3K7TA

Crystal structure of apo-form 6-hydroxy-l-nicotine oxidase, crystal form p3121
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 117
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7tA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7tA02
3FMWA 3COXA 4H50A 2Y6RA 1GT8A 3NYCA 4YKFA 2XLPA 2XDOA 2XCGA 2JAEA 3S61A 3UP4A 3AWIA 4NEVA 5KOWA 2WPCA 2YLZA 2RGOA 4GDPA 1CJ2A 1L9CA 3GDPA 3AE2A 5KRQA 4J56A 2VRLA 4OPGA 4EQRA 3UKKA 2OA1A 4CNJA 3UTEA 2YM2A 2I0ZA 1E39A 1KSUA 2TPRA 2YLSA 1PDHA 1CBOA 2X8CA 2OAMA 4IA5A 4BK2A 3QVRA 1EL7A 5JCKA 1CHUA 2QAEA 3AE9A 4GR1A 1Q9IA 1ZX9A 2FBWA 2VQ7A 2GVCA 1L9DA 3UTGA 1RSGA 3AE5A 2NPXA 2YG4A 1DXLA 4HB9A 2Z5XA 1FL2A 2QA1A 2R46A 2YQUA 4K5RA 3B3RA 2WPEA 3QFAA 3Q6JA 4YTPA 1GRFA 3UKLA 5EB4A 4U8PA 4J34A 4A5LA 1AOGA 2GRTA 2WU2A 2GAGB 1GTEA 3GD4A 3PO7A 4H4WA 2C7GA 1PXCA 3CNPA 4ICYA 3AE6A 4B64A 1VQWA 3GDNA 1MOKA 4NTCA 1B37A 3NYFA 3VR9A 3CGBA 1NENA 4OPCA 3NLCA 1SEZA 1TDFA 2VRMA 1IUTA 2C76A 2XVIA 4LU6A 1B5QA 1PJ7A 3LB8A 1LJ1A 2GB0A 4XXGA 3CGEA 1PJ5A 4U2SA 1FEBA 1LPFA 4TM0A 3VRBA 3AEDA 1LQUA 1ZY8A 4BJZA 3NIXA 2BXSA 3AEEA 4UDPA 5C2TA 1XDIA 3K30A 2BK3A 1GV4A 1OJDA 4ADWA 3CPHG 4Z26A 1DODA 2X8GA 2JB3A 3NTAA 3V3NA 3ICRA 1QJDA 2WOWA 2XVEA 3FPZA 1GREA 3AD7B 3QVPA 2BK5A 4JQ9A 3UP5A 4I58A 4X9MA 4CRTA 3NT6A 3G5SA 2YR5A 1Y56B 2IVDA 2B7RA 4B66A 3EAOA 1N4VA 2VVLA 3L1RA 4KX6A 1TYPA 5IPYA 2GQFA 3GYJA 2YLTA 3LZWA 4I59A 2GR3A 3CTYA 3KVEA 1H7XA 4KPRA 4JY3A 4U2TA 5FS9A 1VG0A 1FOHA 5IQ1A 3QSEA 2X50A 4J33A 4EMWA 5KWFA 4YXDA 3M12A 3IWAA 3CGDA 1REOA 3VRDB 3LJPA 1RP0A 3DJGX 2C75A 4IA6A 1VDCA 4LA1A 1L0VA 4PAAA 2WDRA 3ATQA 4H4PA 2CULA 2R4EA 4Z2RA 3KA7A 2JKCA 5KVHA 3D8XA 4OPUA 2WOIA 1NHRA 3AYIA 3DK8A 4JNQA 2QCUA 1XANA 4AT0A 4YT0A 1D4CA 1E1NA 1EL9A 1NPXA 1PN0A 2YR6A 3GMBA 2C65A 2GMJA 2BACA 4M52A 3KD9A 1H81A 1CC4A 2YG5A 1E1MA 1FECA 5GRTA 1PBDA 4ECHA 3UKPA 5C3JA 2YWLA 1NG3A 3DJEA 1B8SA 3GWDA 3BNMA 2BS3A 4O5UA 2NVKX 4H4TA 3ATRA 4U8LA 4IV9A 2GEWA 4Z2UA 1K0IA 2YAUA 3H4KA 4AOXA 1CC6A 1FCDA 2BC0A 5FS6A 3NN6X 4USRA 4J31A 1K4QA 1IUXA 2C67A 2WESA 2YM1A 5M0ZA 4D04A 4D03A 5TR3A 1CJ4A 1W4XA 4H4XA 4EIQA 1VRQB 1OJCA 1XPQA 5BUKA 2GR1A 2HQMA 2ZZ0A 4YTMA 4XWRA 3AYLA 1K0LA 4Y4LA 4C3XA 2BCGG 2GAHB 3NKSA 2WOVA 2R0GA 3SFEA 4B1BA 5LV9A 1F8WA 4B65A 3B6DA 3T37A 4UDRA 4CCRA 1DOBA 1JRXA 1S2QA 5U63A 1FEAA 4B67A 3DJJA 2J3NA 1M64A 3V76A 1X31B 1GALA 3KPFA 4A65A 1TDEA 1E1LA 3GSIA 5FS7A 3EANA 3FG2P 3GRTA 5KXJA 3G5RA 3L8KA 2Y6QA 2A87A 2VQBA 2VZ2A 2C72A 3LOVA 2PHHA 5ER0A 2C73A 2X8HA 2Q6UA 1IUWA 2B7SA 3GD3A 4K8DA 1TDKA 1JNZA 1Y56A 5JCNA 2JBVA 4JY2A 1JRZA 2C64A 3NHOX 3F8DA 3H8LA 3NGCX 4IVMB 4OPTA 2XFOA 3VQRA 1GRBA 5HYMA 1BF3A 1NHPA 3BI4A 4GRTA 4JNAA 1F8RA 1PBCA 4CNKA 1DJNA 4EMJA 1D5TA 1CJ3A 1GXFA 3ISHA 1KFYA 5CKUA 3UKHA 4EM4A 2WHDA 1F3PA 1H84A 2XVJA 1P2HA 3ALLA 3LADA 4CY8A 4A6NB 2WETA 3ABVA 1ZP0A 3K7TA 1D7LA 4OCGA 3UOZA 1V59A 1BWCA 3PS9A 4O5QA 2ACZA 5HHFA 4Z25A 4H2NA 2C3DA 3QJ4A 3AE8A 4FK1C 1PS9A 3C96A 3LXDA 2AQJA 3AEAA 3AXBA 4ZN0A 3O0HA 2OLOA 2Z5YA 4MJWA 3SQPA 5HY5A 1ZMDA 4GDEA 4NEWA 2YG3A 3UKQA 4BK1A 2EQ7A 1P2EA 1ZMCA 3ALJA 1O94A 3GWFA 4ZCCA 3P4SA 4H4UA 2XFUA 3QSMA 3ZDNA 4K5SA 2BABA 4Z44A 2BK4A 1F6MA 4U2LA 3QSSA 4JDRA 4NTDA 5J7XA 4APNA 1ZKQA 1CF3A 3NK2X 5U1OA 4OVIA 4BURA 1PXBA 1VG9A 1JOAA 2E5VA 1S3BA 1LQTA 3DGZA 3RHAA 2A8XA 4DSHA 4H4VA 2YVGA 2JK6A 3CGCA 3QFBA 3ADAB 4J2WA 3V3OA 2C70A 1BGNA 3AEBA 3KKJA 1EL5A 3UTFA 4H2PA 4A9WA 1E6EA 3NYEA 1JRYA 2CVJA 2R9ZA 4OPDA 3KU9A 4EMIA 3NN0X 3K7MX 1E7PA 2GV8A 1PHHA 2XVFA 2YVFA 4H4YA 1GSNA 3II4A 4AOSA 4TLZA 3E1TA 1QO8A 1JEHA 1GRTA 4XWZA 1PJ6A 1GETA 3ICSA 3KLJA 2RGHA 4C5OA 1ZDLA 2YG7A 4K2XA 2DKHA 3NTDA 2WQYA 4USQA 4EQXA 4IVOB 1O5WA 3VRAA 1H82A 2RABA 1QLBA 2R45A 2XFPA 1UKVG 3UOXA 1GRGA 3CNSA 1NHQA 3F8RA 4GCMA 3RP7A 1CL0A 2EQ6A 2BYBA 4B69A 1DOEA 2YLXA 4X4JA 1Z6LA 5BULA 1NEKA 1GRHA 1MXTA 2FJAA 3BNUA 3LZXA 3BI2A 2B9YA 3UTHA 2VOUA 4GUVA 3DA1A 3DK9A 2JB2A 4DGKA 2DKIA 3I3LA 3AD8B 2WP9A 1IJHA 3NH3X 3P4PA 3AECA 5EB5A 1PBFA 2ZBWA 3AYJA 3OZ2A 3S5WA 3SM8A 2F5ZA 4A7AA 4YSZA 4YTNA 3URHA 1OJTA 1S2YA 4DNAA 1ZK7A 1GPEA 2V5ZA 2XFNA 3M0OA 5CQFA 4C3YA 5BRTA 3NG7X 5J60A 2Q7VA 2X99A 2OLNA 4A6NA 3OC4A 5U25A 1CC2A 4B68A 3G5QA 2WPFA 1YKJA 2XLUA 1COYA 4YSHA 1F8SA 1KNPA 4OPLA 4YWOA 2XLSA 3DH9A 3DGHA 1ZOYA 2CDUA 3CNJA 3P1WA 3H8IA 1NDAA 3M13A 4TM3A 2B9WA 3ZYXA 3UKFA 2V3BA 3C4AA 1NAAA 1Q1WA 4J36A 1ONFA 1O95A 4Z43A 4U8KA 4U8IA 5KVIA 2H88A 2GR2A 4JN9A 4YSYA 5JCMA 1GESA 2CFYA 4NZHA 1TDNA 1OJ9A 4GF7A 4H4ZA 4YSXA 2YLWA 2E1MA 2QA2A 4J57A 1NHSA 2WDVA 3D1CA 1EL8A 4H4RA 4A79A 4H4QA 3AE1A 4H2RA 4BV6A 4C77A 4RG3A 4FK1A 2JB1A 3ICTA 1NG4A 2EQ8A 4P9SA 3GRSA 4EQWA 3CPJG 1LTXR 4H7UA 3UOYA 5JCLA 1RYIA 3F8PA 1Q1RA 3CNDA 1ELIA 2BS4A 2XFQA 5EBKA 2GF3A 3GYIA 3HZLA 4YKGA 1BGJA 1YQ3A 1K0JA 1JU2A 3BHFA 1DJQA 1HYUA 4FX9A 4A99A 1TDOA 2WS3A 3CPIG 3EPTA 4ZCDA 2V3AA 2APGA 5HXIA 2E4GA 1Y0PA 1KF6A 5IQ4A 4RG4A 3SFDA 2W0HA 3IHGA 1H86A 3NRNA 2PYXA 4B63A 3P4RA 1E1KA 3GMCA 4UP3A 5JCIA 1LVLA 1N1PA 1DNCA 1YQZA 3RP6A 2ARDA 4EQSA 1N4UA 3CN8A 2WDQA 3NK0X 4LIIA 5M10A 5KOXA 1YQ4A 2RGJA 2YR4A 3FIMB 3PVCA 4AP3A 4K22A 4U8MA 2UZZA 3I6DA 2B9XA 1KNRA 1KSSA 2R4JA 4WCTA 2BA9A 2GR0A 3IF9A 3EF6A 3NK1X 4U8OA 4AP1A 3P9UA 1PXAA 2YLRA 2ZZCA 4H4SA 5L46A 4TLXA 2FJDA 3AB1A 2IIDA 1TYTA 4TM1A 2WU5A 3DK4A 2C66A 2XYOA 2Q0KA 2WP5A 1IUSA 4BK3A 4AT2A 4HA6A 4PABA 2AR8A 2X3NA 3JSKA 1D4DA 1H6VA 3ALMA 2Q0LA 2FJBA 2XLTA 4CY6A 3REDA 2VVMA 2ZZBA 2A89A 2V61A 3AE7A 5DBJA 1D4EA 1GERA 1XHCA 2BS2A 4RSLA 4Z2TA 2XVHA 2AAQA 2H89A 4H2QA 2VVLG 4Y4MA 3VR8A 1DOCA 3ITJA 3BHKA 1JNRA 2BXRA 2GQWA 3AEGA 3CIRA 4U8NA 2C3CA 4NTEA 3Q9TA 3DMEA 1N4WA 3RP8A 1BZLA 1D7YA 3C4NA 1GNDA 3SGLA 3BI5A 3UCLA 1MO9A 2WBAA 2BC1A 3UOVA 2WEUA 3CNTA 4WX1A 3WE0A 4C74A 4E0VA 5FMHA 1BKWA 2IVEA 1S3EA 1GOSA 1OJAA 3AD9B 4FDCB 1IUUA 1TRBA 3AE4A 1ZOVA 3R9UA 2YG6A 3IHMA 1B4VA 2B76A 1H83A 1PBEA 3DJDA 3NNEA 4EM3A 2V6OA 3UKAA 2GMHA 5GSNA 3RNMA 2WP6A 3AEFA 4UDQA 1YY5A 2OALA 2GH5A 3K7QX 4U8JA 4DSGA 2BCPA 4K7ZA 4BJYA 3IC9A 2EQ9A 4EIPA 3FBSA 1H7WA 1CJCA 1KDGA 2O9ZA 1M6IA 1EBDA 4X9NA 4Y4NA 2R0PA 2FJEA 1GTHA 2YVJA 5FS8A 2R0CA 3P4QA 1PBBA 1GRAA 4N9XA 4Z24A 1L9EA 4OPIA 4TM4A 4REKA 4CBQA 1LV0A 5EOWA 1IUVA 2XLRA 3AE3A 2V60A 2TMDA 4CCQA 1GEUA 5BVAA
chains in the Genus database with same CATH superfamily
3FMWA 3COXA 4H50A 2Y6RA 1GT8A 3NYCA 4YKFA 2XLPA 2XDOA 2XCGA 2JAEA 3S61A 3UP4A 3AWIA 4NEVA 5KOWA 2WPCA 2YLZA 2RGOA 4GDPA 1CJ2A 1L9CA 3GDPA 3AE2A 5KRQA 4J56A 2VRLA 4OPGA 4EQRA 3UKKA 2OA1A 4CNJA 3UTEA 2YM2A 2I0ZA 1E39A 1KSUA 2TPRA 2YLSA 1PDHA 1CBOA 2X8CA 2OAMA 4IA5A 4BK2A 3QVRA 1EL7A 5JCKA 1CHUA 2QAEA 3AE9A 4GR1A 1Q9IA 1ZX9A 2FBWA 2VQ7A 2GVCA 1L9DA 3UTGA 1RSGA 3AE5A 2NPXA 2YG4A 1DXLA 4HB9A 2Z5XA 1FL2A 2QA1A 2R46A 2YQUA 4K5RA 3SZ0A 3B3RA 2WPEA 3QFAA 3Q6JA 4GAPA 1GRFA 3UKLA 5EB4A 4U8PA 4J34A 4A5LA 4YTPA 2GRTA 2WU2A 2GAGB 1GTEA 3GD4A 3PO7A 4H4WA 2C7GA 1PXCA 3CNPA 4ICYA 3AE6A 4B64A 1VQWA 3GDNA 1MOKA 4NTCA 1B37A 3NYFA 3VR9A 3CGBA 1NENA 4OPCA 3NLCA 1SEZA 1TDFA 2VRMA 1IUTA 2C76A 2XVIA 4LU6A 3T2ZA 1B5QA 1PJ7A 3LB8A 1LJ1A 2GB0A 4XXGA 3CGEA 1PJ5A 3T2YA 4U2SA 1FEBA 1LPFA 3KPKA 4TM0A 3AEDA 3VRBA 1LQUA 1ZY8A 4BJZA 3NIXA 2BXSA 3AEEA 4UDPA 4NWZA 5C2TA 1XDIA 3K30A 2BK3A 1GV4A 1OJDA 4ADWA 3CPHG 4Z26A 1DODA 2X8GA 2JB3A 3NTAA 3V3NA 3ICRA 1QJDA 2WOWA 2XVEA 3FPZA 1GREA 3AD7B 3QVPA 2BK5A 4JQ9A 3UP5A 4I58A 4X9MA 4CRTA 3NT6A 3G5SA 2YR5A 1Y56B 2IVDA 2B7RA 4B66A 3EAOA 1N4VA 2VVLA 3L1RA 4KX6A 1TYPA 3HYWA 5IPYA 2GQFA 3GYJA 2YLTA 3LZWA 4I59A 2GR3A 3CTYA 4G9KA 3KVEA 1H7XA 4KPRA 4JY3A 4U2TA 5FS9A 1VG0A 1FOHA 5IQ1A 3QSEA 2X50A 4J33A 4EMWA 5KWFA 4YXDA 3M12A 3IWAA 3CGDA 1REOA 3VRDB 3LJPA 1RP0A 3DJGX 2C75A 4IA6A 1VDCA 4LA1A 3SZFA 1L0VA 4PAAA 2WDRA 3ATQA 4H4PA 2CULA 2R4EA 4Z2RA 3KA7A 2JKCA 4G73A 5KVHA 3D8XA 4OPUA 2WOIA 1NHRA 3AYIA 3DK8A 4JNQA 2QCUA 1XANA 4AT0A 4YT0A 1D4CA 1E1NA 1EL9A 1NPXA 1PN0A 2YR6A 3GMBA 2C65A 2GMJA 2BACA 4M52A 3KD9A 1H81A 1CC4A 2YG5A 1E1MA 1FECA 5GRTA 1PBDA 3T14A 4ECHA 3UKPA 5C3JA 2YWLA 1NG3A 3DJEA 1B8SA 3GWDA 3BNMA 2BS3A 4O5UA 2NVKX 4H4TA 3ATRA 4U8LA 4IV9A 2GEWA 4Z2UA 1K0IA 2YAUA 3H4KA 4AOXA 1CC6A 1FCDA 2BC0A 5FS6A 3NN6X 4USRA 4J31A 1K4QA 1IUXA 2C67A 2WESA 2YM1A 5M0ZA 4D04A 4D03A 5TR3A 1CJ4A 1W4XA 4H4XA 4EIQA 1VRQB 1OJCA 1XPQA 5BUKA 2GR1A 2HQMA 2ZZ0A 4YTMA 4XWRA 3AYLA 1K0LA 4Y4LA 4C3XA 2BCGG 2GAHB 3NKSA 2WOVA 2R0GA 3SFEA 4B1BA 5LV9A 1F8WA 4B65A 5KNLA 3B6DA 3T37A 4UDRA 4CCRA 1DOBA 1JRXA 1S2QA 5U63A 1FEAA 4B67A 3DJJA 2J3NA 1M64A 3V76A 1X31B 1GALA 3KPFA 4A65A 1TDEA 1E1LA 3GSIA 5FS7A 2BRAA 4G74A 3EANA 3FG2P 3GRTA 5KXJA 3G5RA 3L8KA 2Y6QA 2A87A 2VQBA 2VZ2A 2C72A 3LOVA 2PHHA 5ER0A 2C73A 2X8HA 2Q6UA 1IUWA 5KMSA 2B7SA 3GD3A 4K8DA 1TDKA 1JNZA 4NNJA 1Y56A 5JCNA 2JBVA 4JY2A 1JRZA 2C64A 3NHOX 3F8DA 3H8LA 3NGCX 4IVMB 4OPTA 2XFOA 3VQRA 1GRBA 5HYMA 1BF3A 1NHPA 3BI4A 4GRTA 4JNAA 1F8RA 1PBCA 4CNKA 1DJNA 4EMJA 1D5TA 1CJ3A 1GXFA 3ISHA 1KFYA 3T0KA 5CKUA 3UKHA 4EM4A 2WHDA 1F3PA 1H84A 2XVJA 1P2HA 3ALLA 3LADA 4CY8A 4A6NB 2WETA 3ABVA 1ZP0A 3K7TA 1D7LA 4OCGA 3UOZA 1V59A 1BWCA 3PS9A 4O5QA 2ACZA 5HHFA 3SXIA 4Z25A 4H2NA 2C3DA 3QJ4A 3AE8A 4FK1C 1PS9A 3C96A 3LXDA 2AQJA 3AEAA 3AXBA 4ZN0A 3O0HA 2OLOA 2Z5YA 4MJWA 3SQPA 5HY5A 1ZMDA 4GDEA 4NEWA 2YG3A 3UKQA 4BK1A 3SY4A 2EQ7A 1P2EA 1ZMCA 3ALJA 1O94A 3GWFA 4ZCCA 3P4SA 4H4UA 2XFUA 3QSMA 3ZDNA 4K5SA 2BABA 4Z44A 2BK4A 1F6MA 4U2LA 3QSSA 4JDRA 4NTDA 5J7XA 4APNA 5KMPA 1ZKQA 1CF3A 3NK2X 5U1OA 4OVIA 4BURA 1PXBA 1VG9A 1JOAA 2E5VA 1S3BA 1LQTA 3DGZA 3RHAA 2A8XA 3T31A 4DSHA 4H4VA 2YVGA 2JK6A 3CGCA 3QFBA 3ADAB 4J2WA 3V3OA 2C70A 1BGNA 3AEBA 3KKJA 1EL5A 3UTFA 4H2PA 4A9WA 1E6EA 3NYEA 1JRYA 2CVJA 2R9ZA 4OPDA 3KU9A 4EMIA 3NN0X 3K7MX 1E7PA 2GV8A 1PHHA 2XVFA 2YVFA 4H4YA 1GSNA 3II4A 4AOSA 4TLZA 3E1TA 1QO8A 1JEHA 1GRTA 4XWZA 3SZWA 1PJ6A 1GETA 3ICSA 3SYIA 3KLJA 2RGHA 4C5OA 1ZDLA 2YG7A 4K2XA 2DKHA 3NTDA 2WQYA 4USQA 4EQXA 4IVOB 1O5WA 3VRAA 1H82A 2RABA 1QLBA 4G6HA 2R45A 2XFPA 1UKVG 2C4CA 3UOXA 1GRGA 3CNSA 1NHQA 3F8RA 4GCMA 3RP7A 1CL0A 2EQ6A 2BYBA 4B69A 1DOEA 2YLXA 4X4JA 1Z6LA 2BRYA 5BULA 1NEKA 1GRHA 1MXTA 2FJAA 3BNUA 3LZXA 3BI2A 2B9YA 3UTHA 2VOUA 4GUVA 3DA1A 3DK9A 2JB2A 4DGKA 2DKIA 1AOGA 3I3LA 3AD8B 2WP9A 1IJHA 3NH3X 3P4PA 3AECA 5EB5A 1PBFA 2ZBWA 3AYJA 3OZ2A 3S5WA 3SM8A 2F5ZA 4A7AA 4YSZA 4YTNA 3URHA 1OJTA 1S2YA 4DNAA 1ZK7A 1GPEA 2V5ZA 2XFNA 3M0OA 5CQFA 4C3YA 5BRTA 3NG7X 5J60A 2Q7VA 2X99A 2OLNA 4A6NA 3OC4A 5U25A 1CC2A 4B68A 3G5QA 2WPFA 1YKJA 2XLUA 1COYA 4YSHA 1F8SA 1KNPA 3CMMA 4OPLA 4YWOA 2XLSA 3DH9A 3DGHA 1ZOYA 2CDUA 3CNJA 3P1WA 3H8IA 1NDAA 3M13A 4TM3A 2B9WA 3ZYXA 3UKFA 2V3BA 3C4AA 1NAAA 1Q1WA 4J36A 1ONFA 1O95A 4Z43A 4U8KA 4U8IA 5KVIA 2H88A 2GR2A 4JN9A 4YSYA 5JCMA 1GESA 2CFYA 4NZHA 1TDNA 1OJ9A 4GF7A 4H4ZA 4YSXA 2YLWA 2E1MA 2QA2A 4J57A 3SZCA 1NHSA 2WDVA 3D1CA 1EL8A 4H4RA 4A79A 4H4QA 3AE1A 4H2RA 4BV6A 4C77A 4RG3A 4FK1A 2JB1A 3ICTA 1NG4A 2EQ8A 4P9SA 3GRSA 4EQWA 3CPJG 1LTXR 4H7UA 3UOYA 5JCLA 1RYIA 3F8PA 1Q1RA 3CNDA 1ELIA 2BS4A 2XFQA 5KMQA 5EBKA 2GF3A 3GYIA 3HZLA 4YKGA 1BGJA 1YQ3A 1K0JA 1JU2A 3BHFA 1DJQA 1HYUA 4FX9A 4A99A 1TDOA 2WS3A 3CPIG 3EPTA 4G6GA 4ZCDA 2V3AA 2APGA 5HXIA 2E4GA 1Y0PA 1KF6A 5IQ4A 4RG4A 3SFDA 2W0HA 3IHGA 1H86A 3NRNA 2PYXA 4B63A 3P4RA 1E1KA 3GMCA 4UP3A 5JCIA 1LVLA 1N1PA 1DNCA 1YQZA 3RP6A 2ARDA 4EQSA 1N4UA 3CN8A 2WDQA 3NK0X 4LIIA 5M10A 5KOXA 1YQ4A 2RGJA 2YR4A 3FIMB 3PVCA 4AP3A 4K22A 4U8MA 2UZZA 3I6DA 2B9XA 1KNRA 4GAVA 1KSSA 2R4JA 4WCTA 2BA9A 2GR0A 3IF9A 3EF6A 3T2KA 3NK1X 4U8OA 4AP1A 3P9UA 1PXAA 2YLRA 2ZZCA 4H4SA 5L46A 4TLXA 2FJDA 3AB1A 2IIDA 1TYTA 4TM1A 2WU5A 3DK4A 2C66A 2XYOA 2Q0KA 2WP5A 1IUSA 4BK3A 4AT2A 4HA6A 3SX6A 4PABA 2AR8A 2X3NA 3JSKA 1D4DA 3HYVA 1H6VA 3ALMA 5KMRA 2Q0LA 2FJBA 2XLTA 4CY6A 3REDA 2VVMA 2ZZBA 2A89A 2V61A 3AE7A 5DBJA 1D4EA 1GERA 1XHCA 2BS2A 4RSLA 4Z2TA 2XVHA 2AAQA 2H89A 4H2QA 2VVLG 4Y4MA 3VR8A 1DOCA 3ITJA 3BHKA 1JNRA 2BXRA 2GQWA 3AEGA 3CIRA 4U8NA 2C3CA 4NTEA 3Q9TA 3DMEA 1N4WA 3RP8A 1BZLA 1D7YA 3C4NA 1GNDA 3SGLA 3BI5A 3UCLA 1MO9A 2WBAA 2BC1A 3UOVA 2WEUA 3CNTA 4WX1A 3WE0A 4C74A 4E0VA 5FMHA 1BKWA 2IVEA 1S3EA 1GOSA 1OJAA 3AD9B 4FDCB 1IUUA 1TRBA 3AE4A 1ZOVA 3R9UA 2YG6A 3IHMA 1B4VA 2B76A 1H83A 1PBEA 3DJDA 3GYXA 3NNEA 2V6OA 4II3A 4EM3A 3UKAA 2GMHA 5GSNA 3RNMA 2WP6A 3AEFA 3HYXA 4UDQA 1YY5A 2OALA 2GH5A 3K7QX 4U8JA 4DSGA 2BCPA 4K7ZA 4BJYA 3IC9A 2EQ9A 4EIPA 3FBSA 1H7WA 1CJCA 1KDGA 2O9ZA 1M6IA 1EBDA 4X9NA 4Y4NA 2R0PA 2FJEA 1GTHA 2YVJA 5FS8A 2R0CA 3P4QA 1PBBA 1GRAA 4N9XA 4Z24A 1L9EA 4OPIA 4TM4A 4REKA 4CBQA 1LV0A 5EOWA 4II2A 1IUVA 2XLRA 3AE3A 2V60A 2TMDA 4CCQA 1GEUA 5BVAA
chains in the Genus database with same CATH topology
3FMWA 3COXA 4H50A 2Y6RA 1GT8A 3NYCA 4YKFA 2XLPA 2XDOA 2XCGA 2JAEA 3S61A 3UP4A 3AWIA 4NEVA 5KOWA 2WPCA 2YLZA 2RGOA 4GDPA 1CJ2A 1L9CA 3GDPA 3AE2A 5KRQA 4J56A 2VRLA 4OPGA 4EQRA 3UKKA 2OA1A 4CNJA 3UTEA 2YM2A 2I0ZA 1E39A 1KSUA 2TPRA 2YLSA 1PDHA 1CBOA 2X8CA 2OAMA 4IA5A 4BK2A 3QVRA 1EL7A 5JCKA 1CHUA 2QAEA 3AE9A 4GR1A 1Q9IA 1ZX9A 2FBWA 2VQ7A 2GVCA 1L9DA 3UTGA 1RSGA 3AE5A 2NPXA 2YG4A 1DXLA 4HB9A 2Z5XA 1FL2A 2QA1A 2R46A 2YQUA 4K5RA 3SZ0A 3B3RA 2WPEA 3QFAA 3Q6JA 4GAPA 1GRFA 3UKLA 5EB4A 4U8PA 4J34A 4A5LA 4YTPA 2GRTA 2WU2A 2GAGB 1GTEA 3GD4A 3PO7A 4H4WA 2C7GA 1PXCA 3CNPA 4ICYA 3AE6A 4B64A 1VQWA 3GDNA 1MOKA 4NTCA 1B37A 3NYFA 3VR9A 3CGBA 1NENA 4OPCA 3NLCA 1SEZA 1TDFA 2VRMA 1IUTA 2C76A 2XVIA 4LU6A 3T2ZA 1B5QA 1PJ7A 3LB8A 1LJ1A 2GB0A 4XXGA 3CGEA 1PJ5A 3T2YA 4U2SA 1FEBA 1LPFA 3KPKA 4TM0A 3AEDA 3VRBA 1LQUA 1ZY8A 4BJZA 3NIXA 2BXSA 3AEEA 4UDPA 4NWZA 5C2TA 1XDIA 3K30A 2BK3A 1GV4A 1OJDA 4ADWA 3CPHG 4Z26A 1DODA 2X8GA 2JB3A 3NTAA 3V3NA 3ICRA 1QJDA 2WOWA 2XVEA 3FPZA 1GREA 3AD7B 3QVPA 2BK5A 4JQ9A 3UP5A 4I58A 4X9MA 4CRTA 3NT6A 3G5SA 2YR5A 1Y56B 2IVDA 2B7RA 4B66A 3EAOA 1N4VA 2VVLA 3L1RA 4KX6A 1TYPA 3HYWA 5IPYA 2GQFA 3GYJA 2YLTA 3LZWA 4I59A 2GR3A 3CTYA 4G9KA 3KVEA 1H7XA 4KPRA 4JY3A 4U2TA 5FS9A 1VG0A 1FOHA 5IQ1A 3QSEA 2X50A 4J33A 4EMWA 5KWFA 4YXDA 3M12A 3IWAA 3CGDA 1REOA 3VRDB 3LJPA 1RP0A 3DJGX 2C75A 4IA6A 1VDCA 4LA1A 3SZFA 1L0VA 4PAAA 2WDRA 3ATQA 4H4PA 2CULA 2R4EA 4Z2RA 3KA7A 2JKCA 4G73A 5KVHA 3D8XA 4OPUA 2WOIA 1NHRA 3AYIA 3DK8A 4JNQA 2QCUA 1XANA 4AT0A 4YT0A 1D4CA 1E1NA 1EL9A 1NPXA 1PN0A 2YR6A 3GMBA 2C65A 2GMJA 2BACA 4M52A 3KD9A 1H81A 1CC4A 2YG5A 1E1MA 1FECA 5GRTA 1PBDA 3T14A 4ECHA 3UKPA 5C3JA 2YWLA 1NG3A 3DJEA 1B8SA 3GWDA 3BNMA 2BS3A 4O5UA 2NVKX 4H4TA 3ATRA 4U8LA 4IV9A 2GEWA 4Z2UA 1K0IA 2YAUA 3H4KA 4AOXA 1CC6A 1FCDA 2BC0A 5FS6A 3NN6X 4USRA 4J31A 1K4QA 1IUXA 2C67A 2WESA 2YM1A 5M0ZA 4D04A 4D03A 5TR3A 1CJ4A 1W4XA 4H4XA 4EIQA 1VRQB 1OJCA 1XPQA 5BUKA 2GR1A 2HQMA 2ZZ0A 4YTMA 4XWRA 3AYLA 1K0LA 4Y4LA 4C3XA 2BCGG 2GAHB 3NKSA 2WOVA 2R0GA 3SFEA 4B1BA 5LV9A 1F8WA 4B65A 5KNLA 3B6DA 3T37A 4UDRA 4CCRA 1DOBA 1JRXA 1S2QA 5U63A 1FEAA 4B67A 3DJJA 2J3NA 1M64A 3V76A 1X31B 1GALA 3KPFA 4A65A 1TDEA 1E1LA 3GSIA 5FS7A 2BRAA 4G74A 3EANA 3FG2P 3GRTA 5KXJA 3G5RA 3L8KA 2Y6QA 2A87A 2VQBA 2VZ2A 2C72A 3LOVA 2PHHA 5ER0A 2C73A 2X8HA 2Q6UA 1IUWA 5KMSA 2B7SA 3GD3A 4K8DA 1TDKA 1JNZA 4NNJA 1Y56A 5JCNA 2JBVA 4JY2A 1JRZA 2C64A 3NHOX 3F8DA 3H8LA 3NGCX 4IVMB 4OPTA 2XFOA 3VQRA 1GRBA 5HYMA 1BF3A 1NHPA 3BI4A 4GRTA 4JNAA 1F8RA 1PBCA 4CNKA 1DJNA 4EMJA 1D5TA 1CJ3A 1GXFA 3ISHA 1KFYA 3T0KA 5CKUA 3UKHA 4EM4A 2WHDA 1F3PA 1H84A 2XVJA 1P2HA 3ALLA 3LADA 4CY8A 4A6NB 2WETA 3ABVA 1ZP0A 3K7TA 1D7LA 4OCGA 3UOZA 1V59A 1BWCA 3PS9A 4O5QA 2ACZA 5HHFA 3SXIA 4Z25A 4H2NA 2C3DA 3QJ4A 3AE8A 4FK1C 1PS9A 3C96A 3LXDA 2AQJA 3AEAA 3AXBA 4ZN0A 3O0HA 2OLOA 2Z5YA 4MJWA 3SQPA 5HY5A 1ZMDA 4GDEA 4NEWA 2YG3A 3UKQA 4BK1A 3SY4A 2EQ7A 1P2EA 1ZMCA 3ALJA 1O94A 3GWFA 4ZCCA 3P4SA 4H4UA 2XFUA 3QSMA 3ZDNA 4K5SA 2BABA 4Z44A 2BK4A 1F6MA 4U2LA 3QSSA 4JDRA 4NTDA 5J7XA 4APNA 5KMPA 1ZKQA 1CF3A 3NK2X 5U1OA 4OVIA 4BURA 1PXBA 1VG9A 1JOAA 2E5VA 1S3BA 1LQTA 3DGZA 3RHAA 2A8XA 3T31A 4DSHA 4H4VA 2YVGA 2JK6A 3CGCA 3QFBA 3ADAB 4J2WA 3V3OA 2C70A 1BGNA 3AEBA 3KKJA 1EL5A 3UTFA 4H2PA 4A9WA 1E6EA 3NYEA 1JRYA 2CVJA 2R9ZA 4OPDA 3KU9A 4EMIA 3NN0X 3K7MX 1E7PA 2GV8A 1PHHA 2XVFA 2YVFA 4H4YA 1GSNA 3II4A 4AOSA 4TLZA 3E1TA 1QO8A 1JEHA 1GRTA 4XWZA 3SZWA 1PJ6A 1GETA 3ICSA 3SYIA 3KLJA 2RGHA 4C5OA 1ZDLA 2YG7A 4K2XA 2DKHA 3NTDA 2WQYA 4USQA 4EQXA 4IVOB 1O5WA 3VRAA 1H82A 2RABA 1QLBA 4G6HA 2R45A 2XFPA 1UKVG 2C4CA 3UOXA 1GRGA 3CNSA 1NHQA 3F8RA 4GCMA 3RP7A 1CL0A 2EQ6A 2BYBA 4B69A 1DOEA 2YLXA 4X4JA 1Z6LA 2BRYA 5BULA 1NEKA 1GRHA 1MXTA 2FJAA 3BNUA 3LZXA 3BI2A 2B9YA 3UTHA 2VOUA 4GUVA 3DA1A 3DK9A 2JB2A 4DGKA 2DKIA 1AOGA 3I3LA 3AD8B 2WP9A 1IJHA 3NH3X 3P4PA 3AECA 5EB5A 1PBFA 2ZBWA 3AYJA 3OZ2A 3S5WA 3SM8A 2F5ZA 4A7AA 4YSZA 4YTNA 3URHA 1OJTA 1S2YA 4DNAA 1ZK7A 1GPEA 2V5ZA 2XFNA 3M0OA 5CQFA 4C3YA 5BRTA 3NG7X 5J60A 2Q7VA 2X99A 2OLNA 4A6NA 3OC4A 5U25A 1CC2A 4B68A 3G5QA 2WPFA 1YKJA 2XLUA 1COYA 4YSHA 1F8SA 1KNPA 3CMMA 4OPLA 4YWOA 2XLSA 3DH9A 3DGHA 1ZOYA 2CDUA 3CNJA 3P1WA 3H8IA 1NDAA 3M13A 4TM3A 2B9WA 3ZYXA 3UKFA 2V3BA 3C4AA 1NAAA 1Q1WA 4J36A 1ONFA 1O95A 4Z43A 4U8KA 4U8IA 5KVIA 2H88A 2GR2A 4JN9A 4YSYA 5JCMA 1GESA 2CFYA 4NZHA 1TDNA 1OJ9A 4GF7A 4H4ZA 4YSXA 2YLWA 2E1MA 2QA2A 4J57A 3SZCA 1NHSA 2WDVA 3D1CA 1EL8A 4H4RA 4A79A 4H4QA 3AE1A 4H2RA 4BV6A 4C77A 4RG3A 4FK1A 2JB1A 3ICTA 1NG4A 2EQ8A 4P9SA 3GRSA 4EQWA 3CPJG 1LTXR 4H7UA 3UOYA 5JCLA 1RYIA 3F8PA 1Q1RA 3CNDA 1ELIA 2BS4A 2XFQA 5KMQA 5EBKA 2GF3A 3GYIA 3HZLA 4YKGA 1BGJA 1YQ3A 1K0JA 1JU2A 3BHFA 1DJQA 1HYUA 4FX9A 4A99A 1TDOA 2WS3A 3CPIG 3EPTA 4G6GA 4ZCDA 2V3AA 2APGA 5HXIA 2E4GA 1Y0PA 1KF6A 5IQ4A 4RG4A 3SFDA 2W0HA 3IHGA 1H86A 3NRNA 2PYXA 4B63A 3P4RA 1E1KA 3GMCA 4UP3A 5JCIA 1LVLA 1N1PA 1DNCA 1YQZA 3RP6A 2ARDA 4EQSA 1N4UA 3CN8A 2WDQA 3NK0X 4LIIA 5M10A 5KOXA 1YQ4A 2RGJA 2YR4A 3FIMB 3PVCA 4AP3A 4K22A 4U8MA 2UZZA 3I6DA 2B9XA 1KNRA 4GAVA 1KSSA 2R4JA 4WCTA 2BA9A 2GR0A 3IF9A 3EF6A 3T2KA 3NK1X 4U8OA 4AP1A 3P9UA 1PXAA 2YLRA 2ZZCA 4H4SA 5L46A 4TLXA 2FJDA 3AB1A 2IIDA 1TYTA 4TM1A 2WU5A 3DK4A 2C66A 2XYOA 2Q0KA 2WP5A 1IUSA 4BK3A 4AT2A 4HA6A 3SX6A 4PABA 2AR8A 2X3NA 3JSKA 1D4DA 3HYVA 1H6VA 3ALMA 5KMRA 2Q0LA 2FJBA 2XLTA 4CY6A 3REDA 2VVMA 2ZZBA 2A89A 2V61A 3AE7A 5DBJA 1D4EA 1GERA 1XHCA 2BS2A 4RSLA 4Z2TA 2XVHA 2AAQA 2H89A 4H2QA 2VVLG 4Y4MA 3VR8A 1DOCA 3ITJA 3BHKA 1JNRA 2BXRA 2GQWA 3AEGA 3CIRA 4U8NA 2C3CA 4NTEA 3Q9TA 3DMEA 1N4WA 3RP8A 1BZLA 1D7YA 3C4NA 1GNDA 3SGLA 3BI5A 3UCLA 1MO9A 2WBAA 2BC1A 3UOVA 2WEUA 3CNTA 4WX1A 3WE0A 4C74A 4E0VA 5FMHA 1BKWA 2IVEA 1S3EA 1GOSA 1OJAA 3AD9B 4FDCB 1IUUA 1TRBA 3AE4A 1ZOVA 3R9UA 2YG6A 3IHMA 1B4VA 2B76A 1H83A 1PBEA 3DJDA 3GYXA 3NNEA 2V6OA 4II3A 4EM3A 3UKAA 2GMHA 5GSNA 3RNMA 2WP6A 3AEFA 3HYXA 4UDQA 1YY5A 2OALA 2GH5A 3K7QX 4U8JA 4DSGA 2BCPA 4K7ZA 4BJYA 3IC9A 2EQ9A 4EIPA 3FBSA 1H7WA 1CJCA 1KDGA 2O9ZA 1M6IA 1EBDA 4X9NA 4Y4NA 2R0PA 2FJEA 1GTHA 2YVJA 5FS8A 2R0CA 3P4QA 1PBBA 1GRAA 4N9XA 4Z24A 1L9EA 4OPIA 4TM4A 4REKA 4CBQA 1LV0A 5EOWA 4II2A 1IUVA 2XLRA 3AE3A 2V60A 2TMDA 4CCQA 1GEUA 5BVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMW A;  3COX A;  4H50 A;  2Y6R A;  1GT8 A;  3NYC A;  4YKF A;  2XLP A;  2XDO A;  2XCG A;  2JAE A;  3S61 A;  3UP4 A;  3AWI A;  4NEV A;  5KOW A;  2WPC A;  2YLZ A;  2RGO A;  4GDP A;  1CJ2 A;  1L9C A;  3GDP A;  3AE2 A;  5KRQ A;  4J56 A;  2VRL A;  4OPG A;  4EQR A;  3UKK A;  2OA1 A;  4CNJ A;  3UTE A;  2YM2 A;  2I0Z A;  1E39 A;  1KSU A;  2TPR A;  2YLS A;  1PDH A;  1CBO A;  2X8C A;  2OAM A;  4IA5 A;  4BK2 A;  3QVR A;  1EL7 A;  5JCK A;  1CHU A;  2QAE A;  3AE9 A;  4GR1 A;  1Q9I A;  1ZX9 A;  2FBW A;  2VQ7 A;  2GVC A;  1L9D A;  3UTG A;  1RSG A;  3AE5 A;  2NPX A;  2YG4 A;  1DXL A;  4HB9 A;  2Z5X A;  1FL2 A;  2QA1 A;  2R46 A;  2YQU A;  4K5R A;  3B3R A;  2WPE A;  3QFA A;  3Q6J A;  4YTP A;  1GRF A;  3UKL A;  5EB4 A;  4U8P A;  4J34 A;  4A5L A;  1AOG A;  2GRT A;  2WU2 A;  2GAG B;  1GTE A;  3GD4 A;  3PO7 A;  4H4W A;  2C7G A;  1PXC A;  3CNP A;  4ICY A;  3AE6 A;  4B64 A;  1VQW A;  3GDN A;  1MOK A;  4NTC A;  1B37 A;  3NYF A;  3VR9 A;  3CGB A;  1NEN A;  4OPC A;  3NLC A;  1SEZ A;  1TDF A;  2VRM A;  1IUT A;  2C76 A;  2XVI A;  4LU6 A;  1B5Q A;  1PJ7 A;  3LB8 A;  1LJ1 A;  2GB0 A;  4XXG A;  3CGE A;  1PJ5 A;  4U2S A;  1FEB A;  1LPF A;  4TM0 A;  3VRB A;  3AED A;  1LQU A;  1ZY8 A;  4BJZ A;  3NIX A;  2BXS A;  3AEE A;  4UDP A;  5C2T A;  1XDI A;  3K30 A;  2BK3 A;  1GV4 A;  1OJD A;  4ADW A;  3CPH G;  4Z26 A;  1DOD A;  2X8G A;  2JB3 A;  3NTA A;  3V3N A;  3ICR A;  1QJD A;  2WOW A;  2XVE A;  3FPZ A;  1GRE A;  3AD7 B;  3QVP A;  2BK5 A;  4JQ9 A;  3UP5 A;  4I58 A;  4X9M A;  4CRT A;  3NT6 A;  3G5S A;  2YR5 A;  1Y56 B;  2IVD A;  2B7R A;  4B66 A;  3EAO A;  1N4V A;  2VVL A;  3L1R A;  4KX6 A;  1TYP A;  5IPY A;  2GQF A;  3GYJ A;  2YLT A;  3LZW A;  4I59 A;  2GR3 A;  3CTY A;  3KVE A;  1H7X A;  4KPR A;  4JY3 A;  4U2T A;  5FS9 A;  1VG0 A;  1FOH A;  5IQ1 A;  3QSE A;  2X50 A;  4J33 A;  4EMW A;  5KWF A;  4YXD A;  3M12 A;  3IWA A;  3CGD A;  1REO A;  3VRD B;  3LJP A;  1RP0 A;  3DJG X;  2C75 A;  4IA6 A;  1VDC A;  4LA1 A;  1L0V A;  4PAA A;  2WDR A;  3ATQ A;  4H4P A;  2CUL A;  2R4E A;  4Z2R A;  3KA7 A;  2JKC A;  5KVH A;  3D8X A;  4OPU A;  2WOI A;  1NHR A;  3AYI A;  3DK8 A;  4JNQ A;  2QCU A;  1XAN A;  4AT0 A;  4YT0 A;  1D4C A;  1E1N A;  1EL9 A;  1NPX A;  1PN0 A;  2YR6 A;  3GMB A;  2C65 A;  2GMJ A;  2BAC A;  4M52 A;  3KD9 A;  1H81 A;  1CC4 A;  2YG5 A;  1E1M A;  1FEC A;  5GRT A;  1PBD A;  4ECH A;  3UKP A;  5C3J A;  2YWL A;  1NG3 A;  3DJE A;  1B8S A;  3GWD A;  3BNM A;  2BS3 A;  4O5U A;  2NVK X;  4H4T A;  3ATR A;  4U8L A;  4IV9 A;  2GEW A;  4Z2U A;  1K0I A;  2YAU A;  3H4K A;  4AOX A;  1CC6 A;  1FCD A;  2BC0 A;  5FS6 A;  3NN6 X;  4USR A;  4J31 A;  1K4Q A;  1IUX A;  2C67 A;  2WES A;  2YM1 A;  5M0Z A;  4D04 A;  4D03 A;  5TR3 A;  1CJ4 A;  1W4X A;  4H4X A;  4EIQ A;  1VRQ B;  1OJC A;  1XPQ A;  5BUK A;  2GR1 A;  2HQM A;  2ZZ0 A;  4YTM A;  4XWR A;  3AYL A;  1K0L A;  4Y4L A;  4C3X A;  2BCG G;  2GAH B;  3NKS A;  2WOV A;  2R0G A;  3SFE A;  4B1B A;  5LV9 A;  1F8W A;  4B65 A;  3B6D A;  3T37 A;  4UDR A;  4CCR A;  1DOB A;  1JRX A;  1S2Q A;  5U63 A;  1FEA A;  4B67 A;  3DJJ A;  2J3N A;  1M64 A;  3V76 A;  1X31 B;  1GAL A;  3KPF A;  4A65 A;  1TDE A;  1E1L A;  3GSI A;  5FS7 A;  3EAN A;  3FG2 P;  3GRT A;  5KXJ A;  3G5R A;  3L8K A;  2Y6Q A;  2A87 A;  2VQB A;  2VZ2 A;  2C72 A;  3LOV A;  2PHH A;  5ER0 A;  2C73 A;  2X8H A;  2Q6U A;  1IUW A;  2B7S A;  3GD3 A;  4K8D A;  1TDK A;  1JNZ A;  1Y56 A;  5JCN A;  2JBV A;  4JY2 A;  1JRZ A;  2C64 A;  3NHO X;  3F8D A;  3H8L A;  3NGC X;  4IVM B;  4OPT A;  2XFO A;  3VQR A;  1GRB A;  5HYM A;  1BF3 A;  1NHP A;  3BI4 A;  4GRT A;  4JNA A;  1F8R A;  1PBC A;  4CNK A;  1DJN A;  4EMJ A;  1D5T A;  1CJ3 A;  1GXF A;  3ISH A;  1KFY A;  5CKU A;  3UKH A;  4EM4 A;  2WHD A;  1F3P A;  1H84 A;  2XVJ A;  1P2H A;  3ALL A;  3LAD A;  4CY8 A;  4A6N B;  2WET A;  3ABV A;  1ZP0 A;  3K7T A;  1D7L A;  4OCG A;  3UOZ A;  1V59 A;  1BWC A;  3PS9 A;  4O5Q A;  2ACZ A;  5HHF A;  4Z25 A;  4H2N A;  2C3D A;  3QJ4 A;  3AE8 A;  4FK1 C;  1PS9 A;  3C96 A;  3LXD A;  2AQJ A;  3AEA A;  3AXB A;  4ZN0 A;  3O0H A;  2OLO A;  2Z5Y A;  4MJW A;  3SQP A;  5HY5 A;  1ZMD A;  4GDE A;  4NEW A;  2YG3 A;  3UKQ A;  4BK1 A;  2EQ7 A;  1P2E A;  1ZMC A;  3ALJ A;  1O94 A;  3GWF A;  4ZCC A;  3P4S A;  4H4U A;  2XFU A;  3QSM A;  3ZDN A;  4K5S A;  2BAB A;  4Z44 A;  2BK4 A;  1F6M A;  4U2L A;  3QSS A;  4JDR A;  4NTD A;  5J7X A;  4APN A;  1ZKQ A;  1CF3 A;  3NK2 X;  5U1O A;  4OVI A;  4BUR A;  1PXB A;  1VG9 A;  1JOA A;  2E5V A;  1S3B A;  1LQT A;  3DGZ A;  3RHA A;  2A8X A;  4DSH A;  4H4V A;  2YVG A;  2JK6 A;  3CGC A;  3QFB A;  3ADA B;  4J2W A;  3V3O A;  2C70 A;  1BGN A;  3AEB A;  3KKJ A;  1EL5 A;  3UTF A;  4H2P A;  4A9W A;  1E6E A;  3NYE A;  1JRY A;  2CVJ A;  2R9Z A;  4OPD A;  3KU9 A;  4EMI A;  3NN0 X;  3K7M X;  1E7P A;  2GV8 A;  1PHH A;  2XVF A;  2YVF A;  4H4Y A;  1GSN A;  3II4 A;  4AOS A;  4TLZ A;  3E1T A;  1QO8 A;  1JEH A;  1GRT A;  4XWZ A;  1PJ6 A;  1GET A;  3ICS A;  3KLJ A;  2RGH A;  4C5O A;  1ZDL A;  2YG7 A;  4K2X A;  2DKH A;  3NTD A;  2WQY A;  4USQ A;  4EQX A;  4IVO B;  1O5W A;  3VRA A;  1H82 A;  2RAB A;  1QLB A;  2R45 A;  2XFP A;  1UKV G;  3UOX A;  1GRG A;  3CNS A;  1NHQ A;  3F8R A;  4GCM A;  3RP7 A;  1CL0 A;  2EQ6 A;  2BYB A;  4B69 A;  1DOE A;  2YLX A;  4X4J A;  1Z6L A;  5BUL A;  1NEK A;  1GRH A;  1MXT A;  2FJA A;  3BNU A;  3LZX A;  3BI2 A;  2B9Y A;  3UTH A;  2VOU A;  4GUV A;  3DA1 A;  3DK9 A;  2JB2 A;  4DGK A;  2DKI A;  3I3L A;  3AD8 B;  2WP9 A;  1IJH A;  3NH3 X;  3P4P A;  3AEC A;  5EB5 A;  1PBF A;  2ZBW A;  3AYJ A;  3OZ2 A;  3S5W A;  3SM8 A;  2F5Z A;  4A7A A;  4YSZ A;  4YTN A;  3URH A;  1OJT A;  1S2Y A;  4DNA A;  1ZK7 A;  1GPE A;  2V5Z A;  2XFN A;  3M0O A;  5CQF A;  4C3Y A;  5BRT A;  3NG7 X;  5J60 A;  2Q7V A;  2X99 A;  2OLN A;  4A6N A;  3OC4 A;  5U25 A;  1CC2 A;  4B68 A;  3G5Q A;  2WPF A;  1YKJ A;  2XLU A;  1COY A;  4YSH A;  1F8S A;  1KNP A;  4OPL A;  4YWO A;  2XLS A;  3DH9 A;  3DGH A;  1ZOY A;  2CDU A;  3CNJ A;  3P1W A;  3H8I A;  1NDA A;  3M13 A;  4TM3 A;  2B9W A;  3ZYX A;  3UKF A;  2V3B A;  3C4A A;  1NAA A;  1Q1W A;  4J36 A;  1ONF A;  1O95 A;  4Z43 A;  4U8K A;  4U8I A;  5KVI A;  2H88 A;  2GR2 A;  4JN9 A;  4YSY A;  5JCM A;  1GES A;  2CFY A;  4NZH A;  1TDN A;  1OJ9 A;  4GF7 A;  4H4Z A;  4YSX A;  2YLW A;  2E1M A;  2QA2 A;  4J57 A;  1NHS A;  2WDV A;  3D1C A;  1EL8 A;  4H4R A;  4A79 A;  4H4Q A;  3AE1 A;  4H2R A;  4BV6 A;  4C77 A;  4RG3 A;  4FK1 A;  2JB1 A;  3ICT A;  1NG4 A;  2EQ8 A;  4P9S A;  3GRS A;  4EQW A;  3CPJ G;  1LTX R;  4H7U A;  3UOY A;  5JCL A;  1RYI A;  3F8P A;  1Q1R A;  3CND A;  1ELI A;  2BS4 A;  2XFQ A;  5EBK A;  2GF3 A;  3GYI A;  3HZL A;  4YKG A;  1BGJ A;  1YQ3 A;  1K0J A;  1JU2 A;  3BHF A;  1DJQ A;  1HYU A;  4FX9 A;  4A99 A;  1TDO A;  2WS3 A;  3CPI G;  3EPT A;  4ZCD A;  2V3A A;  2APG A;  5HXI A;  2E4G A;  1Y0P A;  1KF6 A;  5IQ4 A;  4RG4 A;  3SFD A;  2W0H A;  3IHG A;  1H86 A;  3NRN A;  2PYX A;  4B63 A;  3P4R A;  1E1K A;  3GMC A;  4UP3 A;  5JCI A;  1LVL A;  1N1P A;  1DNC A;  1YQZ A;  3RP6 A;  2ARD A;  4EQS A;  1N4U A;  3CN8 A;  2WDQ A;  3NK0 X;  4LII A;  5M10 A;  5KOX A;  1YQ4 A;  2RGJ A;  2YR4 A;  3FIM B;  3PVC A;  4AP3 A;  4K22 A;  4U8M A;  2UZZ A;  3I6D A;  2B9X A;  1KNR A;  1KSS A;  2R4J A;  4WCT A;  2BA9 A;  2GR0 A;  3IF9 A;  3EF6 A;  3NK1 X;  4U8O A;  4AP1 A;  3P9U A;  1PXA A;  2YLR A;  2ZZC A;  4H4S A;  5L46 A;  4TLX A;  2FJD A;  3AB1 A;  2IID A;  1TYT A;  4TM1 A;  2WU5 A;  3DK4 A;  2C66 A;  2XYO A;  2Q0K A;  2WP5 A;  1IUS A;  4BK3 A;  4AT2 A;  4HA6 A;  4PAB A;  2AR8 A;  2X3N A;  3JSK A;  1D4D A;  1H6V A;  3ALM A;  2Q0L A;  2FJB A;  2XLT A;  4CY6 A;  3RED A;  2VVM A;  2ZZB A;  2A89 A;  2V61 A;  3AE7 A;  5DBJ A;  1D4E A;  1GER A;  1XHC A;  2BS2 A;  4RSL A;  4Z2T A;  2XVH A;  2AAQ A;  2H89 A;  4H2Q A;  2VVL G;  4Y4M A;  3VR8 A;  1DOC A;  3ITJ A;  3BHK A;  1JNR A;  2BXR A;  2GQW A;  3AEG A;  3CIR A;  4U8N A;  2C3C A;  4NTE A;  3Q9T A;  3DME A;  1N4W A;  3RP8 A;  1BZL A;  1D7Y A;  3C4N A;  1GND A;  3SGL A;  3BI5 A;  3UCL A;  1MO9 A;  2WBA A;  2BC1 A;  3UOV A;  2WEU A;  3CNT A;  4WX1 A;  3WE0 A;  4C74 A;  4E0V A;  5FMH A;  1BKW A;  2IVE A;  1S3E A;  1GOS A;  1OJA A;  3AD9 B;  4FDC B;  1IUU A;  1TRB A;  3AE4 A;  1ZOV A;  3R9U A;  2YG6 A;  3IHM A;  1B4V A;  2B76 A;  1H83 A;  1PBE A;  3DJD A;  3NNE A;  4EM3 A;  2V6O A;  3UKA A;  2GMH A;  5GSN A;  3RNM A;  2WP6 A;  3AEF A;  4UDQ A;  1YY5 A;  2OAL A;  2GH5 A;  3K7Q X;  4U8J A;  4DSG A;  2BCP A;  4K7Z A;  4BJY A;  3IC9 A;  2EQ9 A;  4EIP A;  3FBS A;  1H7W A;  1CJC A;  1KDG A;  2O9Z A;  1M6I A;  1EBD A;  4X9N A;  4Y4N A;  2R0P A;  2FJE A;  1GTH A;  2YVJ A;  5FS8 A;  2R0C A;  3P4Q A;  1PBB A;  1GRA A;  4N9X A;  4Z24 A;  1L9E A;  4OPI A;  4TM4 A;  4REK A;  4CBQ A;  1LV0 A;  5EOW A;  1IUV A;  2XLR A;  3AE3 A;  2V60 A;  2TMD A;  4CCQ A;  1GEU A;  5BVA A; 
#chains in the Genus database with same CATH topology
 3FMW A;  3COX A;  4H50 A;  2Y6R A;  1GT8 A;  3NYC A;  4YKF A;  2XLP A;  2XDO A;  2XCG A;  2JAE A;  3S61 A;  3UP4 A;  3AWI A;  4NEV A;  5KOW A;  2WPC A;  2YLZ A;  2RGO A;  4GDP A;  1CJ2 A;  1L9C A;  3GDP A;  3AE2 A;  5KRQ A;  4J56 A;  2VRL A;  4OPG A;  4EQR A;  3UKK A;  2OA1 A;  4CNJ A;  3UTE A;  2YM2 A;  2I0Z A;  1E39 A;  1KSU A;  2TPR A;  2YLS A;  1PDH A;  1CBO A;  2X8C A;  2OAM A;  4IA5 A;  4BK2 A;  3QVR A;  1EL7 A;  5JCK A;  1CHU A;  2QAE A;  3AE9 A;  4GR1 A;  1Q9I A;  1ZX9 A;  2FBW A;  2VQ7 A;  2GVC A;  1L9D A;  3UTG A;  1RSG A;  3AE5 A;  2NPX A;  2YG4 A;  1DXL A;  4HB9 A;  2Z5X A;  1FL2 A;  2QA1 A;  2R46 A;  2YQU A;  4K5R A;  3SZ0 A;  3B3R A;  2WPE A;  3QFA A;  3Q6J A;  4GAP A;  1GRF A;  3UKL A;  5EB4 A;  4U8P A;  4J34 A;  4A5L A;  4YTP A;  2GRT A;  2WU2 A;  2GAG B;  1GTE A;  3GD4 A;  3PO7 A;  4H4W A;  2C7G A;  1PXC A;  3CNP A;  4ICY A;  3AE6 A;  4B64 A;  1VQW A;  3GDN A;  1MOK A;  4NTC A;  1B37 A;  3NYF A;  3VR9 A;  3CGB A;  1NEN A;  4OPC A;  3NLC A;  1SEZ A;  1TDF A;  2VRM A;  1IUT A;  2C76 A;  2XVI A;  4LU6 A;  3T2Z A;  1B5Q A;  1PJ7 A;  3LB8 A;  1LJ1 A;  2GB0 A;  4XXG A;  3CGE A;  1PJ5 A;  3T2Y A;  4U2S A;  1FEB A;  1LPF A;  3KPK A;  4TM0 A;  3AED A;  3VRB A;  1LQU A;  1ZY8 A;  4BJZ A;  3NIX A;  2BXS A;  3AEE A;  4UDP A;  4NWZ A;  5C2T A;  1XDI A;  3K30 A;  2BK3 A;  1GV4 A;  1OJD A;  4ADW A;  3CPH G;  4Z26 A;  1DOD A;  2X8G A;  2JB3 A;  3NTA A;  3V3N A;  3ICR A;  1QJD A;  2WOW A;  2XVE A;  3FPZ A;  1GRE A;  3AD7 B;  3QVP A;  2BK5 A;  4JQ9 A;  3UP5 A;  4I58 A;  4X9M A;  4CRT A;  3NT6 A;  3G5S A;  2YR5 A;  1Y56 B;  2IVD A;  2B7R A;  4B66 A;  3EAO A;  1N4V A;  2VVL A;  3L1R A;  4KX6 A;  1TYP A;  3HYW A;  5IPY A;  2GQF A;  3GYJ A;  2YLT A;  3LZW A;  4I59 A;  2GR3 A;  3CTY A;  4G9K A;  3KVE A;  1H7X A;  4KPR A;  4JY3 A;  4U2T A;  5FS9 A;  1VG0 A;  1FOH A;  5IQ1 A;  3QSE A;  2X50 A;  4J33 A;  4EMW A;  5KWF A;  4YXD A;  3M12 A;  3IWA A;  3CGD A;  1REO A;  3VRD B;  3LJP A;  1RP0 A;  3DJG X;  2C75 A;  4IA6 A;  1VDC A;  4LA1 A;  3SZF A;  1L0V A;  4PAA A;  2WDR A;  3ATQ A;  4H4P A;  2CUL A;  2R4E A;  4Z2R A;  3KA7 A;  2JKC A;  4G73 A;  5KVH A;  3D8X A;  4OPU A;  2WOI A;  1NHR A;  3AYI A;  3DK8 A;  4JNQ A;  2QCU A;  1XAN A;  4AT0 A;  4YT0 A;  1D4C A;  1E1N A;  1EL9 A;  1NPX A;  1PN0 A;  2YR6 A;  3GMB A;  2C65 A;  2GMJ A;  2BAC A;  4M52 A;  3KD9 A;  1H81 A;  1CC4 A;  2YG5 A;  1E1M A;  1FEC A;  5GRT A;  1PBD A;  3T14 A;  4ECH A;  3UKP A;  5C3J A;  2YWL A;  1NG3 A;  3DJE A;  1B8S A;  3GWD A;  3BNM A;  2BS3 A;  4O5U A;  2NVK X;  4H4T A;  3ATR A;  4U8L A;  4IV9 A;  2GEW A;  4Z2U A;  1K0I A;  2YAU A;  3H4K A;  4AOX A;  1CC6 A;  1FCD A;  2BC0 A;  5FS6 A;  3NN6 X;  4USR A;  4J31 A;  1K4Q A;  1IUX A;  2C67 A;  2WES A;  2YM1 A;  5M0Z A;  4D04 A;  4D03 A;  5TR3 A;  1CJ4 A;  1W4X A;  4H4X A;  4EIQ A;  1VRQ B;  1OJC A;  1XPQ A;  5BUK A;  2GR1 A;  2HQM A;  2ZZ0 A;  4YTM A;  4XWR A;  3AYL A;  1K0L A;  4Y4L A;  4C3X A;  2BCG G;  2GAH B;  3NKS A;  2WOV A;  2R0G A;  3SFE A;  4B1B A;  5LV9 A;  1F8W A;  4B65 A;  5KNL A;  3B6D A;  3T37 A;  4UDR A;  4CCR A;  1DOB A;  1JRX A;  1S2Q A;  5U63 A;  1FEA A;  4B67 A;  3DJJ A;  2J3N A;  1M64 A;  3V76 A;  1X31 B;  1GAL A;  3KPF A;  4A65 A;  1TDE A;  1E1L A;  3GSI A;  5FS7 A;  2BRA A;  4G74 A;  3EAN A;  3FG2 P;  3GRT A;  5KXJ A;  3G5R A;  3L8K A;  2Y6Q A;  2A87 A;  2VQB A;  2VZ2 A;  2C72 A;  3LOV A;  2PHH A;  5ER0 A;  2C73 A;  2X8H A;  2Q6U A;  1IUW A;  5KMS A;  2B7S A;  3GD3 A;  4K8D A;  1TDK A;  1JNZ A;  4NNJ A;  1Y56 A;  5JCN A;  2JBV A;  4JY2 A;  1JRZ A;  2C64 A;  3NHO X;  3F8D A;  3H8L A;  3NGC X;  4IVM B;  4OPT A;  2XFO A;  3VQR A;  1GRB A;  5HYM A;  1BF3 A;  1NHP A;  3BI4 A;  4GRT A;  4JNA A;  1F8R A;  1PBC A;  4CNK A;  1DJN A;  4EMJ A;  1D5T A;  1CJ3 A;  1GXF A;  3ISH A;  1KFY A;  3T0K A;  5CKU A;  3UKH A;  4EM4 A;  2WHD A;  1F3P A;  1H84 A;  2XVJ A;  1P2H A;  3ALL A;  3LAD A;  4CY8 A;  4A6N B;  2WET A;  3ABV A;  1ZP0 A;  3K7T A;  1D7L A;  4OCG A;  3UOZ A;  1V59 A;  1BWC A;  3PS9 A;  4O5Q A;  2ACZ A;  5HHF A;  3SXI A;  4Z25 A;  4H2N A;  2C3D A;  3QJ4 A;  3AE8 A;  4FK1 C;  1PS9 A;  3C96 A;  3LXD A;  2AQJ A;  3AEA A;  3AXB A;  4ZN0 A;  3O0H A;  2OLO A;  2Z5Y A;  4MJW A;  3SQP A;  5HY5 A;  1ZMD A;  4GDE A;  4NEW A;  2YG3 A;  3UKQ A;  4BK1 A;  3SY4 A;  2EQ7 A;  1P2E A;  1ZMC A;  3ALJ A;  1O94 A;  3GWF A;  4ZCC A;  3P4S A;  4H4U A;  2XFU A;  3QSM A;  3ZDN A;  4K5S A;  2BAB A;  4Z44 A;  2BK4 A;  1F6M A;  4U2L A;  3QSS A;  4JDR A;  4NTD A;  5J7X A;  4APN A;  5KMP A;  1ZKQ A;  1CF3 A;  3NK2 X;  5U1O A;  4OVI A;  4BUR A;  1PXB A;  1VG9 A;  1JOA A;  2E5V A;  1S3B A;  1LQT A;  3DGZ A;  3RHA A;  2A8X A;  3T31 A;  4DSH A;  4H4V A;  2YVG A;  2JK6 A;  3CGC A;  3QFB A;  3ADA B;  4J2W A;  3V3O A;  2C70 A;  1BGN A;  3AEB A;  3KKJ A;  1EL5 A;  3UTF A;  4H2P A;  4A9W A;  1E6E A;  3NYE A;  1JRY A;  2CVJ A;  2R9Z A;  4OPD A;  3KU9 A;  4EMI A;  3NN0 X;  3K7M X;  1E7P A;  2GV8 A;  1PHH A;  2XVF A;  2YVF A;  4H4Y A;  1GSN A;  3II4 A;  4AOS A;  4TLZ A;  3E1T A;  1QO8 A;  1JEH A;  1GRT A;  4XWZ A;  3SZW A;  1PJ6 A;  1GET A;  3ICS A;  3SYI A;  3KLJ A;  2RGH A;  4C5O A;  1ZDL A;  2YG7 A;  4K2X A;  2DKH A;  3NTD A;  2WQY A;  4USQ A;  4EQX A;  4IVO B;  1O5W A;  3VRA A;  1H82 A;  2RAB A;  1QLB A;  4G6H A;  2R45 A;  2XFP A;  1UKV G;  2C4C A;  3UOX A;  1GRG A;  3CNS A;  1NHQ A;  3F8R A;  4GCM A;  3RP7 A;  1CL0 A;  2EQ6 A;  2BYB A;  4B69 A;  1DOE A;  2YLX A;  4X4J A;  1Z6L A;  2BRY A;  5BUL A;  1NEK A;  1GRH A;  1MXT A;  2FJA A;  3BNU A;  3LZX A;  3BI2 A;  2B9Y A;  3UTH A;  2VOU A;  4GUV A;  3DA1 A;  3DK9 A;  2JB2 A;  4DGK A;  2DKI A;  1AOG A;  3I3L A;  3AD8 B;  2WP9 A;  1IJH A;  3NH3 X;  3P4P A;  3AEC A;  5EB5 A;  1PBF A;  2ZBW A;  3AYJ A;  3OZ2 A;  3S5W A;  3SM8 A;  2F5Z A;  4A7A A;  4YSZ A;  4YTN A;  3URH A;  1OJT A;  1S2Y A;  4DNA A;  1ZK7 A;  1GPE A;  2V5Z A;  2XFN A;  3M0O A;  5CQF A;  4C3Y A;  5BRT A;  3NG7 X;  5J60 A;  2Q7V A;  2X99 A;  2OLN A;  4A6N A;  3OC4 A;  5U25 A;  1CC2 A;  4B68 A;  3G5Q A;  2WPF A;  1YKJ A;  2XLU A;  1COY A;  4YSH A;  1F8S A;  1KNP A;  3CMM A;  4OPL A;  4YWO A;  2XLS A;  3DH9 A;  3DGH A;  1ZOY A;  2CDU A;  3CNJ A;  3P1W A;  3H8I A;  1NDA A;  3M13 A;  4TM3 A;  2B9W A;  3ZYX A;  3UKF A;  2V3B A;  3C4A A;  1NAA A;  1Q1W A;  4J36 A;  1ONF A;  1O95 A;  4Z43 A;  4U8K A;  4U8I A;  5KVI A;  2H88 A;  2GR2 A;  4JN9 A;  4YSY A;  5JCM A;  1GES A;  2CFY A;  4NZH A;  1TDN A;  1OJ9 A;  4GF7 A;  4H4Z A;  4YSX A;  2YLW A;  2E1M A;  2QA2 A;  4J57 A;  3SZC A;  1NHS A;  2WDV A;  3D1C A;  1EL8 A;  4H4R A;  4A79 A;  4H4Q A;  3AE1 A;  4H2R A;  4BV6 A;  4C77 A;  4RG3 A;  4FK1 A;  2JB1 A;  3ICT A;  1NG4 A;  2EQ8 A;  4P9S A;  3GRS A;  4EQW A;  3CPJ G;  1LTX R;  4H7U A;  3UOY A;  5JCL A;  1RYI A;  3F8P A;  1Q1R A;  3CND A;  1ELI A;  2BS4 A;  2XFQ A;  5KMQ A;  5EBK A;  2GF3 A;  3GYI A;  3HZL A;  4YKG A;  1BGJ A;  1YQ3 A;  1K0J A;  1JU2 A;  3BHF A;  1DJQ A;  1HYU A;  4FX9 A;  4A99 A;  1TDO A;  2WS3 A;  3CPI G;  3EPT A;  4G6G A;  4ZCD A;  2V3A A;  2APG A;  5HXI A;  2E4G A;  1Y0P A;  1KF6 A;  5IQ4 A;  4RG4 A;  3SFD A;  2W0H A;  3IHG A;  1H86 A;  3NRN A;  2PYX A;  4B63 A;  3P4R A;  1E1K A;  3GMC A;  4UP3 A;  5JCI A;  1LVL A;  1N1P A;  1DNC A;  1YQZ A;  3RP6 A;  2ARD A;  4EQS A;  1N4U A;  3CN8 A;  2WDQ A;  3NK0 X;  4LII A;  5M10 A;  5KOX A;  1YQ4 A;  2RGJ A;  2YR4 A;  3FIM B;  3PVC A;  4AP3 A;  4K22 A;  4U8M A;  2UZZ A;  3I6D A;  2B9X A;  1KNR A;  4GAV A;  1KSS A;  2R4J A;  4WCT A;  2BA9 A;  2GR0 A;  3IF9 A;  3EF6 A;  3T2K A;  3NK1 X;  4U8O A;  4AP1 A;  3P9U A;  1PXA A;  2YLR A;  2ZZC A;  4H4S A;  5L46 A;  4TLX A;  2FJD A;  3AB1 A;  2IID A;  1TYT A;  4TM1 A;  2WU5 A;  3DK4 A;  2C66 A;  2XYO A;  2Q0K A;  2WP5 A;  1IUS A;  4BK3 A;  4AT2 A;  4HA6 A;  3SX6 A;  4PAB A;  2AR8 A;  2X3N A;  3JSK A;  1D4D A;  3HYV A;  1H6V A;  3ALM A;  5KMR A;  2Q0L A;  2FJB A;  2XLT A;  4CY6 A;  3RED A;  2VVM A;  2ZZB A;  2A89 A;  2V61 A;  3AE7 A;  5DBJ A;  1D4E A;  1GER A;  1XHC A;  2BS2 A;  4RSL A;  4Z2T A;  2XVH A;  2AAQ A;  2H89 A;  4H2Q A;  2VVL G;  4Y4M A;  3VR8 A;  1DOC A;  3ITJ A;  3BHK A;  1JNR A;  2BXR A;  2GQW A;  3AEG A;  3CIR A;  4U8N A;  2C3C A;  4NTE A;  3Q9T A;  3DME A;  1N4W A;  3RP8 A;  1BZL A;  1D7Y A;  3C4N A;  1GND A;  3SGL A;  3BI5 A;  3UCL A;  1MO9 A;  2WBA A;  2BC1 A;  3UOV A;  2WEU A;  3CNT A;  4WX1 A;  3WE0 A;  4C74 A;  4E0V A;  5FMH A;  1BKW A;  2IVE A;  1S3E A;  1GOS A;  1OJA A;  3AD9 B;  4FDC B;  1IUU A;  1TRB A;  3AE4 A;  1ZOV A;  3R9U A;  2YG6 A;  3IHM A;  1B4V A;  2B76 A;  1H83 A;  1PBE A;  3DJD A;  3GYX A;  3NNE A;  2V6O A;  4II3 A;  4EM3 A;  3UKA A;  2GMH A;  5GSN A;  3RNM A;  2WP6 A;  3AEF A;  3HYX A;  4UDQ A;  1YY5 A;  2OAL A;  2GH5 A;  3K7Q X;  4U8J A;  4DSG A;  2BCP A;  4K7Z A;  4BJY A;  3IC9 A;  2EQ9 A;  4EIP A;  3FBS A;  1H7W A;  1CJC A;  1KDG A;  2O9Z A;  1M6I A;  1EBD A;  4X9N A;  4Y4N A;  2R0P A;  2FJE A;  1GTH A;  2YVJ A;  5FS8 A;  2R0C A;  3P4Q A;  1PBB A;  1GRA A;  4N9X A;  4Z24 A;  1L9E A;  4OPI A;  4TM4 A;  4REK A;  4CBQ A;  1LV0 A;  5EOW A;  4II2 A;  1IUV A;  2XLR A;  3AE3 A;  2V60 A;  2TMD A;  4CCQ A;  1GEU A;  5BVA A; 
#chains in the Genus database with same CATH homology
 3FMW A;  3COX A;  4H50 A;  2Y6R A;  1GT8 A;  3NYC A;  4YKF A;  2XLP A;  2XDO A;  2XCG A;  2JAE A;  3S61 A;  3UP4 A;  3AWI A;  4NEV A;  5KOW A;  2WPC A;  2YLZ A;  2RGO A;  4GDP A;  1CJ2 A;  1L9C A;  3GDP A;  3AE2 A;  5KRQ A;  4J56 A;  2VRL A;  4OPG A;  4EQR A;  3UKK A;  2OA1 A;  4CNJ A;  3UTE A;  2YM2 A;  2I0Z A;  1E39 A;  1KSU A;  2TPR A;  2YLS A;  1PDH A;  1CBO A;  2X8C A;  2OAM A;  4IA5 A;  4BK2 A;  3QVR A;  1EL7 A;  5JCK A;  1CHU A;  2QAE A;  3AE9 A;  4GR1 A;  1Q9I A;  1ZX9 A;  2FBW A;  2VQ7 A;  2GVC A;  1L9D A;  3UTG A;  1RSG A;  3AE5 A;  2NPX A;  2YG4 A;  1DXL A;  4HB9 A;  2Z5X A;  1FL2 A;  2QA1 A;  2R46 A;  2YQU A;  4K5R A;  3SZ0 A;  3B3R A;  2WPE A;  3QFA A;  3Q6J A;  4GAP A;  1GRF A;  3UKL A;  5EB4 A;  4U8P A;  4J34 A;  4A5L A;  4YTP A;  2GRT A;  2WU2 A;  2GAG B;  1GTE A;  3GD4 A;  3PO7 A;  4H4W A;  2C7G A;  1PXC A;  3CNP A;  4ICY A;  3AE6 A;  4B64 A;  1VQW A;  3GDN A;  1MOK A;  4NTC A;  1B37 A;  3NYF A;  3VR9 A;  3CGB A;  1NEN A;  4OPC A;  3NLC A;  1SEZ A;  1TDF A;  2VRM A;  1IUT A;  2C76 A;  2XVI A;  4LU6 A;  3T2Z A;  1B5Q A;  1PJ7 A;  3LB8 A;  1LJ1 A;  2GB0 A;  4XXG A;  3CGE A;  1PJ5 A;  3T2Y A;  4U2S A;  1FEB A;  1LPF A;  3KPK A;  4TM0 A;  3AED A;  3VRB A;  1LQU A;  1ZY8 A;  4BJZ A;  3NIX A;  2BXS A;  3AEE A;  4UDP A;  4NWZ A;  5C2T A;  1XDI A;  3K30 A;  2BK3 A;  1GV4 A;  1OJD A;  4ADW A;  3CPH G;  4Z26 A;  1DOD A;  2X8G A;  2JB3 A;  3NTA A;  3V3N A;  3ICR A;  1QJD A;  2WOW A;  2XVE A;  3FPZ A;  1GRE A;  3AD7 B;  3QVP A;  2BK5 A;  4JQ9 A;  3UP5 A;  4I58 A;  4X9M A;  4CRT A;  3NT6 A;  3G5S A;  2YR5 A;  1Y56 B;  2IVD A;  2B7R A;  4B66 A;  3EAO A;  1N4V A;  2VVL A;  3L1R A;  4KX6 A;  1TYP A;  3HYW A;  5IPY A;  2GQF A;  3GYJ A;  2YLT A;  3LZW A;  4I59 A;  2GR3 A;  3CTY A;  4G9K A;  3KVE A;  1H7X A;  4KPR A;  4JY3 A;  4U2T A;  5FS9 A;  1VG0 A;  1FOH A;  5IQ1 A;  3QSE A;  2X50 A;  4J33 A;  4EMW A;  5KWF A;  4YXD A;  3M12 A;  3IWA A;  3CGD A;  1REO A;  3VRD B;  3LJP A;  1RP0 A;  3DJG X;  2C75 A;  4IA6 A;  1VDC A;  4LA1 A;  3SZF A;  1L0V A;  4PAA A;  2WDR A;  3ATQ A;  4H4P A;  2CUL A;  2R4E A;  4Z2R A;  3KA7 A;  2JKC A;  4G73 A;  5KVH A;  3D8X A;  4OPU A;  2WOI A;  1NHR A;  3AYI A;  3DK8 A;  4JNQ A;  2QCU A;  1XAN A;  4AT0 A;  4YT0 A;  1D4C A;  1E1N A;  1EL9 A;  1NPX A;  1PN0 A;  2YR6 A;  3GMB A;  2C65 A;  2GMJ A;  2BAC A;  4M52 A;  3KD9 A;  1H81 A;  1CC4 A;  2YG5 A;  1E1M A;  1FEC A;  5GRT A;  1PBD A;  3T14 A;  4ECH A;  3UKP A;  5C3J A;  2YWL A;  1NG3 A;  3DJE A;  1B8S A;  3GWD A;  3BNM A;  2BS3 A;  4O5U A;  2NVK X;  4H4T A;  3ATR A;  4U8L A;  4IV9 A;  2GEW A;  4Z2U A;  1K0I A;  2YAU A;  3H4K A;  4AOX A;  1CC6 A;  1FCD A;  2BC0 A;  5FS6 A;  3NN6 X;  4USR A;  4J31 A;  1K4Q A;  1IUX A;  2C67 A;  2WES A;  2YM1 A;  5M0Z A;  4D04 A;  4D03 A;  5TR3 A;  1CJ4 A;  1W4X A;  4H4X A;  4EIQ A;  1VRQ B;  1OJC A;  1XPQ A;  5BUK A;  2GR1 A;  2HQM A;  2ZZ0 A;  4YTM A;  4XWR A;  3AYL A;  1K0L A;  4Y4L A;  4C3X A;  2BCG G;  2GAH B;  3NKS A;  2WOV A;  2R0G A;  3SFE A;  4B1B A;  5LV9 A;  1F8W A;  4B65 A;  5KNL A;  3B6D A;  3T37 A;  4UDR A;  4CCR A;  1DOB A;  1JRX A;  1S2Q A;  5U63 A;  1FEA A;  4B67 A;  3DJJ A;  2J3N A;  1M64 A;  3V76 A;  1X31 B;  1GAL A;  3KPF A;  4A65 A;  1TDE A;  1E1L A;  3GSI A;  5FS7 A;  2BRA A;  4G74 A;  3EAN A;  3FG2 P;  3GRT A;  5KXJ A;  3G5R A;  3L8K A;  2Y6Q A;  2A87 A;  2VQB A;  2VZ2 A;  2C72 A;  3LOV A;  2PHH A;  5ER0 A;  2C73 A;  2X8H A;  2Q6U A;  1IUW A;  5KMS A;  2B7S A;  3GD3 A;  4K8D A;  1TDK A;  1JNZ A;  4NNJ A;  1Y56 A;  5JCN A;  2JBV A;  4JY2 A;  1JRZ A;  2C64 A;  3NHO X;  3F8D A;  3H8L A;  3NGC X;  4IVM B;  4OPT A;  2XFO A;  3VQR A;  1GRB A;  5HYM A;  1BF3 A;  1NHP A;  3BI4 A;  4GRT A;  4JNA A;  1F8R A;  1PBC A;  4CNK A;  1DJN A;  4EMJ A;  1D5T A;  1CJ3 A;  1GXF A;  3ISH A;  1KFY A;  3T0K A;  5CKU A;  3UKH A;  4EM4 A;  2WHD A;  1F3P A;  1H84 A;  2XVJ A;  1P2H A;  3ALL A;  3LAD A;  4CY8 A;  4A6N B;  2WET A;  3ABV A;  1ZP0 A;  3K7T A;  1D7L A;  4OCG A;  3UOZ A;  1V59 A;  1BWC A;  3PS9 A;  4O5Q A;  2ACZ A;  5HHF A;  3SXI A;  4Z25 A;  4H2N A;  2C3D A;  3QJ4 A;  3AE8 A;  4FK1 C;  1PS9 A;  3C96 A;  3LXD A;  2AQJ A;  3AEA A;  3AXB A;  4ZN0 A;  3O0H A;  2OLO A;  2Z5Y A;  4MJW A;  3SQP A;  5HY5 A;  1ZMD A;  4GDE A;  4NEW A;  2YG3 A;  3UKQ A;  4BK1 A;  3SY4 A;  2EQ7 A;  1P2E A;  1ZMC A;  3ALJ A;  1O94 A;  3GWF A;  4ZCC A;  3P4S A;  4H4U A;  2XFU A;  3QSM A;  3ZDN A;  4K5S A;  2BAB A;  4Z44 A;  2BK4 A;  1F6M A;  4U2L A;  3QSS A;  4JDR A;  4NTD A;  5J7X A;  4APN A;  5KMP A;  1ZKQ A;  1CF3 A;  3NK2 X;  5U1O A;  4OVI A;  4BUR A;  1PXB A;  1VG9 A;  1JOA A;  2E5V A;  1S3B A;  1LQT A;  3DGZ A;  3RHA A;  2A8X A;  3T31 A;  4DSH A;  4H4V A;  2YVG A;  2JK6 A;  3CGC A;  3QFB A;  3ADA B;  4J2W A;  3V3O A;  2C70 A;  1BGN A;  3AEB A;  3KKJ A;  1EL5 A;  3UTF A;  4H2P A;  4A9W A;  1E6E A;  3NYE A;  1JRY A;  2CVJ A;  2R9Z A;  4OPD A;  3KU9 A;  4EMI A;  3NN0 X;  3K7M X;  1E7P A;  2GV8 A;  1PHH A;  2XVF A;  2YVF A;  4H4Y A;  1GSN A;  3II4 A;  4AOS A;  4TLZ A;  3E1T A;  1QO8 A;  1JEH A;  1GRT A;  4XWZ A;  3SZW A;  1PJ6 A;  1GET A;  3ICS A;  3SYI A;  3KLJ A;  2RGH A;  4C5O A;  1ZDL A;  2YG7 A;  4K2X A;  2DKH A;  3NTD A;  2WQY A;  4USQ A;  4EQX A;  4IVO B;  1O5W A;  3VRA A;  1H82 A;  2RAB A;  1QLB A;  4G6H A;  2R45 A;  2XFP A;  1UKV G;  2C4C A;  3UOX A;  1GRG A;  3CNS A;  1NHQ A;  3F8R A;  4GCM A;  3RP7 A;  1CL0 A;  2EQ6 A;  2BYB A;  4B69 A;  1DOE A;  2YLX A;  4X4J A;  1Z6L A;  2BRY A;  5BUL A;  1NEK A;  1GRH A;  1MXT A;  2FJA A;  3BNU A;  3LZX A;  3BI2 A;  2B9Y A;  3UTH A;  2VOU A;  4GUV A;  3DA1 A;  3DK9 A;  2JB2 A;  4DGK A;  2DKI A;  1AOG A;  3I3L A;  3AD8 B;  2WP9 A;  1IJH A;  3NH3 X;  3P4P A;  3AEC A;  5EB5 A;  1PBF A;  2ZBW A;  3AYJ A;  3OZ2 A;  3S5W A;  3SM8 A;  2F5Z A;  4A7A A;  4YSZ A;  4YTN A;  3URH A;  1OJT A;  1S2Y A;  4DNA A;  1ZK7 A;  1GPE A;  2V5Z A;  2XFN A;  3M0O A;  5CQF A;  4C3Y A;  5BRT A;  3NG7 X;  5J60 A;  2Q7V A;  2X99 A;  2OLN A;  4A6N A;  3OC4 A;  5U25 A;  1CC2 A;  4B68 A;  3G5Q A;  2WPF A;  1YKJ A;  2XLU A;  1COY A;  4YSH A;  1F8S A;  1KNP A;  3CMM A;  4OPL A;  4YWO A;  2XLS A;  3DH9 A;  3DGH A;  1ZOY A;  2CDU A;  3CNJ A;  3P1W A;  3H8I A;  1NDA A;  3M13 A;  4TM3 A;  2B9W A;  3ZYX A;  3UKF A;  2V3B A;  3C4A A;  1NAA A;  1Q1W A;  4J36 A;  1ONF A;  1O95 A;  4Z43 A;  4U8K A;  4U8I A;  5KVI A;  2H88 A;  2GR2 A;  4JN9 A;  4YSY A;  5JCM A;  1GES A;  2CFY A;  4NZH A;  1TDN A;  1OJ9 A;  4GF7 A;  4H4Z A;  4YSX A;  2YLW A;  2E1M A;  2QA2 A;  4J57 A;  3SZC A;  1NHS A;  2WDV A;  3D1C A;  1EL8 A;  4H4R A;  4A79 A;  4H4Q A;  3AE1 A;  4H2R A;  4BV6 A;  4C77 A;  4RG3 A;  4FK1 A;  2JB1 A;  3ICT A;  1NG4 A;  2EQ8 A;  4P9S A;  3GRS A;  4EQW A;  3CPJ G;  1LTX R;  4H7U A;  3UOY A;  5JCL A;  1RYI A;  3F8P A;  1Q1R A;  3CND A;  1ELI A;  2BS4 A;  2XFQ A;  5KMQ A;  5EBK A;  2GF3 A;  3GYI A;  3HZL A;  4YKG A;  1BGJ A;  1YQ3 A;  1K0J A;  1JU2 A;  3BHF A;  1DJQ A;  1HYU A;  4FX9 A;  4A99 A;  1TDO A;  2WS3 A;  3CPI G;  3EPT A;  4G6G A;  4ZCD A;  2V3A A;  2APG A;  5HXI A;  2E4G A;  1Y0P A;  1KF6 A;  5IQ4 A;  4RG4 A;  3SFD A;  2W0H A;  3IHG A;  1H86 A;  3NRN A;  2PYX A;  4B63 A;  3P4R A;  1E1K A;  3GMC A;  4UP3 A;  5JCI A;  1LVL A;  1N1P A;  1DNC A;  1YQZ A;  3RP6 A;  2ARD A;  4EQS A;  1N4U A;  3CN8 A;  2WDQ A;  3NK0 X;  4LII A;  5M10 A;  5KOX A;  1YQ4 A;  2RGJ A;  2YR4 A;  3FIM B;  3PVC A;  4AP3 A;  4K22 A;  4U8M A;  2UZZ A;  3I6D A;  2B9X A;  1KNR A;  4GAV A;  1KSS A;  2R4J A;  4WCT A;  2BA9 A;  2GR0 A;  3IF9 A;  3EF6 A;  3T2K A;  3NK1 X;  4U8O A;  4AP1 A;  3P9U A;  1PXA A;  2YLR A;  2ZZC A;  4H4S A;  5L46 A;  4TLX A;  2FJD A;  3AB1 A;  2IID A;  1TYT A;  4TM1 A;  2WU5 A;  3DK4 A;  2C66 A;  2XYO A;  2Q0K A;  2WP5 A;  1IUS A;  4BK3 A;  4AT2 A;  4HA6 A;  3SX6 A;  4PAB A;  2AR8 A;  2X3N A;  3JSK A;  1D4D A;  3HYV A;  1H6V A;  3ALM A;  5KMR A;  2Q0L A;  2FJB A;  2XLT A;  4CY6 A;  3RED A;  2VVM A;  2ZZB A;  2A89 A;  2V61 A;  3AE7 A;  5DBJ A;  1D4E A;  1GER A;  1XHC A;  2BS2 A;  4RSL A;  4Z2T A;  2XVH A;  2AAQ A;  2H89 A;  4H2Q A;  2VVL G;  4Y4M A;  3VR8 A;  1DOC A;  3ITJ A;  3BHK A;  1JNR A;  2BXR A;  2GQW A;  3AEG A;  3CIR A;  4U8N A;  2C3C A;  4NTE A;  3Q9T A;  3DME A;  1N4W A;  3RP8 A;  1BZL A;  1D7Y A;  3C4N A;  1GND A;  3SGL A;  3BI5 A;  3UCL A;  1MO9 A;  2WBA A;  2BC1 A;  3UOV A;  2WEU A;  3CNT A;  4WX1 A;  3WE0 A;  4C74 A;  4E0V A;  5FMH A;  1BKW A;  2IVE A;  1S3E A;  1GOS A;  1OJA A;  3AD9 B;  4FDC B;  1IUU A;  1TRB A;  3AE4 A;  1ZOV A;  3R9U A;  2YG6 A;  3IHM A;  1B4V A;  2B76 A;  1H83 A;  1PBE A;  3DJD A;  3GYX A;  3NNE A;  2V6O A;  4II3 A;  4EM3 A;  3UKA A;  2GMH A;  5GSN A;  3RNM A;  2WP6 A;  3AEF A;  3HYX A;  4UDQ A;  1YY5 A;  2OAL A;  2GH5 A;  3K7Q X;  4U8J A;  4DSG A;  2BCP A;  4K7Z A;  4BJY A;  3IC9 A;  2EQ9 A;  4EIP A;  3FBS A;  1H7W A;  1CJC A;  1KDG A;  2O9Z A;  1M6I A;  1EBD A;  4X9N A;  4Y4N A;  2R0P A;  2FJE A;  1GTH A;  2YVJ A;  5FS8 A;  2R0C A;  3P4Q A;  1PBB A;  1GRA A;  4N9X A;  4Z24 A;  1L9E A;  4OPI A;  4TM4 A;  4REK A;  4CBQ A;  1LV0 A;  5EOW A;  4II2 A;  1IUV A;  2XLR A;  3AE3 A;  2V60 A;  2TMD A;  4CCQ A;  1GEU A;  5BVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...