 2YVFA 1PBDA 3AEDA 1TDOA 2GV8A 3GD3A 5EBKA 4EQRA 1B4VA 4K8DA 1V59A 1F8WA 1DXLA 4RG3A 3UKLA 2QA1A 1CL0A 1YQ4A 4OVIA 1ZX9A 2I0ZA 4Z25A 1Q9IA 3CNDA 3AE5A 3GRTA 3RHAA 2C3DA 4DNAA 5BRTA 1COYA 4AT0A 2F5ZA 4U8IA 2R0PA 4Y4NA 1B37A 3SY4A 3D1CA 2WETA 3IWAA 4GAVA 4XXGA 4AP3A 2YM1A 3RP6A 3GYJA 1NEKA 4U8OA 4JQ9A 2WQYA 4J57A 3NHOX 3SYIA 4EMIA 3AE7A 2C76A 2FBWA 4GAPA 4H4YA 4H50A 3T0KA 1GRTA 3LADA 2V5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V76 A;  3ITJ A;  3UKA A;  4EQX A;  3LB8 A;  1JNR A;  1PS9 A;  1ZOY A;  1S2Y A;  4K5S A;  4TM1 A;  4EIQ A;  3QFA A;  4I59 A;  2WBA A;  3AEC A;  3NGC X;  2A89 A;  3RP7 A;  1KDG A;  1KSS A;  5HHF A;  4OPT A;  2WPE A;  1EL9 A;  1REO A;  2J3N A;  3GWF A;  4B69 A;  2XYO A;  3CGB A;  1B8S A;  1ONF A;  1E7P A;  2WU5 A;  3UTE A;  3ALJ A;  3AD9 B;  1TDF A;  3K7M X;  1E1L A;  4RG4 A;  4CY6 A;  2V6O A;  2X99 A;  4YKF A;  4ZN0 A;  3DH9 A;  3GMC A;  3CGE A;  4YTN A;  1W4X A;  2NPX A;  2X8H A;  1NG4 A;  2TMD A;  3H4K A;  4CCQ A;  2GR1 A;  1GRG A;  1ZY8 A;  1ZOV A;  2C65 A;  2NVK X;  2OLN A;  4H4P A;  3UCL A;  2YLZ A;  1O94 A;  2OAM A;  4Z2T A;  3PVC A;  3FIM B;  4BV6 A;  3Q9T A;  3CNP A;  4X9N A;  1GET A;  1NHP A;  4B1B A;  4GF7 A;  3SM8 A;  1H7X A;  5KRQ A;  4UDP A;  1F8S A;  1UKV G;  4EM4 A;  1DOE A;  1Y56 A;  4Z2R A;  2Y6Q A;  4JDR A;  1M64 A;  2YG4 A;  4FX9 A;  3G5Q A;  5JCL A;  1ZMC A;  4YSX A;  3GWD A;  3G5S A;  1L9D A;  3O0H A;  3UOX A;  1H86 A;  2YLT A;  5IQ4 A;  3NYF A;  2YG5 A;  3L1R A;  3ATR A;  2VVM A;  4U2S A;  3CTY A;  5JCM A;  4CCR A;  4NEW A;  3QSS A;  2PYX A;  2QAE A;  3NIX A;  3GMB A;  4JN9 A;  2X3N A;  3EAO A;  3FBS A;  3M0O A;  1PBC A;  2X8G A;  2YG6 A;  1GT8 A;  4LA1 A;  2YLS A;  3KA7 A;  2JB3 A;  3AE3 A;  1VG9 A;  1ELI A;  2FJE A;  3NK0 X;  2R0C A;  2XVE A;  5JCN A;  2EQ7 A;  1H7W A;  2OAL A;  2XDO A;  3H8L A;  3NN0 X;  3RP8 A;  2VRM A;  4WX1 A;  2BA9 A;  3DJE A;  2CFY A;  4UDQ A;  2JB2 A;  2H88 A;  2RAB A;  1IUS A;  3NNE A;  4J31 A;  1GRH A;  2GF3 A;  4BUR A;  4YSH A;  4BK3 A;  3LXD A;  1IJH A;  3ICR A;  1VQW A;  1S3E A;  1TRB A;  3AE2 A;  3GYI A;  4RSL A;  1GND A;  3V3O A;  1K0I A;  3ADA B;  3K7T A;  5KXJ A;  2XVF A;  3NT6 A;  1RSG A;  3LOV A;  4TLZ A;  2EQ6 A;  3NN6 X;  5DBJ A;  3UKQ A;  4EQW A;  3EPT A;  1DNC A;  3UOY A;  4H4X A;  4JNA A;  3P4S A;  2C64 A;  1KF6 A;  4DGK A;  1PJ6 A;  2W0H A;  3KKJ A;  4J36 A;  3AE4 A;  4YKG A;  3F8R A;  4AT2 A;  4BK1 A;  3AD8 B;  1GTE A;  5LV9 A;  2EQ8 A;  1CC2 A;  3SFD A;  1PBB A;  1NPX A;  5BUL A;  3CPI G;  1KNR A;  2O9Z A;  1CHU A;  4LII A;  1D4E A;  1OJD A;  4H4T A;  1PXB A;  3NLC A;  2YLR A;  2OLO A;  4YSY A;  1Z6L A;  1RYI A;  3ALM A;  3SGL A;  3NK2 X;  3NRN A;  4JNQ A;  1E1M A;  4K22 A;  4TM0 A;  2YAU A;  1CJC A;  2XFO A;  2CVJ A;  1P2E A;  2JKC A;  1EBD A;  4CNK A;  3BNM A;  1N4W A;  1JNZ A;  4EMJ A;  2VVL G;  4PAB A;  2YG7 A;  4K2X A;  1PXA A;  3DJD A;  3ICS A;  1D5T A;  1IUW A;  2RGO A;  3BNU A;  4Y4M A;  4A99 A;  3ICT A;  1IUV A;  3KVE A;  2DKH A;  3FPZ A;  4GR1 A;  4TLX A;  4B65 A;  5EB5 A;  3CGC A;  4U8J A;  3AEF A;  3CGD A;  3SFE A;  2BXR A;  1HYU A;  1NHS A;  1GOS A;  2VZ2 A;  1GRF A;  3LJP A;  1PDH A;  5FS8 A;  3NH3 X;  3S5W A;  1ZK7 A;  4YSZ A;  3VR8 A;  1CJ2 A;  2B9X A;  4OPC A;  2GB0 A;  4A79 A;  1DJN A;  1GSN A;  5HY5 A;  2AR8 A;  2QA2 A;  1BF3 A;  2C73 A;  1JEH A;  4OPI A;  1MO9 A;  2YR6 A;  2WDQ A;  3C4A A;  5U25 A;  2JBV A;  3UKP A;  2Q6U A;  2WEU A;  4U2T A;  1H82 A;  2V3A A;  1EL8 A;  2RGH A;  1L9E A;  2GMH A;  2YR4 A;  4A65 A;  4CBQ A;  4A6N B;  5IQ1 A;  1ZP0 A;  2IID A;  1TYT A;  2C67 A;  2XLP A;  3FG2 P;  4A5L A;  1FL2 A;  4BK2 A;  3UOV A;  2OA1 A;  1YQ3 A;  2WOI A;  3AYI A;  3ISH A;  3AE1 A;  4MJW A;  4NTC A;  5HYM A;  2GAG B;  1PN0 A;  3AD7 B;  4NTD A;  1CC6 A;  3AXB A;  4C74 A;  1BZL A;  2WPC A;  3ABV A;  1BWC A;  4X4J A;  3BHK A;  2IVD A;  1CJ4 A;  3OZ2 A;  3ALL A;  4LU6 A;  4U8K A;  5EB4 A;  4J56 A;  4TM3 A;  4XWR A;  2FJB A;  5KVI A;  2APG A;  1BGJ A;  2BAB A;  4AOX A;  4CNJ A;  2B9W A;  3F8P A;  3AE6 A;  4H2N A;  1NHR A;  2GAH B;  3UKK A;  2ZBW A;  3URH A;  4EMW A;  1QJD A;  2B9Y A;  2PHH A;  5U1O A;  2WP6 A;  2GQF A;  2A8X A;  1D4D A;  2BCG G;  3P4R A;  2Z5Y A;  1PHH A;  2R46 A;  3IC9 A;  1JOA A;  1LQT A;  3QSE A;  4YWO A;  3GDP A;  4C3X A;  2Q0L A;  3AEB A;  1JU2 A;  1AOG A;  2WHD A;  3BI4 A;  2YM2 A;  4U8L A;  4BJY A;  3NKS A;  2YVJ A;  3AYJ A;  2XLS A;  3UOZ A;  2XFN A;  1ZDL A;  1H81 A;  4H4U A;  1TDE A;  4K5R A;  1S3B A;  1Q1W A;  1QO8 A;  3VR9 A;  2GRT A;  4J34 A;  2EQ9 A;  3CNS A;  2XLR A;  2YG3 A;  3CPJ G;  2E4G A;  4ECH A;  2WES A;  3II4 A;  5FS7 A;  3NTD A;  2E5V A;  4AP1 A;  1LJ1 A;  3CNJ A;  1VDC A;  1LQU A;  1L9C A;  3B3R A;  1EL7 A;  3KLJ A;  1Y0P A;  4Z26 A;  4A6N A;  3CN8 A;  4IVM B;  3G5R A;  2BCP A;  4B68 A;  4FDC B;  1F3P A;  1CF3 A;  2XFQ A;  3VRD B;  1GER A;  2BXS A;  3B6D A;  3H8I A;  3OC4 A;  4AOS A;  5KVH A;  1O5W A;  4OPG A;  4U8P A;  1P2H A;  1D4C A;  2BS2 A;  4M52 A;  2GH5 A;  4A9W A;  2R45 A;  4JY3 A;  4OPD A;  3Q6J A;  4U8N A;  4PAA A;  1K0L A;  4H2R A;  4YTP A;  2VQB A;  3EAN A;  4H4Z A;  1NDA A;  1LTX R;  4NEV A;  3DJG X;  3ZYX A;  3GD4 A;  4REK A;  5GRT A;  4ADW A;  3AYL A;  4N9X A;  3P1W A;  1SEZ A;  3R9U A;  1GRE A;  3V3N A;  3P9U A;  4HB9 A;  1FEA A;  1IUX A;  3QJ4 A;  5KWF A;  3DME A;  4KPR A;  3UKH A;  3AEA A;  2IVE A;  2YWL A;  1DOD A;  2WPF A;  2ARD A;  2WP5 A;  4TM4 A;  3P4Q A;  3QSM A;  1PBF A;  1X31 B;  5KOW A;  1JRX A;  1CJ3 A;  4YT0 A;  1GV4 A;  4ZCC A;  4H2P A;  5TR3 A;  4CY8 A;  1E1K A;  1TYP A;  1XDI A;  2CUL A;  2XVJ A;  3AE8 A;  1YQZ A;  2YR5 A;  3DJJ A;  2B76 A;  2C7G A;  1MOK A;  1E39 A;  1BKW A;  3CNT A;  1OJT A;  3FMW A;  1JRY A;  2WOW A;  3KU9 A;  2RGJ A;  2FJA A;  4H4V A;  2X50 A;  1BGN A;  4YXD A;  2GEW A;  2Y6R A;  3UP4 A;  2R9Z A;  4D03 A;  4K7Z A;  1IUU A;  4GCM A;  2XFU A;  2YLX A;  1KSU A;  2XLT A;  2WDV A;  3IF9 A;  4DSH A;  1Y56 B;  3CIR A;  3LZX A;  1O95 A;  4J2W A;  4U2L A;  1NAA A;  2DKI A;  5FMH A;  4H4S A;  1PXC A;  1YY5 A;  4NZH A;  3VQR A;  4OCG A;  1FEB A;  1N1P A;  4ICY A;  1L0V A;  1GRA A;  4H4W A;  2R0G A;  1TDK A;  4B66 A;  2BS3 A;  2YQU A;  5L46 A;  3DA1 A;  1OJA A;  5FS6 A;  1D7L A;  3NK1 X;  2C3C A;  3UTH A;  4GRT A;  1IUT A;  2A87 A;  4UP3 A;  4USQ A;  3VRA A;  2YLW A;  2V60 A;  4IA6 A;  4Z2U A;  3QVR A;  5BUK A;  4P9S A;  3F8D A;  3SQP A;  1VG0 A;  1XHC A;  3IHM A;  1DOC A;  3NYE A;  4X9M A;  1N4V A;  1S2Q A;  4B63 A;  3L8K A;  1OJ9 A;  2BK4 A;  2C70 A;  2FJD A;  1GXF A;  5HXI A;  2VVL A;  2JAE A;  2WDR A;  3P4P A;  4C3Y A;  2C72 A;  1CC4 A;  2Q7V A;  3BHF A;  1M6I A;  5BVA A;  2GVC A;  1E1N A;  1N4U A;  1LVL A;  2ACZ A;  1K4Q A;  2V61 A;  3BI2 A;  1NEN A;  3NG7 X;  3CPH G;  5M0Z A;  3HZL A;  3EF6 A;  1F6M A;  3S61 A;  2AAQ A;  3GDN A;  4WCT A;  4EM3 A;  2XCG A;  5CKU A;  1JRZ A;  2VRL A;  2JB1 A;  2GQW A;  3AWI A;  3NYC A;  4U8M A;  3ZDN A;  4C77 A;  1E6E A;  4UDR A;  2XFP A;  2XLU A;  2GMJ A;  5U63 A;  5JCK A;  3I3L A;  1GTH A;  4IV9 A;  4A7A A;  4IVO B;  1XPQ A;  1OJC A;  2R4J A;  1NG3 A;  1YKJ A;  2WP9 A;  5J7X A;  3D8X A;  1GEU A;  2BC1 A;  2BK5 A;  2YVG A;  3QVP A;  5ER0 A;  1D7Y A;  4D04 A;  3UTF A;  3NTA A;  3WE0 A;  1GES A;  5C2T A;  1VRQ B;  1XAN A;  3COX A;  3PS9 A;  4OPL A;  3AEG A;  5CQF A;  1H84 A;  3BI5 A;  5C3J A;  2ZZC A;  3C96 A;  1FEC A;  4KX6 A;  1EL5 A;  3RNM A;  1ZMD A;  2B7S A;  1B5Q A;  2XVI A;  2BS4 A;  3DK8 A;  2BC0 A;  3M12 A;  2ZZB A;  2WOV A;  2BAC A;  3GSI A;  1K0J A;  2QCU A;  3K7Q X;  4NTE A;  1KFY A;  1GAL A;  3AE9 A;  1QLB A;  2WS3 A;  4H4R A;  4FK1 A;  4J33 A;  1FOH A;  1PBE A;  3IHG A;  3RED A;  4H2Q A;  4CRT A;  2B7R A;  1Q1R A;  1TDN A;  2H89 A;  2TPR A;  4O5Q A;  4E0V A;  3VRB A;  3ATQ A;  2V3B A;  2VOU A;  2XVH A;  4Y4L A;  4BJZ A;  3K30 A;  3JSK A;  1KNP A;  3DGH A;  4YTM A;  4XWZ A;  1PJ5 A;  5J60 A;  1H83 A;  2UZZ A;  1PJ7 A;  3AEE A;  3DGZ A;  2C66 A;  3GRS A;  4H4Q A;  4Z43 A;  2C75 A;  2HQM A;  3T37 A;  2Q0K A;  4FK1 C;  4C5O A;  1GPE A;  4Z24 A;  4IA5 A;  2ZZ0 A;  2JK6 A;  4B67 A;  1RP0 A;  2WU2 A;  1FCD A;  3M13 A;  2GR3 A;  5FS9 A;  4EQS A;  4GDE A;  3UP5 A;  3UTG A;  3KD9 A;  4Z44 A;  3PO7 A;  4I58 A;  2AQJ A;  4JY2 A;  1DJQ A;  4OPU A;  2BK3 A;  3LZW A;  5M10 A;  1DOB A;  2Z5X A;  1MXT A;  2CDU A;  4O5U A;  4ZCD A;  1GRB A;  3KPF A;  5GSN A;  3I6D A;  3DK9 A;  4GUV A;  1ZKQ A;  1LPF A;  2BYB A;  3AB1 A;  3UKF A;  1CBO A;  3QFB A;  2R4E A;  4H7U A;  4B64 A;  1H6V A;  1NHQ A;  2GR2 A;  5IPY A;  4EIP A;  5KOX A;  4GDP A;  3DK4 A;  5JCI A;  5EOW A;  3C4N A;  2X8C A;  1LV0 A;  3E1T A;  1F8R A;  4USR A;  2E1M A;  2VQ7 A;  4DSG A;  2GR0 A;  4APN A;  4HA6 A;  2YVF A;  1PBD A;  3AED A;  1TDO A;  2GV8 A;  3GD3 A;  5EBK A;  4EQR A;  1B4V A;  4K8D A;  1V59 A;  1F8W A;  1DXL A;  4RG3 A;  3UKL A;  2QA1 A;  1CL0 A;  1YQ4 A;  4OVI A;  1ZX9 A;  2I0Z A;  4Z25 A;  1Q9I A;  3CND A;  3AE5 A;  3GRT A;  3RHA A;  2C3D A;  4DNA A;  5BRT A;  1COY A;  4AT0 A;  2F5Z A;  4U8I A;  2R0P A;  4Y4N A;  1B37 A;  3D1C A;  2WET A;  3IWA A;  4XXG A;  4AP3 A;  2YM1 A;  3RP6 A;  3GYJ A;  1NEK A;  4U8O A;  4JQ9 A;  2WQY A;  4J57 A;  3NHO X;  4EMI A;  3AE7 A;  2C76 A;  2FBW A;  4H4Y A;  4H50 A;  1GRT A;  3LAD A;  2V5Z A; 
#chains in the Genus database with same CATH topology
 3V76 A;  3ITJ A;  3UKA A;  4EQX A;  3LB8 A;  1JNR A;  1PS9 A;  1ZOY A;  1S2Y A;  4K5S A;  4TM1 A;  4EIQ A;  3QFA A;  4I59 A;  2WBA A;  3AEC A;  3NGC X;  2A89 A;  3RP7 A;  1KDG A;  1KSS A;  5HHF A;  4OPT A;  2WPE A;  1EL9 A;  1REO A;  2J3N A;  3GWF A;  3SXI A;  4B69 A;  2XYO A;  3CGB A;  5KNL A;  1B8S A;  1ONF A;  1E7P A;  2WU5 A;  3UTE A;  3ALJ A;  3AD9 B;  1TDF A;  3K7M X;  1E1L A;  4RG4 A;  4CY6 A;  2V6O A;  2X99 A;  4YKF A;  4ZN0 A;  3DH9 A;  3GMC A;  3CGE A;  4YTN A;  1W4X A;  2NPX A;  2X8H A;  1NG4 A;  2TMD A;  3H4K A;  4CCQ A;  2GR1 A;  1GRG A;  1ZY8 A;  1ZOV A;  2C65 A;  2NVK X;  2OLN A;  4H4P A;  3UCL A;  2YLZ A;  3GYX A;  1O94 A;  2OAM A;  4Z2T A;  3PVC A;  3FIM B;  4BV6 A;  3Q9T A;  3CNP A;  4X9N A;  1GET A;  1NHP A;  4B1B A;  4GF7 A;  3SM8 A;  1H7X A;  5KRQ A;  4UDP A;  1F8S A;  1UKV G;  4EM4 A;  1DOE A;  1Y56 A;  4Z2R A;  2Y6Q A;  4JDR A;  1M64 A;  2YG4 A;  4FX9 A;  3G5Q A;  3HYW A;  5JCL A;  1ZMC A;  4YSX A;  3GWD A;  3G5S A;  5KMS A;  1L9D A;  3O0H A;  3UOX A;  1H86 A;  2YLT A;  5IQ4 A;  3NYF A;  2YG5 A;  3L1R A;  3ATR A;  2VVM A;  4U2S A;  3CTY A;  5JCM A;  4CCR A;  4NEW A;  3QSS A;  2PYX A;  2QAE A;  3NIX A;  3GMB A;  4JN9 A;  2X3N A;  3EAO A;  3FBS A;  3M0O A;  1PBC A;  2X8G A;  2YG6 A;  1GT8 A;  4LA1 A;  2YLS A;  3KA7 A;  2JB3 A;  3AE3 A;  1VG9 A;  1ELI A;  2FJE A;  3NK0 X;  2R0C A;  2XVE A;  5JCN A;  2EQ7 A;  1H7W A;  2OAL A;  2XDO A;  3H8L A;  3NN0 X;  3RP8 A;  2VRM A;  4WX1 A;  2BA9 A;  3DJE A;  2CFY A;  4UDQ A;  2JB2 A;  2H88 A;  2RAB A;  1IUS A;  3NNE A;  4J31 A;  1GRH A;  2GF3 A;  4BUR A;  4YSH A;  4BK3 A;  3LXD A;  1IJH A;  3ICR A;  1VQW A;  1S3E A;  1TRB A;  3AE2 A;  3GYI A;  4RSL A;  1GND A;  3V3O A;  1K0I A;  4G73 A;  3ADA B;  3K7T A;  5KXJ A;  2XVF A;  3NT6 A;  1RSG A;  3LOV A;  4TLZ A;  4II3 A;  2EQ6 A;  3NN6 X;  5DBJ A;  3UKQ A;  4EQW A;  3EPT A;  1DNC A;  3UOY A;  4H4X A;  4JNA A;  3P4S A;  2C64 A;  1KF6 A;  4DGK A;  1PJ6 A;  2W0H A;  3KKJ A;  4J36 A;  3AE4 A;  4YKG A;  3F8R A;  4AT2 A;  4BK1 A;  3AD8 B;  1GTE A;  5LV9 A;  2EQ8 A;  1CC2 A;  3SFD A;  1PBB A;  1NPX A;  5BUL A;  3CPI G;  1KNR A;  2O9Z A;  1CHU A;  4LII A;  1D4E A;  1OJD A;  4H4T A;  1PXB A;  3NLC A;  2YLR A;  2OLO A;  4YSY A;  1Z6L A;  1RYI A;  3ALM A;  3SGL A;  3NK2 X;  3NRN A;  4JNQ A;  1E1M A;  4K22 A;  4TM0 A;  2YAU A;  1CJC A;  2XFO A;  2CVJ A;  1P2E A;  2JKC A;  1EBD A;  4CNK A;  3BNM A;  1N4W A;  1JNZ A;  4EMJ A;  2VVL G;  4PAB A;  2YG7 A;  4K2X A;  1PXA A;  3DJD A;  3ICS A;  1D5T A;  1IUW A;  2RGO A;  3BNU A;  4Y4M A;  4A99 A;  3ICT A;  1IUV A;  3KVE A;  5KMP A;  2DKH A;  3FPZ A;  4GR1 A;  4TLX A;  4B65 A;  5EB5 A;  3CGC A;  4U8J A;  3AEF A;  3CGD A;  3SFE A;  2BXR A;  1HYU A;  1NHS A;  1GOS A;  2VZ2 A;  1GRF A;  3LJP A;  1PDH A;  5FS8 A;  3NH3 X;  3S5W A;  1ZK7 A;  4YSZ A;  3VR8 A;  1CJ2 A;  2B9X A;  3KPK A;  4OPC A;  2GB0 A;  4A79 A;  1DJN A;  1GSN A;  5HY5 A;  2AR8 A;  2QA2 A;  3SZW A;  1BF3 A;  2C73 A;  1JEH A;  4OPI A;  1MO9 A;  2YR6 A;  3T2Y A;  2WDQ A;  3C4A A;  5U25 A;  2JBV A;  3UKP A;  2Q6U A;  2WEU A;  4U2T A;  1H82 A;  2V3A A;  1EL8 A;  2RGH A;  1L9E A;  2GMH A;  2YR4 A;  4A65 A;  4CBQ A;  4A6N B;  5IQ1 A;  1ZP0 A;  2IID A;  5KMR A;  1TYT A;  2C67 A;  2XLP A;  3FG2 P;  4A5L A;  1FL2 A;  4BK2 A;  3UOV A;  2OA1 A;  1YQ3 A;  2WOI A;  3AYI A;  3ISH A;  3AE1 A;  4MJW A;  4NTC A;  5HYM A;  2GAG B;  1PN0 A;  3AD7 B;  4NTD A;  1CC6 A;  3AXB A;  4C74 A;  1BZL A;  2WPC A;  3ABV A;  1BWC A;  4X4J A;  3BHK A;  2IVD A;  1CJ4 A;  3OZ2 A;  3ALL A;  4LU6 A;  4U8K A;  5EB4 A;  4J56 A;  4TM3 A;  4XWR A;  2FJB A;  5KVI A;  2APG A;  1BGJ A;  2BAB A;  4AOX A;  4CNJ A;  2B9W A;  5KMQ A;  3F8P A;  3AE6 A;  4H2N A;  1NHR A;  2GAH B;  3UKK A;  2ZBW A;  3URH A;  4EMW A;  1QJD A;  2B9Y A;  2PHH A;  5U1O A;  2WP6 A;  2GQF A;  2A8X A;  1D4D A;  2BCG G;  3P4R A;  2Z5Y A;  1PHH A;  2R46 A;  3IC9 A;  1JOA A;  1LQT A;  3QSE A;  4YWO A;  3GDP A;  4C3X A;  2Q0L A;  3AEB A;  1JU2 A;  1AOG A;  2WHD A;  3BI4 A;  2YM2 A;  4U8L A;  4BJY A;  3NKS A;  2YVJ A;  3AYJ A;  4G9K A;  2XLS A;  3UOZ A;  2XFN A;  1ZDL A;  1H81 A;  4H4U A;  1TDE A;  4K5R A;  4NNJ A;  1S3B A;  1Q1W A;  1QO8 A;  3VR9 A;  2GRT A;  4J34 A;  2EQ9 A;  3CNS A;  2XLR A;  2YG3 A;  3CPJ G;  2E4G A;  2BRA A;  4ECH A;  2WES A;  3II4 A;  5FS7 A;  3NTD A;  2E5V A;  4AP1 A;  1LJ1 A;  3CNJ A;  1VDC A;  1LQU A;  1L9C A;  3B3R A;  1EL7 A;  3KLJ A;  1Y0P A;  4Z26 A;  4A6N A;  3CN8 A;  4IVM B;  3G5R A;  2BCP A;  4B68 A;  4FDC B;  1F3P A;  1CF3 A;  2XFQ A;  3VRD B;  1GER A;  2BXS A;  3B6D A;  3H8I A;  3OC4 A;  4AOS A;  5KVH A;  1O5W A;  4OPG A;  4U8P A;  1P2H A;  1D4C A;  2BS2 A;  4M52 A;  2GH5 A;  4A9W A;  2R45 A;  4JY3 A;  4OPD A;  3Q6J A;  4U8N A;  4PAA A;  1K0L A;  4H2R A;  4YTP A;  2VQB A;  3EAN A;  4H4Z A;  1NDA A;  1LTX R;  4NEV A;  3DJG X;  3ZYX A;  3GD4 A;  4REK A;  5GRT A;  4ADW A;  3AYL A;  4N9X A;  3P1W A;  1SEZ A;  3R9U A;  1GRE A;  3V3N A;  3P9U A;  4HB9 A;  1FEA A;  1IUX A;  3QJ4 A;  5KWF A;  3DME A;  4KPR A;  3UKH A;  3AEA A;  3SX6 A;  3T31 A;  2IVE A;  2YWL A;  1DOD A;  2WPF A;  2ARD A;  2WP5 A;  4TM4 A;  3P4Q A;  3QSM A;  1PBF A;  1X31 B;  5KOW A;  1JRX A;  1CJ3 A;  4YT0 A;  1GV4 A;  4ZCC A;  4H2P A;  5TR3 A;  4CY8 A;  1E1K A;  1TYP A;  1XDI A;  2CUL A;  2XVJ A;  3AE8 A;  1YQZ A;  2YR5 A;  3DJJ A;  2B76 A;  2C7G A;  1MOK A;  1E39 A;  1BKW A;  3CNT A;  1OJT A;  3FMW A;  1JRY A;  2WOW A;  3KU9 A;  2RGJ A;  2FJA A;  4H4V A;  2X50 A;  1BGN A;  4YXD A;  2GEW A;  2Y6R A;  3UP4 A;  2R9Z A;  4D03 A;  4K7Z A;  1IUU A;  4GCM A;  2XFU A;  3SZ0 A;  2YLX A;  1KSU A;  2XLT A;  2WDV A;  3IF9 A;  4DSH A;  1Y56 B;  3CIR A;  3LZX A;  1O95 A;  4J2W A;  4U2L A;  1NAA A;  2DKI A;  5FMH A;  4H4S A;  1PXC A;  1YY5 A;  4NZH A;  3VQR A;  4OCG A;  1FEB A;  1N1P A;  4ICY A;  1L0V A;  1GRA A;  4H4W A;  2R0G A;  1TDK A;  4B66 A;  2BS3 A;  2YQU A;  5L46 A;  3DA1 A;  1OJA A;  5FS6 A;  1D7L A;  3NK1 X;  2C3C A;  3UTH A;  2C4C A;  4GRT A;  1IUT A;  2A87 A;  4UP3 A;  4USQ A;  3VRA A;  2YLW A;  2V60 A;  4IA6 A;  4Z2U A;  3QVR A;  5BUK A;  4P9S A;  3F8D A;  3SQP A;  1VG0 A;  1XHC A;  3IHM A;  2BRY A;  1DOC A;  3NYE A;  4X9M A;  1N4V A;  1S2Q A;  3T2Z A;  4B63 A;  3L8K A;  1OJ9 A;  2BK4 A;  2C70 A;  2FJD A;  1GXF A;  5HXI A;  2VVL A;  2JAE A;  2WDR A;  3P4P A;  4C3Y A;  3T2K A;  2C72 A;  1CC4 A;  2Q7V A;  3BHF A;  1M6I A;  5BVA A;  2GVC A;  1E1N A;  1N4U A;  1LVL A;  2ACZ A;  1K4Q A;  2V61 A;  3BI2 A;  1NEN A;  3NG7 X;  3CPH G;  4II2 A;  3HZL A;  3EF6 A;  5M0Z A;  1F6M A;  3S61 A;  2AAQ A;  3GDN A;  4WCT A;  4EM3 A;  2XCG A;  5CKU A;  1JRZ A;  2VRL A;  2JB1 A;  2GQW A;  3AWI A;  3NYC A;  4U8M A;  3ZDN A;  4C77 A;  1E6E A;  3HYX A;  4UDR A;  2XFP A;  2XLU A;  2GMJ A;  4NWZ A;  5U63 A;  3I3L A;  1GTH A;  4IV9 A;  4A7A A;  4IVO B;  1XPQ A;  1OJC A;  2R4J A;  1NG3 A;  1YKJ A;  2WP9 A;  5J7X A;  3D8X A;  1GEU A;  2BC1 A;  2BK5 A;  2YVG A;  3QVP A;  5ER0 A;  1D7Y A;  4D04 A;  3UTF A;  3NTA A;  3WE0 A;  1GES A;  5C2T A;  1VRQ B;  1XAN A;  3COX A;  3PS9 A;  4OPL A;  3AEG A;  5CQF A;  1H84 A;  3BI5 A;  5C3J A;  2ZZC A;  3C96 A;  1FEC A;  4KX6 A;  1EL5 A;  3RNM A;  1ZMD A;  4G74 A;  2B7S A;  1B5Q A;  2XVI A;  2BS4 A;  3DK8 A;  2BC0 A;  3M12 A;  2ZZB A;  2WOV A;  2BAC A;  3GSI A;  1K0J A;  2QCU A;  3K7Q X;  4NTE A;  1KFY A;  1GAL A;  3AE9 A;  1QLB A;  2WS3 A;  4H4R A;  4FK1 A;  4J33 A;  1FOH A;  1PBE A;  3IHG A;  3RED A;  4H2Q A;  4CRT A;  2B7R A;  1Q1R A;  1TDN A;  2H89 A;  2TPR A;  4O5Q A;  3CMM A;  4E0V A;  3VRB A;  3ATQ A;  2V3B A;  2VOU A;  2XVH A;  4Y4L A;  4BJZ A;  3K30 A;  3JSK A;  1KNP A;  3DGH A;  4YTM A;  4XWZ A;  1PJ5 A;  5J60 A;  1H83 A;  2UZZ A;  1PJ7 A;  3AEE A;  3DGZ A;  2C66 A;  3GRS A;  4H4Q A;  4Z43 A;  2C75 A;  2HQM A;  3T14 A;  3T37 A;  2Q0K A;  4FK1 C;  4G6H A;  4C5O A;  5JCK A;  1GPE A;  4Z24 A;  4IA5 A;  2ZZ0 A;  2JK6 A;  4B67 A;  1RP0 A;  2WU2 A;  1FCD A;  3M13 A;  2GR3 A;  5FS9 A;  4EQS A;  4GDE A;  3UP5 A;  3UTG A;  3KD9 A;  4Z44 A;  3SZF A;  3PO7 A;  4I58 A;  2AQJ A;  4G6G A;  1DJQ A;  4JY2 A;  4OPU A;  2BK3 A;  3LZW A;  5M10 A;  1DOB A;  2Z5X A;  1MXT A;  2CDU A;  3SZC A;  4O5U A;  4ZCD A;  1GRB A;  3KPF A;  5GSN A;  3HYV A;  3I6D A;  3DK9 A;  4GUV A;  1ZKQ A;  1LPF A;  2BYB A;  3AB1 A;  3UKF A;  1CBO A;  3QFB A;  2R4E A;  4H7U A;  4B64 A;  1H6V A;  1NHQ A;  2GR2 A;  5IPY A;  4EIP A;  5KOX A;  4GDP A;  3DK4 A;  5JCI A;  5EOW A;  3C4N A;  2X8C A;  1LV0 A;  3E1T A;  1F8R A;  4USR A;  2E1M A;  2VQ7 A;  4DSG A;  2GR0 A;  4APN A;  4HA6 A;  2YVF A;  1PBD A;  3AED A;  1TDO A;  2GV8 A;  3GD3 A;  5EBK A;  4EQR A;  1B4V A;  4K8D A;  1V59 A;  1F8W A;  1DXL A;  4RG3 A;  3UKL A;  2QA1 A;  1CL0 A;  1YQ4 A;  4OVI A;  1ZX9 A;  2I0Z A;  4Z25 A;  1Q9I A;  3CND A;  3AE5 A;  3GRT A;  3RHA A;  2C3D A;  4DNA A;  5BRT A;  1COY A;  4AT0 A;  2F5Z A;  4U8I A;  2R0P A;  4Y4N A;  1B37 A;  3SY4 A;  3D1C A;  2WET A;  3IWA A;  4GAV A;  4XXG A;  4AP3 A;  2YM1 A;  3RP6 A;  3GYJ A;  1NEK A;  4U8O A;  4JQ9 A;  2WQY A;  4J57 A;  3NHO X;  3SYI A;  4EMI A;  3AE7 A;  2C76 A;  2FBW A;  4GAP A;  4H4Y A;  4H50 A;  3T0K A;  1GRT A;  3LAD A;  2V5Z A; 
#chains in the Genus database with same CATH homology
 3V76 A;  3ITJ A;  3UKA A;  4EQX A;  3LB8 A;  1JNR A;  1PS9 A;  1ZOY A;  1S2Y A;  4K5S A;  4TM1 A;  4EIQ A;  3QFA A;  4I59 A;  2WBA A;  3AEC A;  3NGC X;  2A89 A;  3RP7 A;  1KDG A;  1KSS A;  5HHF A;  4OPT A;  2WPE A;  1EL9 A;  1REO A;  2J3N A;  3GWF A;  3SXI A;  4B69 A;  2XYO A;  3CGB A;  5KNL A;  1B8S A;  1ONF A;  1E7P A;  2WU5 A;  3UTE A;  3ALJ A;  3AD9 B;  1TDF A;  3K7M X;  1E1L A;  4RG4 A;  4CY6 A;  2V6O A;  2X99 A;  4YKF A;  4ZN0 A;  3DH9 A;  3GMC A;  3CGE A;  4YTN A;  1W4X A;  2NPX A;  2X8H A;  1NG4 A;  2TMD A;  3H4K A;  4CCQ A;  2GR1 A;  1GRG A;  1ZY8 A;  1ZOV A;  2C65 A;  2NVK X;  2OLN A;  4H4P A;  3UCL A;  2YLZ A;  3GYX A;  1O94 A;  2OAM A;  4Z2T A;  3PVC A;  3FIM B;  4BV6 A;  3Q9T A;  3CNP A;  4X9N A;  1GET A;  1NHP A;  4B1B A;  4GF7 A;  3SM8 A;  1H7X A;  5KRQ A;  4UDP A;  1F8S A;  1UKV G;  4EM4 A;  1DOE A;  1Y56 A;  4Z2R A;  2Y6Q A;  4JDR A;  1M64 A;  2YG4 A;  4FX9 A;  3G5Q A;  3HYW A;  5JCL A;  1ZMC A;  4YSX A;  3GWD A;  3G5S A;  5KMS A;  1L9D A;  3O0H A;  3UOX A;  1H86 A;  2YLT A;  5IQ4 A;  3NYF A;  2YG5 A;  3L1R A;  3ATR A;  2VVM A;  4U2S A;  3CTY A;  5JCM A;  4CCR A;  4NEW A;  3QSS A;  2PYX A;  2QAE A;  3NIX A;  3GMB A;  4JN9 A;  2X3N A;  3EAO A;  3FBS A;  3M0O A;  1PBC A;  2X8G A;  2YG6 A;  1GT8 A;  4LA1 A;  2YLS A;  3KA7 A;  2JB3 A;  3AE3 A;  1VG9 A;  1ELI A;  2FJE A;  3NK0 X;  2R0C A;  2XVE A;  5JCN A;  2EQ7 A;  1H7W A;  2OAL A;  2XDO A;  3H8L A;  3NN0 X;  3RP8 A;  2VRM A;  4WX1 A;  2BA9 A;  3DJE A;  2CFY A;  4UDQ A;  2JB2 A;  2H88 A;  2RAB A;  1IUS A;  3NNE A;  4J31 A;  1GRH A;  2GF3 A;  4BUR A;  4YSH A;  4BK3 A;  3LXD A;  1IJH A;  3ICR A;  1VQW A;  1S3E A;  1TRB A;  3AE2 A;  3GYI A;  4RSL A;  1GND A;  3V3O A;  1K0I A;  4G73 A;  3ADA B;  3K7T A;  5KXJ A;  2XVF A;  3NT6 A;  1RSG A;  3LOV A;  4TLZ A;  4II3 A;  2EQ6 A;  3NN6 X;  5DBJ A;  3UKQ A;  4EQW A;  3EPT A;  1DNC A;  3UOY A;  4H4X A;  4JNA A;  3P4S A;  2C64 A;  1KF6 A;  4DGK A;  1PJ6 A;  2W0H A;  3KKJ A;  4J36 A;  3AE4 A;  4YKG A;  3F8R A;  4AT2 A;  4BK1 A;  3AD8 B;  1GTE A;  5LV9 A;  2EQ8 A;  1CC2 A;  3SFD A;  1PBB A;  1NPX A;  5BUL A;  3CPI G;  1KNR A;  2O9Z A;  1CHU A;  4LII A;  1D4E A;  1OJD A;  4H4T A;  1PXB A;  3NLC A;  2YLR A;  2OLO A;  4YSY A;  1Z6L A;  1RYI A;  3ALM A;  3SGL A;  3NK2 X;  3NRN A;  4JNQ A;  1E1M A;  4K22 A;  4TM0 A;  2YAU A;  1CJC A;  2XFO A;  2CVJ A;  1P2E A;  2JKC A;  1EBD A;  4CNK A;  3BNM A;  1N4W A;  1JNZ A;  4EMJ A;  2VVL G;  4PAB A;  2YG7 A;  4K2X A;  1PXA A;  3DJD A;  3ICS A;  1D5T A;  1IUW A;  2RGO A;  3BNU A;  4Y4M A;  4A99 A;  3ICT A;  1IUV A;  3KVE A;  5KMP A;  2DKH A;  3FPZ A;  4GR1 A;  4TLX A;  4B65 A;  5EB5 A;  3CGC A;  4U8J A;  3AEF A;  3CGD A;  3SFE A;  2BXR A;  1HYU A;  1NHS A;  1GOS A;  2VZ2 A;  1GRF A;  3LJP A;  1PDH A;  5FS8 A;  3NH3 X;  3S5W A;  1ZK7 A;  4YSZ A;  3VR8 A;  1CJ2 A;  2B9X A;  3KPK A;  4OPC A;  2GB0 A;  4A79 A;  1DJN A;  1GSN A;  5HY5 A;  2AR8 A;  2QA2 A;  3SZW A;  1BF3 A;  2C73 A;  1JEH A;  4OPI A;  1MO9 A;  2YR6 A;  3T2Y A;  2WDQ A;  3C4A A;  5U25 A;  2JBV A;  3UKP A;  2Q6U A;  2WEU A;  4U2T A;  1H82 A;  2V3A A;  1EL8 A;  2RGH A;  1L9E A;  2GMH A;  2YR4 A;  4A65 A;  4CBQ A;  4A6N B;  5IQ1 A;  1ZP0 A;  2IID A;  5KMR A;  1TYT A;  2C67 A;  2XLP A;  3FG2 P;  4A5L A;  1FL2 A;  4BK2 A;  3UOV A;  2OA1 A;  1YQ3 A;  2WOI A;  3AYI A;  3ISH A;  3AE1 A;  4MJW A;  4NTC A;  5HYM A;  2GAG B;  1PN0 A;  3AD7 B;  4NTD A;  1CC6 A;  3AXB A;  4C74 A;  1BZL A;  2WPC A;  3ABV A;  1BWC A;  4X4J A;  3BHK A;  2IVD A;  1CJ4 A;  3OZ2 A;  3ALL A;  4LU6 A;  4U8K A;  5EB4 A;  4J56 A;  4TM3 A;  4XWR A;  2FJB A;  5KVI A;  2APG A;  1BGJ A;  2BAB A;  4AOX A;  4CNJ A;  2B9W A;  5KMQ A;  3F8P A;  3AE6 A;  4H2N A;  1NHR A;  2GAH B;  3UKK A;  2ZBW A;  3URH A;  4EMW A;  1QJD A;  2B9Y A;  2PHH A;  5U1O A;  2WP6 A;  2GQF A;  2A8X A;  1D4D A;  2BCG G;  3P4R A;  2Z5Y A;  1PHH A;  2R46 A;  3IC9 A;  1JOA A;  1LQT A;  3QSE A;  4YWO A;  3GDP A;  4C3X A;  2Q0L A;  3AEB A;  1JU2 A;  1AOG A;  2WHD A;  3BI4 A;  2YM2 A;  4U8L A;  4BJY A;  3NKS A;  2YVJ A;  3AYJ A;  4G9K A;  2XLS A;  3UOZ A;  2XFN A;  1ZDL A;  1H81 A;  4H4U A;  1TDE A;  4K5R A;  4NNJ A;  1S3B A;  1Q1W A;  1QO8 A;  3VR9 A;  2GRT A;  4J34 A;  2EQ9 A;  3CNS A;  2XLR A;  2YG3 A;  3CPJ G;  2E4G A;  2BRA A;  4ECH A;  2WES A;  3II4 A;  5FS7 A;  3NTD A;  2E5V A;  4AP1 A;  1LJ1 A;  3CNJ A;  1VDC A;  1LQU A;  1L9C A;  3B3R A;  1EL7 A;  3KLJ A;  1Y0P A;  4Z26 A;  4A6N A;  3CN8 A;  4IVM B;  3G5R A;  2BCP A;  4B68 A;  4FDC B;  1F3P A;  1CF3 A;  2XFQ A;  3VRD B;  1GER A;  2BXS A;  3B6D A;  3H8I A;  3OC4 A;  4AOS A;  5KVH A;  1O5W A;  4OPG A;  4U8P A;  1P2H A;  1D4C A;  2BS2 A;  4M52 A;  2GH5 A;  4A9W A;  2R45 A;  4JY3 A;  4OPD A;  3Q6J A;  4U8N A;  4PAA A;  1K0L A;  4H2R A;  4YTP A;  2VQB A;  3EAN A;  4H4Z A;  1NDA A;  1LTX R;  4NEV A;  3DJG X;  3ZYX A;  3GD4 A;  4REK A;  5GRT A;  4ADW A;  3AYL A;  4N9X A;  3P1W A;  1SEZ A;  3R9U A;  1GRE A;  3V3N A;  3P9U A;  4HB9 A;  1FEA A;  1IUX A;  3QJ4 A;  5KWF A;  3DME A;  4KPR A;  3UKH A;  3AEA A;  3SX6 A;  3T31 A;  2IVE A;  2YWL A;  1DOD A;  2WPF A;  2ARD A;  2WP5 A;  4TM4 A;  3P4Q A;  3QSM A;  1PBF A;  1X31 B;  5KOW A;  1JRX A;  1CJ3 A;  4YT0 A;  1GV4 A;  4ZCC A;  4H2P A;  5TR3 A;  4CY8 A;  1E1K A;  1TYP A;  1XDI A;  2CUL A;  2XVJ A;  3AE8 A;  1YQZ A;  2YR5 A;  3DJJ A;  2B76 A;  2C7G A;  1MOK A;  1E39 A;  1BKW A;  3CNT A;  1OJT A;  3FMW A;  1JRY A;  2WOW A;  3KU9 A;  2RGJ A;  2FJA A;  4H4V A;  2X50 A;  1BGN A;  4YXD A;  2GEW A;  2Y6R A;  3UP4 A;  2R9Z A;  4D03 A;  4K7Z A;  1IUU A;  4GCM A;  2XFU A;  3SZ0 A;  2YLX A;  1KSU A;  2XLT A;  2WDV A;  3IF9 A;  4DSH A;  1Y56 B;  3CIR A;  3LZX A;  1O95 A;  4J2W A;  4U2L A;  1NAA A;  2DKI A;  5FMH A;  4H4S A;  1PXC A;  1YY5 A;  4NZH A;  3VQR A;  4OCG A;  1FEB A;  1N1P A;  4ICY A;  1L0V A;  1GRA A;  4H4W A;  2R0G A;  1TDK A;  4B66 A;  2BS3 A;  2YQU A;  5L46 A;  3DA1 A;  1OJA A;  5FS6 A;  1D7L A;  3NK1 X;  2C3C A;  3UTH A;  2C4C A;  4GRT A;  1IUT A;  2A87 A;  4UP3 A;  4USQ A;  3VRA A;  2YLW A;  2V60 A;  4IA6 A;  4Z2U A;  3QVR A;  5BUK A;  4P9S A;  3F8D A;  3SQP A;  1VG0 A;  1XHC A;  3IHM A;  2BRY A;  1DOC A;  3NYE A;  4X9M A;  1N4V A;  1S2Q A;  3T2Z A;  4B63 A;  3L8K A;  1OJ9 A;  2BK4 A;  2C70 A;  2FJD A;  1GXF A;  5HXI A;  2VVL A;  2JAE A;  2WDR A;  3P4P A;  4C3Y A;  3T2K A;  2C72 A;  1CC4 A;  2Q7V A;  3BHF A;  1M6I A;  5BVA A;  2GVC A;  1E1N A;  1N4U A;  1LVL A;  2ACZ A;  1K4Q A;  2V61 A;  3BI2 A;  1NEN A;  3NG7 X;  3CPH G;  4II2 A;  3HZL A;  3EF6 A;  5M0Z A;  1F6M A;  3S61 A;  2AAQ A;  3GDN A;  4WCT A;  4EM3 A;  2XCG A;  5CKU A;  1JRZ A;  2VRL A;  2JB1 A;  2GQW A;  3AWI A;  3NYC A;  4U8M A;  3ZDN A;  4C77 A;  1E6E A;  3HYX A;  4UDR A;  2XFP A;  2XLU A;  2GMJ A;  4NWZ A;  5U63 A;  3I3L A;  1GTH A;  4IV9 A;  4A7A A;  4IVO B;  1XPQ A;  1OJC A;  2R4J A;  1NG3 A;  1YKJ A;  2WP9 A;  5J7X A;  3D8X A;  1GEU A;  2BC1 A;  2BK5 A;  2YVG A;  3QVP A;  5ER0 A;  1D7Y A;  4D04 A;  3UTF A;  3NTA A;  3WE0 A;  1GES A;  5C2T A;  1VRQ B;  1XAN A;  3COX A;  3PS9 A;  4OPL A;  3AEG A;  5CQF A;  1H84 A;  3BI5 A;  5C3J A;  2ZZC A;  3C96 A;  1FEC A;  4KX6 A;  1EL5 A;  3RNM A;  1ZMD A;  4G74 A;  2B7S A;  1B5Q A;  2XVI A;  2BS4 A;  3DK8 A;  2BC0 A;  3M12 A;  2ZZB A;  2WOV A;  2BAC A;  3GSI A;  1K0J A;  2QCU A;  3K7Q X;  4NTE A;  1KFY A;  1GAL A;  3AE9 A;  1QLB A;  2WS3 A;  4H4R A;  4FK1 A;  4J33 A;  1FOH A;  1PBE A;  3IHG A;  3RED A;  4H2Q A;  4CRT A;  2B7R A;  1Q1R A;  1TDN A;  2H89 A;  2TPR A;  4O5Q A;  3CMM A;  4E0V A;  3VRB A;  3ATQ A;  2V3B A;  2VOU A;  2XVH A;  4Y4L A;  4BJZ A;  3K30 A;  3JSK A;  1KNP A;  3DGH A;  4YTM A;  4XWZ A;  1PJ5 A;  5J60 A;  1H83 A;  2UZZ A;  1PJ7 A;  3AEE A;  3DGZ A;  2C66 A;  3GRS A;  4H4Q A;  4Z43 A;  2C75 A;  2HQM A;  3T14 A;  3T37 A;  2Q0K A;  4FK1 C;  4G6H A;  4C5O A;  5JCK A;  1GPE A;  4Z24 A;  4IA5 A;  2ZZ0 A;  2JK6 A;  4B67 A;  1RP0 A;  2WU2 A;  1FCD A;  3M13 A;  2GR3 A;  5FS9 A;  4EQS A;  4GDE A;  3UP5 A;  3UTG A;  3KD9 A;  4Z44 A;  3SZF A;  3PO7 A;  4I58 A;  2AQJ A;  4G6G A;  1DJQ A;  4JY2 A;  4OPU A;  2BK3 A;  3LZW A;  5M10 A;  1DOB A;  2Z5X A;  1MXT A;  2CDU A;  3SZC A;  4O5U A;  4ZCD A;  1GRB A;  3KPF A;  5GSN A;  3HYV A;  3I6D A;  3DK9 A;  4GUV A;  1ZKQ A;  1LPF A;  2BYB A;  3AB1 A;  3UKF A;  1CBO A;  3QFB A;  2R4E A;  4H7U A;  4B64 A;  1H6V A;  1NHQ A;  2GR2 A;  5IPY A;  4EIP A;  5KOX A;  4GDP A;  3DK4 A;  5JCI A;  5EOW A;  3C4N A;  2X8C A;  1LV0 A;  3E1T A;  1F8R A;  4USR A;  2E1M A;  2VQ7 A;  4DSG A;  2GR0 A;  4APN A;  4HA6 A;  2YVF A;  1PBD A;  3AED A;  1TDO A;  2GV8 A;  3GD3 A;  5EBK A;  4EQR A;  1B4V A;  4K8D A;  1V59 A;  1F8W A;  1DXL A;  4RG3 A;  3UKL A;  2QA1 A;  1CL0 A;  1YQ4 A;  4OVI A;  1ZX9 A;  2I0Z A;  4Z25 A;  1Q9I A;  3CND A;  3AE5 A;  3GRT A;  3RHA A;  2C3D A;  4DNA A;  5BRT A;  1COY A;  4AT0 A;  2F5Z A;  4U8I A;  2R0P A;  4Y4N A;  1B37 A;  3SY4 A;  3D1C A;  2WET A;  3IWA A;  4GAV A;  4XXG A;  4AP3 A;  2YM1 A;  3RP6 A;  3GYJ A;  1NEK A;  4U8O A;  4JQ9 A;  2WQY A;  4J57 A;  3NHO X;  3SYI A;  4EMI A;  3AE7 A;  2C76 A;  2FBW A;  4GAP A;  4H4Y A;  4H50 A;  3T0K A;  1GRT A;  3LAD A;  2V5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...