5BULA

Structure of flavin-dependent brominase bmp2 triple mutant y302s f306v a345w
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
397
structure length
392
Chain Sequence
b'HYDVVIIGSGPAGSLCGIECRKKGLSVLCIEKEQFPRFHIGESLTGNAGQIIRDLGLAEDMDAAGFPDKPGVNVIGSLSKNEFFIPILAPTWQVRRSDFDDMIKRKAVEHGVEYKLGMVTDVIKDGEKVVGALYKADGVEHQVRSKVLVDASGQNTFLSRKGVAGKRQIEFFSQQIASFAHYKGVERDLPPFSTNTTILYSKQYHWSWIIPISPDTDSLGVVIPKDLYYKECNPDDAIAWGMDHISPELKRRFKNAERQGDSQSMADFSYRIEPFVGDGWMCIGDAHRFLDPIFSSGVSVAMKEGIRAAEAIAQVVAGQDWKAPFYAYRDWSNGGQQIWADLIRYFWIYPIFFGYQMQNPRDEVIRLLGGCCFDGWKAPAIFRNAIEEYDRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords flavin-dependent halogenase triple mutant
molecule tags Hydrolase
source organism Streptomyces
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
total genus 140
structure length 392
sequence length 397
ec nomenclature
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bulA00
1D7LA 2WPFA 2ZZ0A 3AD8B 3URHA 4OPUA 4LA1A 1ZK7A 3P4SA 3KD9A 2BS4A 1IUSA 1ZOYA 3VR9A 3QSEA 1NAAA 3AWIA 1PXBA 1JOAA 1ZDLA 4YKGA 3FIMB 4J31A 4Y4MA 4J57A 3UP4A 1F6MA 1CJCA 1S3BA 2YVJA 4N9XA 3NK2X 1XHCA 2V61A 4DGKA 4A6NA 3CPIG 2XVFA 4OVIA 4A9WA 3BI4A 1PBEA 1B5QA 4H4SA 2XLSA 3DGHA 4Z2TA 2R0CA 3T37A 2FBWA 2J3NA 2WP6A 4B68A 4Z26A 2RGJA 3AECA 3BNMA 1L9CA 1GXFA 4AOSA 3LZXA 1LTXR 3M13A 2VVLG 1H6VA 3DMEA 1K0LA 5IPYA 1FCDA 2C73A 4A5LA 2YG5A 2WDQA 3GDPA 3M0OA 1NDAA 4AT2A 4YSHA 4H4VA 2WOWA 5EBKA 3UKQA 4HB9A 1CC6A 1EL7A 1PJ6A 1RP0A 1FEBA 2R0PA 2VQ7A 3AE7A 1PBCA 2BK5A 4LIIA 1NG3A 3QVRA 3ADAB 1KDGA 4XXGA 2BS2A 3C96A 3OC4A 4O5QA 4H4QA 3UKKA 2YM1A 4NEVA 1ZX9A 4JNQA 3I6DA 3ITJA 1PJ5A 2R4EA 4TM3A 4CY6A 1FL2A 2QA2A 1KFYA 2XLTA 3BI5A 3GD4A 3LADA 2A87A 4J33A 2ZZBA 5C2TA 2OALA 2XLUA 5U63A 1GT8A 3DJGX 4J36A 2C70A 2IIDA 4YSYA 1GETA 3COXA 3CNTA 4YTNA 3NYCA 2GRTA 2B7SA 3PS9A 1BKWA 2NVKX 3SFEA 2BXRA 4IVOB 3ATRA 3F8PA 4U8PA 4ZCDA 3REDA 1H7XA 3M12A 3NKSA 1QLBA 1ZMDA 2TMDA 1JNZA 3LZWA 1PHHA 1VG9A 2OLNA 3LB8A 1YQ3A 4CNJA 3B6DA 4FK1A 2HQMA 3UKAA 1D7YA 2C3CA 4ZCCA 1LVLA 1E1KA 2V3AA 3CNJA 3GWFA 3ZDNA 2GVCA 3NTDA 1H81A 4GR1A 4REKA 5HYMA 2YLXA 2Q0KA 3NGCX 1E6EA 1IUUA 4FDCB 3K7QX 1FOHA 2XFUA 3PVCA 5LV9A 4OPLA 2C65A 1XPQA 5CKUA 5FS8A 1L9DA 5FS6A 4X9NA 4EQXA 2Z5XA 3IF9A 5JCNA 2GAGB 2R4JA 2WOIA 4NEWA 2R45A 1GSNA 1COYA 5CQFA 4U8NA 4OPCA 1OJDA 2BC1A 4KPRA 2EQ7A 3HZLA 4Z25A 4TM4A 4U8KA 5J7XA 2CFYA 5JCLA 5JCKA 4EIPA 1PBDA 4AP1A 4BV6A 3VR8A 3AD7B 1GREA 3FG2P 1EL8A 2FJBA 4NTCA 1L0VA 5KOXA 1DOEA 3ABVA 1CBOA 4U8MA 3UOZA 2JB1A 5ER0A 3R9UA 3UOVA 3QVPA 3GMCA 4EMWA 3UCLA 1LPFA 1NG4A 2B76A 3L8KA 4EQWA 1W4XA 1H82A 1D4DA 1XDIA 2WS3A 4H4PA 1YKJA 4I58A 4UDRA 5KWFA 1GRTA 3BI2A 1GPEA 2XVIA 2V3BA 1KNPA 1JRXA 2IVEA 3DK9A 4A79A 1BF3A 3CIRA 3ISHA 1VQWA 5KOWA 2JB2A 3LJPA 2C72A 2GR0A 3BHKA 2DKIA 2WP5A 1LQUA 2WU5A 2YWLA 2C75A 2RABA 4JN9A 3CGCA 4Z44A 1NHSA 3UP5A 3AEBA 1JNRA 1L9EA 3CPHG 2A8XA 3NNEA 4H50A 1NHPA 3UKPA 3DK8A 1OJTA 3NTAA 1DXLA 1B4VA 1HYUA 2Y6QA 3LOVA 1GOSA 3GRTA 1Y56A 4YKFA 3P9UA 1TDEA 3EF6A 5J60A 3NK0X 4USQA 3V76A 4EIQA 4ECHA 2BACA 1KSSA 4U8IA 4Z2RA 3NG7X 4AP3A 2Z5YA 4U2TA 2E5VA 1FEAA 2YR6A 3AYIA 3IC9A 4CY8A 3K30A 4B67A 3F8RA 4USRA 4B64A 2GH5A 4C5OA 1M64A 2JAEA 4DSHA 5EB5A 4IVMB 4JQ9A 1PBFA 2H89A 1ZKQA 3DA1A 2OA1A 3O0HA 4AT0A 4ZN0A 5HXIA 4A99A 4DSGA 3FMWA 1TDKA 1KSUA 3UOXA 1Q9IA 4I59A 2YG3A 3CNPA 3IWAA 4GDPA 1VRQB 3G5SA 1FECA 4EM3A 5FMHA 3AYJA 1CC2A 4CNKA 5IQ4A 1GERA 1IUVA 2AAQA 2ZBWA 1OJCA 4WCTA 2GQWA 2EQ9A 1KNRA 3GSIA 3K7MX 1F8WA 4M52A 3EPTA 2QA1A 1BGNA 5KVIA 1YY5A 2C3DA 1GESA 5M0ZA 5KVHA 1O95A 2X8HA 1M6IA 5KXJA 4Z24A 2F5ZA 1EL9A 1BZLA 3FBSA 2GR1A 4TLXA 1TYTA 5GSNA 3AE3A 1Y0PA 3CGBA 3UTFA 5IQ1A 4NTDA 1BGJA 4EQSA 2CDUA 4Y4NA 1XANA 4H2RA 3V3NA 3RHAA 1ZP0A 3UKLA 3DJJA 1DODA 1IJHA 1E7PA 3UKFA 5BRTA 3QSMA 1Q1WA 2GR2A 3NH3X 4K2XA 3UTGA 1D5TA 4H4YA 4ICYA 4LU6A 3AE1A 1IUTA 1N4UA 2RGHA 4U8OA 1GRGA 1N1PA 3KVEA 3QFBA 3EANA 4BK3A 1CJ4A 3DK4A 4OPTA 1CC4A 2GQFA 4K22A 3IHGA 1TRBA 2XDOA 1GEUA 2XVEA 3VQRA 3NRNA 2QAEA 3JSKA 4H4TA 2WOVA 5L46A 3FPZA 4Z43A 2WPEA 3UOYA 3RP7A 1TDFA 3H8LA 2B9WA 3DJDA 4O5UA 1MXTA 1PJ7A 4BK1A 4K8DA 1REOA 3VRDB 4OPDA 4APNA 2OAMA 1NHRA 1RYIA 3RNMA 2VRMA 1JRYA 3ALJA 2NPXA 2YLTA 2V5ZA 2ACZA 2JK6A 2Q7VA 3P4PA 4X9MA 5DBJA 2A89A 4CCQA 3NYEA 1MO9A 1H84A 4BK2A 1B37A 3ICTA 2E1MA 3CN8A 4GUVA 1PXCA 2UZZA 4IA5A 1AOGA 3E1TA 2FJEA 2YLWA 3GRSA 4K5SA 5TR3A 3QSSA 3D8XA 4B1BA 3F8DA 3ZYXA 1GRBA 1ZOVA 2GR3A 5U25A 4H2NA 3C4NA 1OJAA 1H83A 3SFDA 2YM2A 1GV4A 4GRTA 2PHHA 2AR8A 1E1MA 4BJYA 4CRTA 3P1WA 1CF3A 3ATQA 2WEUA 3QFAA 3ICRA 4JNAA 2XLPA 3KA7A 1PDHA 5HHFA 3AXBA 1PS9A 2O9ZA 3NT6A 2ZZCA 3CTYA 1JEHA 3NHOX 1MOKA 2RGOA 2VVLA 3SGLA 2GEWA 4D03A 2XVJA 5EOWA 4NTEA 4B69A 1LV0A 2YAUA 1DJNA 4IA6A 4JY2A 1ZMCA 2VRLA 3UTEA 4UP3A 4GF7A 4PABA 5JCMA 1O5WA 4C3YA 4PAAA 2Q6UA 3B3RA 4XWRA 1RSGA 4U8LA 4OPGA 2H88A 1TYPA 2X50A 2WDVA 5KRQA 2C67A 1EL5A 4RG4A 2FJDA 2YG6A 4B66A 1TDOA 2VVMA 3AEGA 4U2LA 5BUKA 3Q6JA 3RP6A 2YVGA 2YQUA 2AQJA 2EQ6A 1D4CA 1GRHA 2GMJA 4RG3A 1DOBA 4YSZA 3AEDA 2GV8A 4EMJA 2XVHA 2XFPA 1YQ4A 2GMHA 3VRBA 1DNCA 3ALMA 1DJQA 5BVAA 3CNDA 4GDEA 3AE8A 4H2PA 4H4WA 3I3LA 3AEAA 4AOXA 2WETA 3ALLA 2YR4A 4OCGA 4TM0A 1EBDA 2DKHA 1QO8A 3PO7A 3NK1X 1IUXA 3KPFA 2R9ZA 2BK4A 3AE6A 1Y56B 4J56A 3BHFA 4RSLA 2XYOA 1NHQA 3Q9TA 4H4RA 3P4QA 3CNSA 1NENA 1BWCA 2WBAA 2WESA 3II4A 1K4QA 2Q0LA 4J34A 2YG4A 4JY3A 4OPIA 3SM8A 4E0VA 2XFNA 1V59A 4H4UA 3GDNA 3AB1A 1GRFA 3LXDA 1F8RA 1LJ1A 2YLSA 2YG7A 1P2EA 2BYBA 2XFQA 2YVFA 5JCIA 1JU2A 5M10A 2C64A 3ICSA 1GALA 3DJEA 1CL0A 1X31B 2E4GA 2BC0A 2X3NA 3GYJA 5C3JA 4X4JA 4YXDA 1DOCA 4CBQA 2WQYA 1P2HA 2CULA 5EB4A 3UTHA 4H7UA 3AE4A 3KKJA 3GMBA 3KU9A 1NEKA 4YWOA 2X8CA 4HA6A 2JB3A 2GB0A 1PN0A 2VQBA 3AEEA 5FS9A 2OLOA 2V6OA 2X99A 1K0IA 3CPJG 4U2SA 4C77A 2C66A 1JRZA 1ELIA 2WPCA 3AE2A 3GYIA 3IHMA 2VOUA 4EMIA 2ARDA 2WU2A 3NN0X 2R0GA 2WHDA 2CVJA 3CGDA 3D1CA 2JKCA 1N4WA 1K0JA 1SEZA 3AD9B 1TDNA 2B9YA 2I0ZA 3G5QA 2BXSA 4P9SA 2XFOA 2X8GA 1S3EA 3AEFA 1ONFA 1OJ9A 3RP8A 3EAOA 4K7ZA 1VG0A 3NYFA 2TPRA 4U8JA 5U1OA 2YR5A 1Z6LA 3DGZA 3NLCA 4ADWA 2IVDA 1QJDA 1GTHA 2V60A 2FJAA 4B63A 3SQPA 2VZ2A 2YLRA 4YSXA 4GCMA 1IUWA 2C7GA 4TLZA 4UDPA 4YT0A 3AYLA 2APGA 4FK1C 1CJ2A 1CHUA 1VDCA 3H4KA 4H4XA 1GTEA 4XWZA 2BS3A 3AE9A 3VRAA 3GWDA 1D4EA 3L1RA 1O94A 3KLJA 4EQRA 3V3OA 2GF3A 4FX9A 1Q1RA 3GD3A 4A65A 2QCUA 3QJ4A 4KX6A 2GAHB 4A6NB 4H4ZA 1YQZA 4D04A 1F3PA 1E39A 3DH9A 3S61A 4J2WA 1NPXA 4YTPA 5GRTA 3C4AA 1B8SA 3AE5A 2B9XA 4Z2UA 2WP9A 3OZ2A 5FS7A 3K7TA 4NZHA 3UKHA 1H86A 1E1NA 1UKVG 1KF6A 1LQTA 4IV9A 1E1LA 3CGEA 4C74A 2C76A 1S2QA 4Y4LA 4YTMA 3S5WA 4B65A 3H8IA 4WX1A 2YLZA 4BURA 4H2QA 1ZY8A 2XLRA 4TM1A 1GRAA 1PBBA 3NIXA 1GNDA 4MJWA 2Y6RA 2BCPA 4K5RA 3G5RA 5BULA 2W0HA 2PYXA 2BA9A 2BCGG 2EQ8A 3P4RA 4CCRA 1PXAA 2BK3A 3WE0A 1CJ3A 4JDRA 4UDQA 4C3XA 4EM4A 1H7WA 2XCGA 1N4VA 3BNUA 2R46A 4DNAA 4A7AA 5HY5A 2B7RA 2JBVA 1F8SA 4BJZA 1S2YA 2WDRA 2BABA 3NN6X
chains in the Genus database with same CATH superfamily
1D7LA 2WPFA 2ZZ0A 3AD8B 3URHA 4OPUA 4LA1A 1ZK7A 3P4SA 3KD9A 2BS4A 1IUSA 1ZOYA 3VR9A 3QSEA 1NAAA 3AWIA 1PXBA 1JOAA 1ZDLA 4G9KA 3FIMB 4YKGA 4J31A 4Y4MA 5KMQA 4J57A 3UP4A 1F6MA 1CJCA 1S3BA 2YVJA 4N9XA 3NK2X 1XHCA 2V61A 4DGKA 4A6NA 3CPIG 2XVFA 4OVIA 4A9WA 3BI4A 1PBEA 1B5QA 4G6GA 2XLSA 3DGHA 4H4SA 4Z2TA 2R0CA 3T37A 2FBWA 2J3NA 2WP6A 4G6HA 4B68A 4Z26A 2RGJA 3AECA 3BNMA 1L9CA 1GXFA 3T2YA 3LZXA 1LTXR 3M13A 2VVLG 1H6VA 3DMEA 1K0LA 4AOSA 1FCDA 5IPYA 2C73A 4A5LA 2YG5A 2WDQA 3GDPA 3SY4A 3M0OA 1NDAA 4AT2A 4YSHA 4H4VA 2WOWA 5EBKA 3UKQA 4HB9A 1CC6A 1EL7A 1PJ6A 1RP0A 1FEBA 2R0PA 2VQ7A 3AE7A 1PBCA 2BK5A 4LIIA 1NG3A 3QVRA 3ADAB 1KDGA 4XXGA 2BS2A 3C96A 3OC4A 4O5QA 4H4QA 3UKKA 2YM1A 4NEVA 1ZX9A 4JNQA 3I6DA 3ITJA 1PJ5A 2R4EA 4TM3A 4CY6A 1FL2A 2QA2A 1KFYA 2XLTA 3BI5A 3GD4A 3LADA 2A87A 4J33A 2ZZBA 5C2TA 2OALA 2XLUA 5U63A 1GT8A 3DJGX 4J36A 2C70A 2IIDA 4YSYA 1GETA 3COXA 3CNTA 4YTNA 3NYCA 2GRTA 2B7SA 3PS9A 1BKWA 2NVKX 3SFEA 2BXRA 4IVOB 3ATRA 3F8PA 4U8PA 4ZCDA 3REDA 1H7XA 3M12A 3NKSA 1QLBA 1ZMDA 2TMDA 1JNZA 3LZWA 1PHHA 1VG9A 2OLNA 3LB8A 1YQ3A 4CNJA 3B6DA 4FK1A 2HQMA 3UKAA 1D7YA 2C3CA 4ZCCA 1LVLA 1E1KA 2V3AA 3CNJA 3GWFA 3ZDNA 2GVCA 3NTDA 1H81A 4GR1A 4REKA 5HYMA 2YLXA 2Q0KA 3NGCX 1E6EA 1IUUA 4FDCB 3K7QX 1FOHA 2XFUA 3PVCA 5LV9A 4OPLA 2C65A 1XPQA 5CKUA 5FS8A 1L9DA 5FS6A 4X9NA 4EQXA 2Z5XA 3IF9A 5JCNA 2GAGB 2R4JA 2WOIA 4NEWA 2R45A 3HYVA 1GSNA 1COYA 5CQFA 4U8NA 4OPCA 1OJDA 2BC1A 4KPRA 2EQ7A 3HZLA 4Z25A 4TM4A 4U8KA 5J7XA 2CFYA 5JCLA 5JCKA 3SYIA 4EIPA 1PBDA 4AP1A 4BV6A 3VR8A 3AD7B 1GREA 3FG2P 1EL8A 2FJBA 4NTCA 1L0VA 5KOXA 1DOEA 3ABVA 1CBOA 4U8MA 3UOZA 2JB1A 5ER0A 3R9UA 3UOVA 3QVPA 3GMCA 4EMWA 3UCLA 1LPFA 1NG4A 2B76A 3L8KA 4EQWA 1W4XA 1H82A 1D4DA 3T2ZA 1XDIA 2WS3A 4H4PA 1YKJA 4I58A 4UDRA 5KWFA 1GRTA 3BI2A 1GPEA 2XVIA 2V3BA 1KNPA 5KMPA 1JRXA 2IVEA 3DK9A 4A79A 1BF3A 3CIRA 3ISHA 1VQWA 5KOWA 2JB2A 3LJPA 2C72A 2GR0A 3BHKA 2DKIA 2WP5A 1LQUA 2WU5A 2YWLA 2C75A 2RABA 4JN9A 3CGCA 4Z44A 1NHSA 3UP5A 3AEBA 1JNRA 1L9EA 3CPHG 2A8XA 3NNEA 4H50A 1NHPA 3UKPA 3DK8A 1OJTA 3NTAA 1DXLA 1B4VA 1HYUA 2Y6QA 3LOVA 1GOSA 3GRTA 1Y56A 4YKFA 3P9UA 1TDEA 3EF6A 5J60A 3NK0X 4USQA 3V76A 4EIQA 4ECHA 2BACA 1KSSA 3KPKA 4U8IA 4Z2RA 3NG7X 4AP3A 2Z5YA 4U2TA 2E5VA 1FEAA 2YR6A 3AYIA 3IC9A 4CY8A 3K30A 4B67A 3T0KA 3F8RA 4USRA 4B64A 2GH5A 4C5OA 1M64A 2JAEA 4DSHA 5EB5A 4IVMB 4JQ9A 1PBFA 2H89A 1ZKQA 3DA1A 2OA1A 3O0HA 4AT0A 4ZN0A 5HXIA 4A99A 4DSGA 3FMWA 1TDKA 1KSUA 3UOXA 1Q9IA 4I59A 2YG3A 3CNPA 3IWAA 4GDPA 1VRQB 3G5SA 1FECA 4EM3A 5FMHA 3SZWA 3AYJA 1CC2A 4CNKA 5IQ4A 1GERA 1IUVA 2AAQA 2ZBWA 1OJCA 4WCTA 2GQWA 2EQ9A 1KNRA 3GSIA 3K7MX 1F8WA 4M52A 3EPTA 2QA1A 1BGNA 5KVIA 1YY5A 2C3DA 1GESA 5M0ZA 5KVHA 1O95A 2X8HA 1M6IA 5KXJA 4Z24A 2F5ZA 1EL9A 1BZLA 3FBSA 2GR1A 4TLXA 1TYTA 5GSNA 3AE3A 1Y0PA 3CGBA 3UTFA 3T31A 5IQ1A 4NTDA 1BGJA 4EQSA 2CDUA 4Y4NA 1XANA 4H2RA 3V3NA 3RHAA 1ZP0A 3UKLA 3DJJA 1DODA 1IJHA 1E7PA 3UKFA 5BRTA 3QSMA 1Q1WA 2GR2A 3NH3X 4K2XA 3UTGA 1D5TA 4H4YA 4ICYA 4LU6A 3AE1A 1IUTA 4NNJA 1N4UA 2RGHA 4U8OA 1GRGA 1N1PA 3HYWA 3KVEA 3QFBA 3EANA 4BK3A 1CJ4A 3DK4A 4OPTA 1CC4A 2GQFA 4K22A 3IHGA 1TRBA 2XDOA 1GEUA 2XVEA 3VQRA 3NRNA 2QAEA 3JSKA 4H4TA 2WOVA 5L46A 3FPZA 4Z43A 2WPEA 3UOYA 3RP7A 1TDFA 3H8LA 2B9WA 3DJDA 4O5UA 1MXTA 1PJ7A 4BK1A 4K8DA 1REOA 3VRDB 4OPDA 4APNA 2OAMA 1NHRA 1RYIA 3RNMA 2VRMA 1JRYA 3ALJA 2NPXA 2YLTA 2V5ZA 2ACZA 2JK6A 2Q7VA 3P4PA 4X9MA 5DBJA 2A89A 4CCQA 3NYEA 1MO9A 1H84A 4BK2A 1B37A 3ICTA 2E1MA 3CN8A 4GUVA 1PXCA 2UZZA 4IA5A 1AOGA 3E1TA 2FJEA 2YLWA 3GRSA 4K5SA 5TR3A 3QSSA 3D8XA 4B1BA 3F8DA 3SZCA 1GRBA 1ZOVA 2GR3A 3ZYXA 4NWZA 5U25A 4H2NA 3C4NA 1OJAA 1H83A 3SFDA 2YM2A 1GV4A 4GRTA 2PHHA 2AR8A 1E1MA 4BJYA 4CRTA 3P1WA 1CF3A 3ATQA 2WEUA 4G74A 3QFAA 3ICRA 4JNAA 2XLPA 3KA7A 1PDHA 5HHFA 3AXBA 1PS9A 2O9ZA 3NT6A 4G73A 2ZZCA 3CTYA 1JEHA 3NHOX 1MOKA 2RGOA 2VVLA 3SGLA 2GEWA 4D03A 5KMRA 2XVJA 5EOWA 4NTEA 4B69A 1LV0A 2YAUA 1DJNA 4IA6A 4JY2A 1ZMCA 2VRLA 3UTEA 4UP3A 4GF7A 4PABA 5JCMA 1O5WA 4C3YA 4PAAA 2Q6UA 3B3RA 4XWRA 1RSGA 4U8LA 3T14A 4OPGA 2H88A 1TYPA 2X50A 2WDVA 5KRQA 2C67A 1EL5A 4RG4A 2FJDA 2YG6A 4B66A 1TDOA 2VVMA 3AEGA 4II3A 4U2LA 5BUKA 3Q6JA 3RP6A 2YVGA 2YQUA 2AQJA 2EQ6A 1D4CA 1GRHA 2GMJA 4RG3A 1DOBA 4YSZA 3AEDA 2GV8A 4EMJA 2XVHA 2XFPA 1YQ4A 2GMHA 3VRBA 1DNCA 3ALMA 1DJQA 5BVAA 3CNDA 4GDEA 3AE8A 4H2PA 4H4WA 3I3LA 3AEAA 4AOXA 2WETA 3ALLA 2YR4A 4OCGA 4TM0A 1EBDA 2DKHA 1QO8A 3PO7A 3NK1X 1IUXA 3KPFA 2R9ZA 5KMSA 2BK4A 3AE6A 1Y56B 4J56A 3BHFA 4RSLA 2XYOA 1NHQA 2C4CA 3Q9TA 3P4QA 4H4RA 3CNSA 1NENA 1BWCA 2WBAA 2WESA 3II4A 1K4QA 2Q0LA 4J34A 2YG4A 4JY3A 4OPIA 3SM8A 4E0VA 2XFNA 1V59A 4H4UA 3GDNA 3AB1A 1GRFA 3LXDA 1F8RA 1LJ1A 2YLSA 2YG7A 1P2EA 2BYBA 2XFQA 2YVFA 5JCIA 1JU2A 5M10A 2C64A 3ICSA 1GALA 3DJEA 1CL0A 1X31B 2E4GA 2BC0A 2X3NA 3GYJA 5C3JA 4X4JA 4YXDA 1DOCA 4CBQA 2WQYA 1P2HA 2CULA 2BRAA 5EB4A 4H7UA 3GYXA 3UTHA 3AE4A 3KKJA 3GMBA 3KU9A 1NEKA 4YWOA 2X8CA 4HA6A 2JB3A 2GB0A 1PN0A 2VQBA 3AEEA 5FS9A 2OLOA 2V6OA 2X99A 1K0IA 3CPJG 4U2SA 4C77A 2C66A 1JRZA 1ELIA 2WPCA 3AE2A 3GYIA 3IHMA 2VOUA 4EMIA 2ARDA 3SX6A 2WU2A 3NN0X 2R0GA 2WHDA 2CVJA 3CGDA 3D1CA 3T2KA 2JKCA 1N4WA 1K0JA 1SEZA 3AD9B 1TDNA 2B9YA 2I0ZA 3G5QA 2BXSA 4P9SA 2XFOA 2X8GA 1S3EA 3AEFA 1ONFA 1OJ9A 3RP8A 3EAOA 4K7ZA 1VG0A 3NYFA 2TPRA 4U8JA 5U1OA 2YR5A 1Z6LA 3DGZA 3NLCA 4ADWA 2IVDA 1QJDA 1GTHA 2V60A 2FJAA 4GAVA 4B63A 3SQPA 2VZ2A 2YLRA 3SZ0A 4YSXA 4GCMA 1IUWA 2C7GA 4TLZA 4UDPA 4YT0A 3AYLA 2APGA 3CMMA 4FK1C 1CJ2A 1CHUA 1VDCA 3H4KA 4H4XA 1GTEA 4XWZA 2BS3A 3AE9A 3VRAA 3GWDA 1D4EA 3L1RA 1O94A 3KLJA 3HYXA 4EQRA 3V3OA 2GF3A 4II2A 4FX9A 1Q1RA 3GD3A 4A65A 2QCUA 3QJ4A 4KX6A 2GAHB 4A6NB 4H4ZA 1YQZA 4D04A 1F3PA 1E39A 3DH9A 3SZFA 3S61A 4J2WA 1NPXA 4YTPA 5GRTA 3C4AA 1B8SA 3AE5A 2B9XA 4Z2UA 2WP9A 3OZ2A 5FS7A 3K7TA 4NZHA 3UKHA 1H86A 1E1NA 1UKVG 1KF6A 1LQTA 2BRYA 1E1LA 3CGEA 4IV9A 4C74A 2C76A 1S2QA 4Y4LA 4YTMA 3S5WA 4B65A 3H8IA 4WX1A 2YLZA 4BURA 4H2QA 1ZY8A 2XLRA 4TM1A 1GRAA 1PBBA 3NIXA 1GNDA 4MJWA 3SXIA 2Y6RA 2BCPA 4K5RA 3G5RA 5BULA 2W0HA 2PYXA 2BA9A 2BCGG 2EQ8A 3P4RA 4CCRA 1PXAA 2BK3A 3WE0A 1CJ3A 4JDRA 4UDQA 4C3XA 4EM4A 1H7WA 2XCGA 1N4VA 3BNUA 2R46A 5KNLA 4DNAA 4A7AA 5HY5A 2B7RA 2JBVA 1F8SA 4BJZA 1S2YA 4GAPA 2WDRA 2BABA 3NN6X
chains in the Genus database with same CATH topology
1D7LA 2WPFA 2ZZ0A 3AD8B 3URHA 4OPUA 4LA1A 1ZK7A 3P4SA 3KD9A 2BS4A 1IUSA 1ZOYA 3VR9A 3QSEA 1NAAA 3AWIA 1PXBA 1JOAA 1ZDLA 4G9KA 3FIMB 4YKGA 4J31A 4Y4MA 5KMQA 4J57A 3UP4A 1F6MA 1CJCA 1S3BA 2YVJA 4N9XA 3NK2X 1XHCA 2V61A 4DGKA 4A6NA 3CPIG 2XVFA 4OVIA 4A9WA 3BI4A 1PBEA 1B5QA 4G6GA 2XLSA 3DGHA 4H4SA 4Z2TA 2R0CA 3T37A 2FBWA 2J3NA 2WP6A 4G6HA 4B68A 4Z26A 2RGJA 3AECA 3BNMA 1L9CA 1GXFA 3T2YA 3LZXA 1LTXR 3M13A 2VVLG 1H6VA 3DMEA 1K0LA 4AOSA 1FCDA 5IPYA 2C73A 4A5LA 2YG5A 2WDQA 3GDPA 3SY4A 3M0OA 1NDAA 4AT2A 4YSHA 4H4VA 2WOWA 5EBKA 3UKQA 4HB9A 1CC6A 1EL7A 1PJ6A 1RP0A 1FEBA 2R0PA 2VQ7A 3AE7A 1PBCA 2BK5A 4LIIA 1NG3A 3QVRA 3ADAB 1KDGA 4XXGA 2BS2A 3C96A 3OC4A 4O5QA 4H4QA 3UKKA 2YM1A 4NEVA 1ZX9A 4JNQA 3I6DA 3ITJA 1PJ5A 2R4EA 4TM3A 4CY6A 1FL2A 2QA2A 1KFYA 2XLTA 3BI5A 3GD4A 3LADA 2A87A 4J33A 2ZZBA 5C2TA 2OALA 2XLUA 5U63A 1GT8A 3DJGX 4J36A 2C70A 2IIDA 4YSYA 1GETA 3COXA 3CNTA 4YTNA 3NYCA 2GRTA 2B7SA 3PS9A 1BKWA 2NVKX 3SFEA 2BXRA 4IVOB 3ATRA 3F8PA 4U8PA 4ZCDA 3REDA 1H7XA 3M12A 3NKSA 1QLBA 1ZMDA 2TMDA 1JNZA 3LZWA 1PHHA 1VG9A 2OLNA 3LB8A 1YQ3A 4CNJA 3B6DA 4FK1A 2HQMA 3UKAA 1D7YA 2C3CA 4ZCCA 1LVLA 1E1KA 2V3AA 3CNJA 3GWFA 3ZDNA 2GVCA 3NTDA 1H81A 4GR1A 4REKA 5HYMA 2YLXA 2Q0KA 3NGCX 1E6EA 1IUUA 4FDCB 3K7QX 1FOHA 2XFUA 3PVCA 5LV9A 4OPLA 2C65A 1XPQA 5CKUA 5FS8A 1L9DA 5FS6A 4X9NA 4EQXA 2Z5XA 3IF9A 5JCNA 2GAGB 2R4JA 2WOIA 4NEWA 2R45A 3HYVA 1GSNA 1COYA 5CQFA 4U8NA 4OPCA 1OJDA 2BC1A 4KPRA 2EQ7A 3HZLA 4Z25A 4TM4A 4U8KA 5J7XA 2CFYA 5JCLA 5JCKA 3SYIA 4EIPA 1PBDA 4AP1A 4BV6A 3VR8A 3AD7B 1GREA 3FG2P 1EL8A 2FJBA 4NTCA 1L0VA 5KOXA 1DOEA 3ABVA 1CBOA 4U8MA 3UOZA 2JB1A 5ER0A 3R9UA 3UOVA 3QVPA 3GMCA 4EMWA 3UCLA 1LPFA 1NG4A 2B76A 3L8KA 4EQWA 1W4XA 1H82A 1D4DA 3T2ZA 1XDIA 2WS3A 4H4PA 1YKJA 4I58A 4UDRA 5KWFA 1GRTA 3BI2A 1GPEA 2XVIA 2V3BA 1KNPA 5KMPA 1JRXA 2IVEA 3DK9A 4A79A 1BF3A 3CIRA 3ISHA 1VQWA 5KOWA 2JB2A 3LJPA 2C72A 2GR0A 3BHKA 2DKIA 2WP5A 1LQUA 2WU5A 2YWLA 2C75A 2RABA 4JN9A 3CGCA 4Z44A 1NHSA 3UP5A 3AEBA 1JNRA 1L9EA 3CPHG 2A8XA 3NNEA 4H50A 1NHPA 3UKPA 3DK8A 1OJTA 3NTAA 1DXLA 1B4VA 1HYUA 2Y6QA 3LOVA 1GOSA 3GRTA 1Y56A 4YKFA 3P9UA 1TDEA 3EF6A 5J60A 3NK0X 4USQA 3V76A 4EIQA 4ECHA 2BACA 1KSSA 3KPKA 4U8IA 4Z2RA 3NG7X 4AP3A 2Z5YA 4U2TA 2E5VA 1FEAA 2YR6A 3AYIA 3IC9A 4CY8A 3K30A 4B67A 3T0KA 3F8RA 4USRA 4B64A 2GH5A 4C5OA 1M64A 2JAEA 4DSHA 5EB5A 4IVMB 4JQ9A 1PBFA 2H89A 1ZKQA 3DA1A 2OA1A 3O0HA 4AT0A 4ZN0A 5HXIA 4A99A 4DSGA 3FMWA 1TDKA 1KSUA 3UOXA 1Q9IA 4I59A 2YG3A 3CNPA 3IWAA 4GDPA 1VRQB 3G5SA 1FECA 4EM3A 5FMHA 3SZWA 3AYJA 1CC2A 4CNKA 5IQ4A 1GERA 1IUVA 2AAQA 2ZBWA 1OJCA 4WCTA 2GQWA 2EQ9A 1KNRA 3GSIA 3K7MX 1F8WA 4M52A 3EPTA 2QA1A 1BGNA 5KVIA 1YY5A 2C3DA 1GESA 5M0ZA 5KVHA 1O95A 2X8HA 1M6IA 5KXJA 4Z24A 2F5ZA 1EL9A 1BZLA 3FBSA 2GR1A 4TLXA 1TYTA 5GSNA 3AE3A 1Y0PA 3CGBA 3UTFA 3T31A 5IQ1A 4NTDA 1BGJA 4EQSA 2CDUA 4Y4NA 1XANA 4H2RA 3V3NA 3RHAA 1ZP0A 3UKLA 3DJJA 1DODA 1IJHA 1E7PA 3UKFA 5BRTA 3QSMA 1Q1WA 2GR2A 3NH3X 4K2XA 3UTGA 1D5TA 4H4YA 4ICYA 4LU6A 3AE1A 1IUTA 4NNJA 1N4UA 2RGHA 4U8OA 1GRGA 1N1PA 3HYWA 3KVEA 3QFBA 3EANA 4BK3A 1CJ4A 3DK4A 4OPTA 1CC4A 2GQFA 4K22A 3IHGA 1TRBA 2XDOA 1GEUA 2XVEA 3VQRA 3NRNA 2QAEA 3JSKA 4H4TA 2WOVA 5L46A 3FPZA 4Z43A 2WPEA 3UOYA 3RP7A 1TDFA 3H8LA 2B9WA 3DJDA 4O5UA 1MXTA 1PJ7A 4BK1A 4K8DA 1REOA 3VRDB 4OPDA 4APNA 2OAMA 1NHRA 1RYIA 3RNMA 2VRMA 1JRYA 3ALJA 2NPXA 2YLTA 2V5ZA 2ACZA 2JK6A 2Q7VA 3P4PA 4X9MA 5DBJA 2A89A 4CCQA 3NYEA 1MO9A 1H84A 4BK2A 1B37A 3ICTA 2E1MA 3CN8A 4GUVA 1PXCA 2UZZA 4IA5A 1AOGA 3E1TA 2FJEA 2YLWA 3GRSA 4K5SA 5TR3A 3QSSA 3D8XA 4B1BA 3F8DA 3SZCA 1GRBA 1ZOVA 2GR3A 3ZYXA 4NWZA 5U25A 4H2NA 3C4NA 1OJAA 1H83A 3SFDA 2YM2A 1GV4A 4GRTA 2PHHA 2AR8A 1E1MA 4BJYA 4CRTA 3P1WA 1CF3A 3ATQA 2WEUA 4G74A 3QFAA 3ICRA 4JNAA 2XLPA 3KA7A 1PDHA 5HHFA 3AXBA 1PS9A 2O9ZA 3NT6A 4G73A 2ZZCA 3CTYA 1JEHA 3NHOX 1MOKA 2RGOA 2VVLA 3SGLA 2GEWA 4D03A 5KMRA 2XVJA 5EOWA 4NTEA 4B69A 1LV0A 2YAUA 1DJNA 4IA6A 4JY2A 1ZMCA 2VRLA 3UTEA 4UP3A 4GF7A 4PABA 5JCMA 1O5WA 4C3YA 4PAAA 2Q6UA 3B3RA 4XWRA 1RSGA 4U8LA 3T14A 4OPGA 2H88A 1TYPA 2X50A 2WDVA 5KRQA 2C67A 1EL5A 4RG4A 2FJDA 2YG6A 4B66A 1TDOA 2VVMA 3AEGA 4II3A 4U2LA 5BUKA 3Q6JA 3RP6A 2YVGA 2YQUA 2AQJA 2EQ6A 1D4CA 1GRHA 2GMJA 4RG3A 1DOBA 4YSZA 3AEDA 2GV8A 4EMJA 2XVHA 2XFPA 1YQ4A 2GMHA 3VRBA 1DNCA 3ALMA 1DJQA 5BVAA 3CNDA 4GDEA 3AE8A 4H2PA 4H4WA 3I3LA 3AEAA 4AOXA 2WETA 3ALLA 2YR4A 4OCGA 4TM0A 1EBDA 2DKHA 1QO8A 3PO7A 3NK1X 1IUXA 3KPFA 2R9ZA 5KMSA 2BK4A 3AE6A 1Y56B 4J56A 3BHFA 4RSLA 2XYOA 1NHQA 2C4CA 3Q9TA 3P4QA 4H4RA 3CNSA 1NENA 1BWCA 2WBAA 2WESA 3II4A 1K4QA 2Q0LA 4J34A 2YG4A 4JY3A 4OPIA 3SM8A 4E0VA 2XFNA 1V59A 4H4UA 3GDNA 3AB1A 1GRFA 3LXDA 1F8RA 1LJ1A 2YLSA 2YG7A 1P2EA 2BYBA 2XFQA 2YVFA 5JCIA 1JU2A 5M10A 2C64A 3ICSA 1GALA 3DJEA 1CL0A 1X31B 2E4GA 2BC0A 2X3NA 3GYJA 5C3JA 4X4JA 4YXDA 1DOCA 4CBQA 2WQYA 1P2HA 2CULA 2BRAA 5EB4A 4H7UA 3GYXA 3UTHA 3AE4A 3KKJA 3GMBA 3KU9A 1NEKA 4YWOA 2X8CA 4HA6A 2JB3A 2GB0A 1PN0A 2VQBA 3AEEA 5FS9A 2OLOA 2V6OA 2X99A 1K0IA 3CPJG 4U2SA 4C77A 2C66A 1JRZA 1ELIA 2WPCA 3AE2A 3GYIA 3IHMA 2VOUA 4EMIA 2ARDA 3SX6A 2WU2A 3NN0X 2R0GA 2WHDA 2CVJA 3CGDA 3D1CA 3T2KA 2JKCA 1N4WA 1K0JA 1SEZA 3AD9B 1TDNA 2B9YA 2I0ZA 3G5QA 2BXSA 4P9SA 2XFOA 2X8GA 1S3EA 3AEFA 1ONFA 1OJ9A 3RP8A 3EAOA 4K7ZA 1VG0A 3NYFA 2TPRA 4U8JA 5U1OA 2YR5A 1Z6LA 3DGZA 3NLCA 4ADWA 2IVDA 1QJDA 1GTHA 2V60A 2FJAA 4GAVA 4B63A 3SQPA 2VZ2A 2YLRA 3SZ0A 4YSXA 4GCMA 1IUWA 2C7GA 4TLZA 4UDPA 4YT0A 3AYLA 2APGA 3CMMA 4FK1C 1CJ2A 1CHUA 1VDCA 3H4KA 4H4XA 1GTEA 4XWZA 2BS3A 3AE9A 3VRAA 3GWDA 1D4EA 3L1RA 1O94A 3KLJA 3HYXA 4EQRA 3V3OA 2GF3A 4II2A 4FX9A 1Q1RA 3GD3A 4A65A 2QCUA 3QJ4A 4KX6A 2GAHB 4A6NB 4H4ZA 1YQZA 4D04A 1F3PA 1E39A 3DH9A 3SZFA 3S61A 4J2WA 1NPXA 4YTPA 5GRTA 3C4AA 1B8SA 3AE5A 2B9XA 4Z2UA 2WP9A 3OZ2A 5FS7A 3K7TA 4NZHA 3UKHA 1H86A 1E1NA 1UKVG 1KF6A 1LQTA 2BRYA 1E1LA 3CGEA 4IV9A 4C74A 2C76A 1S2QA 4Y4LA 4YTMA 3S5WA 4B65A 3H8IA 4WX1A 2YLZA 4BURA 4H2QA 1ZY8A 2XLRA 4TM1A 1GRAA 1PBBA 3NIXA 1GNDA 4MJWA 3SXIA 2Y6RA 2BCPA 4K5RA 3G5RA 5BULA 2W0HA 2PYXA 2BA9A 2BCGG 2EQ8A 3P4RA 4CCRA 1PXAA 2BK3A 3WE0A 1CJ3A 4JDRA 4UDQA 4C3XA 4EM4A 1H7WA 2XCGA 1N4VA 3BNUA 2R46A 5KNLA 4DNAA 4A7AA 5HY5A 2B7RA 2JBVA 1F8SA 4BJZA 1S2YA 4GAPA 2WDRA 2BABA 3NN6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7L A;  2WPF A;  2ZZ0 A;  3AD8 B;  3URH A;  4OPU A;  4LA1 A;  1ZK7 A;  3P4S A;  3KD9 A;  2BS4 A;  1IUS A;  1ZOY A;  3VR9 A;  3QSE A;  1NAA A;  3AWI A;  1PXB A;  1JOA A;  1ZDL A;  4YKG A;  3FIM B;  4J31 A;  4Y4M A;  4J57 A;  3UP4 A;  1F6M A;  1CJC A;  1S3B A;  2YVJ A;  4N9X A;  3NK2 X;  1XHC A;  2V61 A;  4DGK A;  4A6N A;  3CPI G;  2XVF A;  4OVI A;  4A9W A;  3BI4 A;  1PBE A;  1B5Q A;  4H4S A;  2XLS A;  3DGH A;  4Z2T A;  2R0C A;  3T37 A;  2FBW A;  2J3N A;  2WP6 A;  4B68 A;  4Z26 A;  2RGJ A;  3AEC A;  3BNM A;  1L9C A;  1GXF A;  4AOS A;  3LZX A;  1LTX R;  3M13 A;  2VVL G;  1H6V A;  3DME A;  1K0L A;  5IPY A;  1FCD A;  2C73 A;  4A5L A;  2YG5 A;  2WDQ A;  3GDP A;  3M0O A;  1NDA A;  4AT2 A;  4YSH A;  4H4V A;  2WOW A;  5EBK A;  3UKQ A;  4HB9 A;  1CC6 A;  1EL7 A;  1PJ6 A;  1RP0 A;  1FEB A;  2R0P A;  2VQ7 A;  3AE7 A;  1PBC A;  2BK5 A;  4LII A;  1NG3 A;  3QVR A;  3ADA B;  1KDG A;  4XXG A;  2BS2 A;  3C96 A;  3OC4 A;  4O5Q A;  4H4Q A;  3UKK A;  2YM1 A;  4NEV A;  1ZX9 A;  4JNQ A;  3I6D A;  3ITJ A;  1PJ5 A;  2R4E A;  4TM3 A;  4CY6 A;  1FL2 A;  2QA2 A;  1KFY A;  2XLT A;  3BI5 A;  3GD4 A;  3LAD A;  2A87 A;  4J33 A;  2ZZB A;  5C2T A;  2OAL A;  2XLU A;  5U63 A;  1GT8 A;  3DJG X;  4J36 A;  2C70 A;  2IID A;  4YSY A;  1GET A;  3COX A;  3CNT A;  4YTN A;  3NYC A;  2GRT A;  2B7S A;  3PS9 A;  1BKW A;  2NVK X;  3SFE A;  2BXR A;  4IVO B;  3ATR A;  3F8P A;  4U8P A;  4ZCD A;  3RED A;  1H7X A;  3M12 A;  3NKS A;  1QLB A;  1ZMD A;  2TMD A;  1JNZ A;  3LZW A;  1PHH A;  1VG9 A;  2OLN A;  3LB8 A;  1YQ3 A;  4CNJ A;  3B6D A;  4FK1 A;  2HQM A;  3UKA A;  1D7Y A;  2C3C A;  4ZCC A;  1LVL A;  1E1K A;  2V3A A;  3CNJ A;  3GWF A;  3ZDN A;  2GVC A;  3NTD A;  1H81 A;  4GR1 A;  4REK A;  5HYM A;  2YLX A;  2Q0K A;  3NGC X;  1E6E A;  1IUU A;  4FDC B;  3K7Q X;  1FOH A;  2XFU A;  3PVC A;  5LV9 A;  4OPL A;  2C65 A;  1XPQ A;  5CKU A;  5FS8 A;  1L9D A;  5FS6 A;  4X9N A;  4EQX A;  2Z5X A;  3IF9 A;  5JCN A;  2GAG B;  2R4J A;  2WOI A;  4NEW A;  2R45 A;  1GSN A;  1COY A;  5CQF A;  4U8N A;  4OPC A;  1OJD A;  2BC1 A;  4KPR A;  2EQ7 A;  3HZL A;  4Z25 A;  4TM4 A;  4U8K A;  5J7X A;  2CFY A;  5JCL A;  5JCK A;  4EIP A;  1PBD A;  4AP1 A;  4BV6 A;  3VR8 A;  3AD7 B;  1GRE A;  3FG2 P;  1EL8 A;  2FJB A;  4NTC A;  1L0V A;  5KOX A;  1DOE A;  3ABV A;  1CBO A;  4U8M A;  3UOZ A;  2JB1 A;  5ER0 A;  3R9U A;  3UOV A;  3QVP A;  3GMC A;  4EMW A;  3UCL A;  1LPF A;  1NG4 A;  2B76 A;  3L8K A;  4EQW A;  1W4X A;  1H82 A;  1D4D A;  1XDI A;  2WS3 A;  4H4P A;  1YKJ A;  4I58 A;  4UDR A;  5KWF A;  1GRT A;  3BI2 A;  1GPE A;  2XVI A;  2V3B A;  1KNP A;  1JRX A;  2IVE A;  3DK9 A;  4A79 A;  1BF3 A;  3CIR A;  3ISH A;  1VQW A;  5KOW A;  2JB2 A;  3LJP A;  2C72 A;  2GR0 A;  3BHK A;  2DKI A;  2WP5 A;  1LQU A;  2WU5 A;  2YWL A;  2C75 A;  2RAB A;  4JN9 A;  3CGC A;  4Z44 A;  1NHS A;  3UP5 A;  3AEB A;  1JNR A;  1L9E A;  3CPH G;  2A8X A;  3NNE A;  4H50 A;  1NHP A;  3UKP A;  3DK8 A;  1OJT A;  3NTA A;  1DXL A;  1B4V A;  1HYU A;  2Y6Q A;  3LOV A;  1GOS A;  3GRT A;  1Y56 A;  4YKF A;  3P9U A;  1TDE A;  3EF6 A;  5J60 A;  3NK0 X;  4USQ A;  3V76 A;  4EIQ A;  4ECH A;  2BAC A;  1KSS A;  4U8I A;  4Z2R A;  3NG7 X;  4AP3 A;  2Z5Y A;  4U2T A;  2E5V A;  1FEA A;  2YR6 A;  3AYI A;  3IC9 A;  4CY8 A;  3K30 A;  4B67 A;  3F8R A;  4USR A;  4B64 A;  2GH5 A;  4C5O A;  1M64 A;  2JAE A;  4DSH A;  5EB5 A;  4IVM B;  4JQ9 A;  1PBF A;  2H89 A;  1ZKQ A;  3DA1 A;  2OA1 A;  3O0H A;  4AT0 A;  4ZN0 A;  5HXI A;  4A99 A;  4DSG A;  3FMW A;  1TDK A;  1KSU A;  3UOX A;  1Q9I A;  4I59 A;  2YG3 A;  3CNP A;  3IWA A;  4GDP A;  1VRQ B;  3G5S A;  1FEC A;  4EM3 A;  5FMH A;  3AYJ A;  1CC2 A;  4CNK A;  5IQ4 A;  1GER A;  1IUV A;  2AAQ A;  2ZBW A;  1OJC A;  4WCT A;  2GQW A;  2EQ9 A;  1KNR A;  3GSI A;  3K7M X;  1F8W A;  4M52 A;  3EPT A;  2QA1 A;  1BGN A;  5KVI A;  1YY5 A;  2C3D A;  1GES A;  5M0Z A;  5KVH A;  1O95 A;  2X8H A;  1M6I A;  5KXJ A;  4Z24 A;  2F5Z A;  1EL9 A;  1BZL A;  3FBS A;  2GR1 A;  4TLX A;  1TYT A;  5GSN A;  3AE3 A;  1Y0P A;  3CGB A;  3UTF A;  5IQ1 A;  4NTD A;  1BGJ A;  4EQS A;  2CDU A;  4Y4N A;  1XAN A;  4H2R A;  3V3N A;  3RHA A;  1ZP0 A;  3UKL A;  3DJJ A;  1DOD A;  1IJH A;  1E7P A;  3UKF A;  5BRT A;  3QSM A;  1Q1W A;  2GR2 A;  3NH3 X;  4K2X A;  3UTG A;  1D5T A;  4H4Y A;  4ICY A;  4LU6 A;  3AE1 A;  1IUT A;  1N4U A;  2RGH A;  4U8O A;  1GRG A;  1N1P A;  3KVE A;  3QFB A;  3EAN A;  4BK3 A;  1CJ4 A;  3DK4 A;  4OPT A;  1CC4 A;  2GQF A;  4K22 A;  3IHG A;  1TRB A;  2XDO A;  1GEU A;  2XVE A;  3VQR A;  3NRN A;  2QAE A;  3JSK A;  4H4T A;  2WOV A;  5L46 A;  3FPZ A;  4Z43 A;  2WPE A;  3UOY A;  3RP7 A;  1TDF A;  3H8L A;  2B9W A;  3DJD A;  4O5U A;  1MXT A;  1PJ7 A;  4BK1 A;  4K8D A;  1REO A;  3VRD B;  4OPD A;  4APN A;  2OAM A;  1NHR A;  1RYI A;  3RNM A;  2VRM A;  1JRY A;  3ALJ A;  2NPX A;  2YLT A;  2V5Z A;  2ACZ A;  2JK6 A;  2Q7V A;  3P4P A;  4X9M A;  5DBJ A;  2A89 A;  4CCQ A;  3NYE A;  1MO9 A;  1H84 A;  4BK2 A;  1B37 A;  3ICT A;  2E1M A;  3CN8 A;  4GUV A;  1PXC A;  2UZZ A;  4IA5 A;  1AOG A;  3E1T A;  2FJE A;  2YLW A;  3GRS A;  4K5S A;  5TR3 A;  3QSS A;  3D8X A;  4B1B A;  3F8D A;  3ZYX A;  1GRB A;  1ZOV A;  2GR3 A;  5U25 A;  4H2N A;  3C4N A;  1OJA A;  1H83 A;  3SFD A;  2YM2 A;  1GV4 A;  4GRT A;  2PHH A;  2AR8 A;  1E1M A;  4BJY A;  4CRT A;  3P1W A;  1CF3 A;  3ATQ A;  2WEU A;  3QFA A;  3ICR A;  4JNA A;  2XLP A;  3KA7 A;  1PDH A;  5HHF A;  3AXB A;  1PS9 A;  2O9Z A;  3NT6 A;  2ZZC A;  3CTY A;  1JEH A;  3NHO X;  1MOK A;  2RGO A;  2VVL A;  3SGL A;  2GEW A;  4D03 A;  2XVJ A;  5EOW A;  4NTE A;  4B69 A;  1LV0 A;  2YAU A;  1DJN A;  4IA6 A;  4JY2 A;  1ZMC A;  2VRL A;  3UTE A;  4UP3 A;  4GF7 A;  4PAB A;  5JCM A;  1O5W A;  4C3Y A;  4PAA A;  2Q6U A;  3B3R A;  4XWR A;  1RSG A;  4U8L A;  4OPG A;  2H88 A;  1TYP A;  2X50 A;  2WDV A;  5KRQ A;  2C67 A;  1EL5 A;  4RG4 A;  2FJD A;  2YG6 A;  4B66 A;  1TDO A;  2VVM A;  3AEG A;  4U2L A;  5BUK A;  3Q6J A;  3RP6 A;  2YVG A;  2YQU A;  2AQJ A;  2EQ6 A;  1D4C A;  1GRH A;  2GMJ A;  4RG3 A;  1DOB A;  4YSZ A;  3AED A;  2GV8 A;  4EMJ A;  2XVH A;  2XFP A;  1YQ4 A;  2GMH A;  3VRB A;  1DNC A;  3ALM A;  1DJQ A;  5BVA A;  3CND A;  4GDE A;  3AE8 A;  4H2P A;  4H4W A;  3I3L A;  3AEA A;  4AOX A;  2WET A;  3ALL A;  2YR4 A;  4OCG A;  4TM0 A;  1EBD A;  2DKH A;  1QO8 A;  3PO7 A;  3NK1 X;  1IUX A;  3KPF A;  2R9Z A;  2BK4 A;  3AE6 A;  1Y56 B;  4J56 A;  3BHF A;  4RSL A;  2XYO A;  1NHQ A;  3Q9T A;  4H4R A;  3P4Q A;  3CNS A;  1NEN A;  1BWC A;  2WBA A;  2WES A;  3II4 A;  1K4Q A;  2Q0L A;  4J34 A;  2YG4 A;  4JY3 A;  4OPI A;  3SM8 A;  4E0V A;  2XFN A;  1V59 A;  4H4U A;  3GDN A;  3AB1 A;  1GRF A;  3LXD A;  1F8R A;  1LJ1 A;  2YLS A;  2YG7 A;  1P2E A;  2BYB A;  2XFQ A;  2YVF A;  5JCI A;  1JU2 A;  5M10 A;  2C64 A;  3ICS A;  1GAL A;  3DJE A;  1CL0 A;  1X31 B;  2E4G A;  2BC0 A;  2X3N A;  3GYJ A;  5C3J A;  4X4J A;  4YXD A;  1DOC A;  4CBQ A;  2WQY A;  1P2H A;  2CUL A;  5EB4 A;  3UTH A;  4H7U A;  3AE4 A;  3KKJ A;  3GMB A;  3KU9 A;  1NEK A;  4YWO A;  2X8C A;  4HA6 A;  2JB3 A;  2GB0 A;  1PN0 A;  2VQB A;  3AEE A;  5FS9 A;  2OLO A;  2V6O A;  2X99 A;  1K0I A;  3CPJ G;  4U2S A;  4C77 A;  2C66 A;  1JRZ A;  1ELI A;  2WPC A;  3AE2 A;  3GYI A;  3IHM A;  2VOU A;  4EMI A;  2ARD A;  2WU2 A;  3NN0 X;  2R0G A;  2WHD A;  2CVJ A;  3CGD A;  3D1C A;  2JKC A;  1N4W A;  1K0J A;  1SEZ A;  3AD9 B;  1TDN A;  2B9Y A;  2I0Z A;  3G5Q A;  2BXS A;  4P9S A;  2XFO A;  2X8G A;  1S3E A;  3AEF A;  1ONF A;  1OJ9 A;  3RP8 A;  3EAO A;  4K7Z A;  1VG0 A;  3NYF A;  2TPR A;  4U8J A;  5U1O A;  2YR5 A;  1Z6L A;  3DGZ A;  3NLC A;  4ADW A;  2IVD A;  1QJD A;  1GTH A;  2V60 A;  2FJA A;  4B63 A;  3SQP A;  2VZ2 A;  2YLR A;  4YSX A;  4GCM A;  1IUW A;  2C7G A;  4TLZ A;  4UDP A;  4YT0 A;  3AYL A;  2APG A;  4FK1 C;  1CJ2 A;  1CHU A;  1VDC A;  3H4K A;  4H4X A;  1GTE A;  4XWZ A;  2BS3 A;  3AE9 A;  3VRA A;  3GWD A;  1D4E A;  3L1R A;  1O94 A;  3KLJ A;  4EQR A;  3V3O A;  2GF3 A;  4FX9 A;  1Q1R A;  3GD3 A;  4A65 A;  2QCU A;  3QJ4 A;  4KX6 A;  2GAH B;  4A6N B;  4H4Z A;  1YQZ A;  4D04 A;  1F3P A;  1E39 A;  3DH9 A;  3S61 A;  4J2W A;  1NPX A;  4YTP A;  5GRT A;  3C4A A;  1B8S A;  3AE5 A;  2B9X A;  4Z2U A;  2WP9 A;  3OZ2 A;  5FS7 A;  3K7T A;  4NZH A;  3UKH A;  1H86 A;  1E1N A;  1UKV G;  1KF6 A;  1LQT A;  4IV9 A;  1E1L A;  3CGE A;  4C74 A;  2C76 A;  1S2Q A;  4Y4L A;  4YTM A;  3S5W A;  4B65 A;  3H8I A;  4WX1 A;  2YLZ A;  4BUR A;  4H2Q A;  1ZY8 A;  2XLR A;  4TM1 A;  1GRA A;  1PBB A;  3NIX A;  1GND A;  4MJW A;  2Y6R A;  2BCP A;  4K5R A;  3G5R A;  5BUL A;  2W0H A;  2PYX A;  2BA9 A;  2BCG G;  2EQ8 A;  3P4R A;  4CCR A;  1PXA A;  2BK3 A;  3WE0 A;  1CJ3 A;  4JDR A;  4UDQ A;  4C3X A;  4EM4 A;  1H7W A;  2XCG A;  1N4V A;  3BNU A;  2R46 A;  4DNA A;  4A7A A;  5HY5 A;  2B7R A;  2JBV A;  1F8S A;  4BJZ A;  1S2Y A;  2WDR A;  2BAB A;  3NN6 X; 
#chains in the Genus database with same CATH topology
 1D7L A;  2WPF A;  2ZZ0 A;  3AD8 B;  3URH A;  4OPU A;  4LA1 A;  1ZK7 A;  3P4S A;  3KD9 A;  2BS4 A;  1IUS A;  1ZOY A;  3VR9 A;  3QSE A;  1NAA A;  3AWI A;  1PXB A;  1JOA A;  1ZDL A;  4G9K A;  3FIM B;  4YKG A;  4J31 A;  4Y4M A;  5KMQ A;  4J57 A;  3UP4 A;  1F6M A;  1CJC A;  1S3B A;  2YVJ A;  4N9X A;  3NK2 X;  1XHC A;  2V61 A;  4DGK A;  4A6N A;  3CPI G;  2XVF A;  4OVI A;  4A9W A;  3BI4 A;  1PBE A;  1B5Q A;  4G6G A;  2XLS A;  3DGH A;  4H4S A;  4Z2T A;  2R0C A;  3T37 A;  2FBW A;  2J3N A;  2WP6 A;  4G6H A;  4B68 A;  4Z26 A;  2RGJ A;  3AEC A;  3BNM A;  1L9C A;  1GXF A;  3T2Y A;  3LZX A;  1LTX R;  3M13 A;  2VVL G;  1H6V A;  3DME A;  1K0L A;  4AOS A;  1FCD A;  5IPY A;  2C73 A;  4A5L A;  2YG5 A;  2WDQ A;  3GDP A;  3SY4 A;  3M0O A;  1NDA A;  4AT2 A;  4YSH A;  4H4V A;  2WOW A;  5EBK A;  3UKQ A;  4HB9 A;  1CC6 A;  1EL7 A;  1PJ6 A;  1RP0 A;  1FEB A;  2R0P A;  2VQ7 A;  3AE7 A;  1PBC A;  2BK5 A;  4LII A;  1NG3 A;  3QVR A;  3ADA B;  1KDG A;  4XXG A;  2BS2 A;  3C96 A;  3OC4 A;  4O5Q A;  4H4Q A;  3UKK A;  2YM1 A;  4NEV A;  1ZX9 A;  4JNQ A;  3I6D A;  3ITJ A;  1PJ5 A;  2R4E A;  4TM3 A;  4CY6 A;  1FL2 A;  2QA2 A;  1KFY A;  2XLT A;  3BI5 A;  3GD4 A;  3LAD A;  2A87 A;  4J33 A;  2ZZB A;  5C2T A;  2OAL A;  2XLU A;  5U63 A;  1GT8 A;  3DJG X;  4J36 A;  2C70 A;  2IID A;  4YSY A;  1GET A;  3COX A;  3CNT A;  4YTN A;  3NYC A;  2GRT A;  2B7S A;  3PS9 A;  1BKW A;  2NVK X;  3SFE A;  2BXR A;  4IVO B;  3ATR A;  3F8P A;  4U8P A;  4ZCD A;  3RED A;  1H7X A;  3M12 A;  3NKS A;  1QLB A;  1ZMD A;  2TMD A;  1JNZ A;  3LZW A;  1PHH A;  1VG9 A;  2OLN A;  3LB8 A;  1YQ3 A;  4CNJ A;  3B6D A;  4FK1 A;  2HQM A;  3UKA A;  1D7Y A;  2C3C A;  4ZCC A;  1LVL A;  1E1K A;  2V3A A;  3CNJ A;  3GWF A;  3ZDN A;  2GVC A;  3NTD A;  1H81 A;  4GR1 A;  4REK A;  5HYM A;  2YLX A;  2Q0K A;  3NGC X;  1E6E A;  1IUU A;  4FDC B;  3K7Q X;  1FOH A;  2XFU A;  3PVC A;  5LV9 A;  4OPL A;  2C65 A;  1XPQ A;  5CKU A;  5FS8 A;  1L9D A;  5FS6 A;  4X9N A;  4EQX A;  2Z5X A;  3IF9 A;  5JCN A;  2GAG B;  2R4J A;  2WOI A;  4NEW A;  2R45 A;  3HYV A;  1GSN A;  1COY A;  5CQF A;  4U8N A;  4OPC A;  1OJD A;  2BC1 A;  4KPR A;  2EQ7 A;  3HZL A;  4Z25 A;  4TM4 A;  4U8K A;  5J7X A;  2CFY A;  5JCL A;  5JCK A;  3SYI A;  4EIP A;  1PBD A;  4AP1 A;  4BV6 A;  3VR8 A;  3AD7 B;  1GRE A;  3FG2 P;  1EL8 A;  2FJB A;  4NTC A;  1L0V A;  5KOX A;  1DOE A;  3ABV A;  1CBO A;  4U8M A;  3UOZ A;  2JB1 A;  5ER0 A;  3R9U A;  3UOV A;  3QVP A;  3GMC A;  4EMW A;  3UCL A;  1LPF A;  1NG4 A;  2B76 A;  3L8K A;  4EQW A;  1W4X A;  1H82 A;  1D4D A;  3T2Z A;  1XDI A;  2WS3 A;  4H4P A;  1YKJ A;  4I58 A;  4UDR A;  5KWF A;  1GRT A;  3BI2 A;  1GPE A;  2XVI A;  2V3B A;  1KNP A;  5KMP A;  1JRX A;  2IVE A;  3DK9 A;  4A79 A;  1BF3 A;  3CIR A;  3ISH A;  1VQW A;  5KOW A;  2JB2 A;  3LJP A;  2C72 A;  2GR0 A;  3BHK A;  2DKI A;  2WP5 A;  1LQU A;  2WU5 A;  2YWL A;  2C75 A;  2RAB A;  4JN9 A;  3CGC A;  4Z44 A;  1NHS A;  3UP5 A;  3AEB A;  1JNR A;  1L9E A;  3CPH G;  2A8X A;  3NNE A;  4H50 A;  1NHP A;  3UKP A;  3DK8 A;  1OJT A;  3NTA A;  1DXL A;  1B4V A;  1HYU A;  2Y6Q A;  3LOV A;  1GOS A;  3GRT A;  1Y56 A;  4YKF A;  3P9U A;  1TDE A;  3EF6 A;  5J60 A;  3NK0 X;  4USQ A;  3V76 A;  4EIQ A;  4ECH A;  2BAC A;  1KSS A;  3KPK A;  4U8I A;  4Z2R A;  3NG7 X;  4AP3 A;  2Z5Y A;  4U2T A;  2E5V A;  1FEA A;  2YR6 A;  3AYI A;  3IC9 A;  4CY8 A;  3K30 A;  4B67 A;  3T0K A;  3F8R A;  4USR A;  4B64 A;  2GH5 A;  4C5O A;  1M64 A;  2JAE A;  4DSH A;  5EB5 A;  4IVM B;  4JQ9 A;  1PBF A;  2H89 A;  1ZKQ A;  3DA1 A;  2OA1 A;  3O0H A;  4AT0 A;  4ZN0 A;  5HXI A;  4A99 A;  4DSG A;  3FMW A;  1TDK A;  1KSU A;  3UOX A;  1Q9I A;  4I59 A;  2YG3 A;  3CNP A;  3IWA A;  4GDP A;  1VRQ B;  3G5S A;  1FEC A;  4EM3 A;  5FMH A;  3SZW A;  3AYJ A;  1CC2 A;  4CNK A;  5IQ4 A;  1GER A;  1IUV A;  2AAQ A;  2ZBW A;  1OJC A;  4WCT A;  2GQW A;  2EQ9 A;  1KNR A;  3GSI A;  3K7M X;  1F8W A;  4M52 A;  3EPT A;  2QA1 A;  1BGN A;  5KVI A;  1YY5 A;  2C3D A;  1GES A;  5M0Z A;  5KVH A;  1O95 A;  2X8H A;  1M6I A;  5KXJ A;  4Z24 A;  2F5Z A;  1EL9 A;  1BZL A;  3FBS A;  2GR1 A;  4TLX A;  1TYT A;  5GSN A;  3AE3 A;  1Y0P A;  3CGB A;  3UTF A;  3T31 A;  5IQ1 A;  4NTD A;  1BGJ A;  4EQS A;  2CDU A;  4Y4N A;  1XAN A;  4H2R A;  3V3N A;  3RHA A;  1ZP0 A;  3UKL A;  3DJJ A;  1DOD A;  1IJH A;  1E7P A;  3UKF A;  5BRT A;  3QSM A;  1Q1W A;  2GR2 A;  3NH3 X;  4K2X A;  3UTG A;  1D5T A;  4H4Y A;  4ICY A;  4LU6 A;  3AE1 A;  1IUT A;  4NNJ A;  1N4U A;  2RGH A;  4U8O A;  1GRG A;  1N1P A;  3HYW A;  3KVE A;  3QFB A;  3EAN A;  4BK3 A;  1CJ4 A;  3DK4 A;  4OPT A;  1CC4 A;  2GQF A;  4K22 A;  3IHG A;  1TRB A;  2XDO A;  1GEU A;  2XVE A;  3VQR A;  3NRN A;  2QAE A;  3JSK A;  4H4T A;  2WOV A;  5L46 A;  3FPZ A;  4Z43 A;  2WPE A;  3UOY A;  3RP7 A;  1TDF A;  3H8L A;  2B9W A;  3DJD A;  4O5U A;  1MXT A;  1PJ7 A;  4BK1 A;  4K8D A;  1REO A;  3VRD B;  4OPD A;  4APN A;  2OAM A;  1NHR A;  1RYI A;  3RNM A;  2VRM A;  1JRY A;  3ALJ A;  2NPX A;  2YLT A;  2V5Z A;  2ACZ A;  2JK6 A;  2Q7V A;  3P4P A;  4X9M A;  5DBJ A;  2A89 A;  4CCQ A;  3NYE A;  1MO9 A;  1H84 A;  4BK2 A;  1B37 A;  3ICT A;  2E1M A;  3CN8 A;  4GUV A;  1PXC A;  2UZZ A;  4IA5 A;  1AOG A;  3E1T A;  2FJE A;  2YLW A;  3GRS A;  4K5S A;  5TR3 A;  3QSS A;  3D8X A;  4B1B A;  3F8D A;  3SZC A;  1GRB A;  1ZOV A;  2GR3 A;  3ZYX A;  4NWZ A;  5U25 A;  4H2N A;  3C4N A;  1OJA A;  1H83 A;  3SFD A;  2YM2 A;  1GV4 A;  4GRT A;  2PHH A;  2AR8 A;  1E1M A;  4BJY A;  4CRT A;  3P1W A;  1CF3 A;  3ATQ A;  2WEU A;  4G74 A;  3QFA A;  3ICR A;  4JNA A;  2XLP A;  3KA7 A;  1PDH A;  5HHF A;  3AXB A;  1PS9 A;  2O9Z A;  3NT6 A;  4G73 A;  2ZZC A;  3CTY A;  1JEH A;  3NHO X;  1MOK A;  2RGO A;  2VVL A;  3SGL A;  2GEW A;  4D03 A;  5KMR A;  2XVJ A;  5EOW A;  4NTE A;  4B69 A;  1LV0 A;  2YAU A;  1DJN A;  4IA6 A;  4JY2 A;  1ZMC A;  2VRL A;  3UTE A;  4UP3 A;  4GF7 A;  4PAB A;  5JCM A;  1O5W A;  4C3Y A;  4PAA A;  2Q6U A;  3B3R A;  4XWR A;  1RSG A;  4U8L A;  3T14 A;  4OPG A;  2H88 A;  1TYP A;  2X50 A;  2WDV A;  5KRQ A;  2C67 A;  1EL5 A;  4RG4 A;  2FJD A;  2YG6 A;  4B66 A;  1TDO A;  2VVM A;  3AEG A;  4II3 A;  4U2L A;  5BUK A;  3Q6J A;  3RP6 A;  2YVG A;  2YQU A;  2AQJ A;  2EQ6 A;  1D4C A;  1GRH A;  2GMJ A;  4RG3 A;  1DOB A;  4YSZ A;  3AED A;  2GV8 A;  4EMJ A;  2XVH A;  2XFP A;  1YQ4 A;  2GMH A;  3VRB A;  1DNC A;  3ALM A;  1DJQ A;  5BVA A;  3CND A;  4GDE A;  3AE8 A;  4H2P A;  4H4W A;  3I3L A;  3AEA A;  4AOX A;  2WET A;  3ALL A;  2YR4 A;  4OCG A;  4TM0 A;  1EBD A;  2DKH A;  1QO8 A;  3PO7 A;  3NK1 X;  1IUX A;  3KPF A;  2R9Z A;  5KMS A;  2BK4 A;  3AE6 A;  1Y56 B;  4J56 A;  3BHF A;  4RSL A;  2XYO A;  1NHQ A;  2C4C A;  3Q9T A;  3P4Q A;  4H4R A;  3CNS A;  1NEN A;  1BWC A;  2WBA A;  2WES A;  3II4 A;  1K4Q A;  2Q0L A;  4J34 A;  2YG4 A;  4JY3 A;  4OPI A;  3SM8 A;  4E0V A;  2XFN A;  1V59 A;  4H4U A;  3GDN A;  3AB1 A;  1GRF A;  3LXD A;  1F8R A;  1LJ1 A;  2YLS A;  2YG7 A;  1P2E A;  2BYB A;  2XFQ A;  2YVF A;  5JCI A;  1JU2 A;  5M10 A;  2C64 A;  3ICS A;  1GAL A;  3DJE A;  1CL0 A;  1X31 B;  2E4G A;  2BC0 A;  2X3N A;  3GYJ A;  5C3J A;  4X4J A;  4YXD A;  1DOC A;  4CBQ A;  2WQY A;  1P2H A;  2CUL A;  2BRA A;  5EB4 A;  4H7U A;  3GYX A;  3UTH A;  3AE4 A;  3KKJ A;  3GMB A;  3KU9 A;  1NEK A;  4YWO A;  2X8C A;  4HA6 A;  2JB3 A;  2GB0 A;  1PN0 A;  2VQB A;  3AEE A;  5FS9 A;  2OLO A;  2V6O A;  2X99 A;  1K0I A;  3CPJ G;  4U2S A;  4C77 A;  2C66 A;  1JRZ A;  1ELI A;  2WPC A;  3AE2 A;  3GYI A;  3IHM A;  2VOU A;  4EMI A;  2ARD A;  3SX6 A;  2WU2 A;  3NN0 X;  2R0G A;  2WHD A;  2CVJ A;  3CGD A;  3D1C A;  3T2K A;  2JKC A;  1N4W A;  1K0J A;  1SEZ A;  3AD9 B;  1TDN A;  2B9Y A;  2I0Z A;  3G5Q A;  2BXS A;  4P9S A;  2XFO A;  2X8G A;  1S3E A;  3AEF A;  1ONF A;  1OJ9 A;  3RP8 A;  3EAO A;  4K7Z A;  1VG0 A;  3NYF A;  2TPR A;  4U8J A;  5U1O A;  2YR5 A;  1Z6L A;  3DGZ A;  3NLC A;  4ADW A;  2IVD A;  1QJD A;  1GTH A;  2V60 A;  2FJA A;  4GAV A;  4B63 A;  3SQP A;  2VZ2 A;  2YLR A;  3SZ0 A;  4YSX A;  4GCM A;  1IUW A;  2C7G A;  4TLZ A;  4UDP A;  4YT0 A;  3AYL A;  2APG A;  3CMM A;  4FK1 C;  1CJ2 A;  1CHU A;  1VDC A;  3H4K A;  4H4X A;  1GTE A;  4XWZ A;  2BS3 A;  3AE9 A;  3VRA A;  3GWD A;  1D4E A;  3L1R A;  1O94 A;  3KLJ A;  3HYX A;  4EQR A;  3V3O A;  2GF3 A;  4II2 A;  4FX9 A;  1Q1R A;  3GD3 A;  4A65 A;  2QCU A;  3QJ4 A;  4KX6 A;  2GAH B;  4A6N B;  4H4Z A;  1YQZ A;  4D04 A;  1F3P A;  1E39 A;  3DH9 A;  3SZF A;  3S61 A;  4J2W A;  1NPX A;  4YTP A;  5GRT A;  3C4A A;  1B8S A;  3AE5 A;  2B9X A;  4Z2U A;  2WP9 A;  3OZ2 A;  5FS7 A;  3K7T A;  4NZH A;  3UKH A;  1H86 A;  1E1N A;  1UKV G;  1KF6 A;  1LQT A;  2BRY A;  1E1L A;  3CGE A;  4IV9 A;  4C74 A;  2C76 A;  1S2Q A;  4Y4L A;  4YTM A;  3S5W A;  4B65 A;  3H8I A;  4WX1 A;  2YLZ A;  4BUR A;  4H2Q A;  1ZY8 A;  2XLR A;  4TM1 A;  1GRA A;  1PBB A;  3NIX A;  1GND A;  4MJW A;  3SXI A;  2Y6R A;  2BCP A;  4K5R A;  3G5R A;  5BUL A;  2W0H A;  2PYX A;  2BA9 A;  2BCG G;  2EQ8 A;  3P4R A;  4CCR A;  1PXA A;  2BK3 A;  3WE0 A;  1CJ3 A;  4JDR A;  4UDQ A;  4C3X A;  4EM4 A;  1H7W A;  2XCG A;  1N4V A;  3BNU A;  2R46 A;  5KNL A;  4DNA A;  4A7A A;  5HY5 A;  2B7R A;  2JBV A;  1F8S A;  4BJZ A;  1S2Y A;  4GAP A;  2WDR A;  2BAB A;  3NN6 X; 
#chains in the Genus database with same CATH homology
 1D7L A;  2WPF A;  2ZZ0 A;  3AD8 B;  3URH A;  4OPU A;  4LA1 A;  1ZK7 A;  3P4S A;  3KD9 A;  2BS4 A;  1IUS A;  1ZOY A;  3VR9 A;  3QSE A;  1NAA A;  3AWI A;  1PXB A;  1JOA A;  1ZDL A;  4G9K A;  3FIM B;  4YKG A;  4J31 A;  4Y4M A;  5KMQ A;  4J57 A;  3UP4 A;  1F6M A;  1CJC A;  1S3B A;  2YVJ A;  4N9X A;  3NK2 X;  1XHC A;  2V61 A;  4DGK A;  4A6N A;  3CPI G;  2XVF A;  4OVI A;  4A9W A;  3BI4 A;  1PBE A;  1B5Q A;  4G6G A;  2XLS A;  3DGH A;  4H4S A;  4Z2T A;  2R0C A;  3T37 A;  2FBW A;  2J3N A;  2WP6 A;  4G6H A;  4B68 A;  4Z26 A;  2RGJ A;  3AEC A;  3BNM A;  1L9C A;  1GXF A;  3T2Y A;  3LZX A;  1LTX R;  3M13 A;  2VVL G;  1H6V A;  3DME A;  1K0L A;  4AOS A;  1FCD A;  5IPY A;  2C73 A;  4A5L A;  2YG5 A;  2WDQ A;  3GDP A;  3SY4 A;  3M0O A;  1NDA A;  4AT2 A;  4YSH A;  4H4V A;  2WOW A;  5EBK A;  3UKQ A;  4HB9 A;  1CC6 A;  1EL7 A;  1PJ6 A;  1RP0 A;  1FEB A;  2R0P A;  2VQ7 A;  3AE7 A;  1PBC A;  2BK5 A;  4LII A;  1NG3 A;  3QVR A;  3ADA B;  1KDG A;  4XXG A;  2BS2 A;  3C96 A;  3OC4 A;  4O5Q A;  4H4Q A;  3UKK A;  2YM1 A;  4NEV A;  1ZX9 A;  4JNQ A;  3I6D A;  3ITJ A;  1PJ5 A;  2R4E A;  4TM3 A;  4CY6 A;  1FL2 A;  2QA2 A;  1KFY A;  2XLT A;  3BI5 A;  3GD4 A;  3LAD A;  2A87 A;  4J33 A;  2ZZB A;  5C2T A;  2OAL A;  2XLU A;  5U63 A;  1GT8 A;  3DJG X;  4J36 A;  2C70 A;  2IID A;  4YSY A;  1GET A;  3COX A;  3CNT A;  4YTN A;  3NYC A;  2GRT A;  2B7S A;  3PS9 A;  1BKW A;  2NVK X;  3SFE A;  2BXR A;  4IVO B;  3ATR A;  3F8P A;  4U8P A;  4ZCD A;  3RED A;  1H7X A;  3M12 A;  3NKS A;  1QLB A;  1ZMD A;  2TMD A;  1JNZ A;  3LZW A;  1PHH A;  1VG9 A;  2OLN A;  3LB8 A;  1YQ3 A;  4CNJ A;  3B6D A;  4FK1 A;  2HQM A;  3UKA A;  1D7Y A;  2C3C A;  4ZCC A;  1LVL A;  1E1K A;  2V3A A;  3CNJ A;  3GWF A;  3ZDN A;  2GVC A;  3NTD A;  1H81 A;  4GR1 A;  4REK A;  5HYM A;  2YLX A;  2Q0K A;  3NGC X;  1E6E A;  1IUU A;  4FDC B;  3K7Q X;  1FOH A;  2XFU A;  3PVC A;  5LV9 A;  4OPL A;  2C65 A;  1XPQ A;  5CKU A;  5FS8 A;  1L9D A;  5FS6 A;  4X9N A;  4EQX A;  2Z5X A;  3IF9 A;  5JCN A;  2GAG B;  2R4J A;  2WOI A;  4NEW A;  2R45 A;  3HYV A;  1GSN A;  1COY A;  5CQF A;  4U8N A;  4OPC A;  1OJD A;  2BC1 A;  4KPR A;  2EQ7 A;  3HZL A;  4Z25 A;  4TM4 A;  4U8K A;  5J7X A;  2CFY A;  5JCL A;  5JCK A;  3SYI A;  4EIP A;  1PBD A;  4AP1 A;  4BV6 A;  3VR8 A;  3AD7 B;  1GRE A;  3FG2 P;  1EL8 A;  2FJB A;  4NTC A;  1L0V A;  5KOX A;  1DOE A;  3ABV A;  1CBO A;  4U8M A;  3UOZ A;  2JB1 A;  5ER0 A;  3R9U A;  3UOV A;  3QVP A;  3GMC A;  4EMW A;  3UCL A;  1LPF A;  1NG4 A;  2B76 A;  3L8K A;  4EQW A;  1W4X A;  1H82 A;  1D4D A;  3T2Z A;  1XDI A;  2WS3 A;  4H4P A;  1YKJ A;  4I58 A;  4UDR A;  5KWF A;  1GRT A;  3BI2 A;  1GPE A;  2XVI A;  2V3B A;  1KNP A;  5KMP A;  1JRX A;  2IVE A;  3DK9 A;  4A79 A;  1BF3 A;  3CIR A;  3ISH A;  1VQW A;  5KOW A;  2JB2 A;  3LJP A;  2C72 A;  2GR0 A;  3BHK A;  2DKI A;  2WP5 A;  1LQU A;  2WU5 A;  2YWL A;  2C75 A;  2RAB A;  4JN9 A;  3CGC A;  4Z44 A;  1NHS A;  3UP5 A;  3AEB A;  1JNR A;  1L9E A;  3CPH G;  2A8X A;  3NNE A;  4H50 A;  1NHP A;  3UKP A;  3DK8 A;  1OJT A;  3NTA A;  1DXL A;  1B4V A;  1HYU A;  2Y6Q A;  3LOV A;  1GOS A;  3GRT A;  1Y56 A;  4YKF A;  3P9U A;  1TDE A;  3EF6 A;  5J60 A;  3NK0 X;  4USQ A;  3V76 A;  4EIQ A;  4ECH A;  2BAC A;  1KSS A;  3KPK A;  4U8I A;  4Z2R A;  3NG7 X;  4AP3 A;  2Z5Y A;  4U2T A;  2E5V A;  1FEA A;  2YR6 A;  3AYI A;  3IC9 A;  4CY8 A;  3K30 A;  4B67 A;  3T0K A;  3F8R A;  4USR A;  4B64 A;  2GH5 A;  4C5O A;  1M64 A;  2JAE A;  4DSH A;  5EB5 A;  4IVM B;  4JQ9 A;  1PBF A;  2H89 A;  1ZKQ A;  3DA1 A;  2OA1 A;  3O0H A;  4AT0 A;  4ZN0 A;  5HXI A;  4A99 A;  4DSG A;  3FMW A;  1TDK A;  1KSU A;  3UOX A;  1Q9I A;  4I59 A;  2YG3 A;  3CNP A;  3IWA A;  4GDP A;  1VRQ B;  3G5S A;  1FEC A;  4EM3 A;  5FMH A;  3SZW A;  3AYJ A;  1CC2 A;  4CNK A;  5IQ4 A;  1GER A;  1IUV A;  2AAQ A;  2ZBW A;  1OJC A;  4WCT A;  2GQW A;  2EQ9 A;  1KNR A;  3GSI A;  3K7M X;  1F8W A;  4M52 A;  3EPT A;  2QA1 A;  1BGN A;  5KVI A;  1YY5 A;  2C3D A;  1GES A;  5M0Z A;  5KVH A;  1O95 A;  2X8H A;  1M6I A;  5KXJ A;  4Z24 A;  2F5Z A;  1EL9 A;  1BZL A;  3FBS A;  2GR1 A;  4TLX A;  1TYT A;  5GSN A;  3AE3 A;  1Y0P A;  3CGB A;  3UTF A;  3T31 A;  5IQ1 A;  4NTD A;  1BGJ A;  4EQS A;  2CDU A;  4Y4N A;  1XAN A;  4H2R A;  3V3N A;  3RHA A;  1ZP0 A;  3UKL A;  3DJJ A;  1DOD A;  1IJH A;  1E7P A;  3UKF A;  5BRT A;  3QSM A;  1Q1W A;  2GR2 A;  3NH3 X;  4K2X A;  3UTG A;  1D5T A;  4H4Y A;  4ICY A;  4LU6 A;  3AE1 A;  1IUT A;  4NNJ A;  1N4U A;  2RGH A;  4U8O A;  1GRG A;  1N1P A;  3HYW A;  3KVE A;  3QFB A;  3EAN A;  4BK3 A;  1CJ4 A;  3DK4 A;  4OPT A;  1CC4 A;  2GQF A;  4K22 A;  3IHG A;  1TRB A;  2XDO A;  1GEU A;  2XVE A;  3VQR A;  3NRN A;  2QAE A;  3JSK A;  4H4T A;  2WOV A;  5L46 A;  3FPZ A;  4Z43 A;  2WPE A;  3UOY A;  3RP7 A;  1TDF A;  3H8L A;  2B9W A;  3DJD A;  4O5U A;  1MXT A;  1PJ7 A;  4BK1 A;  4K8D A;  1REO A;  3VRD B;  4OPD A;  4APN A;  2OAM A;  1NHR A;  1RYI A;  3RNM A;  2VRM A;  1JRY A;  3ALJ A;  2NPX A;  2YLT A;  2V5Z A;  2ACZ A;  2JK6 A;  2Q7V A;  3P4P A;  4X9M A;  5DBJ A;  2A89 A;  4CCQ A;  3NYE A;  1MO9 A;  1H84 A;  4BK2 A;  1B37 A;  3ICT A;  2E1M A;  3CN8 A;  4GUV A;  1PXC A;  2UZZ A;  4IA5 A;  1AOG A;  3E1T A;  2FJE A;  2YLW A;  3GRS A;  4K5S A;  5TR3 A;  3QSS A;  3D8X A;  4B1B A;  3F8D A;  3SZC A;  1GRB A;  1ZOV A;  2GR3 A;  3ZYX A;  4NWZ A;  5U25 A;  4H2N A;  3C4N A;  1OJA A;  1H83 A;  3SFD A;  2YM2 A;  1GV4 A;  4GRT A;  2PHH A;  2AR8 A;  1E1M A;  4BJY A;  4CRT A;  3P1W A;  1CF3 A;  3ATQ A;  2WEU A;  4G74 A;  3QFA A;  3ICR A;  4JNA A;  2XLP A;  3KA7 A;  1PDH A;  5HHF A;  3AXB A;  1PS9 A;  2O9Z A;  3NT6 A;  4G73 A;  2ZZC A;  3CTY A;  1JEH A;  3NHO X;  1MOK A;  2RGO A;  2VVL A;  3SGL A;  2GEW A;  4D03 A;  5KMR A;  2XVJ A;  5EOW A;  4NTE A;  4B69 A;  1LV0 A;  2YAU A;  1DJN A;  4IA6 A;  4JY2 A;  1ZMC A;  2VRL A;  3UTE A;  4UP3 A;  4GF7 A;  4PAB A;  5JCM A;  1O5W A;  4C3Y A;  4PAA A;  2Q6U A;  3B3R A;  4XWR A;  1RSG A;  4U8L A;  3T14 A;  4OPG A;  2H88 A;  1TYP A;  2X50 A;  2WDV A;  5KRQ A;  2C67 A;  1EL5 A;  4RG4 A;  2FJD A;  2YG6 A;  4B66 A;  1TDO A;  2VVM A;  3AEG A;  4II3 A;  4U2L A;  5BUK A;  3Q6J A;  3RP6 A;  2YVG A;  2YQU A;  2AQJ A;  2EQ6 A;  1D4C A;  1GRH A;  2GMJ A;  4RG3 A;  1DOB A;  4YSZ A;  3AED A;  2GV8 A;  4EMJ A;  2XVH A;  2XFP A;  1YQ4 A;  2GMH A;  3VRB A;  1DNC A;  3ALM A;  1DJQ A;  5BVA A;  3CND A;  4GDE A;  3AE8 A;  4H2P A;  4H4W A;  3I3L A;  3AEA A;  4AOX A;  2WET A;  3ALL A;  2YR4 A;  4OCG A;  4TM0 A;  1EBD A;  2DKH A;  1QO8 A;  3PO7 A;  3NK1 X;  1IUX A;  3KPF A;  2R9Z A;  5KMS A;  2BK4 A;  3AE6 A;  1Y56 B;  4J56 A;  3BHF A;  4RSL A;  2XYO A;  1NHQ A;  2C4C A;  3Q9T A;  3P4Q A;  4H4R A;  3CNS A;  1NEN A;  1BWC A;  2WBA A;  2WES A;  3II4 A;  1K4Q A;  2Q0L A;  4J34 A;  2YG4 A;  4JY3 A;  4OPI A;  3SM8 A;  4E0V A;  2XFN A;  1V59 A;  4H4U A;  3GDN A;  3AB1 A;  1GRF A;  3LXD A;  1F8R A;  1LJ1 A;  2YLS A;  2YG7 A;  1P2E A;  2BYB A;  2XFQ A;  2YVF A;  5JCI A;  1JU2 A;  5M10 A;  2C64 A;  3ICS A;  1GAL A;  3DJE A;  1CL0 A;  1X31 B;  2E4G A;  2BC0 A;  2X3N A;  3GYJ A;  5C3J A;  4X4J A;  4YXD A;  1DOC A;  4CBQ A;  2WQY A;  1P2H A;  2CUL A;  2BRA A;  5EB4 A;  4H7U A;  3GYX A;  3UTH A;  3AE4 A;  3KKJ A;  3GMB A;  3KU9 A;  1NEK A;  4YWO A;  2X8C A;  4HA6 A;  2JB3 A;  2GB0 A;  1PN0 A;  2VQB A;  3AEE A;  5FS9 A;  2OLO A;  2V6O A;  2X99 A;  1K0I A;  3CPJ G;  4U2S A;  4C77 A;  2C66 A;  1JRZ A;  1ELI A;  2WPC A;  3AE2 A;  3GYI A;  3IHM A;  2VOU A;  4EMI A;  2ARD A;  3SX6 A;  2WU2 A;  3NN0 X;  2R0G A;  2WHD A;  2CVJ A;  3CGD A;  3D1C A;  3T2K A;  2JKC A;  1N4W A;  1K0J A;  1SEZ A;  3AD9 B;  1TDN A;  2B9Y A;  2I0Z A;  3G5Q A;  2BXS A;  4P9S A;  2XFO A;  2X8G A;  1S3E A;  3AEF A;  1ONF A;  1OJ9 A;  3RP8 A;  3EAO A;  4K7Z A;  1VG0 A;  3NYF A;  2TPR A;  4U8J A;  5U1O A;  2YR5 A;  1Z6L A;  3DGZ A;  3NLC A;  4ADW A;  2IVD A;  1QJD A;  1GTH A;  2V60 A;  2FJA A;  4GAV A;  4B63 A;  3SQP A;  2VZ2 A;  2YLR A;  3SZ0 A;  4YSX A;  4GCM A;  1IUW A;  2C7G A;  4TLZ A;  4UDP A;  4YT0 A;  3AYL A;  2APG A;  3CMM A;  4FK1 C;  1CJ2 A;  1CHU A;  1VDC A;  3H4K A;  4H4X A;  1GTE A;  4XWZ A;  2BS3 A;  3AE9 A;  3VRA A;  3GWD A;  1D4E A;  3L1R A;  1O94 A;  3KLJ A;  3HYX A;  4EQR A;  3V3O A;  2GF3 A;  4II2 A;  4FX9 A;  1Q1R A;  3GD3 A;  4A65 A;  2QCU A;  3QJ4 A;  4KX6 A;  2GAH B;  4A6N B;  4H4Z A;  1YQZ A;  4D04 A;  1F3P A;  1E39 A;  3DH9 A;  3SZF A;  3S61 A;  4J2W A;  1NPX A;  4YTP A;  5GRT A;  3C4A A;  1B8S A;  3AE5 A;  2B9X A;  4Z2U A;  2WP9 A;  3OZ2 A;  5FS7 A;  3K7T A;  4NZH A;  3UKH A;  1H86 A;  1E1N A;  1UKV G;  1KF6 A;  1LQT A;  2BRY A;  1E1L A;  3CGE A;  4IV9 A;  4C74 A;  2C76 A;  1S2Q A;  4Y4L A;  4YTM A;  3S5W A;  4B65 A;  3H8I A;  4WX1 A;  2YLZ A;  4BUR A;  4H2Q A;  1ZY8 A;  2XLR A;  4TM1 A;  1GRA A;  1PBB A;  3NIX A;  1GND A;  4MJW A;  3SXI A;  2Y6R A;  2BCP A;  4K5R A;  3G5R A;  5BUL A;  2W0H A;  2PYX A;  2BA9 A;  2BCG G;  2EQ8 A;  3P4R A;  4CCR A;  1PXA A;  2BK3 A;  3WE0 A;  1CJ3 A;  4JDR A;  4UDQ A;  4C3X A;  4EM4 A;  1H7W A;  2XCG A;  1N4V A;  3BNU A;  2R46 A;  5KNL A;  4DNA A;  4A7A A;  5HY5 A;  2B7R A;  2JBV A;  1F8S A;  4BJZ A;  1S2Y A;  4GAP A;  2WDR A;  2BAB A;  3NN6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...