1TDKA

L-amino acid oxidase from agkistrodon halys in complex with suicide substrate l-vinylglycine
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
484
structure length
484
Chain Sequence
b'DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complexes with substrates and substrate analogue
rcsb
molecule tags Oxidoreductase
total genus 175
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdkA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdkA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdkA01
4UDPA 4RSLA 2YG5A 1PXAA 4X4JA 3K30A 1YQZA 2Q7VA 3CPJG 3QFAA 3UOXA 3UOZA 3UTFA 4BJZA 4NZHA 3DGHA 2R46A 4H4UA 4K5SA 1S2YA 2YG3A 3AYJA 1JRYA 1IUWA 1VQWA 2JB2A 1CJCA 4H4WA 1VRQB 1E1KA 2XLSA 2NPXA 3EF6A 3NN0X 4J34A 4U8PA 3COXA 1B4VA 1GALA 1VG9A 3I3LA 4JY3A 4XXGA 1OJ9A 4EMWA 3SQPA 1XPQA 4EM3A 1ZKQA 4NEVA 5IPYA 4UP3A 4FDCB 4C3YA 2ARDA 2YQUA 1CJ4A 3UP4A 4U8KA 1TDOA 4LA1A 1E1NA 5FS7A 2V5ZA 2XVHA 4B68A 3BNUA 3BNMA 3OC4A 5KWFA 1E7PA 3UP5A 1LV0A 3C4AA 1CJ2A 1REOA 4N9XA 3AE2A 4DNAA 2BS2A 2BS4A 2Q0KA 1H81A 3R9UA 3BI4A 4CY8A 3P9UA 3NHOX 2WOVA 3V3OA 4A7AA 2JBVA 2V3BA 3ADAB 1DOCA 2WOWA 4U2SA 2OALA 3ISHA 4U2TA 3NTDA 1E6EA 3AE7A 2JK6A 2PHHA 2X3NA 2OAMA 5U1OA 3RP8A 2R0PA 2W0HA 2BK4A 2C75A 1D4EA 2Y6QA 3ZYXA 3DJJA 4Z26A 3H8LA 3S5WA 1IUSA 2E5VA 4H4SA 2X8GA 2H88A 3F8PA 3NYFA 4JN9A 2X8CA 2IVEA 3ZDNA 4EQXA 4UDQA 2VRLA 1EBDA 3NK0X 1YQ3A 5C3JA 3GWDA 3E1TA 4XWZA 4TM1A 1K4QA 1ZX9A 4Z44A 4EM4A 3KLJA 2XFPA 4FK1A 4B64A 1F8SA 3ICRA 4ZCDA 2YVFA 3NKSA 1LVLA 1KF6A 2QCUA 1D4CA 4LIIA 5GSNA 1H82A 1ONFA 3GMBA 1GOSA 2BABA 5CQFA 4CNJA 4A99A 2C64A 2FJDA 4OVIA 4BV6A 1DNCA 4MJWA 3S61A 3QVRA 2VZ2A 2C7GA 4H4YA 1UKVG 4A9WA 3VRAA 4D03A 4OPLA 3KA7A 1B8SA 2EQ7A 3V3NA 3VR9A 3ICTA 4O5UA 4WX1A 2GR2A 3UKKA 1PBDA 2APGA 1Q1WA 4ADWA 4M52A 4GR1A 2WPEA 1PN0A 1VDCA 1QJDA 2B9XA 4KPRA 1TDFA 1FEBA 3AEDA 2GQFA 5FS8A 5GRTA 3NNEA 3F8RA 1GETA 2VQBA 2GR0A 3FG2P 2FJBA 3FMWA 1GRFA 5KOXA 2YVJA 3AE6A 1O5WA 3PVCA 3UCLA 1PDHA 3FBSA 3AEBA 1ZMCA 3IF9A 4U8OA 5HXIA 1B5QA 1TDEA 2GB0A 3ALMA 2C70A 3DH9A 5BUKA 5TR3A 1YKJA 2RGOA 1NG3A 2VQ7A 1QLBA 2AR8A 3VRDB 3SFDA 3AYIA 4U8LA 2BK5A 3GSIA 5EB4A 4A6NA 2DKHA 2R4EA 1Q9IA 2QAEA 4YSXA 1FOHA 2YLZA 3GRTA 3AEGA 2YVGA 2YG6A 1XANA 3II4A 2VRMA 2GF3A 3SGLA 1DXLA 3WE0A 1K0IA 2WESA 3AE3A 1JEHA 2WS3A 2ZBWA 3UOVA 4NTEA 2GEWA 1NHRA 1ZOVA 2YLTA 4UDRA 1JOAA 4ZCCA 4IVOB 4YSYA 2WETA 3C96A 1CF3A 3QSEA 4GDEA 1P2EA 3AECA 1KSUA 2WDVA 5FS9A 1M6IA 3NLCA 2C67A 3QVPA 2X99A 3PS9A 1Z6LA 3ALLA 2O9ZA 1DOBA 4H2PA 3B6DA 1S3EA 1H6VA 4ZN0A 4GCMA 1D4DA 1DJQA 2YWLA 3KVEA 1TRBA 2XVIA 2Y6RA 5C2TA 4H4PA 4Z24A 2XFUA 2C66A 1F8WA 2BACA 4DGKA 3M13A 3D1CA 1KSSA 3AE5A 4BK1A 4NTDA 4B66A 2R9ZA 4TLXA 2VOUA 2GR3A 4CBQA 3P1WA 2B7RA 3AE4A 2CVJA 3M0OA 3ICSA 3RHAA 2WQYA 5IQ1A 1S2QA 2H89A 2C73A 5FS6A 2YLXA 1LQUA 3G5RA 1GSNA 2GVCA 1Q1RA 1M64A 4TM4A 3BI5A 1H84A 4J57A 1GRHA 1BZLA 5JCKA 2XVFA 3AD8B 4H4RA 3CNDA 3QSMA 4FX9A 2GMHA 4IV9A 1OJDA 3QFBA 1PS9A 4YTPA 1E1LA 3BI2A 5EBKA 2JB3A 2C65A 3T37A 4BK2A 4E0VA 2FJEA 4X9MA 3ATRA 2Q6UA 2YAUA 3NG7X 2E4GA 1D5TA 3NTAA 4P9SA 2OA1A 3GWFA 3PO7A 4TLZA 4JNQA 5JCIA 3LOVA 4J2WA 4LU6A 3DJGX 2QA1A 2WP5A 2WU2A 1COYA 2V3AA 2BC0A 1ELIA 1L9DA 1N4VA 1KNPA 1LTXR 1CBOA 1GRBA 3DJDA 4CCRA 2ACZA 1TYTA 2CDUA 3IHMA 2WEUA 4JDRA 1S3BA 1IUXA 4PAAA 5EB5A 1CC4A 4A6NB 5IQ4A 4AOSA 4USQA 4U8MA 1GERA 3AEAA 3DK8A 1W4XA 4JNAA 3K7QX 3L1RA 1RYIA 4GUVA 4OPDA 1TDNA 2VVLG 1GPEA 3AD9B 3UKFA 2CFYA 1BKWA 3SFEA 5J7XA 4A5LA 1RP0A 1GNDA 4AT2A 2OLNA 5JCMA 3VQRA 2PYXA 3P4PA 4H2RA 3AXBA 2WP9A 4U8NA 3NH3X 1O94A 4J36A 1LQTA 2BXRA 1ZY8A 3C4NA 4NEWA 3L8KA 2WP6A 2E1MA 2V61A 3CNTA 3BHFA 2EQ9A 1PXBA 1L0VA 3NYEA 3UTEA 4CCQA 1HYUA 1FEAA 3CGDA 5FMHA 1NPXA 1KDGA 1O95A 2TPRA 3AD7B 1BWCA 1SEZA 3GRSA 2WBAA 4U8IA 2RABA 4YTMA 3CNPA 4REKA 3Q6JA 1CJ3A 4RG4A 3H8IA 5KXJA 4B1BA 2YM1A 3CTYA 5ER0A 2R45A 1PXCA 3REDA 1D7LA 4OPGA 3VRBA 4EQSA 5J60A 1LJ1A 1JRZA 3G5SA 5U25A 3GD3A 4U2LA 1GRAA 3GMCA 1P2HA 3P4RA 4H2NA 2B9WA 3SM8A 2YLSA 3RNMA 1EL8A 1K0LA 3RP6A 4B67A 3KPFA 1GTEA 2AAQA 2WDRA 2Z5XA 3GYIA 1LPFA 4FK1C 2WPCA 1OJCA 2X50A 2XLRA 1NEKA 4EIQA 1BGJA 2JB1A 1GESA 2BXSA 4H4TA 1ZP0A 3LJPA 2B9YA 2IVDA 5JCNA 2XCGA 2GH5A 4YSHA 4YTNA 5HYMA 1KNRA 4USRA 2YR6A 1YY5A 3IWAA 1PBEA 2XFQA 1OJAA 1JNRA 3CIRA 4GRTA 3NN6X 3EANA 1N4WA 1TYPA 1V59A 2R0GA 3EAOA 4IA6A 4I59A 3M12A 3NGCX 4K7ZA 4TM3A 4EQRA 3Q9TA 4H2QA 4KX6A 5LV9A 1RSGA 4H7UA 3VR8A 3P4QA 4GF7A 1Y56B 4J56A 4H4VA 2ZZBA 3DMEA 3LZXA 5L46A 2A89A 1F6MA 4B63A 4PABA 1DODA 4HB9A 2J3NA 3CPIG 1H7XA 5KVHA 4APNA 3UKHA 4EQWA 1X31B 5BULA 1DJNA 1NHQA 2BS3A 4C3XA 1JNZA 3AEEA 4YXDA 4Z25A 3AWIA 3LADA 2GV8A 3UKPA 1EL9A 1PBFA 3NIXA 4C77A 4C74A 2JAEA 2IIDA 2WDQA 4YWOA 1XHCA 2XFOA 3AYLA 1N4UA 4OPTA 3QJ4A 5KRQA 1IUVA 5KVIA 4YKGA 3NYCA 2GRTA 4AT0A 4B65A 1CL0A 2BYBA 2GR1A 2HQMA 3HZLA 1GEUA 1NHSA 2VVMA 1XDIA 1QO8A 2A87A 2XLPA 3F8DA 4H4XA 3AE9A 3UKLA 2FJAA 4J31A 3JSKA 1IJHA 2RGJA 1DOEA 3GDNA 4EIPA 3IHGA 4HA6A 3FPZA 1H7WA 3AB1A 3DJEA 1BF3A 1E39A 2EQ8A 4K22A 1PJ7A 2BC1A 1NHPA 2NVKX 4OPCA 4RG3A 5EOWA 4Z2TA 5HY5A 5M0ZA 5U63A 1L9EA 3P4SA 3DK9A 2R0CA 3RP7A 4WCTA 1H83A 2GAGB 2C3CA 2QA2A 3AE1A 1PBCA 3CNJA 3OZ2A 1IUUA 1CC6A 4YT0A 1Y56A 2YR4A 5BVAA 2GMJA 5CKUA 4IVMB 2YG4A 1TDKA 4A79A 4H4ZA 4CRTA 2XVEA 4U8JA 2RGHA 3I6DA 4OPUA 3AEFA 2GQWA 2C72A 4H50A 5M10A 1GTHA 3FIMB 4A65A 3NRNA 1FECA 1JU2A 2JKCA 3UTGA 4B69A 1PBBA 1ZOYA 4I58A 4YKFA 5DBJA 1AOGA 3GDPA 1GT8A 5BRTA 3CGCA 2YLRA 3GYJA 1EL5A 1CHUA 4Y4MA 1GXFA 2VVLA 3H4KA 2GAHB 1MO9A 3O0HA 1MXTA 2BA9A 3V76A 4YSZA 1H86A 1GREA 4K2XA 3AE8A 4O5QA 2YR5A 2BCPA 4K5RA 2V60A 1NG4A 1CC2A 2WOIA 2Q0LA 2WPFA 2XDOA 3UTHA 2OLOA 2BCGG 4BK3A 4BJYA 3URHA 2C76A 2C3DA 3KU9A 1NDAA 4CY6A 1MOKA 4DSHA 4EMIA 4ECHA 3GD4A 5KOWA 1ZK7A 3CGBA 3ITJA 3LZWA 1EL7A 1NAAA 4AP3A 3UKQA 2X8HA 4NTCA 2V6OA 1GV4A 3NT6A 4OPIA 1GRGA 4ICYA 4Y4LA 2FBWA 1Y0PA 3QSSA 1ZMDA 4J33A 4Z2RA 3BHKA 4Z43A 2UZZA 1GRTA 1D7YA 3B3RA 2B7SA 2Z5YA 3EPTA 2B76A 3ATQA 3CGEA 2TMDA 1E1MA 3NK1X 4XWRA 2YG7A 4Y4NA 3NK2X 1JRXA 2XYOA 1F3PA 4IA5A 1VG0A 3CPHG 4K8DA 1PHHA 4C5OA 5JCLA 2ZZCA 1KFYA 4TM0A 1F8RA 1PJ6A 2XFNA 1YQ4A 2R4JA 1BGNA 2A8XA 1IUTA 3KKJA 3LB8A 4AP1A 4Z2UA 1N1PA 3UOYA 4EMJA 2F5ZA 1PJ5A 2XLUA 4DSGA 3IC9A 3UKAA 4AOXA 1L9CA 2YM2A 1K0JA 2YLWA 3CNSA 3DK4A 3KD9A 1OJTA 4OCGA 1ZDLA 2EQ6A 4X9NA 3DGZA 4GDPA 3D8XA 3ABVA 2CULA 2WHDA 1FCDA 2XLTA 2DKIA 2WU5A 3K7TA 4D04A 3DA1A 5HHFA 3G5QA 1FL2A 4JQ9A 2ZZ0A 4JY2A 1B37A 3K7MX 4BURA 3ALJA 3CN8A 4H4QA 3LXDA 2AQJA 1NENA 2BK3A 2I0ZA 2XVJA 4CNKA
chains in the Genus database with same CATH superfamily
4UDPA 4RSLA 2YG5A 1PXAA 4X4JA 3K30A 1YQZA 2Q7VA 3CPJG 3QFAA 3UOXA 3UOZA 3UTFA 4BJZA 4NZHA 3DGHA 2R46A 4H4UA 4K5SA 1S2YA 2YG3A 3AYJA 5KNLA 1JRYA 1IUWA 3HYWA 1VQWA 2JB2A 1CJCA 4H4WA 1VRQB 1E1KA 2XLSA 2NPXA 3EF6A 3NN0X 4J34A 4U8PA 3COXA 5KMSA 1B4VA 1GALA 1VG9A 3I3LA 4JY3A 4XXGA 1OJ9A 3SYIA 4EMWA 3SQPA 1XPQA 3T31A 1ZKQA 4NEVA 4EM3A 4UP3A 4FDCB 5IPYA 4C3YA 2ARDA 2YQUA 1CJ4A 3UP4A 4U8KA 1TDOA 4LA1A 1E1NA 4GAVA 5FS7A 2V5ZA 2XVHA 4B68A 3BNUA 3BNMA 3OC4A 5KWFA 1E7PA 3UP5A 1LV0A 3C4AA 1CJ2A 1REOA 4N9XA 3AE2A 4DNAA 2BS2A 2BS4A 2Q0KA 1H81A 3R9UA 3BI4A 4CY8A 3P9UA 3NHOX 2WOVA 3V3OA 4A7AA 2JBVA 2V3BA 3ADAB 1DOCA 2WOWA 4U2SA 2OALA 3ISHA 4U2TA 3NTDA 1E6EA 3AE7A 2JK6A 2PHHA 2X3NA 2OAMA 3T0KA 5U1OA 3RP8A 2R0PA 2W0HA 2BK4A 2C75A 1D4EA 2Y6QA 3ZYXA 3DJJA 4Z26A 3H8LA 3S5WA 1IUSA 2E5VA 4H4SA 3T2YA 2X8GA 2H88A 3F8PA 3NYFA 4JN9A 2X8CA 2IVEA 3ZDNA 4EQXA 3HYXA 4UDQA 2VRLA 1EBDA 3NK0X 1YQ3A 5C3JA 3GWDA 3E1TA 4XWZA 4TM1A 1K4QA 1ZX9A 4Z44A 4EM4A 3KLJA 2XFPA 4FK1A 4B64A 1F8SA 3ICRA 4ZCDA 2YVFA 3NKSA 1LVLA 1KF6A 2QCUA 1D4CA 4LIIA 5GSNA 1H82A 1ONFA 3GMBA 1GOSA 2BABA 5CQFA 4CNJA 4A99A 5KMRA 2C64A 2FJDA 4OVIA 4BV6A 1DNCA 4MJWA 3S61A 3QVRA 2VZ2A 2C7GA 4H4YA 1UKVG 4A9WA 3VRAA 4D03A 4OPLA 3KA7A 1B8SA 2EQ7A 3V3NA 3VR9A 3ICTA 4O5UA 4WX1A 2GR2A 3UKKA 1PBDA 2APGA 1Q1WA 4ADWA 4M52A 4GR1A 2WPEA 1PN0A 1VDCA 2B9XA 1QJDA 4KPRA 1TDFA 1FEBA 3AEDA 2GQFA 5FS8A 5GRTA 3NNEA 3F8RA 1GETA 2VQBA 2GR0A 3FG2P 2FJBA 3FMWA 1GRFA 5KOXA 2YVJA 3AE6A 1O5WA 3PVCA 3UCLA 1PDHA 3FBSA 3AEBA 1ZMCA 3IF9A 4U8OA 5HXIA 1B5QA 1TDEA 2GB0A 3ALMA 2C70A 3DH9A 5BUKA 5TR3A 1YKJA 2RGOA 1NG3A 2VQ7A 1QLBA 2AR8A 3VRDB 3SFDA 3AYIA 4U8LA 2BK5A 3GSIA 5EB4A 4A6NA 2DKHA 2R4EA 1Q9IA 2QAEA 3SZFA 4YSXA 1FOHA 2YLZA 3GRTA 3AEGA 2YVGA 2YG6A 3WE0A 1XANA 2VRMA 2GF3A 3II4A 1DXLA 1K0IA 2WESA 3AE3A 1JEHA 2WS3A 2ZBWA 3UOVA 4NTEA 2GEWA 1NHRA 1ZOVA 2YLTA 4UDRA 1JOAA 4ZCCA 4IVOB 4YSYA 2WETA 3C96A 1CF3A 3QSEA 4GDEA 1P2EA 3AECA 1KSUA 2WDVA 5FS9A 1M6IA 3NLCA 2C67A 3QVPA 2X99A 3PS9A 1Z6LA 3ALLA 2O9ZA 1DOBA 4H2PA 3B6DA 1S3EA 1H6VA 3CMMA 4G73A 4ZN0A 4GCMA 1D4DA 1DJQA 4G6GA 2YWLA 3KVEA 1TRBA 2XVIA 2Y6RA 5C2TA 4H4PA 4Z24A 2XFUA 2C66A 1F8WA 2BACA 4DGKA 3M13A 3D1CA 1KSSA 3AE5A 4II3A 4BK1A 4NTDA 4B66A 2R9ZA 4TLXA 2VOUA 2GR3A 4CBQA 3P1WA 2B7RA 3AE4A 2CVJA 3M0OA 3ICSA 3RHAA 2WQYA 5IQ1A 1S2QA 2H89A 2C73A 5FS6A 2YLXA 1LQUA 3G5RA 1GSNA 2GVCA 1Q1RA 1M64A 4TM4A 3BI5A 1H84A 4J57A 1GRHA 1BZLA 5JCKA 2XVFA 3AD8B 4H4RA 3CNDA 3QSMA 4FX9A 2GMHA 2BRAA 4IV9A 1OJDA 3QFBA 1PS9A 4YTPA 1E1LA 3BI2A 5EBKA 2JB3A 2C65A 3T37A 4BK2A 4E0VA 2FJEA 4X9MA 3ATRA 2Q6UA 2YAUA 3NG7X 2E4GA 1D5TA 3NTAA 4P9SA 2OA1A 3GWFA 3PO7A 4TLZA 4JNQA 5JCIA 3LOVA 4J2WA 4LU6A 3DJGX 4G74A 2QA1A 2WP5A 2WU2A 1COYA 2V3AA 2BC0A 1ELIA 1L9DA 1N4VA 1KNPA 1LTXR 1CBOA 1GRBA 3DJDA 4CCRA 2ACZA 1TYTA 2CDUA 3IHMA 2WEUA 4JDRA 1S3BA 1IUXA 4PAAA 5EB5A 1CC4A 4A6NB 5IQ4A 4AOSA 4USQA 4U8MA 1GERA 3AEAA 3DK8A 1W4XA 4JNAA 3K7QX 3L1RA 1RYIA 4GUVA 4OPDA 1TDNA 3HYVA 2VVLG 3SZ0A 1GPEA 3AD9B 3UKFA 2CFYA 1BKWA 3SFEA 3KPKA 5J7XA 4A5LA 1RP0A 1GNDA 4AT2A 2OLNA 5JCMA 3VQRA 2PYXA 3P4PA 4H2RA 3AXBA 2WP9A 4U8NA 3NH3X 1O94A 4J36A 1LQTA 2BXRA 1ZY8A 3C4NA 4NEWA 3L8KA 2WP6A 2E1MA 2V61A 3CNTA 3BHFA 2EQ9A 1PXBA 3SXIA 1L0VA 3NYEA 3UTEA 4CCQA 1HYUA 1FEAA 3CGDA 4II2A 5FMHA 1NPXA 1KDGA 1O95A 2TPRA 3AD7B 4G6HA 1BWCA 1SEZA 3GRSA 2WBAA 4U8IA 2RABA 4YTMA 3CNPA 4REKA 3Q6JA 1CJ3A 4RG4A 3H8IA 5KXJA 4B1BA 2YM1A 3CTYA 5ER0A 2R45A 1PXCA 3REDA 1D7LA 4OPGA 3VRBA 4G9KA 4EQSA 1LJ1A 5J60A 1JRZA 3G5SA 5U25A 3GD3A 4U2LA 1GRAA 3GMCA 1P2HA 3P4RA 4H2NA 2B9WA 3SM8A 2YLSA 3RNMA 1EL8A 1K0LA 3RP6A 4B67A 3KPFA 3SX6A 1GTEA 2AAQA 2WDRA 2Z5XA 3GYIA 3SZCA 1LPFA 4FK1C 2WPCA 1OJCA 2X50A 2XLRA 1NEKA 4EIQA 1BGJA 2JB1A 1GESA 2BXSA 4H4TA 1ZP0A 3LJPA 2B9YA 2IVDA 5JCNA 2XCGA 2GH5A 4YSHA 4YTNA 5HYMA 1KNRA 4USRA 2YR6A 1YY5A 3IWAA 1PBEA 2XFQA 1OJAA 1JNRA 3CIRA 4GRTA 3NN6X 3EANA 1N4WA 1TYPA 1V59A 2R0GA 3EAOA 4IA6A 4I59A 3M12A 3NGCX 4K7ZA 4TM3A 4EQRA 3Q9TA 4H2QA 4KX6A 5LV9A 1RSGA 4H7UA 3VR8A 3P4QA 4GF7A 1Y56B 4J56A 4H4VA 3T2KA 2ZZBA 3DMEA 3LZXA 5L46A 2A89A 1F6MA 4B63A 4PABA 1DODA 4HB9A 2J3NA 3CPIG 1H7XA 5KVHA 4APNA 3UKHA 4EQWA 1X31B 5BULA 1DJNA 1NHQA 2BS3A 4C3XA 1JNZA 3AEEA 4YXDA 4Z25A 3AWIA 3LADA 2GV8A 3UKPA 1EL9A 1PBFA 3NIXA 4C77A 4C74A 2JAEA 2IIDA 2WDQA 4YWOA 1XHCA 2XFOA 3AYLA 1N4UA 4NWZA 3QJ4A 4OPTA 5KRQA 1IUVA 5KVIA 4YKGA 3NYCA 2GRTA 4AT0A 4B65A 1CL0A 2BYBA 2GR1A 2HQMA 3HZLA 1GEUA 1NHSA 2VVMA 3T2ZA 1XDIA 1QO8A 2A87A 2XLPA 3F8DA 4GAPA 3AE9A 4H4XA 3UKLA 2FJAA 4J31A 3JSKA 1IJHA 2RGJA 1DOEA 3GDNA 4EIPA 3IHGA 4HA6A 3FPZA 1H7WA 3AB1A 3DJEA 1BF3A 1E39A 2EQ8A 4K22A 3GYXA 1PJ7A 2BC1A 1NHPA 2NVKX 4OPCA 4RG3A 5EOWA 4Z2TA 5HY5A 5M0ZA 5U63A 1L9EA 3P4SA 3DK9A 2R0CA 5KMPA 3RP7A 4WCTA 1H83A 2GAGB 2C3CA 2QA2A 3AE1A 1PBCA 3CNJA 3OZ2A 1IUUA 1CC6A 4YT0A 1Y56A 2YR4A 5BVAA 2GMJA 5CKUA 4IVMB 2YG4A 1TDKA 4A79A 4H4ZA 4CRTA 2XVEA 4U8JA 2RGHA 3I6DA 4OPUA 3AEFA 2GQWA 2C72A 4H50A 5M10A 1GTHA 3FIMB 4A65A 3NRNA 1FECA 1JU2A 2C4CA 2JKCA 3UTGA 4B69A 1PBBA 1ZOYA 4I58A 4YKFA 5DBJA 1AOGA 3GDPA 1GT8A 5BRTA 3CGCA 2YLRA 4NNJA 3GYJA 1EL5A 3SZWA 1CHUA 4Y4MA 1GXFA 2VVLA 3H4KA 2GAHB 1MO9A 3O0HA 2BA9A 1MXTA 3V76A 4YSZA 1H86A 1GREA 4K2XA 3AE8A 4O5QA 2YR5A 2BCPA 4K5RA 2V60A 1NG4A 1CC2A 2WOIA 2Q0LA 2WPFA 2XDOA 3UTHA 2OLOA 2BCGG 4BK3A 4BJYA 3SY4A 3URHA 2C76A 2C3DA 3KU9A 1NDAA 4CY6A 1MOKA 4DSHA 4EMIA 4ECHA 3GD4A 5KOWA 1ZK7A 3CGBA 3ITJA 3LZWA 1EL7A 1NAAA 4AP3A 3UKQA 2X8HA 4NTCA 2BRYA 2V6OA 1GV4A 3NT6A 4OPIA 1GRGA 4ICYA 4Y4LA 2FBWA 1Y0PA 3QSSA 1ZMDA 4J33A 4Z2RA 3BHKA 4Z43A 2UZZA 1GRTA 1D7YA 3B3RA 2B7SA 2Z5YA 3EPTA 2B76A 3ATQA 3CGEA 2TMDA 1E1MA 3NK1X 4XWRA 2YG7A 4Y4NA 3NK2X 1JRXA 2XYOA 1F3PA 4IA5A 1VG0A 3CPHG 4K8DA 1PHHA 4C5OA 5JCLA 2ZZCA 1KFYA 4TM0A 1F8RA 1PJ6A 2XFNA 1YQ4A 2R4JA 1BGNA 2A8XA 1IUTA 3KKJA 3LB8A 4AP1A 4Z2UA 1N1PA 3UOYA 4EMJA 2F5ZA 1PJ5A 2XLUA 3SGLA 3IC9A 3UKAA 4DSGA 4AOXA 1L9CA 2YM2A 1K0JA 2YLWA 3CNSA 3DK4A 3KD9A 1OJTA 4OCGA 1ZDLA 2EQ6A 4X9NA 3DGZA 4GDPA 3D8XA 3ABVA 2CULA 2WHDA 1FCDA 2XLTA 2DKIA 2WU5A 3K7TA 3T14A 3DA1A 4D04A 5HHFA 3G5QA 1FL2A 4JQ9A 2ZZ0A 4JY2A 5KMQA 1B37A 3K7MX 4BURA 3ALJA 3CN8A 4H4QA 3LXDA 2AQJA 1NENA 2BK3A 2I0ZA 2XVJA 4CNKA
chains in the Genus database with same CATH topology
4UDPA 4RSLA 2YG5A 1PXAA 4X4JA 3K30A 1YQZA 2Q7VA 3CPJG 3QFAA 3UOXA 3UOZA 3UTFA 4BJZA 4NZHA 3DGHA 2R46A 4H4UA 4K5SA 1S2YA 2YG3A 3AYJA 5KNLA 1JRYA 1IUWA 3HYWA 1VQWA 2JB2A 1CJCA 4H4WA 1VRQB 1E1KA 2XLSA 2NPXA 3EF6A 3NN0X 4J34A 4U8PA 3COXA 5KMSA 1B4VA 1GALA 1VG9A 3I3LA 4JY3A 4XXGA 1OJ9A 3SYIA 4EMWA 3SQPA 1XPQA 3T31A 1ZKQA 4NEVA 4EM3A 4UP3A 4FDCB 5IPYA 4C3YA 2ARDA 2YQUA 1CJ4A 3UP4A 4U8KA 1TDOA 4LA1A 1E1NA 4GAVA 5FS7A 2V5ZA 2XVHA 4B68A 3BNUA 3BNMA 3OC4A 5KWFA 1E7PA 3UP5A 1LV0A 3C4AA 1CJ2A 1REOA 4N9XA 3AE2A 4DNAA 2BS2A 2BS4A 2Q0KA 1H81A 3R9UA 3BI4A 4CY8A 3P9UA 3NHOX 2WOVA 3V3OA 4A7AA 2JBVA 2V3BA 3ADAB 1DOCA 2WOWA 4U2SA 2OALA 3ISHA 4U2TA 3NTDA 1E6EA 3AE7A 2JK6A 2PHHA 2X3NA 2OAMA 3T0KA 5U1OA 3RP8A 2R0PA 2W0HA 2BK4A 2C75A 1D4EA 2Y6QA 3ZYXA 3DJJA 4Z26A 3H8LA 3S5WA 1IUSA 2E5VA 4H4SA 3T2YA 2X8GA 2H88A 3F8PA 3NYFA 4JN9A 2X8CA 2IVEA 3ZDNA 4EQXA 3HYXA 4UDQA 2VRLA 1EBDA 3NK0X 1YQ3A 5C3JA 3GWDA 3E1TA 4XWZA 4TM1A 1K4QA 1ZX9A 4Z44A 4EM4A 3KLJA 2XFPA 4FK1A 4B64A 1F8SA 3ICRA 4ZCDA 2YVFA 3NKSA 1LVLA 1KF6A 2QCUA 1D4CA 4LIIA 5GSNA 1H82A 1ONFA 3GMBA 1GOSA 2BABA 5CQFA 4CNJA 4A99A 5KMRA 2C64A 2FJDA 4OVIA 4BV6A 1DNCA 4MJWA 3S61A 3QVRA 2VZ2A 2C7GA 4H4YA 1UKVG 4A9WA 3VRAA 4D03A 4OPLA 3KA7A 1B8SA 2EQ7A 3V3NA 3VR9A 3ICTA 4O5UA 4WX1A 2GR2A 3UKKA 1PBDA 2APGA 1Q1WA 4ADWA 4M52A 4GR1A 2WPEA 1PN0A 1VDCA 1QJDA 2B9XA 4KPRA 1TDFA 1FEBA 3AEDA 2GQFA 5FS8A 5GRTA 3NNEA 3F8RA 1GETA 2VQBA 2GR0A 3FG2P 2FJBA 3FMWA 1GRFA 5KOXA 2YVJA 3AE6A 1O5WA 3PVCA 3UCLA 1PDHA 3FBSA 3AEBA 1ZMCA 3IF9A 4U8OA 5HXIA 1B5QA 1TDEA 2GB0A 3ALMA 2C70A 3DH9A 5BUKA 5TR3A 1YKJA 2RGOA 1NG3A 2VQ7A 1QLBA 2AR8A 3VRDB 3SFDA 3AYIA 4U8LA 2BK5A 3GSIA 5EB4A 4A6NA 2DKHA 2R4EA 1Q9IA 2QAEA 3SZFA 4YSXA 1FOHA 2YLZA 3GRTA 3AEGA 2YVGA 2YG6A 1XANA 3II4A 2VRMA 2GF3A 3SGLA 1DXLA 3WE0A 1K0IA 2WESA 3AE3A 1JEHA 2WS3A 2ZBWA 3UOVA 4NTEA 2GEWA 1NHRA 1ZOVA 2YLTA 4UDRA 1JOAA 4ZCCA 4IVOB 4YSYA 2WETA 3C96A 1CF3A 3QSEA 4GDEA 1P2EA 3AECA 1KSUA 2WDVA 5FS9A 1M6IA 3NLCA 2C67A 3QVPA 2X99A 3PS9A 1Z6LA 3ALLA 2O9ZA 1DOBA 4H2PA 3B6DA 1S3EA 1H6VA 3CMMA 4G73A 4ZN0A 4GCMA 1D4DA 1DJQA 4G6GA 2YWLA 3KVEA 1TRBA 2XVIA 2Y6RA 5C2TA 4H4PA 4Z24A 2XFUA 2C66A 1F8WA 2BACA 4DGKA 3M13A 3D1CA 1KSSA 3AE5A 4II3A 4BK1A 4NTDA 4B66A 2R9ZA 4TLXA 2VOUA 2GR3A 4CBQA 3P1WA 2B7RA 3AE4A 2CVJA 3M0OA 3ICSA 3RHAA 2WQYA 5IQ1A 1S2QA 2H89A 2C73A 5FS6A 2YLXA 1LQUA 3G5RA 1GSNA 2GVCA 1Q1RA 1M64A 4TM4A 3BI5A 1H84A 4J57A 1GRHA 1BZLA 5JCKA 2XVFA 3AD8B 4H4RA 3CNDA 3QSMA 4FX9A 2GMHA 2BRAA 4IV9A 1OJDA 3QFBA 1PS9A 4YTPA 1E1LA 3BI2A 5EBKA 2JB3A 2C65A 3T37A 4BK2A 4E0VA 2FJEA 4X9MA 3ATRA 2Q6UA 2YAUA 3NG7X 2E4GA 1D5TA 3NTAA 4P9SA 2OA1A 3GWFA 3PO7A 4TLZA 4JNQA 5JCIA 3LOVA 4J2WA 4LU6A 3DJGX 4G74A 2QA1A 2WP5A 2WU2A 1COYA 2V3AA 2BC0A 1ELIA 1L9DA 1N4VA 1KNPA 1LTXR 1CBOA 1GRBA 3DJDA 4CCRA 2ACZA 1TYTA 2CDUA 3IHMA 2WEUA 4JDRA 1S3BA 1IUXA 4PAAA 5EB5A 1CC4A 4A6NB 5IQ4A 4AOSA 4USQA 4U8MA 1GERA 3AEAA 3DK8A 1W4XA 4JNAA 3K7QX 3L1RA 1RYIA 4GUVA 4OPDA 1TDNA 3HYVA 2VVLG 3SZ0A 1GPEA 3AD9B 3UKFA 2CFYA 1BKWA 3SFEA 3KPKA 5J7XA 4A5LA 1RP0A 1GNDA 4AT2A 2OLNA 5JCMA 3VQRA 2PYXA 3P4PA 4H2RA 3AXBA 2WP9A 4U8NA 3NH3X 1O94A 4J36A 1LQTA 2BXRA 1ZY8A 3C4NA 4NEWA 3L8KA 2WP6A 2E1MA 2V61A 3CNTA 3BHFA 2EQ9A 1PXBA 3SXIA 1L0VA 3NYEA 3UTEA 4CCQA 1HYUA 1FEAA 3CGDA 4II2A 5FMHA 1NPXA 1KDGA 1O95A 2TPRA 3AD7B 4G6HA 1BWCA 1SEZA 3GRSA 2WBAA 4U8IA 2RABA 4YTMA 3CNPA 4REKA 3Q6JA 1CJ3A 4RG4A 3H8IA 5KXJA 4B1BA 2YM1A 3CTYA 5ER0A 2R45A 1PXCA 3REDA 1D7LA 4OPGA 3VRBA 4G9KA 4EQSA 1LJ1A 5J60A 1JRZA 3G5SA 5U25A 3GD3A 4U2LA 1GRAA 3GMCA 1P2HA 3P4RA 4H2NA 2B9WA 3SM8A 2YLSA 3RNMA 1EL8A 1K0LA 3RP6A 4B67A 3KPFA 3SX6A 1GTEA 2AAQA 2WDRA 2Z5XA 3GYIA 3SZCA 1LPFA 4FK1C 2WPCA 1OJCA 2X50A 2XLRA 1NEKA 4EIQA 1BGJA 2JB1A 1GESA 2BXSA 4H4TA 1ZP0A 3LJPA 2B9YA 2IVDA 5JCNA 2XCGA 2GH5A 4YSHA 4YTNA 5HYMA 1KNRA 4USRA 2YR6A 1YY5A 3IWAA 1PBEA 2XFQA 1OJAA 1JNRA 3CIRA 4GRTA 3NN6X 3EANA 1N4WA 1TYPA 1V59A 2R0GA 3EAOA 4IA6A 4I59A 3M12A 3NGCX 4K7ZA 4TM3A 4EQRA 3Q9TA 4H2QA 4KX6A 5LV9A 1RSGA 4H7UA 3VR8A 3P4QA 4GF7A 1Y56B 4J56A 4H4VA 3T2KA 2ZZBA 3DMEA 3LZXA 5L46A 2A89A 1F6MA 4B63A 4PABA 1DODA 4HB9A 2J3NA 3CPIG 1H7XA 5KVHA 4APNA 3UKHA 4EQWA 1X31B 5BULA 1DJNA 1NHQA 2BS3A 4C3XA 1JNZA 3AEEA 4YXDA 4Z25A 3AWIA 3LADA 2GV8A 3UKPA 1EL9A 1PBFA 3NIXA 4C77A 4C74A 2JAEA 2IIDA 2WDQA 4YWOA 1XHCA 2XFOA 3AYLA 1N4UA 4NWZA 3QJ4A 4OPTA 5KRQA 1IUVA 5KVIA 4YKGA 3NYCA 2GRTA 4AT0A 4B65A 1CL0A 2BYBA 2GR1A 2HQMA 3HZLA 1GEUA 1NHSA 2VVMA 3T2ZA 1XDIA 1QO8A 2A87A 2XLPA 3F8DA 4GAPA 3AE9A 4H4XA 3UKLA 2FJAA 4J31A 3JSKA 1IJHA 2RGJA 1DOEA 3GDNA 4EIPA 3IHGA 4HA6A 3FPZA 1H7WA 3AB1A 3DJEA 1BF3A 1E39A 2EQ8A 4K22A 3GYXA 1PJ7A 2BC1A 1NHPA 2NVKX 4OPCA 4RG3A 5EOWA 4Z2TA 5HY5A 5M0ZA 5U63A 1L9EA 3P4SA 3DK9A 2R0CA 5KMPA 3RP7A 4WCTA 1H83A 2GAGB 2C3CA 2QA2A 3AE1A 1PBCA 3CNJA 3OZ2A 1IUUA 1CC6A 4YT0A 1Y56A 2YR4A 5BVAA 2GMJA 5CKUA 4IVMB 2YG4A 1TDKA 4A79A 4H4ZA 4CRTA 2XVEA 4U8JA 2RGHA 3I6DA 4OPUA 3AEFA 2GQWA 2C72A 4H50A 5M10A 1GTHA 3FIMB 4A65A 3NRNA 1FECA 1JU2A 2C4CA 2JKCA 3UTGA 4B69A 1PBBA 1ZOYA 4I58A 4YKFA 5DBJA 1AOGA 3GDPA 1GT8A 5BRTA 3CGCA 2YLRA 4NNJA 3GYJA 1EL5A 3SZWA 1CHUA 4Y4MA 1GXFA 2VVLA 3H4KA 2GAHB 1MO9A 3O0HA 1MXTA 2BA9A 3V76A 4YSZA 1H86A 1GREA 4K2XA 3AE8A 4O5QA 2YR5A 2BCPA 4K5RA 2V60A 1NG4A 1CC2A 2WOIA 2Q0LA 2WPFA 2XDOA 3UTHA 2OLOA 2BCGG 4BK3A 4BJYA 3SY4A 3URHA 2C76A 2C3DA 3KU9A 1NDAA 4CY6A 1MOKA 4DSHA 4EMIA 4ECHA 3GD4A 5KOWA 1ZK7A 3CGBA 3ITJA 3LZWA 1EL7A 1NAAA 4AP3A 3UKQA 2X8HA 4NTCA 2BRYA 2V6OA 1GV4A 3NT6A 4OPIA 1GRGA 4ICYA 4Y4LA 2FBWA 1Y0PA 3QSSA 1ZMDA 4J33A 4Z2RA 3BHKA 4Z43A 2UZZA 1GRTA 1D7YA 3B3RA 2B7SA 2Z5YA 3EPTA 2B76A 3ATQA 3CGEA 2TMDA 1E1MA 3NK1X 4XWRA 2YG7A 4Y4NA 3NK2X 1JRXA 2XYOA 1F3PA 4IA5A 1VG0A 3CPHG 4K8DA 1PHHA 4C5OA 5JCLA 2ZZCA 1KFYA 4TM0A 1F8RA 1PJ6A 2XFNA 1YQ4A 2R4JA 1BGNA 2A8XA 1IUTA 3KKJA 3LB8A 4AP1A 4Z2UA 1N1PA 3UOYA 4EMJA 2F5ZA 1PJ5A 2XLUA 4DSGA 3IC9A 3UKAA 4AOXA 1L9CA 2YM2A 1K0JA 2YLWA 3CNSA 3DK4A 3KD9A 1OJTA 4OCGA 1ZDLA 2EQ6A 4X9NA 3DGZA 4GDPA 3D8XA 3ABVA 2CULA 2WHDA 1FCDA 2XLTA 2DKIA 2WU5A 3K7TA 3T14A 3DA1A 4D04A 5HHFA 3G5QA 1FL2A 4JQ9A 2ZZ0A 4JY2A 5KMQA 1B37A 3K7MX 4BURA 3ALJA 3CN8A 4H4QA 3LXDA 2AQJA 1NENA 2BK3A 2I0ZA 2XVJA 4CNKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UDP A;  4RSL A;  2YG5 A;  1PXA A;  4X4J A;  3K30 A;  1YQZ A;  2Q7V A;  3CPJ G;  3QFA A;  3UOX A;  3UOZ A;  3UTF A;  4BJZ A;  4NZH A;  3DGH A;  2R46 A;  4H4U A;  4K5S A;  1S2Y A;  2YG3 A;  3AYJ A;  1JRY A;  1IUW A;  1VQW A;  2JB2 A;  1CJC A;  4H4W A;  1VRQ B;  1E1K A;  2XLS A;  2NPX A;  3EF6 A;  3NN0 X;  4J34 A;  4U8P A;  3COX A;  1B4V A;  1GAL A;  1VG9 A;  3I3L A;  4JY3 A;  4XXG A;  1OJ9 A;  4EMW A;  3SQP A;  1XPQ A;  4EM3 A;  1ZKQ A;  4NEV A;  5IPY A;  4UP3 A;  4FDC B;  4C3Y A;  2ARD A;  2YQU A;  1CJ4 A;  3UP4 A;  4U8K A;  1TDO A;  4LA1 A;  1E1N A;  5FS7 A;  2V5Z A;  2XVH A;  4B68 A;  3BNU A;  3BNM A;  3OC4 A;  5KWF A;  1E7P A;  3UP5 A;  1LV0 A;  3C4A A;  1CJ2 A;  1REO A;  4N9X A;  3AE2 A;  4DNA A;  2BS2 A;  2BS4 A;  2Q0K A;  1H81 A;  3R9U A;  3BI4 A;  4CY8 A;  3P9U A;  3NHO X;  2WOV A;  3V3O A;  4A7A A;  2JBV A;  2V3B A;  3ADA B;  1DOC A;  2WOW A;  4U2S A;  2OAL A;  3ISH A;  4U2T A;  3NTD A;  1E6E A;  3AE7 A;  2JK6 A;  2PHH A;  2X3N A;  2OAM A;  5U1O A;  3RP8 A;  2R0P A;  2W0H A;  2BK4 A;  2C75 A;  1D4E A;  2Y6Q A;  3ZYX A;  3DJJ A;  4Z26 A;  3H8L A;  3S5W A;  1IUS A;  2E5V A;  4H4S A;  2X8G A;  2H88 A;  3F8P A;  3NYF A;  4JN9 A;  2X8C A;  2IVE A;  3ZDN A;  4EQX A;  4UDQ A;  2VRL A;  1EBD A;  3NK0 X;  1YQ3 A;  5C3J A;  3GWD A;  3E1T A;  4XWZ A;  4TM1 A;  1K4Q A;  1ZX9 A;  4Z44 A;  4EM4 A;  3KLJ A;  2XFP A;  4FK1 A;  4B64 A;  1F8S A;  3ICR A;  4ZCD A;  2YVF A;  3NKS A;  1LVL A;  1KF6 A;  2QCU A;  1D4C A;  4LII A;  5GSN A;  1H82 A;  1ONF A;  3GMB A;  1GOS A;  2BAB A;  5CQF A;  4CNJ A;  4A99 A;  2C64 A;  2FJD A;  4OVI A;  4BV6 A;  1DNC A;  4MJW A;  3S61 A;  3QVR A;  2VZ2 A;  2C7G A;  4H4Y A;  1UKV G;  4A9W A;  3VRA A;  4D03 A;  4OPL A;  3KA7 A;  1B8S A;  2EQ7 A;  3V3N A;  3VR9 A;  3ICT A;  4O5U A;  4WX1 A;  2GR2 A;  3UKK A;  1PBD A;  2APG A;  1Q1W A;  4ADW A;  4M52 A;  4GR1 A;  2WPE A;  1PN0 A;  1VDC A;  1QJD A;  2B9X A;  4KPR A;  1TDF A;  1FEB A;  3AED A;  2GQF A;  5FS8 A;  5GRT A;  3NNE A;  3F8R A;  1GET A;  2VQB A;  2GR0 A;  3FG2 P;  2FJB A;  3FMW A;  1GRF A;  5KOX A;  2YVJ A;  3AE6 A;  1O5W A;  3PVC A;  3UCL A;  1PDH A;  3FBS A;  3AEB A;  1ZMC A;  3IF9 A;  4U8O A;  5HXI A;  1B5Q A;  1TDE A;  2GB0 A;  3ALM A;  2C70 A;  3DH9 A;  5BUK A;  5TR3 A;  1YKJ A;  2RGO A;  1NG3 A;  2VQ7 A;  1QLB A;  2AR8 A;  3VRD B;  3SFD A;  3AYI A;  4U8L A;  2BK5 A;  3GSI A;  5EB4 A;  4A6N A;  2DKH A;  2R4E A;  1Q9I A;  2QAE A;  4YSX A;  1FOH A;  2YLZ A;  3GRT A;  3AEG A;  2YVG A;  2YG6 A;  1XAN A;  3II4 A;  2VRM A;  2GF3 A;  3SGL A;  1DXL A;  3WE0 A;  1K0I A;  2WES A;  3AE3 A;  1JEH A;  2WS3 A;  2ZBW A;  3UOV A;  4NTE A;  2GEW A;  1NHR A;  1ZOV A;  2YLT A;  4UDR A;  1JOA A;  4ZCC A;  4IVO B;  4YSY A;  2WET A;  3C96 A;  1CF3 A;  3QSE A;  4GDE A;  1P2E A;  3AEC A;  1KSU A;  2WDV A;  5FS9 A;  1M6I A;  3NLC A;  2C67 A;  3QVP A;  2X99 A;  3PS9 A;  1Z6L A;  3ALL A;  2O9Z A;  1DOB A;  4H2P A;  3B6D A;  1S3E A;  1H6V A;  4ZN0 A;  4GCM A;  1D4D A;  1DJQ A;  2YWL A;  3KVE A;  1TRB A;  2XVI A;  2Y6R A;  5C2T A;  4H4P A;  4Z24 A;  2XFU A;  2C66 A;  1F8W A;  2BAC A;  4DGK A;  3M13 A;  3D1C A;  1KSS A;  3AE5 A;  4BK1 A;  4NTD A;  4B66 A;  2R9Z A;  4TLX A;  2VOU A;  2GR3 A;  4CBQ A;  3P1W A;  2B7R A;  3AE4 A;  2CVJ A;  3M0O A;  3ICS A;  3RHA A;  2WQY A;  5IQ1 A;  1S2Q A;  2H89 A;  2C73 A;  5FS6 A;  2YLX A;  1LQU A;  3G5R A;  1GSN A;  2GVC A;  1Q1R A;  1M64 A;  4TM4 A;  3BI5 A;  1H84 A;  4J57 A;  1GRH A;  1BZL A;  5JCK A;  2XVF A;  3AD8 B;  4H4R A;  3CND A;  3QSM A;  4FX9 A;  2GMH A;  4IV9 A;  1OJD A;  3QFB A;  1PS9 A;  4YTP A;  1E1L A;  3BI2 A;  5EBK A;  2JB3 A;  2C65 A;  3T37 A;  4BK2 A;  4E0V A;  2FJE A;  4X9M A;  3ATR A;  2Q6U A;  2YAU A;  3NG7 X;  2E4G A;  1D5T A;  3NTA A;  4P9S A;  2OA1 A;  3GWF A;  3PO7 A;  4TLZ A;  4JNQ A;  5JCI A;  3LOV A;  4J2W A;  4LU6 A;  3DJG X;  2QA1 A;  2WP5 A;  2WU2 A;  1COY A;  2V3A A;  2BC0 A;  1ELI A;  1L9D A;  1N4V A;  1KNP A;  1LTX R;  1CBO A;  1GRB A;  3DJD A;  4CCR A;  2ACZ A;  1TYT A;  2CDU A;  3IHM A;  2WEU A;  4JDR A;  1S3B A;  1IUX A;  4PAA A;  5EB5 A;  1CC4 A;  4A6N B;  5IQ4 A;  4AOS A;  4USQ A;  4U8M A;  1GER A;  3AEA A;  3DK8 A;  1W4X A;  4JNA A;  3K7Q X;  3L1R A;  1RYI A;  4GUV A;  4OPD A;  1TDN A;  2VVL G;  1GPE A;  3AD9 B;  3UKF A;  2CFY A;  1BKW A;  3SFE A;  5J7X A;  4A5L A;  1RP0 A;  1GND A;  4AT2 A;  2OLN A;  5JCM A;  3VQR A;  2PYX A;  3P4P A;  4H2R A;  3AXB A;  2WP9 A;  4U8N A;  3NH3 X;  1O94 A;  4J36 A;  1LQT A;  2BXR A;  1ZY8 A;  3C4N A;  4NEW A;  3L8K A;  2WP6 A;  2E1M A;  2V61 A;  3CNT A;  3BHF A;  2EQ9 A;  1PXB A;  1L0V A;  3NYE A;  3UTE A;  4CCQ A;  1HYU A;  1FEA A;  3CGD A;  5FMH A;  1NPX A;  1KDG A;  1O95 A;  2TPR A;  3AD7 B;  1BWC A;  1SEZ A;  3GRS A;  2WBA A;  4U8I A;  2RAB A;  4YTM A;  3CNP A;  4REK A;  3Q6J A;  1CJ3 A;  4RG4 A;  3H8I A;  5KXJ A;  4B1B A;  2YM1 A;  3CTY A;  5ER0 A;  2R45 A;  1PXC A;  3RED A;  1D7L A;  4OPG A;  3VRB A;  4EQS A;  5J60 A;  1LJ1 A;  1JRZ A;  3G5S A;  5U25 A;  3GD3 A;  4U2L A;  1GRA A;  3GMC A;  1P2H A;  3P4R A;  4H2N A;  2B9W A;  3SM8 A;  2YLS A;  3RNM A;  1EL8 A;  1K0L A;  3RP6 A;  4B67 A;  3KPF A;  1GTE A;  2AAQ A;  2WDR A;  2Z5X A;  3GYI A;  1LPF A;  4FK1 C;  2WPC A;  1OJC A;  2X50 A;  2XLR A;  1NEK A;  4EIQ A;  1BGJ A;  2JB1 A;  1GES A;  2BXS A;  4H4T A;  1ZP0 A;  3LJP A;  2B9Y A;  2IVD A;  5JCN A;  2XCG A;  2GH5 A;  4YSH A;  4YTN A;  5HYM A;  1KNR A;  4USR A;  2YR6 A;  1YY5 A;  3IWA A;  1PBE A;  2XFQ A;  1OJA A;  1JNR A;  3CIR A;  4GRT A;  3NN6 X;  3EAN A;  1N4W A;  1TYP A;  1V59 A;  2R0G A;  3EAO A;  4IA6 A;  4I59 A;  3M12 A;  3NGC X;  4K7Z A;  4TM3 A;  4EQR A;  3Q9T A;  4H2Q A;  4KX6 A;  5LV9 A;  1RSG A;  4H7U A;  3VR8 A;  3P4Q A;  4GF7 A;  1Y56 B;  4J56 A;  4H4V A;  2ZZB A;  3DME A;  3LZX A;  5L46 A;  2A89 A;  1F6M A;  4B63 A;  4PAB A;  1DOD A;  4HB9 A;  2J3N A;  3CPI G;  1H7X A;  5KVH A;  4APN A;  3UKH A;  4EQW A;  1X31 B;  5BUL A;  1DJN A;  1NHQ A;  2BS3 A;  4C3X A;  1JNZ A;  3AEE A;  4YXD A;  4Z25 A;  3AWI A;  3LAD A;  2GV8 A;  3UKP A;  1EL9 A;  1PBF A;  3NIX A;  4C77 A;  4C74 A;  2JAE A;  2IID A;  2WDQ A;  4YWO A;  1XHC A;  2XFO A;  3AYL A;  1N4U A;  4OPT A;  3QJ4 A;  5KRQ A;  1IUV A;  5KVI A;  4YKG A;  3NYC A;  2GRT A;  4AT0 A;  4B65 A;  1CL0 A;  2BYB A;  2GR1 A;  2HQM A;  3HZL A;  1GEU A;  1NHS A;  2VVM A;  1XDI A;  1QO8 A;  2A87 A;  2XLP A;  3F8D A;  4H4X A;  3AE9 A;  3UKL A;  2FJA A;  4J31 A;  3JSK A;  1IJH A;  2RGJ A;  1DOE A;  3GDN A;  4EIP A;  3IHG A;  4HA6 A;  3FPZ A;  1H7W A;  3AB1 A;  3DJE A;  1BF3 A;  1E39 A;  2EQ8 A;  4K22 A;  1PJ7 A;  2BC1 A;  1NHP A;  2NVK X;  4OPC A;  4RG3 A;  5EOW A;  4Z2T A;  5HY5 A;  5M0Z A;  5U63 A;  1L9E A;  3P4S A;  3DK9 A;  2R0C A;  3RP7 A;  4WCT A;  1H83 A;  2GAG B;  2C3C A;  2QA2 A;  3AE1 A;  1PBC A;  3CNJ A;  3OZ2 A;  1IUU A;  1CC6 A;  4YT0 A;  1Y56 A;  2YR4 A;  5BVA A;  2GMJ A;  5CKU A;  4IVM B;  2YG4 A;  1TDK A;  4A79 A;  4H4Z A;  4CRT A;  2XVE A;  4U8J A;  2RGH A;  3I6D A;  4OPU A;  3AEF A;  2GQW A;  2C72 A;  4H50 A;  5M10 A;  1GTH A;  3FIM B;  4A65 A;  3NRN A;  1FEC A;  1JU2 A;  2JKC A;  3UTG A;  4B69 A;  1PBB A;  1ZOY A;  4I58 A;  4YKF A;  5DBJ A;  1AOG A;  3GDP A;  1GT8 A;  5BRT A;  3CGC A;  2YLR A;  3GYJ A;  1EL5 A;  1CHU A;  4Y4M A;  1GXF A;  2VVL A;  3H4K A;  2GAH B;  1MO9 A;  3O0H A;  1MXT A;  2BA9 A;  3V76 A;  4YSZ A;  1H86 A;  1GRE A;  4K2X A;  3AE8 A;  4O5Q A;  2YR5 A;  2BCP A;  4K5R A;  2V60 A;  1NG4 A;  1CC2 A;  2WOI A;  2Q0L A;  2WPF A;  2XDO A;  3UTH A;  2OLO A;  2BCG G;  4BK3 A;  4BJY A;  3URH A;  2C76 A;  2C3D A;  3KU9 A;  1NDA A;  4CY6 A;  1MOK A;  4DSH A;  4EMI A;  4ECH A;  3GD4 A;  5KOW A;  1ZK7 A;  3CGB A;  3ITJ A;  3LZW A;  1EL7 A;  1NAA A;  4AP3 A;  3UKQ A;  2X8H A;  4NTC A;  2V6O A;  1GV4 A;  3NT6 A;  4OPI A;  1GRG A;  4ICY A;  4Y4L A;  2FBW A;  1Y0P A;  3QSS A;  1ZMD A;  4J33 A;  4Z2R A;  3BHK A;  4Z43 A;  2UZZ A;  1GRT A;  1D7Y A;  3B3R A;  2B7S A;  2Z5Y A;  3EPT A;  2B76 A;  3ATQ A;  3CGE A;  2TMD A;  1E1M A;  3NK1 X;  4XWR A;  2YG7 A;  4Y4N A;  3NK2 X;  1JRX A;  2XYO A;  1F3P A;  4IA5 A;  1VG0 A;  3CPH G;  4K8D A;  1PHH A;  4C5O A;  5JCL A;  2ZZC A;  1KFY A;  4TM0 A;  1F8R A;  1PJ6 A;  2XFN A;  1YQ4 A;  2R4J A;  1BGN A;  2A8X A;  1IUT A;  3KKJ A;  3LB8 A;  4AP1 A;  4Z2U A;  1N1P A;  3UOY A;  4EMJ A;  2F5Z A;  1PJ5 A;  2XLU A;  4DSG A;  3IC9 A;  3UKA A;  4AOX A;  1L9C A;  2YM2 A;  1K0J A;  2YLW A;  3CNS A;  3DK4 A;  3KD9 A;  1OJT A;  4OCG A;  1ZDL A;  2EQ6 A;  4X9N A;  3DGZ A;  4GDP A;  3D8X A;  3ABV A;  2CUL A;  2WHD A;  1FCD A;  2XLT A;  2DKI A;  2WU5 A;  3K7T A;  4D04 A;  3DA1 A;  5HHF A;  3G5Q A;  1FL2 A;  4JQ9 A;  2ZZ0 A;  4JY2 A;  1B37 A;  3K7M X;  4BUR A;  3ALJ A;  3CN8 A;  4H4Q A;  3LXD A;  2AQJ A;  1NEN A;  2BK3 A;  2I0Z A;  2XVJ A;  4CNK A; 
#chains in the Genus database with same CATH topology
 4UDP A;  4RSL A;  2YG5 A;  1PXA A;  4X4J A;  3K30 A;  1YQZ A;  2Q7V A;  3CPJ G;  3QFA A;  3UOX A;  3UOZ A;  3UTF A;  4BJZ A;  4NZH A;  3DGH A;  2R46 A;  4H4U A;  4K5S A;  1S2Y A;  2YG3 A;  3AYJ A;  5KNL A;  1JRY A;  1IUW A;  3HYW A;  1VQW A;  2JB2 A;  1CJC A;  4H4W A;  1VRQ B;  1E1K A;  2XLS A;  2NPX A;  3EF6 A;  3NN0 X;  4J34 A;  4U8P A;  3COX A;  5KMS A;  1B4V A;  1GAL A;  1VG9 A;  3I3L A;  4JY3 A;  4XXG A;  1OJ9 A;  3SYI A;  4EMW A;  3SQP A;  1XPQ A;  3T31 A;  1ZKQ A;  4NEV A;  4EM3 A;  4UP3 A;  4FDC B;  5IPY A;  4C3Y A;  2ARD A;  2YQU A;  1CJ4 A;  3UP4 A;  4U8K A;  1TDO A;  4LA1 A;  1E1N A;  4GAV A;  5FS7 A;  2V5Z A;  2XVH A;  4B68 A;  3BNU A;  3BNM A;  3OC4 A;  5KWF A;  1E7P A;  3UP5 A;  1LV0 A;  3C4A A;  1CJ2 A;  1REO A;  4N9X A;  3AE2 A;  4DNA A;  2BS2 A;  2BS4 A;  2Q0K A;  1H81 A;  3R9U A;  3BI4 A;  4CY8 A;  3P9U A;  3NHO X;  2WOV A;  3V3O A;  4A7A A;  2JBV A;  2V3B A;  3ADA B;  1DOC A;  2WOW A;  4U2S A;  2OAL A;  3ISH A;  4U2T A;  3NTD A;  1E6E A;  3AE7 A;  2JK6 A;  2PHH A;  2X3N A;  2OAM A;  3T0K A;  5U1O A;  3RP8 A;  2R0P A;  2W0H A;  2BK4 A;  2C75 A;  1D4E A;  2Y6Q A;  3ZYX A;  3DJJ A;  4Z26 A;  3H8L A;  3S5W A;  1IUS A;  2E5V A;  4H4S A;  3T2Y A;  2X8G A;  2H88 A;  3F8P A;  3NYF A;  4JN9 A;  2X8C A;  2IVE A;  3ZDN A;  4EQX A;  3HYX A;  4UDQ A;  2VRL A;  1EBD A;  3NK0 X;  1YQ3 A;  5C3J A;  3GWD A;  3E1T A;  4XWZ A;  4TM1 A;  1K4Q A;  1ZX9 A;  4Z44 A;  4EM4 A;  3KLJ A;  2XFP A;  4FK1 A;  4B64 A;  1F8S A;  3ICR A;  4ZCD A;  2YVF A;  3NKS A;  1LVL A;  1KF6 A;  2QCU A;  1D4C A;  4LII A;  5GSN A;  1H82 A;  1ONF A;  3GMB A;  1GOS A;  2BAB A;  5CQF A;  4CNJ A;  4A99 A;  5KMR A;  2C64 A;  2FJD A;  4OVI A;  4BV6 A;  1DNC A;  4MJW A;  3S61 A;  3QVR A;  2VZ2 A;  2C7G A;  4H4Y A;  1UKV G;  4A9W A;  3VRA A;  4D03 A;  4OPL A;  3KA7 A;  1B8S A;  2EQ7 A;  3V3N A;  3VR9 A;  3ICT A;  4O5U A;  4WX1 A;  2GR2 A;  3UKK A;  1PBD A;  2APG A;  1Q1W A;  4ADW A;  4M52 A;  4GR1 A;  2WPE A;  1PN0 A;  1VDC A;  2B9X A;  1QJD A;  4KPR A;  1TDF A;  1FEB A;  3AED A;  2GQF A;  5FS8 A;  5GRT A;  3NNE A;  3F8R A;  1GET A;  2VQB A;  2GR0 A;  3FG2 P;  2FJB A;  3FMW A;  1GRF A;  5KOX A;  2YVJ A;  3AE6 A;  1O5W A;  3PVC A;  3UCL A;  1PDH A;  3FBS A;  3AEB A;  1ZMC A;  3IF9 A;  4U8O A;  5HXI A;  1B5Q A;  1TDE A;  2GB0 A;  3ALM A;  2C70 A;  3DH9 A;  5BUK A;  5TR3 A;  1YKJ A;  2RGO A;  1NG3 A;  2VQ7 A;  1QLB A;  2AR8 A;  3VRD B;  3SFD A;  3AYI A;  4U8L A;  2BK5 A;  3GSI A;  5EB4 A;  4A6N A;  2DKH A;  2R4E A;  1Q9I A;  2QAE A;  3SZF A;  4YSX A;  1FOH A;  2YLZ A;  3GRT A;  3AEG A;  2YVG A;  2YG6 A;  3WE0 A;  1XAN A;  2VRM A;  2GF3 A;  3II4 A;  1DXL A;  1K0I A;  2WES A;  3AE3 A;  1JEH A;  2WS3 A;  2ZBW A;  3UOV A;  4NTE A;  2GEW A;  1NHR A;  1ZOV A;  2YLT A;  4UDR A;  1JOA A;  4ZCC A;  4IVO B;  4YSY A;  2WET A;  3C96 A;  1CF3 A;  3QSE A;  4GDE A;  1P2E A;  3AEC A;  1KSU A;  2WDV A;  5FS9 A;  1M6I A;  3NLC A;  2C67 A;  3QVP A;  2X99 A;  3PS9 A;  1Z6L A;  3ALL A;  2O9Z A;  1DOB A;  4H2P A;  3B6D A;  1S3E A;  1H6V A;  3CMM A;  4G73 A;  4ZN0 A;  4GCM A;  1D4D A;  1DJQ A;  4G6G A;  2YWL A;  3KVE A;  1TRB A;  2XVI A;  2Y6R A;  5C2T A;  4H4P A;  4Z24 A;  2XFU A;  2C66 A;  1F8W A;  2BAC A;  4DGK A;  3M13 A;  3D1C A;  1KSS A;  3AE5 A;  4II3 A;  4BK1 A;  4NTD A;  4B66 A;  2R9Z A;  4TLX A;  2VOU A;  2GR3 A;  4CBQ A;  3P1W A;  2B7R A;  3AE4 A;  2CVJ A;  3M0O A;  3ICS A;  3RHA A;  2WQY A;  5IQ1 A;  1S2Q A;  2H89 A;  2C73 A;  5FS6 A;  2YLX A;  1LQU A;  3G5R A;  1GSN A;  2GVC A;  1Q1R A;  1M64 A;  4TM4 A;  3BI5 A;  1H84 A;  4J57 A;  1GRH A;  1BZL A;  5JCK A;  2XVF A;  3AD8 B;  4H4R A;  3CND A;  3QSM A;  4FX9 A;  2GMH A;  2BRA A;  4IV9 A;  1OJD A;  3QFB A;  1PS9 A;  4YTP A;  1E1L A;  3BI2 A;  5EBK A;  2JB3 A;  2C65 A;  3T37 A;  4BK2 A;  4E0V A;  2FJE A;  4X9M A;  3ATR A;  2Q6U A;  2YAU A;  3NG7 X;  2E4G A;  1D5T A;  3NTA A;  4P9S A;  2OA1 A;  3GWF A;  3PO7 A;  4TLZ A;  4JNQ A;  5JCI A;  3LOV A;  4J2W A;  4LU6 A;  3DJG X;  4G74 A;  2QA1 A;  2WP5 A;  2WU2 A;  1COY A;  2V3A A;  2BC0 A;  1ELI A;  1L9D A;  1N4V A;  1KNP A;  1LTX R;  1CBO A;  1GRB A;  3DJD A;  4CCR A;  2ACZ A;  1TYT A;  2CDU A;  3IHM A;  2WEU A;  4JDR A;  1S3B A;  1IUX A;  4PAA A;  5EB5 A;  1CC4 A;  4A6N B;  5IQ4 A;  4AOS A;  4USQ A;  4U8M A;  1GER A;  3AEA A;  3DK8 A;  1W4X A;  4JNA A;  3K7Q X;  3L1R A;  1RYI A;  4GUV A;  4OPD A;  1TDN A;  3HYV A;  2VVL G;  3SZ0 A;  1GPE A;  3AD9 B;  3UKF A;  2CFY A;  1BKW A;  3SFE A;  3KPK A;  5J7X A;  4A5L A;  1RP0 A;  1GND A;  4AT2 A;  2OLN A;  5JCM A;  3VQR A;  2PYX A;  3P4P A;  4H2R A;  3AXB A;  2WP9 A;  4U8N A;  3NH3 X;  1O94 A;  4J36 A;  1LQT A;  2BXR A;  1ZY8 A;  3C4N A;  4NEW A;  3L8K A;  2WP6 A;  2E1M A;  2V61 A;  3CNT A;  3BHF A;  2EQ9 A;  1PXB A;  3SXI A;  1L0V A;  3NYE A;  3UTE A;  4CCQ A;  1HYU A;  1FEA A;  3CGD A;  4II2 A;  5FMH A;  1NPX A;  1KDG A;  1O95 A;  2TPR A;  3AD7 B;  4G6H A;  1BWC A;  1SEZ A;  3GRS A;  2WBA A;  4U8I A;  2RAB A;  4YTM A;  3CNP A;  4REK A;  3Q6J A;  1CJ3 A;  4RG4 A;  3H8I A;  5KXJ A;  4B1B A;  2YM1 A;  3CTY A;  5ER0 A;  2R45 A;  1PXC A;  3RED A;  1D7L A;  4OPG A;  3VRB A;  4G9K A;  4EQS A;  1LJ1 A;  5J60 A;  1JRZ A;  3G5S A;  5U25 A;  3GD3 A;  4U2L A;  1GRA A;  3GMC A;  1P2H A;  3P4R A;  4H2N A;  2B9W A;  3SM8 A;  2YLS A;  3RNM A;  1EL8 A;  1K0L A;  3RP6 A;  4B67 A;  3KPF A;  3SX6 A;  1GTE A;  2AAQ A;  2WDR A;  2Z5X A;  3GYI A;  3SZC A;  1LPF A;  4FK1 C;  2WPC A;  1OJC A;  2X50 A;  2XLR A;  1NEK A;  4EIQ A;  1BGJ A;  2JB1 A;  1GES A;  2BXS A;  4H4T A;  1ZP0 A;  3LJP A;  2B9Y A;  2IVD A;  5JCN A;  2XCG A;  2GH5 A;  4YSH A;  4YTN A;  5HYM A;  1KNR A;  4USR A;  2YR6 A;  1YY5 A;  3IWA A;  1PBE A;  2XFQ A;  1OJA A;  1JNR A;  3CIR A;  4GRT A;  3NN6 X;  3EAN A;  1N4W A;  1TYP A;  1V59 A;  2R0G A;  3EAO A;  4IA6 A;  4I59 A;  3M12 A;  3NGC X;  4K7Z A;  4TM3 A;  4EQR A;  3Q9T A;  4H2Q A;  4KX6 A;  5LV9 A;  1RSG A;  4H7U A;  3VR8 A;  3P4Q A;  4GF7 A;  1Y56 B;  4J56 A;  4H4V A;  3T2K A;  2ZZB A;  3DME A;  3LZX A;  5L46 A;  2A89 A;  1F6M A;  4B63 A;  4PAB A;  1DOD A;  4HB9 A;  2J3N A;  3CPI G;  1H7X A;  5KVH A;  4APN A;  3UKH A;  4EQW A;  1X31 B;  5BUL A;  1DJN A;  1NHQ A;  2BS3 A;  4C3X A;  1JNZ A;  3AEE A;  4YXD A;  4Z25 A;  3AWI A;  3LAD A;  2GV8 A;  3UKP A;  1EL9 A;  1PBF A;  3NIX A;  4C77 A;  4C74 A;  2JAE A;  2IID A;  2WDQ A;  4YWO A;  1XHC A;  2XFO A;  3AYL A;  1N4U A;  4NWZ A;  3QJ4 A;  4OPT A;  5KRQ A;  1IUV A;  5KVI A;  4YKG A;  3NYC A;  2GRT A;  4AT0 A;  4B65 A;  1CL0 A;  2BYB A;  2GR1 A;  2HQM A;  3HZL A;  1GEU A;  1NHS A;  2VVM A;  3T2Z A;  1XDI A;  1QO8 A;  2A87 A;  2XLP A;  3F8D A;  4GAP A;  3AE9 A;  4H4X A;  3UKL A;  2FJA A;  4J31 A;  3JSK A;  1IJH A;  2RGJ A;  1DOE A;  3GDN A;  4EIP A;  3IHG A;  4HA6 A;  3FPZ A;  1H7W A;  3AB1 A;  3DJE A;  1BF3 A;  1E39 A;  2EQ8 A;  4K22 A;  3GYX A;  1PJ7 A;  2BC1 A;  1NHP A;  2NVK X;  4OPC A;  4RG3 A;  5EOW A;  4Z2T A;  5HY5 A;  5M0Z A;  5U63 A;  1L9E A;  3P4S A;  3DK9 A;  2R0C A;  5KMP A;  3RP7 A;  4WCT A;  1H83 A;  2GAG B;  2C3C A;  2QA2 A;  3AE1 A;  1PBC A;  3CNJ A;  3OZ2 A;  1IUU A;  1CC6 A;  4YT0 A;  1Y56 A;  2YR4 A;  5BVA A;  2GMJ A;  5CKU A;  4IVM B;  2YG4 A;  1TDK A;  4A79 A;  4H4Z A;  4CRT A;  2XVE A;  4U8J A;  2RGH A;  3I6D A;  4OPU A;  3AEF A;  2GQW A;  2C72 A;  4H50 A;  5M10 A;  1GTH A;  3FIM B;  4A65 A;  3NRN A;  1FEC A;  1JU2 A;  2C4C A;  2JKC A;  3UTG A;  4B69 A;  1PBB A;  1ZOY A;  4I58 A;  4YKF A;  5DBJ A;  1AOG A;  3GDP A;  1GT8 A;  5BRT A;  3CGC A;  2YLR A;  4NNJ A;  3GYJ A;  1EL5 A;  3SZW A;  1CHU A;  4Y4M A;  1GXF A;  2VVL A;  3H4K A;  2GAH B;  1MO9 A;  3O0H A;  2BA9 A;  1MXT A;  3V76 A;  4YSZ A;  1H86 A;  1GRE A;  4K2X A;  3AE8 A;  4O5Q A;  2YR5 A;  2BCP A;  4K5R A;  2V60 A;  1NG4 A;  1CC2 A;  2WOI A;  2Q0L A;  2WPF A;  2XDO A;  3UTH A;  2OLO A;  2BCG G;  4BK3 A;  4BJY A;  3SY4 A;  3URH A;  2C76 A;  2C3D A;  3KU9 A;  1NDA A;  4CY6 A;  1MOK A;  4DSH A;  4EMI A;  4ECH A;  3GD4 A;  5KOW A;  1ZK7 A;  3CGB A;  3ITJ A;  3LZW A;  1EL7 A;  1NAA A;  4AP3 A;  3UKQ A;  2X8H A;  4NTC A;  2BRY A;  2V6O A;  1GV4 A;  3NT6 A;  4OPI A;  1GRG A;  4ICY A;  4Y4L A;  2FBW A;  1Y0P A;  3QSS A;  1ZMD A;  4J33 A;  4Z2R A;  3BHK A;  4Z43 A;  2UZZ A;  1GRT A;  1D7Y A;  3B3R A;  2B7S A;  2Z5Y A;  3EPT A;  2B76 A;  3ATQ A;  3CGE A;  2TMD A;  1E1M A;  3NK1 X;  4XWR A;  2YG7 A;  4Y4N A;  3NK2 X;  1JRX A;  2XYO A;  1F3P A;  4IA5 A;  1VG0 A;  3CPH G;  4K8D A;  1PHH A;  4C5O A;  5JCL A;  2ZZC A;  1KFY A;  4TM0 A;  1F8R A;  1PJ6 A;  2XFN A;  1YQ4 A;  2R4J A;  1BGN A;  2A8X A;  1IUT A;  3KKJ A;  3LB8 A;  4AP1 A;  4Z2U A;  1N1P A;  3UOY A;  4EMJ A;  2F5Z A;  1PJ5 A;  2XLU A;  3SGL A;  3IC9 A;  3UKA A;  4DSG A;  4AOX A;  1L9C A;  2YM2 A;  1K0J A;  2YLW A;  3CNS A;  3DK4 A;  3KD9 A;  1OJT A;  4OCG A;  1ZDL A;  2EQ6 A;  4X9N A;  3DGZ A;  4GDP A;  3D8X A;  3ABV A;  2CUL A;  2WHD A;  1FCD A;  2XLT A;  2DKI A;  2WU5 A;  3K7T A;  3T14 A;  3DA1 A;  4D04 A;  5HHF A;  3G5Q A;  1FL2 A;  4JQ9 A;  2ZZ0 A;  4JY2 A;  5KMQ A;  1B37 A;  3K7M X;  4BUR A;  3ALJ A;  3CN8 A;  4H4Q A;  3LXD A;  2AQJ A;  1NEN A;  2BK3 A;  2I0Z A;  2XVJ A;  4CNK A; 
#chains in the Genus database with same CATH homology
 4UDP A;  4RSL A;  2YG5 A;  1PXA A;  4X4J A;  3K30 A;  1YQZ A;  2Q7V A;  3CPJ G;  3QFA A;  3UOX A;  3UOZ A;  3UTF A;  4BJZ A;  4NZH A;  3DGH A;  2R46 A;  4H4U A;  4K5S A;  1S2Y A;  2YG3 A;  3AYJ A;  5KNL A;  1JRY A;  1IUW A;  3HYW A;  1VQW A;  2JB2 A;  1CJC A;  4H4W A;  1VRQ B;  1E1K A;  2XLS A;  2NPX A;  3EF6 A;  3NN0 X;  4J34 A;  4U8P A;  3COX A;  5KMS A;  1B4V A;  1GAL A;  1VG9 A;  3I3L A;  4JY3 A;  4XXG A;  1OJ9 A;  3SYI A;  4EMW A;  3SQP A;  1XPQ A;  3T31 A;  1ZKQ A;  4NEV A;  4EM3 A;  4UP3 A;  4FDC B;  5IPY A;  4C3Y A;  2ARD A;  2YQU A;  1CJ4 A;  3UP4 A;  4U8K A;  1TDO A;  4LA1 A;  1E1N A;  4GAV A;  5FS7 A;  2V5Z A;  2XVH A;  4B68 A;  3BNU A;  3BNM A;  3OC4 A;  5KWF A;  1E7P A;  3UP5 A;  1LV0 A;  3C4A A;  1CJ2 A;  1REO A;  4N9X A;  3AE2 A;  4DNA A;  2BS2 A;  2BS4 A;  2Q0K A;  1H81 A;  3R9U A;  3BI4 A;  4CY8 A;  3P9U A;  3NHO X;  2WOV A;  3V3O A;  4A7A A;  2JBV A;  2V3B A;  3ADA B;  1DOC A;  2WOW A;  4U2S A;  2OAL A;  3ISH A;  4U2T A;  3NTD A;  1E6E A;  3AE7 A;  2JK6 A;  2PHH A;  2X3N A;  2OAM A;  3T0K A;  5U1O A;  3RP8 A;  2R0P A;  2W0H A;  2BK4 A;  2C75 A;  1D4E A;  2Y6Q A;  3ZYX A;  3DJJ A;  4Z26 A;  3H8L A;  3S5W A;  1IUS A;  2E5V A;  4H4S A;  3T2Y A;  2X8G A;  2H88 A;  3F8P A;  3NYF A;  4JN9 A;  2X8C A;  2IVE A;  3ZDN A;  4EQX A;  3HYX A;  4UDQ A;  2VRL A;  1EBD A;  3NK0 X;  1YQ3 A;  5C3J A;  3GWD A;  3E1T A;  4XWZ A;  4TM1 A;  1K4Q A;  1ZX9 A;  4Z44 A;  4EM4 A;  3KLJ A;  2XFP A;  4FK1 A;  4B64 A;  1F8S A;  3ICR A;  4ZCD A;  2YVF A;  3NKS A;  1LVL A;  1KF6 A;  2QCU A;  1D4C A;  4LII A;  5GSN A;  1H82 A;  1ONF A;  3GMB A;  1GOS A;  2BAB A;  5CQF A;  4CNJ A;  4A99 A;  5KMR A;  2C64 A;  2FJD A;  4OVI A;  4BV6 A;  1DNC A;  4MJW A;  3S61 A;  3QVR A;  2VZ2 A;  2C7G A;  4H4Y A;  1UKV G;  4A9W A;  3VRA A;  4D03 A;  4OPL A;  3KA7 A;  1B8S A;  2EQ7 A;  3V3N A;  3VR9 A;  3ICT A;  4O5U A;  4WX1 A;  2GR2 A;  3UKK A;  1PBD A;  2APG A;  1Q1W A;  4ADW A;  4M52 A;  4GR1 A;  2WPE A;  1PN0 A;  1VDC A;  1QJD A;  2B9X A;  4KPR A;  1TDF A;  1FEB A;  3AED A;  2GQF A;  5FS8 A;  5GRT A;  3NNE A;  3F8R A;  1GET A;  2VQB A;  2GR0 A;  3FG2 P;  2FJB A;  3FMW A;  1GRF A;  5KOX A;  2YVJ A;  3AE6 A;  1O5W A;  3PVC A;  3UCL A;  1PDH A;  3FBS A;  3AEB A;  1ZMC A;  3IF9 A;  4U8O A;  5HXI A;  1B5Q A;  1TDE A;  2GB0 A;  3ALM A;  2C70 A;  3DH9 A;  5BUK A;  5TR3 A;  1YKJ A;  2RGO A;  1NG3 A;  2VQ7 A;  1QLB A;  2AR8 A;  3VRD B;  3SFD A;  3AYI A;  4U8L A;  2BK5 A;  3GSI A;  5EB4 A;  4A6N A;  2DKH A;  2R4E A;  1Q9I A;  2QAE A;  3SZF A;  4YSX A;  1FOH A;  2YLZ A;  3GRT A;  3AEG A;  2YVG A;  2YG6 A;  1XAN A;  3II4 A;  2VRM A;  2GF3 A;  3SGL A;  1DXL A;  3WE0 A;  1K0I A;  2WES A;  3AE3 A;  1JEH A;  2WS3 A;  2ZBW A;  3UOV A;  4NTE A;  2GEW A;  1NHR A;  1ZOV A;  2YLT A;  4UDR A;  1JOA A;  4ZCC A;  4IVO B;  4YSY A;  2WET A;  3C96 A;  1CF3 A;  3QSE A;  4GDE A;  1P2E A;  3AEC A;  1KSU A;  2WDV A;  5FS9 A;  1M6I A;  3NLC A;  2C67 A;  3QVP A;  2X99 A;  3PS9 A;  1Z6L A;  3ALL A;  2O9Z A;  1DOB A;  4H2P A;  3B6D A;  1S3E A;  1H6V A;  3CMM A;  4G73 A;  4ZN0 A;  4GCM A;  1D4D A;  1DJQ A;  4G6G A;  2YWL A;  3KVE A;  1TRB A;  2XVI A;  2Y6R A;  5C2T A;  4H4P A;  4Z24 A;  2XFU A;  2C66 A;  1F8W A;  2BAC A;  4DGK A;  3M13 A;  3D1C A;  1KSS A;  3AE5 A;  4II3 A;  4BK1 A;  4NTD A;  4B66 A;  2R9Z A;  4TLX A;  2VOU A;  2GR3 A;  4CBQ A;  3P1W A;  2B7R A;  3AE4 A;  2CVJ A;  3M0O A;  3ICS A;  3RHA A;  2WQY A;  5IQ1 A;  1S2Q A;  2H89 A;  2C73 A;  5FS6 A;  2YLX A;  1LQU A;  3G5R A;  1GSN A;  2GVC A;  1Q1R A;  1M64 A;  4TM4 A;  3BI5 A;  1H84 A;  4J57 A;  1GRH A;  1BZL A;  5JCK A;  2XVF A;  3AD8 B;  4H4R A;  3CND A;  3QSM A;  4FX9 A;  2GMH A;  2BRA A;  4IV9 A;  1OJD A;  3QFB A;  1PS9 A;  4YTP A;  1E1L A;  3BI2 A;  5EBK A;  2JB3 A;  2C65 A;  3T37 A;  4BK2 A;  4E0V A;  2FJE A;  4X9M A;  3ATR A;  2Q6U A;  2YAU A;  3NG7 X;  2E4G A;  1D5T A;  3NTA A;  4P9S A;  2OA1 A;  3GWF A;  3PO7 A;  4TLZ A;  4JNQ A;  5JCI A;  3LOV A;  4J2W A;  4LU6 A;  3DJG X;  4G74 A;  2QA1 A;  2WP5 A;  2WU2 A;  1COY A;  2V3A A;  2BC0 A;  1ELI A;  1L9D A;  1N4V A;  1KNP A;  1LTX R;  1CBO A;  1GRB A;  3DJD A;  4CCR A;  2ACZ A;  1TYT A;  2CDU A;  3IHM A;  2WEU A;  4JDR A;  1S3B A;  1IUX A;  4PAA A;  5EB5 A;  1CC4 A;  4A6N B;  5IQ4 A;  4AOS A;  4USQ A;  4U8M A;  1GER A;  3AEA A;  3DK8 A;  1W4X A;  4JNA A;  3K7Q X;  3L1R A;  1RYI A;  4GUV A;  4OPD A;  1TDN A;  3HYV A;  2VVL G;  3SZ0 A;  1GPE A;  3AD9 B;  3UKF A;  2CFY A;  1BKW A;  3SFE A;  3KPK A;  5J7X A;  4A5L A;  1RP0 A;  1GND A;  4AT2 A;  2OLN A;  5JCM A;  3VQR A;  2PYX A;  3P4P A;  4H2R A;  3AXB A;  2WP9 A;  4U8N A;  3NH3 X;  1O94 A;  4J36 A;  1LQT A;  2BXR A;  1ZY8 A;  3C4N A;  4NEW A;  3L8K A;  2WP6 A;  2E1M A;  2V61 A;  3CNT A;  3BHF A;  2EQ9 A;  1PXB A;  3SXI A;  1L0V A;  3NYE A;  3UTE A;  4CCQ A;  1HYU A;  1FEA A;  3CGD A;  4II2 A;  5FMH A;  1NPX A;  1KDG A;  1O95 A;  2TPR A;  3AD7 B;  4G6H A;  1BWC A;  1SEZ A;  3GRS A;  2WBA A;  4U8I A;  2RAB A;  4YTM A;  3CNP A;  4REK A;  3Q6J A;  1CJ3 A;  4RG4 A;  3H8I A;  5KXJ A;  4B1B A;  2YM1 A;  3CTY A;  5ER0 A;  2R45 A;  1PXC A;  3RED A;  1D7L A;  4OPG A;  3VRB A;  4G9K A;  4EQS A;  1LJ1 A;  5J60 A;  1JRZ A;  3G5S A;  5U25 A;  3GD3 A;  4U2L A;  1GRA A;  3GMC A;  1P2H A;  3P4R A;  4H2N A;  2B9W A;  3SM8 A;  2YLS A;  3RNM A;  1EL8 A;  1K0L A;  3RP6 A;  4B67 A;  3KPF A;  3SX6 A;  1GTE A;  2AAQ A;  2WDR A;  2Z5X A;  3GYI A;  3SZC A;  1LPF A;  4FK1 C;  2WPC A;  1OJC A;  2X50 A;  2XLR A;  1NEK A;  4EIQ A;  1BGJ A;  2JB1 A;  1GES A;  2BXS A;  4H4T A;  1ZP0 A;  3LJP A;  2B9Y A;  2IVD A;  5JCN A;  2XCG A;  2GH5 A;  4YSH A;  4YTN A;  5HYM A;  1KNR A;  4USR A;  2YR6 A;  1YY5 A;  3IWA A;  1PBE A;  2XFQ A;  1OJA A;  1JNR A;  3CIR A;  4GRT A;  3NN6 X;  3EAN A;  1N4W A;  1TYP A;  1V59 A;  2R0G A;  3EAO A;  4IA6 A;  4I59 A;  3M12 A;  3NGC X;  4K7Z A;  4TM3 A;  4EQR A;  3Q9T A;  4H2Q A;  4KX6 A;  5LV9 A;  1RSG A;  4H7U A;  3VR8 A;  3P4Q A;  4GF7 A;  1Y56 B;  4J56 A;  4H4V A;  3T2K A;  2ZZB A;  3DME A;  3LZX A;  5L46 A;  2A89 A;  1F6M A;  4B63 A;  4PAB A;  1DOD A;  4HB9 A;  2J3N A;  3CPI G;  1H7X A;  5KVH A;  4APN A;  3UKH A;  4EQW A;  1X31 B;  5BUL A;  1DJN A;  1NHQ A;  2BS3 A;  4C3X A;  1JNZ A;  3AEE A;  4YXD A;  4Z25 A;  3AWI A;  3LAD A;  2GV8 A;  3UKP A;  1EL9 A;  1PBF A;  3NIX A;  4C77 A;  4C74 A;  2JAE A;  2IID A;  2WDQ A;  4YWO A;  1XHC A;  2XFO A;  3AYL A;  1N4U A;  4NWZ A;  3QJ4 A;  4OPT A;  5KRQ A;  1IUV A;  5KVI A;  4YKG A;  3NYC A;  2GRT A;  4AT0 A;  4B65 A;  1CL0 A;  2BYB A;  2GR1 A;  2HQM A;  3HZL A;  1GEU A;  1NHS A;  2VVM A;  3T2Z A;  1XDI A;  1QO8 A;  2A87 A;  2XLP A;  3F8D A;  4GAP A;  3AE9 A;  4H4X A;  3UKL A;  2FJA A;  4J31 A;  3JSK A;  1IJH A;  2RGJ A;  1DOE A;  3GDN A;  4EIP A;  3IHG A;  4HA6 A;  3FPZ A;  1H7W A;  3AB1 A;  3DJE A;  1BF3 A;  1E39 A;  2EQ8 A;  4K22 A;  3GYX A;  1PJ7 A;  2BC1 A;  1NHP A;  2NVK X;  4OPC A;  4RG3 A;  5EOW A;  4Z2T A;  5HY5 A;  5M0Z A;  5U63 A;  1L9E A;  3P4S A;  3DK9 A;  2R0C A;  5KMP A;  3RP7 A;  4WCT A;  1H83 A;  2GAG B;  2C3C A;  2QA2 A;  3AE1 A;  1PBC A;  3CNJ A;  3OZ2 A;  1IUU A;  1CC6 A;  4YT0 A;  1Y56 A;  2YR4 A;  5BVA A;  2GMJ A;  5CKU A;  4IVM B;  2YG4 A;  1TDK A;  4A79 A;  4H4Z A;  4CRT A;  2XVE A;  4U8J A;  2RGH A;  3I6D A;  4OPU A;  3AEF A;  2GQW A;  2C72 A;  4H50 A;  5M10 A;  1GTH A;  3FIM B;  4A65 A;  3NRN A;  1FEC A;  1JU2 A;  2C4C A;  2JKC A;  3UTG A;  4B69 A;  1PBB A;  1ZOY A;  4I58 A;  4YKF A;  5DBJ A;  1AOG A;  3GDP A;  1GT8 A;  5BRT A;  3CGC A;  2YLR A;  4NNJ A;  3GYJ A;  1EL5 A;  3SZW A;  1CHU A;  4Y4M A;  1GXF A;  2VVL A;  3H4K A;  2GAH B;  1MO9 A;  3O0H A;  1MXT A;  2BA9 A;  3V76 A;  4YSZ A;  1H86 A;  1GRE A;  4K2X A;  3AE8 A;  4O5Q A;  2YR5 A;  2BCP A;  4K5R A;  2V60 A;  1NG4 A;  1CC2 A;  2WOI A;  2Q0L A;  2WPF A;  2XDO A;  3UTH A;  2OLO A;  2BCG G;  4BK3 A;  4BJY A;  3SY4 A;  3URH A;  2C76 A;  2C3D A;  3KU9 A;  1NDA A;  4CY6 A;  1MOK A;  4DSH A;  4EMI A;  4ECH A;  3GD4 A;  5KOW A;  1ZK7 A;  3CGB A;  3ITJ A;  3LZW A;  1EL7 A;  1NAA A;  4AP3 A;  3UKQ A;  2X8H A;  4NTC A;  2BRY A;  2V6O A;  1GV4 A;  3NT6 A;  4OPI A;  1GRG A;  4ICY A;  4Y4L A;  2FBW A;  1Y0P A;  3QSS A;  1ZMD A;  4J33 A;  4Z2R A;  3BHK A;  4Z43 A;  2UZZ A;  1GRT A;  1D7Y A;  3B3R A;  2B7S A;  2Z5Y A;  3EPT A;  2B76 A;  3ATQ A;  3CGE A;  2TMD A;  1E1M A;  3NK1 X;  4XWR A;  2YG7 A;  4Y4N A;  3NK2 X;  1JRX A;  2XYO A;  1F3P A;  4IA5 A;  1VG0 A;  3CPH G;  4K8D A;  1PHH A;  4C5O A;  5JCL A;  2ZZC A;  1KFY A;  4TM0 A;  1F8R A;  1PJ6 A;  2XFN A;  1YQ4 A;  2R4J A;  1BGN A;  2A8X A;  1IUT A;  3KKJ A;  3LB8 A;  4AP1 A;  4Z2U A;  1N1P A;  3UOY A;  4EMJ A;  2F5Z A;  1PJ5 A;  2XLU A;  4DSG A;  3IC9 A;  3UKA A;  4AOX A;  1L9C A;  2YM2 A;  1K0J A;  2YLW A;  3CNS A;  3DK4 A;  3KD9 A;  1OJT A;  4OCG A;  1ZDL A;  2EQ6 A;  4X9N A;  3DGZ A;  4GDP A;  3D8X A;  3ABV A;  2CUL A;  2WHD A;  1FCD A;  2XLT A;  2DKI A;  2WU5 A;  3K7T A;  3T14 A;  3DA1 A;  4D04 A;  5HHF A;  3G5Q A;  1FL2 A;  4JQ9 A;  2ZZ0 A;  4JY2 A;  5KMQ A;  1B37 A;  3K7M X;  4BUR A;  3ALJ A;  3CN8 A;  4H4Q A;  3LXD A;  2AQJ A;  1NEN A;  2BK3 A;  2I0Z A;  2XVJ A;  4CNK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...