3K7TA

Crystal structure of apo-form 6-hydroxy-l-nicotine oxidase, crystal form p3121
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 117
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7tA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7tA02
1H86A 1L9DA 5EBKA 3UOYA 3KU9A 2DKIA 1CBOA 4AP1A 5TR3A 1CJCA 3AE8A 1QLBA 4EIQA 4J33A 5EB5A 1OJCA 1FEBA 4BJZA 3V76A 1OJAA 2FJEA 4U8KA 4YTPA 1VRQB 3HZLA 5LV9A 4HB9A 3V3OA 3SFDA 3EANA 3URHA 2FBWA 3GDPA 2R9ZA 2YLZA 3NT6A 4YSHA 4IA6A 4H4RA 2X8GA 3OC4A 4ADWA 4H4VA 1B5QA 4USQA 1F6MA 4A6NB 3I3LA 1LTXR 2YWLA 3UTGA 1F8RA 1LQUA 4TM1A 3DGZA 4AOSA 3LZXA 1DOCA 1NAAA 4FK1A 4H2RA 1S2YA 3GD4A 1RYIA 1ZY8A 1FOHA 4TM4A 4YXDA 5FS7A 3NKSA 2GF3A 4EIPA 1GV4A 1OJ9A 1GRHA 1K4QA 1PDHA 3FG2P 3GYJA 3T37A 1YQ3A 3AD7B 2OALA 3H4KA 4BURA 1M64A 3F8PA 1PXAA 4D04A 1O94A 2Y6QA 3AECA 1ZMCA 1ZMDA 2WOWA 5IPYA 2X50A 4XWRA 1PJ7A 4GUVA 1B37A 4IVOB 3B6DA 4EQRA 2FJBA 3CTYA 3NK0X 2FJAA 4APNA 1X31B 2C3CA 1KSSA 3G5RA 1CJ4A 3L1RA 4FDCB 5DBJA 4A79A 2EQ6A 4CY8A 4GRTA 3LXDA 4EQSA 2ZZBA 1GEUA 4GF7A 2RGJA 3COXA 4EM4A 3PVCA 3CNJA 1FL2A 1O95A 4X4JA 2VRMA 3ICTA 4YSZA 5KVIA 1JRZA 2YAUA 1NHQA 2CFYA 4X9NA 5J60A 1GRBA 3IHMA 1H7XA 5JCIA 2GH5A 3VRDB 2BXSA 3FMWA 3UKPA 1DOBA 1KFYA 1GREA 4Z2UA 1DJNA 1D7LA 4GDEA 4CRTA 2C70A 3G5SA 3P4QA 5JCMA 3AD8B 3SGLA 2XFNA 2YR6A 3QSMA 1GALA 1S3EA 1E1MA 4X9MA 2C76A 4U8LA 4H4TA 1DXLA 1ZOYA 4B66A 3CNTA 1KNPA 1QO8A 3M0OA 3NK1X 2Z5XA 2GVCA 2WDQA 2WHDA 4CNKA 1N4WA 2I0ZA 3C96A 4FX9A 3BHKA 4ZCCA 4OPTA 1ZP0A 2JKCA 2X99A 1D7YA 2XVJA 4H2QA 2YLWA 1XHCA 3NN6X 5HHFA 4BJYA 1S2QA 1Y0PA 5FS6A 1LJ1A 1ZK7A 4NTEA 3AEDA 4TM0A 4H50A 3V3NA 1CC2A 2WP6A 3UKFA 4YKFA 4NTCA 5EB4A 4PAAA 5KXJA 2GQFA 1JNRA 4GDPA 3C4AA 2BS3A 4OPDA 3AYLA 4JNAA 3BNMA 3ALMA 3NHOX 2XVIA 2ZBWA 5U1OA 2C7GA 1B4VA 1LPFA 1CHUA 1H6VA 2W0HA 3UTHA 2JK6A 1PBFA 3F8DA 4JN9A 4NEWA 3RP7A 5L46A 2C64A 2V6OA 3QSEA 1IUSA 1PS9A 2VVLA 1PXCA 1L9CA 2YG4A 2GV8A 2Q6UA 2QA2A 4A9WA 2YG3A 4J34A 4EMIA 5KVHA 2BS4A 3Q6JA 1CJ3A 2JB2A 2J3NA 3I6DA 1ONFA 1Y56A 2WETA 3O0HA 2GQWA 3VR8A 1N4VA 3M12A 3CNDA 4AP3A 3Q9TA 2BA9A 2CULA 2C3DA 4UDRA 4K5RA 4XWZA 2YVFA 1MXTA 2BK3A 3NK2X 3QVPA 3RP8A 2YLRA 1ZDLA 4A7AA 4B64A 1Q1RA 3ISHA 1K0LA 1H83A 2E5VA 5JCKA 2XFOA 3REDA 3B3RA 3K30A 4FK1C 2V3BA 3BI2A 1DODA 2Q0LA 4EM3A 2GRTA 4NZHA 4D03A 3IWAA 3NIXA 4U2SA 3AB1A 3QFAA 3NYEA 2R0GA 1L9EA 2H89A 2YR4A 4Z24A 1Z6LA 2Y6RA 5EOWA 4Z43A 4K2XA 1F8WA 4CCRA 2Z5YA 5FS8A 2X8CA 3NTDA 4JDRA 2GR3A 2XFPA 3LB8A 4YTMA 4YKGA 1KDGA 2IIDA 5C2TA 1L0VA 1LV0A 4BV6A 3P1WA 1H81A 2C75A 1YY5A 3LOVA 5KRQA 1FECA 1HYUA 4A99A 3DK4A 4JNQA 1EL8A 1PJ6A 3D8XA 2WP9A 1CL0A 1DOEA 2R4EA 1GRGA 1NG4A 3IHGA 1XPQA 1K0JA 4OPUA 1PJ5A 2YVGA 2WU2A 3GRSA 3S61A 3AE6A 2X8HA 1Q9IA 2YM2A 5C3JA 3AE9A 3ALLA 2UZZA 1NEKA 1BGJA 1N4UA 3NYCA 3UOXA 4C3XA 4M52A 4DSHA 4CCQA 4IA5A 4USRA 1Y56B 3DGHA 3CPIG 1CJ2A 3K7MX 4U2TA 4EQWA 2GAHB 2BABA 3CPJG 1CC6A 4TLXA 2R0CA 4OPIA 3BNUA 1FEAA 3AYIA 2GMHA 3P4RA 3ICRA 1GXFA 5J7XA 3UP5A 4UP3A 4UDQA 3RNMA 5BRTA 3K7QX 2HQMA 3AEAA 4YWOA 2YVJA 5M0ZA 2OLOA 3UKAA 4A5LA 4I58A 4NEVA 1KF6A 4OCGA 3DK8A 5CKUA 1SEZA 2BK5A 4GCMA 1COYA 2Q7VA 4K5SA 2RGOA 1GETA 1JOAA 2WESA 3ZYXA 1NENA 3AYJA 1Q1WA 4LA1A 1BZLA 5CQFA 2GMJA 4K22A 1GTEA 5FS9A 2WS3A 1TYPA 3KPFA 3CPHG 1E6EA 4Z44A 1KSUA 3GDNA 2XLSA 2VZ2A 3GMBA 1MO9A 4H4XA 1TRBA 2XYOA 3ATQA 1NDAA 3IC9A 5GSNA 3ATRA 3BI5A 3NH3X 2V5ZA 4C3YA 3K7TA 4CNJA 3UTFA 3CGBA 3QVRA 3L8KA 3DJJA 3E1TA 5JCLA 2C66A 3DJGX 3NN0X 1E7PA 3GD3A 3GWFA 4H4UA 1NHRA 2WU5A 4Y4MA 2YLXA 2ZZCA 4KPRA 1IUTA 1YQ4A 2JAEA 4B68A 4H4ZA 2XDOA 4LIIA 3QFBA 4N9XA 5GRTA 1JU2A 3GMCA 2YG5A 2C65A 1E39A 2WPEA 4J56A 1P2HA 1VQWA 4AT2A 3DH9A 4Z2TA 2WPCA 4C5OA 4U8OA 2XLRA 2EQ9A 5U63A 1PBDA 3NGCX 1GOSA 4H7UA 1AOGA 4Z25A 1S3BA 3NLCA 3P4SA 2DKHA 2IVDA 1M6IA 2V3AA 2VVLG 1D4CA 2QAEA 2XFUA 2EQ8A 3NNEA 4OPLA 1EL5A 1NHPA 1PBBA 3UP4A 4CY6A 1P2EA 4ZCDA 4A6NA 4C77A 3SM8A 4A65A 5KWFA 2IVEA 4H4PA 4JQ9A 5JCNA 4YSXA 4YTNA 1CF3A 4DGKA 2AAQA 1IUUA 5HY5A 4ICYA 2XCGA 1K0IA 4KX6A 2XFQA 3AEBA 4ZN0A 2B76A 2B7SA 4H2NA 1VG9A 2C67A 4EMWA 4O5QA 1TDKA 1GT8A 2B7RA 2QCUA 3KKJA 2B9YA 4Y4LA 2TMDA 2WP5A 4B67A 3JSKA 2E1MA 4U8NA 3ITJA 1LVLA 4C74A 1JRYA 2B9WA 3KA7A 4JY2A 4OPCA 3CIRA 3C4NA 3AD9B 1D4DA 4HA6A 4Z26A 1GSNA 2ARDA 3CGDA 2XVEA 3FBSA 2WDVA 4MJWA 2AQJA 1B8SA 1DJQA 2GAGB 3AE1A 1TYTA 3KD9A 3KLJA 2XLTA 3AXBA 4J2WA 1KNRA 2BCGG 3GSIA 1O5WA 1EBDA 1PN0A 1PBCA 4OPGA 3M13A 2WDRA 3BHFA 2QA1A 2H88A 1OJDA 2R0PA 4UDPA 5HYMA 1NG3A 4K8DA 2JB3A 2O9ZA 4E0VA 4TLZA 3CNSA 4BK3A 3NG7X 4J36A 2XVHA 1RP0A 2APGA 3H8LA 4U8MA 2PYXA 3DJEA 5KOWA 1GRAA 2C73A 1PXBA 2TPRA 2WPFA 3GWDA 4ECHA 4H4SA 1QJDA 2E4GA 3DK9A 4WCTA 2F5ZA 2WOIA 4B1BA 1GNDA 1GTHA 1ZOVA 1E1NA 1VG0A 2ACZA 4XXGA 3R9UA 3WE0A 4NTDA 1H7WA 3ICSA 4RG4A 3PS9A 2WEUA 4AT0A 4H4QA 4WX1A 4TM3A 1GRTA 1PBEA 2BC0A 1TDEA 1VDCA 2CVJA 1BGNA 2BYBA 1MOKA 1YQZA 2PHHA 2C72A 1TDNA 2V61A 2VQBA 4B65A 2B9XA 1IJHA 4H4WA 1EL7A 1ZX9A 3DA1A 2WQYA 3ALJA 2EQ7A 2R46A 1XANA 3D1CA 1RSGA 4U8PA 2OA1A 1FCDA 1H82A 4J31A 2GEWA 3FPZA 3IF9A 2YLSA 1W4XA 2OLNA 3LJPA 1TDOA 2NVKX 1IUVA 1IUWA 2BC1A 1GESA 3EAOA 2A87A 3EPTA 1ZKQA 4IV9A 5FMHA 3ADAB 4BK1A 1CC4A 5BULA 3UKQA 3AEFA 3UTEA 4J57A 2V60A 4EQXA 2YR5A 5IQ4A 2R45A 4Y4NA 4H2PA 5HXIA 3P4PA 4U2LA 3H8IA 1JNZA 1YKJA 3AEEA 2XLPA 1DNCA 4LU6A 2VVMA 4U8JA 3CGCA 3GRTA 3UOZA 4Z2RA 4OVIA 3AE4A 5BUKA 1GERA 3RP6A 2JB1A 4YSYA 2FJDA 2YQUA 4RG3A 5M10A 2R4JA 5BVAA 3OZ2A 3DJDA 2BACA 2NPXA 2XLUA 2YLTA 2YG6A 2A8XA 3EF6A 4PABA 1E1LA 4B69A 1BWCA 4RSLA 1D5TA 3QSSA 4I59A 2WOVA 1JRXA 1EL9A 3NYFA 3NTAA 3UCLA 3ABVA 2Q0KA 2BXRA 1D4EA 4DSGA 4O5UA 3PO7A 3CGEA 3LADA 3UKHA 4U8IA 4B63A 2OAMA 2RGHA 1PHHA 3P9UA 3S5WA 4AOXA 1ELIA 2GR1A 3F8RA 1BF3A 5U25A 3SFEA 4DNAA 5ER0A 2JBVA 2CDUA 4H4YA 4P9SA 1TDFA 2BCPA 1IUXA 3UKLA 1V59A 5IQ1A 1N1PA 2VOUA 1LQTA 2BS2A 4IVMB 2GR2A 3VR9A 2AR8A 3AE5A 3QJ4A 1BKWA 2RABA 1NPXA 2XVFA 3DMEA 1REOA 3AE2A 3II4A 3FIMB 2VRLA 1UKVG 2GB0A 1E1KA 1JEHA 1OJTA 1GRFA 3ZDNA 4JY3A 3NRNA 4BK2A 3AEGA 3AWIA 4CBQA 4EMJA 1F8SA 2GR0A 2VQ7A 3UOVA 3AE3A 1F3PA 1H84A 3VQRA 3VRBA 3UKKA 5KOXA 2YM1A 3VRAA 3CNPA 3GYIA 1GPEA 4YT0A 3LZWA 2X3NA 3RHAA 3SQPA 3AE7A 1NHSA 3BI4A 2A89A 4GR1A 4REKA 2ZZ0A 3KVEA 1XDIA 4K7ZA 3CN8A 2YG7A 3G5QA 2WBAA 2BK4A
chains in the Genus database with same CATH superfamily
1H86A 1L9DA 5EBKA 3UOYA 3KU9A 2DKIA 1CBOA 4AP1A 5TR3A 1CJCA 3AE8A 1QLBA 4EIQA 4J33A 5EB5A 1OJCA 1FEBA 4BJZA 3V76A 1OJAA 2FJEA 4U8KA 4YTPA 1VRQB 3HZLA 5LV9A 4G74A 4HB9A 3V3OA 3SFDA 3EANA 3URHA 2FBWA 3GDPA 2R9ZA 2YLZA 3NT6A 4YSHA 4IA6A 4H4RA 2X8GA 3OC4A 4ADWA 4H4VA 1B5QA 4USQA 1F6MA 4A6NB 3I3LA 1LTXR 2YWLA 3UTGA 1F8RA 1LQUA 4TM1A 3DGZA 4AOSA 3LZXA 1DOCA 1NAAA 4FK1A 4H2RA 1S2YA 3GD4A 1RYIA 1ZY8A 1FOHA 4TM4A 4YXDA 3GYXA 5FS7A 3NKSA 2GF3A 4EIPA 1GV4A 1OJ9A 1GRHA 1K4QA 1PDHA 3FG2P 3GYJA 3T37A 1YQ3A 3AD7B 2OALA 3H4KA 4BURA 1M64A 3F8PA 1PXAA 4D04A 1O94A 2Y6QA 3AECA 1ZMCA 1ZMDA 2WOWA 5IPYA 2X50A 4XWRA 1PJ7A 4GUVA 1B37A 4IVOB 3B6DA 4EQRA 2FJBA 3CTYA 3NK0X 2FJAA 4APNA 1X31B 2C3CA 1KSSA 3G5RA 1CJ4A 3L1RA 4FDCB 5DBJA 4A79A 2EQ6A 5KMRA 4CY8A 4GRTA 3LXDA 4EQSA 2ZZBA 1GEUA 4GF7A 2RGJA 3SZCA 3COXA 4EM4A 3PVCA 3CNJA 1FL2A 3SZWA 1O95A 4X4JA 2VRMA 3ICTA 4YSZA 5KVIA 1JRZA 2YAUA 1NHQA 2CFYA 4X9NA 5J60A 1GRBA 3IHMA 1H7XA 5JCIA 2GH5A 3VRDB 2BXSA 3FMWA 3UKPA 1DOBA 2BRAA 1KFYA 1GREA 4Z2UA 1DJNA 1D7LA 4GDEA 4CRTA 2C70A 3G5SA 3P4QA 5JCMA 3AD8B 3SGLA 2XFNA 2YR6A 3QSMA 1GALA 1S3EA 1E1MA 4X9MA 2C76A 4U8LA 4H4TA 1DXLA 1ZOYA 4B66A 3CNTA 1KNPA 1QO8A 3M0OA 3NK1X 2Z5XA 2GVCA 2WDQA 2WHDA 4CNKA 1N4WA 2I0ZA 3C96A 4FX9A 3BHKA 4ZCCA 4OPTA 1ZP0A 2JKCA 2X99A 1D7YA 2XVJA 4H2QA 2YLWA 1XHCA 3NN6X 5HHFA 3SX6A 1S2QA 1Y0PA 4BJYA 5FS6A 1LJ1A 1ZK7A 4NTEA 3AEDA 4TM0A 4H50A 3V3NA 1CC2A 2WP6A 3UKFA 4YKFA 4NTCA 5EB4A 4PAAA 5KXJA 2GQFA 1JNRA 4GDPA 3C4AA 2BS3A 4OPDA 3AYLA 4JNAA 3BNMA 3ALMA 3NHOX 5KMQA 2XVIA 2ZBWA 5U1OA 2C7GA 1B4VA 1LPFA 1CHUA 1H6VA 2W0HA 3UTHA 2JK6A 1PBFA 3F8DA 4JN9A 4NEWA 3RP7A 5L46A 2C64A 2V6OA 3QSEA 1IUSA 1PS9A 2VVLA 1PXCA 1L9CA 2YG4A 2GV8A 2Q6UA 2QA2A 4A9WA 2YG3A 4J34A 4EMIA 5KVHA 2BS4A 3Q6JA 1CJ3A 2JB2A 2J3NA 3I6DA 1ONFA 1Y56A 2WETA 3O0HA 2GQWA 3VR8A 1N4VA 3M12A 3SY4A 3CNDA 4AP3A 3Q9TA 2BA9A 2CULA 2C3DA 4UDRA 4K5RA 4XWZA 2YVFA 1MXTA 2BK3A 3NK2X 3QVPA 3RP8A 2YLRA 1ZDLA 4A7AA 4B64A 1Q1RA 3ISHA 2BRYA 1K0LA 4NWZA 1H83A 2E5VA 5JCKA 2XFOA 3REDA 3B3RA 3K30A 4FK1C 2V3BA 3BI2A 1DODA 2Q0LA 4EM3A 2GRTA 4NZHA 4D03A 3IWAA 4II2A 3NIXA 4U2SA 3AB1A 3QFAA 3NYEA 2R0GA 1L9EA 2H89A 2YR4A 4Z24A 1Z6LA 2Y6RA 5EOWA 3SXIA 4Z43A 4K2XA 1F8WA 4CCRA 2Z5YA 5FS8A 2X8CA 3NTDA 4JDRA 2GR3A 2XFPA 3LB8A 4II3A 4YTMA 1KDGA 2IIDA 4YKGA 4G6HA 5C2TA 1L0VA 1LV0A 4BV6A 3P1WA 1H81A 2C75A 1YY5A 3LOVA 5KRQA 1FECA 1HYUA 4A99A 3DK4A 4JNQA 1EL8A 1PJ6A 3D8XA 2WP9A 1CL0A 3KPKA 1DOEA 2R4EA 1GRGA 1NG4A 3IHGA 1XPQA 1K0JA 4OPUA 1PJ5A 2YVGA 2WU2A 3GRSA 3S61A 3AE6A 2X8HA 1Q9IA 3T2YA 2YM2A 5C3JA 3AE9A 3ALLA 2UZZA 1NEKA 1BGJA 1N4UA 3NYCA 3UOXA 4C3XA 4M52A 4DSHA 4CCQA 4IA5A 4USRA 1Y56B 3DGHA 3CPIG 1CJ2A 3K7MX 4U2TA 4EQWA 2GAHB 2BABA 3CPJG 1CC6A 4TLXA 2R0CA 4OPIA 3BNUA 1FEAA 3AYIA 2GMHA 3P4RA 3ICRA 1GXFA 5J7XA 3UP5A 4UP3A 3SYIA 4UDQA 3T0KA 3RNMA 5BRTA 3K7QX 2HQMA 3AEAA 4YWOA 2YVJA 5M0ZA 2OLOA 3UKAA 4A5LA 4I58A 4NEVA 1KF6A 4OCGA 3DK8A 3SZFA 5CKUA 1SEZA 2BK5A 4GCMA 1COYA 2Q7VA 4K5SA 3T2ZA 2RGOA 1GETA 1JOAA 2WESA 3ZYXA 3CMMA 1NENA 3AYJA 1Q1WA 4LA1A 1BZLA 5CQFA 2GMJA 4K22A 1GTEA 5FS9A 2WS3A 1TYPA 3KPFA 3CPHG 1E6EA 4Z44A 1KSUA 3GDNA 2XLSA 2VZ2A 3GMBA 1MO9A 4H4XA 1TRBA 2XYOA 3ATQA 1NDAA 3IC9A 5GSNA 3ATRA 3BI5A 3NH3X 2V5ZA 4C3YA 3K7TA 4CNJA 5KMPA 3UTFA 3CGBA 3QVRA 3L8KA 3DJJA 3E1TA 5JCLA 2C66A 3DJGX 3NN0X 1E7PA 3GD3A 3GWFA 4H4UA 1NHRA 2WU5A 4Y4MA 2YLXA 2ZZCA 4KPRA 4NNJA 1IUTA 1YQ4A 2JAEA 4B68A 4H4ZA 2XDOA 4LIIA 3QFBA 4N9XA 5GRTA 1JU2A 2C4CA 2YG5A 3GMCA 2C65A 1E39A 2WPEA 4J56A 1P2HA 3HYXA 1VQWA 4AT2A 3DH9A 4Z2TA 2WPCA 4C5OA 4U8OA 2XLRA 2EQ9A 5U63A 1PBDA 3NGCX 1GOSA 4H7UA 1AOGA 4Z25A 1S3BA 3NLCA 3P4SA 2DKHA 2IVDA 1M6IA 2V3AA 2VVLG 1D4CA 2QAEA 2XFUA 2EQ8A 3NNEA 4OPLA 1EL5A 1NHPA 1PBBA 3UP4A 4CY6A 1P2EA 4ZCDA 4A6NA 4C77A 3SM8A 4A65A 5KWFA 2IVEA 4H4PA 4JQ9A 5JCNA 4YSXA 4YTNA 1CF3A 4DGKA 2AAQA 1IUUA 5HY5A 4ICYA 2XCGA 1K0IA 4KX6A 2XFQA 3AEBA 4ZN0A 2B76A 2B7SA 4H2NA 1VG9A 2C67A 4EMWA 4O5QA 1TDKA 1GT8A 2B7RA 2QCUA 3KKJA 2B9YA 4Y4LA 2TMDA 2WP5A 4B67A 3JSKA 2E1MA 4U8NA 3ITJA 1LVLA 4C74A 1JRYA 2B9WA 4GAVA 3KA7A 4JY2A 4OPCA 3CIRA 3C4NA 3AD9B 1D4DA 4HA6A 4Z26A 1GSNA 2ARDA 3CGDA 2XVEA 3FBSA 2WDVA 4MJWA 2AQJA 1B8SA 1DJQA 2GAGB 3AE1A 1TYTA 3KD9A 3KLJA 4G6GA 2XLTA 3AXBA 4J2WA 5KMSA 1KNRA 2BCGG 3GSIA 1O5WA 1EBDA 1PN0A 1PBCA 4OPGA 3M13A 2WDRA 3BHFA 2QA1A 2H88A 1OJDA 2R0PA 4UDPA 5HYMA 1NG3A 3HYWA 4K8DA 2JB3A 2O9ZA 4E0VA 4TLZA 3CNSA 4BK3A 3NG7X 4J36A 2XVHA 1RP0A 2APGA 3H8LA 4U8MA 3T31A 2PYXA 3DJEA 5KOWA 1GRAA 2C73A 1PXBA 2TPRA 2WPFA 3GWDA 4ECHA 4H4SA 1QJDA 2E4GA 3DK9A 4WCTA 2F5ZA 2WOIA 4B1BA 1GNDA 1GTHA 1ZOVA 1E1NA 1VG0A 2ACZA 4XXGA 3R9UA 3WE0A 4NTDA 1H7WA 3ICSA 3SZ0A 4RG4A 3PS9A 2WEUA 4AT0A 4H4QA 4WX1A 4TM3A 1GRTA 1PBEA 2BC0A 1TDEA 1VDCA 2CVJA 1BGNA 2BYBA 1MOKA 1YQZA 2PHHA 2C72A 1TDNA 2V61A 2VQBA 4B65A 2B9XA 3HYVA 1IJHA 4H4WA 1EL7A 1ZX9A 3DA1A 2WQYA 3ALJA 2EQ7A 2R46A 1XANA 3D1CA 1RSGA 4U8PA 2OA1A 1FCDA 1H82A 4J31A 2GEWA 3FPZA 3IF9A 2YLSA 3T2KA 1W4XA 2OLNA 3LJPA 1TDOA 2NVKX 1IUVA 1IUWA 2BC1A 1GESA 3EAOA 2A87A 3EPTA 1ZKQA 4IV9A 5FMHA 3ADAB 4BK1A 1CC4A 5BULA 3UKQA 3AEFA 3UTEA 4J57A 2V60A 4EQXA 2YR5A 5IQ4A 2R45A 4Y4NA 4H2PA 5HXIA 3P4PA 4U2LA 3H8IA 1JNZA 1YKJA 3AEEA 2XLPA 1DNCA 4LU6A 2VVMA 4U8JA 3CGCA 3GRTA 3UOZA 4Z2RA 4OVIA 3AE4A 5BUKA 1GERA 3RP6A 2JB1A 4YSYA 2FJDA 2YQUA 4RG3A 5M10A 2R4JA 5BVAA 3OZ2A 3DJDA 2BACA 2NPXA 2XLUA 2YLTA 2YG6A 2A8XA 3EF6A 4PABA 1E1LA 4B69A 3T14A 1BWCA 4GAPA 1D5TA 4RSLA 3QSSA 4I59A 2WOVA 1JRXA 1EL9A 3NYFA 3NTAA 3UCLA 3ABVA 2Q0KA 2BXRA 1D4EA 4DSGA 4O5UA 3PO7A 3CGEA 3LADA 3UKHA 4U8IA 4B63A 2OAMA 2RGHA 1PHHA 3P9UA 3S5WA 4AOXA 1ELIA 2GR1A 3F8RA 1BF3A 5U25A 3SFEA 4DNAA 5ER0A 5KNLA 2JBVA 2CDUA 4G73A 4H4YA 1TDFA 4P9SA 2BCPA 1IUXA 3UKLA 1V59A 5IQ1A 1N1PA 2VOUA 1LQTA 2BS2A 4IVMB 2GR2A 3VR9A 2AR8A 3AE5A 3QJ4A 1BKWA 2RABA 1NPXA 2XVFA 3DMEA 1REOA 3AE2A 3II4A 3FIMB 2VRLA 1UKVG 2GB0A 1E1KA 1JEHA 1OJTA 1GRFA 3ZDNA 4JY3A 3NRNA 4BK2A 3AEGA 3AWIA 4CBQA 4EMJA 1F8SA 2GR0A 2VQ7A 3UOVA 3AE3A 1F3PA 1H84A 3VQRA 3VRBA 3UKKA 5KOXA 2YM1A 3VRAA 3CNPA 3GYIA 1GPEA 4YT0A 3LZWA 2X3NA 3RHAA 3SQPA 3AE7A 1NHSA 3BI4A 2A89A 4GR1A 4REKA 2ZZ0A 3KVEA 1XDIA 4K7ZA 3CN8A 2YG7A 3G5QA 4G9KA 2WBAA 2BK4A
chains in the Genus database with same CATH topology
1H86A 1L9DA 5EBKA 3UOYA 3KU9A 2DKIA 1CBOA 4AP1A 5TR3A 1CJCA 3AE8A 1QLBA 4EIQA 4J33A 5EB5A 1OJCA 1FEBA 4BJZA 3V76A 1OJAA 2FJEA 4U8KA 4YTPA 1VRQB 3HZLA 5LV9A 4G74A 4HB9A 3V3OA 3SFDA 3EANA 3URHA 2FBWA 3GDPA 2R9ZA 2YLZA 3NT6A 4YSHA 4IA6A 4H4RA 2X8GA 3OC4A 4ADWA 4H4VA 1B5QA 4USQA 1F6MA 4A6NB 3I3LA 1LTXR 2YWLA 3UTGA 1F8RA 1LQUA 4TM1A 3DGZA 4AOSA 3LZXA 1DOCA 1NAAA 4FK1A 4H2RA 1S2YA 3GD4A 1RYIA 1ZY8A 1FOHA 4TM4A 4YXDA 3GYXA 5FS7A 3NKSA 2GF3A 4EIPA 1GV4A 1OJ9A 1GRHA 1K4QA 1PDHA 3FG2P 3GYJA 3T37A 1YQ3A 3AD7B 2OALA 3H4KA 4BURA 1M64A 3F8PA 1PXAA 4D04A 1O94A 2Y6QA 3AECA 1ZMCA 1ZMDA 2WOWA 5IPYA 2X50A 4XWRA 1PJ7A 4GUVA 1B37A 4IVOB 3B6DA 4EQRA 2FJBA 3CTYA 3NK0X 2FJAA 4APNA 1X31B 2C3CA 1KSSA 3G5RA 1CJ4A 3L1RA 4FDCB 5DBJA 4A79A 2EQ6A 5KMRA 4CY8A 4GRTA 3LXDA 4EQSA 2ZZBA 1GEUA 4GF7A 2RGJA 3SZCA 3COXA 4EM4A 3PVCA 3CNJA 1FL2A 3SZWA 1O95A 4X4JA 2VRMA 3ICTA 4YSZA 5KVIA 1JRZA 2YAUA 1NHQA 2CFYA 4X9NA 5J60A 1GRBA 3IHMA 1H7XA 5JCIA 2GH5A 3VRDB 2BXSA 3FMWA 3UKPA 1DOBA 2BRAA 1KFYA 1GREA 4Z2UA 1DJNA 1D7LA 4GDEA 4CRTA 2C70A 3G5SA 3P4QA 5JCMA 3AD8B 3SGLA 2XFNA 2YR6A 3QSMA 1GALA 1S3EA 1E1MA 4X9MA 2C76A 4U8LA 4H4TA 1DXLA 1ZOYA 4B66A 3CNTA 1KNPA 1QO8A 3M0OA 3NK1X 2Z5XA 2GVCA 2WDQA 2WHDA 4CNKA 1N4WA 2I0ZA 3C96A 4FX9A 3BHKA 4ZCCA 4OPTA 1ZP0A 2JKCA 2X99A 1D7YA 2XVJA 4H2QA 2YLWA 1XHCA 3NN6X 5HHFA 3SX6A 1S2QA 1Y0PA 4BJYA 5FS6A 1LJ1A 1ZK7A 4NTEA 3AEDA 4TM0A 4H50A 3V3NA 1CC2A 2WP6A 3UKFA 4YKFA 4NTCA 5EB4A 4PAAA 5KXJA 2GQFA 1JNRA 4GDPA 3C4AA 2BS3A 4OPDA 3AYLA 4JNAA 3BNMA 3ALMA 3NHOX 5KMQA 2XVIA 2ZBWA 5U1OA 2C7GA 1B4VA 1LPFA 1CHUA 1H6VA 2W0HA 3UTHA 2JK6A 1PBFA 3F8DA 4JN9A 4NEWA 3RP7A 5L46A 2C64A 2V6OA 3QSEA 1IUSA 1PS9A 2VVLA 1PXCA 1L9CA 2YG4A 2GV8A 2Q6UA 2QA2A 4A9WA 2YG3A 4J34A 4EMIA 5KVHA 2BS4A 3Q6JA 1CJ3A 2JB2A 2J3NA 3I6DA 1ONFA 1Y56A 2WETA 3O0HA 2GQWA 3VR8A 1N4VA 3M12A 3SY4A 3CNDA 4AP3A 3Q9TA 2BA9A 2CULA 2C3DA 4UDRA 4K5RA 4XWZA 2YVFA 1MXTA 2BK3A 3NK2X 3QVPA 3RP8A 2YLRA 1ZDLA 4A7AA 4B64A 1Q1RA 3ISHA 2BRYA 1K0LA 4NWZA 1H83A 2E5VA 5JCKA 2XFOA 3REDA 3B3RA 3K30A 4FK1C 2V3BA 3BI2A 1DODA 2Q0LA 4EM3A 2GRTA 4NZHA 4D03A 3IWAA 4II2A 3NIXA 4U2SA 3AB1A 3QFAA 3NYEA 2R0GA 1L9EA 2H89A 2YR4A 4Z24A 1Z6LA 2Y6RA 5EOWA 3SXIA 4Z43A 4K2XA 1F8WA 4CCRA 2Z5YA 5FS8A 2X8CA 3NTDA 4JDRA 2GR3A 2XFPA 3LB8A 4II3A 4YTMA 1KDGA 2IIDA 4YKGA 4G6HA 5C2TA 1L0VA 1LV0A 4BV6A 3P1WA 1H81A 2C75A 1YY5A 3LOVA 5KRQA 1FECA 1HYUA 4A99A 3DK4A 4JNQA 1EL8A 1PJ6A 3D8XA 2WP9A 1CL0A 3KPKA 1DOEA 2R4EA 1GRGA 1NG4A 3IHGA 1XPQA 1K0JA 4OPUA 1PJ5A 2YVGA 2WU2A 3GRSA 3S61A 3AE6A 2X8HA 1Q9IA 3T2YA 2YM2A 5C3JA 3AE9A 3ALLA 2UZZA 1NEKA 1BGJA 1N4UA 3NYCA 3UOXA 4C3XA 4M52A 4DSHA 4CCQA 4IA5A 4USRA 1Y56B 3DGHA 3CPIG 1CJ2A 3K7MX 4U2TA 4EQWA 2GAHB 2BABA 3CPJG 1CC6A 4TLXA 2R0CA 4OPIA 3BNUA 1FEAA 3AYIA 2GMHA 3P4RA 3ICRA 1GXFA 5J7XA 3UP5A 4UP3A 3SYIA 4UDQA 3T0KA 3RNMA 5BRTA 3K7QX 2HQMA 3AEAA 4YWOA 2YVJA 5M0ZA 2OLOA 3UKAA 4A5LA 4I58A 4NEVA 1KF6A 4OCGA 3DK8A 3SZFA 5CKUA 1SEZA 2BK5A 4GCMA 1COYA 2Q7VA 4K5SA 3T2ZA 2RGOA 1GETA 1JOAA 2WESA 3ZYXA 3CMMA 1NENA 3AYJA 1Q1WA 4LA1A 1BZLA 5CQFA 2GMJA 4K22A 1GTEA 5FS9A 2WS3A 1TYPA 3KPFA 3CPHG 1E6EA 4Z44A 1KSUA 3GDNA 2XLSA 2VZ2A 3GMBA 1MO9A 4H4XA 1TRBA 2XYOA 3ATQA 1NDAA 3IC9A 5GSNA 3ATRA 3BI5A 3NH3X 2V5ZA 4C3YA 3K7TA 4CNJA 5KMPA 3UTFA 3CGBA 3QVRA 3L8KA 3DJJA 3E1TA 5JCLA 2C66A 3DJGX 3NN0X 1E7PA 3GD3A 3GWFA 4H4UA 1NHRA 2WU5A 4Y4MA 2YLXA 2ZZCA 4KPRA 4NNJA 1IUTA 1YQ4A 2JAEA 4B68A 4H4ZA 2XDOA 4LIIA 3QFBA 4N9XA 5GRTA 1JU2A 2C4CA 2YG5A 3GMCA 2C65A 1E39A 2WPEA 4J56A 1P2HA 3HYXA 1VQWA 4AT2A 3DH9A 4Z2TA 2WPCA 4C5OA 4U8OA 2XLRA 2EQ9A 5U63A 1PBDA 3NGCX 1GOSA 4H7UA 1AOGA 4Z25A 1S3BA 3NLCA 3P4SA 2DKHA 2IVDA 1M6IA 2V3AA 2VVLG 1D4CA 2QAEA 2XFUA 2EQ8A 3NNEA 4OPLA 1EL5A 1NHPA 1PBBA 3UP4A 4CY6A 1P2EA 4ZCDA 4A6NA 4C77A 3SM8A 4A65A 5KWFA 2IVEA 4H4PA 4JQ9A 5JCNA 4YSXA 4YTNA 1CF3A 4DGKA 2AAQA 1IUUA 5HY5A 4ICYA 2XCGA 1K0IA 4KX6A 2XFQA 3AEBA 4ZN0A 2B76A 2B7SA 4H2NA 1VG9A 2C67A 4EMWA 4O5QA 1TDKA 1GT8A 2B7RA 2QCUA 3KKJA 2B9YA 4Y4LA 2TMDA 2WP5A 4B67A 3JSKA 2E1MA 4U8NA 3ITJA 1LVLA 4C74A 1JRYA 2B9WA 4GAVA 3KA7A 4JY2A 4OPCA 3CIRA 3C4NA 3AD9B 1D4DA 4HA6A 4Z26A 1GSNA 2ARDA 3CGDA 2XVEA 3FBSA 2WDVA 4MJWA 2AQJA 1B8SA 1DJQA 2GAGB 3AE1A 1TYTA 3KD9A 3KLJA 4G6GA 2XLTA 3AXBA 4J2WA 5KMSA 1KNRA 2BCGG 3GSIA 1O5WA 1EBDA 1PN0A 1PBCA 4OPGA 3M13A 2WDRA 3BHFA 2QA1A 2H88A 1OJDA 2R0PA 4UDPA 5HYMA 1NG3A 3HYWA 4K8DA 2JB3A 2O9ZA 4E0VA 4TLZA 3CNSA 4BK3A 3NG7X 4J36A 2XVHA 1RP0A 2APGA 3H8LA 4U8MA 3T31A 2PYXA 3DJEA 5KOWA 1GRAA 2C73A 1PXBA 2TPRA 2WPFA 3GWDA 4ECHA 4H4SA 1QJDA 2E4GA 3DK9A 4WCTA 2F5ZA 2WOIA 4B1BA 1GNDA 1GTHA 1ZOVA 1E1NA 1VG0A 2ACZA 4XXGA 3R9UA 3WE0A 4NTDA 1H7WA 3ICSA 3SZ0A 4RG4A 3PS9A 2WEUA 4AT0A 4H4QA 4WX1A 4TM3A 1GRTA 1PBEA 2BC0A 1TDEA 1VDCA 2CVJA 1BGNA 2BYBA 1MOKA 1YQZA 2PHHA 2C72A 1TDNA 2V61A 2VQBA 4B65A 2B9XA 3HYVA 1IJHA 4H4WA 1EL7A 1ZX9A 3DA1A 2WQYA 3ALJA 2EQ7A 2R46A 1XANA 3D1CA 1RSGA 4U8PA 2OA1A 1FCDA 1H82A 4J31A 2GEWA 3FPZA 3IF9A 2YLSA 3T2KA 1W4XA 2OLNA 3LJPA 1TDOA 2NVKX 1IUVA 1IUWA 2BC1A 1GESA 3EAOA 2A87A 3EPTA 1ZKQA 4IV9A 5FMHA 3ADAB 4BK1A 1CC4A 5BULA 3UKQA 3AEFA 3UTEA 4J57A 2V60A 4EQXA 2YR5A 5IQ4A 2R45A 4Y4NA 4H2PA 5HXIA 3P4PA 4U2LA 3H8IA 1JNZA 1YKJA 3AEEA 2XLPA 1DNCA 4LU6A 2VVMA 4U8JA 3CGCA 3GRTA 3UOZA 4Z2RA 4OVIA 3AE4A 5BUKA 1GERA 3RP6A 2JB1A 4YSYA 2FJDA 2YQUA 4RG3A 5M10A 2R4JA 5BVAA 3OZ2A 3DJDA 2BACA 2NPXA 2XLUA 2YLTA 2YG6A 2A8XA 3EF6A 4PABA 1E1LA 4B69A 3T14A 1BWCA 4GAPA 1D5TA 4RSLA 3QSSA 4I59A 2WOVA 1JRXA 1EL9A 3NYFA 3NTAA 3UCLA 3ABVA 2Q0KA 2BXRA 1D4EA 4DSGA 4O5UA 3PO7A 3CGEA 3LADA 3UKHA 4U8IA 4B63A 2OAMA 2RGHA 1PHHA 3P9UA 3S5WA 4AOXA 1ELIA 2GR1A 3F8RA 1BF3A 5U25A 3SFEA 4DNAA 5ER0A 5KNLA 2JBVA 2CDUA 4G73A 4H4YA 1TDFA 4P9SA 2BCPA 1IUXA 3UKLA 1V59A 5IQ1A 1N1PA 2VOUA 1LQTA 2BS2A 4IVMB 2GR2A 3VR9A 2AR8A 3AE5A 3QJ4A 1BKWA 2RABA 1NPXA 2XVFA 3DMEA 1REOA 3AE2A 3II4A 3FIMB 2VRLA 1UKVG 2GB0A 1E1KA 1JEHA 1OJTA 1GRFA 3ZDNA 4JY3A 3NRNA 4BK2A 3AEGA 3AWIA 4CBQA 4EMJA 1F8SA 2GR0A 2VQ7A 3UOVA 3AE3A 1F3PA 1H84A 3VQRA 3VRBA 3UKKA 5KOXA 2YM1A 3VRAA 3CNPA 3GYIA 1GPEA 4YT0A 3LZWA 2X3NA 3RHAA 3SQPA 3AE7A 1NHSA 3BI4A 2A89A 4GR1A 4REKA 2ZZ0A 3KVEA 1XDIA 4K7ZA 3CN8A 2YG7A 3G5QA 4G9KA 2WBAA 2BK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H86 A;  1L9D A;  5EBK A;  3UOY A;  3KU9 A;  2DKI A;  1CBO A;  4AP1 A;  5TR3 A;  1CJC A;  3AE8 A;  1QLB A;  4EIQ A;  4J33 A;  5EB5 A;  1OJC A;  1FEB A;  4BJZ A;  3V76 A;  1OJA A;  2FJE A;  4U8K A;  4YTP A;  1VRQ B;  3HZL A;  5LV9 A;  4HB9 A;  3V3O A;  3SFD A;  3EAN A;  3URH A;  2FBW A;  3GDP A;  2R9Z A;  2YLZ A;  3NT6 A;  4YSH A;  4IA6 A;  4H4R A;  2X8G A;  3OC4 A;  4ADW A;  4H4V A;  1B5Q A;  4USQ A;  1F6M A;  4A6N B;  3I3L A;  1LTX R;  2YWL A;  3UTG A;  1F8R A;  1LQU A;  4TM1 A;  3DGZ A;  4AOS A;  3LZX A;  1DOC A;  1NAA A;  4FK1 A;  4H2R A;  1S2Y A;  3GD4 A;  1RYI A;  1ZY8 A;  1FOH A;  4TM4 A;  4YXD A;  5FS7 A;  3NKS A;  2GF3 A;  4EIP A;  1GV4 A;  1OJ9 A;  1GRH A;  1K4Q A;  1PDH A;  3FG2 P;  3GYJ A;  3T37 A;  1YQ3 A;  3AD7 B;  2OAL A;  3H4K A;  4BUR A;  1M64 A;  3F8P A;  1PXA A;  4D04 A;  1O94 A;  2Y6Q A;  3AEC A;  1ZMC A;  1ZMD A;  2WOW A;  5IPY A;  2X50 A;  4XWR A;  1PJ7 A;  4GUV A;  1B37 A;  4IVO B;  3B6D A;  4EQR A;  2FJB A;  3CTY A;  3NK0 X;  2FJA A;  4APN A;  1X31 B;  2C3C A;  1KSS A;  3G5R A;  1CJ4 A;  3L1R A;  4FDC B;  5DBJ A;  4A79 A;  2EQ6 A;  4CY8 A;  4GRT A;  3LXD A;  4EQS A;  2ZZB A;  1GEU A;  4GF7 A;  2RGJ A;  3COX A;  4EM4 A;  3PVC A;  3CNJ A;  1FL2 A;  1O95 A;  4X4J A;  2VRM A;  3ICT A;  4YSZ A;  5KVI A;  1JRZ A;  2YAU A;  1NHQ A;  2CFY A;  4X9N A;  5J60 A;  1GRB A;  3IHM A;  1H7X A;  5JCI A;  2GH5 A;  3VRD B;  2BXS A;  3FMW A;  3UKP A;  1DOB A;  1KFY A;  1GRE A;  4Z2U A;  1DJN A;  1D7L A;  4GDE A;  4CRT A;  2C70 A;  3G5S A;  3P4Q A;  5JCM A;  3AD8 B;  3SGL A;  2XFN A;  2YR6 A;  3QSM A;  1GAL A;  1S3E A;  1E1M A;  4X9M A;  2C76 A;  4U8L A;  4H4T A;  1DXL A;  1ZOY A;  4B66 A;  3CNT A;  1KNP A;  1QO8 A;  3M0O A;  3NK1 X;  2Z5X A;  2GVC A;  2WDQ A;  2WHD A;  4CNK A;  1N4W A;  2I0Z A;  3C96 A;  4FX9 A;  3BHK A;  4ZCC A;  4OPT A;  1ZP0 A;  2JKC A;  2X99 A;  1D7Y A;  2XVJ A;  4H2Q A;  2YLW A;  1XHC A;  3NN6 X;  5HHF A;  4BJY A;  1S2Q A;  1Y0P A;  5FS6 A;  1LJ1 A;  1ZK7 A;  4NTE A;  3AED A;  4TM0 A;  4H50 A;  3V3N A;  1CC2 A;  2WP6 A;  3UKF A;  4YKF A;  4NTC A;  5EB4 A;  4PAA A;  5KXJ A;  2GQF A;  1JNR A;  4GDP A;  3C4A A;  2BS3 A;  4OPD A;  3AYL A;  4JNA A;  3BNM A;  3ALM A;  3NHO X;  2XVI A;  2ZBW A;  5U1O A;  2C7G A;  1B4V A;  1LPF A;  1CHU A;  1H6V A;  2W0H A;  3UTH A;  2JK6 A;  1PBF A;  3F8D A;  4JN9 A;  4NEW A;  3RP7 A;  5L46 A;  2C64 A;  2V6O A;  3QSE A;  1IUS A;  1PS9 A;  2VVL A;  1PXC A;  1L9C A;  2YG4 A;  2GV8 A;  2Q6U A;  2QA2 A;  4A9W A;  2YG3 A;  4J34 A;  4EMI A;  5KVH A;  2BS4 A;  3Q6J A;  1CJ3 A;  2JB2 A;  2J3N A;  3I6D A;  1ONF A;  1Y56 A;  2WET A;  3O0H A;  2GQW A;  3VR8 A;  1N4V A;  3M12 A;  3CND A;  4AP3 A;  3Q9T A;  2BA9 A;  2CUL A;  2C3D A;  4UDR A;  4K5R A;  4XWZ A;  2YVF A;  1MXT A;  2BK3 A;  3NK2 X;  3QVP A;  3RP8 A;  2YLR A;  1ZDL A;  4A7A A;  4B64 A;  1Q1R A;  3ISH A;  1K0L A;  1H83 A;  2E5V A;  5JCK A;  2XFO A;  3RED A;  3B3R A;  3K30 A;  4FK1 C;  2V3B A;  3BI2 A;  1DOD A;  2Q0L A;  4EM3 A;  2GRT A;  4NZH A;  4D03 A;  3IWA A;  3NIX A;  4U2S A;  3AB1 A;  3QFA A;  3NYE A;  2R0G A;  1L9E A;  2H89 A;  2YR4 A;  4Z24 A;  1Z6L A;  2Y6R A;  5EOW A;  4Z43 A;  4K2X A;  1F8W A;  4CCR A;  2Z5Y A;  5FS8 A;  2X8C A;  3NTD A;  4JDR A;  2GR3 A;  2XFP A;  3LB8 A;  4YTM A;  4YKG A;  1KDG A;  2IID A;  5C2T A;  1L0V A;  1LV0 A;  4BV6 A;  3P1W A;  1H81 A;  2C75 A;  1YY5 A;  3LOV A;  5KRQ A;  1FEC A;  1HYU A;  4A99 A;  3DK4 A;  4JNQ A;  1EL8 A;  1PJ6 A;  3D8X A;  2WP9 A;  1CL0 A;  1DOE A;  2R4E A;  1GRG A;  1NG4 A;  3IHG A;  1XPQ A;  1K0J A;  4OPU A;  1PJ5 A;  2YVG A;  2WU2 A;  3GRS A;  3S61 A;  3AE6 A;  2X8H A;  1Q9I A;  2YM2 A;  5C3J A;  3AE9 A;  3ALL A;  2UZZ A;  1NEK A;  1BGJ A;  1N4U A;  3NYC A;  3UOX A;  4C3X A;  4M52 A;  4DSH A;  4CCQ A;  4IA5 A;  4USR A;  1Y56 B;  3DGH A;  3CPI G;  1CJ2 A;  3K7M X;  4U2T A;  4EQW A;  2GAH B;  2BAB A;  3CPJ G;  1CC6 A;  4TLX A;  2R0C A;  4OPI A;  3BNU A;  1FEA A;  3AYI A;  2GMH A;  3P4R A;  3ICR A;  1GXF A;  5J7X A;  3UP5 A;  4UP3 A;  4UDQ A;  3RNM A;  5BRT A;  3K7Q X;  2HQM A;  3AEA A;  4YWO A;  2YVJ A;  5M0Z A;  2OLO A;  3UKA A;  4A5L A;  4I58 A;  4NEV A;  1KF6 A;  4OCG A;  3DK8 A;  5CKU A;  1SEZ A;  2BK5 A;  4GCM A;  1COY A;  2Q7V A;  4K5S A;  2RGO A;  1GET A;  1JOA A;  2WES A;  3ZYX A;  1NEN A;  3AYJ A;  1Q1W A;  4LA1 A;  1BZL A;  5CQF A;  2GMJ A;  4K22 A;  1GTE A;  5FS9 A;  2WS3 A;  1TYP A;  3KPF A;  3CPH G;  1E6E A;  4Z44 A;  1KSU A;  3GDN A;  2XLS A;  2VZ2 A;  3GMB A;  1MO9 A;  4H4X A;  1TRB A;  2XYO A;  3ATQ A;  1NDA A;  3IC9 A;  5GSN A;  3ATR A;  3BI5 A;  3NH3 X;  2V5Z A;  4C3Y A;  3K7T A;  4CNJ A;  3UTF A;  3CGB A;  3QVR A;  3L8K A;  3DJJ A;  3E1T A;  5JCL A;  2C66 A;  3DJG X;  3NN0 X;  1E7P A;  3GD3 A;  3GWF A;  4H4U A;  1NHR A;  2WU5 A;  4Y4M A;  2YLX A;  2ZZC A;  4KPR A;  1IUT A;  1YQ4 A;  2JAE A;  4B68 A;  4H4Z A;  2XDO A;  4LII A;  3QFB A;  4N9X A;  5GRT A;  1JU2 A;  3GMC A;  2YG5 A;  2C65 A;  1E39 A;  2WPE A;  4J56 A;  1P2H A;  1VQW A;  4AT2 A;  3DH9 A;  4Z2T A;  2WPC A;  4C5O A;  4U8O A;  2XLR A;  2EQ9 A;  5U63 A;  1PBD A;  3NGC X;  1GOS A;  4H7U A;  1AOG A;  4Z25 A;  1S3B A;  3NLC A;  3P4S A;  2DKH A;  2IVD A;  1M6I A;  2V3A A;  2VVL G;  1D4C A;  2QAE A;  2XFU A;  2EQ8 A;  3NNE A;  4OPL A;  1EL5 A;  1NHP A;  1PBB A;  3UP4 A;  4CY6 A;  1P2E A;  4ZCD A;  4A6N A;  4C77 A;  3SM8 A;  4A65 A;  5KWF A;  2IVE A;  4H4P A;  4JQ9 A;  5JCN A;  4YSX A;  4YTN A;  1CF3 A;  4DGK A;  2AAQ A;  1IUU A;  5HY5 A;  4ICY A;  2XCG A;  1K0I A;  4KX6 A;  2XFQ A;  3AEB A;  4ZN0 A;  2B76 A;  2B7S A;  4H2N A;  1VG9 A;  2C67 A;  4EMW A;  4O5Q A;  1TDK A;  1GT8 A;  2B7R A;  2QCU A;  3KKJ A;  2B9Y A;  4Y4L A;  2TMD A;  2WP5 A;  4B67 A;  3JSK A;  2E1M A;  4U8N A;  3ITJ A;  1LVL A;  4C74 A;  1JRY A;  2B9W A;  3KA7 A;  4JY2 A;  4OPC A;  3CIR A;  3C4N A;  3AD9 B;  1D4D A;  4HA6 A;  4Z26 A;  1GSN A;  2ARD A;  3CGD A;  2XVE A;  3FBS A;  2WDV A;  4MJW A;  2AQJ A;  1B8S A;  1DJQ A;  2GAG B;  3AE1 A;  1TYT A;  3KD9 A;  3KLJ A;  2XLT A;  3AXB A;  4J2W A;  1KNR A;  2BCG G;  3GSI A;  1O5W A;  1EBD A;  1PN0 A;  1PBC A;  4OPG A;  3M13 A;  2WDR A;  3BHF A;  2QA1 A;  2H88 A;  1OJD A;  2R0P A;  4UDP A;  5HYM A;  1NG3 A;  4K8D A;  2JB3 A;  2O9Z A;  4E0V A;  4TLZ A;  3CNS A;  4BK3 A;  3NG7 X;  4J36 A;  2XVH A;  1RP0 A;  2APG A;  3H8L A;  4U8M A;  2PYX A;  3DJE A;  5KOW A;  1GRA A;  2C73 A;  1PXB A;  2TPR A;  2WPF A;  3GWD A;  4ECH A;  4H4S A;  1QJD A;  2E4G A;  3DK9 A;  4WCT A;  2F5Z A;  2WOI A;  4B1B A;  1GND A;  1GTH A;  1ZOV A;  1E1N A;  1VG0 A;  2ACZ A;  4XXG A;  3R9U A;  3WE0 A;  4NTD A;  1H7W A;  3ICS A;  4RG4 A;  3PS9 A;  2WEU A;  4AT0 A;  4H4Q A;  4WX1 A;  4TM3 A;  1GRT A;  1PBE A;  2BC0 A;  1TDE A;  1VDC A;  2CVJ A;  1BGN A;  2BYB A;  1MOK A;  1YQZ A;  2PHH A;  2C72 A;  1TDN A;  2V61 A;  2VQB A;  4B65 A;  2B9X A;  1IJH A;  4H4W A;  1EL7 A;  1ZX9 A;  3DA1 A;  2WQY A;  3ALJ A;  2EQ7 A;  2R46 A;  1XAN A;  3D1C A;  1RSG A;  4U8P A;  2OA1 A;  1FCD A;  1H82 A;  4J31 A;  2GEW A;  3FPZ A;  3IF9 A;  2YLS A;  1W4X A;  2OLN A;  3LJP A;  1TDO A;  2NVK X;  1IUV A;  1IUW A;  2BC1 A;  1GES A;  3EAO A;  2A87 A;  3EPT A;  1ZKQ A;  4IV9 A;  5FMH A;  3ADA B;  4BK1 A;  1CC4 A;  5BUL A;  3UKQ A;  3AEF A;  3UTE A;  4J57 A;  2V60 A;  4EQX A;  2YR5 A;  5IQ4 A;  2R45 A;  4Y4N A;  4H2P A;  5HXI A;  3P4P A;  4U2L A;  3H8I A;  1JNZ A;  1YKJ A;  3AEE A;  2XLP A;  1DNC A;  4LU6 A;  2VVM A;  4U8J A;  3CGC A;  3GRT A;  3UOZ A;  4Z2R A;  4OVI A;  3AE4 A;  5BUK A;  1GER A;  3RP6 A;  2JB1 A;  4YSY A;  2FJD A;  2YQU A;  4RG3 A;  5M10 A;  2R4J A;  5BVA A;  3OZ2 A;  3DJD A;  2BAC A;  2NPX A;  2XLU A;  2YLT A;  2YG6 A;  2A8X A;  3EF6 A;  4PAB A;  1E1L A;  4B69 A;  1BWC A;  4RSL A;  1D5T A;  3QSS A;  4I59 A;  2WOV A;  1JRX A;  1EL9 A;  3NYF A;  3NTA A;  3UCL A;  3ABV A;  2Q0K A;  2BXR A;  1D4E A;  4DSG A;  4O5U A;  3PO7 A;  3CGE A;  3LAD A;  3UKH A;  4U8I A;  4B63 A;  2OAM A;  2RGH A;  1PHH A;  3P9U A;  3S5W A;  4AOX A;  1ELI A;  2GR1 A;  3F8R A;  1BF3 A;  5U25 A;  3SFE A;  4DNA A;  5ER0 A;  2JBV A;  2CDU A;  4H4Y A;  4P9S A;  1TDF A;  2BCP A;  1IUX A;  3UKL A;  1V59 A;  5IQ1 A;  1N1P A;  2VOU A;  1LQT A;  2BS2 A;  4IVM B;  2GR2 A;  3VR9 A;  2AR8 A;  3AE5 A;  3QJ4 A;  1BKW A;  2RAB A;  1NPX A;  2XVF A;  3DME A;  1REO A;  3AE2 A;  3II4 A;  3FIM B;  2VRL A;  1UKV G;  2GB0 A;  1E1K A;  1JEH A;  1OJT A;  1GRF A;  3ZDN A;  4JY3 A;  3NRN A;  4BK2 A;  3AEG A;  3AWI A;  4CBQ A;  4EMJ A;  1F8S A;  2GR0 A;  2VQ7 A;  3UOV A;  3AE3 A;  1F3P A;  1H84 A;  3VQR A;  3VRB A;  3UKK A;  5KOX A;  2YM1 A;  3VRA A;  3CNP A;  3GYI A;  1GPE A;  4YT0 A;  3LZW A;  2X3N A;  3RHA A;  3SQP A;  3AE7 A;  1NHS A;  3BI4 A;  2A89 A;  4GR1 A;  4REK A;  2ZZ0 A;  3KVE A;  1XDI A;  4K7Z A;  3CN8 A;  2YG7 A;  3G5Q A;  2WBA A;  2BK4 A; 
#chains in the Genus database with same CATH topology
 1H86 A;  1L9D A;  5EBK A;  3UOY A;  3KU9 A;  2DKI A;  1CBO A;  4AP1 A;  5TR3 A;  1CJC A;  3AE8 A;  1QLB A;  4EIQ A;  4J33 A;  5EB5 A;  1OJC A;  1FEB A;  4BJZ A;  3V76 A;  1OJA A;  2FJE A;  4U8K A;  4YTP A;  1VRQ B;  3HZL A;  5LV9 A;  4G74 A;  4HB9 A;  3V3O A;  3SFD A;  3EAN A;  3URH A;  2FBW A;  3GDP A;  2R9Z A;  2YLZ A;  3NT6 A;  4YSH A;  4IA6 A;  4H4R A;  2X8G A;  3OC4 A;  4ADW A;  4H4V A;  1B5Q A;  4USQ A;  1F6M A;  4A6N B;  3I3L A;  1LTX R;  2YWL A;  3UTG A;  1F8R A;  1LQU A;  4TM1 A;  3DGZ A;  4AOS A;  3LZX A;  1DOC A;  1NAA A;  4FK1 A;  4H2R A;  1S2Y A;  3GD4 A;  1RYI A;  1ZY8 A;  1FOH A;  4TM4 A;  4YXD A;  3GYX A;  5FS7 A;  3NKS A;  2GF3 A;  4EIP A;  1GV4 A;  1OJ9 A;  1GRH A;  1K4Q A;  1PDH A;  3FG2 P;  3GYJ A;  3T37 A;  1YQ3 A;  3AD7 B;  2OAL A;  3H4K A;  4BUR A;  1M64 A;  3F8P A;  1PXA A;  4D04 A;  1O94 A;  2Y6Q A;  3AEC A;  1ZMC A;  1ZMD A;  2WOW A;  5IPY A;  2X50 A;  4XWR A;  1PJ7 A;  4GUV A;  1B37 A;  4IVO B;  3B6D A;  4EQR A;  2FJB A;  3CTY A;  3NK0 X;  2FJA A;  4APN A;  1X31 B;  2C3C A;  1KSS A;  3G5R A;  1CJ4 A;  3L1R A;  4FDC B;  5DBJ A;  4A79 A;  2EQ6 A;  5KMR A;  4CY8 A;  4GRT A;  3LXD A;  4EQS A;  2ZZB A;  1GEU A;  4GF7 A;  2RGJ A;  3SZC A;  3COX A;  4EM4 A;  3PVC A;  3CNJ A;  1FL2 A;  3SZW A;  1O95 A;  4X4J A;  2VRM A;  3ICT A;  4YSZ A;  5KVI A;  1JRZ A;  2YAU A;  1NHQ A;  2CFY A;  4X9N A;  5J60 A;  1GRB A;  3IHM A;  1H7X A;  5JCI A;  2GH5 A;  3VRD B;  2BXS A;  3FMW A;  3UKP A;  1DOB A;  2BRA A;  1KFY A;  1GRE A;  4Z2U A;  1DJN A;  1D7L A;  4GDE A;  4CRT A;  2C70 A;  3G5S A;  3P4Q A;  5JCM A;  3AD8 B;  3SGL A;  2XFN A;  2YR6 A;  3QSM A;  1GAL A;  1S3E A;  1E1M A;  4X9M A;  2C76 A;  4U8L A;  4H4T A;  1DXL A;  1ZOY A;  4B66 A;  3CNT A;  1KNP A;  1QO8 A;  3M0O A;  3NK1 X;  2Z5X A;  2GVC A;  2WDQ A;  2WHD A;  4CNK A;  1N4W A;  2I0Z A;  3C96 A;  4FX9 A;  3BHK A;  4ZCC A;  4OPT A;  1ZP0 A;  2JKC A;  2X99 A;  1D7Y A;  2XVJ A;  4H2Q A;  2YLW A;  1XHC A;  3NN6 X;  5HHF A;  3SX6 A;  1S2Q A;  1Y0P A;  4BJY A;  5FS6 A;  1LJ1 A;  1ZK7 A;  4NTE A;  3AED A;  4TM0 A;  4H50 A;  3V3N A;  1CC2 A;  2WP6 A;  3UKF A;  4YKF A;  4NTC A;  5EB4 A;  4PAA A;  5KXJ A;  2GQF A;  1JNR A;  4GDP A;  3C4A A;  2BS3 A;  4OPD A;  3AYL A;  4JNA A;  3BNM A;  3ALM A;  3NHO X;  5KMQ A;  2XVI A;  2ZBW A;  5U1O A;  2C7G A;  1B4V A;  1LPF A;  1CHU A;  1H6V A;  2W0H A;  3UTH A;  2JK6 A;  1PBF A;  3F8D A;  4JN9 A;  4NEW A;  3RP7 A;  5L46 A;  2C64 A;  2V6O A;  3QSE A;  1IUS A;  1PS9 A;  2VVL A;  1PXC A;  1L9C A;  2YG4 A;  2GV8 A;  2Q6U A;  2QA2 A;  4A9W A;  2YG3 A;  4J34 A;  4EMI A;  5KVH A;  2BS4 A;  3Q6J A;  1CJ3 A;  2JB2 A;  2J3N A;  3I6D A;  1ONF A;  1Y56 A;  2WET A;  3O0H A;  2GQW A;  3VR8 A;  1N4V A;  3M12 A;  3SY4 A;  3CND A;  4AP3 A;  3Q9T A;  2BA9 A;  2CUL A;  2C3D A;  4UDR A;  4K5R A;  4XWZ A;  2YVF A;  1MXT A;  2BK3 A;  3NK2 X;  3QVP A;  3RP8 A;  2YLR A;  1ZDL A;  4A7A A;  4B64 A;  1Q1R A;  3ISH A;  2BRY A;  1K0L A;  4NWZ A;  1H83 A;  2E5V A;  5JCK A;  2XFO A;  3RED A;  3B3R A;  3K30 A;  4FK1 C;  2V3B A;  3BI2 A;  1DOD A;  2Q0L A;  4EM3 A;  2GRT A;  4NZH A;  4D03 A;  3IWA A;  4II2 A;  3NIX A;  4U2S A;  3AB1 A;  3QFA A;  3NYE A;  2R0G A;  1L9E A;  2H89 A;  2YR4 A;  4Z24 A;  1Z6L A;  2Y6R A;  5EOW A;  3SXI A;  4Z43 A;  4K2X A;  1F8W A;  4CCR A;  2Z5Y A;  5FS8 A;  2X8C A;  3NTD A;  4JDR A;  2GR3 A;  2XFP A;  3LB8 A;  4II3 A;  4YTM A;  1KDG A;  2IID A;  4YKG A;  4G6H A;  5C2T A;  1L0V A;  1LV0 A;  4BV6 A;  3P1W A;  1H81 A;  2C75 A;  1YY5 A;  3LOV A;  5KRQ A;  1FEC A;  1HYU A;  4A99 A;  3DK4 A;  4JNQ A;  1EL8 A;  1PJ6 A;  3D8X A;  2WP9 A;  1CL0 A;  3KPK A;  1DOE A;  2R4E A;  1GRG A;  1NG4 A;  3IHG A;  1XPQ A;  1K0J A;  4OPU A;  1PJ5 A;  2YVG A;  2WU2 A;  3GRS A;  3S61 A;  3AE6 A;  2X8H A;  1Q9I A;  3T2Y A;  2YM2 A;  5C3J A;  3AE9 A;  3ALL A;  2UZZ A;  1NEK A;  1BGJ A;  1N4U A;  3NYC A;  3UOX A;  4C3X A;  4M52 A;  4DSH A;  4CCQ A;  4IA5 A;  4USR A;  1Y56 B;  3DGH A;  3CPI G;  1CJ2 A;  3K7M X;  4U2T A;  4EQW A;  2GAH B;  2BAB A;  3CPJ G;  1CC6 A;  4TLX A;  2R0C A;  4OPI A;  3BNU A;  1FEA A;  3AYI A;  2GMH A;  3P4R A;  3ICR A;  1GXF A;  5J7X A;  3UP5 A;  4UP3 A;  3SYI A;  4UDQ A;  3T0K A;  3RNM A;  5BRT A;  3K7Q X;  2HQM A;  3AEA A;  4YWO A;  2YVJ A;  5M0Z A;  2OLO A;  3UKA A;  4A5L A;  4I58 A;  4NEV A;  1KF6 A;  4OCG A;  3DK8 A;  3SZF A;  5CKU A;  1SEZ A;  2BK5 A;  4GCM A;  1COY A;  2Q7V A;  4K5S A;  3T2Z A;  2RGO A;  1GET A;  1JOA A;  2WES A;  3ZYX A;  3CMM A;  1NEN A;  3AYJ A;  1Q1W A;  4LA1 A;  1BZL A;  5CQF A;  2GMJ A;  4K22 A;  1GTE A;  5FS9 A;  2WS3 A;  1TYP A;  3KPF A;  3CPH G;  1E6E A;  4Z44 A;  1KSU A;  3GDN A;  2XLS A;  2VZ2 A;  3GMB A;  1MO9 A;  4H4X A;  1TRB A;  2XYO A;  3ATQ A;  1NDA A;  3IC9 A;  5GSN A;  3ATR A;  3BI5 A;  3NH3 X;  2V5Z A;  4C3Y A;  3K7T A;  4CNJ A;  5KMP A;  3UTF A;  3CGB A;  3QVR A;  3L8K A;  3DJJ A;  3E1T A;  5JCL A;  2C66 A;  3DJG X;  3NN0 X;  1E7P A;  3GD3 A;  3GWF A;  4H4U A;  1NHR A;  2WU5 A;  4Y4M A;  2YLX A;  2ZZC A;  4KPR A;  4NNJ A;  1IUT A;  1YQ4 A;  2JAE A;  4B68 A;  4H4Z A;  2XDO A;  4LII A;  3QFB A;  4N9X A;  5GRT A;  1JU2 A;  2C4C A;  2YG5 A;  3GMC A;  2C65 A;  1E39 A;  2WPE A;  4J56 A;  1P2H A;  3HYX A;  1VQW A;  4AT2 A;  3DH9 A;  4Z2T A;  2WPC A;  4C5O A;  4U8O A;  2XLR A;  2EQ9 A;  5U63 A;  1PBD A;  3NGC X;  1GOS A;  4H7U A;  1AOG A;  4Z25 A;  1S3B A;  3NLC A;  3P4S A;  2DKH A;  2IVD A;  1M6I A;  2V3A A;  2VVL G;  1D4C A;  2QAE A;  2XFU A;  2EQ8 A;  3NNE A;  4OPL A;  1EL5 A;  1NHP A;  1PBB A;  3UP4 A;  4CY6 A;  1P2E A;  4ZCD A;  4A6N A;  4C77 A;  3SM8 A;  4A65 A;  5KWF A;  2IVE A;  4H4P A;  4JQ9 A;  5JCN A;  4YSX A;  4YTN A;  1CF3 A;  4DGK A;  2AAQ A;  1IUU A;  5HY5 A;  4ICY A;  2XCG A;  1K0I A;  4KX6 A;  2XFQ A;  3AEB A;  4ZN0 A;  2B76 A;  2B7S A;  4H2N A;  1VG9 A;  2C67 A;  4EMW A;  4O5Q A;  1TDK A;  1GT8 A;  2B7R A;  2QCU A;  3KKJ A;  2B9Y A;  4Y4L A;  2TMD A;  2WP5 A;  4B67 A;  3JSK A;  2E1M A;  4U8N A;  3ITJ A;  1LVL A;  4C74 A;  1JRY A;  2B9W A;  4GAV A;  3KA7 A;  4JY2 A;  4OPC A;  3CIR A;  3C4N A;  3AD9 B;  1D4D A;  4HA6 A;  4Z26 A;  1GSN A;  2ARD A;  3CGD A;  2XVE A;  3FBS A;  2WDV A;  4MJW A;  2AQJ A;  1B8S A;  1DJQ A;  2GAG B;  3AE1 A;  1TYT A;  3KD9 A;  3KLJ A;  4G6G A;  2XLT A;  3AXB A;  4J2W A;  5KMS A;  1KNR A;  2BCG G;  3GSI A;  1O5W A;  1EBD A;  1PN0 A;  1PBC A;  4OPG A;  3M13 A;  2WDR A;  3BHF A;  2QA1 A;  2H88 A;  1OJD A;  2R0P A;  4UDP A;  5HYM A;  1NG3 A;  3HYW A;  4K8D A;  2JB3 A;  2O9Z A;  4E0V A;  4TLZ A;  3CNS A;  4BK3 A;  3NG7 X;  4J36 A;  2XVH A;  1RP0 A;  2APG A;  3H8L A;  4U8M A;  3T31 A;  2PYX A;  3DJE A;  5KOW A;  1GRA A;  2C73 A;  1PXB A;  2TPR A;  2WPF A;  3GWD A;  4ECH A;  4H4S A;  1QJD A;  2E4G A;  3DK9 A;  4WCT A;  2F5Z A;  2WOI A;  4B1B A;  1GND A;  1GTH A;  1ZOV A;  1E1N A;  1VG0 A;  2ACZ A;  4XXG A;  3R9U A;  3WE0 A;  4NTD A;  1H7W A;  3ICS A;  3SZ0 A;  4RG4 A;  3PS9 A;  2WEU A;  4AT0 A;  4H4Q A;  4WX1 A;  4TM3 A;  1GRT A;  1PBE A;  2BC0 A;  1TDE A;  1VDC A;  2CVJ A;  1BGN A;  2BYB A;  1MOK A;  1YQZ A;  2PHH A;  2C72 A;  1TDN A;  2V61 A;  2VQB A;  4B65 A;  2B9X A;  3HYV A;  1IJH A;  4H4W A;  1EL7 A;  1ZX9 A;  3DA1 A;  2WQY A;  3ALJ A;  2EQ7 A;  2R46 A;  1XAN A;  3D1C A;  1RSG A;  4U8P A;  2OA1 A;  1FCD A;  1H82 A;  4J31 A;  2GEW A;  3FPZ A;  3IF9 A;  2YLS A;  3T2K A;  1W4X A;  2OLN A;  3LJP A;  1TDO A;  2NVK X;  1IUV A;  1IUW A;  2BC1 A;  1GES A;  3EAO A;  2A87 A;  3EPT A;  1ZKQ A;  4IV9 A;  5FMH A;  3ADA B;  4BK1 A;  1CC4 A;  5BUL A;  3UKQ A;  3AEF A;  3UTE A;  4J57 A;  2V60 A;  4EQX A;  2YR5 A;  5IQ4 A;  2R45 A;  4Y4N A;  4H2P A;  5HXI A;  3P4P A;  4U2L A;  3H8I A;  1JNZ A;  1YKJ A;  3AEE A;  2XLP A;  1DNC A;  4LU6 A;  2VVM A;  4U8J A;  3CGC A;  3GRT A;  3UOZ A;  4Z2R A;  4OVI A;  3AE4 A;  5BUK A;  1GER A;  3RP6 A;  2JB1 A;  4YSY A;  2FJD A;  2YQU A;  4RG3 A;  5M10 A;  2R4J A;  5BVA A;  3OZ2 A;  3DJD A;  2BAC A;  2NPX A;  2XLU A;  2YLT A;  2YG6 A;  2A8X A;  3EF6 A;  4PAB A;  1E1L A;  4B69 A;  3T14 A;  1BWC A;  4GAP A;  1D5T A;  4RSL A;  3QSS A;  4I59 A;  2WOV A;  1JRX A;  1EL9 A;  3NYF A;  3NTA A;  3UCL A;  3ABV A;  2Q0K A;  2BXR A;  1D4E A;  4DSG A;  4O5U A;  3PO7 A;  3CGE A;  3LAD A;  3UKH A;  4U8I A;  4B63 A;  2OAM A;  2RGH A;  1PHH A;  3P9U A;  3S5W A;  4AOX A;  1ELI A;  2GR1 A;  3F8R A;  1BF3 A;  5U25 A;  3SFE A;  4DNA A;  5ER0 A;  5KNL A;  2JBV A;  2CDU A;  4G73 A;  4H4Y A;  1TDF A;  4P9S A;  2BCP A;  1IUX A;  3UKL A;  1V59 A;  5IQ1 A;  1N1P A;  2VOU A;  1LQT A;  2BS2 A;  4IVM B;  2GR2 A;  3VR9 A;  2AR8 A;  3AE5 A;  3QJ4 A;  1BKW A;  2RAB A;  1NPX A;  2XVF A;  3DME A;  1REO A;  3AE2 A;  3II4 A;  3FIM B;  2VRL A;  1UKV G;  2GB0 A;  1E1K A;  1JEH A;  1OJT A;  1GRF A;  3ZDN A;  4JY3 A;  3NRN A;  4BK2 A;  3AEG A;  3AWI A;  4CBQ A;  4EMJ A;  1F8S A;  2GR0 A;  2VQ7 A;  3UOV A;  3AE3 A;  1F3P A;  1H84 A;  3VQR A;  3VRB A;  3UKK A;  5KOX A;  2YM1 A;  3VRA A;  3CNP A;  3GYI A;  1GPE A;  4YT0 A;  3LZW A;  2X3N A;  3RHA A;  3SQP A;  3AE7 A;  1NHS A;  3BI4 A;  2A89 A;  4GR1 A;  4REK A;  2ZZ0 A;  3KVE A;  1XDI A;  4K7Z A;  3CN8 A;  2YG7 A;  3G5Q A;  4G9K A;  2WBA A;  2BK4 A; 
#chains in the Genus database with same CATH homology
 1H86 A;  1L9D A;  5EBK A;  3UOY A;  3KU9 A;  2DKI A;  1CBO A;  4AP1 A;  5TR3 A;  1CJC A;  3AE8 A;  1QLB A;  4EIQ A;  4J33 A;  5EB5 A;  1OJC A;  1FEB A;  4BJZ A;  3V76 A;  1OJA A;  2FJE A;  4U8K A;  4YTP A;  1VRQ B;  3HZL A;  5LV9 A;  4G74 A;  4HB9 A;  3V3O A;  3SFD A;  3EAN A;  3URH A;  2FBW A;  3GDP A;  2R9Z A;  2YLZ A;  3NT6 A;  4YSH A;  4IA6 A;  4H4R A;  2X8G A;  3OC4 A;  4ADW A;  4H4V A;  1B5Q A;  4USQ A;  1F6M A;  4A6N B;  3I3L A;  1LTX R;  2YWL A;  3UTG A;  1F8R A;  1LQU A;  4TM1 A;  3DGZ A;  4AOS A;  3LZX A;  1DOC A;  1NAA A;  4FK1 A;  4H2R A;  1S2Y A;  3GD4 A;  1RYI A;  1ZY8 A;  1FOH A;  4TM4 A;  4YXD A;  3GYX A;  5FS7 A;  3NKS A;  2GF3 A;  4EIP A;  1GV4 A;  1OJ9 A;  1GRH A;  1K4Q A;  1PDH A;  3FG2 P;  3GYJ A;  3T37 A;  1YQ3 A;  3AD7 B;  2OAL A;  3H4K A;  4BUR A;  1M64 A;  3F8P A;  1PXA A;  4D04 A;  1O94 A;  2Y6Q A;  3AEC A;  1ZMC A;  1ZMD A;  2WOW A;  5IPY A;  2X50 A;  4XWR A;  1PJ7 A;  4GUV A;  1B37 A;  4IVO B;  3B6D A;  4EQR A;  2FJB A;  3CTY A;  3NK0 X;  2FJA A;  4APN A;  1X31 B;  2C3C A;  1KSS A;  3G5R A;  1CJ4 A;  3L1R A;  4FDC B;  5DBJ A;  4A79 A;  2EQ6 A;  5KMR A;  4CY8 A;  4GRT A;  3LXD A;  4EQS A;  2ZZB A;  1GEU A;  4GF7 A;  2RGJ A;  3SZC A;  3COX A;  4EM4 A;  3PVC A;  3CNJ A;  1FL2 A;  3SZW A;  1O95 A;  4X4J A;  2VRM A;  3ICT A;  4YSZ A;  5KVI A;  1JRZ A;  2YAU A;  1NHQ A;  2CFY A;  4X9N A;  5J60 A;  1GRB A;  3IHM A;  1H7X A;  5JCI A;  2GH5 A;  3VRD B;  2BXS A;  3FMW A;  3UKP A;  1DOB A;  2BRA A;  1KFY A;  1GRE A;  4Z2U A;  1DJN A;  1D7L A;  4GDE A;  4CRT A;  2C70 A;  3G5S A;  3P4Q A;  5JCM A;  3AD8 B;  3SGL A;  2XFN A;  2YR6 A;  3QSM A;  1GAL A;  1S3E A;  1E1M A;  4X9M A;  2C76 A;  4U8L A;  4H4T A;  1DXL A;  1ZOY A;  4B66 A;  3CNT A;  1KNP A;  1QO8 A;  3M0O A;  3NK1 X;  2Z5X A;  2GVC A;  2WDQ A;  2WHD A;  4CNK A;  1N4W A;  2I0Z A;  3C96 A;  4FX9 A;  3BHK A;  4ZCC A;  4OPT A;  1ZP0 A;  2JKC A;  2X99 A;  1D7Y A;  2XVJ A;  4H2Q A;  2YLW A;  1XHC A;  3NN6 X;  5HHF A;  3SX6 A;  1S2Q A;  1Y0P A;  4BJY A;  5FS6 A;  1LJ1 A;  1ZK7 A;  4NTE A;  3AED A;  4TM0 A;  4H50 A;  3V3N A;  1CC2 A;  2WP6 A;  3UKF A;  4YKF A;  4NTC A;  5EB4 A;  4PAA A;  5KXJ A;  2GQF A;  1JNR A;  4GDP A;  3C4A A;  2BS3 A;  4OPD A;  3AYL A;  4JNA A;  3BNM A;  3ALM A;  3NHO X;  5KMQ A;  2XVI A;  2ZBW A;  5U1O A;  2C7G A;  1B4V A;  1LPF A;  1CHU A;  1H6V A;  2W0H A;  3UTH A;  2JK6 A;  1PBF A;  3F8D A;  4JN9 A;  4NEW A;  3RP7 A;  5L46 A;  2C64 A;  2V6O A;  3QSE A;  1IUS A;  1PS9 A;  2VVL A;  1PXC A;  1L9C A;  2YG4 A;  2GV8 A;  2Q6U A;  2QA2 A;  4A9W A;  2YG3 A;  4J34 A;  4EMI A;  5KVH A;  2BS4 A;  3Q6J A;  1CJ3 A;  2JB2 A;  2J3N A;  3I6D A;  1ONF A;  1Y56 A;  2WET A;  3O0H A;  2GQW A;  3VR8 A;  1N4V A;  3M12 A;  3SY4 A;  3CND A;  4AP3 A;  3Q9T A;  2BA9 A;  2CUL A;  2C3D A;  4UDR A;  4K5R A;  4XWZ A;  2YVF A;  1MXT A;  2BK3 A;  3NK2 X;  3QVP A;  3RP8 A;  2YLR A;  1ZDL A;  4A7A A;  4B64 A;  1Q1R A;  3ISH A;  2BRY A;  1K0L A;  4NWZ A;  1H83 A;  2E5V A;  5JCK A;  2XFO A;  3RED A;  3B3R A;  3K30 A;  4FK1 C;  2V3B A;  3BI2 A;  1DOD A;  2Q0L A;  4EM3 A;  2GRT A;  4NZH A;  4D03 A;  3IWA A;  4II2 A;  3NIX A;  4U2S A;  3AB1 A;  3QFA A;  3NYE A;  2R0G A;  1L9E A;  2H89 A;  2YR4 A;  4Z24 A;  1Z6L A;  2Y6R A;  5EOW A;  3SXI A;  4Z43 A;  4K2X A;  1F8W A;  4CCR A;  2Z5Y A;  5FS8 A;  2X8C A;  3NTD A;  4JDR A;  2GR3 A;  2XFP A;  3LB8 A;  4II3 A;  4YTM A;  1KDG A;  2IID A;  4YKG A;  4G6H A;  5C2T A;  1L0V A;  1LV0 A;  4BV6 A;  3P1W A;  1H81 A;  2C75 A;  1YY5 A;  3LOV A;  5KRQ A;  1FEC A;  1HYU A;  4A99 A;  3DK4 A;  4JNQ A;  1EL8 A;  1PJ6 A;  3D8X A;  2WP9 A;  1CL0 A;  3KPK A;  1DOE A;  2R4E A;  1GRG A;  1NG4 A;  3IHG A;  1XPQ A;  1K0J A;  4OPU A;  1PJ5 A;  2YVG A;  2WU2 A;  3GRS A;  3S61 A;  3AE6 A;  2X8H A;  1Q9I A;  3T2Y A;  2YM2 A;  5C3J A;  3AE9 A;  3ALL A;  2UZZ A;  1NEK A;  1BGJ A;  1N4U A;  3NYC A;  3UOX A;  4C3X A;  4M52 A;  4DSH A;  4CCQ A;  4IA5 A;  4USR A;  1Y56 B;  3DGH A;  3CPI G;  1CJ2 A;  3K7M X;  4U2T A;  4EQW A;  2GAH B;  2BAB A;  3CPJ G;  1CC6 A;  4TLX A;  2R0C A;  4OPI A;  3BNU A;  1FEA A;  3AYI A;  2GMH A;  3P4R A;  3ICR A;  1GXF A;  5J7X A;  3UP5 A;  4UP3 A;  3SYI A;  4UDQ A;  3T0K A;  3RNM A;  5BRT A;  3K7Q X;  2HQM A;  3AEA A;  4YWO A;  2YVJ A;  5M0Z A;  2OLO A;  3UKA A;  4A5L A;  4I58 A;  4NEV A;  1KF6 A;  4OCG A;  3DK8 A;  3SZF A;  5CKU A;  1SEZ A;  2BK5 A;  4GCM A;  1COY A;  2Q7V A;  4K5S A;  3T2Z A;  2RGO A;  1GET A;  1JOA A;  2WES A;  3ZYX A;  3CMM A;  1NEN A;  3AYJ A;  1Q1W A;  4LA1 A;  1BZL A;  5CQF A;  2GMJ A;  4K22 A;  1GTE A;  5FS9 A;  2WS3 A;  1TYP A;  3KPF A;  3CPH G;  1E6E A;  4Z44 A;  1KSU A;  3GDN A;  2XLS A;  2VZ2 A;  3GMB A;  1MO9 A;  4H4X A;  1TRB A;  2XYO A;  3ATQ A;  1NDA A;  3IC9 A;  5GSN A;  3ATR A;  3BI5 A;  3NH3 X;  2V5Z A;  4C3Y A;  3K7T A;  4CNJ A;  5KMP A;  3UTF A;  3CGB A;  3QVR A;  3L8K A;  3DJJ A;  3E1T A;  5JCL A;  2C66 A;  3DJG X;  3NN0 X;  1E7P A;  3GD3 A;  3GWF A;  4H4U A;  1NHR A;  2WU5 A;  4Y4M A;  2YLX A;  2ZZC A;  4KPR A;  4NNJ A;  1IUT A;  1YQ4 A;  2JAE A;  4B68 A;  4H4Z A;  2XDO A;  4LII A;  3QFB A;  4N9X A;  5GRT A;  1JU2 A;  2C4C A;  2YG5 A;  3GMC A;  2C65 A;  1E39 A;  2WPE A;  4J56 A;  1P2H A;  3HYX A;  1VQW A;  4AT2 A;  3DH9 A;  4Z2T A;  2WPC A;  4C5O A;  4U8O A;  2XLR A;  2EQ9 A;  5U63 A;  1PBD A;  3NGC X;  1GOS A;  4H7U A;  1AOG A;  4Z25 A;  1S3B A;  3NLC A;  3P4S A;  2DKH A;  2IVD A;  1M6I A;  2V3A A;  2VVL G;  1D4C A;  2QAE A;  2XFU A;  2EQ8 A;  3NNE A;  4OPL A;  1EL5 A;  1NHP A;  1PBB A;  3UP4 A;  4CY6 A;  1P2E A;  4ZCD A;  4A6N A;  4C77 A;  3SM8 A;  4A65 A;  5KWF A;  2IVE A;  4H4P A;  4JQ9 A;  5JCN A;  4YSX A;  4YTN A;  1CF3 A;  4DGK A;  2AAQ A;  1IUU A;  5HY5 A;  4ICY A;  2XCG A;  1K0I A;  4KX6 A;  2XFQ A;  3AEB A;  4ZN0 A;  2B76 A;  2B7S A;  4H2N A;  1VG9 A;  2C67 A;  4EMW A;  4O5Q A;  1TDK A;  1GT8 A;  2B7R A;  2QCU A;  3KKJ A;  2B9Y A;  4Y4L A;  2TMD A;  2WP5 A;  4B67 A;  3JSK A;  2E1M A;  4U8N A;  3ITJ A;  1LVL A;  4C74 A;  1JRY A;  2B9W A;  4GAV A;  3KA7 A;  4JY2 A;  4OPC A;  3CIR A;  3C4N A;  3AD9 B;  1D4D A;  4HA6 A;  4Z26 A;  1GSN A;  2ARD A;  3CGD A;  2XVE A;  3FBS A;  2WDV A;  4MJW A;  2AQJ A;  1B8S A;  1DJQ A;  2GAG B;  3AE1 A;  1TYT A;  3KD9 A;  3KLJ A;  4G6G A;  2XLT A;  3AXB A;  4J2W A;  5KMS A;  1KNR A;  2BCG G;  3GSI A;  1O5W A;  1EBD A;  1PN0 A;  1PBC A;  4OPG A;  3M13 A;  2WDR A;  3BHF A;  2QA1 A;  2H88 A;  1OJD A;  2R0P A;  4UDP A;  5HYM A;  1NG3 A;  3HYW A;  4K8D A;  2JB3 A;  2O9Z A;  4E0V A;  4TLZ A;  3CNS A;  4BK3 A;  3NG7 X;  4J36 A;  2XVH A;  1RP0 A;  2APG A;  3H8L A;  4U8M A;  3T31 A;  2PYX A;  3DJE A;  5KOW A;  1GRA A;  2C73 A;  1PXB A;  2TPR A;  2WPF A;  3GWD A;  4ECH A;  4H4S A;  1QJD A;  2E4G A;  3DK9 A;  4WCT A;  2F5Z A;  2WOI A;  4B1B A;  1GND A;  1GTH A;  1ZOV A;  1E1N A;  1VG0 A;  2ACZ A;  4XXG A;  3R9U A;  3WE0 A;  4NTD A;  1H7W A;  3ICS A;  3SZ0 A;  4RG4 A;  3PS9 A;  2WEU A;  4AT0 A;  4H4Q A;  4WX1 A;  4TM3 A;  1GRT A;  1PBE A;  2BC0 A;  1TDE A;  1VDC A;  2CVJ A;  1BGN A;  2BYB A;  1MOK A;  1YQZ A;  2PHH A;  2C72 A;  1TDN A;  2V61 A;  2VQB A;  4B65 A;  2B9X A;  3HYV A;  1IJH A;  4H4W A;  1EL7 A;  1ZX9 A;  3DA1 A;  2WQY A;  3ALJ A;  2EQ7 A;  2R46 A;  1XAN A;  3D1C A;  1RSG A;  4U8P A;  2OA1 A;  1FCD A;  1H82 A;  4J31 A;  2GEW A;  3FPZ A;  3IF9 A;  2YLS A;  3T2K A;  1W4X A;  2OLN A;  3LJP A;  1TDO A;  2NVK X;  1IUV A;  1IUW A;  2BC1 A;  1GES A;  3EAO A;  2A87 A;  3EPT A;  1ZKQ A;  4IV9 A;  5FMH A;  3ADA B;  4BK1 A;  1CC4 A;  5BUL A;  3UKQ A;  3AEF A;  3UTE A;  4J57 A;  2V60 A;  4EQX A;  2YR5 A;  5IQ4 A;  2R45 A;  4Y4N A;  4H2P A;  5HXI A;  3P4P A;  4U2L A;  3H8I A;  1JNZ A;  1YKJ A;  3AEE A;  2XLP A;  1DNC A;  4LU6 A;  2VVM A;  4U8J A;  3CGC A;  3GRT A;  3UOZ A;  4Z2R A;  4OVI A;  3AE4 A;  5BUK A;  1GER A;  3RP6 A;  2JB1 A;  4YSY A;  2FJD A;  2YQU A;  4RG3 A;  5M10 A;  2R4J A;  5BVA A;  3OZ2 A;  3DJD A;  2BAC A;  2NPX A;  2XLU A;  2YLT A;  2YG6 A;  2A8X A;  3EF6 A;  4PAB A;  1E1L A;  4B69 A;  3T14 A;  1BWC A;  4GAP A;  1D5T A;  4RSL A;  3QSS A;  4I59 A;  2WOV A;  1JRX A;  1EL9 A;  3NYF A;  3NTA A;  3UCL A;  3ABV A;  2Q0K A;  2BXR A;  1D4E A;  4DSG A;  4O5U A;  3PO7 A;  3CGE A;  3LAD A;  3UKH A;  4U8I A;  4B63 A;  2OAM A;  2RGH A;  1PHH A;  3P9U A;  3S5W A;  4AOX A;  1ELI A;  2GR1 A;  3F8R A;  1BF3 A;  5U25 A;  3SFE A;  4DNA A;  5ER0 A;  5KNL A;  2JBV A;  2CDU A;  4G73 A;  4H4Y A;  1TDF A;  4P9S A;  2BCP A;  1IUX A;  3UKL A;  1V59 A;  5IQ1 A;  1N1P A;  2VOU A;  1LQT A;  2BS2 A;  4IVM B;  2GR2 A;  3VR9 A;  2AR8 A;  3AE5 A;  3QJ4 A;  1BKW A;  2RAB A;  1NPX A;  2XVF A;  3DME A;  1REO A;  3AE2 A;  3II4 A;  3FIM B;  2VRL A;  1UKV G;  2GB0 A;  1E1K A;  1JEH A;  1OJT A;  1GRF A;  3ZDN A;  4JY3 A;  3NRN A;  4BK2 A;  3AEG A;  3AWI A;  4CBQ A;  4EMJ A;  1F8S A;  2GR0 A;  2VQ7 A;  3UOV A;  3AE3 A;  1F3P A;  1H84 A;  3VQR A;  3VRB A;  3UKK A;  5KOX A;  2YM1 A;  3VRA A;  3CNP A;  3GYI A;  1GPE A;  4YT0 A;  3LZW A;  2X3N A;  3RHA A;  3SQP A;  3AE7 A;  1NHS A;  3BI4 A;  2A89 A;  4GR1 A;  4REK A;  2ZZ0 A;  3KVE A;  1XDI A;  4K7Z A;  3CN8 A;  2YG7 A;  3G5Q A;  4G9K A;  2WBA A;  2BK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...