1TDKA

L-amino acid oxidase from agkistrodon halys in complex with suicide substrate l-vinylglycine
Total Genus 175
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
175
sequence length
484
structure length
484
Chain Sequence
DRNPLEECFRETDYEEFLEIARNGLKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLEASERAGGRVRTYRNDKEDWYANLGPMRLPEKHRIVREYIRKFGLQLNEFSQENDNAWYFIKNIRKRVGEVKKDPGVLKYPVKPSEEGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLLKEGNLSPGAVDMIGDLMNEDSGYYVSFPESLRHDDIFAYEKRFDEIVGGMDKLPTSMYRAIEEKVHLNAQVIKIQKNAEKVTVVYQTPAKEMASVTADYVIVCTTSRATRRIKFEPPLPPKKAHALRSVHYRSGTKIFLTCTKKFWEDEGIHGGKSTTDLPSRFIYYPNHNFTSGVGVIIAYGIGDDANFFQALDFKDCADIVINDLSLIHQLPREEIQTFCYPSMIQKWSLDKYAMGGITTFTPYQFQHFSESLTASVDRIYFAGEHTAEAHGWIDSTIKSGLRAARDVNRASEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-amino acid oxidase
publication title Structures of L-amino acid oxidase in complexes with substrates and substrate analogue
rcsb
total genus 175
structure length 484
sequence length 484
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2004-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1tdkA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1tdkA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1tdkA01
2I0ZA 5C2TA 3DK4A 1Y0PA 3V76A 2YVGA 3H4KA 3QFBA 1GRBA 1P2HA 3RP8A 2WESA 1FOHA 3AB1A 4YXDA 4C3YA 4H4YA 3NLCA 1DOCA 1QO8A 1OJTA 2H88A 2YR5A 1YQ4A 2ZZ0A 3V3NA 1CF3A 1E6EA 1FEAA 3EANA 2IIDA 5U25A 1D7LA 1TYPA 4E0VA 3F8DA 3UTFA 4NEWA 4C77A 2VRLA 2WP6A 3AE7A 3OC4A 1OJDA 4I58A 4A9WA 5IPYA 4TM1A 5JCKA 2NPXA 2YLTA 4YTPA 4AOSA 3KVEA 3F8PA 1DJNA 5FS6A 4TM3A 2TMDA 4TLZA 4AOXA 5KXJA 4A6NB 4CNKA 3AE8A 2C70A 1FEBA 2VQBA 2WPCA 4J2WA 3KA7A 4B68A 1NG4A 1RSGA 1GXFA 3ALMA 4YTMA 3VR9A 2XLSA 3PO7A 3K7QX 3BNMA 3UOVA 3ADAB 1PBDA 2GR0A 1FCDA 3CGBA 3EPTA 2APGA 3F8RA 2BC0A 2V3BA 3AXBA 3NKSA 4EQRA 4YTNA 3EF6A 1IUXA 1PBEA 3Q9TA 2YR4A 3QFAA 4Z25A 4K5SA 3NN6X 4CBQA 4X9MA 4Y4NA 1IUTA 1EL9A 3AEDA 4X4JA 2EQ8A 2QAEA 2V6OA 1OJAA 2GEWA 2BCPA 3SFEA 2ACZA 1F3PA 3PS9A 4DSGA 1IUSA 1CJ4A 1ZX9A 2GR1A 1PJ5A 1CC6A 2X50A 2XYOA 3NRNA 4KX6A 3REDA 4H4UA 4YKGA 1H6VA 3NYEA 5TR3A 2YLXA 1H84A 4Z44A 4TM4A 4H4RA 4BJZA 1PJ7A 1CL0A 3CNTA 1MOKA 1LJ1A 1L0VA 4BK1A 2R9ZA 5JCIA 1GNDA 5JCNA 1B8SA 2YG4A 5U1OA 5KVIA 3R9UA 1CC4A 2FJBA 1JOAA 2WOWA 4Y4MA 4ZN0A 2YVFA 1N4VA 2X3NA 3RP7A 2C66A 2YG7A 3LB8A 2XVFA 3NGCX 2EQ7A 3UKAA 3DGZA 3M0OA 1M6IA 2R0CA 1GOSA 4NTEA 2VVLG 5FS7A 1NEKA 4H4VA 3AE3A 2FJEA 3BNUA 2TPRA 3AD9B 3M12A 3P4RA 1VDCA 3RHAA 4EM4A 2WP5A 3FPZA 1VQWA 1ONFA 1XDIA 4K8DA 3CIRA 2Q0KA 3SGLA 3UOZA 3RNMA 4NTCA 1NHRA 4Y4LA 3UOXA 3CNDA 2C75A 1S3EA 3CPHG 3VR8A 5KRQA 1F8SA 1GTEA 1D5TA 4BK2A 2WDQA 4YSZA 4UDRA 2ZBWA 2Q0LA 2FJDA 4YSYA 3DJGX 3AD8B 3AEBA 2GAGB 4NZHA 3VRBA 1L9EA 1LV0A 5CKUA 4OPIA 3KPFA 4GR1A 3L1RA 4I59A 4LU6A 4B67A 4XWZA 3GWDA 1KFYA 3GYIA 4LIIA 2DKHA 1LQTA 2IVEA 4JNAA 5J60A 3AE4A 4APNA 3FG2P 3SQPA 1ELIA 1JRXA 2GH5A 2FJAA 2VRMA 4JQ9A 4A79A 4J34A 1H7XA 4Z24A 4YT0A 4UDQA 4EMIA 3H8IA 1CBOA 1KSSA 1IJHA 2GR2A 5FMHA 4H2PA 1COYA 2NVKX 2WHDA 3QSMA 4Z2RA 4N9XA 3UP4A 1KSUA 4U2TA 3SFDA 4YKFA 2Y6RA 2CFYA 3NK0X 2AQJA 4J57A 4EQWA 3L8KA 3P4PA 2C76A 3BI5A 5EB4A 1ZP0A 3JSKA 5FS8A 1H7WA 4U8MA 3P4SA 2CVJA 2B76A 4AP1A 2XLUA 3IC9A 1L9DA 2C67A 1Q9IA 2DKIA 5DBJA 1JNRA 2AR8A 1FL2A 1E1MA 4P9SA 2Q7VA 1HYUA 3LJPA 1GALA 1LVLA 2WU2A 1K0JA 1VG0A 1LPFA 2JKCA 2A89A 3AECA 3NK2X 1M64A 3GRTA 3OZ2A 1BGNA 4JY3A 1TDNA 4OPLA 4XWRA 4FK1A 4MJWA 4IVMB 3AEGA 4TLXA 1GEUA 3C4AA 5LV9A 3AWIA 2WDRA 2QCUA 3C96A 1DODA 2E1MA 4O5UA 2AAQA 3P4QA 2BXRA 1Z6LA 2WOVA 3CNJA 4AT0A 4EIQA 2C3DA 2V3AA 1TDKA 1B5QA 3UKKA 1K4QA 1GRHA 4PAAA 2B7RA 4H4SA 3GWFA 3CGCA 4ADWA 1Y56A 1XHCA 3NK1X 4EQXA 1O5WA 2BA9A 1PS9A 3AE6A 3IHMA 3IWAA 1NHPA 4BK3A 5L46A 2XFNA 2OA1A 2JK6A 1S2QA 5M0ZA 1QJDA 1E7PA 3I6DA 3AE9A 2F5ZA 3CGEA 3UCLA 3VRAA 3DH9A 2WPFA 1KNRA 2GF3A 3AD7B 4DGKA 1NENA 4OPGA 1GERA 2BACA 2Y6QA 3DMEA 4CCQA 4C3XA 4A7AA 1CHUA 1CJ2A 2B9YA 4UP3A 1PHHA 4RG4A 3CPIG 2Q6UA 4EMWA 1GRGA 2C65A 3II4A 1S2YA 4FDCB 2BK3A 3B6DA 3UKPA 4REKA 1V59A 3IHGA 2YM1A 3GMBA 2WS3A 4YWOA 2W0HA 3CTYA 3UP5A 2X8CA 3VQRA 4B1BA 2BS2A 1E39A 4CRTA 2XCGA 1LQUA 3GSIA 1BF3A 4OPCA 2EQ6A 2PYXA 4GUVA 3O0HA 3HZLA 3B3RA 3P1WA 4B64A 4YSXA 3UKFA 3KKJA 1F8RA 5CQFA 1GRFA 3FBSA 2BK5A 1CJCA 2UZZA 3KU9A 1OJ9A 4WX1A 4A6NA 5M10A 1REOA 2X99A 4CY6A 3AEEA 1H81A 2R45A 1YKJA 1H83A 4TM0A 4U8KA 3LZXA 2ZZBA 2BYBA 4GCMA 2EQ9A 2VOUA 1NHSA 3G5SA 5HXIA 3QVPA 4Z2UA 2C7GA 3UTHA 3DK8A 3GD3A 5U63A 2B9WA 5IQ1A 5GRTA 1F6MA 1NDAA 5ER0A 1PN0A 4ICYA 2X8GA 1LTXR 1BWCA 5EB5A 5EOWA 3I3LA 2BS3A 2JB2A 2YLSA 4GF7A 4H2NA 3BHFA 4FX9A 3CN8A 4K7ZA 2XVIA 1GV4A 3BI4A 4H4PA 1NG3A 1CJ3A 3GRSA 1TDFA 3NG7X 4FK1C 1BGJA 2YQUA 5FS9A 1XPQA 3K30A 4OPTA 1Q1WA 3ABVA 2B9XA 3URHA 2YG3A 2YLZA 3S61A 4DNAA 1MXTA 2BCGG 3QSEA 3DJEA 1ZMCA 4J31A 2YVJA 4JDRA 4OVIA 3DA1A 2OALA 5JCLA 1N1PA 3CNPA 5BUKA 3C4NA 1PXCA 4JNQA 2BS4A 2XLTA 2GQFA 3DK9A 1ZY8A 1ZKQA 1P2EA 2VQ7A 1UKVG 4H7UA 3ISHA 4J36A 4C5OA 3ICSA 2YG5A 4EM3A 4IV9A 1IUWA 1GETA 2E4GA 1BZLA 2PHHA 4OPDA 1YY5A 2JB1A 3CPJG 1D4CA 2XLRA 4GDEA 3Q6JA 4AP3A 1EBDA 1YQZA 3NTAA 4IVOB 3E1TA 1K0LA 4A65A 2XVJA 3NT6A 4U8PA 5EBKA 2XFOA 2GMHA 1QLBA 4H4XA 4HA6A 3NN0X 1D7YA 1DXLA 4Z43A 3LADA 5JCMA 4USQA 2BK4A 2C3CA 3GD4A 5J7XA 1FECA 2WPEA 4H4TA 2JB3A 3AE5A 1PXBA 4GDPA 1B4VA 1E1KA 3S5WA 4PABA 1KNPA 4U2SA 3AYIA 4CNJA 2VVLA 2OAMA 2WEUA 1N4UA 2X8HA 3AYLA 3ATQA 3PVCA 1TRBA 4OCGA 1H86A 4K2XA 3QVRA 2YG6A 3EAOA 4CCRA 4M52A 2CULA 2XDOA 3UTEA 1SEZA 1RYIA 1TYTA 1VG9A 2ZZCA 1L9CA 4B65A 1IUUA 1JNZA 4GRTA 4J56A 3UTGA 4DSHA 3CGDA 4U8OA 3G5QA 3KLJA 1S3BA 2R4EA 2JAEA 2C73A 1PXAA 1KDGA 2R0PA 3M13A 2GVCA 4USRA 4XXGA 2Z5YA 3KD9A 2WETA 4IA5A 2GR3A 4A5LA 4H4ZA 3FMWA 4U8LA 5GSNA 1F8WA 1YQ3A 1GRAA 2XLPA 4D03A 1RP0A 5HYMA 3BI2A 3AE1A 1BKWA 2YAUA 2XFQA 2YWLA 3NYFA 3BHKA 5BULA 1W4XA 3NYCA 1GESA 4C74A 2OLOA 2RABA 3UKLA 2XFUA 1JEHA 1ZMDA 2JBVA 2R46A 2XVHA 2YLWA 4YSHA 1ZOVA 2BXSA 3COXA 3D1CA 3UOYA 4BJYA 1N4WA 3AE2A 4H2QA 3DJDA 1AOGA 2RGJA 2J3NA 4BURA 1O95A 2VZ2A 4U8JA 1H82A 1JRYA 3AYJA 4EMJA 2C64A 2XVEA 3NHOX 4A99A 1NAAA 1KF6A 4NTDA 1Q1RA 1NHQA 1D4EA 4CY8A 4B66A 2GMJA 3DJJA 3LZWA 1XANA 2QA2A 3GMCA 4BV6A 4IA6A 2BC1A 4UDPA 2R0GA 1GPEA 4NEVA 3QJ4A 2C72A 5BRTA 2GV8A 4AT2A 3ATRA 5KWFA 1EL8A 3IF9A 1DJQA 3GDNA 1GT8A 2V60A 3ITJA 1TDEA 3D8XA 1PBFA 4ZCCA 5KVHA 4ZCDA 3ZDNA 2GB0A 4H50A 4D04A 2Z5XA 1B37A 3LOVA 1NPXA 2GAHB 2GQWA 4WCTA 3WE0A 3AEAA 2BABA 3NIXA 2WDVA 2V61A 2IVDA 4OPUA 4K5RA 2RGOA 2GRTA 1OJCA 4ECHA 2YLRA 4HB9A 4H4WA 2WU5A 2R4JA 5IQ4A 2OLNA 2YM2A 3NH3X 3VRDB 2RGHA 1GRTA 1D4DA 4EQSA 4Z26A 1GSNA 3K7MX 3T37A 1DOEA 3UKQA 3SM8A 2V5ZA 2O9ZA 5KOWA 1PJ6A 1DNCA 1PDHA 2VVMA 1O94A 2A8XA 1DOBA 2WQYA 3ALLA 3NTDA 1X31B 3K7TA 3GYJA 4B63A 1E1LA 5KOXA 3FIMB 2XFPA 3GDPA 5BVAA 4B69A 1JRZA 3H8LA 2ARDA 2WP9A 3NNEA 5HHFA 1IUVA 4JN9A 3P9UA 3V3OA 3ALJA 1ZK7A 2YR6A 3ICTA 4U8NA 1MO9A 1JU2A 1ZDLA 3ICRA 4Z2TA 4KPRA 4X9NA 2WBAA 5C3JA 4O5QA 4RG3A 1VRQB 2E5VA 2A87A 3G5RA 2FBWA 2HQMA 3QSSA 1ZOYA 1Y56B 2WOIA 4H2RA 3UKHA 1K0IA 2QA1A 4H4QA 5HY5A 2B7SA 1CC2A 1GTHA 4U8IA 4JY2A 3ZYXA 1TDOA 1PBCA 3AEFA 1GREA 1PBBA 3LXDA 3DGHA 1E1NA 2CDUA 4LA1A 4RSLA 4K22A 1EL7A 3CNSA 4EIPA 4J33A 3RP6A 2H89A 4U2LA 1EL5A
chains in the Genus database with same CATH superfamily
2I0ZA 5C2TA 3DK4A 1Y0PA 3V76A 2YVGA 3H4KA 3QFBA 1GRBA 1P2HA 3RP8A 2WESA 1FOHA 3AB1A 4YXDA 4C3YA 4GAPA 4H4YA 3NLCA 1DOCA 1QO8A 1OJTA 2H88A 2YR5A 5KMSA 1YQ4A 2ZZ0A 3V3NA 1CF3A 1E6EA 1FEAA 3EANA 2IIDA 5U25A 1D7LA 1TYPA 4E0VA 3F8DA 3UTFA 4NEWA 4C77A 2VRLA 2WP6A 3AE7A 3OC4A 3SXIA 1OJDA 4I58A 4A9WA 5IPYA 4TM1A 5JCKA 4G73A 2NPXA 2YLTA 4YTPA 4AOSA 3KVEA 3F8PA 1DJNA 5FS6A 4TM3A 2TMDA 4TLZA 4AOXA 5KXJA 4G74A 4A6NB 4CNKA 3AE8A 2C70A 1FEBA 3SY4A 3T2YA 2VQBA 2WPCA 4J2WA 3KA7A 4B68A 1NG4A 1RSGA 3HYXA 1GXFA 3ALMA 4YTMA 3VR9A 2XLSA 3PO7A 3K7QX 3BNMA 3UOVA 3ADAB 1PBDA 2GR0A 1FCDA 3CGBA 3EPTA 2APGA 3F8RA 2BC0A 2V3BA 3AXBA 3NKSA 4EQRA 3KPKA 4YTNA 3EF6A 1IUXA 1PBEA 3Q9TA 2YR4A 3QFAA 4Z25A 4K5SA 3NN6X 4CBQA 4X9MA 4Y4NA 1IUTA 1EL9A 3AEDA 4X4JA 2EQ8A 2QAEA 2V6OA 1OJAA 2GEWA 2BCPA 3SFEA 2ACZA 1F3PA 3PS9A 4DSGA 1IUSA 1CJ4A 1ZX9A 2GR1A 1PJ5A 1CC6A 2X50A 2XYOA 3NRNA 4KX6A 3REDA 4H4UA 4YKGA 1H6VA 3NYEA 5TR3A 2YLXA 1H84A 4Z44A 4TM4A 4H4RA 4BJZA 1PJ7A 1CL0A 3CNTA 1MOKA 1LJ1A 1L0VA 4BK1A 2R9ZA 5JCIA 1GNDA 5JCNA 1B8SA 2YG4A 5U1OA 5KVIA 3R9UA 1CC4A 2FJBA 1JOAA 2WOWA 4Y4MA 4ZN0A 2YVFA 2C4CA 1N4VA 2X3NA 3RP7A 2C66A 2YG7A 3LB8A 2XVFA 3NGCX 2EQ7A 3UKAA 3DGZA 3M0OA 1M6IA 2R0CA 1GOSA 4NTEA 2VVLG 3HYVA 1NEKA 5FS7A 4H4VA 3AE3A 2FJEA 3BNUA 2TPRA 3AD9B 3M12A 3P4RA 1VDCA 3RHAA 4EM4A 2WP5A 3FPZA 1VQWA 1ONFA 1XDIA 2BRAA 3CIRA 2Q0KA 4K8DA 3SGLA 3UOZA 3RNMA 4NTCA 1NHRA 4Y4LA 3UOXA 3CNDA 2C75A 1S3EA 3CPHG 3VR8A 5KRQA 1F8SA 1GTEA 1D5TA 4BK2A 2WDQA 4YSZA 4UDRA 2ZBWA 2Q0LA 2FJDA 4YSYA 3DJGX 3AD8B 3AEBA 2GAGB 4NZHA 3VRBA 1L9EA 1LV0A 5CKUA 4OPIA 3KPFA 4GR1A 3L1RA 4I59A 4LU6A 4B67A 4XWZA 3GWDA 1KFYA 3GYIA 4LIIA 2DKHA 1LQTA 2IVEA 4JNAA 5J60A 3AE4A 4APNA 3CMMA 3FG2P 3SQPA 1ELIA 1JRXA 2GH5A 2FJAA 2VRMA 4JQ9A 4A79A 4J34A 1H7XA 4Z24A 4YT0A 4UDQA 4EMIA 3H8IA 1CBOA 1KSSA 1IJHA 2GR2A 5FMHA 4H2PA 1COYA 2NVKX 2WHDA 3QSMA 4Z2RA 4N9XA 3UP4A 1KSUA 4U2TA 3SFDA 4YKFA 2Y6RA 2CFYA 3NK0X 2AQJA 4J57A 4EQWA 3L8KA 3P4PA 2C76A 3BI5A 5EB4A 1ZP0A 3JSKA 5FS8A 1H7WA 4U8MA 3P4SA 2CVJA 2B76A 4AP1A 2XLUA 3IC9A 1L9DA 2C67A 1Q9IA 2DKIA 5DBJA 1JNRA 2AR8A 1FL2A 1E1MA 4P9SA 2Q7VA 1HYUA 3LJPA 1GALA 1LVLA 2WU2A 1K0JA 1VG0A 1LPFA 2JKCA 2A89A 3AECA 3NK2X 1M64A 3GRTA 3OZ2A 1BGNA 4JY3A 1TDNA 4OPLA 4XWRA 4FK1A 4MJWA 4IVMB 3AEGA 4TLXA 1GEUA 3C4AA 5LV9A 3AWIA 2WDRA 2QCUA 3C96A 1DODA 2E1MA 4O5UA 2AAQA 3T2KA 3P4QA 2BXRA 1Z6LA 2WOVA 3CNJA 4AT0A 4EIQA 2C3DA 2V3AA 1TDKA 1B5QA 3UKKA 1K4QA 1GRHA 4PAAA 2B7RA 4H4SA 3GWFA 3CGCA 4ADWA 1Y56A 1XHCA 3NK1X 4EQXA 1O5WA 2BA9A 1PS9A 3AE6A 3IHMA 3IWAA 1NHPA 4BK3A 5L46A 2XFNA 2OA1A 2JK6A 1S2QA 5M0ZA 1QJDA 1E7PA 3I6DA 3AE9A 2F5ZA 3CGEA 3UCLA 3VRAA 3DH9A 2WPFA 1KNRA 2GF3A 3AD7B 4DGKA 1NENA 4OPGA 1GERA 2BACA 2Y6QA 3DMEA 4CCQA 4C3XA 4A7AA 2B9YA 1CHUA 1CJ2A 4UP3A 1PHHA 4RG4A 3CPIG 4GAVA 2Q6UA 4EMWA 1GRGA 2C65A 3II4A 1S2YA 4FDCB 2BK3A 3B6DA 3UKPA 4REKA 1V59A 3IHGA 2YM1A 3GMBA 2WS3A 4YWOA 2W0HA 3CTYA 3UP5A 2X8CA 3VQRA 4B1BA 2BS2A 1E39A 4CRTA 2XCGA 1LQUA 3GSIA 1BF3A 4OPCA 2EQ6A 2PYXA 4NNJA 4GUVA 3O0HA 3HZLA 3SZCA 3B3RA 3T31A 3P1WA 4B64A 4YSXA 3UKFA 3KKJA 1F8RA 5CQFA 1GRFA 3FBSA 2BK5A 1CJCA 2UZZA 3KU9A 1OJ9A 4WX1A 4A6NA 5M10A 1REOA 2X99A 4CY6A 3AEEA 1H81A 2R45A 1YKJA 1H83A 4TM0A 4U8KA 3LZXA 2ZZBA 2BYBA 4GCMA 2EQ9A 2VOUA 1NHSA 3G5SA 5HXIA 3QVPA 4Z2UA 2C7GA 3UTHA 3DK8A 3GD3A 5U63A 2B9WA 5IQ1A 5GRTA 1F6MA 1NDAA 5ER0A 1PN0A 4ICYA 2X8GA 1LTXR 1BWCA 5EB5A 5EOWA 3I3LA 2BS3A 2JB2A 2YLSA 4GF7A 4H2NA 3BHFA 4FX9A 3CN8A 4K7ZA 2XVIA 1GV4A 3BI4A 3GYXA 4H4PA 1NG3A 1CJ3A 3GRSA 1TDFA 3NG7X 4FK1C 1BGJA 4NWZA 2YQUA 5FS9A 1XPQA 3K30A 4OPTA 1Q1WA 3ABVA 2B9XA 3URHA 2YG3A 2YLZA 3S61A 4DNAA 1MXTA 2BCGG 3QSEA 3DJEA 5KMRA 1ZMCA 4J31A 2YVJA 4JDRA 4G6GA 4OVIA 3DA1A 2OALA 5JCLA 1N1PA 3CNPA 5BUKA 3C4NA 1PXCA 4JNQA 2BS4A 2XLTA 2GQFA 3DK9A 1ZY8A 1ZKQA 1P2EA 2VQ7A 4II2A 1UKVG 4H7UA 3ISHA 4J36A 4C5OA 3ICSA 2YG5A 4EM3A 4IV9A 1IUWA 1GETA 2E4GA 1BZLA 2PHHA 4OPDA 5KMQA 1YY5A 2JB1A 3CPJG 1D4CA 2XLRA 4GDEA 3Q6JA 4AP3A 1EBDA 1YQZA 3NTAA 4IVOB 3E1TA 1K0LA 4A65A 3SZWA 2XVJA 3NT6A 4U8PA 5EBKA 2XFOA 2GMHA 1QLBA 4H4XA 4HA6A 3NN0X 1D7YA 1DXLA 4Z43A 3LADA 5JCMA 4USQA 2BK4A 2C3CA 3GD4A 5J7XA 1FECA 2WPEA 4H4TA 2JB3A 3AE5A 1PXBA 4GDPA 1B4VA 1E1KA 3S5WA 4PABA 1KNPA 4U2SA 3AYIA 4CNJA 2VVLA 2OAMA 2WEUA 1N4UA 2X8HA 3AYLA 3SYIA 3ATQA 3PVCA 1TRBA 4OCGA 1H86A 4K2XA 3QVRA 2YG6A 3EAOA 3SZ0A 4CCRA 4M52A 2CULA 2XDOA 3UTEA 1SEZA 1RYIA 1TYTA 1VG9A 2ZZCA 1L9CA 4B65A 1IUUA 1JNZA 4GRTA 4J56A 3UTGA 4DSHA 3CGDA 4U8OA 3G5QA 3KLJA 1S3BA 2R4EA 2JAEA 2C73A 1PXAA 1KDGA 2R0PA 3M13A 2GVCA 4USRA 4XXGA 2Z5YA 3KD9A 2WETA 4IA5A 2GR3A 4A5LA 4H4ZA 3FMWA 4U8LA 5GSNA 1F8WA 1YQ3A 1GRAA 2XLPA 4D03A 1RP0A 5HYMA 3T2ZA 3BI2A 3AE1A 1BKWA 2YAUA 2XFQA 2YWLA 3NYFA 3BHKA 5BULA 1W4XA 3NYCA 1GESA 4C74A 2OLOA 2RABA 3UKLA 2XFUA 1JEHA 1ZMDA 2JBVA 2R46A 2XVHA 2YLWA 4YSHA 1ZOVA 2BXSA 3COXA 3D1CA 3UOYA 4BJYA 1N4WA 3AE2A 4H2QA 3DJDA 1AOGA 2RGJA 2J3NA 4BURA 1O95A 2VZ2A 4U8JA 3SX6A 1H82A 1JRYA 3AYJA 4EMJA 2C64A 4II3A 5KMPA 2XVEA 3NHOX 4A99A 1NAAA 3T14A 1KF6A 4NTDA 1Q1RA 1NHQA 1D4EA 4CY8A 4B66A 3HYWA 2GMJA 3DJJA 3LZWA 1XANA 2QA2A 3GMCA 4BV6A 4IA6A 2BC1A 4UDPA 2R0GA 1GPEA 4NEVA 3QJ4A 2C72A 5BRTA 2GV8A 4AT2A 3ATRA 5KWFA 1EL8A 3IF9A 1DJQA 3GDNA 1GT8A 2V60A 3ITJA 1TDEA 3D8XA 1PBFA 4ZCCA 5KVHA 4ZCDA 3ZDNA 2GB0A 4H50A 4D04A 2Z5XA 1B37A 3LOVA 1NPXA 2GAHB 2GQWA 4WCTA 3WE0A 3AEAA 2BABA 3NIXA 2WDVA 2V61A 2IVDA 4OPUA 4K5RA 2RGOA 2GRTA 1OJCA 4ECHA 2YLRA 4HB9A 4H4WA 2WU5A 2R4JA 5IQ4A 2OLNA 2YM2A 3NH3X 3VRDB 2RGHA 1GRTA 1D4DA 4EQSA 4Z26A 1GSNA 3K7MX 3T37A 1DOEA 3UKQA 3SM8A 2V5ZA 2O9ZA 5KOWA 1PJ6A 1DNCA 1PDHA 2VVMA 1O94A 2A8XA 1DOBA 2WQYA 3ALLA 3NTDA 1X31B 3K7TA 3GYJA 4B63A 1E1LA 5KOXA 3FIMB 2XFPA 3GDPA 5BVAA 4B69A 1JRZA 3H8LA 2ARDA 2WP9A 3NNEA 5HHFA 1IUVA 4JN9A 3P9UA 3V3OA 3ALJA 1ZK7A 2YR6A 3ICTA 4U8NA 1MO9A 1JU2A 1ZDLA 3ICRA 4Z2TA 4KPRA 4X9NA 2WBAA 5C3JA 4G6HA 4O5QA 4RG3A 1VRQB 2E5VA 2A87A 3G5RA 2FBWA 2HQMA 3QSSA 1ZOYA 1Y56B 2WOIA 4H2RA 3UKHA 2BRYA 1K0IA 2QA1A 4H4QA 5HY5A 2B7SA 1CC2A 1GTHA 4U8IA 4JY2A 3T0KA 3ZYXA 1TDOA 1PBCA 3AEFA 1GREA 1PBBA 3LXDA 3SZFA 3DGHA 1E1NA 2CDUA 4LA1A 4G9KA 4RSLA 4K22A 1EL7A 3CNSA 4EIPA 5KNLA 4J33A 3RP6A 2H89A 4U2LA 1EL5A
chains in the Genus database with same CATH topology
2I0ZA 5C2TA 3DK4A 1Y0PA 3V76A 2YVGA 3H4KA 3QFBA 1GRBA 1P2HA 3RP8A 2WESA 1FOHA 3AB1A 4YXDA 4C3YA 4GAPA 4H4YA 3NLCA 1DOCA 1QO8A 1OJTA 2H88A 2YR5A 5KMSA 1YQ4A 2ZZ0A 3V3NA 1CF3A 1E6EA 1FEAA 3EANA 2IIDA 5U25A 1D7LA 1TYPA 4E0VA 3F8DA 3UTFA 4NEWA 4C77A 2VRLA 2WP6A 3AE7A 3OC4A 3SXIA 1OJDA 4I58A 4A9WA 5IPYA 4TM1A 5JCKA 4G73A 2NPXA 2YLTA 4YTPA 4AOSA 3KVEA 3F8PA 1DJNA 5FS6A 4TM3A 2TMDA 4TLZA 4AOXA 5KXJA 4G74A 4A6NB 4CNKA 3AE8A 2C70A 1FEBA 3SY4A 3T2YA 2VQBA 2WPCA 4J2WA 3KA7A 4B68A 1NG4A 1RSGA 3HYXA 1GXFA 3ALMA 4YTMA 3VR9A 2XLSA 3PO7A 3K7QX 3BNMA 3UOVA 3ADAB 1PBDA 2GR0A 1FCDA 3CGBA 3EPTA 2APGA 3F8RA 2BC0A 2V3BA 3AXBA 3NKSA 4EQRA 3KPKA 4YTNA 3EF6A 1IUXA 1PBEA 3Q9TA 2YR4A 3QFAA 4Z25A 4K5SA 3NN6X 4CBQA 4X9MA 4Y4NA 1IUTA 1EL9A 3AEDA 4X4JA 2EQ8A 2QAEA 2V6OA 1OJAA 2GEWA 2BCPA 3SFEA 2ACZA 1F3PA 3PS9A 4DSGA 1IUSA 1CJ4A 1ZX9A 2GR1A 1PJ5A 1CC6A 2X50A 2XYOA 3NRNA 4KX6A 3REDA 4H4UA 4YKGA 1H6VA 3NYEA 5TR3A 2YLXA 1H84A 4Z44A 4TM4A 4H4RA 4BJZA 1PJ7A 1CL0A 3CNTA 1MOKA 1LJ1A 1L0VA 4BK1A 2R9ZA 5JCIA 1GNDA 5JCNA 1B8SA 2YG4A 5U1OA 5KVIA 3R9UA 1CC4A 2FJBA 1JOAA 2WOWA 4Y4MA 4ZN0A 2YVFA 2C4CA 1N4VA 2X3NA 3RP7A 2C66A 2YG7A 3LB8A 2XVFA 3NGCX 2EQ7A 3UKAA 3DGZA 3M0OA 1M6IA 2R0CA 1GOSA 4NTEA 2VVLG 3HYVA 1NEKA 5FS7A 4H4VA 3AE3A 2FJEA 3BNUA 2TPRA 3AD9B 3M12A 3P4RA 1VDCA 3RHAA 4EM4A 2WP5A 3FPZA 1VQWA 1ONFA 1XDIA 2BRAA 3CIRA 2Q0KA 4K8DA 3SGLA 3UOZA 3RNMA 4NTCA 1NHRA 4Y4LA 3UOXA 3CNDA 2C75A 1S3EA 3CPHG 3VR8A 5KRQA 1F8SA 1GTEA 1D5TA 4BK2A 2WDQA 4YSZA 4UDRA 2ZBWA 2Q0LA 2FJDA 4YSYA 3DJGX 3AD8B 3AEBA 2GAGB 4NZHA 3VRBA 1L9EA 1LV0A 5CKUA 4OPIA 3KPFA 4GR1A 3L1RA 4I59A 4LU6A 4B67A 4XWZA 3GWDA 1KFYA 3GYIA 4LIIA 2DKHA 1LQTA 2IVEA 4JNAA 5J60A 3AE4A 4APNA 3CMMA 3FG2P 3SQPA 1ELIA 1JRXA 2GH5A 2FJAA 2VRMA 4JQ9A 4A79A 4J34A 1H7XA 4Z24A 4YT0A 4UDQA 4EMIA 3H8IA 1CBOA 1KSSA 1IJHA 2GR2A 5FMHA 4H2PA 1COYA 2NVKX 2WHDA 3QSMA 4Z2RA 4N9XA 3UP4A 1KSUA 4U2TA 3SFDA 4YKFA 2Y6RA 2CFYA 3NK0X 2AQJA 4J57A 4EQWA 3L8KA 3P4PA 2C76A 3BI5A 5EB4A 1ZP0A 3JSKA 5FS8A 1H7WA 4U8MA 3P4SA 2CVJA 2B76A 4AP1A 2XLUA 3IC9A 1L9DA 2C67A 1Q9IA 2DKIA 5DBJA 1JNRA 2AR8A 1FL2A 1E1MA 4P9SA 2Q7VA 1HYUA 3LJPA 1GALA 1LVLA 2WU2A 1K0JA 1VG0A 1LPFA 2JKCA 2A89A 3AECA 3NK2X 1M64A 3GRTA 3OZ2A 1BGNA 4JY3A 1TDNA 4OPLA 4XWRA 4FK1A 4MJWA 4IVMB 3AEGA 4TLXA 1GEUA 3C4AA 5LV9A 3AWIA 2WDRA 2QCUA 3C96A 1DODA 2E1MA 4O5UA 2AAQA 3T2KA 3P4QA 2BXRA 1Z6LA 2WOVA 3CNJA 4AT0A 4EIQA 2C3DA 2V3AA 1TDKA 1B5QA 3UKKA 1K4QA 1GRHA 4PAAA 2B7RA 4H4SA 3GWFA 3CGCA 4ADWA 1Y56A 1XHCA 3NK1X 4EQXA 1O5WA 2BA9A 1PS9A 3AE6A 3IHMA 3IWAA 1NHPA 4BK3A 5L46A 2XFNA 2OA1A 2JK6A 1S2QA 5M0ZA 1QJDA 1E7PA 3I6DA 3AE9A 2F5ZA 3CGEA 3UCLA 3VRAA 3DH9A 2WPFA 1KNRA 2GF3A 3AD7B 4DGKA 1NENA 4OPGA 1GERA 2BACA 2Y6QA 3DMEA 4CCQA 4C3XA 4A7AA 1CHUA 1CJ2A 2B9YA 4UP3A 1PHHA 4RG4A 3CPIG 4GAVA 2Q6UA 4EMWA 1GRGA 2C65A 3II4A 1S2YA 4FDCB 2BK3A 3B6DA 3UKPA 4REKA 1V59A 3IHGA 2YM1A 3GMBA 2WS3A 4YWOA 2W0HA 3CTYA 3UP5A 2X8CA 3VQRA 4B1BA 2BS2A 1E39A 4CRTA 2XCGA 1LQUA 3GSIA 1BF3A 4OPCA 2EQ6A 2PYXA 4NNJA 4GUVA 3O0HA 3HZLA 3SZCA 3B3RA 3T31A 3P1WA 4B64A 4YSXA 3UKFA 3KKJA 1F8RA 5CQFA 1GRFA 3FBSA 2BK5A 1CJCA 2UZZA 3KU9A 1OJ9A 4WX1A 4A6NA 5M10A 1REOA 2X99A 4CY6A 3AEEA 1H81A 2R45A 1YKJA 1H83A 4TM0A 4U8KA 3LZXA 2ZZBA 2BYBA 4GCMA 2EQ9A 2VOUA 1NHSA 3G5SA 5HXIA 3QVPA 4Z2UA 2C7GA 3UTHA 3DK8A 3GD3A 5U63A 2B9WA 5IQ1A 5GRTA 1F6MA 1NDAA 5ER0A 1PN0A 4ICYA 2X8GA 1LTXR 1BWCA 5EB5A 5EOWA 3I3LA 2BS3A 2JB2A 2YLSA 4GF7A 4H2NA 3BHFA 4FX9A 3CN8A 4K7ZA 2XVIA 1GV4A 3BI4A 3GYXA 4H4PA 1NG3A 1CJ3A 3GRSA 1TDFA 3NG7X 4FK1C 1BGJA 4NWZA 2YQUA 5FS9A 1XPQA 3K30A 4OPTA 1Q1WA 3ABVA 2B9XA 3URHA 2YG3A 2YLZA 3S61A 4DNAA 1MXTA 2BCGG 3QSEA 3DJEA 5KMRA 1ZMCA 4J31A 2YVJA 4JDRA 4G6GA 4OVIA 3DA1A 2OALA 5JCLA 1N1PA 3CNPA 5BUKA 3C4NA 1PXCA 4JNQA 2BS4A 2XLTA 2GQFA 3DK9A 1ZY8A 1ZKQA 1P2EA 2VQ7A 4II2A 1UKVG 4H7UA 3ISHA 4J36A 4C5OA 3ICSA 2YG5A 4EM3A 4IV9A 1IUWA 1GETA 2E4GA 1BZLA 2PHHA 4OPDA 5KMQA 1YY5A 2JB1A 3CPJG 1D4CA 2XLRA 4GDEA 3Q6JA 4AP3A 1EBDA 1YQZA 3NTAA 4IVOB 3E1TA 1K0LA 4A65A 3SZWA 2XVJA 3NT6A 4U8PA 5EBKA 2XFOA 2GMHA 1QLBA 4H4XA 4HA6A 3NN0X 1D7YA 1DXLA 4Z43A 3LADA 5JCMA 4USQA 2BK4A 2C3CA 3GD4A 5J7XA 1FECA 2WPEA 4H4TA 2JB3A 3AE5A 1PXBA 4GDPA 1B4VA 1E1KA 3S5WA 4PABA 1KNPA 4U2SA 3AYIA 4CNJA 2VVLA 2OAMA 2WEUA 1N4UA 2X8HA 3AYLA 3SYIA 3ATQA 3PVCA 1TRBA 4OCGA 1H86A 4K2XA 3QVRA 2YG6A 3EAOA 3SZ0A 4CCRA 4M52A 2CULA 2XDOA 3UTEA 1SEZA 1RYIA 1TYTA 1VG9A 2ZZCA 1L9CA 4B65A 1IUUA 1JNZA 4GRTA 4J56A 3UTGA 4DSHA 3CGDA 4U8OA 3G5QA 3KLJA 1S3BA 2R4EA 2JAEA 2C73A 1PXAA 1KDGA 2R0PA 3M13A 2GVCA 4USRA 4XXGA 2Z5YA 3KD9A 2WETA 4IA5A 2GR3A 4A5LA 4H4ZA 3FMWA 4U8LA 5GSNA 1F8WA 1YQ3A 1GRAA 2XLPA 4D03A 1RP0A 5HYMA 3T2ZA 3BI2A 3AE1A 1BKWA 2YAUA 2XFQA 2YWLA 3NYFA 3BHKA 5BULA 1W4XA 3NYCA 1GESA 4C74A 2OLOA 2RABA 3UKLA 2XFUA 1JEHA 1ZMDA 2JBVA 2R46A 2XVHA 2YLWA 4YSHA 1ZOVA 2BXSA 3COXA 3D1CA 3UOYA 4BJYA 1N4WA 3AE2A 4H2QA 3DJDA 1AOGA 2RGJA 2J3NA 4BURA 1O95A 2VZ2A 4U8JA 3SX6A 1H82A 1JRYA 3AYJA 4EMJA 2C64A 4II3A 5KMPA 2XVEA 3NHOX 4A99A 1NAAA 3T14A 1KF6A 4NTDA 1Q1RA 1NHQA 1D4EA 4CY8A 4B66A 3HYWA 2GMJA 3DJJA 3LZWA 1XANA 2QA2A 3GMCA 4BV6A 4IA6A 2BC1A 4UDPA 2R0GA 1GPEA 4NEVA 3QJ4A 2C72A 5BRTA 2GV8A 4AT2A 3ATRA 5KWFA 1EL8A 3IF9A 1DJQA 3GDNA 1GT8A 2V60A 3ITJA 1TDEA 3D8XA 1PBFA 4ZCCA 5KVHA 4ZCDA 3ZDNA 2GB0A 4H50A 4D04A 2Z5XA 1B37A 3LOVA 1NPXA 2GAHB 2GQWA 4WCTA 3WE0A 3AEAA 2BABA 3NIXA 2WDVA 2V61A 2IVDA 4OPUA 4K5RA 2RGOA 2GRTA 1OJCA 4ECHA 2YLRA 4HB9A 4H4WA 2WU5A 2R4JA 5IQ4A 2OLNA 2YM2A 3NH3X 3VRDB 2RGHA 1GRTA 1D4DA 4EQSA 4Z26A 1GSNA 3K7MX 3T37A 1DOEA 3UKQA 3SM8A 2V5ZA 2O9ZA 5KOWA 1PJ6A 1DNCA 1PDHA 2VVMA 1O94A 2A8XA 1DOBA 2WQYA 3ALLA 3NTDA 1X31B 3K7TA 3GYJA 4B63A 1E1LA 5KOXA 3FIMB 2XFPA 3GDPA 5BVAA 4B69A 1JRZA 3H8LA 2ARDA 2WP9A 3NNEA 5HHFA 1IUVA 4JN9A 3P9UA 3V3OA 3ALJA 1ZK7A 2YR6A 3ICTA 4U8NA 1MO9A 1JU2A 1ZDLA 3ICRA 4Z2TA 4KPRA 4X9NA 2WBAA 5C3JA 4G6HA 4O5QA 4RG3A 1VRQB 2E5VA 2A87A 3G5RA 2FBWA 2HQMA 3QSSA 1ZOYA 1Y56B 2WOIA 4H2RA 3UKHA 2BRYA 1K0IA 2QA1A 4H4QA 5HY5A 2B7SA 1CC2A 1GTHA 4U8IA 4JY2A 3T0KA 3ZYXA 1TDOA 1PBCA 3AEFA 1GREA 1PBBA 3LXDA 3SZFA 3DGHA 1E1NA 2CDUA 4LA1A 4G9KA 4RSLA 4K22A 1EL7A 3CNSA 4EIPA 5KNLA 4J33A 3RP6A 2H89A 4U2LA 1EL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0Z A;  5C2T A;  3DK4 A;  1Y0P A;  3V76 A;  2YVG A;  3H4K A;  3QFB A;  1GRB A;  1P2H A;  3RP8 A;  2WES A;  1FOH A;  3AB1 A;  4YXD A;  4C3Y A;  4H4Y A;  3NLC A;  1DOC A;  1QO8 A;  1OJT A;  2H88 A;  2YR5 A;  1YQ4 A;  2ZZ0 A;  3V3N A;  1CF3 A;  1E6E A;  1FEA A;  3EAN A;  2IID A;  5U25 A;  1D7L A;  1TYP A;  4E0V A;  3F8D A;  3UTF A;  4NEW A;  4C77 A;  2VRL A;  2WP6 A;  3AE7 A;  3OC4 A;  1OJD A;  4I58 A;  4A9W A;  5IPY A;  4TM1 A;  5JCK A;  2NPX A;  2YLT A;  4YTP A;  4AOS A;  3KVE A;  3F8P A;  1DJN A;  5FS6 A;  4TM3 A;  2TMD A;  4TLZ A;  4AOX A;  5KXJ A;  4A6N B;  4CNK A;  3AE8 A;  2C70 A;  1FEB A;  2VQB A;  2WPC A;  4J2W A;  3KA7 A;  4B68 A;  1NG4 A;  1RSG A;  1GXF A;  3ALM A;  4YTM A;  3VR9 A;  2XLS A;  3PO7 A;  3K7Q X;  3BNM A;  3UOV A;  3ADA B;  1PBD A;  2GR0 A;  1FCD A;  3CGB A;  3EPT A;  2APG A;  3F8R A;  2BC0 A;  2V3B A;  3AXB A;  3NKS A;  4EQR A;  4YTN A;  3EF6 A;  1IUX A;  1PBE A;  3Q9T A;  2YR4 A;  3QFA A;  4Z25 A;  4K5S A;  3NN6 X;  4CBQ A;  4X9M A;  4Y4N A;  1IUT A;  1EL9 A;  3AED A;  4X4J A;  2EQ8 A;  2QAE A;  2V6O A;  1OJA A;  2GEW A;  2BCP A;  3SFE A;  2ACZ A;  1F3P A;  3PS9 A;  4DSG A;  1IUS A;  1CJ4 A;  1ZX9 A;  2GR1 A;  1PJ5 A;  1CC6 A;  2X50 A;  2XYO A;  3NRN A;  4KX6 A;  3RED A;  4H4U A;  4YKG A;  1H6V A;  3NYE A;  5TR3 A;  2YLX A;  1H84 A;  4Z44 A;  4TM4 A;  4H4R A;  4BJZ A;  1PJ7 A;  1CL0 A;  3CNT A;  1MOK A;  1LJ1 A;  1L0V A;  4BK1 A;  2R9Z A;  5JCI A;  1GND A;  5JCN A;  1B8S A;  2YG4 A;  5U1O A;  5KVI A;  3R9U A;  1CC4 A;  2FJB A;  1JOA A;  2WOW A;  4Y4M A;  4ZN0 A;  2YVF A;  1N4V A;  2X3N A;  3RP7 A;  2C66 A;  2YG7 A;  3LB8 A;  2XVF A;  3NGC X;  2EQ7 A;  3UKA A;  3DGZ A;  3M0O A;  1M6I A;  2R0C A;  1GOS A;  4NTE A;  2VVL G;  5FS7 A;  1NEK A;  4H4V A;  3AE3 A;  2FJE A;  3BNU A;  2TPR A;  3AD9 B;  3M12 A;  3P4R A;  1VDC A;  3RHA A;  4EM4 A;  2WP5 A;  3FPZ A;  1VQW A;  1ONF A;  1XDI A;  4K8D A;  3CIR A;  2Q0K A;  3SGL A;  3UOZ A;  3RNM A;  4NTC A;  1NHR A;  4Y4L A;  3UOX A;  3CND A;  2C75 A;  1S3E A;  3CPH G;  3VR8 A;  5KRQ A;  1F8S A;  1GTE A;  1D5T A;  4BK2 A;  2WDQ A;  4YSZ A;  4UDR A;  2ZBW A;  2Q0L A;  2FJD A;  4YSY A;  3DJG X;  3AD8 B;  3AEB A;  2GAG B;  4NZH A;  3VRB A;  1L9E A;  1LV0 A;  5CKU A;  4OPI A;  3KPF A;  4GR1 A;  3L1R A;  4I59 A;  4LU6 A;  4B67 A;  4XWZ A;  3GWD A;  1KFY A;  3GYI A;  4LII A;  2DKH A;  1LQT A;  2IVE A;  4JNA A;  5J60 A;  3AE4 A;  4APN A;  3FG2 P;  3SQP A;  1ELI A;  1JRX A;  2GH5 A;  2FJA A;  2VRM A;  4JQ9 A;  4A79 A;  4J34 A;  1H7X A;  4Z24 A;  4YT0 A;  4UDQ A;  4EMI A;  3H8I A;  1CBO A;  1KSS A;  1IJH A;  2GR2 A;  5FMH A;  4H2P A;  1COY A;  2NVK X;  2WHD A;  3QSM A;  4Z2R A;  4N9X A;  3UP4 A;  1KSU A;  4U2T A;  3SFD A;  4YKF A;  2Y6R A;  2CFY A;  3NK0 X;  2AQJ A;  4J57 A;  4EQW A;  3L8K A;  3P4P A;  2C76 A;  3BI5 A;  5EB4 A;  1ZP0 A;  3JSK A;  5FS8 A;  1H7W A;  4U8M A;  3P4S A;  2CVJ A;  2B76 A;  4AP1 A;  2XLU A;  3IC9 A;  1L9D A;  2C67 A;  1Q9I A;  2DKI A;  5DBJ A;  1JNR A;  2AR8 A;  1FL2 A;  1E1M A;  4P9S A;  2Q7V A;  1HYU A;  3LJP A;  1GAL A;  1LVL A;  2WU2 A;  1K0J A;  1VG0 A;  1LPF A;  2JKC A;  2A89 A;  3AEC A;  3NK2 X;  1M64 A;  3GRT A;  3OZ2 A;  1BGN A;  4JY3 A;  1TDN A;  4OPL A;  4XWR A;  4FK1 A;  4MJW A;  4IVM B;  3AEG A;  4TLX A;  1GEU A;  3C4A A;  5LV9 A;  3AWI A;  2WDR A;  2QCU A;  3C96 A;  1DOD A;  2E1M A;  4O5U A;  2AAQ A;  3P4Q A;  2BXR A;  1Z6L A;  2WOV A;  3CNJ A;  4AT0 A;  4EIQ A;  2C3D A;  2V3A A;  1TDK A;  1B5Q A;  3UKK A;  1K4Q A;  1GRH A;  4PAA A;  2B7R A;  4H4S A;  3GWF A;  3CGC A;  4ADW A;  1Y56 A;  1XHC A;  3NK1 X;  4EQX A;  1O5W A;  2BA9 A;  1PS9 A;  3AE6 A;  3IHM A;  3IWA A;  1NHP A;  4BK3 A;  5L46 A;  2XFN A;  2OA1 A;  2JK6 A;  1S2Q A;  5M0Z A;  1QJD A;  1E7P A;  3I6D A;  3AE9 A;  2F5Z A;  3CGE A;  3UCL A;  3VRA A;  3DH9 A;  2WPF A;  1KNR A;  2GF3 A;  3AD7 B;  4DGK A;  1NEN A;  4OPG A;  1GER A;  2BAC A;  2Y6Q A;  3DME A;  4CCQ A;  4C3X A;  4A7A A;  1CHU A;  1CJ2 A;  2B9Y A;  4UP3 A;  1PHH A;  4RG4 A;  3CPI G;  2Q6U A;  4EMW A;  1GRG A;  2C65 A;  3II4 A;  1S2Y A;  4FDC B;  2BK3 A;  3B6D A;  3UKP A;  4REK A;  1V59 A;  3IHG A;  2YM1 A;  3GMB A;  2WS3 A;  4YWO A;  2W0H A;  3CTY A;  3UP5 A;  2X8C A;  3VQR A;  4B1B A;  2BS2 A;  1E39 A;  4CRT A;  2XCG A;  1LQU A;  3GSI A;  1BF3 A;  4OPC A;  2EQ6 A;  2PYX A;  4GUV A;  3O0H A;  3HZL A;  3B3R A;  3P1W A;  4B64 A;  4YSX A;  3UKF A;  3KKJ A;  1F8R A;  5CQF A;  1GRF A;  3FBS A;  2BK5 A;  1CJC A;  2UZZ A;  3KU9 A;  1OJ9 A;  4WX1 A;  4A6N A;  5M10 A;  1REO A;  2X99 A;  4CY6 A;  3AEE A;  1H81 A;  2R45 A;  1YKJ A;  1H83 A;  4TM0 A;  4U8K A;  3LZX A;  2ZZB A;  2BYB A;  4GCM A;  2EQ9 A;  2VOU A;  1NHS A;  3G5S A;  5HXI A;  3QVP A;  4Z2U A;  2C7G A;  3UTH A;  3DK8 A;  3GD3 A;  5U63 A;  2B9W A;  5IQ1 A;  5GRT A;  1F6M A;  1NDA A;  5ER0 A;  1PN0 A;  4ICY A;  2X8G A;  1LTX R;  1BWC A;  5EB5 A;  5EOW A;  3I3L A;  2BS3 A;  2JB2 A;  2YLS A;  4GF7 A;  4H2N A;  3BHF A;  4FX9 A;  3CN8 A;  4K7Z A;  2XVI A;  1GV4 A;  3BI4 A;  4H4P A;  1NG3 A;  1CJ3 A;  3GRS A;  1TDF A;  3NG7 X;  4FK1 C;  1BGJ A;  2YQU A;  5FS9 A;  1XPQ A;  3K30 A;  4OPT A;  1Q1W A;  3ABV A;  2B9X A;  3URH A;  2YG3 A;  2YLZ A;  3S61 A;  4DNA A;  1MXT A;  2BCG G;  3QSE A;  3DJE A;  1ZMC A;  4J31 A;  2YVJ A;  4JDR A;  4OVI A;  3DA1 A;  2OAL A;  5JCL A;  1N1P A;  3CNP A;  5BUK A;  3C4N A;  1PXC A;  4JNQ A;  2BS4 A;  2XLT A;  2GQF A;  3DK9 A;  1ZY8 A;  1ZKQ A;  1P2E A;  2VQ7 A;  1UKV G;  4H7U A;  3ISH A;  4J36 A;  4C5O A;  3ICS A;  2YG5 A;  4EM3 A;  4IV9 A;  1IUW A;  1GET A;  2E4G A;  1BZL A;  2PHH A;  4OPD A;  1YY5 A;  2JB1 A;  3CPJ G;  1D4C A;  2XLR A;  4GDE A;  3Q6J A;  4AP3 A;  1EBD A;  1YQZ A;  3NTA A;  4IVO B;  3E1T A;  1K0L A;  4A65 A;  2XVJ A;  3NT6 A;  4U8P A;  5EBK A;  2XFO A;  2GMH A;  1QLB A;  4H4X A;  4HA6 A;  3NN0 X;  1D7Y A;  1DXL A;  4Z43 A;  3LAD A;  5JCM A;  4USQ A;  2BK4 A;  2C3C A;  3GD4 A;  5J7X A;  1FEC A;  2WPE A;  4H4T A;  2JB3 A;  3AE5 A;  1PXB A;  4GDP A;  1B4V A;  1E1K A;  3S5W A;  4PAB A;  1KNP A;  4U2S A;  3AYI A;  4CNJ A;  2VVL A;  2OAM A;  2WEU A;  1N4U A;  2X8H A;  3AYL A;  3ATQ A;  3PVC A;  1TRB A;  4OCG A;  1H86 A;  4K2X A;  3QVR A;  2YG6 A;  3EAO A;  4CCR A;  4M52 A;  2CUL A;  2XDO A;  3UTE A;  1SEZ A;  1RYI A;  1TYT A;  1VG9 A;  2ZZC A;  1L9C A;  4B65 A;  1IUU A;  1JNZ A;  4GRT A;  4J56 A;  3UTG A;  4DSH A;  3CGD A;  4U8O A;  3G5Q A;  3KLJ A;  1S3B A;  2R4E A;  2JAE A;  2C73 A;  1PXA A;  1KDG A;  2R0P A;  3M13 A;  2GVC A;  4USR A;  4XXG A;  2Z5Y A;  3KD9 A;  2WET A;  4IA5 A;  2GR3 A;  4A5L A;  4H4Z A;  3FMW A;  4U8L A;  5GSN A;  1F8W A;  1YQ3 A;  1GRA A;  2XLP A;  4D03 A;  1RP0 A;  5HYM A;  3BI2 A;  3AE1 A;  1BKW A;  2YAU A;  2XFQ A;  2YWL A;  3NYF A;  3BHK A;  5BUL A;  1W4X A;  3NYC A;  1GES A;  4C74 A;  2OLO A;  2RAB A;  3UKL A;  2XFU A;  1JEH A;  1ZMD A;  2JBV A;  2R46 A;  2XVH A;  2YLW A;  4YSH A;  1ZOV A;  2BXS A;  3COX A;  3D1C A;  3UOY A;  4BJY A;  1N4W A;  3AE2 A;  4H2Q A;  3DJD A;  1AOG A;  2RGJ A;  2J3N A;  4BUR A;  1O95 A;  2VZ2 A;  4U8J A;  1H82 A;  1JRY A;  3AYJ A;  4EMJ A;  2C64 A;  2XVE A;  3NHO X;  4A99 A;  1NAA A;  1KF6 A;  4NTD A;  1Q1R A;  1NHQ A;  1D4E A;  4CY8 A;  4B66 A;  2GMJ A;  3DJJ A;  3LZW A;  1XAN A;  2QA2 A;  3GMC A;  4BV6 A;  4IA6 A;  2BC1 A;  4UDP A;  2R0G A;  1GPE A;  4NEV A;  3QJ4 A;  2C72 A;  5BRT A;  2GV8 A;  4AT2 A;  3ATR A;  5KWF A;  1EL8 A;  3IF9 A;  1DJQ A;  3GDN A;  1GT8 A;  2V60 A;  3ITJ A;  1TDE A;  3D8X A;  1PBF A;  4ZCC A;  5KVH A;  4ZCD A;  3ZDN A;  2GB0 A;  4H50 A;  4D04 A;  2Z5X A;  1B37 A;  3LOV A;  1NPX A;  2GAH B;  2GQW A;  4WCT A;  3WE0 A;  3AEA A;  2BAB A;  3NIX A;  2WDV A;  2V61 A;  2IVD A;  4OPU A;  4K5R A;  2RGO A;  2GRT A;  1OJC A;  4ECH A;  2YLR A;  4HB9 A;  4H4W A;  2WU5 A;  2R4J A;  5IQ4 A;  2OLN A;  2YM2 A;  3NH3 X;  3VRD B;  2RGH A;  1GRT A;  1D4D A;  4EQS A;  4Z26 A;  1GSN A;  3K7M X;  3T37 A;  1DOE A;  3UKQ A;  3SM8 A;  2V5Z A;  2O9Z A;  5KOW A;  1PJ6 A;  1DNC A;  1PDH A;  2VVM A;  1O94 A;  2A8X A;  1DOB A;  2WQY A;  3ALL A;  3NTD A;  1X31 B;  3K7T A;  3GYJ A;  4B63 A;  1E1L A;  5KOX A;  3FIM B;  2XFP A;  3GDP A;  5BVA A;  4B69 A;  1JRZ A;  3H8L A;  2ARD A;  2WP9 A;  3NNE A;  5HHF A;  1IUV A;  4JN9 A;  3P9U A;  3V3O A;  3ALJ A;  1ZK7 A;  2YR6 A;  3ICT A;  4U8N A;  1MO9 A;  1JU2 A;  1ZDL A;  3ICR A;  4Z2T A;  4KPR A;  4X9N A;  2WBA A;  5C3J A;  4O5Q A;  4RG3 A;  1VRQ B;  2E5V A;  2A87 A;  3G5R A;  2FBW A;  2HQM A;  3QSS A;  1ZOY A;  1Y56 B;  2WOI A;  4H2R A;  3UKH A;  1K0I A;  2QA1 A;  4H4Q A;  5HY5 A;  2B7S A;  1CC2 A;  1GTH A;  4U8I A;  4JY2 A;  3ZYX A;  1TDO A;  1PBC A;  3AEF A;  1GRE A;  1PBB A;  3LXD A;  3DGH A;  1E1N A;  2CDU A;  4LA1 A;  4RSL A;  4K22 A;  1EL7 A;  3CNS A;  4EIP A;  4J33 A;  3RP6 A;  2H89 A;  4U2L A;  1EL5 A; 
#chains in the Genus database with same CATH topology
 2I0Z A;  5C2T A;  3DK4 A;  1Y0P A;  3V76 A;  2YVG A;  3H4K A;  3QFB A;  1GRB A;  1P2H A;  3RP8 A;  2WES A;  1FOH A;  3AB1 A;  4YXD A;  4C3Y A;  4GAP A;  4H4Y A;  3NLC A;  1DOC A;  1QO8 A;  1OJT A;  2H88 A;  2YR5 A;  5KMS A;  1YQ4 A;  2ZZ0 A;  3V3N A;  1CF3 A;  1E6E A;  1FEA A;  3EAN A;  2IID A;  5U25 A;  1D7L A;  1TYP A;  4E0V A;  3F8D A;  3UTF A;  4NEW A;  4C77 A;  2VRL A;  2WP6 A;  3AE7 A;  3OC4 A;  3SXI A;  1OJD A;  4I58 A;  4A9W A;  5IPY A;  4TM1 A;  5JCK A;  4G73 A;  2NPX A;  2YLT A;  4YTP A;  4AOS A;  3KVE A;  3F8P A;  1DJN A;  5FS6 A;  4TM3 A;  2TMD A;  4TLZ A;  4AOX A;  5KXJ A;  4G74 A;  4A6N B;  4CNK A;  3AE8 A;  2C70 A;  1FEB A;  3SY4 A;  3T2Y A;  2VQB A;  2WPC A;  4J2W A;  3KA7 A;  4B68 A;  1NG4 A;  1RSG A;  3HYX A;  1GXF A;  3ALM A;  4YTM A;  3VR9 A;  2XLS A;  3PO7 A;  3K7Q X;  3BNM A;  3UOV A;  3ADA B;  1PBD A;  2GR0 A;  1FCD A;  3CGB A;  3EPT A;  2APG A;  3F8R A;  2BC0 A;  2V3B A;  3AXB A;  3NKS A;  4EQR A;  3KPK A;  4YTN A;  3EF6 A;  1IUX A;  1PBE A;  3Q9T A;  2YR4 A;  3QFA A;  4Z25 A;  4K5S A;  3NN6 X;  4CBQ A;  4X9M A;  4Y4N A;  1IUT A;  1EL9 A;  3AED A;  4X4J A;  2EQ8 A;  2QAE A;  2V6O A;  1OJA A;  2GEW A;  2BCP A;  3SFE A;  2ACZ A;  1F3P A;  3PS9 A;  4DSG A;  1IUS A;  1CJ4 A;  1ZX9 A;  2GR1 A;  1PJ5 A;  1CC6 A;  2X50 A;  2XYO A;  3NRN A;  4KX6 A;  3RED A;  4H4U A;  4YKG A;  1H6V A;  3NYE A;  5TR3 A;  2YLX A;  1H84 A;  4Z44 A;  4TM4 A;  4H4R A;  4BJZ A;  1PJ7 A;  1CL0 A;  3CNT A;  1MOK A;  1LJ1 A;  1L0V A;  4BK1 A;  2R9Z A;  5JCI A;  1GND A;  5JCN A;  1B8S A;  2YG4 A;  5U1O A;  5KVI A;  3R9U A;  1CC4 A;  2FJB A;  1JOA A;  2WOW A;  4Y4M A;  4ZN0 A;  2YVF A;  2C4C A;  1N4V A;  2X3N A;  3RP7 A;  2C66 A;  2YG7 A;  3LB8 A;  2XVF A;  3NGC X;  2EQ7 A;  3UKA A;  3DGZ A;  3M0O A;  1M6I A;  2R0C A;  1GOS A;  4NTE A;  2VVL G;  3HYV A;  1NEK A;  5FS7 A;  4H4V A;  3AE3 A;  2FJE A;  3BNU A;  2TPR A;  3AD9 B;  3M12 A;  3P4R A;  1VDC A;  3RHA A;  4EM4 A;  2WP5 A;  3FPZ A;  1VQW A;  1ONF A;  1XDI A;  2BRA A;  3CIR A;  2Q0K A;  4K8D A;  3SGL A;  3UOZ A;  3RNM A;  4NTC A;  1NHR A;  4Y4L A;  3UOX A;  3CND A;  2C75 A;  1S3E A;  3CPH G;  3VR8 A;  5KRQ A;  1F8S A;  1GTE A;  1D5T A;  4BK2 A;  2WDQ A;  4YSZ A;  4UDR A;  2ZBW A;  2Q0L A;  2FJD A;  4YSY A;  3DJG X;  3AD8 B;  3AEB A;  2GAG B;  4NZH A;  3VRB A;  1L9E A;  1LV0 A;  5CKU A;  4OPI A;  3KPF A;  4GR1 A;  3L1R A;  4I59 A;  4LU6 A;  4B67 A;  4XWZ A;  3GWD A;  1KFY A;  3GYI A;  4LII A;  2DKH A;  1LQT A;  2IVE A;  4JNA A;  5J60 A;  3AE4 A;  4APN A;  3CMM A;  3FG2 P;  3SQP A;  1ELI A;  1JRX A;  2GH5 A;  2FJA A;  2VRM A;  4JQ9 A;  4A79 A;  4J34 A;  1H7X A;  4Z24 A;  4YT0 A;  4UDQ A;  4EMI A;  3H8I A;  1CBO A;  1KSS A;  1IJH A;  2GR2 A;  5FMH A;  4H2P A;  1COY A;  2NVK X;  2WHD A;  3QSM A;  4Z2R A;  4N9X A;  3UP4 A;  1KSU A;  4U2T A;  3SFD A;  4YKF A;  2Y6R A;  2CFY A;  3NK0 X;  2AQJ A;  4J57 A;  4EQW A;  3L8K A;  3P4P A;  2C76 A;  3BI5 A;  5EB4 A;  1ZP0 A;  3JSK A;  5FS8 A;  1H7W A;  4U8M A;  3P4S A;  2CVJ A;  2B76 A;  4AP1 A;  2XLU A;  3IC9 A;  1L9D A;  2C67 A;  1Q9I A;  2DKI A;  5DBJ A;  1JNR A;  2AR8 A;  1FL2 A;  1E1M A;  4P9S A;  2Q7V A;  1HYU A;  3LJP A;  1GAL A;  1LVL A;  2WU2 A;  1K0J A;  1VG0 A;  1LPF A;  2JKC A;  2A89 A;  3AEC A;  3NK2 X;  1M64 A;  3GRT A;  3OZ2 A;  1BGN A;  4JY3 A;  1TDN A;  4OPL A;  4XWR A;  4FK1 A;  4MJW A;  4IVM B;  3AEG A;  4TLX A;  1GEU A;  3C4A A;  5LV9 A;  3AWI A;  2WDR A;  2QCU A;  3C96 A;  1DOD A;  2E1M A;  4O5U A;  2AAQ A;  3T2K A;  3P4Q A;  2BXR A;  1Z6L A;  2WOV A;  3CNJ A;  4AT0 A;  4EIQ A;  2C3D A;  2V3A A;  1TDK A;  1B5Q A;  3UKK A;  1K4Q A;  1GRH A;  4PAA A;  2B7R A;  4H4S A;  3GWF A;  3CGC A;  4ADW A;  1Y56 A;  1XHC A;  3NK1 X;  4EQX A;  1O5W A;  2BA9 A;  1PS9 A;  3AE6 A;  3IHM A;  3IWA A;  1NHP A;  4BK3 A;  5L46 A;  2XFN A;  2OA1 A;  2JK6 A;  1S2Q A;  5M0Z A;  1QJD A;  1E7P A;  3I6D A;  3AE9 A;  2F5Z A;  3CGE A;  3UCL A;  3VRA A;  3DH9 A;  2WPF A;  1KNR A;  2GF3 A;  3AD7 B;  4DGK A;  1NEN A;  4OPG A;  1GER A;  2BAC A;  2Y6Q A;  3DME A;  4CCQ A;  4C3X A;  4A7A A;  2B9Y A;  1CHU A;  1CJ2 A;  4UP3 A;  1PHH A;  4RG4 A;  3CPI G;  4GAV A;  2Q6U A;  4EMW A;  1GRG A;  2C65 A;  3II4 A;  1S2Y A;  4FDC B;  2BK3 A;  3B6D A;  3UKP A;  4REK A;  1V59 A;  3IHG A;  2YM1 A;  3GMB A;  2WS3 A;  4YWO A;  2W0H A;  3CTY A;  3UP5 A;  2X8C A;  3VQR A;  4B1B A;  2BS2 A;  1E39 A;  4CRT A;  2XCG A;  1LQU A;  3GSI A;  1BF3 A;  4OPC A;  2EQ6 A;  2PYX A;  4NNJ A;  4GUV A;  3O0H A;  3HZL A;  3SZC A;  3B3R A;  3T31 A;  3P1W A;  4B64 A;  4YSX A;  3UKF A;  3KKJ A;  1F8R A;  5CQF A;  1GRF A;  3FBS A;  2BK5 A;  1CJC A;  2UZZ A;  3KU9 A;  1OJ9 A;  4WX1 A;  4A6N A;  5M10 A;  1REO A;  2X99 A;  4CY6 A;  3AEE A;  1H81 A;  2R45 A;  1YKJ A;  1H83 A;  4TM0 A;  4U8K A;  3LZX A;  2ZZB A;  2BYB A;  4GCM A;  2EQ9 A;  2VOU A;  1NHS A;  3G5S A;  5HXI A;  3QVP A;  4Z2U A;  2C7G A;  3UTH A;  3DK8 A;  3GD3 A;  5U63 A;  2B9W A;  5IQ1 A;  5GRT A;  1F6M A;  1NDA A;  5ER0 A;  1PN0 A;  4ICY A;  2X8G A;  1LTX R;  1BWC A;  5EB5 A;  5EOW A;  3I3L A;  2BS3 A;  2JB2 A;  2YLS A;  4GF7 A;  4H2N A;  3BHF A;  4FX9 A;  3CN8 A;  4K7Z A;  2XVI A;  1GV4 A;  3BI4 A;  3GYX A;  4H4P A;  1NG3 A;  1CJ3 A;  3GRS A;  1TDF A;  3NG7 X;  4FK1 C;  1BGJ A;  4NWZ A;  2YQU A;  5FS9 A;  1XPQ A;  3K30 A;  4OPT A;  1Q1W A;  3ABV A;  2B9X A;  3URH A;  2YG3 A;  2YLZ A;  3S61 A;  4DNA A;  1MXT A;  2BCG G;  3QSE A;  3DJE A;  5KMR A;  1ZMC A;  4J31 A;  2YVJ A;  4JDR A;  4G6G A;  4OVI A;  3DA1 A;  2OAL A;  5JCL A;  1N1P A;  3CNP A;  5BUK A;  3C4N A;  1PXC A;  4JNQ A;  2BS4 A;  2XLT A;  2GQF A;  3DK9 A;  1ZY8 A;  1ZKQ A;  1P2E A;  2VQ7 A;  4II2 A;  1UKV G;  4H7U A;  3ISH A;  4J36 A;  4C5O A;  3ICS A;  2YG5 A;  4EM3 A;  4IV9 A;  1IUW A;  1GET A;  2E4G A;  1BZL A;  2PHH A;  4OPD A;  5KMQ A;  1YY5 A;  2JB1 A;  3CPJ G;  1D4C A;  2XLR A;  4GDE A;  3Q6J A;  4AP3 A;  1EBD A;  1YQZ A;  3NTA A;  4IVO B;  3E1T A;  1K0L A;  4A65 A;  3SZW A;  2XVJ A;  3NT6 A;  4U8P A;  5EBK A;  2XFO A;  2GMH A;  1QLB A;  4H4X A;  4HA6 A;  3NN0 X;  1D7Y A;  1DXL A;  4Z43 A;  3LAD A;  5JCM A;  4USQ A;  2BK4 A;  2C3C A;  3GD4 A;  5J7X A;  1FEC A;  2WPE A;  4H4T A;  2JB3 A;  3AE5 A;  1PXB A;  4GDP A;  1B4V A;  1E1K A;  3S5W A;  4PAB A;  1KNP A;  4U2S A;  3AYI A;  4CNJ A;  2VVL A;  2OAM A;  2WEU A;  1N4U A;  2X8H A;  3AYL A;  3SYI A;  3ATQ A;  3PVC A;  1TRB A;  4OCG A;  1H86 A;  4K2X A;  3QVR A;  2YG6 A;  3EAO A;  3SZ0 A;  4CCR A;  4M52 A;  2CUL A;  2XDO A;  3UTE A;  1SEZ A;  1RYI A;  1TYT A;  1VG9 A;  2ZZC A;  1L9C A;  4B65 A;  1IUU A;  1JNZ A;  4GRT A;  4J56 A;  3UTG A;  4DSH A;  3CGD A;  4U8O A;  3G5Q A;  3KLJ A;  1S3B A;  2R4E A;  2JAE A;  2C73 A;  1PXA A;  1KDG A;  2R0P A;  3M13 A;  2GVC A;  4USR A;  4XXG A;  2Z5Y A;  3KD9 A;  2WET A;  4IA5 A;  2GR3 A;  4A5L A;  4H4Z A;  3FMW A;  4U8L A;  5GSN A;  1F8W A;  1YQ3 A;  1GRA A;  2XLP A;  4D03 A;  1RP0 A;  5HYM A;  3T2Z A;  3BI2 A;  3AE1 A;  1BKW A;  2YAU A;  2XFQ A;  2YWL A;  3NYF A;  3BHK A;  5BUL A;  1W4X A;  3NYC A;  1GES A;  4C74 A;  2OLO A;  2RAB A;  3UKL A;  2XFU A;  1JEH A;  1ZMD A;  2JBV A;  2R46 A;  2XVH A;  2YLW A;  4YSH A;  1ZOV A;  2BXS A;  3COX A;  3D1C A;  3UOY A;  4BJY A;  1N4W A;  3AE2 A;  4H2Q A;  3DJD A;  1AOG A;  2RGJ A;  2J3N A;  4BUR A;  1O95 A;  2VZ2 A;  4U8J A;  3SX6 A;  1H82 A;  1JRY A;  3AYJ A;  4EMJ A;  2C64 A;  4II3 A;  5KMP A;  2XVE A;  3NHO X;  4A99 A;  1NAA A;  3T14 A;  1KF6 A;  4NTD A;  1Q1R A;  1NHQ A;  1D4E A;  4CY8 A;  4B66 A;  3HYW A;  2GMJ A;  3DJJ A;  3LZW A;  1XAN A;  2QA2 A;  3GMC A;  4BV6 A;  4IA6 A;  2BC1 A;  4UDP A;  2R0G A;  1GPE A;  4NEV A;  3QJ4 A;  2C72 A;  5BRT A;  2GV8 A;  4AT2 A;  3ATR A;  5KWF A;  1EL8 A;  3IF9 A;  1DJQ A;  3GDN A;  1GT8 A;  2V60 A;  3ITJ A;  1TDE A;  3D8X A;  1PBF A;  4ZCC A;  5KVH A;  4ZCD A;  3ZDN A;  2GB0 A;  4H50 A;  4D04 A;  2Z5X A;  1B37 A;  3LOV A;  1NPX A;  2GAH B;  2GQW A;  4WCT A;  3WE0 A;  3AEA A;  2BAB A;  3NIX A;  2WDV A;  2V61 A;  2IVD A;  4OPU A;  4K5R A;  2RGO A;  2GRT A;  1OJC A;  4ECH A;  2YLR A;  4HB9 A;  4H4W A;  2WU5 A;  2R4J A;  5IQ4 A;  2OLN A;  2YM2 A;  3NH3 X;  3VRD B;  2RGH A;  1GRT A;  1D4D A;  4EQS A;  4Z26 A;  1GSN A;  3K7M X;  3T37 A;  1DOE A;  3UKQ A;  3SM8 A;  2V5Z A;  2O9Z A;  5KOW A;  1PJ6 A;  1DNC A;  1PDH A;  2VVM A;  1O94 A;  2A8X A;  1DOB A;  2WQY A;  3ALL A;  3NTD A;  1X31 B;  3K7T A;  3GYJ A;  4B63 A;  1E1L A;  5KOX A;  3FIM B;  2XFP A;  3GDP A;  5BVA A;  4B69 A;  1JRZ A;  3H8L A;  2ARD A;  2WP9 A;  3NNE A;  5HHF A;  1IUV A;  4JN9 A;  3P9U A;  3V3O A;  3ALJ A;  1ZK7 A;  2YR6 A;  3ICT A;  4U8N A;  1MO9 A;  1JU2 A;  1ZDL A;  3ICR A;  4Z2T A;  4KPR A;  4X9N A;  2WBA A;  5C3J A;  4G6H A;  4O5Q A;  4RG3 A;  1VRQ B;  2E5V A;  2A87 A;  3G5R A;  2FBW A;  2HQM A;  3QSS A;  1ZOY A;  1Y56 B;  2WOI A;  4H2R A;  3UKH A;  2BRY A;  1K0I A;  2QA1 A;  4H4Q A;  5HY5 A;  2B7S A;  1CC2 A;  1GTH A;  4U8I A;  4JY2 A;  3T0K A;  3ZYX A;  1TDO A;  1PBC A;  3AEF A;  1GRE A;  1PBB A;  3LXD A;  3SZF A;  3DGH A;  1E1N A;  2CDU A;  4LA1 A;  4G9K A;  4RSL A;  4K22 A;  1EL7 A;  3CNS A;  4EIP A;  5KNL A;  4J33 A;  3RP6 A;  2H89 A;  4U2L A;  1EL5 A; 
#chains in the Genus database with same CATH homology
 2I0Z A;  5C2T A;  3DK4 A;  1Y0P A;  3V76 A;  2YVG A;  3H4K A;  3QFB A;  1GRB A;  1P2H A;  3RP8 A;  2WES A;  1FOH A;  3AB1 A;  4YXD A;  4C3Y A;  4GAP A;  4H4Y A;  3NLC A;  1DOC A;  1QO8 A;  1OJT A;  2H88 A;  2YR5 A;  5KMS A;  1YQ4 A;  2ZZ0 A;  3V3N A;  1CF3 A;  1E6E A;  1FEA A;  3EAN A;  2IID A;  5U25 A;  1D7L A;  1TYP A;  4E0V A;  3F8D A;  3UTF A;  4NEW A;  4C77 A;  2VRL A;  2WP6 A;  3AE7 A;  3OC4 A;  3SXI A;  1OJD A;  4I58 A;  4A9W A;  5IPY A;  4TM1 A;  5JCK A;  4G73 A;  2NPX A;  2YLT A;  4YTP A;  4AOS A;  3KVE A;  3F8P A;  1DJN A;  5FS6 A;  4TM3 A;  2TMD A;  4TLZ A;  4AOX A;  5KXJ A;  4G74 A;  4A6N B;  4CNK A;  3AE8 A;  2C70 A;  1FEB A;  3SY4 A;  3T2Y A;  2VQB A;  2WPC A;  4J2W A;  3KA7 A;  4B68 A;  1NG4 A;  1RSG A;  3HYX A;  1GXF A;  3ALM A;  4YTM A;  3VR9 A;  2XLS A;  3PO7 A;  3K7Q X;  3BNM A;  3UOV A;  3ADA B;  1PBD A;  2GR0 A;  1FCD A;  3CGB A;  3EPT A;  2APG A;  3F8R A;  2BC0 A;  2V3B A;  3AXB A;  3NKS A;  4EQR A;  3KPK A;  4YTN A;  3EF6 A;  1IUX A;  1PBE A;  3Q9T A;  2YR4 A;  3QFA A;  4Z25 A;  4K5S A;  3NN6 X;  4CBQ A;  4X9M A;  4Y4N A;  1IUT A;  1EL9 A;  3AED A;  4X4J A;  2EQ8 A;  2QAE A;  2V6O A;  1OJA A;  2GEW A;  2BCP A;  3SFE A;  2ACZ A;  1F3P A;  3PS9 A;  4DSG A;  1IUS A;  1CJ4 A;  1ZX9 A;  2GR1 A;  1PJ5 A;  1CC6 A;  2X50 A;  2XYO A;  3NRN A;  4KX6 A;  3RED A;  4H4U A;  4YKG A;  1H6V A;  3NYE A;  5TR3 A;  2YLX A;  1H84 A;  4Z44 A;  4TM4 A;  4H4R A;  4BJZ A;  1PJ7 A;  1CL0 A;  3CNT A;  1MOK A;  1LJ1 A;  1L0V A;  4BK1 A;  2R9Z A;  5JCI A;  1GND A;  5JCN A;  1B8S A;  2YG4 A;  5U1O A;  5KVI A;  3R9U A;  1CC4 A;  2FJB A;  1JOA A;  2WOW A;  4Y4M A;  4ZN0 A;  2YVF A;  2C4C A;  1N4V A;  2X3N A;  3RP7 A;  2C66 A;  2YG7 A;  3LB8 A;  2XVF A;  3NGC X;  2EQ7 A;  3UKA A;  3DGZ A;  3M0O A;  1M6I A;  2R0C A;  1GOS A;  4NTE A;  2VVL G;  3HYV A;  1NEK A;  5FS7 A;  4H4V A;  3AE3 A;  2FJE A;  3BNU A;  2TPR A;  3AD9 B;  3M12 A;  3P4R A;  1VDC A;  3RHA A;  4EM4 A;  2WP5 A;  3FPZ A;  1VQW A;  1ONF A;  1XDI A;  2BRA A;  3CIR A;  2Q0K A;  4K8D A;  3SGL A;  3UOZ A;  3RNM A;  4NTC A;  1NHR A;  4Y4L A;  3UOX A;  3CND A;  2C75 A;  1S3E A;  3CPH G;  3VR8 A;  5KRQ A;  1F8S A;  1GTE A;  1D5T A;  4BK2 A;  2WDQ A;  4YSZ A;  4UDR A;  2ZBW A;  2Q0L A;  2FJD A;  4YSY A;  3DJG X;  3AD8 B;  3AEB A;  2GAG B;  4NZH A;  3VRB A;  1L9E A;  1LV0 A;  5CKU A;  4OPI A;  3KPF A;  4GR1 A;  3L1R A;  4I59 A;  4LU6 A;  4B67 A;  4XWZ A;  3GWD A;  1KFY A;  3GYI A;  4LII A;  2DKH A;  1LQT A;  2IVE A;  4JNA A;  5J60 A;  3AE4 A;  4APN A;  3CMM A;  3FG2 P;  3SQP A;  1ELI A;  1JRX A;  2GH5 A;  2FJA A;  2VRM A;  4JQ9 A;  4A79 A;  4J34 A;  1H7X A;  4Z24 A;  4YT0 A;  4UDQ A;  4EMI A;  3H8I A;  1CBO A;  1KSS A;  1IJH A;  2GR2 A;  5FMH A;  4H2P A;  1COY A;  2NVK X;  2WHD A;  3QSM A;  4Z2R A;  4N9X A;  3UP4 A;  1KSU A;  4U2T A;  3SFD A;  4YKF A;  2Y6R A;  2CFY A;  3NK0 X;  2AQJ A;  4J57 A;  4EQW A;  3L8K A;  3P4P A;  2C76 A;  3BI5 A;  5EB4 A;  1ZP0 A;  3JSK A;  5FS8 A;  1H7W A;  4U8M A;  3P4S A;  2CVJ A;  2B76 A;  4AP1 A;  2XLU A;  3IC9 A;  1L9D A;  2C67 A;  1Q9I A;  2DKI A;  5DBJ A;  1JNR A;  2AR8 A;  1FL2 A;  1E1M A;  4P9S A;  2Q7V A;  1HYU A;  3LJP A;  1GAL A;  1LVL A;  2WU2 A;  1K0J A;  1VG0 A;  1LPF A;  2JKC A;  2A89 A;  3AEC A;  3NK2 X;  1M64 A;  3GRT A;  3OZ2 A;  1BGN A;  4JY3 A;  1TDN A;  4OPL A;  4XWR A;  4FK1 A;  4MJW A;  4IVM B;  3AEG A;  4TLX A;  1GEU A;  3C4A A;  5LV9 A;  3AWI A;  2WDR A;  2QCU A;  3C96 A;  1DOD A;  2E1M A;  4O5U A;  2AAQ A;  3T2K A;  3P4Q A;  2BXR A;  1Z6L A;  2WOV A;  3CNJ A;  4AT0 A;  4EIQ A;  2C3D A;  2V3A A;  1TDK A;  1B5Q A;  3UKK A;  1K4Q A;  1GRH A;  4PAA A;  2B7R A;  4H4S A;  3GWF A;  3CGC A;  4ADW A;  1Y56 A;  1XHC A;  3NK1 X;  4EQX A;  1O5W A;  2BA9 A;  1PS9 A;  3AE6 A;  3IHM A;  3IWA A;  1NHP A;  4BK3 A;  5L46 A;  2XFN A;  2OA1 A;  2JK6 A;  1S2Q A;  5M0Z A;  1QJD A;  1E7P A;  3I6D A;  3AE9 A;  2F5Z A;  3CGE A;  3UCL A;  3VRA A;  3DH9 A;  2WPF A;  1KNR A;  2GF3 A;  3AD7 B;  4DGK A;  1NEN A;  4OPG A;  1GER A;  2BAC A;  2Y6Q A;  3DME A;  4CCQ A;  4C3X A;  4A7A A;  1CHU A;  1CJ2 A;  2B9Y A;  4UP3 A;  1PHH A;  4RG4 A;  3CPI G;  4GAV A;  2Q6U A;  4EMW A;  1GRG A;  2C65 A;  3II4 A;  1S2Y A;  4FDC B;  2BK3 A;  3B6D A;  3UKP A;  4REK A;  1V59 A;  3IHG A;  2YM1 A;  3GMB A;  2WS3 A;  4YWO A;  2W0H A;  3CTY A;  3UP5 A;  2X8C A;  3VQR A;  4B1B A;  2BS2 A;  1E39 A;  4CRT A;  2XCG A;  1LQU A;  3GSI A;  1BF3 A;  4OPC A;  2EQ6 A;  2PYX A;  4NNJ A;  4GUV A;  3O0H A;  3HZL A;  3SZC A;  3B3R A;  3T31 A;  3P1W A;  4B64 A;  4YSX A;  3UKF A;  3KKJ A;  1F8R A;  5CQF A;  1GRF A;  3FBS A;  2BK5 A;  1CJC A;  2UZZ A;  3KU9 A;  1OJ9 A;  4WX1 A;  4A6N A;  5M10 A;  1REO A;  2X99 A;  4CY6 A;  3AEE A;  1H81 A;  2R45 A;  1YKJ A;  1H83 A;  4TM0 A;  4U8K A;  3LZX A;  2ZZB A;  2BYB A;  4GCM A;  2EQ9 A;  2VOU A;  1NHS A;  3G5S A;  5HXI A;  3QVP A;  4Z2U A;  2C7G A;  3UTH A;  3DK8 A;  3GD3 A;  5U63 A;  2B9W A;  5IQ1 A;  5GRT A;  1F6M A;  1NDA A;  5ER0 A;  1PN0 A;  4ICY A;  2X8G A;  1LTX R;  1BWC A;  5EB5 A;  5EOW A;  3I3L A;  2BS3 A;  2JB2 A;  2YLS A;  4GF7 A;  4H2N A;  3BHF A;  4FX9 A;  3CN8 A;  4K7Z A;  2XVI A;  1GV4 A;  3BI4 A;  3GYX A;  4H4P A;  1NG3 A;  1CJ3 A;  3GRS A;  1TDF A;  3NG7 X;  4FK1 C;  1BGJ A;  4NWZ A;  2YQU A;  5FS9 A;  1XPQ A;  3K30 A;  4OPT A;  1Q1W A;  3ABV A;  2B9X A;  3URH A;  2YG3 A;  2YLZ A;  3S61 A;  4DNA A;  1MXT A;  2BCG G;  3QSE A;  3DJE A;  5KMR A;  1ZMC A;  4J31 A;  2YVJ A;  4JDR A;  4G6G A;  4OVI A;  3DA1 A;  2OAL A;  5JCL A;  1N1P A;  3CNP A;  5BUK A;  3C4N A;  1PXC A;  4JNQ A;  2BS4 A;  2XLT A;  2GQF A;  3DK9 A;  1ZY8 A;  1ZKQ A;  1P2E A;  2VQ7 A;  4II2 A;  1UKV G;  4H7U A;  3ISH A;  4J36 A;  4C5O A;  3ICS A;  2YG5 A;  4EM3 A;  4IV9 A;  1IUW A;  1GET A;  2E4G A;  1BZL A;  2PHH A;  4OPD A;  5KMQ A;  1YY5 A;  2JB1 A;  3CPJ G;  1D4C A;  2XLR A;  4GDE A;  3Q6J A;  4AP3 A;  1EBD A;  1YQZ A;  3NTA A;  4IVO B;  3E1T A;  1K0L A;  4A65 A;  3SZW A;  2XVJ A;  3NT6 A;  4U8P A;  5EBK A;  2XFO A;  2GMH A;  1QLB A;  4H4X A;  4HA6 A;  3NN0 X;  1D7Y A;  1DXL A;  4Z43 A;  3LAD A;  5JCM A;  4USQ A;  2BK4 A;  2C3C A;  3GD4 A;  5J7X A;  1FEC A;  2WPE A;  4H4T A;  2JB3 A;  3AE5 A;  1PXB A;  4GDP A;  1B4V A;  1E1K A;  3S5W A;  4PAB A;  1KNP A;  4U2S A;  3AYI A;  4CNJ A;  2VVL A;  2OAM A;  2WEU A;  1N4U A;  2X8H A;  3AYL A;  3SYI A;  3ATQ A;  3PVC A;  1TRB A;  4OCG A;  1H86 A;  4K2X A;  3QVR A;  2YG6 A;  3EAO A;  3SZ0 A;  4CCR A;  4M52 A;  2CUL A;  2XDO A;  3UTE A;  1SEZ A;  1RYI A;  1TYT A;  1VG9 A;  2ZZC A;  1L9C A;  4B65 A;  1IUU A;  1JNZ A;  4GRT A;  4J56 A;  3UTG A;  4DSH A;  3CGD A;  4U8O A;  3G5Q A;  3KLJ A;  1S3B A;  2R4E A;  2JAE A;  2C73 A;  1PXA A;  1KDG A;  2R0P A;  3M13 A;  2GVC A;  4USR A;  4XXG A;  2Z5Y A;  3KD9 A;  2WET A;  4IA5 A;  2GR3 A;  4A5L A;  4H4Z A;  3FMW A;  4U8L A;  5GSN A;  1F8W A;  1YQ3 A;  1GRA A;  2XLP A;  4D03 A;  1RP0 A;  5HYM A;  3T2Z A;  3BI2 A;  3AE1 A;  1BKW A;  2YAU A;  2XFQ A;  2YWL A;  3NYF A;  3BHK A;  5BUL A;  1W4X A;  3NYC A;  1GES A;  4C74 A;  2OLO A;  2RAB A;  3UKL A;  2XFU A;  1JEH A;  1ZMD A;  2JBV A;  2R46 A;  2XVH A;  2YLW A;  4YSH A;  1ZOV A;  2BXS A;  3COX A;  3D1C A;  3UOY A;  4BJY A;  1N4W A;  3AE2 A;  4H2Q A;  3DJD A;  1AOG A;  2RGJ A;  2J3N A;  4BUR A;  1O95 A;  2VZ2 A;  4U8J A;  3SX6 A;  1H82 A;  1JRY A;  3AYJ A;  4EMJ A;  2C64 A;  4II3 A;  5KMP A;  2XVE A;  3NHO X;  4A99 A;  1NAA A;  3T14 A;  1KF6 A;  4NTD A;  1Q1R A;  1NHQ A;  1D4E A;  4CY8 A;  4B66 A;  3HYW A;  2GMJ A;  3DJJ A;  3LZW A;  1XAN A;  2QA2 A;  3GMC A;  4BV6 A;  4IA6 A;  2BC1 A;  4UDP A;  2R0G A;  1GPE A;  4NEV A;  3QJ4 A;  2C72 A;  5BRT A;  2GV8 A;  4AT2 A;  3ATR A;  5KWF A;  1EL8 A;  3IF9 A;  1DJQ A;  3GDN A;  1GT8 A;  2V60 A;  3ITJ A;  1TDE A;  3D8X A;  1PBF A;  4ZCC A;  5KVH A;  4ZCD A;  3ZDN A;  2GB0 A;  4H50 A;  4D04 A;  2Z5X A;  1B37 A;  3LOV A;  1NPX A;  2GAH B;  2GQW A;  4WCT A;  3WE0 A;  3AEA A;  2BAB A;  3NIX A;  2WDV A;  2V61 A;  2IVD A;  4OPU A;  4K5R A;  2RGO A;  2GRT A;  1OJC A;  4ECH A;  2YLR A;  4HB9 A;  4H4W A;  2WU5 A;  2R4J A;  5IQ4 A;  2OLN A;  2YM2 A;  3NH3 X;  3VRD B;  2RGH A;  1GRT A;  1D4D A;  4EQS A;  4Z26 A;  1GSN A;  3K7M X;  3T37 A;  1DOE A;  3UKQ A;  3SM8 A;  2V5Z A;  2O9Z A;  5KOW A;  1PJ6 A;  1DNC A;  1PDH A;  2VVM A;  1O94 A;  2A8X A;  1DOB A;  2WQY A;  3ALL A;  3NTD A;  1X31 B;  3K7T A;  3GYJ A;  4B63 A;  1E1L A;  5KOX A;  3FIM B;  2XFP A;  3GDP A;  5BVA A;  4B69 A;  1JRZ A;  3H8L A;  2ARD A;  2WP9 A;  3NNE A;  5HHF A;  1IUV A;  4JN9 A;  3P9U A;  3V3O A;  3ALJ A;  1ZK7 A;  2YR6 A;  3ICT A;  4U8N A;  1MO9 A;  1JU2 A;  1ZDL A;  3ICR A;  4Z2T A;  4KPR A;  4X9N A;  2WBA A;  5C3J A;  4G6H A;  4O5Q A;  4RG3 A;  1VRQ B;  2E5V A;  2A87 A;  3G5R A;  2FBW A;  2HQM A;  3QSS A;  1ZOY A;  1Y56 B;  2WOI A;  4H2R A;  3UKH A;  2BRY A;  1K0I A;  2QA1 A;  4H4Q A;  5HY5 A;  2B7S A;  1CC2 A;  1GTH A;  4U8I A;  4JY2 A;  3T0K A;  3ZYX A;  1TDO A;  1PBC A;  3AEF A;  1GRE A;  1PBB A;  3LXD A;  3SZF A;  3DGH A;  1E1N A;  2CDU A;  4LA1 A;  4G9K A;  4RSL A;  4K22 A;  1EL7 A;  3CNS A;  4EIP A;  5KNL A;  4J33 A;  3RP6 A;  2H89 A;  4U2L A;  1EL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...