5BULA

Structure of flavin-dependent brominase bmp2 triple mutant y302s f306v a345w
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
397
structure length
392
Chain Sequence
HYDVVIIGSGPAGSLCGIECRKKGLSVLCIEKEQFPRFHIGESLTGNAGQIIRDLGLAEDMDAAGFPDKPGVNVIGSLSKNEFFIPILAPTWQVRRSDFDDMIKRKAVEHGVEYKLGMVTDVIKDGEKVVGALYKADGVEHQVRSKVLVDASGQNTFLSRKGVAGKRQIEFFSQQIASFAHYKGVERDLPPFSTNTTILYSKQYHWSWIIPISPDTDSLGVVIPKDLYYKECNPDDAIAWGMDHISPELKRRFKNAERQGDSQSMADFSYRIEPFVGDGWMCIGDAHRFLDPIFSSGVSVAMKEGIRAAEAIAQVVAGQDWKAPFYAYRDWSNGGQQIWADLIRYFWIYPIFFGYQMQNPRDEVIRLLGGCCFDGWKAPAIFRNAIEEYDRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords flavin-dependent halogenase triple mutant
publication title Biosynthesis of coral settlement cue tetrabromopyrrole in marine bacteria by a uniquely adapted brominase-thioesterase enzyme pair.
pubmed doi rcsb
source organism Streptomyces
molecule tags Hydrolase
total genus 140
structure length 392
sequence length 397
ec nomenclature
pdb deposition date 2015-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04820 Trp_halogenase Tryptophan halogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5bulA00
1B4VA 2BK4A 2EQ7A 3KD9A 1EL8A 1ZKQA 1VDCA 3AECA 3E1TA 3K7MX 4J33A 3UKPA 4D03A 3QJ4A 3FMWA 1DOCA 3AXBA 2R0GA 1BGNA 4UDQA 4C74A 4XXGA 3VR9A 5FS7A 4H4VA 2YR4A 5BUKA 3ZDNA 3BHFA 2NPXA 2R45A 3CTYA 4EMWA 3I6DA 2TPRA 3JSKA 3GWFA 2GV8A 2YR6A 2Z5XA 5L46A 3ALJA 1LQTA 1VG9A 4OPTA 2GMJA 1YQ3A 3DH9A 1NENA 1S2QA 4RG4A 2WPCA 4C5OA 4ZCDA 1KDGA 2OAMA 3GD3A 1PJ5A 2C7GA 1ZOYA 3KA7A 4UDRA 5HY5A 4GF7A 3CNPA 4JNQA 1F3PA 1DJNA 3DJJA 4RSLA 1GRGA 3AYJA 1CJ4A 1NG4A 3BI5A 3GMBA 4ECHA 4U8MA 3H4KA 2YAUA 5JCNA 1Y56A 2GVCA 1PDHA 2X8HA 1S3EA 1IUTA 1SEZA 3ADAB 2GR2A 3UP5A 1XHCA 2XVHA 4K5SA 2R0CA 3GSIA 5J60A 3L8KA 2GQWA 2VVLA 1JU2A 5HYMA 2Q6UA 1L9DA 3AE4A 4JQ9A 3NN0X 2GQFA 1L9CA 3CPIG 4H50A 1BF3A 2C70A 2V6OA 2RGHA 3QSSA 4LA1A 3PS9A 2F5ZA 3UOXA 4JDRA 3H8IA 2FJAA 2C76A 1Q1RA 1OJDA 2C75A 3NIXA 2XLUA 2YVGA 2XLRA 3ALLA 3DK4A 1GRHA 1RSGA 4GUVA 1B37A 3QFBA 3L1RA 1MXTA 2CULA 4O5UA 3KPFA 4OPDA 4NTCA 1N1PA 2WOVA 2BA9A 3G5RA 1RP0A 3GYIA 4CRTA 2JKCA 4PABA 2O9ZA 3GD4A 3KVEA 2BC0A 2WDRA 2B9XA 1CBOA 2BXSA 4J56A 1ELIA 1GESA 3C4AA 3KLJA 1GRBA 2X8CA 1BWCA 1JEHA 3NRNA 1D4EA 1TDKA 1O5WA 2WOIA 3NYFA 2Q7VA 1IUVA 3VQRA 1NHQA 3LOVA 1Z6LA 4CNKA 3M0OA 1LQUA 4RG3A 2JB3A 4CY6A 5EB5A 2XVIA 2JB2A 5HHFA 1H81A 3RHAA 5M10A 3QVRA 2XFPA 1PBFA 3NK0X 4AOXA 4DGKA 3C4NA 4OVIA 3URHA 2Q0KA 3GDPA 4A5LA 2R4EA 2XFQA 4TM1A 2YG4A 3ICRA 3QVPA 1FL2A 3CPHG 4H4SA 4PAAA 1CC6A 2XVJA 4U8JA 2BC1A 3DGZA 4YSHA 4BK2A 3REDA 3F8PA 4ZN0A 5KWFA 3UKKA 4H4TA 1CJ2A 3B6DA 4K5RA 2H89A 2WOWA 1GV4A 4OPUA 3M12A 3AEAA 3RP7A 5EOWA 1AOGA 1K0IA 2YLWA 4TLZA 5IQ4A 2GAHB 2A87A 4LIIA 4XWZA 2WPFA 2E5VA 4C3XA 2B7SA 3CGBA 3G5SA 4B68A 1XDIA 5GRTA 3UTEA 1KSUA 4U8KA 4J34A 2WBAA 5JCKA 3ITJA 4NEVA 3ATRA 4B63A 4KPRA 3CIRA 5FS9A 1F8WA 2TMDA 4NTEA 3SFDA 1Y56B 3UKLA 5JCIA 2NVKX 1ZK7A 3AE2A 1LPFA 3I3LA 4Y4LA 4AOSA 3AD9B 1IJHA 4H2RA 4J57A 2WP5A 2ZZBA 4OPLA 4EQXA 4J2WA 3CGCA 5BVAA 4YTPA 4Z43A 2VVLG 1H83A 2GMHA 4A99A 3SGLA 2GF3A 5ER0A 3SM8A 4Y4MA 3D8XA 3ICTA 1EL7A 1PBEA 2A8XA 3II4A 1GTHA 3AE3A 2YM1A 2DKIA 2GB0A 4O5QA 4IA5A 3GWDA 3GYJA 2FJEA 3BI4A 5IQ1A 1LTXR 2OALA 2EQ8A 3AYIA 3ZYXA 4B67A 4CCRA 4H2PA 1ZY8A 4BK1A 5IPYA 2WQYA 3BI2A 2YLXA 2JAEA 1LVLA 3BNMA 2WU5A 1ONFA 2IIDA 2E4GA 2R9ZA 4I59A 4CNJA 5TR3A 4BK3A 3AB1A 1Y0PA 3QFAA 1OJTA 1D7LA 3AEEA 4U8PA 2BACA 1E39A 2B9YA 3VRDB 1JRZA 1TYTA 1TDFA 1GRAA 3ISHA 3NYEA 4Z2UA 2B9WA 4Y4NA 1PXCA 1CL0A 4B69A 4DSGA 3FG2P 2JB1A 3CNDA 1CC4A 3DMEA 4I58A 1KFYA 2C73A 3NH3X 1CHUA 1DODA 4H4WA 1B8SA 3UP4A 1GNDA 2X3NA 1H7WA 4UDPA 4U8IA 1K0JA 3CN8A 1XANA 1GOSA 3UCLA 4EM4A 5KOXA 1ZP0A 4EMJA 3DJDA 2C65A 1BGJA 1NHPA 3NK2X 2VRMA 1FECA 3GRSA 4CBQA 5KRQA 1PJ7A 4NZHA 4ADWA 2R46A 2XFNA 5C2TA 3NN6X 1D4DA 2I0ZA 2W0HA 2QCUA 2YG7A 1F8SA 4OPIA 4AT2A 1TRBA 2GRTA 3CPJG 4Z2RA 4D04A 1H7XA 1TDOA 3SQPA 5BULA 4BJYA 3UTGA 1JNRA 1PHHA 2XYOA 3KKJA 3AD8B 1GEUA 2VZ2A 3R9UA 3IF9A 4H4UA 4J36A 2V60A 1TDNA 1IUWA 4B64A 4XWRA 1E1KA 3EAOA 1VRQB 2AQJA 5JCLA 1CJCA 4WCTA 4Z2TA 1GPEA 1NEKA 2EQ6A 1F6MA 4Z24A 1CF3A 3VRBA 3ABVA 1O94A 2C72A 2R0PA 1PJ6A 5EBKA 3BHKA 2BK3A 4C3YA 5JCMA 2A89A 4H7UA 2BYBA 3SFEA 1ZOVA 5CKUA 4EM3A 1GREA 1S3BA 4ZCCA 3AD7B 2WDQA 4YTNA 4Z25A 1F8RA 1X31B 2ACZA 1D7YA 4WX1A 4H4XA 1OJ9A 1GTEA 3NG7X 1K4QA 1LV0A 3UOZA 5KOWA 4AP1A 4GDEA 2V3AA 4YWOA 4J31A 3NYCA 2JBVA 2OA1A 2XFUA 4YSXA 4E0VA 1DXLA 2YG3A 1H82A 2XVEA 1PBBA 2FJBA 3LZWA 2VOUA 2VQ7A 2BXRA 3S61A 3LADA 2YVFA 3O0HA 3OC4A 1PN0A 2RGJA 2VRLA 1Q9IA 2YR5A 5HXIA 2WP9A 2AAQA 5EB4A 1CC2A 1PXBA 3AEGA 4X9NA 2VVMA 3EANA 5DBJA 4HB9A 1O95A 5C3JA 1REOA 4TM4A 3P4SA 5KVIA 1NDAA 4GCMA 4HA6A 3VRAA 2OLOA 4K8DA 5BRTA 3AEDA 1KSSA 1NHSA 1N4VA 3CGDA 3IWAA 4USQA 2Z5YA 1QO8A 4P9SA 4U8OA 4NEWA 3AE6A 2Q0LA 1NHRA 2Y6RA 3NNEA 4TM3A 2BK5A 3LB8A 4FK1C 1HYUA 1P2HA 4JN9A 2WDVA 4U8LA 4YT0A 1B5QA 1QJDA 2QAEA 1DJQA 4YSZA 3QSMA 4C77A 3GMCA 3AE1A 3C96A 3DJEA 2YLRA 3P4QA 4H4RA 4DNAA 3G5QA 4U8NA 5M0ZA 1GRTA 3RP8A 4B66A 2X8GA 3UKAA 4A65A 1H6VA 2ARDA 3DGHA 1QLBA 2XDOA 1YY5A 2BABA 2ZZCA 4IVOB 2YM2A 2JK6A 4USRA 2XFOA 2PYXA 2C66A 4K2XA 4A6NA 2Y6QA 1RYIA 2EQ9A 4JY3A 1GXFA 1NG3A 1PS9A 1S2YA 3AYLA 5FMHA 4CY8A 4APNA 3AEFA 4A79A 2H88A 3NT6A 3QSEA 2WETA 3EPTA 2J3NA 3AEBA 4K7ZA 4U2SA 2BCGG 2X50A 3Q6JA 1VQWA 4H2NA 3CGEA 2CVJA 1E6EA 1YQ4A 3NLCA 3NTDA 3V76A 2BS3A 2PHHA 1MOKA 4IV9A 1BKWA 4BJZA 4YSYA 3NGCX 1E1LA 4MJWA 3V3OA 4YXDA 3PVCA 1GT8A 3PO7A 4FDCB 2ZZ0A 3F8DA 4X9MA 3P4RA 2XLPA 3GRTA 3DJGX 3P9UA 1UKVG 4GRTA 4H4QA 3LJPA 4OPGA 1COYA 1PBCA 4TM0A 1EL5A 2E1MA 4EQSA 4U2LA 2FBWA 4YKFA 5KVHA 1TDEA 2RGOA 4IA6A 1JRXA 3NHOX 1FEAA 1ZX9A 4FK1A 3HZLA 1LJ1A 2IVDA 4B65A 3K7QX 4H2QA 2GR0A 3FPZA 4B1BA 4EMIA 2B76A 2CDUA 2V61A 2WPEA 1XPQA 3AE7A 3KU9A 1GSNA 2BCPA 1OJCA 3NK1X 3DK8A 1GALA 2IVEA 3COXA 4Z44A 3K30A 2FJDA 3CNSA 1EL9A 2HQMA 3V3NA 1L9EA 1PXAA 4GR1A 4X4JA 2BS4A 2YG5A 2C3CA 4YKGA 2WHDA 4NTDA 1P2EA 3DK9A 3NKSA 1GETA 3FIMB 4OPCA 3UKQA 3LZXA 3UKFA 3WE0A 4JNAA 1FOHA 2YWLA 4ICYA 1TYPA 1KNPA 1H84A 3UTFA 1E1NA 3K7TA 2XLTA 3UOYA 1KF6A 1KNRA 2RABA 2WS3A 3IHGA 4H4ZA 3UKHA 1N4UA 3IC9A 3S5WA 1D4CA 3AWIA 5FS8A 3CNJA 3ALMA 3OZ2A 3RP6A 2GEWA 1E1MA 1Q1WA 2YQUA 4BV6A 2APGA 4U2TA 5J7XA 4DSHA 2AR8A 4EQRA 5LV9A 5CQFA 1FCDA 3GDNA 2BS2A 3ATQA 2WU2A 1NAAA 1YKJA 1N4WA 2XCGA 4LU6A 3AE5A 2VQBA 3B3RA 1VG0A 4FX9A 3FBSA 4OCGA 1JNZA 1ZDLA 3NTAA 1JOAA 3DA1A 3UTHA 1JRYA 1IUUA 2WP6A 1MO9A 4H4YA 4A6NB 4AT0A 2QA2A 3CNTA 4A7AA 2GR1A 2XVFA 1PBDA 1H86A 3M13A 1M64A 5GSNA 4CCQA 1E7PA 2WEUA 3EF6A 3RNMA 3ICSA 2C3DA 4Z26A 1FEBA 2YLSA 4REKA 2YG6A 4UP3A 2ZBWA 1ZMDA 1GERA 3VR8A 1IUSA 3IHMA 1DNCA 3F8RA 4A9WA 5KXJA 1K0LA 1NPXA 1DOEA 1M6IA 2V3BA 1L0VA 4EIPA 4EIQA 5FS6A 1CJ3A 3D1CA 1EBDA 2YLTA 2C67A 4JY2A 2QA1A 4IVMB 1BZLA 5U25A 3T37A 2GR3A 4M52A 4KX6A 4EQWA 1OJAA 2GH5A 4YTMA 2UZZA 2V5ZA 2YVJA 2XLSA 2CFYA 3P1WA 3H8LA 2WESA 1YQZA 1GRFA 1IUXA 3Q9TA 2C64A 3P4PA 4K22A 2R4JA 1ZMCA 3BNUA 4H4PA 4AP3A 5U63A 4N9XA 3LXDA 4BURA 3UOVA 2GAGB 2B7RA 1D5TA 4GDPA 1DOBA 2DKHA 2OLNA 3AE8A 1W4XA 3AE9A 1V59A 2X99A 2YLZA 4TLXA 5U1OA
chains in the Genus database with same CATH superfamily
1B4VA 2BK4A 2EQ7A 3KD9A 1EL8A 1ZKQA 1VDCA 3AECA 3E1TA 3K7MX 4J33A 3UKPA 4D03A 3QJ4A 3FMWA 1DOCA 3AXBA 2R0GA 1BGNA 4UDQA 4C74A 4XXGA 3VR9A 5FS7A 4H4VA 2YR4A 5BUKA 3ZDNA 3BHFA 2NPXA 2R45A 3CTYA 4EMWA 3I6DA 2TPRA 3JSKA 3GWFA 2GV8A 2YR6A 2Z5XA 5L46A 3ALJA 1LQTA 1VG9A 4OPTA 2GMJA 1YQ3A 3DH9A 1NENA 1S2QA 4RG4A 2WPCA 4C5OA 4ZCDA 1KDGA 2OAMA 3GD3A 1PJ5A 2C7GA 1ZOYA 3KA7A 4UDRA 5HY5A 4GF7A 3CNPA 4JNQA 1F3PA 1DJNA 3DJJA 4RSLA 1GRGA 3AYJA 1CJ4A 1NG4A 3BI5A 3GMBA 4ECHA 4U8MA 3H4KA 2YAUA 5JCNA 1Y56A 2GVCA 1PDHA 2X8HA 1S3EA 1IUTA 1SEZA 3ADAB 2GR2A 3UP5A 1XHCA 2XVHA 4K5SA 2R0CA 3GSIA 5J60A 3L8KA 2GQWA 2VVLA 1JU2A 5HYMA 2Q6UA 1L9DA 3AE4A 4JQ9A 3NN0X 2GQFA 1L9CA 3CPIG 4H50A 1BF3A 2C70A 2V6OA 2RGHA 3QSSA 4LA1A 3PS9A 2F5ZA 3UOXA 4JDRA 3H8IA 2FJAA 2C76A 1Q1RA 1OJDA 2C75A 3NIXA 2XLUA 2YVGA 2XLRA 3ALLA 3DK4A 1GRHA 1RSGA 4GUVA 1B37A 3QFBA 3L1RA 1MXTA 2CULA 4O5UA 3KPFA 4OPDA 4NTCA 1N1PA 2WOVA 2BA9A 3G5RA 1RP0A 3GYIA 4CRTA 2JKCA 4PABA 2O9ZA 3GD4A 3KVEA 2BC0A 2WDRA 2B9XA 1CBOA 2BXSA 4J56A 1ELIA 1GESA 3C4AA 3KLJA 1GRBA 4G6HA 2X8CA 1BWCA 1JEHA 3NRNA 1D4EA 1TDKA 1O5WA 2WOIA 3NYFA 2Q7VA 1IUVA 3SZFA 3VQRA 1NHQA 3LOVA 1Z6LA 4CNKA 3M0OA 1LQUA 4RG3A 2JB3A 4CY6A 5EB5A 2XVIA 2JB2A 5HHFA 1H81A 3RHAA 5M10A 3QVRA 2XFPA 1PBFA 3NK0X 4AOXA 4DGKA 3C4NA 4OVIA 3URHA 2Q0KA 3GDPA 4A5LA 2R4EA 2XFQA 4TM1A 2YG4A 3ICRA 3QVPA 1FL2A 3CPHG 4H4SA 4PAAA 1CC6A 2XVJA 4U8JA 3T2YA 2BC1A 3DGZA 4YSHA 4BK2A 4G73A 3REDA 3F8PA 4ZN0A 5KWFA 3UKKA 4H4TA 1CJ2A 3B6DA 4K5RA 2H89A 2WOWA 1GV4A 4OPUA 3M12A 3AEAA 3RP7A 5EOWA 1AOGA 1K0IA 2YLWA 4TLZA 5IQ4A 2GAHB 2A87A 4LIIA 4XWZA 2WPFA 2E5VA 4C3XA 2B7SA 3CGBA 3G5SA 4B68A 1XDIA 5GRTA 3UTEA 1KSUA 4U8KA 4J34A 2WBAA 5JCKA 3ITJA 4NEVA 3ATRA 4B63A 4KPRA 3CIRA 5FS9A 1F8WA 2TMDA 4NTEA 3SFDA 1Y56B 3UKLA 5JCIA 2NVKX 1ZK7A 3AE2A 1LPFA 3I3LA 4Y4LA 4AOSA 3AD9B 1IJHA 4H2RA 4J57A 2WP5A 2ZZBA 4OPLA 4EQXA 4J2WA 3CGCA 5BVAA 4YTPA 3SZCA 4Z43A 2VVLG 1H83A 2GMHA 4A99A 3SGLA 2GF3A 5ER0A 3SM8A 4Y4MA 3D8XA 3ICTA 1EL7A 1PBEA 2A8XA 3II4A 1GTHA 3AE3A 2YM1A 2DKIA 2GB0A 4O5QA 4IA5A 3GWDA 3GYJA 2FJEA 3BI4A 5IQ1A 1LTXR 2OALA 2EQ8A 3AYIA 3ZYXA 4B67A 3T14A 4H2PA 1ZY8A 4BK1A 4CCRA 2WQYA 5IPYA 3BI2A 2YLXA 2JAEA 1LVLA 3BNMA 2WU5A 1ONFA 2IIDA 2E4GA 2R9ZA 4I59A 4NWZA 4CNJA 5TR3A 4BK3A 3AB1A 1Y0PA 3QFAA 1OJTA 1D7LA 3AEEA 4U8PA 2BACA 1E39A 2B9YA 3VRDB 1JRZA 1TYTA 1TDFA 1GRAA 3ISHA 3NYEA 3SY4A 4Z2UA 2B9WA 4Y4NA 1PXCA 1CL0A 4B69A 4DSGA 3FG2P 2JB1A 3CNDA 1CC4A 3DMEA 3HYWA 4I58A 1KFYA 2C73A 3NH3X 1CHUA 1DODA 4H4WA 1B8SA 3UP4A 1GNDA 3T0KA 2X3NA 1H7WA 4UDPA 4U8IA 1K0JA 3CN8A 1XANA 1GOSA 3UCLA 4EM4A 5KOXA 1ZP0A 4EMJA 3DJDA 2C65A 1BGJA 2BRAA 1NHPA 3NK2X 5KMRA 2VRMA 1FECA 3GRSA 4CBQA 5KRQA 1PJ7A 4NZHA 4ADWA 3SYIA 2R46A 3T2ZA 2XFNA 5C2TA 3NN6X 1D4DA 2I0ZA 2W0HA 2QCUA 2YG7A 1F8SA 4OPIA 4AT2A 1TRBA 2GRTA 3CPJG 4Z2RA 4D04A 1H7XA 1TDOA 3SQPA 5BULA 4BJYA 3UTGA 1JNRA 1PHHA 2XYOA 3KKJA 3AD8B 1GEUA 2VZ2A 3R9UA 3IF9A 4H4UA 4J36A 2V60A 1TDNA 5KMPA 1IUWA 4B64A 4XWRA 1E1KA 3EAOA 1VRQB 2AQJA 5JCLA 1CJCA 4WCTA 4Z2TA 1GPEA 1NEKA 2EQ6A 1F6MA 4Z24A 1CF3A 3VRBA 3ABVA 1O94A 2C72A 2R0PA 1PJ6A 5EBKA 3BHKA 2BK3A 4C3YA 5JCMA 2A89A 4H7UA 2BYBA 3SFEA 1ZOVA 5CKUA 4EM3A 1GREA 1S3BA 4ZCCA 3AD7B 2WDQA 4YTNA 4Z25A 1F8RA 1X31B 2ACZA 1D7YA 4WX1A 4H4XA 1OJ9A 1GTEA 3NG7X 1K4QA 1LV0A 3UOZA 5KOWA 3T2KA 4AP1A 4GDEA 2V3AA 4YWOA 4J31A 3NYCA 2JBVA 2OA1A 2XFUA 4YSXA 4E0VA 1DXLA 2YG3A 1H82A 2XVEA 1PBBA 2FJBA 3LZWA 2VOUA 2VQ7A 2BXRA 3S61A 3LADA 2YVFA 3O0HA 3OC4A 1PN0A 2RGJA 2VRLA 1Q9IA 2YR5A 5HXIA 2WP9A 2AAQA 5EB4A 1CC2A 1PXBA 3AEGA 4X9NA 2VVMA 3EANA 5DBJA 4HB9A 1O95A 5C3JA 1REOA 4TM4A 3P4SA 5KVIA 1NDAA 4GCMA 4HA6A 3VRAA 2OLOA 4K8DA 5BRTA 3AEDA 1KSSA 3KPKA 1NHSA 1N4VA 3CGDA 3IWAA 4USQA 2Z5YA 1QO8A 4P9SA 4U8OA 4NEWA 3AE6A 2Q0LA 1NHRA 2Y6RA 3NNEA 4TM3A 2BK5A 3LB8A 4FK1C 1HYUA 1P2HA 4JN9A 2WDVA 4U8LA 4YT0A 1B5QA 1QJDA 2QAEA 1DJQA 4YSZA 3QSMA 4C77A 3GMCA 3AE1A 3C96A 3DJEA 2YLRA 3P4QA 4H4RA 4DNAA 3G5QA 4U8NA 5M0ZA 1GRTA 3RP8A 4G6GA 2X8GA 4B66A 3UKAA 4A65A 1H6VA 2ARDA 3DGHA 1QLBA 2XDOA 1YY5A 2BABA 2ZZCA 4IVOB 2YM2A 5KMSA 2JK6A 4USRA 2XFOA 2PYXA 2C66A 4K2XA 4A6NA 2Y6QA 1RYIA 2EQ9A 4JY3A 1GXFA 1NG3A 1PS9A 1S2YA 3AYLA 5FMHA 4CY8A 4APNA 3AEFA 4A79A 2H88A 3NT6A 3QSEA 2WETA 5KMQA 3EPTA 2J3NA 3AEBA 4K7ZA 4U2SA 2BCGG 2X50A 3Q6JA 1VQWA 4H2NA 3CGEA 2CVJA 1E6EA 1YQ4A 3NLCA 3NTDA 3V76A 2BS3A 2PHHA 1MOKA 4IV9A 1BKWA 4BJZA 4YSYA 3NGCX 1E1LA 4MJWA 3V3OA 4YXDA 3PVCA 1GT8A 3PO7A 4FDCB 2ZZ0A 3F8DA 4X9MA 3P4RA 2XLPA 3GRTA 3DJGX 3P9UA 1UKVG 4GRTA 4H4QA 3LJPA 4OPGA 1COYA 1PBCA 4TM0A 1EL5A 2E1MA 4EQSA 4U2LA 2FBWA 4YKFA 4II2A 5KVHA 1TDEA 2RGOA 4IA6A 1JRXA 3NHOX 1FEAA 1ZX9A 4FK1A 3HZLA 1LJ1A 2IVDA 4B65A 3SZ0A 3K7QX 4H2QA 2GR0A 3FPZA 4B1BA 4EMIA 2B76A 2CDUA 2V61A 2WPEA 1XPQA 3AE7A 3KU9A 1GSNA 2BCPA 1OJCA 3NK1X 3DK8A 1GALA 5KNLA 2IVEA 3COXA 4Z44A 3K30A 2FJDA 3CNSA 1EL9A 2HQMA 3V3NA 1L9EA 1PXAA 4GR1A 4NNJA 4X4JA 2BS4A 2YG5A 2C3CA 4YKGA 2WHDA 4NTDA 1P2EA 3DK9A 3HYXA 3NKSA 1GETA 3FIMB 4OPCA 3UKQA 3LZXA 3UKFA 3WE0A 4JNAA 1FOHA 2YWLA 4ICYA 1TYPA 1KNPA 1H84A 3UTFA 1E1NA 3K7TA 2XLTA 3UOYA 1KF6A 1KNRA 2RABA 2WS3A 3IHGA 3HYVA 4H4ZA 1N4UA 3IC9A 3S5WA 3UKHA 1D4CA 3AWIA 5FS8A 3CNJA 3ALMA 3OZ2A 3RP6A 2GEWA 1E1MA 1Q1WA 2YQUA 4BV6A 2APGA 4U2TA 5J7XA 4DSHA 2AR8A 4EQRA 5LV9A 5CQFA 1FCDA 3GDNA 2BS2A 3ATQA 2WU2A 1NAAA 1YKJA 1N4WA 2XCGA 3GYXA 4LU6A 3AE5A 2VQBA 3B3RA 1VG0A 4FX9A 3FBSA 4OCGA 1JNZA 1ZDLA 3NTAA 1JOAA 3DA1A 3UTHA 1JRYA 1IUUA 2WP6A 1MO9A 4H4YA 4A6NB 4AT0A 2QA2A 3CNTA 4A7AA 2GR1A 2XVFA 4GAPA 2C4CA 1PBDA 1H86A 3M13A 1M64A 5GSNA 4CCQA 1E7PA 2WEUA 3EF6A 3RNMA 3ICSA 2C3DA 4Z26A 1FEBA 2YLSA 4REKA 2YG6A 4UP3A 2ZBWA 1ZMDA 4II3A 1GERA 3VR8A 4G74A 1IUSA 3IHMA 1DNCA 3F8RA 4A9WA 5KXJA 1K0LA 1NPXA 1DOEA 1M6IA 2V3BA 4G9KA 1L0VA 4EIPA 4EIQA 5FS6A 1CJ3A 3D1CA 1EBDA 2YLTA 2C67A 4JY2A 2QA1A 4IVMB 1BZLA 5U25A 3T37A 2GR3A 4M52A 4KX6A 4EQWA 1OJAA 2GH5A 4YTMA 2UZZA 2V5ZA 2YVJA 2XLSA 2CFYA 3P1WA 3H8LA 2BRYA 2WESA 1YQZA 3SXIA 1GRFA 1IUXA 3Q9TA 2C64A 3P4PA 4K22A 2R4JA 4GAVA 1ZMCA 3BNUA 4H4PA 4AP3A 3SX6A 5U63A 3SZWA 4N9XA 3LXDA 4BURA 3UOVA 2GAGB 2B7RA 3CMMA 1D5TA 4GDPA 1DOBA 2DKHA 2OLNA 3AE8A 1W4XA 3AE9A 1V59A 2X99A 2YLZA 3T31A 4TLXA 5U1OA
chains in the Genus database with same CATH topology
1B4VA 2BK4A 2EQ7A 3KD9A 1EL8A 1ZKQA 1VDCA 3AECA 3E1TA 3K7MX 4J33A 3UKPA 4D03A 3QJ4A 3FMWA 1DOCA 3AXBA 2R0GA 1BGNA 4UDQA 4C74A 4XXGA 3VR9A 5FS7A 4H4VA 2YR4A 5BUKA 3ZDNA 3BHFA 2NPXA 2R45A 3CTYA 4EMWA 3I6DA 2TPRA 3JSKA 3GWFA 2GV8A 2YR6A 2Z5XA 5L46A 3ALJA 1LQTA 1VG9A 4OPTA 2GMJA 1YQ3A 3DH9A 1NENA 1S2QA 4RG4A 2WPCA 4C5OA 4ZCDA 1KDGA 2OAMA 3GD3A 1PJ5A 2C7GA 1ZOYA 3KA7A 4UDRA 5HY5A 4GF7A 3CNPA 4JNQA 1F3PA 1DJNA 3DJJA 4RSLA 1GRGA 3AYJA 1CJ4A 1NG4A 3BI5A 3GMBA 4ECHA 4U8MA 3H4KA 2YAUA 5JCNA 1Y56A 2GVCA 1PDHA 2X8HA 1S3EA 1IUTA 1SEZA 3ADAB 2GR2A 3UP5A 1XHCA 2XVHA 4K5SA 2R0CA 3GSIA 5J60A 3L8KA 2GQWA 2VVLA 1JU2A 5HYMA 2Q6UA 1L9DA 3AE4A 4JQ9A 3NN0X 2GQFA 1L9CA 3CPIG 4H50A 1BF3A 2C70A 2V6OA 2RGHA 3QSSA 4LA1A 3PS9A 2F5ZA 3UOXA 4JDRA 3H8IA 2FJAA 2C76A 1Q1RA 1OJDA 2C75A 3NIXA 2XLUA 2YVGA 2XLRA 3ALLA 3DK4A 1GRHA 1RSGA 4GUVA 1B37A 3QFBA 3L1RA 1MXTA 2CULA 4O5UA 3KPFA 4OPDA 4NTCA 1N1PA 2WOVA 2BA9A 3G5RA 1RP0A 3GYIA 4CRTA 2JKCA 4PABA 2O9ZA 3GD4A 3KVEA 2BC0A 2WDRA 2B9XA 1CBOA 2BXSA 4J56A 1ELIA 1GESA 3C4AA 3KLJA 1GRBA 4G6HA 2X8CA 1BWCA 1JEHA 3NRNA 1D4EA 1TDKA 1O5WA 2WOIA 3NYFA 2Q7VA 1IUVA 3SZFA 3VQRA 1NHQA 3LOVA 1Z6LA 4CNKA 3M0OA 1LQUA 4RG3A 2JB3A 4CY6A 5EB5A 2XVIA 2JB2A 5HHFA 1H81A 3RHAA 5M10A 3QVRA 2XFPA 1PBFA 3NK0X 4AOXA 4DGKA 3C4NA 4OVIA 3URHA 2Q0KA 3GDPA 4A5LA 2R4EA 2XFQA 4TM1A 2YG4A 3ICRA 3QVPA 1FL2A 3CPHG 4H4SA 4PAAA 1CC6A 2XVJA 4U8JA 3T2YA 2BC1A 3DGZA 4YSHA 4BK2A 4G73A 3REDA 3F8PA 4ZN0A 5KWFA 3UKKA 4H4TA 1CJ2A 3B6DA 4K5RA 2H89A 2WOWA 1GV4A 4OPUA 3M12A 3AEAA 3RP7A 5EOWA 1AOGA 1K0IA 2YLWA 4TLZA 5IQ4A 2GAHB 2A87A 4LIIA 4XWZA 2WPFA 2E5VA 4C3XA 2B7SA 3CGBA 3G5SA 4B68A 1XDIA 5GRTA 3UTEA 1KSUA 4U8KA 4J34A 2WBAA 5JCKA 3ITJA 4NEVA 3ATRA 4B63A 4KPRA 3CIRA 5FS9A 1F8WA 2TMDA 4NTEA 3SFDA 1Y56B 3UKLA 5JCIA 2NVKX 1ZK7A 3AE2A 1LPFA 3I3LA 4Y4LA 4AOSA 3AD9B 1IJHA 4H2RA 4J57A 2WP5A 2ZZBA 4OPLA 4EQXA 4J2WA 3CGCA 5BVAA 4YTPA 3SZCA 4Z43A 2VVLG 1H83A 2GMHA 4A99A 3SGLA 2GF3A 5ER0A 3SM8A 4Y4MA 3D8XA 3ICTA 1EL7A 1PBEA 2A8XA 3II4A 1GTHA 3AE3A 2YM1A 2DKIA 2GB0A 4O5QA 4IA5A 3GWDA 3GYJA 2FJEA 3BI4A 5IQ1A 1LTXR 2OALA 2EQ8A 3AYIA 3ZYXA 4B67A 3T14A 4H2PA 1ZY8A 4BK1A 4CCRA 2WQYA 5IPYA 3BI2A 2YLXA 2JAEA 1LVLA 3BNMA 2WU5A 1ONFA 2IIDA 2E4GA 2R9ZA 4I59A 4NWZA 4CNJA 5TR3A 4BK3A 3AB1A 1Y0PA 3QFAA 1OJTA 1D7LA 3AEEA 4U8PA 2BACA 1E39A 2B9YA 3VRDB 1JRZA 1TYTA 1TDFA 1GRAA 3ISHA 3NYEA 3SY4A 4Z2UA 2B9WA 4Y4NA 1PXCA 1CL0A 4B69A 4DSGA 3FG2P 2JB1A 3CNDA 1CC4A 3DMEA 3HYWA 4I58A 1KFYA 2C73A 3NH3X 1CHUA 1DODA 4H4WA 1B8SA 3UP4A 1GNDA 3T0KA 2X3NA 1H7WA 4UDPA 4U8IA 1K0JA 3CN8A 1XANA 1GOSA 3UCLA 4EM4A 5KOXA 1ZP0A 4EMJA 3DJDA 2C65A 1BGJA 2BRAA 1NHPA 3NK2X 5KMRA 2VRMA 1FECA 3GRSA 4CBQA 5KRQA 1PJ7A 4NZHA 4ADWA 3SYIA 2R46A 3T2ZA 2XFNA 5C2TA 3NN6X 1D4DA 2I0ZA 2W0HA 2QCUA 2YG7A 1F8SA 4OPIA 4AT2A 1TRBA 2GRTA 3CPJG 4Z2RA 4D04A 1H7XA 1TDOA 3SQPA 5BULA 4BJYA 3UTGA 1JNRA 1PHHA 2XYOA 3KKJA 3AD8B 1GEUA 2VZ2A 3R9UA 3IF9A 4H4UA 4J36A 2V60A 1TDNA 5KMPA 1IUWA 4B64A 4XWRA 1E1KA 3EAOA 1VRQB 2AQJA 5JCLA 1CJCA 4WCTA 4Z2TA 1GPEA 1NEKA 2EQ6A 1F6MA 4Z24A 1CF3A 3VRBA 3ABVA 1O94A 2C72A 2R0PA 1PJ6A 5EBKA 3BHKA 2BK3A 4C3YA 5JCMA 2A89A 4H7UA 2BYBA 3SFEA 1ZOVA 5CKUA 4EM3A 1GREA 1S3BA 4ZCCA 3AD7B 2WDQA 4YTNA 4Z25A 1F8RA 1X31B 2ACZA 1D7YA 4WX1A 4H4XA 1OJ9A 1GTEA 3NG7X 1K4QA 1LV0A 3UOZA 5KOWA 3T2KA 4AP1A 4GDEA 2V3AA 4YWOA 4J31A 3NYCA 2JBVA 2OA1A 2XFUA 4YSXA 4E0VA 1DXLA 2YG3A 1H82A 2XVEA 1PBBA 2FJBA 3LZWA 2VOUA 2VQ7A 2BXRA 3S61A 3LADA 2YVFA 3O0HA 3OC4A 1PN0A 2RGJA 2VRLA 1Q9IA 2YR5A 5HXIA 2WP9A 2AAQA 5EB4A 1CC2A 1PXBA 3AEGA 4X9NA 2VVMA 3EANA 5DBJA 4HB9A 1O95A 5C3JA 1REOA 4TM4A 3P4SA 5KVIA 1NDAA 4GCMA 4HA6A 3VRAA 2OLOA 4K8DA 5BRTA 3AEDA 1KSSA 3KPKA 1NHSA 1N4VA 3CGDA 3IWAA 4USQA 2Z5YA 1QO8A 4P9SA 4U8OA 4NEWA 3AE6A 2Q0LA 1NHRA 2Y6RA 3NNEA 4TM3A 2BK5A 3LB8A 4FK1C 1HYUA 1P2HA 4JN9A 2WDVA 4U8LA 4YT0A 1B5QA 1QJDA 2QAEA 1DJQA 4YSZA 3QSMA 4C77A 3GMCA 3AE1A 3C96A 3DJEA 2YLRA 3P4QA 4H4RA 4DNAA 3G5QA 4U8NA 5M0ZA 1GRTA 3RP8A 4G6GA 2X8GA 4B66A 3UKAA 4A65A 1H6VA 2ARDA 3DGHA 1QLBA 2XDOA 1YY5A 2BABA 2ZZCA 4IVOB 2YM2A 5KMSA 2JK6A 4USRA 2XFOA 2PYXA 2C66A 4K2XA 4A6NA 2Y6QA 1RYIA 2EQ9A 4JY3A 1GXFA 1NG3A 1PS9A 1S2YA 3AYLA 5FMHA 4CY8A 4APNA 3AEFA 4A79A 2H88A 3NT6A 3QSEA 2WETA 5KMQA 3EPTA 2J3NA 3AEBA 4K7ZA 4U2SA 2BCGG 2X50A 3Q6JA 1VQWA 4H2NA 3CGEA 2CVJA 1E6EA 1YQ4A 3NLCA 3NTDA 3V76A 2BS3A 2PHHA 1MOKA 4IV9A 1BKWA 4BJZA 4YSYA 3NGCX 1E1LA 4MJWA 3V3OA 4YXDA 3PVCA 1GT8A 3PO7A 4FDCB 2ZZ0A 3F8DA 4X9MA 3P4RA 2XLPA 3GRTA 3DJGX 3P9UA 1UKVG 4GRTA 4H4QA 3LJPA 4OPGA 1COYA 1PBCA 4TM0A 1EL5A 2E1MA 4EQSA 4U2LA 2FBWA 4YKFA 4II2A 5KVHA 1TDEA 2RGOA 4IA6A 1JRXA 3NHOX 1FEAA 1ZX9A 4FK1A 3HZLA 1LJ1A 2IVDA 4B65A 3SZ0A 3K7QX 4H2QA 2GR0A 3FPZA 4B1BA 4EMIA 2B76A 2CDUA 2V61A 2WPEA 1XPQA 3AE7A 3KU9A 1GSNA 2BCPA 1OJCA 3NK1X 3DK8A 1GALA 5KNLA 2IVEA 3COXA 4Z44A 3K30A 2FJDA 3CNSA 1EL9A 2HQMA 3V3NA 1L9EA 1PXAA 4GR1A 4NNJA 4X4JA 2BS4A 2YG5A 2C3CA 4YKGA 2WHDA 4NTDA 1P2EA 3DK9A 3HYXA 3NKSA 1GETA 3FIMB 4OPCA 3UKQA 3LZXA 3UKFA 3WE0A 4JNAA 1FOHA 2YWLA 4ICYA 1TYPA 1KNPA 1H84A 3UTFA 1E1NA 3K7TA 2XLTA 3UOYA 1KF6A 1KNRA 2RABA 2WS3A 3IHGA 3HYVA 4H4ZA 1N4UA 3IC9A 3S5WA 3UKHA 1D4CA 3AWIA 5FS8A 3CNJA 3ALMA 3OZ2A 3RP6A 2GEWA 1E1MA 1Q1WA 2YQUA 4BV6A 2APGA 4U2TA 5J7XA 4DSHA 2AR8A 4EQRA 5LV9A 5CQFA 1FCDA 3GDNA 2BS2A 3ATQA 2WU2A 1NAAA 1YKJA 1N4WA 2XCGA 3GYXA 4LU6A 3AE5A 2VQBA 3B3RA 1VG0A 4FX9A 3FBSA 4OCGA 1JNZA 1ZDLA 3NTAA 1JOAA 3DA1A 3UTHA 1JRYA 1IUUA 2WP6A 1MO9A 4H4YA 4A6NB 4AT0A 2QA2A 3CNTA 4A7AA 2GR1A 2XVFA 4GAPA 2C4CA 1PBDA 1H86A 3M13A 1M64A 5GSNA 4CCQA 1E7PA 2WEUA 3EF6A 3RNMA 3ICSA 2C3DA 4Z26A 1FEBA 2YLSA 4REKA 2YG6A 4UP3A 2ZBWA 1ZMDA 4II3A 1GERA 3VR8A 4G74A 1IUSA 3IHMA 1DNCA 3F8RA 4A9WA 5KXJA 1K0LA 1NPXA 1DOEA 1M6IA 2V3BA 4G9KA 1L0VA 4EIPA 4EIQA 5FS6A 1CJ3A 3D1CA 1EBDA 2YLTA 2C67A 4JY2A 2QA1A 4IVMB 1BZLA 5U25A 3T37A 2GR3A 4M52A 4KX6A 4EQWA 1OJAA 2GH5A 4YTMA 2UZZA 2V5ZA 2YVJA 2XLSA 2CFYA 3P1WA 3H8LA 2BRYA 2WESA 1YQZA 3SXIA 1GRFA 1IUXA 3Q9TA 2C64A 3P4PA 4K22A 2R4JA 4GAVA 1ZMCA 3BNUA 4H4PA 4AP3A 3SX6A 5U63A 3SZWA 4N9XA 3LXDA 4BURA 3UOVA 2GAGB 2B7RA 3CMMA 1D5TA 4GDPA 1DOBA 2DKHA 2OLNA 3AE8A 1W4XA 3AE9A 1V59A 2X99A 2YLZA 3T31A 4TLXA 5U1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B4V A;  2BK4 A;  2EQ7 A;  3KD9 A;  1EL8 A;  1ZKQ A;  1VDC A;  3AEC A;  3E1T A;  3K7M X;  4J33 A;  3UKP A;  4D03 A;  3QJ4 A;  3FMW A;  1DOC A;  3AXB A;  2R0G A;  1BGN A;  4UDQ A;  4C74 A;  4XXG A;  3VR9 A;  5FS7 A;  4H4V A;  2YR4 A;  5BUK A;  3ZDN A;  3BHF A;  2NPX A;  2R45 A;  3CTY A;  4EMW A;  3I6D A;  2TPR A;  3JSK A;  3GWF A;  2GV8 A;  2YR6 A;  2Z5X A;  5L46 A;  3ALJ A;  1LQT A;  1VG9 A;  4OPT A;  2GMJ A;  1YQ3 A;  3DH9 A;  1NEN A;  1S2Q A;  4RG4 A;  2WPC A;  4C5O A;  4ZCD A;  1KDG A;  2OAM A;  3GD3 A;  1PJ5 A;  2C7G A;  1ZOY A;  3KA7 A;  4UDR A;  5HY5 A;  4GF7 A;  3CNP A;  4JNQ A;  1F3P A;  1DJN A;  3DJJ A;  4RSL A;  1GRG A;  3AYJ A;  1CJ4 A;  1NG4 A;  3BI5 A;  3GMB A;  4ECH A;  4U8M A;  3H4K A;  2YAU A;  5JCN A;  1Y56 A;  2GVC A;  1PDH A;  2X8H A;  1S3E A;  1IUT A;  1SEZ A;  3ADA B;  2GR2 A;  3UP5 A;  1XHC A;  2XVH A;  4K5S A;  2R0C A;  3GSI A;  5J60 A;  3L8K A;  2GQW A;  2VVL A;  1JU2 A;  5HYM A;  2Q6U A;  1L9D A;  3AE4 A;  4JQ9 A;  3NN0 X;  2GQF A;  1L9C A;  3CPI G;  4H50 A;  1BF3 A;  2C70 A;  2V6O A;  2RGH A;  3QSS A;  4LA1 A;  3PS9 A;  2F5Z A;  3UOX A;  4JDR A;  3H8I A;  2FJA A;  2C76 A;  1Q1R A;  1OJD A;  2C75 A;  3NIX A;  2XLU A;  2YVG A;  2XLR A;  3ALL A;  3DK4 A;  1GRH A;  1RSG A;  4GUV A;  1B37 A;  3QFB A;  3L1R A;  1MXT A;  2CUL A;  4O5U A;  3KPF A;  4OPD A;  4NTC A;  1N1P A;  2WOV A;  2BA9 A;  3G5R A;  1RP0 A;  3GYI A;  4CRT A;  2JKC A;  4PAB A;  2O9Z A;  3GD4 A;  3KVE A;  2BC0 A;  2WDR A;  2B9X A;  1CBO A;  2BXS A;  4J56 A;  1ELI A;  1GES A;  3C4A A;  3KLJ A;  1GRB A;  2X8C A;  1BWC A;  1JEH A;  3NRN A;  1D4E A;  1TDK A;  1O5W A;  2WOI A;  3NYF A;  2Q7V A;  1IUV A;  3VQR A;  1NHQ A;  3LOV A;  1Z6L A;  4CNK A;  3M0O A;  1LQU A;  4RG3 A;  2JB3 A;  4CY6 A;  5EB5 A;  2XVI A;  2JB2 A;  5HHF A;  1H81 A;  3RHA A;  5M10 A;  3QVR A;  2XFP A;  1PBF A;  3NK0 X;  4AOX A;  4DGK A;  3C4N A;  4OVI A;  3URH A;  2Q0K A;  3GDP A;  4A5L A;  2R4E A;  2XFQ A;  4TM1 A;  2YG4 A;  3ICR A;  3QVP A;  1FL2 A;  3CPH G;  4H4S A;  4PAA A;  1CC6 A;  2XVJ A;  4U8J A;  2BC1 A;  3DGZ A;  4YSH A;  4BK2 A;  3RED A;  3F8P A;  4ZN0 A;  5KWF A;  3UKK A;  4H4T A;  1CJ2 A;  3B6D A;  4K5R A;  2H89 A;  2WOW A;  1GV4 A;  4OPU A;  3M12 A;  3AEA A;  3RP7 A;  5EOW A;  1AOG A;  1K0I A;  2YLW A;  4TLZ A;  5IQ4 A;  2GAH B;  2A87 A;  4LII A;  4XWZ A;  2WPF A;  2E5V A;  4C3X A;  2B7S A;  3CGB A;  3G5S A;  4B68 A;  1XDI A;  5GRT A;  3UTE A;  1KSU A;  4U8K A;  4J34 A;  2WBA A;  5JCK A;  3ITJ A;  4NEV A;  3ATR A;  4B63 A;  4KPR A;  3CIR A;  5FS9 A;  1F8W A;  2TMD A;  4NTE A;  3SFD A;  1Y56 B;  3UKL A;  5JCI A;  2NVK X;  1ZK7 A;  3AE2 A;  1LPF A;  3I3L A;  4Y4L A;  4AOS A;  3AD9 B;  1IJH A;  4H2R A;  4J57 A;  2WP5 A;  2ZZB A;  4OPL A;  4EQX A;  4J2W A;  3CGC A;  5BVA A;  4YTP A;  4Z43 A;  2VVL G;  1H83 A;  2GMH A;  4A99 A;  3SGL A;  2GF3 A;  5ER0 A;  3SM8 A;  4Y4M A;  3D8X A;  3ICT A;  1EL7 A;  1PBE A;  2A8X A;  3II4 A;  1GTH A;  3AE3 A;  2YM1 A;  2DKI A;  2GB0 A;  4O5Q A;  4IA5 A;  3GWD A;  3GYJ A;  2FJE A;  3BI4 A;  5IQ1 A;  1LTX R;  2OAL A;  2EQ8 A;  3AYI A;  3ZYX A;  4B67 A;  4CCR A;  4H2P A;  1ZY8 A;  4BK1 A;  5IPY A;  2WQY A;  3BI2 A;  2YLX A;  2JAE A;  1LVL A;  3BNM A;  2WU5 A;  1ONF A;  2IID A;  2E4G A;  2R9Z A;  4I59 A;  4CNJ A;  5TR3 A;  4BK3 A;  3AB1 A;  1Y0P A;  3QFA A;  1OJT A;  1D7L A;  3AEE A;  4U8P A;  2BAC A;  1E39 A;  2B9Y A;  3VRD B;  1JRZ A;  1TYT A;  1TDF A;  1GRA A;  3ISH A;  3NYE A;  4Z2U A;  2B9W A;  4Y4N A;  1PXC A;  1CL0 A;  4B69 A;  4DSG A;  3FG2 P;  2JB1 A;  3CND A;  1CC4 A;  3DME A;  4I58 A;  1KFY A;  2C73 A;  3NH3 X;  1CHU A;  1DOD A;  4H4W A;  1B8S A;  3UP4 A;  1GND A;  2X3N A;  1H7W A;  4UDP A;  4U8I A;  1K0J A;  3CN8 A;  1XAN A;  1GOS A;  3UCL A;  4EM4 A;  5KOX A;  1ZP0 A;  4EMJ A;  3DJD A;  2C65 A;  1BGJ A;  1NHP A;  3NK2 X;  2VRM A;  1FEC A;  3GRS A;  4CBQ A;  5KRQ A;  1PJ7 A;  4NZH A;  4ADW A;  2R46 A;  2XFN A;  5C2T A;  3NN6 X;  1D4D A;  2I0Z A;  2W0H A;  2QCU A;  2YG7 A;  1F8S A;  4OPI A;  4AT2 A;  1TRB A;  2GRT A;  3CPJ G;  4Z2R A;  4D04 A;  1H7X A;  1TDO A;  3SQP A;  5BUL A;  4BJY A;  3UTG A;  1JNR A;  1PHH A;  2XYO A;  3KKJ A;  3AD8 B;  1GEU A;  2VZ2 A;  3R9U A;  3IF9 A;  4H4U A;  4J36 A;  2V60 A;  1TDN A;  1IUW A;  4B64 A;  4XWR A;  1E1K A;  3EAO A;  1VRQ B;  2AQJ A;  5JCL A;  1CJC A;  4WCT A;  4Z2T A;  1GPE A;  1NEK A;  2EQ6 A;  1F6M A;  4Z24 A;  1CF3 A;  3VRB A;  3ABV A;  1O94 A;  2C72 A;  2R0P A;  1PJ6 A;  5EBK A;  3BHK A;  2BK3 A;  4C3Y A;  5JCM A;  2A89 A;  4H7U A;  2BYB A;  3SFE A;  1ZOV A;  5CKU A;  4EM3 A;  1GRE A;  1S3B A;  4ZCC A;  3AD7 B;  2WDQ A;  4YTN A;  4Z25 A;  1F8R A;  1X31 B;  2ACZ A;  1D7Y A;  4WX1 A;  4H4X A;  1OJ9 A;  1GTE A;  3NG7 X;  1K4Q A;  1LV0 A;  3UOZ A;  5KOW A;  4AP1 A;  4GDE A;  2V3A A;  4YWO A;  4J31 A;  3NYC A;  2JBV A;  2OA1 A;  2XFU A;  4YSX A;  4E0V A;  1DXL A;  2YG3 A;  1H82 A;  2XVE A;  1PBB A;  2FJB A;  3LZW A;  2VOU A;  2VQ7 A;  2BXR A;  3S61 A;  3LAD A;  2YVF A;  3O0H A;  3OC4 A;  1PN0 A;  2RGJ A;  2VRL A;  1Q9I A;  2YR5 A;  5HXI A;  2WP9 A;  2AAQ A;  5EB4 A;  1CC2 A;  1PXB A;  3AEG A;  4X9N A;  2VVM A;  3EAN A;  5DBJ A;  4HB9 A;  1O95 A;  5C3J A;  1REO A;  4TM4 A;  3P4S A;  5KVI A;  1NDA A;  4GCM A;  4HA6 A;  3VRA A;  2OLO A;  4K8D A;  5BRT A;  3AED A;  1KSS A;  1NHS A;  1N4V A;  3CGD A;  3IWA A;  4USQ A;  2Z5Y A;  1QO8 A;  4P9S A;  4U8O A;  4NEW A;  3AE6 A;  2Q0L A;  1NHR A;  2Y6R A;  3NNE A;  4TM3 A;  2BK5 A;  3LB8 A;  4FK1 C;  1HYU A;  1P2H A;  4JN9 A;  2WDV A;  4U8L A;  4YT0 A;  1B5Q A;  1QJD A;  2QAE A;  1DJQ A;  4YSZ A;  3QSM A;  4C77 A;  3GMC A;  3AE1 A;  3C96 A;  3DJE A;  2YLR A;  3P4Q A;  4H4R A;  4DNA A;  3G5Q A;  4U8N A;  5M0Z A;  1GRT A;  3RP8 A;  4B66 A;  2X8G A;  3UKA A;  4A65 A;  1H6V A;  2ARD A;  3DGH A;  1QLB A;  2XDO A;  1YY5 A;  2BAB A;  2ZZC A;  4IVO B;  2YM2 A;  2JK6 A;  4USR A;  2XFO A;  2PYX A;  2C66 A;  4K2X A;  4A6N A;  2Y6Q A;  1RYI A;  2EQ9 A;  4JY3 A;  1GXF A;  1NG3 A;  1PS9 A;  1S2Y A;  3AYL A;  5FMH A;  4CY8 A;  4APN A;  3AEF A;  4A79 A;  2H88 A;  3NT6 A;  3QSE A;  2WET A;  3EPT A;  2J3N A;  3AEB A;  4K7Z A;  4U2S A;  2BCG G;  2X50 A;  3Q6J A;  1VQW A;  4H2N A;  3CGE A;  2CVJ A;  1E6E A;  1YQ4 A;  3NLC A;  3NTD A;  3V76 A;  2BS3 A;  2PHH A;  1MOK A;  4IV9 A;  1BKW A;  4BJZ A;  4YSY A;  3NGC X;  1E1L A;  4MJW A;  3V3O A;  4YXD A;  3PVC A;  1GT8 A;  3PO7 A;  4FDC B;  2ZZ0 A;  3F8D A;  4X9M A;  3P4R A;  2XLP A;  3GRT A;  3DJG X;  3P9U A;  1UKV G;  4GRT A;  4H4Q A;  3LJP A;  4OPG A;  1COY A;  1PBC A;  4TM0 A;  1EL5 A;  2E1M A;  4EQS A;  4U2L A;  2FBW A;  4YKF A;  5KVH A;  1TDE A;  2RGO A;  4IA6 A;  1JRX A;  3NHO X;  1FEA A;  1ZX9 A;  4FK1 A;  3HZL A;  1LJ1 A;  2IVD A;  4B65 A;  3K7Q X;  4H2Q A;  2GR0 A;  3FPZ A;  4B1B A;  4EMI A;  2B76 A;  2CDU A;  2V61 A;  2WPE A;  1XPQ A;  3AE7 A;  3KU9 A;  1GSN A;  2BCP A;  1OJC A;  3NK1 X;  3DK8 A;  1GAL A;  2IVE A;  3COX A;  4Z44 A;  3K30 A;  2FJD A;  3CNS A;  1EL9 A;  2HQM A;  3V3N A;  1L9E A;  1PXA A;  4GR1 A;  4X4J A;  2BS4 A;  2YG5 A;  2C3C A;  4YKG A;  2WHD A;  4NTD A;  1P2E A;  3DK9 A;  3NKS A;  1GET A;  3FIM B;  4OPC A;  3UKQ A;  3LZX A;  3UKF A;  3WE0 A;  4JNA A;  1FOH A;  2YWL A;  4ICY A;  1TYP A;  1KNP A;  1H84 A;  3UTF A;  1E1N A;  3K7T A;  2XLT A;  3UOY A;  1KF6 A;  1KNR A;  2RAB A;  2WS3 A;  3IHG A;  4H4Z A;  3UKH A;  1N4U A;  3IC9 A;  3S5W A;  1D4C A;  3AWI A;  5FS8 A;  3CNJ A;  3ALM A;  3OZ2 A;  3RP6 A;  2GEW A;  1E1M A;  1Q1W A;  2YQU A;  4BV6 A;  2APG A;  4U2T A;  5J7X A;  4DSH A;  2AR8 A;  4EQR A;  5LV9 A;  5CQF A;  1FCD A;  3GDN A;  2BS2 A;  3ATQ A;  2WU2 A;  1NAA A;  1YKJ A;  1N4W A;  2XCG A;  4LU6 A;  3AE5 A;  2VQB A;  3B3R A;  1VG0 A;  4FX9 A;  3FBS A;  4OCG A;  1JNZ A;  1ZDL A;  3NTA A;  1JOA A;  3DA1 A;  3UTH A;  1JRY A;  1IUU A;  2WP6 A;  1MO9 A;  4H4Y A;  4A6N B;  4AT0 A;  2QA2 A;  3CNT A;  4A7A A;  2GR1 A;  2XVF A;  1PBD A;  1H86 A;  3M13 A;  1M64 A;  5GSN A;  4CCQ A;  1E7P A;  2WEU A;  3EF6 A;  3RNM A;  3ICS A;  2C3D A;  4Z26 A;  1FEB A;  2YLS A;  4REK A;  2YG6 A;  4UP3 A;  2ZBW A;  1ZMD A;  1GER A;  3VR8 A;  1IUS A;  3IHM A;  1DNC A;  3F8R A;  4A9W A;  5KXJ A;  1K0L A;  1NPX A;  1DOE A;  1M6I A;  2V3B A;  1L0V A;  4EIP A;  4EIQ A;  5FS6 A;  1CJ3 A;  3D1C A;  1EBD A;  2YLT A;  2C67 A;  4JY2 A;  2QA1 A;  4IVM B;  1BZL A;  5U25 A;  3T37 A;  2GR3 A;  4M52 A;  4KX6 A;  4EQW A;  1OJA A;  2GH5 A;  4YTM A;  2UZZ A;  2V5Z A;  2YVJ A;  2XLS A;  2CFY A;  3P1W A;  3H8L A;  2WES A;  1YQZ A;  1GRF A;  1IUX A;  3Q9T A;  2C64 A;  3P4P A;  4K22 A;  2R4J A;  1ZMC A;  3BNU A;  4H4P A;  4AP3 A;  5U63 A;  4N9X A;  3LXD A;  4BUR A;  3UOV A;  2GAG B;  2B7R A;  1D5T A;  4GDP A;  1DOB A;  2DKH A;  2OLN A;  3AE8 A;  1W4X A;  3AE9 A;  1V59 A;  2X99 A;  2YLZ A;  4TLX A;  5U1O A; 
#chains in the Genus database with same CATH topology
 1B4V A;  2BK4 A;  2EQ7 A;  3KD9 A;  1EL8 A;  1ZKQ A;  1VDC A;  3AEC A;  3E1T A;  3K7M X;  4J33 A;  3UKP A;  4D03 A;  3QJ4 A;  3FMW A;  1DOC A;  3AXB A;  2R0G A;  1BGN A;  4UDQ A;  4C74 A;  4XXG A;  3VR9 A;  5FS7 A;  4H4V A;  2YR4 A;  5BUK A;  3ZDN A;  3BHF A;  2NPX A;  2R45 A;  3CTY A;  4EMW A;  3I6D A;  2TPR A;  3JSK A;  3GWF A;  2GV8 A;  2YR6 A;  2Z5X A;  5L46 A;  3ALJ A;  1LQT A;  1VG9 A;  4OPT A;  2GMJ A;  1YQ3 A;  3DH9 A;  1NEN A;  1S2Q A;  4RG4 A;  2WPC A;  4C5O A;  4ZCD A;  1KDG A;  2OAM A;  3GD3 A;  1PJ5 A;  2C7G A;  1ZOY A;  3KA7 A;  4UDR A;  5HY5 A;  4GF7 A;  3CNP A;  4JNQ A;  1F3P A;  1DJN A;  3DJJ A;  4RSL A;  1GRG A;  3AYJ A;  1CJ4 A;  1NG4 A;  3BI5 A;  3GMB A;  4ECH A;  4U8M A;  3H4K A;  2YAU A;  5JCN A;  1Y56 A;  2GVC A;  1PDH A;  2X8H A;  1S3E A;  1IUT A;  1SEZ A;  3ADA B;  2GR2 A;  3UP5 A;  1XHC A;  2XVH A;  4K5S A;  2R0C A;  3GSI A;  5J60 A;  3L8K A;  2GQW A;  2VVL A;  1JU2 A;  5HYM A;  2Q6U A;  1L9D A;  3AE4 A;  4JQ9 A;  3NN0 X;  2GQF A;  1L9C A;  3CPI G;  4H50 A;  1BF3 A;  2C70 A;  2V6O A;  2RGH A;  3QSS A;  4LA1 A;  3PS9 A;  2F5Z A;  3UOX A;  4JDR A;  3H8I A;  2FJA A;  2C76 A;  1Q1R A;  1OJD A;  2C75 A;  3NIX A;  2XLU A;  2YVG A;  2XLR A;  3ALL A;  3DK4 A;  1GRH A;  1RSG A;  4GUV A;  1B37 A;  3QFB A;  3L1R A;  1MXT A;  2CUL A;  4O5U A;  3KPF A;  4OPD A;  4NTC A;  1N1P A;  2WOV A;  2BA9 A;  3G5R A;  1RP0 A;  3GYI A;  4CRT A;  2JKC A;  4PAB A;  2O9Z A;  3GD4 A;  3KVE A;  2BC0 A;  2WDR A;  2B9X A;  1CBO A;  2BXS A;  4J56 A;  1ELI A;  1GES A;  3C4A A;  3KLJ A;  1GRB A;  4G6H A;  2X8C A;  1BWC A;  1JEH A;  3NRN A;  1D4E A;  1TDK A;  1O5W A;  2WOI A;  3NYF A;  2Q7V A;  1IUV A;  3SZF A;  3VQR A;  1NHQ A;  3LOV A;  1Z6L A;  4CNK A;  3M0O A;  1LQU A;  4RG3 A;  2JB3 A;  4CY6 A;  5EB5 A;  2XVI A;  2JB2 A;  5HHF A;  1H81 A;  3RHA A;  5M10 A;  3QVR A;  2XFP A;  1PBF A;  3NK0 X;  4AOX A;  4DGK A;  3C4N A;  4OVI A;  3URH A;  2Q0K A;  3GDP A;  4A5L A;  2R4E A;  2XFQ A;  4TM1 A;  2YG4 A;  3ICR A;  3QVP A;  1FL2 A;  3CPH G;  4H4S A;  4PAA A;  1CC6 A;  2XVJ A;  4U8J A;  3T2Y A;  2BC1 A;  3DGZ A;  4YSH A;  4BK2 A;  4G73 A;  3RED A;  3F8P A;  4ZN0 A;  5KWF A;  3UKK A;  4H4T A;  1CJ2 A;  3B6D A;  4K5R A;  2H89 A;  2WOW A;  1GV4 A;  4OPU A;  3M12 A;  3AEA A;  3RP7 A;  5EOW A;  1AOG A;  1K0I A;  2YLW A;  4TLZ A;  5IQ4 A;  2GAH B;  2A87 A;  4LII A;  4XWZ A;  2WPF A;  2E5V A;  4C3X A;  2B7S A;  3CGB A;  3G5S A;  4B68 A;  1XDI A;  5GRT A;  3UTE A;  1KSU A;  4U8K A;  4J34 A;  2WBA A;  5JCK A;  3ITJ A;  4NEV A;  3ATR A;  4B63 A;  4KPR A;  3CIR A;  5FS9 A;  1F8W A;  2TMD A;  4NTE A;  3SFD A;  1Y56 B;  3UKL A;  5JCI A;  2NVK X;  1ZK7 A;  3AE2 A;  1LPF A;  3I3L A;  4Y4L A;  4AOS A;  3AD9 B;  1IJH A;  4H2R A;  4J57 A;  2WP5 A;  2ZZB A;  4OPL A;  4EQX A;  4J2W A;  3CGC A;  5BVA A;  4YTP A;  3SZC A;  4Z43 A;  2VVL G;  1H83 A;  2GMH A;  4A99 A;  3SGL A;  2GF3 A;  5ER0 A;  3SM8 A;  4Y4M A;  3D8X A;  3ICT A;  1EL7 A;  1PBE A;  2A8X A;  3II4 A;  1GTH A;  3AE3 A;  2YM1 A;  2DKI A;  2GB0 A;  4O5Q A;  4IA5 A;  3GWD A;  3GYJ A;  2FJE A;  3BI4 A;  5IQ1 A;  1LTX R;  2OAL A;  2EQ8 A;  3AYI A;  3ZYX A;  4B67 A;  3T14 A;  4H2P A;  1ZY8 A;  4BK1 A;  4CCR A;  2WQY A;  5IPY A;  3BI2 A;  2YLX A;  2JAE A;  1LVL A;  3BNM A;  2WU5 A;  1ONF A;  2IID A;  2E4G A;  2R9Z A;  4I59 A;  4NWZ A;  4CNJ A;  5TR3 A;  4BK3 A;  3AB1 A;  1Y0P A;  3QFA A;  1OJT A;  1D7L A;  3AEE A;  4U8P A;  2BAC A;  1E39 A;  2B9Y A;  3VRD B;  1JRZ A;  1TYT A;  1TDF A;  1GRA A;  3ISH A;  3NYE A;  3SY4 A;  4Z2U A;  2B9W A;  4Y4N A;  1PXC A;  1CL0 A;  4B69 A;  4DSG A;  3FG2 P;  2JB1 A;  3CND A;  1CC4 A;  3DME A;  3HYW A;  4I58 A;  1KFY A;  2C73 A;  3NH3 X;  1CHU A;  1DOD A;  4H4W A;  1B8S A;  3UP4 A;  1GND A;  3T0K A;  2X3N A;  1H7W A;  4UDP A;  4U8I A;  1K0J A;  3CN8 A;  1XAN A;  1GOS A;  3UCL A;  4EM4 A;  5KOX A;  1ZP0 A;  4EMJ A;  3DJD A;  2C65 A;  1BGJ A;  2BRA A;  1NHP A;  3NK2 X;  5KMR A;  2VRM A;  1FEC A;  3GRS A;  4CBQ A;  5KRQ A;  1PJ7 A;  4NZH A;  4ADW A;  3SYI A;  2R46 A;  3T2Z A;  2XFN A;  5C2T A;  3NN6 X;  1D4D A;  2I0Z A;  2W0H A;  2QCU A;  2YG7 A;  1F8S A;  4OPI A;  4AT2 A;  1TRB A;  2GRT A;  3CPJ G;  4Z2R A;  4D04 A;  1H7X A;  1TDO A;  3SQP A;  5BUL A;  4BJY A;  3UTG A;  1JNR A;  1PHH A;  2XYO A;  3KKJ A;  3AD8 B;  1GEU A;  2VZ2 A;  3R9U A;  3IF9 A;  4H4U A;  4J36 A;  2V60 A;  1TDN A;  5KMP A;  1IUW A;  4B64 A;  4XWR A;  1E1K A;  3EAO A;  1VRQ B;  2AQJ A;  5JCL A;  1CJC A;  4WCT A;  4Z2T A;  1GPE A;  1NEK A;  2EQ6 A;  1F6M A;  4Z24 A;  1CF3 A;  3VRB A;  3ABV A;  1O94 A;  2C72 A;  2R0P A;  1PJ6 A;  5EBK A;  3BHK A;  2BK3 A;  4C3Y A;  5JCM A;  2A89 A;  4H7U A;  2BYB A;  3SFE A;  1ZOV A;  5CKU A;  4EM3 A;  1GRE A;  1S3B A;  4ZCC A;  3AD7 B;  2WDQ A;  4YTN A;  4Z25 A;  1F8R A;  1X31 B;  2ACZ A;  1D7Y A;  4WX1 A;  4H4X A;  1OJ9 A;  1GTE A;  3NG7 X;  1K4Q A;  1LV0 A;  3UOZ A;  5KOW A;  3T2K A;  4AP1 A;  4GDE A;  2V3A A;  4YWO A;  4J31 A;  3NYC A;  2JBV A;  2OA1 A;  2XFU A;  4YSX A;  4E0V A;  1DXL A;  2YG3 A;  1H82 A;  2XVE A;  1PBB A;  2FJB A;  3LZW A;  2VOU A;  2VQ7 A;  2BXR A;  3S61 A;  3LAD A;  2YVF A;  3O0H A;  3OC4 A;  1PN0 A;  2RGJ A;  2VRL A;  1Q9I A;  2YR5 A;  5HXI A;  2WP9 A;  2AAQ A;  5EB4 A;  1CC2 A;  1PXB A;  3AEG A;  4X9N A;  2VVM A;  3EAN A;  5DBJ A;  4HB9 A;  1O95 A;  5C3J A;  1REO A;  4TM4 A;  3P4S A;  5KVI A;  1NDA A;  4GCM A;  4HA6 A;  3VRA A;  2OLO A;  4K8D A;  5BRT A;  3AED A;  1KSS A;  3KPK A;  1NHS A;  1N4V A;  3CGD A;  3IWA A;  4USQ A;  2Z5Y A;  1QO8 A;  4P9S A;  4U8O A;  4NEW A;  3AE6 A;  2Q0L A;  1NHR A;  2Y6R A;  3NNE A;  4TM3 A;  2BK5 A;  3LB8 A;  4FK1 C;  1HYU A;  1P2H A;  4JN9 A;  2WDV A;  4U8L A;  4YT0 A;  1B5Q A;  1QJD A;  2QAE A;  1DJQ A;  4YSZ A;  3QSM A;  4C77 A;  3GMC A;  3AE1 A;  3C96 A;  3DJE A;  2YLR A;  3P4Q A;  4H4R A;  4DNA A;  3G5Q A;  4U8N A;  5M0Z A;  1GRT A;  3RP8 A;  4G6G A;  2X8G A;  4B66 A;  3UKA A;  4A65 A;  1H6V A;  2ARD A;  3DGH A;  1QLB A;  2XDO A;  1YY5 A;  2BAB A;  2ZZC A;  4IVO B;  2YM2 A;  5KMS A;  2JK6 A;  4USR A;  2XFO A;  2PYX A;  2C66 A;  4K2X A;  4A6N A;  2Y6Q A;  1RYI A;  2EQ9 A;  4JY3 A;  1GXF A;  1NG3 A;  1PS9 A;  1S2Y A;  3AYL A;  5FMH A;  4CY8 A;  4APN A;  3AEF A;  4A79 A;  2H88 A;  3NT6 A;  3QSE A;  2WET A;  5KMQ A;  3EPT A;  2J3N A;  3AEB A;  4K7Z A;  4U2S A;  2BCG G;  2X50 A;  3Q6J A;  1VQW A;  4H2N A;  3CGE A;  2CVJ A;  1E6E A;  1YQ4 A;  3NLC A;  3NTD A;  3V76 A;  2BS3 A;  2PHH A;  1MOK A;  4IV9 A;  1BKW A;  4BJZ A;  4YSY A;  3NGC X;  1E1L A;  4MJW A;  3V3O A;  4YXD A;  3PVC A;  1GT8 A;  3PO7 A;  4FDC B;  2ZZ0 A;  3F8D A;  4X9M A;  3P4R A;  2XLP A;  3GRT A;  3DJG X;  3P9U A;  1UKV G;  4GRT A;  4H4Q A;  3LJP A;  4OPG A;  1COY A;  1PBC A;  4TM0 A;  1EL5 A;  2E1M A;  4EQS A;  4U2L A;  2FBW A;  4YKF A;  4II2 A;  5KVH A;  1TDE A;  2RGO A;  4IA6 A;  1JRX A;  3NHO X;  1FEA A;  1ZX9 A;  4FK1 A;  3HZL A;  1LJ1 A;  2IVD A;  4B65 A;  3SZ0 A;  3K7Q X;  4H2Q A;  2GR0 A;  3FPZ A;  4B1B A;  4EMI A;  2B76 A;  2CDU A;  2V61 A;  2WPE A;  1XPQ A;  3AE7 A;  3KU9 A;  1GSN A;  2BCP A;  1OJC A;  3NK1 X;  3DK8 A;  1GAL A;  5KNL A;  2IVE A;  3COX A;  4Z44 A;  3K30 A;  2FJD A;  3CNS A;  1EL9 A;  2HQM A;  3V3N A;  1L9E A;  1PXA A;  4GR1 A;  4NNJ A;  4X4J A;  2BS4 A;  2YG5 A;  2C3C A;  4YKG A;  2WHD A;  4NTD A;  1P2E A;  3DK9 A;  3HYX A;  3NKS A;  1GET A;  3FIM B;  4OPC A;  3UKQ A;  3LZX A;  3UKF A;  3WE0 A;  4JNA A;  1FOH A;  2YWL A;  4ICY A;  1TYP A;  1KNP A;  1H84 A;  3UTF A;  1E1N A;  3K7T A;  2XLT A;  3UOY A;  1KF6 A;  1KNR A;  2RAB A;  2WS3 A;  3IHG A;  3HYV A;  4H4Z A;  1N4U A;  3IC9 A;  3S5W A;  3UKH A;  1D4C A;  3AWI A;  5FS8 A;  3CNJ A;  3ALM A;  3OZ2 A;  3RP6 A;  2GEW A;  1E1M A;  1Q1W A;  2YQU A;  4BV6 A;  2APG A;  4U2T A;  5J7X A;  4DSH A;  2AR8 A;  4EQR A;  5LV9 A;  5CQF A;  1FCD A;  3GDN A;  2BS2 A;  3ATQ A;  2WU2 A;  1NAA A;  1YKJ A;  1N4W A;  2XCG A;  3GYX A;  4LU6 A;  3AE5 A;  2VQB A;  3B3R A;  1VG0 A;  4FX9 A;  3FBS A;  4OCG A;  1JNZ A;  1ZDL A;  3NTA A;  1JOA A;  3DA1 A;  3UTH A;  1JRY A;  1IUU A;  2WP6 A;  1MO9 A;  4H4Y A;  4A6N B;  4AT0 A;  2QA2 A;  3CNT A;  4A7A A;  2GR1 A;  2XVF A;  4GAP A;  2C4C A;  1PBD A;  1H86 A;  3M13 A;  1M64 A;  5GSN A;  4CCQ A;  1E7P A;  2WEU A;  3EF6 A;  3RNM A;  3ICS A;  2C3D A;  4Z26 A;  1FEB A;  2YLS A;  4REK A;  2YG6 A;  4UP3 A;  2ZBW A;  1ZMD A;  4II3 A;  1GER A;  3VR8 A;  4G74 A;  1IUS A;  3IHM A;  1DNC A;  3F8R A;  4A9W A;  5KXJ A;  1K0L A;  1NPX A;  1DOE A;  1M6I A;  2V3B A;  4G9K A;  1L0V A;  4EIP A;  4EIQ A;  5FS6 A;  1CJ3 A;  3D1C A;  1EBD A;  2YLT A;  2C67 A;  4JY2 A;  2QA1 A;  4IVM B;  1BZL A;  5U25 A;  3T37 A;  2GR3 A;  4M52 A;  4KX6 A;  4EQW A;  1OJA A;  2GH5 A;  4YTM A;  2UZZ A;  2V5Z A;  2YVJ A;  2XLS A;  2CFY A;  3P1W A;  3H8L A;  2BRY A;  2WES A;  1YQZ A;  3SXI A;  1GRF A;  1IUX A;  3Q9T A;  2C64 A;  3P4P A;  4K22 A;  2R4J A;  4GAV A;  1ZMC A;  3BNU A;  4H4P A;  4AP3 A;  3SX6 A;  5U63 A;  3SZW A;  4N9X A;  3LXD A;  4BUR A;  3UOV A;  2GAG B;  2B7R A;  3CMM A;  1D5T A;  4GDP A;  1DOB A;  2DKH A;  2OLN A;  3AE8 A;  1W4X A;  3AE9 A;  1V59 A;  2X99 A;  2YLZ A;  3T31 A;  4TLX A;  5U1O A; 
#chains in the Genus database with same CATH homology
 1B4V A;  2BK4 A;  2EQ7 A;  3KD9 A;  1EL8 A;  1ZKQ A;  1VDC A;  3AEC A;  3E1T A;  3K7M X;  4J33 A;  3UKP A;  4D03 A;  3QJ4 A;  3FMW A;  1DOC A;  3AXB A;  2R0G A;  1BGN A;  4UDQ A;  4C74 A;  4XXG A;  3VR9 A;  5FS7 A;  4H4V A;  2YR4 A;  5BUK A;  3ZDN A;  3BHF A;  2NPX A;  2R45 A;  3CTY A;  4EMW A;  3I6D A;  2TPR A;  3JSK A;  3GWF A;  2GV8 A;  2YR6 A;  2Z5X A;  5L46 A;  3ALJ A;  1LQT A;  1VG9 A;  4OPT A;  2GMJ A;  1YQ3 A;  3DH9 A;  1NEN A;  1S2Q A;  4RG4 A;  2WPC A;  4C5O A;  4ZCD A;  1KDG A;  2OAM A;  3GD3 A;  1PJ5 A;  2C7G A;  1ZOY A;  3KA7 A;  4UDR A;  5HY5 A;  4GF7 A;  3CNP A;  4JNQ A;  1F3P A;  1DJN A;  3DJJ A;  4RSL A;  1GRG A;  3AYJ A;  1CJ4 A;  1NG4 A;  3BI5 A;  3GMB A;  4ECH A;  4U8M A;  3H4K A;  2YAU A;  5JCN A;  1Y56 A;  2GVC A;  1PDH A;  2X8H A;  1S3E A;  1IUT A;  1SEZ A;  3ADA B;  2GR2 A;  3UP5 A;  1XHC A;  2XVH A;  4K5S A;  2R0C A;  3GSI A;  5J60 A;  3L8K A;  2GQW A;  2VVL A;  1JU2 A;  5HYM A;  2Q6U A;  1L9D A;  3AE4 A;  4JQ9 A;  3NN0 X;  2GQF A;  1L9C A;  3CPI G;  4H50 A;  1BF3 A;  2C70 A;  2V6O A;  2RGH A;  3QSS A;  4LA1 A;  3PS9 A;  2F5Z A;  3UOX A;  4JDR A;  3H8I A;  2FJA A;  2C76 A;  1Q1R A;  1OJD A;  2C75 A;  3NIX A;  2XLU A;  2YVG A;  2XLR A;  3ALL A;  3DK4 A;  1GRH A;  1RSG A;  4GUV A;  1B37 A;  3QFB A;  3L1R A;  1MXT A;  2CUL A;  4O5U A;  3KPF A;  4OPD A;  4NTC A;  1N1P A;  2WOV A;  2BA9 A;  3G5R A;  1RP0 A;  3GYI A;  4CRT A;  2JKC A;  4PAB A;  2O9Z A;  3GD4 A;  3KVE A;  2BC0 A;  2WDR A;  2B9X A;  1CBO A;  2BXS A;  4J56 A;  1ELI A;  1GES A;  3C4A A;  3KLJ A;  1GRB A;  4G6H A;  2X8C A;  1BWC A;  1JEH A;  3NRN A;  1D4E A;  1TDK A;  1O5W A;  2WOI A;  3NYF A;  2Q7V A;  1IUV A;  3SZF A;  3VQR A;  1NHQ A;  3LOV A;  1Z6L A;  4CNK A;  3M0O A;  1LQU A;  4RG3 A;  2JB3 A;  4CY6 A;  5EB5 A;  2XVI A;  2JB2 A;  5HHF A;  1H81 A;  3RHA A;  5M10 A;  3QVR A;  2XFP A;  1PBF A;  3NK0 X;  4AOX A;  4DGK A;  3C4N A;  4OVI A;  3URH A;  2Q0K A;  3GDP A;  4A5L A;  2R4E A;  2XFQ A;  4TM1 A;  2YG4 A;  3ICR A;  3QVP A;  1FL2 A;  3CPH G;  4H4S A;  4PAA A;  1CC6 A;  2XVJ A;  4U8J A;  3T2Y A;  2BC1 A;  3DGZ A;  4YSH A;  4BK2 A;  4G73 A;  3RED A;  3F8P A;  4ZN0 A;  5KWF A;  3UKK A;  4H4T A;  1CJ2 A;  3B6D A;  4K5R A;  2H89 A;  2WOW A;  1GV4 A;  4OPU A;  3M12 A;  3AEA A;  3RP7 A;  5EOW A;  1AOG A;  1K0I A;  2YLW A;  4TLZ A;  5IQ4 A;  2GAH B;  2A87 A;  4LII A;  4XWZ A;  2WPF A;  2E5V A;  4C3X A;  2B7S A;  3CGB A;  3G5S A;  4B68 A;  1XDI A;  5GRT A;  3UTE A;  1KSU A;  4U8K A;  4J34 A;  2WBA A;  5JCK A;  3ITJ A;  4NEV A;  3ATR A;  4B63 A;  4KPR A;  3CIR A;  5FS9 A;  1F8W A;  2TMD A;  4NTE A;  3SFD A;  1Y56 B;  3UKL A;  5JCI A;  2NVK X;  1ZK7 A;  3AE2 A;  1LPF A;  3I3L A;  4Y4L A;  4AOS A;  3AD9 B;  1IJH A;  4H2R A;  4J57 A;  2WP5 A;  2ZZB A;  4OPL A;  4EQX A;  4J2W A;  3CGC A;  5BVA A;  4YTP A;  3SZC A;  4Z43 A;  2VVL G;  1H83 A;  2GMH A;  4A99 A;  3SGL A;  2GF3 A;  5ER0 A;  3SM8 A;  4Y4M A;  3D8X A;  3ICT A;  1EL7 A;  1PBE A;  2A8X A;  3II4 A;  1GTH A;  3AE3 A;  2YM1 A;  2DKI A;  2GB0 A;  4O5Q A;  4IA5 A;  3GWD A;  3GYJ A;  2FJE A;  3BI4 A;  5IQ1 A;  1LTX R;  2OAL A;  2EQ8 A;  3AYI A;  3ZYX A;  4B67 A;  3T14 A;  4H2P A;  1ZY8 A;  4BK1 A;  4CCR A;  2WQY A;  5IPY A;  3BI2 A;  2YLX A;  2JAE A;  1LVL A;  3BNM A;  2WU5 A;  1ONF A;  2IID A;  2E4G A;  2R9Z A;  4I59 A;  4NWZ A;  4CNJ A;  5TR3 A;  4BK3 A;  3AB1 A;  1Y0P A;  3QFA A;  1OJT A;  1D7L A;  3AEE A;  4U8P A;  2BAC A;  1E39 A;  2B9Y A;  3VRD B;  1JRZ A;  1TYT A;  1TDF A;  1GRA A;  3ISH A;  3NYE A;  3SY4 A;  4Z2U A;  2B9W A;  4Y4N A;  1PXC A;  1CL0 A;  4B69 A;  4DSG A;  3FG2 P;  2JB1 A;  3CND A;  1CC4 A;  3DME A;  3HYW A;  4I58 A;  1KFY A;  2C73 A;  3NH3 X;  1CHU A;  1DOD A;  4H4W A;  1B8S A;  3UP4 A;  1GND A;  3T0K A;  2X3N A;  1H7W A;  4UDP A;  4U8I A;  1K0J A;  3CN8 A;  1XAN A;  1GOS A;  3UCL A;  4EM4 A;  5KOX A;  1ZP0 A;  4EMJ A;  3DJD A;  2C65 A;  1BGJ A;  2BRA A;  1NHP A;  3NK2 X;  5KMR A;  2VRM A;  1FEC A;  3GRS A;  4CBQ A;  5KRQ A;  1PJ7 A;  4NZH A;  4ADW A;  3SYI A;  2R46 A;  3T2Z A;  2XFN A;  5C2T A;  3NN6 X;  1D4D A;  2I0Z A;  2W0H A;  2QCU A;  2YG7 A;  1F8S A;  4OPI A;  4AT2 A;  1TRB A;  2GRT A;  3CPJ G;  4Z2R A;  4D04 A;  1H7X A;  1TDO A;  3SQP A;  5BUL A;  4BJY A;  3UTG A;  1JNR A;  1PHH A;  2XYO A;  3KKJ A;  3AD8 B;  1GEU A;  2VZ2 A;  3R9U A;  3IF9 A;  4H4U A;  4J36 A;  2V60 A;  1TDN A;  5KMP A;  1IUW A;  4B64 A;  4XWR A;  1E1K A;  3EAO A;  1VRQ B;  2AQJ A;  5JCL A;  1CJC A;  4WCT A;  4Z2T A;  1GPE A;  1NEK A;  2EQ6 A;  1F6M A;  4Z24 A;  1CF3 A;  3VRB A;  3ABV A;  1O94 A;  2C72 A;  2R0P A;  1PJ6 A;  5EBK A;  3BHK A;  2BK3 A;  4C3Y A;  5JCM A;  2A89 A;  4H7U A;  2BYB A;  3SFE A;  1ZOV A;  5CKU A;  4EM3 A;  1GRE A;  1S3B A;  4ZCC A;  3AD7 B;  2WDQ A;  4YTN A;  4Z25 A;  1F8R A;  1X31 B;  2ACZ A;  1D7Y A;  4WX1 A;  4H4X A;  1OJ9 A;  1GTE A;  3NG7 X;  1K4Q A;  1LV0 A;  3UOZ A;  5KOW A;  3T2K A;  4AP1 A;  4GDE A;  2V3A A;  4YWO A;  4J31 A;  3NYC A;  2JBV A;  2OA1 A;  2XFU A;  4YSX A;  4E0V A;  1DXL A;  2YG3 A;  1H82 A;  2XVE A;  1PBB A;  2FJB A;  3LZW A;  2VOU A;  2VQ7 A;  2BXR A;  3S61 A;  3LAD A;  2YVF A;  3O0H A;  3OC4 A;  1PN0 A;  2RGJ A;  2VRL A;  1Q9I A;  2YR5 A;  5HXI A;  2WP9 A;  2AAQ A;  5EB4 A;  1CC2 A;  1PXB A;  3AEG A;  4X9N A;  2VVM A;  3EAN A;  5DBJ A;  4HB9 A;  1O95 A;  5C3J A;  1REO A;  4TM4 A;  3P4S A;  5KVI A;  1NDA A;  4GCM A;  4HA6 A;  3VRA A;  2OLO A;  4K8D A;  5BRT A;  3AED A;  1KSS A;  3KPK A;  1NHS A;  1N4V A;  3CGD A;  3IWA A;  4USQ A;  2Z5Y A;  1QO8 A;  4P9S A;  4U8O A;  4NEW A;  3AE6 A;  2Q0L A;  1NHR A;  2Y6R A;  3NNE A;  4TM3 A;  2BK5 A;  3LB8 A;  4FK1 C;  1HYU A;  1P2H A;  4JN9 A;  2WDV A;  4U8L A;  4YT0 A;  1B5Q A;  1QJD A;  2QAE A;  1DJQ A;  4YSZ A;  3QSM A;  4C77 A;  3GMC A;  3AE1 A;  3C96 A;  3DJE A;  2YLR A;  3P4Q A;  4H4R A;  4DNA A;  3G5Q A;  4U8N A;  5M0Z A;  1GRT A;  3RP8 A;  4G6G A;  2X8G A;  4B66 A;  3UKA A;  4A65 A;  1H6V A;  2ARD A;  3DGH A;  1QLB A;  2XDO A;  1YY5 A;  2BAB A;  2ZZC A;  4IVO B;  2YM2 A;  5KMS A;  2JK6 A;  4USR A;  2XFO A;  2PYX A;  2C66 A;  4K2X A;  4A6N A;  2Y6Q A;  1RYI A;  2EQ9 A;  4JY3 A;  1GXF A;  1NG3 A;  1PS9 A;  1S2Y A;  3AYL A;  5FMH A;  4CY8 A;  4APN A;  3AEF A;  4A79 A;  2H88 A;  3NT6 A;  3QSE A;  2WET A;  5KMQ A;  3EPT A;  2J3N A;  3AEB A;  4K7Z A;  4U2S A;  2BCG G;  2X50 A;  3Q6J A;  1VQW A;  4H2N A;  3CGE A;  2CVJ A;  1E6E A;  1YQ4 A;  3NLC A;  3NTD A;  3V76 A;  2BS3 A;  2PHH A;  1MOK A;  4IV9 A;  1BKW A;  4BJZ A;  4YSY A;  3NGC X;  1E1L A;  4MJW A;  3V3O A;  4YXD A;  3PVC A;  1GT8 A;  3PO7 A;  4FDC B;  2ZZ0 A;  3F8D A;  4X9M A;  3P4R A;  2XLP A;  3GRT A;  3DJG X;  3P9U A;  1UKV G;  4GRT A;  4H4Q A;  3LJP A;  4OPG A;  1COY A;  1PBC A;  4TM0 A;  1EL5 A;  2E1M A;  4EQS A;  4U2L A;  2FBW A;  4YKF A;  4II2 A;  5KVH A;  1TDE A;  2RGO A;  4IA6 A;  1JRX A;  3NHO X;  1FEA A;  1ZX9 A;  4FK1 A;  3HZL A;  1LJ1 A;  2IVD A;  4B65 A;  3SZ0 A;  3K7Q X;  4H2Q A;  2GR0 A;  3FPZ A;  4B1B A;  4EMI A;  2B76 A;  2CDU A;  2V61 A;  2WPE A;  1XPQ A;  3AE7 A;  3KU9 A;  1GSN A;  2BCP A;  1OJC A;  3NK1 X;  3DK8 A;  1GAL A;  5KNL A;  2IVE A;  3COX A;  4Z44 A;  3K30 A;  2FJD A;  3CNS A;  1EL9 A;  2HQM A;  3V3N A;  1L9E A;  1PXA A;  4GR1 A;  4NNJ A;  4X4J A;  2BS4 A;  2YG5 A;  2C3C A;  4YKG A;  2WHD A;  4NTD A;  1P2E A;  3DK9 A;  3HYX A;  3NKS A;  1GET A;  3FIM B;  4OPC A;  3UKQ A;  3LZX A;  3UKF A;  3WE0 A;  4JNA A;  1FOH A;  2YWL A;  4ICY A;  1TYP A;  1KNP A;  1H84 A;  3UTF A;  1E1N A;  3K7T A;  2XLT A;  3UOY A;  1KF6 A;  1KNR A;  2RAB A;  2WS3 A;  3IHG A;  3HYV A;  4H4Z A;  1N4U A;  3IC9 A;  3S5W A;  3UKH A;  1D4C A;  3AWI A;  5FS8 A;  3CNJ A;  3ALM A;  3OZ2 A;  3RP6 A;  2GEW A;  1E1M A;  1Q1W A;  2YQU A;  4BV6 A;  2APG A;  4U2T A;  5J7X A;  4DSH A;  2AR8 A;  4EQR A;  5LV9 A;  5CQF A;  1FCD A;  3GDN A;  2BS2 A;  3ATQ A;  2WU2 A;  1NAA A;  1YKJ A;  1N4W A;  2XCG A;  3GYX A;  4LU6 A;  3AE5 A;  2VQB A;  3B3R A;  1VG0 A;  4FX9 A;  3FBS A;  4OCG A;  1JNZ A;  1ZDL A;  3NTA A;  1JOA A;  3DA1 A;  3UTH A;  1JRY A;  1IUU A;  2WP6 A;  1MO9 A;  4H4Y A;  4A6N B;  4AT0 A;  2QA2 A;  3CNT A;  4A7A A;  2GR1 A;  2XVF A;  4GAP A;  2C4C A;  1PBD A;  1H86 A;  3M13 A;  1M64 A;  5GSN A;  4CCQ A;  1E7P A;  2WEU A;  3EF6 A;  3RNM A;  3ICS A;  2C3D A;  4Z26 A;  1FEB A;  2YLS A;  4REK A;  2YG6 A;  4UP3 A;  2ZBW A;  1ZMD A;  4II3 A;  1GER A;  3VR8 A;  4G74 A;  1IUS A;  3IHM A;  1DNC A;  3F8R A;  4A9W A;  5KXJ A;  1K0L A;  1NPX A;  1DOE A;  1M6I A;  2V3B A;  4G9K A;  1L0V A;  4EIP A;  4EIQ A;  5FS6 A;  1CJ3 A;  3D1C A;  1EBD A;  2YLT A;  2C67 A;  4JY2 A;  2QA1 A;  4IVM B;  1BZL A;  5U25 A;  3T37 A;  2GR3 A;  4M52 A;  4KX6 A;  4EQW A;  1OJA A;  2GH5 A;  4YTM A;  2UZZ A;  2V5Z A;  2YVJ A;  2XLS A;  2CFY A;  3P1W A;  3H8L A;  2BRY A;  2WES A;  1YQZ A;  3SXI A;  1GRF A;  1IUX A;  3Q9T A;  2C64 A;  3P4P A;  4K22 A;  2R4J A;  4GAV A;  1ZMC A;  3BNU A;  4H4P A;  4AP3 A;  3SX6 A;  5U63 A;  3SZW A;  4N9X A;  3LXD A;  4BUR A;  3UOV A;  2GAG B;  2B7R A;  3CMM A;  1D5T A;  4GDP A;  1DOB A;  2DKH A;  2OLN A;  3AE8 A;  1W4X A;  3AE9 A;  1V59 A;  2X99 A;  2YLZ A;  3T31 A;  4TLX A;  5U1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...