3K7TA

Crystal structure of apo-form 6-hydroxy-l-nicotine oxidase, crystal form p3121
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 117
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7tA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7tA02
1B37A 4B69A 4UDRA 1NG3A 5KOWA 1XDIA 1FECA 1OJDA 3ADAB 2ZZCA 3COXA 4IA5A 5KXJA 4CY6A 1ZDLA 4C3YA 1LVLA 4U8MA 1JEHA 3ALLA 1N4WA 2WQYA 1O5WA 1W4XA 3DA1A 1MO9A 2XVIA 2WHDA 4E0VA 3K7TA 4KX6A 5EB5A 2YM1A 4UDQA 3ITJA 5FS7A 1COYA 1LJ1A 1H81A 5BUKA 2FJBA 4XXGA 2JBVA 5J60A 1IUWA 3AE2A 3RNMA 1NHSA 2W0HA 1NPXA 3BI2A 4IV9A 3VRBA 1PDHA 3GWDA 1JRYA 3Q6JA 4J33A 3D1CA 3RHAA 3AEEA 1NG4A 2YG4A 4J56A 2R45A 4OPTA 1GETA 1EBDA 3V3NA 1H84A 4Z24A 1QLBA 4B63A 1KNPA 2C76A 1F8WA 4EQXA 2VVLA 2GV8A 4Y4LA 3P9UA 1PBBA 2BK3A 3F8RA 5U1OA 3G5SA 3IHGA 3CNSA 1H6VA 2I0ZA 2BS3A 1PBDA 3NYFA 2XDOA 5KVIA 1L9EA 3P1WA 4B65A 1D4EA 1TRBA 4CCQA 4CNJA 4BK2A 4H4RA 3P4RA 2IVDA 1TDFA 4YSYA 3CPIG 1NHPA 4U2LA 1ZY8A 5JCLA 2RABA 2X99A 4BURA 3GD3A 2E1MA 1IUSA 5J7XA 1GOSA 2C73A 4OPLA 1VQWA 2YLSA 4JDRA 4LU6A 2WPCA 3AYJA 4H4WA 1DOBA 2PYXA 4DGKA 3H8LA 4HA6A 2V3BA 1CJ3A 4GR1A 1LQUA 3ATQA 4X4JA 1EL8A 2C66A 4X9NA 1ONFA 3UKQA 3GRSA 4I58A 2B9WA 2OLOA 2YG6A 3UP4A 3QVRA 3KD9A 3NKSA 1PXBA 3UTHA 2HQMA 3CTYA 2ZBWA 2AQJA 3VRAA 1K0JA 2JB2A 4RSLA 3CPJG 2R4EA 4J2WA 3S61A 1EL9A 1JRZA 1FOHA 5CQFA 1S3EA 3NYCA 3Q9TA 1Q1RA 1F3PA 2VZ2A 4Z44A 1GALA 2ZZ0A 2V60A 3F8PA 2C3DA 4H4YA 3QFAA 2Z5XA 3AE7A 3C4AA 3UOZA 1NENA 1YQ4A 1GSNA 1IUVA 2R0GA 3HZLA 2VRMA 2AR8A 3FPZA 1LQTA 4JNQA 2BK4A 3LZXA 3UKHA 1LV0A 2BS4A 2OAMA 1TDEA 2JB3A 3KVEA 4KPRA 1PBCA 2Q0LA 4GF7A 4MJWA 5C2TA 2GRTA 2FBWA 4UP3A 3V76A 2VVLG 2WU2A 3EANA 1FEBA 5EB4A 4H2NA 4A9WA 1M64A 3AE9A 3LZWA 3RP8A 4Z26A 1O94A 5HY5A 4H4PA 1NHRA 2VQBA 3QJ4A 4D03A 3AD8B 2E5VA 1NDAA 1NHQA 3G5QA 3AD7B 1L0VA 3K30A 3QSSA 3PO7A 2BACA 1IUXA 1CF3A 3REDA 1IJHA 5M10A 1F6MA 4ICYA 1MOKA 1Z6LA 1E1KA 1OJAA 2WETA 3ALMA 4GUVA 4B66A 2EQ9A 1KF6A 2FJAA 2OALA 1E7PA 2BCGG 3AD9B 1FCDA 3AE4A 1GRFA 4JY3A 1DJNA 2BC0A 2GR0A 1E1MA 4CBQA 1S2QA 3KLJA 2OLNA 2PHHA 2GF3A 2RGJA 3CGCA 3B3RA 3ICTA 3JSKA 4REKA 3F8DA 2GQWA 3CIRA 4U8OA 2XFNA 1TDKA 1OJ9A 3GYJA 4NZHA 1F8SA 3DK8A 1ZP0A 3NG7X 4K22A 4N9XA 2BYBA 3P4SA 4JQ9A 4RG4A 1BZLA 4K5RA 4DSHA 4ZN0A 4H4QA 3BHKA 3AEFA 2WP6A 5U25A 5BVAA 1GERA 3O0HA 1E1LA 1RYIA 4PABA 2O9ZA 4OVIA 4D04A 2X8HA 3NH3X 4JNAA 3UTGA 2C75A 2X8CA 4EQRA 2BC1A 3ICSA 4U8NA 5JCMA 3BI5A 3AECA 4Y4MA 4OCGA 4OPCA 2GH5A 3EAOA 5HYMA 5IPYA 3AXBA 4AOSA 1E1NA 5BULA 4AT0A 2WDVA 3LJPA 5FS9A 2YLXA 4NEVA 4DNAA 3GYIA 1GRTA 3NN6X 4YWOA 1PXAA 3I3LA 1DXLA 2JKCA 1QO8A 3CGEA 2GQFA 3IHMA 1D5TA 4U2SA 3EF6A 3BHFA 1LPFA 2YLWA 1K0IA 1SEZA 3S5WA 4FDCB 3FBSA 1FL2A 3NGCX 3CGBA 2BS2A 2YR6A 5GRTA 4C74A 3BI4A 1ZOYA 2GR2A 3SQPA 1GRBA 3EPTA 4K8DA 4UDPA 5EBKA 4DSGA 3AEBA 5C3JA 4X9MA 3QSEA 4CRTA 2WS3A 3K7QX 4K2XA 1CC4A 1EL5A 4CY8A 2H89A 2XLSA 3RP7A 1CJCA 2WPFA 3NK0X 2WESA 4M52A 3SFEA 4TM1A 1YQ3A 2UZZA 4Z2UA 2XLUA 3AB1A 3DJDA 5HHFA 3UOVA 4CNKA 3NIXA 3CGDA 1PN0A 3AE5A 1CC2A 1TYPA 4C77A 5FMHA 3NTDA 3NK2X 1ZX9A 3BNMA 3B6DA 1DODA 3II4A 5LV9A 2QA2A 3NRNA 4WX1A 3ALJA 3SFDA 2C67A 4Z2TA 2YM2A 4U2TA 1CHUA 3ISHA 3UKKA 3OZ2A 1GTEA 4ADWA 2XFQA 1PXCA 1B4VA 4I59A 4O5UA 1PHHA 2YWLA 1K0LA 1S2YA 1GT8A 2QCUA 2WP5A 2WDRA 3IF9A 1KFYA 2VRLA 2XLTA 2WP9A 4EQWA 1IUUA 2XFPA 4OPGA 4BK3A 4TM4A 2R0PA 1OJTA 1PS9A 3GSIA 4EM3A 1JNRA 3GD4A 1N1PA 1GV4A 4RG3A 4Z43A 2XLPA 2Y6QA 2WPEA 3DGZA 1N4UA 2R4JA 1GPEA 2FJDA 1B8SA 1DOEA 5DBJA 1YY5A 1X31B 4EM4A 3DJJA 2RGHA 1E39A 2DKHA 1F8RA 2XLRA 3UOYA 2YG7A 4YSZA 4AP3A 4PAAA 1GNDA 1ZOVA 4APNA 1UKVG 2GMHA 2WEUA 2JAEA 1DJQA 3UP5A 1O95A 2APGA 1DNCA 2NPXA 1QJDA 3M0OA 2V6OA 3R9UA 2EQ8A 1BF3A 4WCTA 3UTFA 3V3OA 2XFOA 1JNZA 4LIIA 4AP1A 1PBEA 4EMJA 5CKUA 2YVFA 3VRDB 2XFUA 1RSGA 2GVCA 4B68A 1CC6A 1D4DA 2Y6RA 3AE8A 4NEWA 5U63A 4O5QA 5JCIA 1XHCA 3AEDA 4C5OA 1GEUA 5TR3A 1D7YA 3ZDNA 4B67A 4YTPA 1ZK7A 4BV6A 4U8IA 1ZMCA 1VDCA 3C4NA 3CNPA 1E6EA 1GRGA 2WOIA 3GMBA 3KU9A 2CFYA 4H4SA 4TM3A 4JY2A 4USQA 3OC4A 1S3BA 3FG2P 1BGNA 4OPDA 1JU2A 1KSUA 2A8XA 2C7GA 2DKIA 2V3AA 2JB1A 3I6DA 3QFBA 5GSNA 1H7XA 1L9CA 4B64A 3NT6A 4YSHA 3DJEA 1PBFA 3M12A 1CL0A 1CJ4A 3H4KA 3H8IA 2WBAA 2B7SA 4FK1A 3CPHG 2VQ7A 1IUTA 3SGLA 4EMWA 2Q6UA 5FS8A 4ZCDA 1PJ7A 2C70A 3AEAA 1OJCA 3GDPA 5M0ZA 3C96A 2CULA 4TM0A 2YLTA 2YVGA 3DH9A 2WU5A 4CCRA 1VRQB 4H2QA 3URHA 5FS6A 5KWFA 1MXTA 4EMIA 1Y0PA 2CDUA 2NVKX 3ZYXA 2ACZA 1H83A 4AOXA 3CN8A 3NLCA 1N4VA 1REOA 2GR3A 4J36A 4TLZA 4USRA 1BWCA 3GMCA 1L9DA 3PVCA 4LA1A 4BK1A 2B9XA 2IVEA 1CBOA 3UKFA 2GB0A 4H2PA 3KA7A 4GCMA 4HB9A 4K7ZA 5JCNA 2XCGA 2YVJA 3LADA 1P2HA 3UCLA 3VR9A 3L1RA 4GDPA 1KDGA 5IQ4A 1YKJA 2X50A 1ZMDA 2Q0KA 1P2EA 2V5ZA 1NEKA 2FJEA 1D4CA 2C64A 2YLRA 2YQUA 3NHOX 2GAHB 1BKWA 5L46A 4U8PA 3UTEA 1GESA 5EOWA 4Y4NA 4NTDA 3M13A 4U8KA 4A6NB 2ZZBA 3DK9A 1KSSA 3DMEA 5KVHA 3UKPA 2VVMA 5HXIA 2BK5A 3DJGX 2C72A 2X8GA 3GRTA 3LXDA 1RP0A 3NYEA 2BXRA 2QAEA 3CNDA 3PS9A 4YTMA 1LTXR 4A7AA 4YXDA 2C65A 2E4GA 4OPIA 1M6IA 3NNEA 2CVJA 2VOUA 3D8XA 2GMJA 4K5SA 1ELIA 1H86A 4FX9A 3AYLA 3WE0A 2Z5YA 4YKGA 2GAGB 1ZKQA 1DOCA 4IA6A 3ABVA 3NTAA 1TDOA 4IVMB 2XVJA 2IIDA 4EQSA 1PJ6A 2A87A 3AE3A 1Q9IA 2F5ZA 3LB8A 2EQ7A 2Q7VA 2WDQA 5ER0A 2WOVA 1YQZA 2B7RA 3DK4A 3KPFA 4YTNA 3VR8A 3SM8A 3G5RA 1FEAA 4ECHA 1H82A 2BABA 3AE1A 2ARDA 4H2RA 4YKFA 3AYIA 2BXSA 2J3NA 3FIMB 1BGJA 5KRQA 3DGHA 3VQRA 2B76A 2WOWA 4GDEA 3KKJA 2GR1A 2TPRA 1EL7A 3ATRA 4H4TA 4J34A 2OA1A 2R46A 4H4UA 2XVHA 4NTEA 1Y56A 2V61A 3P4QA 2YR4A 3CNTA 4AT2A 1GRAA 3AWIA 2TMDA 3IWAA 4JN9A 4BJZA 1GXFA 1TDNA 2XYOA 3RP6A 4A65A 3GDNA 4EIQA 4A99A 1VG0A 4ZCCA 3T37A 4GRTA 3IC9A 1HYUA 2H88A 3L8KA 4C3XA 2QA1A 1D7LA 1JOAA 1GRHA 3LOVA 3P4PA 2R9ZA 4YSXA 2YG3A 4Z2RA 4IVOB 3GWFA 3UKAA 3UOXA 4EIPA 3E1TA 2XVFA 4H4VA 2RGOA 3UKLA 4OPUA 3BNUA 3ICRA 3QVPA 2AAQA 5BRTA 2YAUA 3NN0X 4NTCA 4J31A 1GTHA 1TYTA 3CNJA 4H4XA 4B1BA 1H7WA 1KNRA 4U8LA 5JCKA 2GEWA 3NK1X 1GREA 1V59A 4YT0A 1VG9A 2YR5A 2YLZA 4A5LA 3QSMA 1AOGA 4XWZA 3FMWA 1CJ2A 2A89A 5KOXA 4P9SA 1JRXA 4H50A 4J57A 4H4ZA 2JK6A 4A6NA 2C3CA 3AE6A 2BA9A 4H7UA 2B9YA 1XPQA 4U8JA 2XVEA 1B5QA 2R0CA 2YG5A 1Y56B 5IQ1A 4BJYA 1XANA 1Q1WA 3K7MX 4A79A 2BCPA 1PJ5A 4XWRA 4Z25A 2EQ6A 1NAAA 4FK1C 3AEGA 1K4QA 4TLXA 2X3NA
chains in the Genus database with same CATH superfamily
1B37A 4B69A 4UDRA 1NG3A 5KOWA 1XDIA 1FECA 1OJDA 3ADAB 2ZZCA 3COXA 4IA5A 5KXJA 4CY6A 1ZDLA 4C3YA 1LVLA 4U8MA 1JEHA 3ALLA 1N4WA 2WQYA 1O5WA 4GAPA 3T0KA 1W4XA 3DA1A 1MO9A 3SXIA 2XVIA 2WHDA 4E0VA 3K7TA 4KX6A 5EB5A 2YM1A 4UDQA 3ITJA 5FS7A 1COYA 1LJ1A 1H81A 5BUKA 2FJBA 4XXGA 2JBVA 5J60A 1IUWA 3AE2A 3RNMA 1NHSA 2W0HA 1NPXA 3BI2A 4IV9A 3VRBA 1PDHA 3GWDA 1JRYA 3Q6JA 4J33A 3D1CA 3RHAA 3AEEA 1NG4A 2YG4A 4J56A 2R45A 4OPTA 1GETA 1EBDA 3V3NA 1H84A 4Z24A 1QLBA 4B63A 1KNPA 2C76A 1F8WA 4EQXA 2VVLA 2GV8A 4Y4LA 3P9UA 1PBBA 2BK3A 3F8RA 5U1OA 3G5SA 3IHGA 3CNSA 1H6VA 2I0ZA 2BS3A 1PBDA 3NYFA 2XDOA 5KVIA 1L9EA 3KPKA 3P1WA 4B65A 1D4EA 1TRBA 4CCQA 4CNJA 4BK2A 4H4RA 3T2YA 3P4RA 2IVDA 1TDFA 4YSYA 3CPIG 1NHPA 4U2LA 1ZY8A 5JCLA 2RABA 2X99A 4BURA 3GD3A 2E1MA 1IUSA 5J7XA 1GOSA 2C73A 4OPLA 1VQWA 2YLSA 4NNJA 4JDRA 4LU6A 2WPCA 3AYJA 4II3A 4H4WA 1DOBA 2PYXA 3T14A 4DGKA 3H8LA 4HA6A 2V3BA 1CJ3A 4GR1A 1LQUA 3ATQA 4X4JA 1EL8A 2C66A 4X9NA 1ONFA 3UKQA 3GRSA 3SZ0A 4I58A 2B9WA 2OLOA 2YG6A 3UP4A 3QVRA 3KD9A 3NKSA 1PXBA 3UTHA 2HQMA 3CTYA 2ZBWA 2AQJA 3VRAA 1K0JA 2JB2A 2C4CA 3CPJG 2R4EA 4RSLA 4J2WA 3S61A 1EL9A 1JRZA 1FOHA 5CQFA 1S3EA 3NYCA 3Q9TA 1Q1RA 1F3PA 2VZ2A 4Z44A 1GALA 2ZZ0A 4G6HA 2V60A 3F8PA 2C3DA 4H4YA 3QFAA 2Z5XA 3AE7A 3C4AA 3UOZA 1NENA 1YQ4A 1GSNA 1IUVA 2R0GA 3HZLA 2VRMA 2AR8A 3FPZA 1LQTA 4JNQA 2BK4A 3LZXA 3UKHA 1LV0A 2BS4A 2OAMA 1TDEA 2JB3A 3KVEA 4KPRA 1PBCA 2Q0LA 4GF7A 4MJWA 5C2TA 2GRTA 2FBWA 4UP3A 3V76A 2VVLG 2WU2A 3EANA 3T2ZA 1FEBA 5EB4A 4H2NA 4A9WA 1M64A 3AE9A 3LZWA 3RP8A 4Z26A 1O94A 5HY5A 4H4PA 1NHRA 2VQBA 3QJ4A 4D03A 3AD8B 2E5VA 1NDAA 1NHQA 3G5QA 3AD7B 1L0VA 3K30A 3QSSA 3PO7A 2BACA 1IUXA 1CF3A 3REDA 1IJHA 3CMMA 5M10A 1F6MA 4ICYA 1MOKA 1Z6LA 1E1KA 1OJAA 2WETA 3ALMA 4GUVA 4B66A 2EQ9A 1KF6A 2FJAA 2OALA 1E7PA 2BCGG 3AD9B 1FCDA 3AE4A 1GRFA 4JY3A 1DJNA 2BC0A 2GR0A 1E1MA 4CBQA 1S2QA 3KLJA 2OLNA 2PHHA 2GF3A 2RGJA 3CGCA 3B3RA 3ICTA 3JSKA 4REKA 3F8DA 2GQWA 3CIRA 4U8OA 2XFNA 1TDKA 1OJ9A 3GYJA 4NZHA 1F8SA 3DK8A 1ZP0A 3NG7X 4K22A 4N9XA 2BYBA 3P4SA 4JQ9A 4RG4A 1BZLA 4K5RA 4DSHA 4ZN0A 4H4QA 3BHKA 3AEFA 2WP6A 5U25A 4G73A 5BVAA 1GERA 3O0HA 1E1LA 1RYIA 4GAVA 2O9ZA 4OVIA 4PABA 4D04A 2X8HA 3NH3X 4JNAA 5KMQA 3UTGA 2C75A 2X8CA 4EQRA 2BC1A 3ICSA 4U8NA 5JCMA 3BI5A 3AECA 4Y4MA 4OCGA 4OPCA 2GH5A 3EAOA 5HYMA 5IPYA 3AXBA 4AOSA 1E1NA 5BULA 4AT0A 2WDVA 3LJPA 5FS9A 2YLXA 4NEVA 4DNAA 3GYIA 1GRTA 3NN6X 4YWOA 1PXAA 3I3LA 1DXLA 2JKCA 1QO8A 3CGEA 3HYVA 2GQFA 3IHMA 1D5TA 4U2SA 3EF6A 3BHFA 1LPFA 2YLWA 1K0IA 1SEZA 3S5WA 4FDCB 3FBSA 1FL2A 3NGCX 3CGBA 2BS2A 2YR6A 5GRTA 4C74A 3BI4A 1ZOYA 3SX6A 2GR2A 3SZFA 3SQPA 1GRBA 3EPTA 4K8DA 4UDPA 5EBKA 4DSGA 3AEBA 5C3JA 4X9MA 3QSEA 4CRTA 2WS3A 3K7QX 4K2XA 1CC4A 1EL5A 4CY8A 2H89A 2XLSA 2BRYA 3RP7A 1CJCA 2WPFA 3NK0X 2WESA 4M52A 3SFEA 4TM1A 1YQ3A 2UZZA 4Z2UA 2XLUA 3AB1A 3DJDA 5HHFA 3UOVA 4G74A 4CNKA 3NIXA 3CGDA 1PN0A 3AE5A 1CC2A 1TYPA 4C77A 5FMHA 3NTDA 3NK2X 1ZX9A 3BNMA 3B6DA 1DODA 3II4A 5LV9A 2QA2A 3NRNA 4WX1A 3ALJA 3SFDA 2C67A 4Z2TA 2YM2A 4U2TA 1CHUA 3ISHA 5KMPA 3UKKA 3OZ2A 1GTEA 4ADWA 2BRAA 2XFQA 1PXCA 1B4VA 4I59A 4O5UA 1PHHA 2YWLA 1K0LA 1S2YA 1GT8A 2QCUA 2WP5A 2WDRA 3IF9A 1KFYA 2VRLA 2XLTA 2WP9A 4EQWA 1IUUA 2XFPA 4OPGA 4BK3A 4TM4A 2R0PA 4II2A 1OJTA 1PS9A 3GSIA 4EM3A 1JNRA 3GD4A 1N1PA 1GV4A 4RG3A 4Z43A 2XLPA 2Y6QA 2WPEA 3DGZA 1N4UA 2R4JA 1GPEA 2FJDA 1B8SA 1DOEA 5DBJA 1YY5A 1X31B 4EM4A 3DJJA 2RGHA 1E39A 2DKHA 1F8RA 2XLRA 3UOYA 2YG7A 4YSZA 4AP3A 4PAAA 1GNDA 1ZOVA 4APNA 1UKVG 2GMHA 2WEUA 2JAEA 1DJQA 3UP5A 1O95A 2APGA 1DNCA 2NPXA 1QJDA 3M0OA 2V6OA 3R9UA 2EQ8A 1BF3A 3T31A 4WCTA 3UTFA 3V3OA 2XFOA 1JNZA 4LIIA 4AP1A 1PBEA 4EMJA 5CKUA 2YVFA 3VRDB 2XFUA 1RSGA 2GVCA 4B68A 1CC6A 1D4DA 2Y6RA 3AE8A 4NEWA 5U63A 4O5QA 5JCIA 1XHCA 3AEDA 4C5OA 1GEUA 5TR3A 1D7YA 3ZDNA 4B67A 4YTPA 5KMSA 1ZK7A 4BV6A 4U8IA 1ZMCA 1VDCA 3C4NA 3CNPA 1E6EA 1GRGA 2WOIA 3GMBA 3KU9A 2CFYA 4H4SA 4TM3A 4JY2A 4USQA 3OC4A 1S3BA 3FG2P 1BGNA 3GYXA 4OPDA 1JU2A 1KSUA 2A8XA 2C7GA 2DKIA 2V3AA 2JB1A 3I6DA 3QFBA 5GSNA 1H7XA 1L9CA 4B64A 3NT6A 4YSHA 3DJEA 1PBFA 3M12A 1CL0A 1CJ4A 3H4KA 3H8IA 2WBAA 2B7SA 4G9KA 4FK1A 3CPHG 2VQ7A 1IUTA 3SGLA 4EMWA 2Q6UA 5FS8A 4ZCDA 1PJ7A 2C70A 5KNLA 3AEAA 1OJCA 3GDPA 5M0ZA 3C96A 2CULA 4TM0A 2YLTA 2YVGA 3DH9A 2WU5A 4CCRA 1VRQB 4H2QA 3URHA 5FS6A 5KWFA 1MXTA 3HYXA 1Y0PA 2CDUA 2NVKX 3ZYXA 2ACZA 4EMIA 1H83A 4AOXA 3CN8A 3NLCA 1N4VA 1REOA 2GR3A 4J36A 4TLZA 4USRA 1BWCA 3GMCA 1L9DA 3PVCA 4LA1A 4BK1A 2B9XA 4NWZA 2IVEA 1CBOA 3UKFA 2GB0A 4H2PA 3KA7A 4GCMA 3SYIA 4HB9A 4K7ZA 5JCNA 2XCGA 2YVJA 3LADA 1P2HA 3UCLA 3VR9A 3L1RA 4GDPA 1KDGA 5IQ4A 1YKJA 2X50A 1ZMDA 2Q0KA 1P2EA 2V5ZA 1NEKA 2FJEA 1D4CA 2C64A 2YLRA 2YQUA 3NHOX 2GAHB 1BKWA 5L46A 4U8PA 3UTEA 1GESA 5EOWA 4Y4NA 4NTDA 3M13A 4U8KA 4A6NB 2ZZBA 3DK9A 1KSSA 3DMEA 5KVHA 3UKPA 2VVMA 5HXIA 2BK5A 3SY4A 3DJGX 2C72A 2X8GA 3GRTA 3LXDA 1RP0A 3NYEA 2BXRA 2QAEA 3CNDA 3PS9A 4YTMA 1LTXR 4A7AA 4YXDA 2C65A 2E4GA 4OPIA 1M6IA 3NNEA 2CVJA 2VOUA 3D8XA 2GMJA 4K5SA 1ELIA 1H86A 4FX9A 3AYLA 3WE0A 2Z5YA 4YKGA 2GAGB 1ZKQA 1DOCA 4IA6A 3ABVA 3NTAA 1TDOA 4IVMB 2XVJA 2IIDA 4EQSA 1PJ6A 2A87A 3AE3A 1Q9IA 2F5ZA 3LB8A 2EQ7A 2Q7VA 2WDQA 5ER0A 2WOVA 1YQZA 2B7RA 3DK4A 3KPFA 4YTNA 3VR8A 3SM8A 3G5RA 1FEAA 4ECHA 1H82A 2BABA 3AE1A 2ARDA 4H2RA 4YKFA 3AYIA 2BXSA 2J3NA 3FIMB 1BGJA 4G6GA 5KRQA 3DGHA 3VQRA 2B76A 2WOWA 4GDEA 3KKJA 2GR1A 2TPRA 1EL7A 3ATRA 4H4TA 4J34A 2OA1A 2R46A 4H4UA 2XVHA 4NTEA 1Y56A 2V61A 3P4QA 2YR4A 3CNTA 4AT2A 1GRAA 3AWIA 2TMDA 3IWAA 4JN9A 4BJZA 1GXFA 1TDNA 2XYOA 3RP6A 4A65A 3GDNA 4EIQA 4A99A 1VG0A 4ZCCA 3T37A 4GRTA 3IC9A 1HYUA 2H88A 3L8KA 4C3XA 2QA1A 1D7LA 1JOAA 1GRHA 3LOVA 3P4PA 2R9ZA 4YSXA 2YG3A 4Z2RA 4IVOB 3GWFA 3UKAA 3UOXA 4EIPA 3T2KA 3E1TA 2XVFA 4H4VA 2RGOA 3UKLA 4OPUA 3BNUA 3ICRA 3QVPA 2AAQA 5BRTA 2YAUA 3NN0X 4NTCA 4J31A 1GTHA 1TYTA 3CNJA 4H4XA 4B1BA 1H7WA 1KNRA 4U8LA 5JCKA 5KMRA 2GEWA 3NK1X 1GREA 1V59A 4YT0A 1VG9A 2YR5A 2YLZA 4A5LA 3QSMA 1AOGA 4XWZA 3FMWA 1CJ2A 2A89A 5KOXA 3SZWA 4P9SA 1JRXA 4H50A 4J57A 4H4ZA 2JK6A 4A6NA 2C3CA 3AE6A 2BA9A 4H7UA 2B9YA 1XPQA 4U8JA 3HYWA 2XVEA 1B5QA 2R0CA 2YG5A 1Y56B 5IQ1A 4BJYA 1XANA 1Q1WA 3K7MX 4A79A 2BCPA 3SZCA 1PJ5A 4XWRA 4Z25A 2EQ6A 1NAAA 4FK1C 3AEGA 1K4QA 4TLXA 2X3NA
chains in the Genus database with same CATH topology
1B37A 4B69A 4UDRA 1NG3A 5KOWA 1XDIA 1FECA 1OJDA 3ADAB 2ZZCA 3COXA 4IA5A 5KXJA 4CY6A 1ZDLA 4C3YA 1LVLA 4U8MA 1JEHA 3ALLA 1N4WA 2WQYA 1O5WA 4GAPA 3T0KA 1W4XA 3DA1A 1MO9A 3SXIA 2XVIA 2WHDA 4E0VA 3K7TA 4KX6A 5EB5A 2YM1A 4UDQA 3ITJA 5FS7A 1COYA 1LJ1A 1H81A 5BUKA 2FJBA 4XXGA 2JBVA 5J60A 1IUWA 3AE2A 3RNMA 1NHSA 2W0HA 1NPXA 3BI2A 4IV9A 3VRBA 1PDHA 3GWDA 1JRYA 3Q6JA 4J33A 3D1CA 3RHAA 3AEEA 1NG4A 2YG4A 4J56A 2R45A 4OPTA 1GETA 1EBDA 3V3NA 1H84A 4Z24A 1QLBA 4B63A 1KNPA 2C76A 1F8WA 4EQXA 2VVLA 2GV8A 4Y4LA 3P9UA 1PBBA 2BK3A 3F8RA 5U1OA 3G5SA 3IHGA 3CNSA 1H6VA 2I0ZA 2BS3A 1PBDA 3NYFA 2XDOA 5KVIA 1L9EA 3KPKA 3P1WA 4B65A 1D4EA 1TRBA 4CCQA 4CNJA 4BK2A 4H4RA 3T2YA 3P4RA 2IVDA 1TDFA 4YSYA 3CPIG 1NHPA 4U2LA 1ZY8A 5JCLA 2RABA 2X99A 4BURA 3GD3A 2E1MA 1IUSA 5J7XA 1GOSA 2C73A 4OPLA 1VQWA 2YLSA 4NNJA 4JDRA 4LU6A 2WPCA 3AYJA 4II3A 4H4WA 1DOBA 2PYXA 3T14A 4DGKA 3H8LA 4HA6A 2V3BA 1CJ3A 4GR1A 1LQUA 3ATQA 4X4JA 1EL8A 2C66A 4X9NA 1ONFA 3UKQA 3GRSA 3SZ0A 4I58A 2B9WA 2OLOA 2YG6A 3UP4A 3QVRA 3KD9A 3NKSA 1PXBA 3UTHA 2HQMA 3CTYA 2ZBWA 2AQJA 3VRAA 1K0JA 2JB2A 2C4CA 3CPJG 2R4EA 4RSLA 4J2WA 3S61A 1EL9A 1JRZA 1FOHA 5CQFA 1S3EA 3NYCA 3Q9TA 1Q1RA 1F3PA 2VZ2A 4Z44A 1GALA 2ZZ0A 4G6HA 2V60A 3F8PA 2C3DA 4H4YA 3QFAA 2Z5XA 3AE7A 3C4AA 3UOZA 1NENA 1YQ4A 1GSNA 1IUVA 2R0GA 3HZLA 2VRMA 2AR8A 3FPZA 1LQTA 4JNQA 2BK4A 3LZXA 3UKHA 1LV0A 2BS4A 2OAMA 1TDEA 2JB3A 3KVEA 4KPRA 1PBCA 2Q0LA 4GF7A 4MJWA 5C2TA 2GRTA 2FBWA 4UP3A 3V76A 2VVLG 2WU2A 3EANA 3T2ZA 1FEBA 5EB4A 4H2NA 4A9WA 1M64A 3AE9A 3LZWA 3RP8A 4Z26A 1O94A 5HY5A 4H4PA 1NHRA 2VQBA 3QJ4A 4D03A 3AD8B 2E5VA 1NDAA 1NHQA 3G5QA 3AD7B 1L0VA 3K30A 3QSSA 3PO7A 2BACA 1IUXA 1CF3A 3REDA 1IJHA 3CMMA 5M10A 1F6MA 4ICYA 1MOKA 1Z6LA 1E1KA 1OJAA 2WETA 3ALMA 4GUVA 4B66A 2EQ9A 1KF6A 2FJAA 2OALA 1E7PA 2BCGG 3AD9B 1FCDA 3AE4A 1GRFA 4JY3A 1DJNA 2BC0A 2GR0A 1E1MA 4CBQA 1S2QA 3KLJA 2OLNA 2PHHA 2GF3A 2RGJA 3CGCA 3B3RA 3ICTA 3JSKA 4REKA 3F8DA 2GQWA 3CIRA 4U8OA 2XFNA 1TDKA 1OJ9A 3GYJA 4NZHA 1F8SA 3DK8A 1ZP0A 3NG7X 4K22A 4N9XA 2BYBA 3P4SA 4JQ9A 4RG4A 1BZLA 4K5RA 4DSHA 4ZN0A 4H4QA 3BHKA 3AEFA 2WP6A 5U25A 4G73A 5BVAA 1GERA 3O0HA 1E1LA 1RYIA 4GAVA 2O9ZA 4OVIA 4PABA 4D04A 2X8HA 3NH3X 4JNAA 5KMQA 3UTGA 2C75A 2X8CA 4EQRA 2BC1A 3ICSA 4U8NA 5JCMA 3BI5A 3AECA 4Y4MA 4OCGA 4OPCA 2GH5A 3EAOA 5HYMA 5IPYA 3AXBA 4AOSA 1E1NA 5BULA 4AT0A 2WDVA 3LJPA 5FS9A 2YLXA 4NEVA 4DNAA 3GYIA 1GRTA 3NN6X 4YWOA 1PXAA 3I3LA 1DXLA 2JKCA 1QO8A 3CGEA 3HYVA 2GQFA 3IHMA 1D5TA 4U2SA 3EF6A 3BHFA 1LPFA 2YLWA 1K0IA 1SEZA 3S5WA 4FDCB 3FBSA 1FL2A 3NGCX 3CGBA 2BS2A 2YR6A 5GRTA 4C74A 3BI4A 1ZOYA 3SX6A 2GR2A 3SZFA 3SQPA 1GRBA 3EPTA 4K8DA 4UDPA 5EBKA 4DSGA 3AEBA 5C3JA 4X9MA 3QSEA 4CRTA 2WS3A 3K7QX 4K2XA 1CC4A 1EL5A 4CY8A 2H89A 2XLSA 2BRYA 3RP7A 1CJCA 2WPFA 3NK0X 2WESA 4M52A 3SFEA 4TM1A 1YQ3A 2UZZA 4Z2UA 2XLUA 3AB1A 3DJDA 5HHFA 3UOVA 4G74A 4CNKA 3NIXA 3CGDA 1PN0A 3AE5A 1CC2A 1TYPA 4C77A 5FMHA 3NTDA 3NK2X 1ZX9A 3BNMA 3B6DA 1DODA 3II4A 5LV9A 2QA2A 3NRNA 4WX1A 3ALJA 3SFDA 2C67A 4Z2TA 2YM2A 4U2TA 1CHUA 3ISHA 5KMPA 3UKKA 3OZ2A 1GTEA 4ADWA 2BRAA 2XFQA 1PXCA 1B4VA 4I59A 4O5UA 1PHHA 2YWLA 1K0LA 1S2YA 1GT8A 2QCUA 2WP5A 2WDRA 3IF9A 1KFYA 2VRLA 2XLTA 2WP9A 4EQWA 1IUUA 2XFPA 4OPGA 4BK3A 4TM4A 2R0PA 4II2A 1OJTA 1PS9A 3GSIA 4EM3A 1JNRA 3GD4A 1N1PA 1GV4A 4RG3A 4Z43A 2XLPA 2Y6QA 2WPEA 3DGZA 1N4UA 2R4JA 1GPEA 2FJDA 1B8SA 1DOEA 5DBJA 1YY5A 1X31B 4EM4A 3DJJA 2RGHA 1E39A 2DKHA 1F8RA 2XLRA 3UOYA 2YG7A 4YSZA 4AP3A 4PAAA 1GNDA 1ZOVA 4APNA 1UKVG 2GMHA 2WEUA 2JAEA 1DJQA 3UP5A 1O95A 2APGA 1DNCA 2NPXA 1QJDA 3M0OA 2V6OA 3R9UA 2EQ8A 1BF3A 3T31A 4WCTA 3UTFA 3V3OA 2XFOA 1JNZA 4LIIA 4AP1A 1PBEA 4EMJA 5CKUA 2YVFA 3VRDB 2XFUA 1RSGA 2GVCA 4B68A 1CC6A 1D4DA 2Y6RA 3AE8A 4NEWA 5U63A 4O5QA 5JCIA 1XHCA 3AEDA 4C5OA 1GEUA 5TR3A 1D7YA 3ZDNA 4B67A 4YTPA 5KMSA 1ZK7A 4BV6A 4U8IA 1ZMCA 1VDCA 3C4NA 3CNPA 1E6EA 1GRGA 2WOIA 3GMBA 3KU9A 2CFYA 4H4SA 4TM3A 4JY2A 4USQA 3OC4A 1S3BA 3FG2P 1BGNA 3GYXA 4OPDA 1JU2A 1KSUA 2A8XA 2C7GA 2DKIA 2V3AA 2JB1A 3I6DA 3QFBA 5GSNA 1H7XA 1L9CA 4B64A 3NT6A 4YSHA 3DJEA 1PBFA 3M12A 1CL0A 1CJ4A 3H4KA 3H8IA 2WBAA 2B7SA 4G9KA 4FK1A 3CPHG 2VQ7A 1IUTA 3SGLA 4EMWA 2Q6UA 5FS8A 4ZCDA 1PJ7A 2C70A 5KNLA 3AEAA 1OJCA 3GDPA 5M0ZA 3C96A 2CULA 4TM0A 2YLTA 2YVGA 3DH9A 2WU5A 4CCRA 1VRQB 4H2QA 3URHA 5FS6A 5KWFA 1MXTA 3HYXA 1Y0PA 2CDUA 2NVKX 3ZYXA 2ACZA 4EMIA 1H83A 4AOXA 3CN8A 3NLCA 1N4VA 1REOA 2GR3A 4J36A 4TLZA 4USRA 1BWCA 3GMCA 1L9DA 3PVCA 4LA1A 4BK1A 2B9XA 4NWZA 2IVEA 1CBOA 3UKFA 2GB0A 4H2PA 3KA7A 4GCMA 3SYIA 4HB9A 4K7ZA 5JCNA 2XCGA 2YVJA 3LADA 1P2HA 3UCLA 3VR9A 3L1RA 4GDPA 1KDGA 5IQ4A 1YKJA 2X50A 1ZMDA 2Q0KA 1P2EA 2V5ZA 1NEKA 2FJEA 1D4CA 2C64A 2YLRA 2YQUA 3NHOX 2GAHB 1BKWA 5L46A 4U8PA 3UTEA 1GESA 5EOWA 4Y4NA 4NTDA 3M13A 4U8KA 4A6NB 2ZZBA 3DK9A 1KSSA 3DMEA 5KVHA 3UKPA 2VVMA 5HXIA 2BK5A 3SY4A 3DJGX 2C72A 2X8GA 3GRTA 3LXDA 1RP0A 3NYEA 2BXRA 2QAEA 3CNDA 3PS9A 4YTMA 1LTXR 4A7AA 4YXDA 2C65A 2E4GA 4OPIA 1M6IA 3NNEA 2CVJA 2VOUA 3D8XA 2GMJA 4K5SA 1ELIA 1H86A 4FX9A 3AYLA 3WE0A 2Z5YA 4YKGA 2GAGB 1ZKQA 1DOCA 4IA6A 3ABVA 3NTAA 1TDOA 4IVMB 2XVJA 2IIDA 4EQSA 1PJ6A 2A87A 3AE3A 1Q9IA 2F5ZA 3LB8A 2EQ7A 2Q7VA 2WDQA 5ER0A 2WOVA 1YQZA 2B7RA 3DK4A 3KPFA 4YTNA 3VR8A 3SM8A 3G5RA 1FEAA 4ECHA 1H82A 2BABA 3AE1A 2ARDA 4H2RA 4YKFA 3AYIA 2BXSA 2J3NA 3FIMB 1BGJA 4G6GA 5KRQA 3DGHA 3VQRA 2B76A 2WOWA 4GDEA 3KKJA 2GR1A 2TPRA 1EL7A 3ATRA 4H4TA 4J34A 2OA1A 2R46A 4H4UA 2XVHA 4NTEA 1Y56A 2V61A 3P4QA 2YR4A 3CNTA 4AT2A 1GRAA 3AWIA 2TMDA 3IWAA 4JN9A 4BJZA 1GXFA 1TDNA 2XYOA 3RP6A 4A65A 3GDNA 4EIQA 4A99A 1VG0A 4ZCCA 3T37A 4GRTA 3IC9A 1HYUA 2H88A 3L8KA 4C3XA 2QA1A 1D7LA 1JOAA 1GRHA 3LOVA 3P4PA 2R9ZA 4YSXA 2YG3A 4Z2RA 4IVOB 3GWFA 3UKAA 3UOXA 4EIPA 3T2KA 3E1TA 2XVFA 4H4VA 2RGOA 3UKLA 4OPUA 3BNUA 3ICRA 3QVPA 2AAQA 5BRTA 2YAUA 3NN0X 4NTCA 4J31A 1GTHA 1TYTA 3CNJA 4H4XA 4B1BA 1H7WA 1KNRA 4U8LA 5JCKA 5KMRA 2GEWA 3NK1X 1GREA 1V59A 4YT0A 1VG9A 2YR5A 2YLZA 4A5LA 3QSMA 1AOGA 4XWZA 3FMWA 1CJ2A 2A89A 5KOXA 3SZWA 4P9SA 1JRXA 4H50A 4J57A 4H4ZA 2JK6A 4A6NA 2C3CA 3AE6A 2BA9A 4H7UA 2B9YA 1XPQA 4U8JA 3HYWA 2XVEA 1B5QA 2R0CA 2YG5A 1Y56B 5IQ1A 4BJYA 1XANA 1Q1WA 3K7MX 4A79A 2BCPA 3SZCA 1PJ5A 4XWRA 4Z25A 2EQ6A 1NAAA 4FK1C 3AEGA 1K4QA 4TLXA 2X3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B37 A;  4B69 A;  4UDR A;  1NG3 A;  5KOW A;  1XDI A;  1FEC A;  1OJD A;  3ADA B;  2ZZC A;  3COX A;  4IA5 A;  5KXJ A;  4CY6 A;  1ZDL A;  4C3Y A;  1LVL A;  4U8M A;  1JEH A;  3ALL A;  1N4W A;  2WQY A;  1O5W A;  1W4X A;  3DA1 A;  1MO9 A;  2XVI A;  2WHD A;  4E0V A;  3K7T A;  4KX6 A;  5EB5 A;  2YM1 A;  4UDQ A;  3ITJ A;  5FS7 A;  1COY A;  1LJ1 A;  1H81 A;  5BUK A;  2FJB A;  4XXG A;  2JBV A;  5J60 A;  1IUW A;  3AE2 A;  3RNM A;  1NHS A;  2W0H A;  1NPX A;  3BI2 A;  4IV9 A;  3VRB A;  1PDH A;  3GWD A;  1JRY A;  3Q6J A;  4J33 A;  3D1C A;  3RHA A;  3AEE A;  1NG4 A;  2YG4 A;  4J56 A;  2R45 A;  4OPT A;  1GET A;  1EBD A;  3V3N A;  1H84 A;  4Z24 A;  1QLB A;  4B63 A;  1KNP A;  2C76 A;  1F8W A;  4EQX A;  2VVL A;  2GV8 A;  4Y4L A;  3P9U A;  1PBB A;  2BK3 A;  3F8R A;  5U1O A;  3G5S A;  3IHG A;  3CNS A;  1H6V A;  2I0Z A;  2BS3 A;  1PBD A;  3NYF A;  2XDO A;  5KVI A;  1L9E A;  3P1W A;  4B65 A;  1D4E A;  1TRB A;  4CCQ A;  4CNJ A;  4BK2 A;  4H4R A;  3P4R A;  2IVD A;  1TDF A;  4YSY A;  3CPI G;  1NHP A;  4U2L A;  1ZY8 A;  5JCL A;  2RAB A;  2X99 A;  4BUR A;  3GD3 A;  2E1M A;  1IUS A;  5J7X A;  1GOS A;  2C73 A;  4OPL A;  1VQW A;  2YLS A;  4JDR A;  4LU6 A;  2WPC A;  3AYJ A;  4H4W A;  1DOB A;  2PYX A;  4DGK A;  3H8L A;  4HA6 A;  2V3B A;  1CJ3 A;  4GR1 A;  1LQU A;  3ATQ A;  4X4J A;  1EL8 A;  2C66 A;  4X9N A;  1ONF A;  3UKQ A;  3GRS A;  4I58 A;  2B9W A;  2OLO A;  2YG6 A;  3UP4 A;  3QVR A;  3KD9 A;  3NKS A;  1PXB A;  3UTH A;  2HQM A;  3CTY A;  2ZBW A;  2AQJ A;  3VRA A;  1K0J A;  2JB2 A;  4RSL A;  3CPJ G;  2R4E A;  4J2W A;  3S61 A;  1EL9 A;  1JRZ A;  1FOH A;  5CQF A;  1S3E A;  3NYC A;  3Q9T A;  1Q1R A;  1F3P A;  2VZ2 A;  4Z44 A;  1GAL A;  2ZZ0 A;  2V60 A;  3F8P A;  2C3D A;  4H4Y A;  3QFA A;  2Z5X A;  3AE7 A;  3C4A A;  3UOZ A;  1NEN A;  1YQ4 A;  1GSN A;  1IUV A;  2R0G A;  3HZL A;  2VRM A;  2AR8 A;  3FPZ A;  1LQT A;  4JNQ A;  2BK4 A;  3LZX A;  3UKH A;  1LV0 A;  2BS4 A;  2OAM A;  1TDE A;  2JB3 A;  3KVE A;  4KPR A;  1PBC A;  2Q0L A;  4GF7 A;  4MJW A;  5C2T A;  2GRT A;  2FBW A;  4UP3 A;  3V76 A;  2VVL G;  2WU2 A;  3EAN A;  1FEB A;  5EB4 A;  4H2N A;  4A9W A;  1M64 A;  3AE9 A;  3LZW A;  3RP8 A;  4Z26 A;  1O94 A;  5HY5 A;  4H4P A;  1NHR A;  2VQB A;  3QJ4 A;  4D03 A;  3AD8 B;  2E5V A;  1NDA A;  1NHQ A;  3G5Q A;  3AD7 B;  1L0V A;  3K30 A;  3QSS A;  3PO7 A;  2BAC A;  1IUX A;  1CF3 A;  3RED A;  1IJH A;  5M10 A;  1F6M A;  4ICY A;  1MOK A;  1Z6L A;  1E1K A;  1OJA A;  2WET A;  3ALM A;  4GUV A;  4B66 A;  2EQ9 A;  1KF6 A;  2FJA A;  2OAL A;  1E7P A;  2BCG G;  3AD9 B;  1FCD A;  3AE4 A;  1GRF A;  4JY3 A;  1DJN A;  2BC0 A;  2GR0 A;  1E1M A;  4CBQ A;  1S2Q A;  3KLJ A;  2OLN A;  2PHH A;  2GF3 A;  2RGJ A;  3CGC A;  3B3R A;  3ICT A;  3JSK A;  4REK A;  3F8D A;  2GQW A;  3CIR A;  4U8O A;  2XFN A;  1TDK A;  1OJ9 A;  3GYJ A;  4NZH A;  1F8S A;  3DK8 A;  1ZP0 A;  3NG7 X;  4K22 A;  4N9X A;  2BYB A;  3P4S A;  4JQ9 A;  4RG4 A;  1BZL A;  4K5R A;  4DSH A;  4ZN0 A;  4H4Q A;  3BHK A;  3AEF A;  2WP6 A;  5U25 A;  5BVA A;  1GER A;  3O0H A;  1E1L A;  1RYI A;  4PAB A;  2O9Z A;  4OVI A;  4D04 A;  2X8H A;  3NH3 X;  4JNA A;  3UTG A;  2C75 A;  2X8C A;  4EQR A;  2BC1 A;  3ICS A;  4U8N A;  5JCM A;  3BI5 A;  3AEC A;  4Y4M A;  4OCG A;  4OPC A;  2GH5 A;  3EAO A;  5HYM A;  5IPY A;  3AXB A;  4AOS A;  1E1N A;  5BUL A;  4AT0 A;  2WDV A;  3LJP A;  5FS9 A;  2YLX A;  4NEV A;  4DNA A;  3GYI A;  1GRT A;  3NN6 X;  4YWO A;  1PXA A;  3I3L A;  1DXL A;  2JKC A;  1QO8 A;  3CGE A;  2GQF A;  3IHM A;  1D5T A;  4U2S A;  3EF6 A;  3BHF A;  1LPF A;  2YLW A;  1K0I A;  1SEZ A;  3S5W A;  4FDC B;  3FBS A;  1FL2 A;  3NGC X;  3CGB A;  2BS2 A;  2YR6 A;  5GRT A;  4C74 A;  3BI4 A;  1ZOY A;  2GR2 A;  3SQP A;  1GRB A;  3EPT A;  4K8D A;  4UDP A;  5EBK A;  4DSG A;  3AEB A;  5C3J A;  4X9M A;  3QSE A;  4CRT A;  2WS3 A;  3K7Q X;  4K2X A;  1CC4 A;  1EL5 A;  4CY8 A;  2H89 A;  2XLS A;  3RP7 A;  1CJC A;  2WPF A;  3NK0 X;  2WES A;  4M52 A;  3SFE A;  4TM1 A;  1YQ3 A;  2UZZ A;  4Z2U A;  2XLU A;  3AB1 A;  3DJD A;  5HHF A;  3UOV A;  4CNK A;  3NIX A;  3CGD A;  1PN0 A;  3AE5 A;  1CC2 A;  1TYP A;  4C77 A;  5FMH A;  3NTD A;  3NK2 X;  1ZX9 A;  3BNM A;  3B6D A;  1DOD A;  3II4 A;  5LV9 A;  2QA2 A;  3NRN A;  4WX1 A;  3ALJ A;  3SFD A;  2C67 A;  4Z2T A;  2YM2 A;  4U2T A;  1CHU A;  3ISH A;  3UKK A;  3OZ2 A;  1GTE A;  4ADW A;  2XFQ A;  1PXC A;  1B4V A;  4I59 A;  4O5U A;  1PHH A;  2YWL A;  1K0L A;  1S2Y A;  1GT8 A;  2QCU A;  2WP5 A;  2WDR A;  3IF9 A;  1KFY A;  2VRL A;  2XLT A;  2WP9 A;  4EQW A;  1IUU A;  2XFP A;  4OPG A;  4BK3 A;  4TM4 A;  2R0P A;  1OJT A;  1PS9 A;  3GSI A;  4EM3 A;  1JNR A;  3GD4 A;  1N1P A;  1GV4 A;  4RG3 A;  4Z43 A;  2XLP A;  2Y6Q A;  2WPE A;  3DGZ A;  1N4U A;  2R4J A;  1GPE A;  2FJD A;  1B8S A;  1DOE A;  5DBJ A;  1YY5 A;  1X31 B;  4EM4 A;  3DJJ A;  2RGH A;  1E39 A;  2DKH A;  1F8R A;  2XLR A;  3UOY A;  2YG7 A;  4YSZ A;  4AP3 A;  4PAA A;  1GND A;  1ZOV A;  4APN A;  1UKV G;  2GMH A;  2WEU A;  2JAE A;  1DJQ A;  3UP5 A;  1O95 A;  2APG A;  1DNC A;  2NPX A;  1QJD A;  3M0O A;  2V6O A;  3R9U A;  2EQ8 A;  1BF3 A;  4WCT A;  3UTF A;  3V3O A;  2XFO A;  1JNZ A;  4LII A;  4AP1 A;  1PBE A;  4EMJ A;  5CKU A;  2YVF A;  3VRD B;  2XFU A;  1RSG A;  2GVC A;  4B68 A;  1CC6 A;  1D4D A;  2Y6R A;  3AE8 A;  4NEW A;  5U63 A;  4O5Q A;  5JCI A;  1XHC A;  3AED A;  4C5O A;  1GEU A;  5TR3 A;  1D7Y A;  3ZDN A;  4B67 A;  4YTP A;  1ZK7 A;  4BV6 A;  4U8I A;  1ZMC A;  1VDC A;  3C4N A;  3CNP A;  1E6E A;  1GRG A;  2WOI A;  3GMB A;  3KU9 A;  2CFY A;  4H4S A;  4TM3 A;  4JY2 A;  4USQ A;  3OC4 A;  1S3B A;  3FG2 P;  1BGN A;  4OPD A;  1JU2 A;  1KSU A;  2A8X A;  2C7G A;  2DKI A;  2V3A A;  2JB1 A;  3I6D A;  3QFB A;  5GSN A;  1H7X A;  1L9C A;  4B64 A;  3NT6 A;  4YSH A;  3DJE A;  1PBF A;  3M12 A;  1CL0 A;  1CJ4 A;  3H4K A;  3H8I A;  2WBA A;  2B7S A;  4FK1 A;  3CPH G;  2VQ7 A;  1IUT A;  3SGL A;  4EMW A;  2Q6U A;  5FS8 A;  4ZCD A;  1PJ7 A;  2C70 A;  3AEA A;  1OJC A;  3GDP A;  5M0Z A;  3C96 A;  2CUL A;  4TM0 A;  2YLT A;  2YVG A;  3DH9 A;  2WU5 A;  4CCR A;  1VRQ B;  4H2Q A;  3URH A;  5FS6 A;  5KWF A;  1MXT A;  4EMI A;  1Y0P A;  2CDU A;  2NVK X;  3ZYX A;  2ACZ A;  1H83 A;  4AOX A;  3CN8 A;  3NLC A;  1N4V A;  1REO A;  2GR3 A;  4J36 A;  4TLZ A;  4USR A;  1BWC A;  3GMC A;  1L9D A;  3PVC A;  4LA1 A;  4BK1 A;  2B9X A;  2IVE A;  1CBO A;  3UKF A;  2GB0 A;  4H2P A;  3KA7 A;  4GCM A;  4HB9 A;  4K7Z A;  5JCN A;  2XCG A;  2YVJ A;  3LAD A;  1P2H A;  3UCL A;  3VR9 A;  3L1R A;  4GDP A;  1KDG A;  5IQ4 A;  1YKJ A;  2X50 A;  1ZMD A;  2Q0K A;  1P2E A;  2V5Z A;  1NEK A;  2FJE A;  1D4C A;  2C64 A;  2YLR A;  2YQU A;  3NHO X;  2GAH B;  1BKW A;  5L46 A;  4U8P A;  3UTE A;  1GES A;  5EOW A;  4Y4N A;  4NTD A;  3M13 A;  4U8K A;  4A6N B;  2ZZB A;  3DK9 A;  1KSS A;  3DME A;  5KVH A;  3UKP A;  2VVM A;  5HXI A;  2BK5 A;  3DJG X;  2C72 A;  2X8G A;  3GRT A;  3LXD A;  1RP0 A;  3NYE A;  2BXR A;  2QAE A;  3CND A;  3PS9 A;  4YTM A;  1LTX R;  4A7A A;  4YXD A;  2C65 A;  2E4G A;  4OPI A;  1M6I A;  3NNE A;  2CVJ A;  2VOU A;  3D8X A;  2GMJ A;  4K5S A;  1ELI A;  1H86 A;  4FX9 A;  3AYL A;  3WE0 A;  2Z5Y A;  4YKG A;  2GAG B;  1ZKQ A;  1DOC A;  4IA6 A;  3ABV A;  3NTA A;  1TDO A;  4IVM B;  2XVJ A;  2IID A;  4EQS A;  1PJ6 A;  2A87 A;  3AE3 A;  1Q9I A;  2F5Z A;  3LB8 A;  2EQ7 A;  2Q7V A;  2WDQ A;  5ER0 A;  2WOV A;  1YQZ A;  2B7R A;  3DK4 A;  3KPF A;  4YTN A;  3VR8 A;  3SM8 A;  3G5R A;  1FEA A;  4ECH A;  1H82 A;  2BAB A;  3AE1 A;  2ARD A;  4H2R A;  4YKF A;  3AYI A;  2BXS A;  2J3N A;  3FIM B;  1BGJ A;  5KRQ A;  3DGH A;  3VQR A;  2B76 A;  2WOW A;  4GDE A;  3KKJ A;  2GR1 A;  2TPR A;  1EL7 A;  3ATR A;  4H4T A;  4J34 A;  2OA1 A;  2R46 A;  4H4U A;  2XVH A;  4NTE A;  1Y56 A;  2V61 A;  3P4Q A;  2YR4 A;  3CNT A;  4AT2 A;  1GRA A;  3AWI A;  2TMD A;  3IWA A;  4JN9 A;  4BJZ A;  1GXF A;  1TDN A;  2XYO A;  3RP6 A;  4A65 A;  3GDN A;  4EIQ A;  4A99 A;  1VG0 A;  4ZCC A;  3T37 A;  4GRT A;  3IC9 A;  1HYU A;  2H88 A;  3L8K A;  4C3X A;  2QA1 A;  1D7L A;  1JOA A;  1GRH A;  3LOV A;  3P4P A;  2R9Z A;  4YSX A;  2YG3 A;  4Z2R A;  4IVO B;  3GWF A;  3UKA A;  3UOX A;  4EIP A;  3E1T A;  2XVF A;  4H4V A;  2RGO A;  3UKL A;  4OPU A;  3BNU A;  3ICR A;  3QVP A;  2AAQ A;  5BRT A;  2YAU A;  3NN0 X;  4NTC A;  4J31 A;  1GTH A;  1TYT A;  3CNJ A;  4H4X A;  4B1B A;  1H7W A;  1KNR A;  4U8L A;  5JCK A;  2GEW A;  3NK1 X;  1GRE A;  1V59 A;  4YT0 A;  1VG9 A;  2YR5 A;  2YLZ A;  4A5L A;  3QSM A;  1AOG A;  4XWZ A;  3FMW A;  1CJ2 A;  2A89 A;  5KOX A;  4P9S A;  1JRX A;  4H50 A;  4J57 A;  4H4Z A;  2JK6 A;  4A6N A;  2C3C A;  3AE6 A;  2BA9 A;  4H7U A;  2B9Y A;  1XPQ A;  4U8J A;  2XVE A;  1B5Q A;  2R0C A;  2YG5 A;  1Y56 B;  5IQ1 A;  4BJY A;  1XAN A;  1Q1W A;  3K7M X;  4A79 A;  2BCP A;  1PJ5 A;  4XWR A;  4Z25 A;  2EQ6 A;  1NAA A;  4FK1 C;  3AEG A;  1K4Q A;  4TLX A;  2X3N A; 
#chains in the Genus database with same CATH topology
 1B37 A;  4B69 A;  4UDR A;  1NG3 A;  5KOW A;  1XDI A;  1FEC A;  1OJD A;  3ADA B;  2ZZC A;  3COX A;  4IA5 A;  5KXJ A;  4CY6 A;  1ZDL A;  4C3Y A;  1LVL A;  4U8M A;  1JEH A;  3ALL A;  1N4W A;  2WQY A;  1O5W A;  4GAP A;  3T0K A;  1W4X A;  3DA1 A;  1MO9 A;  3SXI A;  2XVI A;  2WHD A;  4E0V A;  3K7T A;  4KX6 A;  5EB5 A;  2YM1 A;  4UDQ A;  3ITJ A;  5FS7 A;  1COY A;  1LJ1 A;  1H81 A;  5BUK A;  2FJB A;  4XXG A;  2JBV A;  5J60 A;  1IUW A;  3AE2 A;  3RNM A;  1NHS A;  2W0H A;  1NPX A;  3BI2 A;  4IV9 A;  3VRB A;  1PDH A;  3GWD A;  1JRY A;  3Q6J A;  4J33 A;  3D1C A;  3RHA A;  3AEE A;  1NG4 A;  2YG4 A;  4J56 A;  2R45 A;  4OPT A;  1GET A;  1EBD A;  3V3N A;  1H84 A;  4Z24 A;  1QLB A;  4B63 A;  1KNP A;  2C76 A;  1F8W A;  4EQX A;  2VVL A;  2GV8 A;  4Y4L A;  3P9U A;  1PBB A;  2BK3 A;  3F8R A;  5U1O A;  3G5S A;  3IHG A;  3CNS A;  1H6V A;  2I0Z A;  2BS3 A;  1PBD A;  3NYF A;  2XDO A;  5KVI A;  1L9E A;  3KPK A;  3P1W A;  4B65 A;  1D4E A;  1TRB A;  4CCQ A;  4CNJ A;  4BK2 A;  4H4R A;  3T2Y A;  3P4R A;  2IVD A;  1TDF A;  4YSY A;  3CPI G;  1NHP A;  4U2L A;  1ZY8 A;  5JCL A;  2RAB A;  2X99 A;  4BUR A;  3GD3 A;  2E1M A;  1IUS A;  5J7X A;  1GOS A;  2C73 A;  4OPL A;  1VQW A;  2YLS A;  4NNJ A;  4JDR A;  4LU6 A;  2WPC A;  3AYJ A;  4II3 A;  4H4W A;  1DOB A;  2PYX A;  3T14 A;  4DGK A;  3H8L A;  4HA6 A;  2V3B A;  1CJ3 A;  4GR1 A;  1LQU A;  3ATQ A;  4X4J A;  1EL8 A;  2C66 A;  4X9N A;  1ONF A;  3UKQ A;  3GRS A;  3SZ0 A;  4I58 A;  2B9W A;  2OLO A;  2YG6 A;  3UP4 A;  3QVR A;  3KD9 A;  3NKS A;  1PXB A;  3UTH A;  2HQM A;  3CTY A;  2ZBW A;  2AQJ A;  3VRA A;  1K0J A;  2JB2 A;  2C4C A;  3CPJ G;  2R4E A;  4RSL A;  4J2W A;  3S61 A;  1EL9 A;  1JRZ A;  1FOH A;  5CQF A;  1S3E A;  3NYC A;  3Q9T A;  1Q1R A;  1F3P A;  2VZ2 A;  4Z44 A;  1GAL A;  2ZZ0 A;  4G6H A;  2V60 A;  3F8P A;  2C3D A;  4H4Y A;  3QFA A;  2Z5X A;  3AE7 A;  3C4A A;  3UOZ A;  1NEN A;  1YQ4 A;  1GSN A;  1IUV A;  2R0G A;  3HZL A;  2VRM A;  2AR8 A;  3FPZ A;  1LQT A;  4JNQ A;  2BK4 A;  3LZX A;  3UKH A;  1LV0 A;  2BS4 A;  2OAM A;  1TDE A;  2JB3 A;  3KVE A;  4KPR A;  1PBC A;  2Q0L A;  4GF7 A;  4MJW A;  5C2T A;  2GRT A;  2FBW A;  4UP3 A;  3V76 A;  2VVL G;  2WU2 A;  3EAN A;  3T2Z A;  1FEB A;  5EB4 A;  4H2N A;  4A9W A;  1M64 A;  3AE9 A;  3LZW A;  3RP8 A;  4Z26 A;  1O94 A;  5HY5 A;  4H4P A;  1NHR A;  2VQB A;  3QJ4 A;  4D03 A;  3AD8 B;  2E5V A;  1NDA A;  1NHQ A;  3G5Q A;  3AD7 B;  1L0V A;  3K30 A;  3QSS A;  3PO7 A;  2BAC A;  1IUX A;  1CF3 A;  3RED A;  1IJH A;  3CMM A;  5M10 A;  1F6M A;  4ICY A;  1MOK A;  1Z6L A;  1E1K A;  1OJA A;  2WET A;  3ALM A;  4GUV A;  4B66 A;  2EQ9 A;  1KF6 A;  2FJA A;  2OAL A;  1E7P A;  2BCG G;  3AD9 B;  1FCD A;  3AE4 A;  1GRF A;  4JY3 A;  1DJN A;  2BC0 A;  2GR0 A;  1E1M A;  4CBQ A;  1S2Q A;  3KLJ A;  2OLN A;  2PHH A;  2GF3 A;  2RGJ A;  3CGC A;  3B3R A;  3ICT A;  3JSK A;  4REK A;  3F8D A;  2GQW A;  3CIR A;  4U8O A;  2XFN A;  1TDK A;  1OJ9 A;  3GYJ A;  4NZH A;  1F8S A;  3DK8 A;  1ZP0 A;  3NG7 X;  4K22 A;  4N9X A;  2BYB A;  3P4S A;  4JQ9 A;  4RG4 A;  1BZL A;  4K5R A;  4DSH A;  4ZN0 A;  4H4Q A;  3BHK A;  3AEF A;  2WP6 A;  5U25 A;  4G73 A;  5BVA A;  1GER A;  3O0H A;  1E1L A;  1RYI A;  4GAV A;  2O9Z A;  4OVI A;  4PAB A;  4D04 A;  2X8H A;  3NH3 X;  4JNA A;  5KMQ A;  3UTG A;  2C75 A;  2X8C A;  4EQR A;  2BC1 A;  3ICS A;  4U8N A;  5JCM A;  3BI5 A;  3AEC A;  4Y4M A;  4OCG A;  4OPC A;  2GH5 A;  3EAO A;  5HYM A;  5IPY A;  3AXB A;  4AOS A;  1E1N A;  5BUL A;  4AT0 A;  2WDV A;  3LJP A;  5FS9 A;  2YLX A;  4NEV A;  4DNA A;  3GYI A;  1GRT A;  3NN6 X;  4YWO A;  1PXA A;  3I3L A;  1DXL A;  2JKC A;  1QO8 A;  3CGE A;  3HYV A;  2GQF A;  3IHM A;  1D5T A;  4U2S A;  3EF6 A;  3BHF A;  1LPF A;  2YLW A;  1K0I A;  1SEZ A;  3S5W A;  4FDC B;  3FBS A;  1FL2 A;  3NGC X;  3CGB A;  2BS2 A;  2YR6 A;  5GRT A;  4C74 A;  3BI4 A;  1ZOY A;  3SX6 A;  2GR2 A;  3SZF A;  3SQP A;  1GRB A;  3EPT A;  4K8D A;  4UDP A;  5EBK A;  4DSG A;  3AEB A;  5C3J A;  4X9M A;  3QSE A;  4CRT A;  2WS3 A;  3K7Q X;  4K2X A;  1CC4 A;  1EL5 A;  4CY8 A;  2H89 A;  2XLS A;  2BRY A;  3RP7 A;  1CJC A;  2WPF A;  3NK0 X;  2WES A;  4M52 A;  3SFE A;  4TM1 A;  1YQ3 A;  2UZZ A;  4Z2U A;  2XLU A;  3AB1 A;  3DJD A;  5HHF A;  3UOV A;  4G74 A;  4CNK A;  3NIX A;  3CGD A;  1PN0 A;  3AE5 A;  1CC2 A;  1TYP A;  4C77 A;  5FMH A;  3NTD A;  3NK2 X;  1ZX9 A;  3BNM A;  3B6D A;  1DOD A;  3II4 A;  5LV9 A;  2QA2 A;  3NRN A;  4WX1 A;  3ALJ A;  3SFD A;  2C67 A;  4Z2T A;  2YM2 A;  4U2T A;  1CHU A;  3ISH A;  5KMP A;  3UKK A;  3OZ2 A;  1GTE A;  4ADW A;  2BRA A;  2XFQ A;  1PXC A;  1B4V A;  4I59 A;  4O5U A;  1PHH A;  2YWL A;  1K0L A;  1S2Y A;  1GT8 A;  2QCU A;  2WP5 A;  2WDR A;  3IF9 A;  1KFY A;  2VRL A;  2XLT A;  2WP9 A;  4EQW A;  1IUU A;  2XFP A;  4OPG A;  4BK3 A;  4TM4 A;  2R0P A;  4II2 A;  1OJT A;  1PS9 A;  3GSI A;  4EM3 A;  1JNR A;  3GD4 A;  1N1P A;  1GV4 A;  4RG3 A;  4Z43 A;  2XLP A;  2Y6Q A;  2WPE A;  3DGZ A;  1N4U A;  2R4J A;  1GPE A;  2FJD A;  1B8S A;  1DOE A;  5DBJ A;  1YY5 A;  1X31 B;  4EM4 A;  3DJJ A;  2RGH A;  1E39 A;  2DKH A;  1F8R A;  2XLR A;  3UOY A;  2YG7 A;  4YSZ A;  4AP3 A;  4PAA A;  1GND A;  1ZOV A;  4APN A;  1UKV G;  2GMH A;  2WEU A;  2JAE A;  1DJQ A;  3UP5 A;  1O95 A;  2APG A;  1DNC A;  2NPX A;  1QJD A;  3M0O A;  2V6O A;  3R9U A;  2EQ8 A;  1BF3 A;  3T31 A;  4WCT A;  3UTF A;  3V3O A;  2XFO A;  1JNZ A;  4LII A;  4AP1 A;  1PBE A;  4EMJ A;  5CKU A;  2YVF A;  3VRD B;  2XFU A;  1RSG A;  2GVC A;  4B68 A;  1CC6 A;  1D4D A;  2Y6R A;  3AE8 A;  4NEW A;  5U63 A;  4O5Q A;  5JCI A;  1XHC A;  3AED A;  4C5O A;  1GEU A;  5TR3 A;  1D7Y A;  3ZDN A;  4B67 A;  4YTP A;  5KMS A;  1ZK7 A;  4BV6 A;  4U8I A;  1ZMC A;  1VDC A;  3C4N A;  3CNP A;  1E6E A;  1GRG A;  2WOI A;  3GMB A;  3KU9 A;  2CFY A;  4H4S A;  4TM3 A;  4JY2 A;  4USQ A;  3OC4 A;  1S3B A;  3FG2 P;  1BGN A;  3GYX A;  4OPD A;  1JU2 A;  1KSU A;  2A8X A;  2C7G A;  2DKI A;  2V3A A;  2JB1 A;  3I6D A;  3QFB A;  5GSN A;  1H7X A;  1L9C A;  4B64 A;  3NT6 A;  4YSH A;  3DJE A;  1PBF A;  3M12 A;  1CL0 A;  1CJ4 A;  3H4K A;  3H8I A;  2WBA A;  2B7S A;  4G9K A;  4FK1 A;  3CPH G;  2VQ7 A;  1IUT A;  3SGL A;  4EMW A;  2Q6U A;  5FS8 A;  4ZCD A;  1PJ7 A;  2C70 A;  5KNL A;  3AEA A;  1OJC A;  3GDP A;  5M0Z A;  3C96 A;  2CUL A;  4TM0 A;  2YLT A;  2YVG A;  3DH9 A;  2WU5 A;  4CCR A;  1VRQ B;  4H2Q A;  3URH A;  5FS6 A;  5KWF A;  1MXT A;  3HYX A;  1Y0P A;  2CDU A;  2NVK X;  3ZYX A;  2ACZ A;  4EMI A;  1H83 A;  4AOX A;  3CN8 A;  3NLC A;  1N4V A;  1REO A;  2GR3 A;  4J36 A;  4TLZ A;  4USR A;  1BWC A;  3GMC A;  1L9D A;  3PVC A;  4LA1 A;  4BK1 A;  2B9X A;  4NWZ A;  2IVE A;  1CBO A;  3UKF A;  2GB0 A;  4H2P A;  3KA7 A;  4GCM A;  3SYI A;  4HB9 A;  4K7Z A;  5JCN A;  2XCG A;  2YVJ A;  3LAD A;  1P2H A;  3UCL A;  3VR9 A;  3L1R A;  4GDP A;  1KDG A;  5IQ4 A;  1YKJ A;  2X50 A;  1ZMD A;  2Q0K A;  1P2E A;  2V5Z A;  1NEK A;  2FJE A;  1D4C A;  2C64 A;  2YLR A;  2YQU A;  3NHO X;  2GAH B;  1BKW A;  5L46 A;  4U8P A;  3UTE A;  1GES A;  5EOW A;  4Y4N A;  4NTD A;  3M13 A;  4U8K A;  4A6N B;  2ZZB A;  3DK9 A;  1KSS A;  3DME A;  5KVH A;  3UKP A;  2VVM A;  5HXI A;  2BK5 A;  3SY4 A;  3DJG X;  2C72 A;  2X8G A;  3GRT A;  3LXD A;  1RP0 A;  3NYE A;  2BXR A;  2QAE A;  3CND A;  3PS9 A;  4YTM A;  1LTX R;  4A7A A;  4YXD A;  2C65 A;  2E4G A;  4OPI A;  1M6I A;  3NNE A;  2CVJ A;  2VOU A;  3D8X A;  2GMJ A;  4K5S A;  1ELI A;  1H86 A;  4FX9 A;  3AYL A;  3WE0 A;  2Z5Y A;  4YKG A;  2GAG B;  1ZKQ A;  1DOC A;  4IA6 A;  3ABV A;  3NTA A;  1TDO A;  4IVM B;  2XVJ A;  2IID A;  4EQS A;  1PJ6 A;  2A87 A;  3AE3 A;  1Q9I A;  2F5Z A;  3LB8 A;  2EQ7 A;  2Q7V A;  2WDQ A;  5ER0 A;  2WOV A;  1YQZ A;  2B7R A;  3DK4 A;  3KPF A;  4YTN A;  3VR8 A;  3SM8 A;  3G5R A;  1FEA A;  4ECH A;  1H82 A;  2BAB A;  3AE1 A;  2ARD A;  4H2R A;  4YKF A;  3AYI A;  2BXS A;  2J3N A;  3FIM B;  1BGJ A;  4G6G A;  5KRQ A;  3DGH A;  3VQR A;  2B76 A;  2WOW A;  4GDE A;  3KKJ A;  2GR1 A;  2TPR A;  1EL7 A;  3ATR A;  4H4T A;  4J34 A;  2OA1 A;  2R46 A;  4H4U A;  2XVH A;  4NTE A;  1Y56 A;  2V61 A;  3P4Q A;  2YR4 A;  3CNT A;  4AT2 A;  1GRA A;  3AWI A;  2TMD A;  3IWA A;  4JN9 A;  4BJZ A;  1GXF A;  1TDN A;  2XYO A;  3RP6 A;  4A65 A;  3GDN A;  4EIQ A;  4A99 A;  1VG0 A;  4ZCC A;  3T37 A;  4GRT A;  3IC9 A;  1HYU A;  2H88 A;  3L8K A;  4C3X A;  2QA1 A;  1D7L A;  1JOA A;  1GRH A;  3LOV A;  3P4P A;  2R9Z A;  4YSX A;  2YG3 A;  4Z2R A;  4IVO B;  3GWF A;  3UKA A;  3UOX A;  4EIP A;  3T2K A;  3E1T A;  2XVF A;  4H4V A;  2RGO A;  3UKL A;  4OPU A;  3BNU A;  3ICR A;  3QVP A;  2AAQ A;  5BRT A;  2YAU A;  3NN0 X;  4NTC A;  4J31 A;  1GTH A;  1TYT A;  3CNJ A;  4H4X A;  4B1B A;  1H7W A;  1KNR A;  4U8L A;  5JCK A;  5KMR A;  2GEW A;  3NK1 X;  1GRE A;  1V59 A;  4YT0 A;  1VG9 A;  2YR5 A;  2YLZ A;  4A5L A;  3QSM A;  1AOG A;  4XWZ A;  3FMW A;  1CJ2 A;  2A89 A;  5KOX A;  3SZW A;  4P9S A;  1JRX A;  4H50 A;  4J57 A;  4H4Z A;  2JK6 A;  4A6N A;  2C3C A;  3AE6 A;  2BA9 A;  4H7U A;  2B9Y A;  1XPQ A;  4U8J A;  3HYW A;  2XVE A;  1B5Q A;  2R0C A;  2YG5 A;  1Y56 B;  5IQ1 A;  4BJY A;  1XAN A;  1Q1W A;  3K7M X;  4A79 A;  2BCP A;  3SZC A;  1PJ5 A;  4XWR A;  4Z25 A;  2EQ6 A;  1NAA A;  4FK1 C;  3AEG A;  1K4Q A;  4TLX A;  2X3N A; 
#chains in the Genus database with same CATH homology
 1B37 A;  4B69 A;  4UDR A;  1NG3 A;  5KOW A;  1XDI A;  1FEC A;  1OJD A;  3ADA B;  2ZZC A;  3COX A;  4IA5 A;  5KXJ A;  4CY6 A;  1ZDL A;  4C3Y A;  1LVL A;  4U8M A;  1JEH A;  3ALL A;  1N4W A;  2WQY A;  1O5W A;  4GAP A;  3T0K A;  1W4X A;  3DA1 A;  1MO9 A;  3SXI A;  2XVI A;  2WHD A;  4E0V A;  3K7T A;  4KX6 A;  5EB5 A;  2YM1 A;  4UDQ A;  3ITJ A;  5FS7 A;  1COY A;  1LJ1 A;  1H81 A;  5BUK A;  2FJB A;  4XXG A;  2JBV A;  5J60 A;  1IUW A;  3AE2 A;  3RNM A;  1NHS A;  2W0H A;  1NPX A;  3BI2 A;  4IV9 A;  3VRB A;  1PDH A;  3GWD A;  1JRY A;  3Q6J A;  4J33 A;  3D1C A;  3RHA A;  3AEE A;  1NG4 A;  2YG4 A;  4J56 A;  2R45 A;  4OPT A;  1GET A;  1EBD A;  3V3N A;  1H84 A;  4Z24 A;  1QLB A;  4B63 A;  1KNP A;  2C76 A;  1F8W A;  4EQX A;  2VVL A;  2GV8 A;  4Y4L A;  3P9U A;  1PBB A;  2BK3 A;  3F8R A;  5U1O A;  3G5S A;  3IHG A;  3CNS A;  1H6V A;  2I0Z A;  2BS3 A;  1PBD A;  3NYF A;  2XDO A;  5KVI A;  1L9E A;  3KPK A;  3P1W A;  4B65 A;  1D4E A;  1TRB A;  4CCQ A;  4CNJ A;  4BK2 A;  4H4R A;  3T2Y A;  3P4R A;  2IVD A;  1TDF A;  4YSY A;  3CPI G;  1NHP A;  4U2L A;  1ZY8 A;  5JCL A;  2RAB A;  2X99 A;  4BUR A;  3GD3 A;  2E1M A;  1IUS A;  5J7X A;  1GOS A;  2C73 A;  4OPL A;  1VQW A;  2YLS A;  4NNJ A;  4JDR A;  4LU6 A;  2WPC A;  3AYJ A;  4II3 A;  4H4W A;  1DOB A;  2PYX A;  3T14 A;  4DGK A;  3H8L A;  4HA6 A;  2V3B A;  1CJ3 A;  4GR1 A;  1LQU A;  3ATQ A;  4X4J A;  1EL8 A;  2C66 A;  4X9N A;  1ONF A;  3UKQ A;  3GRS A;  3SZ0 A;  4I58 A;  2B9W A;  2OLO A;  2YG6 A;  3UP4 A;  3QVR A;  3KD9 A;  3NKS A;  1PXB A;  3UTH A;  2HQM A;  3CTY A;  2ZBW A;  2AQJ A;  3VRA A;  1K0J A;  2JB2 A;  2C4C A;  3CPJ G;  2R4E A;  4RSL A;  4J2W A;  3S61 A;  1EL9 A;  1JRZ A;  1FOH A;  5CQF A;  1S3E A;  3NYC A;  3Q9T A;  1Q1R A;  1F3P A;  2VZ2 A;  4Z44 A;  1GAL A;  2ZZ0 A;  4G6H A;  2V60 A;  3F8P A;  2C3D A;  4H4Y A;  3QFA A;  2Z5X A;  3AE7 A;  3C4A A;  3UOZ A;  1NEN A;  1YQ4 A;  1GSN A;  1IUV A;  2R0G A;  3HZL A;  2VRM A;  2AR8 A;  3FPZ A;  1LQT A;  4JNQ A;  2BK4 A;  3LZX A;  3UKH A;  1LV0 A;  2BS4 A;  2OAM A;  1TDE A;  2JB3 A;  3KVE A;  4KPR A;  1PBC A;  2Q0L A;  4GF7 A;  4MJW A;  5C2T A;  2GRT A;  2FBW A;  4UP3 A;  3V76 A;  2VVL G;  2WU2 A;  3EAN A;  3T2Z A;  1FEB A;  5EB4 A;  4H2N A;  4A9W A;  1M64 A;  3AE9 A;  3LZW A;  3RP8 A;  4Z26 A;  1O94 A;  5HY5 A;  4H4P A;  1NHR A;  2VQB A;  3QJ4 A;  4D03 A;  3AD8 B;  2E5V A;  1NDA A;  1NHQ A;  3G5Q A;  3AD7 B;  1L0V A;  3K30 A;  3QSS A;  3PO7 A;  2BAC A;  1IUX A;  1CF3 A;  3RED A;  1IJH A;  3CMM A;  5M10 A;  1F6M A;  4ICY A;  1MOK A;  1Z6L A;  1E1K A;  1OJA A;  2WET A;  3ALM A;  4GUV A;  4B66 A;  2EQ9 A;  1KF6 A;  2FJA A;  2OAL A;  1E7P A;  2BCG G;  3AD9 B;  1FCD A;  3AE4 A;  1GRF A;  4JY3 A;  1DJN A;  2BC0 A;  2GR0 A;  1E1M A;  4CBQ A;  1S2Q A;  3KLJ A;  2OLN A;  2PHH A;  2GF3 A;  2RGJ A;  3CGC A;  3B3R A;  3ICT A;  3JSK A;  4REK A;  3F8D A;  2GQW A;  3CIR A;  4U8O A;  2XFN A;  1TDK A;  1OJ9 A;  3GYJ A;  4NZH A;  1F8S A;  3DK8 A;  1ZP0 A;  3NG7 X;  4K22 A;  4N9X A;  2BYB A;  3P4S A;  4JQ9 A;  4RG4 A;  1BZL A;  4K5R A;  4DSH A;  4ZN0 A;  4H4Q A;  3BHK A;  3AEF A;  2WP6 A;  5U25 A;  4G73 A;  5BVA A;  1GER A;  3O0H A;  1E1L A;  1RYI A;  4GAV A;  2O9Z A;  4OVI A;  4PAB A;  4D04 A;  2X8H A;  3NH3 X;  4JNA A;  5KMQ A;  3UTG A;  2C75 A;  2X8C A;  4EQR A;  2BC1 A;  3ICS A;  4U8N A;  5JCM A;  3BI5 A;  3AEC A;  4Y4M A;  4OCG A;  4OPC A;  2GH5 A;  3EAO A;  5HYM A;  5IPY A;  3AXB A;  4AOS A;  1E1N A;  5BUL A;  4AT0 A;  2WDV A;  3LJP A;  5FS9 A;  2YLX A;  4NEV A;  4DNA A;  3GYI A;  1GRT A;  3NN6 X;  4YWO A;  1PXA A;  3I3L A;  1DXL A;  2JKC A;  1QO8 A;  3CGE A;  3HYV A;  2GQF A;  3IHM A;  1D5T A;  4U2S A;  3EF6 A;  3BHF A;  1LPF A;  2YLW A;  1K0I A;  1SEZ A;  3S5W A;  4FDC B;  3FBS A;  1FL2 A;  3NGC X;  3CGB A;  2BS2 A;  2YR6 A;  5GRT A;  4C74 A;  3BI4 A;  1ZOY A;  3SX6 A;  2GR2 A;  3SZF A;  3SQP A;  1GRB A;  3EPT A;  4K8D A;  4UDP A;  5EBK A;  4DSG A;  3AEB A;  5C3J A;  4X9M A;  3QSE A;  4CRT A;  2WS3 A;  3K7Q X;  4K2X A;  1CC4 A;  1EL5 A;  4CY8 A;  2H89 A;  2XLS A;  2BRY A;  3RP7 A;  1CJC A;  2WPF A;  3NK0 X;  2WES A;  4M52 A;  3SFE A;  4TM1 A;  1YQ3 A;  2UZZ A;  4Z2U A;  2XLU A;  3AB1 A;  3DJD A;  5HHF A;  3UOV A;  4G74 A;  4CNK A;  3NIX A;  3CGD A;  1PN0 A;  3AE5 A;  1CC2 A;  1TYP A;  4C77 A;  5FMH A;  3NTD A;  3NK2 X;  1ZX9 A;  3BNM A;  3B6D A;  1DOD A;  3II4 A;  5LV9 A;  2QA2 A;  3NRN A;  4WX1 A;  3ALJ A;  3SFD A;  2C67 A;  4Z2T A;  2YM2 A;  4U2T A;  1CHU A;  3ISH A;  5KMP A;  3UKK A;  3OZ2 A;  1GTE A;  4ADW A;  2BRA A;  2XFQ A;  1PXC A;  1B4V A;  4I59 A;  4O5U A;  1PHH A;  2YWL A;  1K0L A;  1S2Y A;  1GT8 A;  2QCU A;  2WP5 A;  2WDR A;  3IF9 A;  1KFY A;  2VRL A;  2XLT A;  2WP9 A;  4EQW A;  1IUU A;  2XFP A;  4OPG A;  4BK3 A;  4TM4 A;  2R0P A;  4II2 A;  1OJT A;  1PS9 A;  3GSI A;  4EM3 A;  1JNR A;  3GD4 A;  1N1P A;  1GV4 A;  4RG3 A;  4Z43 A;  2XLP A;  2Y6Q A;  2WPE A;  3DGZ A;  1N4U A;  2R4J A;  1GPE A;  2FJD A;  1B8S A;  1DOE A;  5DBJ A;  1YY5 A;  1X31 B;  4EM4 A;  3DJJ A;  2RGH A;  1E39 A;  2DKH A;  1F8R A;  2XLR A;  3UOY A;  2YG7 A;  4YSZ A;  4AP3 A;  4PAA A;  1GND A;  1ZOV A;  4APN A;  1UKV G;  2GMH A;  2WEU A;  2JAE A;  1DJQ A;  3UP5 A;  1O95 A;  2APG A;  1DNC A;  2NPX A;  1QJD A;  3M0O A;  2V6O A;  3R9U A;  2EQ8 A;  1BF3 A;  3T31 A;  4WCT A;  3UTF A;  3V3O A;  2XFO A;  1JNZ A;  4LII A;  4AP1 A;  1PBE A;  4EMJ A;  5CKU A;  2YVF A;  3VRD B;  2XFU A;  1RSG A;  2GVC A;  4B68 A;  1CC6 A;  1D4D A;  2Y6R A;  3AE8 A;  4NEW A;  5U63 A;  4O5Q A;  5JCI A;  1XHC A;  3AED A;  4C5O A;  1GEU A;  5TR3 A;  1D7Y A;  3ZDN A;  4B67 A;  4YTP A;  5KMS A;  1ZK7 A;  4BV6 A;  4U8I A;  1ZMC A;  1VDC A;  3C4N A;  3CNP A;  1E6E A;  1GRG A;  2WOI A;  3GMB A;  3KU9 A;  2CFY A;  4H4S A;  4TM3 A;  4JY2 A;  4USQ A;  3OC4 A;  1S3B A;  3FG2 P;  1BGN A;  3GYX A;  4OPD A;  1JU2 A;  1KSU A;  2A8X A;  2C7G A;  2DKI A;  2V3A A;  2JB1 A;  3I6D A;  3QFB A;  5GSN A;  1H7X A;  1L9C A;  4B64 A;  3NT6 A;  4YSH A;  3DJE A;  1PBF A;  3M12 A;  1CL0 A;  1CJ4 A;  3H4K A;  3H8I A;  2WBA A;  2B7S A;  4G9K A;  4FK1 A;  3CPH G;  2VQ7 A;  1IUT A;  3SGL A;  4EMW A;  2Q6U A;  5FS8 A;  4ZCD A;  1PJ7 A;  2C70 A;  5KNL A;  3AEA A;  1OJC A;  3GDP A;  5M0Z A;  3C96 A;  2CUL A;  4TM0 A;  2YLT A;  2YVG A;  3DH9 A;  2WU5 A;  4CCR A;  1VRQ B;  4H2Q A;  3URH A;  5FS6 A;  5KWF A;  1MXT A;  3HYX A;  1Y0P A;  2CDU A;  2NVK X;  3ZYX A;  2ACZ A;  4EMI A;  1H83 A;  4AOX A;  3CN8 A;  3NLC A;  1N4V A;  1REO A;  2GR3 A;  4J36 A;  4TLZ A;  4USR A;  1BWC A;  3GMC A;  1L9D A;  3PVC A;  4LA1 A;  4BK1 A;  2B9X A;  4NWZ A;  2IVE A;  1CBO A;  3UKF A;  2GB0 A;  4H2P A;  3KA7 A;  4GCM A;  3SYI A;  4HB9 A;  4K7Z A;  5JCN A;  2XCG A;  2YVJ A;  3LAD A;  1P2H A;  3UCL A;  3VR9 A;  3L1R A;  4GDP A;  1KDG A;  5IQ4 A;  1YKJ A;  2X50 A;  1ZMD A;  2Q0K A;  1P2E A;  2V5Z A;  1NEK A;  2FJE A;  1D4C A;  2C64 A;  2YLR A;  2YQU A;  3NHO X;  2GAH B;  1BKW A;  5L46 A;  4U8P A;  3UTE A;  1GES A;  5EOW A;  4Y4N A;  4NTD A;  3M13 A;  4U8K A;  4A6N B;  2ZZB A;  3DK9 A;  1KSS A;  3DME A;  5KVH A;  3UKP A;  2VVM A;  5HXI A;  2BK5 A;  3SY4 A;  3DJG X;  2C72 A;  2X8G A;  3GRT A;  3LXD A;  1RP0 A;  3NYE A;  2BXR A;  2QAE A;  3CND A;  3PS9 A;  4YTM A;  1LTX R;  4A7A A;  4YXD A;  2C65 A;  2E4G A;  4OPI A;  1M6I A;  3NNE A;  2CVJ A;  2VOU A;  3D8X A;  2GMJ A;  4K5S A;  1ELI A;  1H86 A;  4FX9 A;  3AYL A;  3WE0 A;  2Z5Y A;  4YKG A;  2GAG B;  1ZKQ A;  1DOC A;  4IA6 A;  3ABV A;  3NTA A;  1TDO A;  4IVM B;  2XVJ A;  2IID A;  4EQS A;  1PJ6 A;  2A87 A;  3AE3 A;  1Q9I A;  2F5Z A;  3LB8 A;  2EQ7 A;  2Q7V A;  2WDQ A;  5ER0 A;  2WOV A;  1YQZ A;  2B7R A;  3DK4 A;  3KPF A;  4YTN A;  3VR8 A;  3SM8 A;  3G5R A;  1FEA A;  4ECH A;  1H82 A;  2BAB A;  3AE1 A;  2ARD A;  4H2R A;  4YKF A;  3AYI A;  2BXS A;  2J3N A;  3FIM B;  1BGJ A;  4G6G A;  5KRQ A;  3DGH A;  3VQR A;  2B76 A;  2WOW A;  4GDE A;  3KKJ A;  2GR1 A;  2TPR A;  1EL7 A;  3ATR A;  4H4T A;  4J34 A;  2OA1 A;  2R46 A;  4H4U A;  2XVH A;  4NTE A;  1Y56 A;  2V61 A;  3P4Q A;  2YR4 A;  3CNT A;  4AT2 A;  1GRA A;  3AWI A;  2TMD A;  3IWA A;  4JN9 A;  4BJZ A;  1GXF A;  1TDN A;  2XYO A;  3RP6 A;  4A65 A;  3GDN A;  4EIQ A;  4A99 A;  1VG0 A;  4ZCC A;  3T37 A;  4GRT A;  3IC9 A;  1HYU A;  2H88 A;  3L8K A;  4C3X A;  2QA1 A;  1D7L A;  1JOA A;  1GRH A;  3LOV A;  3P4P A;  2R9Z A;  4YSX A;  2YG3 A;  4Z2R A;  4IVO B;  3GWF A;  3UKA A;  3UOX A;  4EIP A;  3T2K A;  3E1T A;  2XVF A;  4H4V A;  2RGO A;  3UKL A;  4OPU A;  3BNU A;  3ICR A;  3QVP A;  2AAQ A;  5BRT A;  2YAU A;  3NN0 X;  4NTC A;  4J31 A;  1GTH A;  1TYT A;  3CNJ A;  4H4X A;  4B1B A;  1H7W A;  1KNR A;  4U8L A;  5JCK A;  5KMR A;  2GEW A;  3NK1 X;  1GRE A;  1V59 A;  4YT0 A;  1VG9 A;  2YR5 A;  2YLZ A;  4A5L A;  3QSM A;  1AOG A;  4XWZ A;  3FMW A;  1CJ2 A;  2A89 A;  5KOX A;  3SZW A;  4P9S A;  1JRX A;  4H50 A;  4J57 A;  4H4Z A;  2JK6 A;  4A6N A;  2C3C A;  3AE6 A;  2BA9 A;  4H7U A;  2B9Y A;  1XPQ A;  4U8J A;  3HYW A;  2XVE A;  1B5Q A;  2R0C A;  2YG5 A;  1Y56 B;  5IQ1 A;  4BJY A;  1XAN A;  1Q1W A;  3K7M X;  4A79 A;  2BCP A;  3SZC A;  1PJ5 A;  4XWR A;  4Z25 A;  2EQ6 A;  1NAA A;  4FK1 C;  3AEG A;  1K4Q A;  4TLX A;  2X3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...