3K7TA

Crystal structure of apo-form 6-hydroxy-l-nicotine oxidase, crystal form p3121
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 117
structure length 425
sequence length 425
chains with identical sequence B
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7tA01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7tA02
1K4QA 2QA1A 1GREA 2R45A 2JBVA 2Z5YA 5JCMA 4H4TA 1CBOA 2YLTA 1EL7A 2WOVA 3IF9A 3PS9A 1BKWA 3UKQA 4ECHA 5LV9A 3AD8B 4ZN0A 4Z24A 1GV4A 4K22A 2OALA 4KPRA 4C77A 4DSHA 1VG0A 5EB4A 3P4SA 2XFUA 2YQUA 1ZDLA 1CC6A 2GR3A 3EAOA 3UTHA 2YR5A 1H83A 3AE4A 3GWDA 1H84A 4Z2RA 3NYFA 1LTXR 4PABA 2C3CA 2C73A 4CCQA 3AEAA 4A65A 2GQFA 4I59A 1ZK7A 1Q1RA 3UKFA 2BK5A 3D1CA 4YWOA 2VZ2A 3AD9B 3NK0X 3GMCA 4JNAA 5FS9A 2Y6RA 2E5VA 3QVRA 4H4RA 2YG4A 2WDQA 3L8KA 1L0VA 1YQZA 4EMJA 2VOUA 3QSEA 3DGHA 3VR8A 1M6IA 3P4QA 4E0VA 4I58A 3M0OA 3EPTA 1VRQB 1GT8A 1F6MA 4FDCB 5C3JA 3S5WA 1PBDA 3NH3X 3VRAA 2JB1A 2X99A 3CGBA 2VVLG 3II4A 1JU2A 1XHCA 1Y56A 2APGA 2CULA 4NEWA 4UDRA 2XLUA 3SGLA 2GR0A 1S2YA 2H88A 3DA1A 4A99A 1KDGA 3QSMA 4GR1A 5GRTA 2VRLA 4EM4A 1EL8A 3DJEA 2NPXA 4YKFA 3S61A 2FBWA 3NGCX 2A87A 1E1LA 2BC1A 3LZXA 4J56A 3K7QX 4GCMA 4TM4A 3NYCA 4CRTA 3V3OA 2A8XA 3UTEA 4H4QA 1N4WA 3VQRA 1TRBA 2AAQA 3P4PA 3K30A 1LJ1A 4U8NA 4CY6A 4Z25A 5JCNA 5U25A 4WCTA 3P4RA 3KD9A 3DJGX 3PVCA 3H8LA 3Q6JA 3GMBA 4OPGA 2GQWA 2GRTA 2OLNA 4XWZA 5TR3A 4CY8A 4YSZA 1KNPA 1P2HA 4HB9A 2Z5XA 3CPHG 3LADA 4B67A 1L9DA 5KOXA 3NN0X 3QSSA 4FK1A 5L46A 3UKKA 4A6NB 3SQPA 1E6EA 1O94A 2ZZCA 1BF3A 1H86A 1YKJA 5BUKA 4ZCCA 3RHAA 2JB3A 2C3DA 3CNDA 2DKIA 3G5QA 3GYJA 1GTHA 3NT6A 1JNZA 1L9EA 1CJCA 4TM0A 4X4JA 2CFYA 5HY5A 1H7XA 1VG9A 4TLZA 4D04A 1FEAA 3E1TA 4C3YA 3GD3A 1JNRA 4OPCA 2BK4A 4YSYA 1NHRA 1Y0PA 4NTEA 3AE1A 3SFDA 2B9WA 1OJAA 1BWCA 2FJEA 2V60A 1CC4A 2WS3A 3KKJA 4C74A 4Z26A 3CGEA 4ZCDA 2WP9A 2X8HA 3DK4A 3AE3A 5EOWA 3NN6X 2WU2A 4REKA 4C5OA 1PN0A 4UP3A 4XXGA 1IUTA 1GXFA 4Z44A 2XLSA 2XVFA 3CGDA 3GDNA 3L1RA 3QFBA 4B64A 2PHHA 2V61A 3NK1X 3I3LA 4YTPA 1B5QA 3RP8A 2BCGG 1CJ4A 3ZDNA 4EIQA 1IUWA 1GRHA 1ELIA 3CNTA 1IUXA 3FIMB 1LV0A 2GF3A 2YLRA 3F8DA 4UDPA 1NEKA 2JB2A 3UOXA 3AD7B 3QFAA 1CJ3A 2WP6A 1PS9A 2C65A 2H89A 1NG3A 4X9MA 2PYXA 2YM1A 2IVDA 3CNPA 2B7RA 4AT2A 4A6NA 4GDPA 2WPCA 3ITJA 1GSNA 1K0IA 4K5SA 4DGKA 3F8PA 2BK3A 2GVCA 3KA7A 4Y4NA 1Q9IA 3AE6A 5IPYA 2ZZ0A 4EMWA 3BI5A 5ER0A 3ZYXA 1S3BA 4YSHA 1NAAA 2WOIA 3V76A 2EQ7A 4ICYA 3UP4A 1H6VA 4GDEA 3NTDA 3AE7A 1PXBA 4YT0A 4OPTA 1P2EA 1DJNA 5BVAA 1D4CA 2BABA 2JK6A 1D7LA 3SFEA 1X31B 2GH5A 5CKUA 1B8SA 4U2LA 4N9XA 4PAAA 4K5RA 4ADWA 5JCKA 3Q9TA 4OVIA 1QLBA 3ABVA 4FX9A 3H4KA 1IUUA 1ZMCA 1MOKA 4A9WA 4Y4MA 4DSGA 4BK3A 1OJDA 1PXCA 1DOBA 4RG4A 3UP5A 2BS3A 4OPUA 2YG6A 2E4GA 3NIXA 4AP3A 1H82A 2TMDA 2OAMA 1JOAA 3P9UA 2YVGA 5FS8A 5FS6A 2WHDA 4BURA 1ZOVA 3JSKA 2BXSA 2WOWA 3C96A 2BCPA 2R9ZA 2W0HA 3DJJA 2WETA 4JNQA 3CPJG 3UKPA 4BJZA 3LJPA 3GYIA 3UOYA 2X3NA 3DGZA 3UKLA 3VRBA 2R0PA 2GAHB 1SEZA 3GRTA 4U8JA 5EBKA 4RG3A 3ALJA 3BNUA 4B69A 3AEBA 4Z43A 1B4VA 2AR8A 4H7UA 4OPDA 2YG3A 1K0JA 2A89A 2GAGB 3NNEA 4IVMB 3BHFA 2UZZA 1VDCA 3B3RA 4EQSA 4H4XA 1B37A 2WBAA 1UKVG 3CNJA 1E7PA 1NG4A 2GMHA 2O9ZA 2XLRA 4OCGA 2Y6QA 2BYBA 3COXA 5HHFA 2XVJA 5KVIA 1PBFA 2RGOA 3ATQA 2B9XA 1NHSA 3C4AA 2WU5A 4EQXA 4EM3A 1NPXA 1REOA 3AWIA 1PJ5A 2CDUA 1NDAA 3BHKA 3DH9A 1BZLA 3F8RA 3G5RA 4U8KA 5U1OA 4HA6A 2WQYA 4DNAA 1OJCA 1GNDA 1COYA 4J34A 1K0LA 2EQ9A 1E1KA 3IC9A 5FS7A 1E1MA 3FPZA 1PDHA 3AYIA 4NTDA 3GSIA 3KVEA 1ZKQA 3UTGA 3GDPA 3K7TA 1PXAA 4IA6A 3AEEA 3BI4A 1CJ2A 3WE0A 1ONFA 3BI2A 1KSSA 2YM2A 2CVJA 1N1PA 4A7AA 2X8GA 3I6DA 1S3EA 2XVEA 4U8PA 4YKGA 1JRXA 1PHHA 2RGHA 2Q7VA 4IV9A 1GRFA 4U8IA 2R0GA 5GSNA 4NEVA 3SM8A 4Y4LA 4TM1A 4B63A 2R4EA 2YLSA 3EANA 3UKAA 1E1NA 1HYUA 5FMHA 1M64A 3AB1A 4BK2A 3AEDA 1D4EA 2C7GA 2TPRA 3ICSA 3CPIG 1KSUA 1N4VA 4JY3A 2QA2A 1DOEA 1DJQA 2GMJA 1S2QA 1GETA 2HQMA 3NYEA 3CIRA 5KWFA 4KX6A 1DODA 5CQFA 2QAEA 2XFNA 2WDVA 3AYJA 2C76A 3EF6A 3DMEA 3UOVA 1TYPA 2GB0A 3AEGA 4IVOB 3VRDB 3KU9A 4CCRA 4H2NA 2EQ8A 1O95A 3UTFA 4EIPA 1IUVA 1PJ7A 3RP6A 2OLOA 2YLWA 5J60A 4U2SA 5M0ZA 2XCGA 3QVPA 1GOSA 5IQ4A 4TM3A 1F8WA 2ACZA 5EB5A 1O5WA 4GUVA 4BK1A 3B6DA 2IVEA 2YAUA 3D8XA 2JKCA 3C4NA 2YLXA 4GF7A 3ICTA 4H4WA 3CNSA 5BULA 1TDKA 2XLPA 2VVMA 2Q6UA 3UKHA 4Z2UA 5KRQA 4FK1C 2AQJA 2Q0LA 2WEUA 1GTEA 3KLJA 4MJWA 5JCLA 1BGNA 2YLZA 1IUSA 3M13A 4J36A 4RSLA 4YTNA 3ISHA 5DBJA 3NK2X 3VR9A 4D03A 3LZWA 4YSXA 2V3AA 1RSGA 3CGCA 4UDQA 1CHUA 3R9UA 1PBCA 1PBEA 4LU6A 1OJTA 1GRTA 1RYIA 2WPFA 1TDEA 2C70A 2R46A 1D5TA 2YR6A 4AOSA 3FBSA 2QCUA 2VRMA 4LIIA 4H4PA 4U8MA 4JN9A 1EL5A 1YY5A 3KPFA 1D7YA 1KF6A 2BXRA 5KXJA 2F5ZA 2XFPA 3DK8A 3URHA 1FECA 4IA5A 1F3PA 4U8OA 2B76A 4J57A 2BC0A 2FJAA 1YQ3A 1CL0A 2Q0KA 1TDNA 4OPIA 4JDRA 1TDFA 3UOZA 1LVLA 1RP0A 1ZMDA 3P1WA 2B7SA 2C75A 1Z6LA 4A79A 5HXIA 1BGJA 1OJ9A 4USRA 3RP7A 1NHPA 4O5UA 4BJYA 2YWLA 3LOVA 2BACA 2R4JA 2WDRA 3UCLA 3GD4A 1KFYA 4AT0A 4Z2TA 3IWAA 4K7ZA 3NHOX 3ATRA 5U63A 4USQA 3RNMA 3IHMA 4B65A 4GRTA 3ALLA 2C67A 1H81A 1ZOYA 2RABA 2EQ6A 1CF3A 1LQTA 3O0HA 4U2TA 1GALA 1PBBA 1QO8A 3LB8A 4H4VA 5IQ1A 1PJ6A 4H4UA 4K2XA 1FOHA 1FEBA 3AE5A 2GR2A 2NVKX 1W4XA 1ZP0A 5HYMA 2XVIA 4NZHA 4H2QA 4JQ9A 4U8LA 3ALMA 3OZ2A 2GEWA 3AE8A 3FMWA 2J3NA 1LQUA 3BNMA 4O5QA 4H4SA 1LPFA 1DXLA 1GPEA 3ICRA 4YXDA 4LA1A 2X8CA 2XYOA 1XDIA 4YTMA 1FL2A 3DJDA 2X50A 5KOWA 2WPEA 2YVJA 4CBQA 1ZY8A 5J7XA 3T37A 4JY2A 1EL9A 4H2PA 2VQBA 4CNJA 4H50A 2I0ZA 1AOGA 2C72A 1TYTA 1XANA 2WP5A 2YVFA 3AEFA 4OPLA 4CNKA 4J31A 1JRYA 2VQ7A 2BS2A 4AOXA 4EQWA 1KNRA 1GRAA 2GR1A 5C2TA 4H2RA 3CN8A 1H7WA 3REDA 3AYLA 4B66A 2GV8A 5JCIA 3NTAA 1Q1WA 2OA1A 2WESA 2YG5A 1GRGA 1JEHA 4TLXA 2V3BA 3ADAB 3V3NA 2JAEA 1XPQA 2V5ZA 2R0CA 3AXBA 4WX1A 2C64A 1E39A 3G5SA 4BV6A 1GEUA 1FCDA 1GRBA 2BS4A 5BRTA 2XFOA 3HZLA 3NKSA 3NRNA 3NG7X 1VQWA 3H8IA 3LXDA 1DNCA 2ARDA 1Y56B 2V6OA 2ZZBA 3OC4A 4AP1A 3DK9A 4H4ZA 1F8RA 4H4YA 4X9NA 1GERA 4B1BA 3IHGA 4M52A 1GESA 2XLTA 2YG7A 1YQ4A 4EMIA 1V59A 4EQRA 3PO7A 1D4DA 5M10A 2FJBA 3K7MX 2BA9A 1QJDA 3AECA 2VVLA 3AE2A 3M12A 2ZBWA 4J33A 1IJHA 2C66A 4A5LA 1DOCA 2XVHA 3GWFA 1MXTA 4P9SA 2B9YA 4B68A 4C3XA 1JRZA 3FG2P 1ZX9A 2YR4A 1CC2A 1EBDA 2XDOA 2E1MA 4APNA 5KVHA 1N4UA 4NTCA 2DKHA 1L9CA 1TDOA 1F8SA 1NENA 3CTYA 4K8DA 2XFQA 2RGJA 3AE9A 2IIDA 4J2WA 3GRSA 1MO9A 2FJDA 1NHQA 3NLCA 4XWRA 3QJ4A
chains in the Genus database with same CATH superfamily
1K4QA 2QA1A 1GREA 2R45A 2JBVA 2Z5YA 5JCMA 4H4TA 1CBOA 2YLTA 1EL7A 2WOVA 3IF9A 3PS9A 1BKWA 3UKQA 4ECHA 5LV9A 3AD8B 4NWZA 4ZN0A 4Z24A 1GV4A 4K22A 2OALA 4KPRA 4C77A 4DSHA 1VG0A 5EB4A 3P4SA 2XFUA 2YQUA 1ZDLA 1CC6A 2GR3A 3EAOA 3UTHA 2YR5A 1H83A 3AE4A 3GWDA 1H84A 4Z2RA 3NYFA 1LTXR 4PABA 2C3CA 2C73A 4CCQA 3AEAA 4A65A 2GQFA 4I59A 1ZK7A 1Q1RA 3UKFA 2BK5A 3D1CA 4YWOA 2VZ2A 3AD9B 3NK0X 3GMCA 4JNAA 5FS9A 2Y6RA 2E5VA 3QVRA 4H4RA 2YG4A 2WDQA 3L8KA 1L0VA 3SY4A 1YQZA 4EMJA 2VOUA 4G6HA 3QSEA 3DGHA 3VR8A 1M6IA 3P4QA 4E0VA 4I58A 3M0OA 3EPTA 1VRQB 1GT8A 1F6MA 4FDCB 5C3JA 3S5WA 1PBDA 3NH3X 3VRAA 2JB1A 2X99A 3CGBA 2VVLG 3II4A 1JU2A 1XHCA 1Y56A 2APGA 2CULA 4G73A 4NEWA 4UDRA 2XLUA 3SGLA 2GR0A 1S2YA 2H88A 3DA1A 4A99A 1KDGA 3QSMA 4GR1A 5GRTA 2VRLA 4EM4A 1EL8A 3DJEA 2NPXA 4YKFA 3S61A 2FBWA 3NGCX 2A87A 1E1LA 2BC1A 3LZXA 4J56A 3K7QX 4GCMA 4TM4A 3NYCA 4CRTA 3V3OA 2A8XA 3UTEA 4H4QA 1N4WA 3VQRA 1TRBA 2AAQA 3P4PA 3K30A 1LJ1A 4U8NA 4CY6A 4Z25A 5JCNA 5U25A 4WCTA 3P4RA 5KMQA 3KD9A 3DJGX 3PVCA 3H8LA 3Q6JA 3GMBA 4OPGA 2GQWA 2GRTA 2OLNA 4XWZA 5TR3A 4CY8A 4YSZA 1KNPA 1P2HA 4HB9A 3SZ0A 2Z5XA 3CPHG 3LADA 4B67A 1L9DA 5KOXA 3NN0X 3QSSA 4FK1A 5L46A 3UKKA 4A6NB 3SQPA 1E6EA 1O94A 2ZZCA 1BF3A 1H86A 1YKJA 5BUKA 4ZCCA 3SZFA 3RHAA 2JB3A 2C3DA 3CNDA 2DKIA 3G5QA 3GYJA 1GTHA 3NT6A 1JNZA 1L9EA 1CJCA 4TM0A 4X4JA 2CFYA 5HY5A 1H7XA 1VG9A 4TLZA 4D04A 5KNLA 1FEAA 3E1TA 4C3YA 3GD3A 1JNRA 4OPCA 2BK4A 4YSYA 1NHRA 1Y0PA 4NTEA 3AE1A 3SFDA 2B9WA 1OJAA 1BWCA 2FJEA 2V60A 1CC4A 2WS3A 3KKJA 4C74A 4Z26A 3CGEA 4ZCDA 2WP9A 2X8HA 3DK4A 3AE3A 5EOWA 3NN6X 2WU2A 4REKA 4C5OA 1PN0A 4UP3A 4XXGA 1IUTA 1GXFA 4Z44A 2XLSA 2XVFA 3CGDA 3GDNA 3L1RA 3QFBA 4B64A 2PHHA 2V61A 3NK1X 3I3LA 4YTPA 1B5QA 3RP8A 2BCGG 1CJ4A 3ZDNA 4EIQA 1IUWA 1GRHA 1ELIA 3CNTA 1IUXA 3FIMB 1LV0A 2GF3A 2YLRA 3F8DA 4UDPA 1NEKA 4GAPA 2JB2A 3T2ZA 3UOXA 3AD7B 3QFAA 1CJ3A 2WP6A 1PS9A 2C65A 2H89A 1NG3A 4X9MA 2PYXA 2YM1A 2IVDA 3CNPA 2B7RA 4AT2A 4A6NA 4GDPA 2WPCA 3ITJA 1GSNA 1K0IA 4K5SA 4DGKA 3F8PA 2BK3A 2GVCA 3KA7A 4Y4NA 1Q9IA 3AE6A 5IPYA 2ZZ0A 4EMWA 3BI5A 5ER0A 3ZYXA 1S3BA 4YSHA 1NAAA 2WOIA 3V76A 2EQ7A 4ICYA 3UP4A 1H6VA 4GDEA 3NTDA 3AE7A 1PXBA 4YT0A 4OPTA 1P2EA 1DJNA 5BVAA 1D4CA 2BABA 2JK6A 1D7LA 3SFEA 1X31B 2GH5A 5CKUA 1B8SA 4U2LA 4N9XA 4NNJA 4K5RA 4PAAA 4ADWA 5JCKA 3Q9TA 4OVIA 1QLBA 3ABVA 4FX9A 3H4KA 1IUUA 1ZMCA 1MOKA 4A9WA 4Y4MA 4DSGA 4BK3A 1OJDA 1PXCA 1DOBA 4RG4A 3UP5A 2BS3A 4OPUA 2YG6A 2E4GA 3NIXA 4AP3A 1H82A 2TMDA 2OAMA 1JOAA 3P9UA 2YVGA 5FS8A 5FS6A 2WHDA 4BURA 1ZOVA 3JSKA 2BXSA 2WOWA 3C96A 2BCPA 2R9ZA 2W0HA 3DJJA 2WETA 4JNQA 3CPJG 3UKPA 4BJZA 3LJPA 3GYIA 4G9KA 3UOYA 2X3NA 3DGZA 3UKLA 3VRBA 2R0PA 2GAHB 1SEZA 3GRTA 4U8JA 5EBKA 4RG3A 3ALJA 3BNUA 4B69A 3AEBA 4Z43A 1B4VA 2AR8A 4H7UA 3T31A 4OPDA 2YG3A 1K0JA 2A89A 2GAGB 3NNEA 4IVMB 3BHFA 2UZZA 1VDCA 3B3RA 4EQSA 4H4XA 1B37A 2WBAA 1UKVG 3CNJA 1E7PA 1NG4A 2GMHA 2O9ZA 2XLRA 4OCGA 2Y6QA 2BYBA 3COXA 5HHFA 2XVJA 5KVIA 1PBFA 2RGOA 3ATQA 2B9XA 1NHSA 3C4AA 2WU5A 4EQXA 4EM3A 1NPXA 1REOA 3AWIA 1PJ5A 2CDUA 1NDAA 3BHKA 3DH9A 1BZLA 3F8RA 3G5RA 4U8KA 3SZCA 5U1OA 4HA6A 2WQYA 3KPKA 4DNAA 1OJCA 1GNDA 1COYA 4J34A 1K0LA 2EQ9A 1E1KA 3IC9A 5FS7A 1E1MA 4GAVA 3FPZA 1PDHA 3AYIA 4NTDA 3GSIA 3KVEA 1ZKQA 3UTGA 3GDPA 3K7TA 1PXAA 4IA6A 3AEEA 3BI4A 1CJ2A 3WE0A 1ONFA 3BI2A 1KSSA 2YM2A 2CVJA 1N1PA 4A7AA 2X8GA 3I6DA 1S3EA 2XVEA 4U8PA 4YKGA 1JRXA 1PHHA 3HYWA 2RGHA 2Q7VA 4IV9A 1GRFA 4U8IA 5KMRA 2R0GA 5GSNA 4NEVA 4II2A 3SM8A 3GYXA 3T0KA 3SXIA 4Y4LA 4TM1A 4B63A 2R4EA 2YLSA 3EANA 3UKAA 1E1NA 1HYUA 5FMHA 1M64A 3AB1A 4BK2A 3AEDA 1D4EA 2C7GA 2TPRA 3ICSA 3CPIG 1KSUA 1N4VA 4JY3A 2QA2A 1DOEA 1DJQA 2GMJA 1S2QA 1GETA 2HQMA 3NYEA 3CIRA 5KWFA 4KX6A 1DODA 5CQFA 2QAEA 2XFNA 2WDVA 3AYJA 2C76A 3EF6A 3DMEA 3UOVA 1TYPA 2GB0A 3AEGA 4IVOB 3VRDB 3KU9A 4CCRA 4H2NA 2EQ8A 1O95A 3UTFA 4EIPA 1IUVA 1PJ7A 3RP6A 2OLOA 2YLWA 5J60A 4U2SA 5M0ZA 2XCGA 3QVPA 1GOSA 5IQ4A 4TM3A 1F8WA 2ACZA 5EB5A 1O5WA 4GUVA 4BK1A 3B6DA 2IVEA 2YAUA 3D8XA 2JKCA 3C4NA 3SX6A 2YLXA 4GF7A 3ICTA 4H4WA 3CNSA 5BULA 1TDKA 3T2YA 2XLPA 2VVMA 2Q6UA 3UKHA 4Z2UA 5KRQA 4FK1C 2AQJA 2Q0LA 2WEUA 1GTEA 3KLJA 4MJWA 5JCLA 1BGNA 2YLZA 1IUSA 3M13A 4J36A 4RSLA 4YTNA 3ISHA 5DBJA 3NK2X 4G74A 3VR9A 4D03A 3LZWA 4YSXA 2V3AA 1RSGA 3CGCA 4UDQA 1CHUA 3R9UA 1PBCA 1PBEA 4LU6A 1OJTA 1GRTA 1RYIA 2WPFA 1TDEA 2C70A 2R46A 1D5TA 2YR6A 3CMMA 4AOSA 2BRYA 2QCUA 2VRMA 3FBSA 4LIIA 4H4PA 4U8MA 4JN9A 1EL5A 1YY5A 3KPFA 1D7YA 1KF6A 2BXRA 3SZWA 2F5ZA 2XFPA 3DK8A 3URHA 5KXJA 1FECA 4IA5A 1F3PA 4U8OA 2B76A 4J57A 2BC0A 2FJAA 1YQ3A 1CL0A 2Q0KA 1TDNA 4OPIA 4JDRA 1TDFA 3UOZA 1LVLA 1RP0A 1ZMDA 3P1WA 2B7SA 2C75A 1Z6LA 4A79A 5HXIA 2BRAA 1BGJA 1OJ9A 4USRA 3RP7A 1NHPA 4O5UA 4G6GA 4BJYA 2YWLA 3LOVA 2BACA 2R4JA 2WDRA 3UCLA 3GD4A 1KFYA 4AT0A 4Z2TA 3IWAA 4K7ZA 3NHOX 3ATRA 5U63A 4USQA 3RNMA 3IHMA 4B65A 4GRTA 3ALLA 2C67A 1H81A 1ZOYA 2RABA 2EQ6A 1CF3A 1LQTA 3O0HA 4U2TA 1GALA 1PBBA 1QO8A 3LB8A 4H4VA 5IQ1A 1PJ6A 3T14A 4H4UA 4K2XA 1FOHA 1FEBA 3AE5A 2GR2A 2NVKX 1W4XA 1ZP0A 5HYMA 2XVIA 4NZHA 4H2QA 4JQ9A 4U8LA 3ALMA 3OZ2A 2GEWA 3AE8A 3FMWA 2J3NA 1LQUA 5KMPA 3BNMA 4O5QA 4H4SA 1LPFA 1DXLA 1GPEA 3ICRA 4YXDA 4LA1A 2X8CA 2XYOA 1XDIA 4YTMA 1FL2A 3DJDA 2X50A 5KOWA 2WPEA 2YVJA 4CBQA 1ZY8A 5KMSA 5J7XA 3T37A 4JY2A 1EL9A 4H2PA 2VQBA 4CNJA 4H50A 2I0ZA 1AOGA 2C72A 1TYTA 1XANA 2WP5A 2YVFA 3AEFA 4OPLA 4CNKA 4J31A 1JRYA 2VQ7A 2BS2A 4AOXA 4EQWA 1KNRA 1GRAA 2GR1A 5C2TA 4H2RA 3CN8A 1H7WA 3REDA 3AYLA 4B66A 2GV8A 5JCIA 3NTAA 1Q1WA 2OA1A 2WESA 4II3A 2YG5A 1GRGA 1JEHA 4TLXA 2V3BA 3ADAB 3V3NA 2JAEA 1XPQA 2V5ZA 2R0CA 3AXBA 4WX1A 2C64A 1E39A 3G5SA 4BV6A 1GEUA 1FCDA 1GRBA 2BS4A 5BRTA 2XFOA 3HZLA 3NKSA 3NRNA 3SYIA 3NG7X 1VQWA 3H8IA 3LXDA 1DNCA 2ARDA 1Y56B 2V6OA 2ZZBA 3OC4A 4AP1A 3DK9A 4H4ZA 1F8RA 4H4YA 4X9NA 1GERA 4B1BA 3IHGA 4M52A 1GESA 2XLTA 2YG7A 1YQ4A 4EMIA 1V59A 3HYVA 4EQRA 3HYXA 3PO7A 1D4DA 5M10A 2FJBA 3K7MX 2BA9A 1QJDA 3AECA 2VVLA 3AE2A 3M12A 2ZBWA 4J33A 1IJHA 2C66A 4A5LA 1DOCA 2XVHA 3GWFA 1MXTA 4P9SA 2B9YA 4B68A 4C3XA 1JRZA 3FG2P 1ZX9A 2YR4A 1CC2A 1EBDA 2XDOA 2E1MA 4APNA 5KVHA 1N4UA 4NTCA 2DKHA 1L9CA 1TDOA 1F8SA 1NENA 3CTYA 3T2KA 4K8DA 2XFQA 2RGJA 3AE9A 2IIDA 2C4CA 4J2WA 3GRSA 1MO9A 2FJDA 1NHQA 3NLCA 4XWRA 3QJ4A
chains in the Genus database with same CATH topology
1K4QA 2QA1A 1GREA 2R45A 2JBVA 2Z5YA 5JCMA 4H4TA 1CBOA 2YLTA 1EL7A 2WOVA 3IF9A 3PS9A 1BKWA 3UKQA 4ECHA 5LV9A 3AD8B 4NWZA 4ZN0A 4Z24A 1GV4A 4K22A 2OALA 4KPRA 4C77A 4DSHA 1VG0A 5EB4A 3P4SA 2XFUA 2YQUA 1ZDLA 1CC6A 2GR3A 3EAOA 3UTHA 2YR5A 1H83A 3AE4A 3GWDA 1H84A 4Z2RA 3NYFA 1LTXR 4PABA 2C3CA 2C73A 4CCQA 3AEAA 4A65A 2GQFA 4I59A 1ZK7A 1Q1RA 3UKFA 2BK5A 3D1CA 4YWOA 2VZ2A 3AD9B 3NK0X 3GMCA 4JNAA 5FS9A 2Y6RA 2E5VA 3QVRA 4H4RA 2YG4A 2WDQA 3L8KA 1L0VA 3SY4A 1YQZA 4EMJA 2VOUA 4G6HA 3QSEA 3DGHA 3VR8A 1M6IA 3P4QA 4E0VA 4I58A 3M0OA 3EPTA 1VRQB 1GT8A 1F6MA 4FDCB 5C3JA 3S5WA 1PBDA 3NH3X 3VRAA 2JB1A 2X99A 3CGBA 2VVLG 3II4A 1JU2A 1XHCA 1Y56A 2APGA 2CULA 4G73A 4NEWA 4UDRA 2XLUA 3SGLA 2GR0A 1S2YA 2H88A 3DA1A 4A99A 1KDGA 3QSMA 4GR1A 5GRTA 2VRLA 4EM4A 1EL8A 3DJEA 2NPXA 4YKFA 3S61A 2FBWA 3NGCX 2A87A 1E1LA 2BC1A 3LZXA 4J56A 3K7QX 4GCMA 4TM4A 3NYCA 4CRTA 3V3OA 2A8XA 3UTEA 4H4QA 1N4WA 3VQRA 1TRBA 2AAQA 3P4PA 3K30A 1LJ1A 4U8NA 4CY6A 4Z25A 5JCNA 5U25A 4WCTA 3P4RA 5KMQA 3KD9A 3DJGX 3PVCA 3H8LA 3Q6JA 3GMBA 4OPGA 2GQWA 2GRTA 2OLNA 4XWZA 5TR3A 4CY8A 4YSZA 1KNPA 1P2HA 4HB9A 3SZ0A 2Z5XA 3CPHG 3LADA 4B67A 1L9DA 5KOXA 3NN0X 3QSSA 4FK1A 5L46A 3UKKA 4A6NB 3SQPA 1E6EA 1O94A 2ZZCA 1BF3A 1H86A 1YKJA 5BUKA 4ZCCA 3SZFA 3RHAA 2JB3A 2C3DA 3CNDA 2DKIA 3G5QA 3GYJA 1GTHA 3NT6A 1JNZA 1L9EA 1CJCA 4TM0A 4X4JA 2CFYA 5HY5A 1H7XA 1VG9A 4TLZA 4D04A 5KNLA 1FEAA 3E1TA 4C3YA 3GD3A 1JNRA 4OPCA 2BK4A 4YSYA 1NHRA 1Y0PA 4NTEA 3AE1A 3SFDA 2B9WA 1OJAA 1BWCA 2FJEA 2V60A 1CC4A 2WS3A 3KKJA 4C74A 4Z26A 3CGEA 4ZCDA 2WP9A 2X8HA 3DK4A 3AE3A 5EOWA 3NN6X 2WU2A 4REKA 4C5OA 1PN0A 4UP3A 4XXGA 1IUTA 1GXFA 4Z44A 2XLSA 2XVFA 3CGDA 3GDNA 3L1RA 3QFBA 4B64A 2PHHA 2V61A 3NK1X 3I3LA 4YTPA 1B5QA 3RP8A 2BCGG 1CJ4A 3ZDNA 4EIQA 1IUWA 1GRHA 1ELIA 3CNTA 1IUXA 3FIMB 1LV0A 2GF3A 2YLRA 3F8DA 4UDPA 1NEKA 4GAPA 2JB2A 3T2ZA 3UOXA 3AD7B 3QFAA 1CJ3A 2WP6A 1PS9A 2C65A 2H89A 1NG3A 4X9MA 2PYXA 2YM1A 2IVDA 3CNPA 2B7RA 4AT2A 4A6NA 4GDPA 2WPCA 3ITJA 1GSNA 1K0IA 4K5SA 4DGKA 3F8PA 2BK3A 2GVCA 3KA7A 4Y4NA 1Q9IA 3AE6A 5IPYA 2ZZ0A 4EMWA 3BI5A 5ER0A 3ZYXA 1S3BA 4YSHA 1NAAA 2WOIA 3V76A 2EQ7A 4ICYA 3UP4A 1H6VA 4GDEA 3NTDA 3AE7A 1PXBA 4YT0A 4OPTA 1P2EA 1DJNA 5BVAA 1D4CA 2BABA 2JK6A 1D7LA 3SFEA 1X31B 2GH5A 5CKUA 1B8SA 4U2LA 4N9XA 4NNJA 4K5RA 4PAAA 4ADWA 5JCKA 3Q9TA 4OVIA 1QLBA 3ABVA 4FX9A 3H4KA 1IUUA 1ZMCA 1MOKA 4A9WA 4Y4MA 4DSGA 4BK3A 1OJDA 1PXCA 1DOBA 4RG4A 3UP5A 2BS3A 4OPUA 2YG6A 2E4GA 3NIXA 4AP3A 1H82A 2TMDA 2OAMA 1JOAA 3P9UA 2YVGA 5FS8A 5FS6A 2WHDA 4BURA 1ZOVA 3JSKA 2BXSA 2WOWA 3C96A 2BCPA 2R9ZA 2W0HA 3DJJA 2WETA 4JNQA 3CPJG 3UKPA 4BJZA 3LJPA 3GYIA 4G9KA 3UOYA 2X3NA 3DGZA 3UKLA 3VRBA 2R0PA 2GAHB 1SEZA 3GRTA 4U8JA 5EBKA 4RG3A 3ALJA 3BNUA 4B69A 3AEBA 4Z43A 1B4VA 2AR8A 4H7UA 3T31A 4OPDA 2YG3A 1K0JA 2A89A 2GAGB 3NNEA 4IVMB 3BHFA 2UZZA 1VDCA 3B3RA 4EQSA 4H4XA 1B37A 2WBAA 1UKVG 3CNJA 1E7PA 1NG4A 2GMHA 2O9ZA 2XLRA 4OCGA 2Y6QA 2BYBA 3COXA 5HHFA 2XVJA 5KVIA 1PBFA 2RGOA 3ATQA 2B9XA 1NHSA 3C4AA 2WU5A 4EQXA 4EM3A 1NPXA 1REOA 3AWIA 1PJ5A 2CDUA 1NDAA 3BHKA 3DH9A 1BZLA 3F8RA 3G5RA 4U8KA 3SZCA 5U1OA 4HA6A 2WQYA 3KPKA 4DNAA 1OJCA 1GNDA 1COYA 4J34A 1K0LA 2EQ9A 1E1KA 3IC9A 5FS7A 1E1MA 4GAVA 3FPZA 1PDHA 3AYIA 4NTDA 3GSIA 3KVEA 1ZKQA 3UTGA 3GDPA 3K7TA 1PXAA 4IA6A 3AEEA 3BI4A 1CJ2A 3WE0A 1ONFA 3BI2A 1KSSA 2YM2A 2CVJA 1N1PA 4A7AA 2X8GA 3I6DA 1S3EA 2XVEA 4U8PA 4YKGA 1JRXA 1PHHA 3HYWA 2RGHA 2Q7VA 4IV9A 1GRFA 4U8IA 5KMRA 2R0GA 5GSNA 4NEVA 4II2A 3SM8A 3GYXA 3T0KA 3SXIA 4Y4LA 4TM1A 4B63A 2R4EA 2YLSA 3EANA 3UKAA 1E1NA 1HYUA 5FMHA 1M64A 3AB1A 4BK2A 3AEDA 1D4EA 2C7GA 2TPRA 3ICSA 3CPIG 1KSUA 1N4VA 4JY3A 2QA2A 1DOEA 1DJQA 2GMJA 1S2QA 1GETA 2HQMA 3NYEA 3CIRA 5KWFA 4KX6A 1DODA 5CQFA 2QAEA 2XFNA 2WDVA 3AYJA 2C76A 3EF6A 3DMEA 3UOVA 1TYPA 2GB0A 3AEGA 4IVOB 3VRDB 3KU9A 4CCRA 4H2NA 2EQ8A 1O95A 3UTFA 4EIPA 1IUVA 1PJ7A 3RP6A 2OLOA 2YLWA 5J60A 4U2SA 5M0ZA 2XCGA 3QVPA 1GOSA 5IQ4A 4TM3A 1F8WA 2ACZA 5EB5A 1O5WA 4GUVA 4BK1A 3B6DA 2IVEA 2YAUA 3D8XA 2JKCA 3C4NA 3SX6A 2YLXA 4GF7A 3ICTA 4H4WA 3CNSA 5BULA 1TDKA 3T2YA 2XLPA 2VVMA 2Q6UA 3UKHA 4Z2UA 5KRQA 4FK1C 2AQJA 2Q0LA 2WEUA 1GTEA 3KLJA 4MJWA 5JCLA 1BGNA 2YLZA 1IUSA 3M13A 4J36A 4RSLA 4YTNA 3ISHA 5DBJA 3NK2X 4G74A 3VR9A 4D03A 3LZWA 4YSXA 2V3AA 1RSGA 3CGCA 4UDQA 1CHUA 3R9UA 1PBCA 1PBEA 4LU6A 1OJTA 1GRTA 1RYIA 2WPFA 1TDEA 2C70A 2R46A 1D5TA 2YR6A 3CMMA 4AOSA 2BRYA 2QCUA 2VRMA 3FBSA 4LIIA 4H4PA 4U8MA 4JN9A 1EL5A 1YY5A 3KPFA 1D7YA 1KF6A 2BXRA 3SZWA 2F5ZA 2XFPA 3DK8A 3URHA 5KXJA 1FECA 4IA5A 1F3PA 4U8OA 2B76A 4J57A 2BC0A 2FJAA 1YQ3A 1CL0A 2Q0KA 1TDNA 4OPIA 4JDRA 1TDFA 3UOZA 1LVLA 1RP0A 1ZMDA 3P1WA 2B7SA 2C75A 1Z6LA 4A79A 5HXIA 2BRAA 1BGJA 1OJ9A 4USRA 3RP7A 1NHPA 4O5UA 4G6GA 4BJYA 2YWLA 3LOVA 2BACA 2R4JA 2WDRA 3UCLA 3GD4A 1KFYA 4AT0A 4Z2TA 3IWAA 4K7ZA 3NHOX 3ATRA 5U63A 4USQA 3RNMA 3IHMA 4B65A 4GRTA 3ALLA 2C67A 1H81A 1ZOYA 2RABA 2EQ6A 1CF3A 1LQTA 3O0HA 4U2TA 1GALA 1PBBA 1QO8A 3LB8A 4H4VA 5IQ1A 1PJ6A 3T14A 4H4UA 4K2XA 1FOHA 1FEBA 3AE5A 2GR2A 2NVKX 1W4XA 1ZP0A 5HYMA 2XVIA 4NZHA 4H2QA 4JQ9A 4U8LA 3ALMA 3OZ2A 2GEWA 3AE8A 3FMWA 2J3NA 1LQUA 5KMPA 3BNMA 4O5QA 4H4SA 1LPFA 1DXLA 1GPEA 3ICRA 4YXDA 4LA1A 2X8CA 2XYOA 1XDIA 4YTMA 1FL2A 3DJDA 2X50A 5KOWA 2WPEA 2YVJA 4CBQA 1ZY8A 5KMSA 5J7XA 3T37A 4JY2A 1EL9A 4H2PA 2VQBA 4CNJA 4H50A 2I0ZA 1AOGA 2C72A 1TYTA 1XANA 2WP5A 2YVFA 3AEFA 4OPLA 4CNKA 4J31A 1JRYA 2VQ7A 2BS2A 4AOXA 4EQWA 1KNRA 1GRAA 2GR1A 5C2TA 4H2RA 3CN8A 1H7WA 3REDA 3AYLA 4B66A 2GV8A 5JCIA 3NTAA 1Q1WA 2OA1A 2WESA 4II3A 2YG5A 1GRGA 1JEHA 4TLXA 2V3BA 3ADAB 3V3NA 2JAEA 1XPQA 2V5ZA 2R0CA 3AXBA 4WX1A 2C64A 1E39A 3G5SA 4BV6A 1GEUA 1FCDA 1GRBA 2BS4A 5BRTA 2XFOA 3HZLA 3NKSA 3NRNA 3SYIA 3NG7X 1VQWA 3H8IA 3LXDA 1DNCA 2ARDA 1Y56B 2V6OA 2ZZBA 3OC4A 4AP1A 3DK9A 4H4ZA 1F8RA 4H4YA 4X9NA 1GERA 4B1BA 3IHGA 4M52A 1GESA 2XLTA 2YG7A 1YQ4A 4EMIA 1V59A 3HYVA 4EQRA 3HYXA 3PO7A 1D4DA 5M10A 2FJBA 3K7MX 2BA9A 1QJDA 3AECA 2VVLA 3AE2A 3M12A 2ZBWA 4J33A 1IJHA 2C66A 4A5LA 1DOCA 2XVHA 3GWFA 1MXTA 4P9SA 2B9YA 4B68A 4C3XA 1JRZA 3FG2P 1ZX9A 2YR4A 1CC2A 1EBDA 2XDOA 2E1MA 4APNA 5KVHA 1N4UA 4NTCA 2DKHA 1L9CA 1TDOA 1F8SA 1NENA 3CTYA 3T2KA 4K8DA 2XFQA 2RGJA 3AE9A 2IIDA 2C4CA 4J2WA 3GRSA 1MO9A 2FJDA 1NHQA 3NLCA 4XWRA 3QJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4Q A;  2QA1 A;  1GRE A;  2R45 A;  2JBV A;  2Z5Y A;  5JCM A;  4H4T A;  1CBO A;  2YLT A;  1EL7 A;  2WOV A;  3IF9 A;  3PS9 A;  1BKW A;  3UKQ A;  4ECH A;  5LV9 A;  3AD8 B;  4ZN0 A;  4Z24 A;  1GV4 A;  4K22 A;  2OAL A;  4KPR A;  4C77 A;  4DSH A;  1VG0 A;  5EB4 A;  3P4S A;  2XFU A;  2YQU A;  1ZDL A;  1CC6 A;  2GR3 A;  3EAO A;  3UTH A;  2YR5 A;  1H83 A;  3AE4 A;  3GWD A;  1H84 A;  4Z2R A;  3NYF A;  1LTX R;  4PAB A;  2C3C A;  2C73 A;  4CCQ A;  3AEA A;  4A65 A;  2GQF A;  4I59 A;  1ZK7 A;  1Q1R A;  3UKF A;  2BK5 A;  3D1C A;  4YWO A;  2VZ2 A;  3AD9 B;  3NK0 X;  3GMC A;  4JNA A;  5FS9 A;  2Y6R A;  2E5V A;  3QVR A;  4H4R A;  2YG4 A;  2WDQ A;  3L8K A;  1L0V A;  1YQZ A;  4EMJ A;  2VOU A;  3QSE A;  3DGH A;  3VR8 A;  1M6I A;  3P4Q A;  4E0V A;  4I58 A;  3M0O A;  3EPT A;  1VRQ B;  1GT8 A;  1F6M A;  4FDC B;  5C3J A;  3S5W A;  1PBD A;  3NH3 X;  3VRA A;  2JB1 A;  2X99 A;  3CGB A;  2VVL G;  3II4 A;  1JU2 A;  1XHC A;  1Y56 A;  2APG A;  2CUL A;  4NEW A;  4UDR A;  2XLU A;  3SGL A;  2GR0 A;  1S2Y A;  2H88 A;  3DA1 A;  4A99 A;  1KDG A;  3QSM A;  4GR1 A;  5GRT A;  2VRL A;  4EM4 A;  1EL8 A;  3DJE A;  2NPX A;  4YKF A;  3S61 A;  2FBW A;  3NGC X;  2A87 A;  1E1L A;  2BC1 A;  3LZX A;  4J56 A;  3K7Q X;  4GCM A;  4TM4 A;  3NYC A;  4CRT A;  3V3O A;  2A8X A;  3UTE A;  4H4Q A;  1N4W A;  3VQR A;  1TRB A;  2AAQ A;  3P4P A;  3K30 A;  1LJ1 A;  4U8N A;  4CY6 A;  4Z25 A;  5JCN A;  5U25 A;  4WCT A;  3P4R A;  3KD9 A;  3DJG X;  3PVC A;  3H8L A;  3Q6J A;  3GMB A;  4OPG A;  2GQW A;  2GRT A;  2OLN A;  4XWZ A;  5TR3 A;  4CY8 A;  4YSZ A;  1KNP A;  1P2H A;  4HB9 A;  2Z5X A;  3CPH G;  3LAD A;  4B67 A;  1L9D A;  5KOX A;  3NN0 X;  3QSS A;  4FK1 A;  5L46 A;  3UKK A;  4A6N B;  3SQP A;  1E6E A;  1O94 A;  2ZZC A;  1BF3 A;  1H86 A;  1YKJ A;  5BUK A;  4ZCC A;  3RHA A;  2JB3 A;  2C3D A;  3CND A;  2DKI A;  3G5Q A;  3GYJ A;  1GTH A;  3NT6 A;  1JNZ A;  1L9E A;  1CJC A;  4TM0 A;  4X4J A;  2CFY A;  5HY5 A;  1H7X A;  1VG9 A;  4TLZ A;  4D04 A;  1FEA A;  3E1T A;  4C3Y A;  3GD3 A;  1JNR A;  4OPC A;  2BK4 A;  4YSY A;  1NHR A;  1Y0P A;  4NTE A;  3AE1 A;  3SFD A;  2B9W A;  1OJA A;  1BWC A;  2FJE A;  2V60 A;  1CC4 A;  2WS3 A;  3KKJ A;  4C74 A;  4Z26 A;  3CGE A;  4ZCD A;  2WP9 A;  2X8H A;  3DK4 A;  3AE3 A;  5EOW A;  3NN6 X;  2WU2 A;  4REK A;  4C5O A;  1PN0 A;  4UP3 A;  4XXG A;  1IUT A;  1GXF A;  4Z44 A;  2XLS A;  2XVF A;  3CGD A;  3GDN A;  3L1R A;  3QFB A;  4B64 A;  2PHH A;  2V61 A;  3NK1 X;  3I3L A;  4YTP A;  1B5Q A;  3RP8 A;  2BCG G;  1CJ4 A;  3ZDN A;  4EIQ A;  1IUW A;  1GRH A;  1ELI A;  3CNT A;  1IUX A;  3FIM B;  1LV0 A;  2GF3 A;  2YLR A;  3F8D A;  4UDP A;  1NEK A;  2JB2 A;  3UOX A;  3AD7 B;  3QFA A;  1CJ3 A;  2WP6 A;  1PS9 A;  2C65 A;  2H89 A;  1NG3 A;  4X9M A;  2PYX A;  2YM1 A;  2IVD A;  3CNP A;  2B7R A;  4AT2 A;  4A6N A;  4GDP A;  2WPC A;  3ITJ A;  1GSN A;  1K0I A;  4K5S A;  4DGK A;  3F8P A;  2BK3 A;  2GVC A;  3KA7 A;  4Y4N A;  1Q9I A;  3AE6 A;  5IPY A;  2ZZ0 A;  4EMW A;  3BI5 A;  5ER0 A;  3ZYX A;  1S3B A;  4YSH A;  1NAA A;  2WOI A;  3V76 A;  2EQ7 A;  4ICY A;  3UP4 A;  1H6V A;  4GDE A;  3NTD A;  3AE7 A;  1PXB A;  4YT0 A;  4OPT A;  1P2E A;  1DJN A;  5BVA A;  1D4C A;  2BAB A;  2JK6 A;  1D7L A;  3SFE A;  1X31 B;  2GH5 A;  5CKU A;  1B8S A;  4U2L A;  4N9X A;  4PAA A;  4K5R A;  4ADW A;  5JCK A;  3Q9T A;  4OVI A;  1QLB A;  3ABV A;  4FX9 A;  3H4K A;  1IUU A;  1ZMC A;  1MOK A;  4A9W A;  4Y4M A;  4DSG A;  4BK3 A;  1OJD A;  1PXC A;  1DOB A;  4RG4 A;  3UP5 A;  2BS3 A;  4OPU A;  2YG6 A;  2E4G A;  3NIX A;  4AP3 A;  1H82 A;  2TMD A;  2OAM A;  1JOA A;  3P9U A;  2YVG A;  5FS8 A;  5FS6 A;  2WHD A;  4BUR A;  1ZOV A;  3JSK A;  2BXS A;  2WOW A;  3C96 A;  2BCP A;  2R9Z A;  2W0H A;  3DJJ A;  2WET A;  4JNQ A;  3CPJ G;  3UKP A;  4BJZ A;  3LJP A;  3GYI A;  3UOY A;  2X3N A;  3DGZ A;  3UKL A;  3VRB A;  2R0P A;  2GAH B;  1SEZ A;  3GRT A;  4U8J A;  5EBK A;  4RG3 A;  3ALJ A;  3BNU A;  4B69 A;  3AEB A;  4Z43 A;  1B4V A;  2AR8 A;  4H7U A;  4OPD A;  2YG3 A;  1K0J A;  2A89 A;  2GAG B;  3NNE A;  4IVM B;  3BHF A;  2UZZ A;  1VDC A;  3B3R A;  4EQS A;  4H4X A;  1B37 A;  2WBA A;  1UKV G;  3CNJ A;  1E7P A;  1NG4 A;  2GMH A;  2O9Z A;  2XLR A;  4OCG A;  2Y6Q A;  2BYB A;  3COX A;  5HHF A;  2XVJ A;  5KVI A;  1PBF A;  2RGO A;  3ATQ A;  2B9X A;  1NHS A;  3C4A A;  2WU5 A;  4EQX A;  4EM3 A;  1NPX A;  1REO A;  3AWI A;  1PJ5 A;  2CDU A;  1NDA A;  3BHK A;  3DH9 A;  1BZL A;  3F8R A;  3G5R A;  4U8K A;  5U1O A;  4HA6 A;  2WQY A;  4DNA A;  1OJC A;  1GND A;  1COY A;  4J34 A;  1K0L A;  2EQ9 A;  1E1K A;  3IC9 A;  5FS7 A;  1E1M A;  3FPZ A;  1PDH A;  3AYI A;  4NTD A;  3GSI A;  3KVE A;  1ZKQ A;  3UTG A;  3GDP A;  3K7T A;  1PXA A;  4IA6 A;  3AEE A;  3BI4 A;  1CJ2 A;  3WE0 A;  1ONF A;  3BI2 A;  1KSS A;  2YM2 A;  2CVJ A;  1N1P A;  4A7A A;  2X8G A;  3I6D A;  1S3E A;  2XVE A;  4U8P A;  4YKG A;  1JRX A;  1PHH A;  2RGH A;  2Q7V A;  4IV9 A;  1GRF A;  4U8I A;  2R0G A;  5GSN A;  4NEV A;  3SM8 A;  4Y4L A;  4TM1 A;  4B63 A;  2R4E A;  2YLS A;  3EAN A;  3UKA A;  1E1N A;  1HYU A;  5FMH A;  1M64 A;  3AB1 A;  4BK2 A;  3AED A;  1D4E A;  2C7G A;  2TPR A;  3ICS A;  3CPI G;  1KSU A;  1N4V A;  4JY3 A;  2QA2 A;  1DOE A;  1DJQ A;  2GMJ A;  1S2Q A;  1GET A;  2HQM A;  3NYE A;  3CIR A;  5KWF A;  4KX6 A;  1DOD A;  5CQF A;  2QAE A;  2XFN A;  2WDV A;  3AYJ A;  2C76 A;  3EF6 A;  3DME A;  3UOV A;  1TYP A;  2GB0 A;  3AEG A;  4IVO B;  3VRD B;  3KU9 A;  4CCR A;  4H2N A;  2EQ8 A;  1O95 A;  3UTF A;  4EIP A;  1IUV A;  1PJ7 A;  3RP6 A;  2OLO A;  2YLW A;  5J60 A;  4U2S A;  5M0Z A;  2XCG A;  3QVP A;  1GOS A;  5IQ4 A;  4TM3 A;  1F8W A;  2ACZ A;  5EB5 A;  1O5W A;  4GUV A;  4BK1 A;  3B6D A;  2IVE A;  2YAU A;  3D8X A;  2JKC A;  3C4N A;  2YLX A;  4GF7 A;  3ICT A;  4H4W A;  3CNS A;  5BUL A;  1TDK A;  2XLP A;  2VVM A;  2Q6U A;  3UKH A;  4Z2U A;  5KRQ A;  4FK1 C;  2AQJ A;  2Q0L A;  2WEU A;  1GTE A;  3KLJ A;  4MJW A;  5JCL A;  1BGN A;  2YLZ A;  1IUS A;  3M13 A;  4J36 A;  4RSL A;  4YTN A;  3ISH A;  5DBJ A;  3NK2 X;  3VR9 A;  4D03 A;  3LZW A;  4YSX A;  2V3A A;  1RSG A;  3CGC A;  4UDQ A;  1CHU A;  3R9U A;  1PBC A;  1PBE A;  4LU6 A;  1OJT A;  1GRT A;  1RYI A;  2WPF A;  1TDE A;  2C70 A;  2R46 A;  1D5T A;  2YR6 A;  4AOS A;  3FBS A;  2QCU A;  2VRM A;  4LII A;  4H4P A;  4U8M A;  4JN9 A;  1EL5 A;  1YY5 A;  3KPF A;  1D7Y A;  1KF6 A;  2BXR A;  5KXJ A;  2F5Z A;  2XFP A;  3DK8 A;  3URH A;  1FEC A;  4IA5 A;  1F3P A;  4U8O A;  2B76 A;  4J57 A;  2BC0 A;  2FJA A;  1YQ3 A;  1CL0 A;  2Q0K A;  1TDN A;  4OPI A;  4JDR A;  1TDF A;  3UOZ A;  1LVL A;  1RP0 A;  1ZMD A;  3P1W A;  2B7S A;  2C75 A;  1Z6L A;  4A79 A;  5HXI A;  1BGJ A;  1OJ9 A;  4USR A;  3RP7 A;  1NHP A;  4O5U A;  4BJY A;  2YWL A;  3LOV A;  2BAC A;  2R4J A;  2WDR A;  3UCL A;  3GD4 A;  1KFY A;  4AT0 A;  4Z2T A;  3IWA A;  4K7Z A;  3NHO X;  3ATR A;  5U63 A;  4USQ A;  3RNM A;  3IHM A;  4B65 A;  4GRT A;  3ALL A;  2C67 A;  1H81 A;  1ZOY A;  2RAB A;  2EQ6 A;  1CF3 A;  1LQT A;  3O0H A;  4U2T A;  1GAL A;  1PBB A;  1QO8 A;  3LB8 A;  4H4V A;  5IQ1 A;  1PJ6 A;  4H4U A;  4K2X A;  1FOH A;  1FEB A;  3AE5 A;  2GR2 A;  2NVK X;  1W4X A;  1ZP0 A;  5HYM A;  2XVI A;  4NZH A;  4H2Q A;  4JQ9 A;  4U8L A;  3ALM A;  3OZ2 A;  2GEW A;  3AE8 A;  3FMW A;  2J3N A;  1LQU A;  3BNM A;  4O5Q A;  4H4S A;  1LPF A;  1DXL A;  1GPE A;  3ICR A;  4YXD A;  4LA1 A;  2X8C A;  2XYO A;  1XDI A;  4YTM A;  1FL2 A;  3DJD A;  2X50 A;  5KOW A;  2WPE A;  2YVJ A;  4CBQ A;  1ZY8 A;  5J7X A;  3T37 A;  4JY2 A;  1EL9 A;  4H2P A;  2VQB A;  4CNJ A;  4H50 A;  2I0Z A;  1AOG A;  2C72 A;  1TYT A;  1XAN A;  2WP5 A;  2YVF A;  3AEF A;  4OPL A;  4CNK A;  4J31 A;  1JRY A;  2VQ7 A;  2BS2 A;  4AOX A;  4EQW A;  1KNR A;  1GRA A;  2GR1 A;  5C2T A;  4H2R A;  3CN8 A;  1H7W A;  3RED A;  3AYL A;  4B66 A;  2GV8 A;  5JCI A;  3NTA A;  1Q1W A;  2OA1 A;  2WES A;  2YG5 A;  1GRG A;  1JEH A;  4TLX A;  2V3B A;  3ADA B;  3V3N A;  2JAE A;  1XPQ A;  2V5Z A;  2R0C A;  3AXB A;  4WX1 A;  2C64 A;  1E39 A;  3G5S A;  4BV6 A;  1GEU A;  1FCD A;  1GRB A;  2BS4 A;  5BRT A;  2XFO A;  3HZL A;  3NKS A;  3NRN A;  3NG7 X;  1VQW A;  3H8I A;  3LXD A;  1DNC A;  2ARD A;  1Y56 B;  2V6O A;  2ZZB A;  3OC4 A;  4AP1 A;  3DK9 A;  4H4Z A;  1F8R A;  4H4Y A;  4X9N A;  1GER A;  4B1B A;  3IHG A;  4M52 A;  1GES A;  2XLT A;  2YG7 A;  1YQ4 A;  4EMI A;  1V59 A;  4EQR A;  3PO7 A;  1D4D A;  5M10 A;  2FJB A;  3K7M X;  2BA9 A;  1QJD A;  3AEC A;  2VVL A;  3AE2 A;  3M12 A;  2ZBW A;  4J33 A;  1IJH A;  2C66 A;  4A5L A;  1DOC A;  2XVH A;  3GWF A;  1MXT A;  4P9S A;  2B9Y A;  4B68 A;  4C3X A;  1JRZ A;  3FG2 P;  1ZX9 A;  2YR4 A;  1CC2 A;  1EBD A;  2XDO A;  2E1M A;  4APN A;  5KVH A;  1N4U A;  4NTC A;  2DKH A;  1L9C A;  1TDO A;  1F8S A;  1NEN A;  3CTY A;  4K8D A;  2XFQ A;  2RGJ A;  3AE9 A;  2IID A;  4J2W A;  3GRS A;  1MO9 A;  2FJD A;  1NHQ A;  3NLC A;  4XWR A;  3QJ4 A; 
#chains in the Genus database with same CATH topology
 1K4Q A;  2QA1 A;  1GRE A;  2R45 A;  2JBV A;  2Z5Y A;  5JCM A;  4H4T A;  1CBO A;  2YLT A;  1EL7 A;  2WOV A;  3IF9 A;  3PS9 A;  1BKW A;  3UKQ A;  4ECH A;  5LV9 A;  3AD8 B;  4NWZ A;  4ZN0 A;  4Z24 A;  1GV4 A;  4K22 A;  2OAL A;  4KPR A;  4C77 A;  4DSH A;  1VG0 A;  5EB4 A;  3P4S A;  2XFU A;  2YQU A;  1ZDL A;  1CC6 A;  2GR3 A;  3EAO A;  3UTH A;  2YR5 A;  1H83 A;  3AE4 A;  3GWD A;  1H84 A;  4Z2R A;  3NYF A;  1LTX R;  4PAB A;  2C3C A;  2C73 A;  4CCQ A;  3AEA A;  4A65 A;  2GQF A;  4I59 A;  1ZK7 A;  1Q1R A;  3UKF A;  2BK5 A;  3D1C A;  4YWO A;  2VZ2 A;  3AD9 B;  3NK0 X;  3GMC A;  4JNA A;  5FS9 A;  2Y6R A;  2E5V A;  3QVR A;  4H4R A;  2YG4 A;  2WDQ A;  3L8K A;  1L0V A;  3SY4 A;  1YQZ A;  4EMJ A;  2VOU A;  4G6H A;  3QSE A;  3DGH A;  3VR8 A;  1M6I A;  3P4Q A;  4E0V A;  4I58 A;  3M0O A;  3EPT A;  1VRQ B;  1GT8 A;  1F6M A;  4FDC B;  5C3J A;  3S5W A;  1PBD A;  3NH3 X;  3VRA A;  2JB1 A;  2X99 A;  3CGB A;  2VVL G;  3II4 A;  1JU2 A;  1XHC A;  1Y56 A;  2APG A;  2CUL A;  4G73 A;  4NEW A;  4UDR A;  2XLU A;  3SGL A;  2GR0 A;  1S2Y A;  2H88 A;  3DA1 A;  4A99 A;  1KDG A;  3QSM A;  4GR1 A;  5GRT A;  2VRL A;  4EM4 A;  1EL8 A;  3DJE A;  2NPX A;  4YKF A;  3S61 A;  2FBW A;  3NGC X;  2A87 A;  1E1L A;  2BC1 A;  3LZX A;  4J56 A;  3K7Q X;  4GCM A;  4TM4 A;  3NYC A;  4CRT A;  3V3O A;  2A8X A;  3UTE A;  4H4Q A;  1N4W A;  3VQR A;  1TRB A;  2AAQ A;  3P4P A;  3K30 A;  1LJ1 A;  4U8N A;  4CY6 A;  4Z25 A;  5JCN A;  5U25 A;  4WCT A;  3P4R A;  5KMQ A;  3KD9 A;  3DJG X;  3PVC A;  3H8L A;  3Q6J A;  3GMB A;  4OPG A;  2GQW A;  2GRT A;  2OLN A;  4XWZ A;  5TR3 A;  4CY8 A;  4YSZ A;  1KNP A;  1P2H A;  4HB9 A;  3SZ0 A;  2Z5X A;  3CPH G;  3LAD A;  4B67 A;  1L9D A;  5KOX A;  3NN0 X;  3QSS A;  4FK1 A;  5L46 A;  3UKK A;  4A6N B;  3SQP A;  1E6E A;  1O94 A;  2ZZC A;  1BF3 A;  1H86 A;  1YKJ A;  5BUK A;  4ZCC A;  3SZF A;  3RHA A;  2JB3 A;  2C3D A;  3CND A;  2DKI A;  3G5Q A;  3GYJ A;  1GTH A;  3NT6 A;  1JNZ A;  1L9E A;  1CJC A;  4TM0 A;  4X4J A;  2CFY A;  5HY5 A;  1H7X A;  1VG9 A;  4TLZ A;  4D04 A;  5KNL A;  1FEA A;  3E1T A;  4C3Y A;  3GD3 A;  1JNR A;  4OPC A;  2BK4 A;  4YSY A;  1NHR A;  1Y0P A;  4NTE A;  3AE1 A;  3SFD A;  2B9W A;  1OJA A;  1BWC A;  2FJE A;  2V60 A;  1CC4 A;  2WS3 A;  3KKJ A;  4C74 A;  4Z26 A;  3CGE A;  4ZCD A;  2WP9 A;  2X8H A;  3DK4 A;  3AE3 A;  5EOW A;  3NN6 X;  2WU2 A;  4REK A;  4C5O A;  1PN0 A;  4UP3 A;  4XXG A;  1IUT A;  1GXF A;  4Z44 A;  2XLS A;  2XVF A;  3CGD A;  3GDN A;  3L1R A;  3QFB A;  4B64 A;  2PHH A;  2V61 A;  3NK1 X;  3I3L A;  4YTP A;  1B5Q A;  3RP8 A;  2BCG G;  1CJ4 A;  3ZDN A;  4EIQ A;  1IUW A;  1GRH A;  1ELI A;  3CNT A;  1IUX A;  3FIM B;  1LV0 A;  2GF3 A;  2YLR A;  3F8D A;  4UDP A;  1NEK A;  4GAP A;  2JB2 A;  3T2Z A;  3UOX A;  3AD7 B;  3QFA A;  1CJ3 A;  2WP6 A;  1PS9 A;  2C65 A;  2H89 A;  1NG3 A;  4X9M A;  2PYX A;  2YM1 A;  2IVD A;  3CNP A;  2B7R A;  4AT2 A;  4A6N A;  4GDP A;  2WPC A;  3ITJ A;  1GSN A;  1K0I A;  4K5S A;  4DGK A;  3F8P A;  2BK3 A;  2GVC A;  3KA7 A;  4Y4N A;  1Q9I A;  3AE6 A;  5IPY A;  2ZZ0 A;  4EMW A;  3BI5 A;  5ER0 A;  3ZYX A;  1S3B A;  4YSH A;  1NAA A;  2WOI A;  3V76 A;  2EQ7 A;  4ICY A;  3UP4 A;  1H6V A;  4GDE A;  3NTD A;  3AE7 A;  1PXB A;  4YT0 A;  4OPT A;  1P2E A;  1DJN A;  5BVA A;  1D4C A;  2BAB A;  2JK6 A;  1D7L A;  3SFE A;  1X31 B;  2GH5 A;  5CKU A;  1B8S A;  4U2L A;  4N9X A;  4NNJ A;  4K5R A;  4PAA A;  4ADW A;  5JCK A;  3Q9T A;  4OVI A;  1QLB A;  3ABV A;  4FX9 A;  3H4K A;  1IUU A;  1ZMC A;  1MOK A;  4A9W A;  4Y4M A;  4DSG A;  4BK3 A;  1OJD A;  1PXC A;  1DOB A;  4RG4 A;  3UP5 A;  2BS3 A;  4OPU A;  2YG6 A;  2E4G A;  3NIX A;  4AP3 A;  1H82 A;  2TMD A;  2OAM A;  1JOA A;  3P9U A;  2YVG A;  5FS8 A;  5FS6 A;  2WHD A;  4BUR A;  1ZOV A;  3JSK A;  2BXS A;  2WOW A;  3C96 A;  2BCP A;  2R9Z A;  2W0H A;  3DJJ A;  2WET A;  4JNQ A;  3CPJ G;  3UKP A;  4BJZ A;  3LJP A;  3GYI A;  4G9K A;  3UOY A;  2X3N A;  3DGZ A;  3UKL A;  3VRB A;  2R0P A;  2GAH B;  1SEZ A;  3GRT A;  4U8J A;  5EBK A;  4RG3 A;  3ALJ A;  3BNU A;  4B69 A;  3AEB A;  4Z43 A;  1B4V A;  2AR8 A;  4H7U A;  3T31 A;  4OPD A;  2YG3 A;  1K0J A;  2A89 A;  2GAG B;  3NNE A;  4IVM B;  3BHF A;  2UZZ A;  1VDC A;  3B3R A;  4EQS A;  4H4X A;  1B37 A;  2WBA A;  1UKV G;  3CNJ A;  1E7P A;  1NG4 A;  2GMH A;  2O9Z A;  2XLR A;  4OCG A;  2Y6Q A;  2BYB A;  3COX A;  5HHF A;  2XVJ A;  5KVI A;  1PBF A;  2RGO A;  3ATQ A;  2B9X A;  1NHS A;  3C4A A;  2WU5 A;  4EQX A;  4EM3 A;  1NPX A;  1REO A;  3AWI A;  1PJ5 A;  2CDU A;  1NDA A;  3BHK A;  3DH9 A;  1BZL A;  3F8R A;  3G5R A;  4U8K A;  3SZC A;  5U1O A;  4HA6 A;  2WQY A;  3KPK A;  4DNA A;  1OJC A;  1GND A;  1COY A;  4J34 A;  1K0L A;  2EQ9 A;  1E1K A;  3IC9 A;  5FS7 A;  1E1M A;  4GAV A;  3FPZ A;  1PDH A;  3AYI A;  4NTD A;  3GSI A;  3KVE A;  1ZKQ A;  3UTG A;  3GDP A;  3K7T A;  1PXA A;  4IA6 A;  3AEE A;  3BI4 A;  1CJ2 A;  3WE0 A;  1ONF A;  3BI2 A;  1KSS A;  2YM2 A;  2CVJ A;  1N1P A;  4A7A A;  2X8G A;  3I6D A;  1S3E A;  2XVE A;  4U8P A;  4YKG A;  1JRX A;  1PHH A;  3HYW A;  2RGH A;  2Q7V A;  4IV9 A;  1GRF A;  4U8I A;  5KMR A;  2R0G A;  5GSN A;  4NEV A;  4II2 A;  3SM8 A;  3GYX A;  3T0K A;  3SXI A;  4Y4L A;  4TM1 A;  4B63 A;  2R4E A;  2YLS A;  3EAN A;  3UKA A;  1E1N A;  1HYU A;  5FMH A;  1M64 A;  3AB1 A;  4BK2 A;  3AED A;  1D4E A;  2C7G A;  2TPR A;  3ICS A;  3CPI G;  1KSU A;  1N4V A;  4JY3 A;  2QA2 A;  1DOE A;  1DJQ A;  2GMJ A;  1S2Q A;  1GET A;  2HQM A;  3NYE A;  3CIR A;  5KWF A;  4KX6 A;  1DOD A;  5CQF A;  2QAE A;  2XFN A;  2WDV A;  3AYJ A;  2C76 A;  3EF6 A;  3DME A;  3UOV A;  1TYP A;  2GB0 A;  3AEG A;  4IVO B;  3VRD B;  3KU9 A;  4CCR A;  4H2N A;  2EQ8 A;  1O95 A;  3UTF A;  4EIP A;  1IUV A;  1PJ7 A;  3RP6 A;  2OLO A;  2YLW A;  5J60 A;  4U2S A;  5M0Z A;  2XCG A;  3QVP A;  1GOS A;  5IQ4 A;  4TM3 A;  1F8W A;  2ACZ A;  5EB5 A;  1O5W A;  4GUV A;  4BK1 A;  3B6D A;  2IVE A;  2YAU A;  3D8X A;  2JKC A;  3C4N A;  3SX6 A;  2YLX A;  4GF7 A;  3ICT A;  4H4W A;  3CNS A;  5BUL A;  1TDK A;  3T2Y A;  2XLP A;  2VVM A;  2Q6U A;  3UKH A;  4Z2U A;  5KRQ A;  4FK1 C;  2AQJ A;  2Q0L A;  2WEU A;  1GTE A;  3KLJ A;  4MJW A;  5JCL A;  1BGN A;  2YLZ A;  1IUS A;  3M13 A;  4J36 A;  4RSL A;  4YTN A;  3ISH A;  5DBJ A;  3NK2 X;  4G74 A;  3VR9 A;  4D03 A;  3LZW A;  4YSX A;  2V3A A;  1RSG A;  3CGC A;  4UDQ A;  1CHU A;  3R9U A;  1PBC A;  1PBE A;  4LU6 A;  1OJT A;  1GRT A;  1RYI A;  2WPF A;  1TDE A;  2C70 A;  2R46 A;  1D5T A;  2YR6 A;  3CMM A;  4AOS A;  2BRY A;  2QCU A;  2VRM A;  3FBS A;  4LII A;  4H4P A;  4U8M A;  4JN9 A;  1EL5 A;  1YY5 A;  3KPF A;  1D7Y A;  1KF6 A;  2BXR A;  3SZW A;  2F5Z A;  2XFP A;  3DK8 A;  3URH A;  5KXJ A;  1FEC A;  4IA5 A;  1F3P A;  4U8O A;  2B76 A;  4J57 A;  2BC0 A;  2FJA A;  1YQ3 A;  1CL0 A;  2Q0K A;  1TDN A;  4OPI A;  4JDR A;  1TDF A;  3UOZ A;  1LVL A;  1RP0 A;  1ZMD A;  3P1W A;  2B7S A;  2C75 A;  1Z6L A;  4A79 A;  5HXI A;  2BRA A;  1BGJ A;  1OJ9 A;  4USR A;  3RP7 A;  1NHP A;  4O5U A;  4G6G A;  4BJY A;  2YWL A;  3LOV A;  2BAC A;  2R4J A;  2WDR A;  3UCL A;  3GD4 A;  1KFY A;  4AT0 A;  4Z2T A;  3IWA A;  4K7Z A;  3NHO X;  3ATR A;  5U63 A;  4USQ A;  3RNM A;  3IHM A;  4B65 A;  4GRT A;  3ALL A;  2C67 A;  1H81 A;  1ZOY A;  2RAB A;  2EQ6 A;  1CF3 A;  1LQT A;  3O0H A;  4U2T A;  1GAL A;  1PBB A;  1QO8 A;  3LB8 A;  4H4V A;  5IQ1 A;  1PJ6 A;  3T14 A;  4H4U A;  4K2X A;  1FOH A;  1FEB A;  3AE5 A;  2GR2 A;  2NVK X;  1W4X A;  1ZP0 A;  5HYM A;  2XVI A;  4NZH A;  4H2Q A;  4JQ9 A;  4U8L A;  3ALM A;  3OZ2 A;  2GEW A;  3AE8 A;  3FMW A;  2J3N A;  1LQU A;  5KMP A;  3BNM A;  4O5Q A;  4H4S A;  1LPF A;  1DXL A;  1GPE A;  3ICR A;  4YXD A;  4LA1 A;  2X8C A;  2XYO A;  1XDI A;  4YTM A;  1FL2 A;  3DJD A;  2X50 A;  5KOW A;  2WPE A;  2YVJ A;  4CBQ A;  1ZY8 A;  5KMS A;  5J7X A;  3T37 A;  4JY2 A;  1EL9 A;  4H2P A;  2VQB A;  4CNJ A;  4H50 A;  2I0Z A;  1AOG A;  2C72 A;  1TYT A;  1XAN A;  2WP5 A;  2YVF A;  3AEF A;  4OPL A;  4CNK A;  4J31 A;  1JRY A;  2VQ7 A;  2BS2 A;  4AOX A;  4EQW A;  1KNR A;  1GRA A;  2GR1 A;  5C2T A;  4H2R A;  3CN8 A;  1H7W A;  3RED A;  3AYL A;  4B66 A;  2GV8 A;  5JCI A;  3NTA A;  1Q1W A;  2OA1 A;  2WES A;  4II3 A;  2YG5 A;  1GRG A;  1JEH A;  4TLX A;  2V3B A;  3ADA B;  3V3N A;  2JAE A;  1XPQ A;  2V5Z A;  2R0C A;  3AXB A;  4WX1 A;  2C64 A;  1E39 A;  3G5S A;  4BV6 A;  1GEU A;  1FCD A;  1GRB A;  2BS4 A;  5BRT A;  2XFO A;  3HZL A;  3NKS A;  3NRN A;  3SYI A;  3NG7 X;  1VQW A;  3H8I A;  3LXD A;  1DNC A;  2ARD A;  1Y56 B;  2V6O A;  2ZZB A;  3OC4 A;  4AP1 A;  3DK9 A;  4H4Z A;  1F8R A;  4H4Y A;  4X9N A;  1GER A;  4B1B A;  3IHG A;  4M52 A;  1GES A;  2XLT A;  2YG7 A;  1YQ4 A;  4EMI A;  1V59 A;  3HYV A;  4EQR A;  3HYX A;  3PO7 A;  1D4D A;  5M10 A;  2FJB A;  3K7M X;  2BA9 A;  1QJD A;  3AEC A;  2VVL A;  3AE2 A;  3M12 A;  2ZBW A;  4J33 A;  1IJH A;  2C66 A;  4A5L A;  1DOC A;  2XVH A;  3GWF A;  1MXT A;  4P9S A;  2B9Y A;  4B68 A;  4C3X A;  1JRZ A;  3FG2 P;  1ZX9 A;  2YR4 A;  1CC2 A;  1EBD A;  2XDO A;  2E1M A;  4APN A;  5KVH A;  1N4U A;  4NTC A;  2DKH A;  1L9C A;  1TDO A;  1F8S A;  1NEN A;  3CTY A;  3T2K A;  4K8D A;  2XFQ A;  2RGJ A;  3AE9 A;  2IID A;  2C4C A;  4J2W A;  3GRS A;  1MO9 A;  2FJD A;  1NHQ A;  3NLC A;  4XWR A;  3QJ4 A; 
#chains in the Genus database with same CATH homology
 1K4Q A;  2QA1 A;  1GRE A;  2R45 A;  2JBV A;  2Z5Y A;  5JCM A;  4H4T A;  1CBO A;  2YLT A;  1EL7 A;  2WOV A;  3IF9 A;  3PS9 A;  1BKW A;  3UKQ A;  4ECH A;  5LV9 A;  3AD8 B;  4NWZ A;  4ZN0 A;  4Z24 A;  1GV4 A;  4K22 A;  2OAL A;  4KPR A;  4C77 A;  4DSH A;  1VG0 A;  5EB4 A;  3P4S A;  2XFU A;  2YQU A;  1ZDL A;  1CC6 A;  2GR3 A;  3EAO A;  3UTH A;  2YR5 A;  1H83 A;  3AE4 A;  3GWD A;  1H84 A;  4Z2R A;  3NYF A;  1LTX R;  4PAB A;  2C3C A;  2C73 A;  4CCQ A;  3AEA A;  4A65 A;  2GQF A;  4I59 A;  1ZK7 A;  1Q1R A;  3UKF A;  2BK5 A;  3D1C A;  4YWO A;  2VZ2 A;  3AD9 B;  3NK0 X;  3GMC A;  4JNA A;  5FS9 A;  2Y6R A;  2E5V A;  3QVR A;  4H4R A;  2YG4 A;  2WDQ A;  3L8K A;  1L0V A;  3SY4 A;  1YQZ A;  4EMJ A;  2VOU A;  4G6H A;  3QSE A;  3DGH A;  3VR8 A;  1M6I A;  3P4Q A;  4E0V A;  4I58 A;  3M0O A;  3EPT A;  1VRQ B;  1GT8 A;  1F6M A;  4FDC B;  5C3J A;  3S5W A;  1PBD A;  3NH3 X;  3VRA A;  2JB1 A;  2X99 A;  3CGB A;  2VVL G;  3II4 A;  1JU2 A;  1XHC A;  1Y56 A;  2APG A;  2CUL A;  4G73 A;  4NEW A;  4UDR A;  2XLU A;  3SGL A;  2GR0 A;  1S2Y A;  2H88 A;  3DA1 A;  4A99 A;  1KDG A;  3QSM A;  4GR1 A;  5GRT A;  2VRL A;  4EM4 A;  1EL8 A;  3DJE A;  2NPX A;  4YKF A;  3S61 A;  2FBW A;  3NGC X;  2A87 A;  1E1L A;  2BC1 A;  3LZX A;  4J56 A;  3K7Q X;  4GCM A;  4TM4 A;  3NYC A;  4CRT A;  3V3O A;  2A8X A;  3UTE A;  4H4Q A;  1N4W A;  3VQR A;  1TRB A;  2AAQ A;  3P4P A;  3K30 A;  1LJ1 A;  4U8N A;  4CY6 A;  4Z25 A;  5JCN A;  5U25 A;  4WCT A;  3P4R A;  5KMQ A;  3KD9 A;  3DJG X;  3PVC A;  3H8L A;  3Q6J A;  3GMB A;  4OPG A;  2GQW A;  2GRT A;  2OLN A;  4XWZ A;  5TR3 A;  4CY8 A;  4YSZ A;  1KNP A;  1P2H A;  4HB9 A;  3SZ0 A;  2Z5X A;  3CPH G;  3LAD A;  4B67 A;  1L9D A;  5KOX A;  3NN0 X;  3QSS A;  4FK1 A;  5L46 A;  3UKK A;  4A6N B;  3SQP A;  1E6E A;  1O94 A;  2ZZC A;  1BF3 A;  1H86 A;  1YKJ A;  5BUK A;  4ZCC A;  3SZF A;  3RHA A;  2JB3 A;  2C3D A;  3CND A;  2DKI A;  3G5Q A;  3GYJ A;  1GTH A;  3NT6 A;  1JNZ A;  1L9E A;  1CJC A;  4TM0 A;  4X4J A;  2CFY A;  5HY5 A;  1H7X A;  1VG9 A;  4TLZ A;  4D04 A;  5KNL A;  1FEA A;  3E1T A;  4C3Y A;  3GD3 A;  1JNR A;  4OPC A;  2BK4 A;  4YSY A;  1NHR A;  1Y0P A;  4NTE A;  3AE1 A;  3SFD A;  2B9W A;  1OJA A;  1BWC A;  2FJE A;  2V60 A;  1CC4 A;  2WS3 A;  3KKJ A;  4C74 A;  4Z26 A;  3CGE A;  4ZCD A;  2WP9 A;  2X8H A;  3DK4 A;  3AE3 A;  5EOW A;  3NN6 X;  2WU2 A;  4REK A;  4C5O A;  1PN0 A;  4UP3 A;  4XXG A;  1IUT A;  1GXF A;  4Z44 A;  2XLS A;  2XVF A;  3CGD A;  3GDN A;  3L1R A;  3QFB A;  4B64 A;  2PHH A;  2V61 A;  3NK1 X;  3I3L A;  4YTP A;  1B5Q A;  3RP8 A;  2BCG G;  1CJ4 A;  3ZDN A;  4EIQ A;  1IUW A;  1GRH A;  1ELI A;  3CNT A;  1IUX A;  3FIM B;  1LV0 A;  2GF3 A;  2YLR A;  3F8D A;  4UDP A;  1NEK A;  4GAP A;  2JB2 A;  3T2Z A;  3UOX A;  3AD7 B;  3QFA A;  1CJ3 A;  2WP6 A;  1PS9 A;  2C65 A;  2H89 A;  1NG3 A;  4X9M A;  2PYX A;  2YM1 A;  2IVD A;  3CNP A;  2B7R A;  4AT2 A;  4A6N A;  4GDP A;  2WPC A;  3ITJ A;  1GSN A;  1K0I A;  4K5S A;  4DGK A;  3F8P A;  2BK3 A;  2GVC A;  3KA7 A;  4Y4N A;  1Q9I A;  3AE6 A;  5IPY A;  2ZZ0 A;  4EMW A;  3BI5 A;  5ER0 A;  3ZYX A;  1S3B A;  4YSH A;  1NAA A;  2WOI A;  3V76 A;  2EQ7 A;  4ICY A;  3UP4 A;  1H6V A;  4GDE A;  3NTD A;  3AE7 A;  1PXB A;  4YT0 A;  4OPT A;  1P2E A;  1DJN A;  5BVA A;  1D4C A;  2BAB A;  2JK6 A;  1D7L A;  3SFE A;  1X31 B;  2GH5 A;  5CKU A;  1B8S A;  4U2L A;  4N9X A;  4NNJ A;  4K5R A;  4PAA A;  4ADW A;  5JCK A;  3Q9T A;  4OVI A;  1QLB A;  3ABV A;  4FX9 A;  3H4K A;  1IUU A;  1ZMC A;  1MOK A;  4A9W A;  4Y4M A;  4DSG A;  4BK3 A;  1OJD A;  1PXC A;  1DOB A;  4RG4 A;  3UP5 A;  2BS3 A;  4OPU A;  2YG6 A;  2E4G A;  3NIX A;  4AP3 A;  1H82 A;  2TMD A;  2OAM A;  1JOA A;  3P9U A;  2YVG A;  5FS8 A;  5FS6 A;  2WHD A;  4BUR A;  1ZOV A;  3JSK A;  2BXS A;  2WOW A;  3C96 A;  2BCP A;  2R9Z A;  2W0H A;  3DJJ A;  2WET A;  4JNQ A;  3CPJ G;  3UKP A;  4BJZ A;  3LJP A;  3GYI A;  4G9K A;  3UOY A;  2X3N A;  3DGZ A;  3UKL A;  3VRB A;  2R0P A;  2GAH B;  1SEZ A;  3GRT A;  4U8J A;  5EBK A;  4RG3 A;  3ALJ A;  3BNU A;  4B69 A;  3AEB A;  4Z43 A;  1B4V A;  2AR8 A;  4H7U A;  3T31 A;  4OPD A;  2YG3 A;  1K0J A;  2A89 A;  2GAG B;  3NNE A;  4IVM B;  3BHF A;  2UZZ A;  1VDC A;  3B3R A;  4EQS A;  4H4X A;  1B37 A;  2WBA A;  1UKV G;  3CNJ A;  1E7P A;  1NG4 A;  2GMH A;  2O9Z A;  2XLR A;  4OCG A;  2Y6Q A;  2BYB A;  3COX A;  5HHF A;  2XVJ A;  5KVI A;  1PBF A;  2RGO A;  3ATQ A;  2B9X A;  1NHS A;  3C4A A;  2WU5 A;  4EQX A;  4EM3 A;  1NPX A;  1REO A;  3AWI A;  1PJ5 A;  2CDU A;  1NDA A;  3BHK A;  3DH9 A;  1BZL A;  3F8R A;  3G5R A;  4U8K A;  3SZC A;  5U1O A;  4HA6 A;  2WQY A;  3KPK A;  4DNA A;  1OJC A;  1GND A;  1COY A;  4J34 A;  1K0L A;  2EQ9 A;  1E1K A;  3IC9 A;  5FS7 A;  1E1M A;  4GAV A;  3FPZ A;  1PDH A;  3AYI A;  4NTD A;  3GSI A;  3KVE A;  1ZKQ A;  3UTG A;  3GDP A;  3K7T A;  1PXA A;  4IA6 A;  3AEE A;  3BI4 A;  1CJ2 A;  3WE0 A;  1ONF A;  3BI2 A;  1KSS A;  2YM2 A;  2CVJ A;  1N1P A;  4A7A A;  2X8G A;  3I6D A;  1S3E A;  2XVE A;  4U8P A;  4YKG A;  1JRX A;  1PHH A;  3HYW A;  2RGH A;  2Q7V A;  4IV9 A;  1GRF A;  4U8I A;  5KMR A;  2R0G A;  5GSN A;  4NEV A;  4II2 A;  3SM8 A;  3GYX A;  3T0K A;  3SXI A;  4Y4L A;  4TM1 A;  4B63 A;  2R4E A;  2YLS A;  3EAN A;  3UKA A;  1E1N A;  1HYU A;  5FMH A;  1M64 A;  3AB1 A;  4BK2 A;  3AED A;  1D4E A;  2C7G A;  2TPR A;  3ICS A;  3CPI G;  1KSU A;  1N4V A;  4JY3 A;  2QA2 A;  1DOE A;  1DJQ A;  2GMJ A;  1S2Q A;  1GET A;  2HQM A;  3NYE A;  3CIR A;  5KWF A;  4KX6 A;  1DOD A;  5CQF A;  2QAE A;  2XFN A;  2WDV A;  3AYJ A;  2C76 A;  3EF6 A;  3DME A;  3UOV A;  1TYP A;  2GB0 A;  3AEG A;  4IVO B;  3VRD B;  3KU9 A;  4CCR A;  4H2N A;  2EQ8 A;  1O95 A;  3UTF A;  4EIP A;  1IUV A;  1PJ7 A;  3RP6 A;  2OLO A;  2YLW A;  5J60 A;  4U2S A;  5M0Z A;  2XCG A;  3QVP A;  1GOS A;  5IQ4 A;  4TM3 A;  1F8W A;  2ACZ A;  5EB5 A;  1O5W A;  4GUV A;  4BK1 A;  3B6D A;  2IVE A;  2YAU A;  3D8X A;  2JKC A;  3C4N A;  3SX6 A;  2YLX A;  4GF7 A;  3ICT A;  4H4W A;  3CNS A;  5BUL A;  1TDK A;  3T2Y A;  2XLP A;  2VVM A;  2Q6U A;  3UKH A;  4Z2U A;  5KRQ A;  4FK1 C;  2AQJ A;  2Q0L A;  2WEU A;  1GTE A;  3KLJ A;  4MJW A;  5JCL A;  1BGN A;  2YLZ A;  1IUS A;  3M13 A;  4J36 A;  4RSL A;  4YTN A;  3ISH A;  5DBJ A;  3NK2 X;  4G74 A;  3VR9 A;  4D03 A;  3LZW A;  4YSX A;  2V3A A;  1RSG A;  3CGC A;  4UDQ A;  1CHU A;  3R9U A;  1PBC A;  1PBE A;  4LU6 A;  1OJT A;  1GRT A;  1RYI A;  2WPF A;  1TDE A;  2C70 A;  2R46 A;  1D5T A;  2YR6 A;  3CMM A;  4AOS A;  2BRY A;  2QCU A;  2VRM A;  3FBS A;  4LII A;  4H4P A;  4U8M A;  4JN9 A;  1EL5 A;  1YY5 A;  3KPF A;  1D7Y A;  1KF6 A;  2BXR A;  3SZW A;  2F5Z A;  2XFP A;  3DK8 A;  3URH A;  5KXJ A;  1FEC A;  4IA5 A;  1F3P A;  4U8O A;  2B76 A;  4J57 A;  2BC0 A;  2FJA A;  1YQ3 A;  1CL0 A;  2Q0K A;  1TDN A;  4OPI A;  4JDR A;  1TDF A;  3UOZ A;  1LVL A;  1RP0 A;  1ZMD A;  3P1W A;  2B7S A;  2C75 A;  1Z6L A;  4A79 A;  5HXI A;  2BRA A;  1BGJ A;  1OJ9 A;  4USR A;  3RP7 A;  1NHP A;  4O5U A;  4G6G A;  4BJY A;  2YWL A;  3LOV A;  2BAC A;  2R4J A;  2WDR A;  3UCL A;  3GD4 A;  1KFY A;  4AT0 A;  4Z2T A;  3IWA A;  4K7Z A;  3NHO X;  3ATR A;  5U63 A;  4USQ A;  3RNM A;  3IHM A;  4B65 A;  4GRT A;  3ALL A;  2C67 A;  1H81 A;  1ZOY A;  2RAB A;  2EQ6 A;  1CF3 A;  1LQT A;  3O0H A;  4U2T A;  1GAL A;  1PBB A;  1QO8 A;  3LB8 A;  4H4V A;  5IQ1 A;  1PJ6 A;  3T14 A;  4H4U A;  4K2X A;  1FOH A;  1FEB A;  3AE5 A;  2GR2 A;  2NVK X;  1W4X A;  1ZP0 A;  5HYM A;  2XVI A;  4NZH A;  4H2Q A;  4JQ9 A;  4U8L A;  3ALM A;  3OZ2 A;  2GEW A;  3AE8 A;  3FMW A;  2J3N A;  1LQU A;  5KMP A;  3BNM A;  4O5Q A;  4H4S A;  1LPF A;  1DXL A;  1GPE A;  3ICR A;  4YXD A;  4LA1 A;  2X8C A;  2XYO A;  1XDI A;  4YTM A;  1FL2 A;  3DJD A;  2X50 A;  5KOW A;  2WPE A;  2YVJ A;  4CBQ A;  1ZY8 A;  5KMS A;  5J7X A;  3T37 A;  4JY2 A;  1EL9 A;  4H2P A;  2VQB A;  4CNJ A;  4H50 A;  2I0Z A;  1AOG A;  2C72 A;  1TYT A;  1XAN A;  2WP5 A;  2YVF A;  3AEF A;  4OPL A;  4CNK A;  4J31 A;  1JRY A;  2VQ7 A;  2BS2 A;  4AOX A;  4EQW A;  1KNR A;  1GRA A;  2GR1 A;  5C2T A;  4H2R A;  3CN8 A;  1H7W A;  3RED A;  3AYL A;  4B66 A;  2GV8 A;  5JCI A;  3NTA A;  1Q1W A;  2OA1 A;  2WES A;  4II3 A;  2YG5 A;  1GRG A;  1JEH A;  4TLX A;  2V3B A;  3ADA B;  3V3N A;  2JAE A;  1XPQ A;  2V5Z A;  2R0C A;  3AXB A;  4WX1 A;  2C64 A;  1E39 A;  3G5S A;  4BV6 A;  1GEU A;  1FCD A;  1GRB A;  2BS4 A;  5BRT A;  2XFO A;  3HZL A;  3NKS A;  3NRN A;  3SYI A;  3NG7 X;  1VQW A;  3H8I A;  3LXD A;  1DNC A;  2ARD A;  1Y56 B;  2V6O A;  2ZZB A;  3OC4 A;  4AP1 A;  3DK9 A;  4H4Z A;  1F8R A;  4H4Y A;  4X9N A;  1GER A;  4B1B A;  3IHG A;  4M52 A;  1GES A;  2XLT A;  2YG7 A;  1YQ4 A;  4EMI A;  1V59 A;  3HYV A;  4EQR A;  3HYX A;  3PO7 A;  1D4D A;  5M10 A;  2FJB A;  3K7M X;  2BA9 A;  1QJD A;  3AEC A;  2VVL A;  3AE2 A;  3M12 A;  2ZBW A;  4J33 A;  1IJH A;  2C66 A;  4A5L A;  1DOC A;  2XVH A;  3GWF A;  1MXT A;  4P9S A;  2B9Y A;  4B68 A;  4C3X A;  1JRZ A;  3FG2 P;  1ZX9 A;  2YR4 A;  1CC2 A;  1EBD A;  2XDO A;  2E1M A;  4APN A;  5KVH A;  1N4U A;  4NTC A;  2DKH A;  1L9C A;  1TDO A;  1F8S A;  1NEN A;  3CTY A;  3T2K A;  4K8D A;  2XFQ A;  2RGJ A;  3AE9 A;  2IID A;  2C4C A;  4J2W A;  3GRS A;  1MO9 A;  2FJD A;  1NHQ A;  3NLC A;  4XWR A;  3QJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...