2VOUA

Structure of 2,6-dihydroxypyridine-3-hydroxylase from arthrobacter nicotinovorans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
393
structure length
393
Chain Sequence
SPTTDRIAVVGGSISGLTAALMLRDAGVDVDVYERSPQPLSGFGTGIVVQPELVHYLLEQGVELDSISVPSSSMEYVDALTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADGGASVVRKRLLGIEPTYAGYVTWRGVLQPGEVADDVWNYFNDKFTYGLLDDGHLIAYPIPGRENAESPRLNFQWYWNVAEGPDLDELMTDVRGIRLPTSVHNNSLNPHNLRQFHSKGESLFKPFRDLVLNASSPFVTVVADATVDRMVHGRVLLIGDAAVTPRPHAAAGGAKASDDARTLAEVFTKNHDLRGSLQSWETRQLQQGHAYLNKVKKMASRLQHGGSFEPGNPAFAFGLPKVDEPSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2,6-DIHYDROXYPYRIDINE HYDROXYLASE
publication title Structure of 2,6-Dihydroxypyridine 3-Hydroxylase from a Nicotine-Degrading Pathway.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
total genus 128
structure length 393
sequence length 393
chains with identical sequence B, C
ec nomenclature ec 1.14.13.10: 2,6-dihydroxypyridine 3-monooxygenase.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.60 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 2vouA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vouA01
2NPXA 2XDOA 1DODA 1NEKA 2ZBWA 3B6DA 4J57A 3UOZA 3AEFA 2GRTA 3BI5A 3CNPA 4USRA 4H4ZA 2DKIA 3CGCA 3CNTA 1CL0A 3CGDA 3NK2X 2YVFA 2GF3A 3H4KA 1FOHA 2BK5A 4U8NA 2YLTA 3PS9A 1EL5A 2GR2A 3GD4A 5FMHA 1TRBA 2WOWA 5U1OA 3AEEA 2PHHA 3ZDNA 1YKJA 4OPIA 1E1MA 3VRDB 3UKQA 1BKWA 1LJ1A 2XFOA 1GPEA 4CNKA 3LXDA 3G5QA 3SQPA 2XLTA 1MXTA 4ICYA 1ZK7A 1PXBA 4H4UA 4Y4LA 3NYEA 2X3NA 3AD9B 4Z25A 2WS3A 3B3RA 4YTMA 2WU5A 1GERA 2WBAA 2VQ7A 3COXA 4OPCA 4ZCDA 5BVAA 3UKLA 4GCMA 5IPYA 3CPIG 3R9UA 1H7XA 1Y0PA 2XVFA 3GDNA 4YSXA 2VQBA 1PBFA 3EF6A 4AT2A 5HYMA 3ITJA 3KVEA 2IVDA 3CIRA 4GF7A 2OALA 5KRQA 5KVHA 2GAHB 3CGBA 2XFPA 3BNUA 2GR3A 2WPEA 3NTAA 1NDAA 4NEWA 4Z2UA 3ATQA 2GV8A 3E1TA 5L46A 4UDPA 1RSGA 4DSGA 3ALLA 4XWRA 1GV4A 3P4PA 1ZMDA 3CN8A 2YR4A 2JAEA 3AWIA 1JRYA 4RG3A 2BC0A 3QJ4A 2WDQA 4EQSA 1TDFA 2I0ZA 3KA7A 3NK0X 4NEVA 4B1BA 4UDQA 2C65A 5JCMA 2AR8A 4JN9A 4YTPA 4C5OA 2ZZ0A 1L9CA 2A8XA 2WHDA 3CTYA 2YM1A 4AP1A 1S3BA 4O5QA 4YTNA 1X31B 1ZOYA 3KU9A 2ZZCA 4LU6A 4Z26A 4TM0A 1S3EA 2RGOA 4BURA 3AYLA 4K2XA 4Y4NA 4A7AA 5KXJA 3AD8B 3UP4A 4IVOB 1CHUA 5GRTA 3P4QA 5U63A 1D7LA 1PBBA 1O5WA 1EL9A 1HYUA 1XANA 3FPZA 1H86A 2YG7A 1F8RA 2BCPA 2WDVA 3ISHA 4IVMB 4IA5A 4M52A 1UKVG 3IHGA 3P1WA 2BACA 3UKHA 1XHCA 1H83A 4CY6A 4Z2RA 1COYA 4H4YA 4HB9A 1RP0A 3DGZA 2GMHA 3BNMA 3GSIA 4J33A 1JNRA 2WQYA 4H4VA 5HHFA 4U8LA 1E1NA 3OZ2A 1K0JA 2XFQA 2CDUA 1DOCA 2XVJA 3VRBA 4APNA 3I6DA 4J56A 1LQTA 1TYTA 4TM3A 4OPTA 4OPUA 3BI2A 3G5RA 5GSNA 2JB3A 4TM1A 2C3CA 3V3NA 3II4A 2FJEA 3JSKA 4H2QA 1B8SA 4K7ZA 4U8JA 1ELIA 2E4GA 1GT8A 3LADA 1VG0A 3Q6JA 3NYFA 1N4UA 4DNAA 2GEWA 3GRTA 1JEHA 2BCGG 1IUSA 4B65A 1PBDA 2GR0A 4ZCCA 4U2LA 3IHMA 1BWCA 1BZLA 2B7RA 1ZOVA 1OJTA 2ACZA 4H2RA 4GR1A 3P9UA 1Q9IA 3ADAB 3AEAA 3NGCX 1IJHA 3AE8A 1N4VA 3CPJG 4OCGA 4U8IA 3AB1A 2BXRA 4J36A 3RP8A 2YG4A 5C3JA 3AE2A 2QAEA 2VRLA 2V61A 1PHHA 2F5ZA 5KOXA 3NRNA 2EQ6A 3AEDA 1D4EA 1JOAA 2ARDA 2GQFA 2YQUA 1XDIA 1ZKQA 1PJ6A 4CCQA 5M10A 2C7GA 1H81A 1NHSA 1YQZA 2AQJA 3DH9A 3V76A 1NPXA 1GEUA 2EQ9A 3EAOA 1D7YA 1FCDA 4GRTA 5FS8A 1OJCA 2CULA 2V3AA 2Y6RA 3P4SA 3AE5A 4K22A 4YKGA 4J2WA 1F3PA 4Z44A 3K30A 3PO7A 2C67A 3M13A 2XLPA 1LV0A 4EIPA 2XVHA 1TDNA 4H4QA 4NZHA 5BUKA 1Y56A 4UDRA 1GOSA 1NHRA 4WX1A 1M64A 1LTXR 1VQWA 2B9WA 3GD3A 1FECA 1TDOA 1EBDA 2WP5A 1ZX9A 3ABVA 5JCLA 1BGNA 1PJ7A 4NTEA 4U8PA 5JCIA 4UP3A 1CC2A 4X9NA 1ZMCA 2ZZBA 3S61A 4B66A 2XFNA 4EIQA 4H2NA 4I58A 1AOGA 2CVJA 3OC4A 4BK2A 4Y4MA 1LPFA 3UP5A 3P4RA 1FL2A 1GRTA 1GREA 2BABA 2WDRA 4AOSA 3KLJA 1BGJA 3F8RA 3UCLA 2YWLA 3UTEA 4H2PA 3SFDA 1NENA 2RGJA 1EL7A 1GRHA 2GMJA 3GRSA 3AE3A 1K0LA 2QA2A 3AE7A 2YVGA 3DJGX 3G5SA 2GH5A 2R0CA 1DJQA 3VR8A 2C66A 1PXAA 2C64A 1Q1RA 1B5QA 2Q0KA 2YLWA 4CNJA 1TYPA 1KDGA 3SFEA 4EM3A 1OJDA 2WETA 4H4SA 2FJAA 2YG3A 1S2YA 5HY5A 1V59A 1ZP0A 4TM4A 2Y6QA 4LIIA 1P2HA 4J34A 4A99A 2AAQA 4CY8A 1CC6A 3NLCA 5DBJA 3AECA 1B4VA 5M0ZA 2IVEA 4REKA 4U8OA 4A6NA 4A65A 4JQ9A 2WPCA 2X8HA 2XLUA 1IUWA 1PDHA 4H4RA 3FMWA 1GXFA 3EPTA 4H7UA 2QA1A 4N9XA 3VQRA 2OAMA 3AYIA 4ZN0A 4NTDA 5CKUA 2WOVA 4EMJA 3M0OA 5LV9A 1RYIA 3UTHA 2BA9A 4J31A 2XLRA 3NK1X 4PAAA 3RHAA 4AP3A 3UKKA 4X4JA 2YM2A 2C72A 1L0VA 4FX9A 3FIMB 2VRMA 2W0HA 4YT0A 5EBKA 3KD9A 2C3DA 2YLZA 1KNRA 3BHFA 2XVIA 2R0GA 4GUVA 1CF3A 5BULA 4EMWA 1O94A 1M6IA 3GMBA 1TDEA 3DK9A 5IQ4A 1GTEA 2C73A 1F8WA 1CC4A 2OA1A 1ZDLA 4CRTA 1Y56B 1IUTA 3PVCA 3K7MX 4HA6A 1NG3A 4BJZA 2WP6A 2RABA 3NT6A 3QVPA 4AOXA 1F8SA 2BK3A 1YY5A 3C4AA 1KSUA 4JNQA 3LOVA 3QFAA 3L1RA 1D4DA 1PBEA 3LZWA 3O0HA 2EQ8A 1DOBA 3QSMA 3REDA 5EOWA 1ONFA 2XLSA 3NYCA 4CCRA 4C74A 3SGLA 1VDCA 2B9YA 4JY2A 1SEZA 4EQRA 3I3LA 4U8MA 2JB1A 1DNCA 2VVMA 2YR5A 3GDPA 1KSSA 2BK4A 3DGHA 4XWZA 2O9ZA 4B63A 1S2QA 2R45A 3NN6X 4OPLA 4EQWA 5EB5A 2JK6A 3NN0X 4A9WA 1VRQB 2TMDA 2BS2A 2JB2A 4H4PA 3UTGA 1NG4A 2APGA 4PABA 1JRZA 3F8PA 3VRAA 1CJ2A 2BYBA 2BXSA 4K5SA 2CFYA 2WESA 4U8KA 2B7SA 2YLXA 3SM8A 4D03A 2YG5A 1CJCA 3ICSA 1BF3A 2V6OA 1H7WA 3CNDA 2BS4A 4O5UA 1E7PA 5IQ1A 3D8XA 4C77A 4TLXA 2R46A 1ZY8A 1Z6LA 3UOXA 3QSEA 4MJWA 4A6NB 4YXDA 2TPRA 3ALJA 3GWFA 2GAGB 3GWDA 2XCGA 2JBVA 3UTFA 5KVIA 4P9SA 4BK3A 2OLNA 4EMIA 3WE0A 1GESA 3LZXA 5C2TA 5JCNA 3KPFA 4GDPA 3HZLA 3NG7X 2VVLG 1GRFA 2XFUA 5FS6A 1CBOA 3UOVA 1E1KA 2H89A 4ECHA 3RP6A 3URHA 3NKSA 3ZYXA 4A79A 3DJDA 1K4QA 2VVLA 2Q0LA 4FK1A 5J7XA 3AXBA 4KPRA 3D1CA 1N1PA 3GYIA 4D04A 4EQXA 4YKFA 2V60A 2A87A 4YSYA 4X9MA 2YLRA 1QJDA 1REOA 3Q9TA 1GNDA 4BK1A 3AEGA 1KNPA 3DK4A 4YSZA 3UKFA 3H8IA 4LA1A 1E39A 3CGEA 3CNSA 3DA1A 2UZZA 1IUXA 1DJNA 1IUUA 2E1MA 2YLSA 2YG6A 3GYJA 4Z24A 2IIDA 3UKPA 5J60A 2GVCA 4H4WA 1JRXA 3AE6A 4KX6A 4DGKA 1O95A 3AD7B 3S5WA 2J3NA 1P2EA 3RNMA 4A5LA 3ICRA 4K5RA 4Z2TA 3C96A 4AT0A 1IUVA 2B76A 3UOYA 4H50A 2YVJA 5FS7A 3FG2P 1TDKA 1W4XA 3NTDA 2WOIA 3V3OA 2X50A 1N4WA 1L9EA 2RGHA 3BI4A 2XVEA 3DJJA 3ICTA 1H82A 4NTCA 5BRTA 3QFBA 4H4XA 2VOUA 4JNAA 3IF9A 4TLZA 3LJPA 1H84A 3IC9A 3L8KA 3NH3X 4IV9A 1KF6A 1DXLA 1K0IA 1LQUA 5JCKA 4JDRA 1PBCA 3ATRA 2DKHA 5FS9A 1PJ5A 3M12A 3QSSA 3NHOX 1MOKA 3H8LA 1GRBA 1PXCA 3DMEA 1YQ4A 4IA6A 5U25A 4I59A 2BC1A 4C3XA 3QVRA 4USQA 2PYXA 2QCUA 3GMCA 3KKJA 3LB8A 1L9DA 3AE9A 3K7QX 1GRGA 3RP7A 1GALA 1GRAA 1NAAA 2Z5XA 4FK1C 4DSHA 1JU2A 1B37A 2GB0A 2GR1A 3AE1A 4K8DA 2R9ZA 1GSNA 2JKCA 2Q6UA 4FDCB 4YSHA 1FEAA 1JNZA 1LVLA 1XPQA 2R4JA 3NNEA 4B64A 1CJ4A 3DJEA 1E6EA 4OPDA 4EM4A 2FJDA 2X99A 4U2SA 4E0VA 3K7TA 2E5VA 2V5ZA 3EANA 1D4CA 3VR9A 1DOEA 4C3YA 1FEBA 4B68A 2B9XA 1MO9A 2A89A 1OJAA 2V3BA 3C4NA 3BHKA 2OLOA 4B67A 3DK8A 4CBQA 2FBWA 3AE4A 4WCTA 1NHPA 5EB4A 2C70A 1QLBA 1H6VA 2YR6A 3ALMA 5TR3A 4BJYA 1PN0A 4XXGA 2Q7VA 2WP9A 1GTHA 4U2TA 5KWFA 1E1LA 2X8CA 3IWAA 3CPHG 2GQWA 1D5TA 4RSLA 2VZ2A 2H88A 2FJBA 1CJ3A 3FBSA 3T37A 4H4TA 2HQMA 1EL8A 4YWOA 4Z43A 3AYJA 1Q1WA 1KFYA 2YAUA 1F6MA 2C75A 2NVKX 2R4EA 3F8DA 2EQ7A 2WPFA 5HXIA 2Z5YA 2XYOA 3NIXA 1QO8A 3UKAA 2BS3A 2R0PA 2WU2A 2WEUA 3AEBA 5KOWA 2X8GA 4BV6A 4B69A 1GETA 1NHQA 1OJ9A 1VG9A 1YQ3A 5ER0A 4JY3A 3CNJA 1PS9A 4ADWA 4GDEA 4OPGA 2C76A 4OVIA 5CQFA 4RG4A
chains in the Genus database with same CATH superfamily
2NPXA 2XDOA 1DODA 1NEKA 2ZBWA 3B6DA 4J57A 3UOZA 3AEFA 2GRTA 3BI5A 3CNPA 4USRA 4H4ZA 2DKIA 3CGCA 3CNTA 1CL0A 3CGDA 3NK2X 2YVFA 2GF3A 3H4KA 1FOHA 2BK5A 4U8NA 2YLTA 3PS9A 1EL5A 2GR2A 3GD4A 5FMHA 1TRBA 2WOWA 5U1OA 3AEEA 2PHHA 3ZDNA 1YKJA 4OPIA 1E1MA 3VRDB 3UKQA 1BKWA 1LJ1A 2XFOA 1GPEA 4CNKA 3LXDA 3G5QA 3SQPA 2XLTA 1MXTA 4ICYA 1ZK7A 1PXBA 4H4UA 4Y4LA 3NYEA 2X3NA 3AD9B 4YJFB 4YJGA 2WS3A 3B3RA 4YTMA 4Z25A 2WU5A 1GERA 2WBAA 2VQ7A 3COXA 4OPCA 4ZCDA 5BVAA 3UKLA 1VE9A 4GCMA 5IPYA 3CPIG 3R9UA 1H7XA 1Y0PA 2XVFA 3GDNA 4YSXA 2VQBA 1PBFA 3EF6A 4AT2A 5HYMA 3ITJA 3KVEA 2IVDA 3CIRA 4GF7A 2OALA 5KRQA 5KVHA 2GAHB 3CGBA 2XFPA 3BNUA 1EVIA 2GR3A 2WPEA 3NTAA 1NDAA 4NEWA 4Z2UA 3ATQA 2GV8A 3E1TA 5L46A 4UDPA 1RSGA 4DSGA 3ALLA 4XWRA 1GV4A 3P4PA 1ZMDA 3W4IA 3CN8A 2YR4A 3AWIA 2JAEA 1JRYA 4RG3A 3G3EA 2BC0A 3QJ4A 2WDQA 4EQSA 1TDFA 2I0ZA 3KA7A 3NK0X 4NEVA 4B1BA 4UDQA 2C65A 5JCMA 2AR8A 4JN9A 4YTPA 4C5OA 2ZZ0A 1L9CA 2A8XA 2WHDA 3CTYA 2YM1A 4AP1A 1S3BA 4O5QA 4YTNA 1X31B 1ZOYA 3KU9A 2ZZCA 4LU6A 4Z26A 4TM0A 1S3EA 2RGOA 4BURA 3AYLA 4K2XA 3T0KA 4Y4NA 4A7AA 5KXJA 3AD8B 3UP4A 4IVOB 1CHUA 5GRTA 3P4QA 1DDOA 1D7LA 1PBBA 1O5WA 1EL9A 1HYUA 1XANA 3FPZA 5U63A 1H86A 2YG7A 4YJHB 1F8RA 2BCPA 2WDVA 3ZNPA 4IA5A 3ISHA 4IVMB 4M52A 3IHGA 1UKVG 3P1WA 2BACA 3UKHA 1XHCA 1H83A 4CY6A 4Z2RA 1COYA 4H4YA 4HB9A 1RP0A 5KNLA 3DGZA 2E82A 2GMHA 3BNMA 3GSIA 4J33A 1JNRA 2WQYA 4H4VA 5HHFA 4U8LA 1E1NA 3OZ2A 1K0JA 2XFQA 2CDUA 1DOCA 2XVJA 3VRBA 4APNA 3I6DA 4J56A 1LQTA 1TYTA 4TM3A 4OPTA 4OPUA 1KIFA 3BI2A 2DU8A 3G5RA 5GSNA 2JB3A 4TM1A 2C3CA 3V3NA 3II4A 2FJEA 3JSKA 3HYVA 4H2QA 1B8SA 4II2A 4K7ZA 4U8JA 1ELIA 1GT8A 2E4GA 3W4JA 3LADA 3T2YA 4QFCA 1VG0A 3NYFA 3Q6JA 1N4UA 4DNAA 2GEWA 3GRTA 1JEHA 2BCGG 1IUSA 4B65A 1PBDA 2GR0A 4ZCCA 4U2LA 3IHMA 1BWCA 1BZLA 2B7RA 1ZOVA 1OJTA 4H2RA 2ACZA 4NWZA 4GR1A 3P9UA 1Q9IA 3SZWA 3T31A 3ADAB 3AEAA 4YJGB 3NGCX 1IJHA 3AE8A 1N4VA 3CPJG 4OCGA 4U8IA 3AB1A 2BXRA 4J36A 3RP8A 2YG4A 5C3JA 3AE2A 2QAEA 2VRLA 2V61A 1PHHA 2F5ZA 5KOXA 3NRNA 2EQ6A 3AEDA 3CMMA 1D4EA 1JOAA 2ARDA 2GQFA 2YQUA 1XDIA 1ZKQA 1PJ6A 4CCQA 5M10A 2C7GA 1H81A 1NHSA 1YQZA 2AQJA 3DH9A 3V76A 1NPXA 1GEUA 2EQ9A 3EAOA 1D7YA 1FCDA 4GRTA 5FS8A 1OJCA 2CULA 2V3AA 2Y6RA 3P4SA 3AE5A 4K22A 4YKGA 4J2WA 1F3PA 4Z44A 3K30A 3PO7A 2C67A 3M13A 2XLPA 4EIPA 1LV0A 2XVHA 1TDNA 4H4QA 4NZHA 5BUKA 1Y56A 4UDRA 1GOSA 1NHRA 4WX1A 1M64A 1LTXR 1VQWA 2B9WA 3GD3A 1FECA 1TDOA 1EBDA 2WP5A 1ZX9A 3ABVA 5JCLA 1BGNA 1PJ7A 4NTEA 4U8PA 5JCIA 4UP3A 1CC2A 4X9NA 1ZMCA 4EIQA 2ZZBA 3S61A 2XFNA 4B66A 4H2NA 3ZNNA 4I58A 1AOGA 2CVJA 3OC4A 4BK2A 4Y4MA 1LPFA 3UP5A 1C0KA 1FL2A 1GRTA 1GREA 2BABA 2WDRA 3P4RA 4AOSA 3KLJA 1BGJA 3F8RA 3UCLA 2YWLA 3UTEA 4H2PA 3SFDA 1NENA 2RGJA 1EL7A 1GRHA 2GMJA 3T2KA 3GRSA 3AE3A 1K0LA 2QA2A 3AE7A 2YVGA 3DJGX 3G5SA 2GH5A 2R0CA 1DJQA 3VR8A 2C66A 1PXAA 2C64A 1Q1RA 1B5QA 2Q0KA 2YLWA 4CNJA 5KMQA 1TYPA 1KDGA 3SFEA 4EM3A 1OJDA 2WETA 4H4SA 2FJAA 2YG3A 1S2YA 5HY5A 3SZCA 1V59A 1ZP0A 4TM4A 2Y6QA 4LIIA 1P2HA 4J34A 4A99A 4G6HA 2AAQA 4CY8A 1CC6A 3SZFA 3NLCA 5DBJA 3AECA 1B4VA 5M0ZA 2IVEA 4REKA 4U8OA 4A6NA 4A65A 4JQ9A 2WPCA 2X8HA 2XLUA 1IUWA 1PDHA 4H4RA 3FMWA 1GXFA 3KPKA 3EPTA 4H7UA 3SZ0A 2QA1A 4N9XA 3VQRA 1C0IA 2OAMA 3AYIA 4ZN0A 4NTDA 3SXIA 5CKUA 4G9KA 2WOVA 4EMJA 3M0OA 5LV9A 2BRAA 1RYIA 3UTHA 4PAAA 2BA9A 2XLRA 3NK1X 4J31A 3RHAA 4AP3A 3UKKA 4X4JA 2YM2A 2C72A 1L0VA 4FX9A 3FIMB 2VRMA 2W0HA 4YT0A 5EBKA 3SYIA 5KMSA 3KD9A 2C3DA 2YLZA 1KNRA 3BHFA 2XVIA 2R0GA 4GUVA 5KMRA 1CF3A 5BULA 4EMWA 1O94A 1M6IA 3GMBA 1TDEA 3DK9A 5IQ4A 1GTEA 4G73A 2C73A 1F8WA 1CC4A 2E48A 2E49A 2OA1A 1ZDLA 4CRTA 1Y56B 1IUTA 3PVCA 3K7MX 4HA6A 1NG3A 4BJZA 2WP6A 2RABA 3NT6A 3QVPA 4AOXA 1F8SA 2BK3A 1YY5A 3C4AA 1KSUA 4JNQA 3LOVA 3QFAA 3L1RA 1D4DA 5KMPA 1PBEA 3LZWA 3O0HA 3QSMA 1DOBA 2EQ8A 2BRYA 3REDA 5EOWA 1ONFA 4NNJA 2XLSA 3NYCA 3ZNOA 3HYXA 3SGLA 4CCRA 4C74A 4QFDA 1VDCA 2B9YA 4JY2A 1SEZA 4EQRA 3I3LA 4U8MA 2JB1A 1DNCA 2VVMA 2YR5A 3GDPA 3GYXA 1KSSA 4XWZA 2BK4A 3DGHA 2O9ZA 4B63A 2R45A 1S2QA 3NN6X 4OPLA 4EQWA 5EB5A 2JK6A 3NN0X 4A9WA 1VRQB 2TMDA 2BS2A 2JB2A 4H4PA 3UTGA 1NG4A 2APGA 1C0LA 4PABA 1DAOA 1JRZA 3F8PA 3VRAA 1CJ2A 2BYBA 2BXSA 4K5SA 2CFYA 3SM8A 2WESA 2B7SA 2YLXA 4U8KA 4D03A 2YG5A 1CJCA 3ICSA 1BF3A 2V6OA 1H7WA 3CNDA 2BS4A 4O5UA 1E7PA 5IQ1A 3D8XA 4C77A 4TLXA 2R46A 1ZY8A 1Z6LA 3UOXA 3QSEA 4MJWA 4A6NB 4YXDA 2TPRA 3ALJA 3GWFA 2GAGB 3GWDA 2XCGA 2JBVA 3UTFA 5KVIA 4P9SA 4BK3A 4G6GA 2OLNA 4EMIA 4G74A 3WE0A 1GESA 3LZXA 5C2TA 5JCNA 3KPFA 4GDPA 3HZLA 3NG7X 2VVLG 1GRFA 2XFUA 5FS6A 1CBOA 3UOVA 1E1KA 2H89A 4ECHA 3RP6A 3URHA 3NKSA 3ZYXA 4A79A 3DJDA 1K4QA 2VVLA 2Q0LA 4FK1A 5J7XA 3AXBA 4KPRA 3D1CA 1N1PA 3GYIA 4D04A 4EQXA 4YKFA 2V60A 2A87A 3T14A 4YSYA 4X9MA 2YLRA 1QJDA 1REOA 4BK1A 1GNDA 3Q9TA 3AEGA 1KNPA 3DK4A 4YSZA 3ZNQA 3UKFA 3H8IA 4LA1A 1E39A 3DA1A 3CGEA 3CNSA 2UZZA 1IUXA 1DJNA 1IUUA 2E1MA 2YLSA 2YG6A 3GYJA 4Z24A 2IIDA 3UKPA 5J60A 2GVCA 4H4WA 1JRXA 3AE6A 4KX6A 3CUKA 4DGKA 3AD7B 1O95A 3S5WA 2J3NA 1P2EA 3RNMA 4A5LA 3ICRA 4K5RA 4Z2TA 3C96A 4AT0A 1IUVA 2B76A 3UOYA 4H50A 2YVJA 5FS7A 3FG2P 1TDKA 1W4XA 3NTDA 2WOIA 3V3OA 2E4AA 2X50A 1N4WA 1L9EA 2RGHA 3BI4A 2XVEA 3DJJA 3ICTA 1H82A 4NTCA 5BRTA 3QFBA 4H4XA 2VOUA 4JNAA 3IF9A 4TLZA 3LJPA 1H84A 3IC9A 3L8KA 3NH3X 4IV9A 1KF6A 1DXLA 1K0IA 1LQUA 5JCKA 4JDRA 1PBCA 3ATRA 2DKHA 5FS9A 1PJ5A 3M12A 3QSSA 4GAVA 3NHOX 1MOKA 3H8LA 1GRBA 1PXCA 3DMEA 1YQ4A 4YJFA 4IA6A 5U25A 4I59A 2BC1A 4C3XA 3QVRA 4GAPA 4USQA 2PYXA 2QCUA 3GMCA 3KKJA 3LB8A 1L9DA 3AE9A 3K7QX 1GRGA 3RP7A 1GALA 1GRAA 1NAAA 2Z5XA 4FK1C 4DSHA 1JU2A 1B37A 2GB0A 2GR1A 3AE1A 4K8DA 2R9ZA 1GSNA 2JKCA 2Q6UA 4FDCB 3SX6A 4YSHA 1FEAA 1JNZA 2R4JA 1LVLA 1XPQA 3NNEA 4B64A 1CJ4A 3DJEA 1E6EA 4OPDA 3SY4A 4EM4A 1AN9A 2FJDA 2X99A 4U2SA 4E0VA 3K7TA 2E5VA 2V5ZA 3EANA 1D4CA 2C4CA 3VR9A 1DOEA 4C3YA 1FEBA 4B68A 2B9XA 1MO9A 2A89A 3C4NA 1OJAA 2V3BA 3BHKA 2OLOA 4B67A 3WGTA 3DK8A 4CBQA 2FBWA 3AE4A 4WCTA 1NHPA 5EB4A 1C0PA 1QLBA 1H6VA 2C70A 3ALMA 2YR6A 5TR3A 4BJYA 1PN0A 4XXGA 2Q7VA 2WP9A 4YJDA 1GTHA 4U2TA 5KWFA 1E1LA 2X8CA 3IWAA 3CPHG 4YJHA 2GQWA 1D5TA 4RSLA 2VZ2A 2H88A 2FJBA 1CJ3A 3FBSA 4II3A 4H4TA 2HQMA 1EL8A 4YWOA 3T37A 3AYJA 4Z43A 1Q1WA 1KFYA 2YAUA 1F6MA 2R4EA 2C75A 2NVKX 3F8DA 2EQ7A 2WPFA 5HXIA 2Z5YA 2XYOA 3NIXA 1QO8A 3HYWA 3UKAA 2R0PA 2BS3A 2WU2A 2WEUA 3AEBA 3T2ZA 5KOWA 3W4KA 2X8GA 4BV6A 4B69A 1GETA 1NHQA 1OJ9A 1VG9A 1YQ3A 5ER0A 4JY3A 3CNJA 1PS9A 4ADWA 4GDEA 4OPGA 2C76A 4OVIA 5CQFA 4RG4A
chains in the Genus database with same CATH topology
2NPXA 2XDOA 1DODA 1NEKA 2ZBWA 3B6DA 4J57A 3UOZA 3AEFA 2GRTA 3BI5A 3CNPA 4USRA 4H4ZA 2DKIA 3CGCA 3CNTA 1CL0A 3CGDA 3NK2X 2YVFA 2GF3A 3H4KA 1FOHA 2BK5A 4U8NA 2YLTA 3PS9A 1EL5A 2GR2A 3GD4A 5FMHA 1TRBA 2WOWA 5U1OA 3AEEA 2PHHA 3ZDNA 1YKJA 4OPIA 1E1MA 3VRDB 3UKQA 1BKWA 1LJ1A 2XFOA 1GPEA 4CNKA 3LXDA 3G5QA 3SQPA 2XLTA 1MXTA 4ICYA 1ZK7A 1PXBA 4H4UA 4Y4LA 3NYEA 2X3NA 3AD9B 4Z25A 2WS3A 3B3RA 4YTMA 2WU5A 1GERA 2WBAA 2VQ7A 3COXA 4OPCA 4ZCDA 5BVAA 3UKLA 4GCMA 5IPYA 3CPIG 3R9UA 1H7XA 1Y0PA 2XVFA 3GDNA 4YSXA 2VQBA 1PBFA 3EF6A 4AT2A 5HYMA 3ITJA 3KVEA 2IVDA 3CIRA 4GF7A 2OALA 5KRQA 5KVHA 2GAHB 3CGBA 2XFPA 3BNUA 2GR3A 2WPEA 3NTAA 1NDAA 4NEWA 4Z2UA 3ATQA 2GV8A 3E1TA 5L46A 4UDPA 1RSGA 4DSGA 3ALLA 4XWRA 1GV4A 3P4PA 1ZMDA 3CN8A 2YR4A 2JAEA 3AWIA 1JRYA 4RG3A 2BC0A 3QJ4A 2WDQA 4EQSA 1TDFA 2I0ZA 3KA7A 3NK0X 4NEVA 4B1BA 4UDQA 2C65A 5JCMA 2AR8A 4JN9A 4YTPA 4C5OA 2ZZ0A 1L9CA 2A8XA 2WHDA 3CTYA 2YM1A 4AP1A 1S3BA 4O5QA 4YTNA 1X31B 1ZOYA 3KU9A 2ZZCA 4LU6A 4Z26A 4TM0A 1S3EA 2RGOA 4BURA 3AYLA 4K2XA 3T0KA 4Y4NA 4A7AA 5KXJA 3AD8B 3UP4A 4IVOB 1CHUA 5GRTA 3P4QA 5U63A 1D7LA 1PBBA 1O5WA 1EL9A 1HYUA 1XANA 3FPZA 1H86A 2YG7A 1F8RA 2BCPA 2WDVA 3ISHA 4IVMB 4IA5A 4M52A 3IHGA 1UKVG 3P1WA 2BACA 3UKHA 1XHCA 1H83A 4CY6A 4Z2RA 1COYA 4H4YA 4HB9A 1RP0A 5KNLA 3DGZA 2GMHA 3BNMA 3GSIA 4J33A 1JNRA 2WQYA 4H4VA 5HHFA 4U8LA 1E1NA 3OZ2A 1K0JA 2XFQA 2CDUA 1DOCA 2XVJA 3VRBA 4APNA 3I6DA 4J56A 1LQTA 1TYTA 4TM3A 4OPTA 4OPUA 3BI2A 3G5RA 5GSNA 2JB3A 4TM1A 2C3CA 3V3NA 3II4A 2FJEA 3JSKA 3HYVA 4H2QA 1B8SA 4II2A 4K7ZA 4U8JA 1ELIA 1GT8A 2E4GA 3LADA 3T2YA 1VG0A 3Q6JA 3NYFA 1N4UA 4DNAA 2GEWA 3GRTA 1JEHA 2BCGG 1IUSA 4B65A 1PBDA 2GR0A 4ZCCA 4U2LA 3IHMA 1BWCA 1BZLA 2B7RA 1ZOVA 1OJTA 4H2RA 2ACZA 4NWZA 4GR1A 3P9UA 1Q9IA 3SZWA 3T31A 3ADAB 3AEAA 3NGCX 1IJHA 3AE8A 1N4VA 3CPJG 4OCGA 4U8IA 3AB1A 2BXRA 4J36A 3RP8A 2YG4A 5C3JA 3AE2A 2QAEA 2VRLA 2V61A 1PHHA 2F5ZA 5KOXA 3NRNA 2EQ6A 3AEDA 3CMMA 1D4EA 1JOAA 2ARDA 2GQFA 2YQUA 1XDIA 1ZKQA 1PJ6A 4CCQA 5M10A 2C7GA 1H81A 1NHSA 1YQZA 2AQJA 3DH9A 3V76A 1NPXA 1GEUA 2EQ9A 3EAOA 1D7YA 1FCDA 4GRTA 5FS8A 1OJCA 2CULA 2V3AA 2Y6RA 3P4SA 3AE5A 4K22A 4YKGA 4J2WA 1F3PA 4Z44A 3K30A 3PO7A 2C67A 3M13A 2XLPA 4EIPA 1LV0A 2XVHA 1TDNA 4H4QA 4NZHA 5BUKA 1Y56A 4UDRA 1GOSA 1NHRA 4WX1A 1M64A 1LTXR 1VQWA 2B9WA 3GD3A 1FECA 1TDOA 1EBDA 2WP5A 1ZX9A 3ABVA 5JCLA 1BGNA 1PJ7A 4NTEA 4U8PA 5JCIA 4UP3A 1CC2A 4X9NA 1ZMCA 4EIQA 2ZZBA 3S61A 2XFNA 4B66A 4H2NA 4I58A 1AOGA 2CVJA 3OC4A 4BK2A 4Y4MA 1LPFA 3UP5A 3P4RA 1FL2A 1GRTA 1GREA 2BABA 2WDRA 4AOSA 3KLJA 1BGJA 3F8RA 3UCLA 2YWLA 3UTEA 4H2PA 3SFDA 1NENA 2RGJA 1EL7A 1GRHA 2GMJA 3T2KA 3GRSA 3AE3A 1K0LA 2QA2A 3AE7A 2YVGA 3DJGX 3G5SA 2GH5A 2R0CA 1DJQA 3VR8A 2C66A 1PXAA 2C64A 1Q1RA 1B5QA 2Q0KA 2YLWA 4CNJA 5KMQA 1TYPA 1KDGA 3SFEA 4EM3A 1OJDA 2WETA 4H4SA 2FJAA 2YG3A 1S2YA 5HY5A 3SZCA 1V59A 1ZP0A 4TM4A 2Y6QA 4LIIA 1P2HA 4J34A 4A99A 4G6HA 2AAQA 4CY8A 1CC6A 3SZFA 3NLCA 5DBJA 3AECA 1B4VA 5M0ZA 2IVEA 4REKA 4U8OA 4A6NA 4A65A 4JQ9A 2WPCA 2X8HA 2XLUA 1IUWA 1PDHA 4H4RA 3FMWA 1GXFA 3KPKA 3EPTA 4H7UA 3SZ0A 2QA1A 4N9XA 3VQRA 2OAMA 3AYIA 4ZN0A 4NTDA 3SXIA 5CKUA 4G9KA 2WOVA 4EMJA 3M0OA 5LV9A 2BRAA 1RYIA 3UTHA 2BA9A 4J31A 2XLRA 3NK1X 4PAAA 3RHAA 4AP3A 3UKKA 4X4JA 2YM2A 2C72A 1L0VA 4FX9A 3FIMB 2VRMA 2W0HA 4YT0A 5EBKA 3SYIA 5KMSA 3KD9A 2C3DA 2YLZA 1KNRA 3BHFA 2XVIA 2R0GA 4GUVA 5KMRA 1CF3A 5BULA 4EMWA 1O94A 1M6IA 3GMBA 1TDEA 3DK9A 5IQ4A 1GTEA 4G73A 2C73A 1F8WA 1CC4A 2OA1A 1ZDLA 4CRTA 1Y56B 1IUTA 3PVCA 3K7MX 4HA6A 1NG3A 4BJZA 2WP6A 2RABA 3NT6A 3QVPA 4AOXA 1F8SA 2BK3A 1YY5A 3C4AA 1KSUA 4JNQA 3LOVA 3QFAA 3L1RA 1D4DA 5KMPA 1PBEA 3LZWA 3O0HA 2EQ8A 1DOBA 3QSMA 2BRYA 3REDA 5EOWA 1ONFA 4NNJA 2XLSA 3HYXA 3NYCA 4CCRA 3SGLA 4C74A 1VDCA 2B9YA 4JY2A 1SEZA 4EQRA 3I3LA 4U8MA 2JB1A 1DNCA 2VVMA 2YR5A 3GDPA 3GYXA 1KSSA 2BK4A 3DGHA 4XWZA 2O9ZA 4B63A 1S2QA 2R45A 3NN6X 4OPLA 4EQWA 5EB5A 2JK6A 3NN0X 4A9WA 1VRQB 2TMDA 2BS2A 2JB2A 4H4PA 3UTGA 1NG4A 2APGA 4PABA 1JRZA 3F8PA 3VRAA 1CJ2A 2BYBA 2BXSA 4K5SA 2CFYA 2WESA 4U8KA 2B7SA 2YLXA 3SM8A 4D03A 2YG5A 1CJCA 3ICSA 1BF3A 2V6OA 1H7WA 3CNDA 2BS4A 4O5UA 1E7PA 5IQ1A 3D8XA 4C77A 4TLXA 2R46A 1ZY8A 1Z6LA 3UOXA 3QSEA 4MJWA 4A6NB 4YXDA 2TPRA 3ALJA 3GWFA 2GAGB 3GWDA 2XCGA 2JBVA 3UTFA 5KVIA 4P9SA 4BK3A 4G6GA 2OLNA 4EMIA 4G74A 3WE0A 1GESA 3LZXA 5C2TA 5JCNA 3KPFA 4GDPA 3HZLA 3NG7X 2VVLG 1GRFA 2XFUA 5FS6A 1CBOA 3UOVA 1E1KA 2H89A 4ECHA 3RP6A 3URHA 3NKSA 3ZYXA 4A79A 3DJDA 1K4QA 2VVLA 2Q0LA 4FK1A 5J7XA 3AXBA 4KPRA 3D1CA 1N1PA 3GYIA 4D04A 4EQXA 4YKFA 2V60A 2A87A 3T14A 4YSYA 4X9MA 2YLRA 1QJDA 1REOA 4BK1A 1GNDA 3Q9TA 3AEGA 1KNPA 3DK4A 4YSZA 3UKFA 3H8IA 4LA1A 1E39A 3CGEA 3CNSA 3DA1A 2UZZA 1IUXA 1DJNA 1IUUA 2E1MA 2YLSA 2YG6A 3GYJA 4Z24A 2IIDA 3UKPA 5J60A 2GVCA 4H4WA 1JRXA 3AE6A 4KX6A 4DGKA 1O95A 3AD7B 3S5WA 2J3NA 1P2EA 3RNMA 4A5LA 3ICRA 4K5RA 4Z2TA 3C96A 4AT0A 1IUVA 2B76A 3UOYA 4H50A 2YVJA 5FS7A 3FG2P 1TDKA 1W4XA 3NTDA 2WOIA 3V3OA 2X50A 1N4WA 1L9EA 2RGHA 3BI4A 2XVEA 3DJJA 3ICTA 1H82A 4NTCA 5BRTA 3QFBA 4H4XA 2VOUA 4JNAA 3IF9A 4TLZA 3LJPA 1H84A 3IC9A 3L8KA 3NH3X 4IV9A 1KF6A 1DXLA 1K0IA 1LQUA 5JCKA 4JDRA 1PBCA 3ATRA 2DKHA 5FS9A 1PJ5A 3M12A 3QSSA 4GAVA 3NHOX 1MOKA 3H8LA 1GRBA 1PXCA 3DMEA 1YQ4A 4IA6A 5U25A 4I59A 2BC1A 4C3XA 3QVRA 4GAPA 4USQA 2PYXA 2QCUA 3GMCA 3KKJA 3LB8A 1L9DA 3AE9A 3K7QX 1GRGA 3RP7A 1GALA 1GRAA 1NAAA 2Z5XA 4FK1C 4DSHA 1JU2A 1B37A 2GB0A 2GR1A 3AE1A 4K8DA 2R9ZA 1GSNA 2JKCA 2Q6UA 4FDCB 3SX6A 4YSHA 1FEAA 1JNZA 1LVLA 1XPQA 2R4JA 3NNEA 4B64A 1CJ4A 3DJEA 1E6EA 4OPDA 3SY4A 4EM4A 2FJDA 2X99A 4U2SA 4E0VA 3K7TA 2E5VA 2V5ZA 3EANA 1D4CA 2C4CA 3VR9A 1DOEA 4C3YA 1FEBA 4B68A 2B9XA 1MO9A 2A89A 1OJAA 2V3BA 3C4NA 3BHKA 2OLOA 4B67A 3DK8A 4CBQA 2FBWA 3AE4A 4WCTA 1NHPA 5EB4A 2C70A 1QLBA 1H6VA 2YR6A 3ALMA 5TR3A 4BJYA 1PN0A 4XXGA 2Q7VA 2WP9A 1GTHA 4U2TA 5KWFA 1E1LA 2X8CA 3IWAA 3CPHG 2GQWA 1D5TA 4RSLA 2VZ2A 2H88A 2FJBA 1CJ3A 3FBSA 4II3A 4H4TA 2HQMA 1EL8A 4YWOA 3T37A 3AYJA 4Z43A 1Q1WA 1KFYA 2YAUA 1F6MA 2C75A 2NVKX 2R4EA 3F8DA 2EQ7A 2WPFA 5HXIA 2Z5YA 2XYOA 3NIXA 1QO8A 3HYWA 3UKAA 2R0PA 2BS3A 2WU2A 2WEUA 3AEBA 3T2ZA 5KOWA 2X8GA 4BV6A 4B69A 1GETA 1NHQA 1OJ9A 1VG9A 1YQ3A 5ER0A 4JY3A 3CNJA 1PS9A 4ADWA 4GDEA 4OPGA 2C76A 4OVIA 5CQFA 4RG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPX A;  2XDO A;  1DOD A;  1NEK A;  2ZBW A;  3B6D A;  4J57 A;  3UOZ A;  3AEF A;  2GRT A;  3BI5 A;  3CNP A;  4USR A;  4H4Z A;  2DKI A;  3CGC A;  3CNT A;  1CL0 A;  3CGD A;  3NK2 X;  2YVF A;  2GF3 A;  3H4K A;  1FOH A;  2BK5 A;  4U8N A;  2YLT A;  3PS9 A;  1EL5 A;  2GR2 A;  3GD4 A;  5FMH A;  1TRB A;  2WOW A;  5U1O A;  3AEE A;  2PHH A;  3ZDN A;  1YKJ A;  4OPI A;  1E1M A;  3VRD B;  3UKQ A;  1BKW A;  1LJ1 A;  2XFO A;  1GPE A;  4CNK A;  3LXD A;  3G5Q A;  3SQP A;  2XLT A;  1MXT A;  4ICY A;  1ZK7 A;  1PXB A;  4H4U A;  4Y4L A;  3NYE A;  2X3N A;  3AD9 B;  4Z25 A;  2WS3 A;  3B3R A;  4YTM A;  2WU5 A;  1GER A;  2WBA A;  2VQ7 A;  3COX A;  4OPC A;  4ZCD A;  5BVA A;  3UKL A;  4GCM A;  5IPY A;  3CPI G;  3R9U A;  1H7X A;  1Y0P A;  2XVF A;  3GDN A;  4YSX A;  2VQB A;  1PBF A;  3EF6 A;  4AT2 A;  5HYM A;  3ITJ A;  3KVE A;  2IVD A;  3CIR A;  4GF7 A;  2OAL A;  5KRQ A;  5KVH A;  2GAH B;  3CGB A;  2XFP A;  3BNU A;  2GR3 A;  2WPE A;  3NTA A;  1NDA A;  4NEW A;  4Z2U A;  3ATQ A;  2GV8 A;  3E1T A;  5L46 A;  4UDP A;  1RSG A;  4DSG A;  3ALL A;  4XWR A;  1GV4 A;  3P4P A;  1ZMD A;  3CN8 A;  2YR4 A;  2JAE A;  3AWI A;  1JRY A;  4RG3 A;  2BC0 A;  3QJ4 A;  2WDQ A;  4EQS A;  1TDF A;  2I0Z A;  3KA7 A;  3NK0 X;  4NEV A;  4B1B A;  4UDQ A;  2C65 A;  5JCM A;  2AR8 A;  4JN9 A;  4YTP A;  4C5O A;  2ZZ0 A;  1L9C A;  2A8X A;  2WHD A;  3CTY A;  2YM1 A;  4AP1 A;  1S3B A;  4O5Q A;  4YTN A;  1X31 B;  1ZOY A;  3KU9 A;  2ZZC A;  4LU6 A;  4Z26 A;  4TM0 A;  1S3E A;  2RGO A;  4BUR A;  3AYL A;  4K2X A;  4Y4N A;  4A7A A;  5KXJ A;  3AD8 B;  3UP4 A;  4IVO B;  1CHU A;  5GRT A;  3P4Q A;  5U63 A;  1D7L A;  1PBB A;  1O5W A;  1EL9 A;  1HYU A;  1XAN A;  3FPZ A;  1H86 A;  2YG7 A;  1F8R A;  2BCP A;  2WDV A;  3ISH A;  4IVM B;  4IA5 A;  4M52 A;  1UKV G;  3IHG A;  3P1W A;  2BAC A;  3UKH A;  1XHC A;  1H83 A;  4CY6 A;  4Z2R A;  1COY A;  4H4Y A;  4HB9 A;  1RP0 A;  3DGZ A;  2GMH A;  3BNM A;  3GSI A;  4J33 A;  1JNR A;  2WQY A;  4H4V A;  5HHF A;  4U8L A;  1E1N A;  3OZ2 A;  1K0J A;  2XFQ A;  2CDU A;  1DOC A;  2XVJ A;  3VRB A;  4APN A;  3I6D A;  4J56 A;  1LQT A;  1TYT A;  4TM3 A;  4OPT A;  4OPU A;  3BI2 A;  3G5R A;  5GSN A;  2JB3 A;  4TM1 A;  2C3C A;  3V3N A;  3II4 A;  2FJE A;  3JSK A;  4H2Q A;  1B8S A;  4K7Z A;  4U8J A;  1ELI A;  2E4G A;  1GT8 A;  3LAD A;  1VG0 A;  3Q6J A;  3NYF A;  1N4U A;  4DNA A;  2GEW A;  3GRT A;  1JEH A;  2BCG G;  1IUS A;  4B65 A;  1PBD A;  2GR0 A;  4ZCC A;  4U2L A;  3IHM A;  1BWC A;  1BZL A;  2B7R A;  1ZOV A;  1OJT A;  2ACZ A;  4H2R A;  4GR1 A;  3P9U A;  1Q9I A;  3ADA B;  3AEA A;  3NGC X;  1IJH A;  3AE8 A;  1N4V A;  3CPJ G;  4OCG A;  4U8I A;  3AB1 A;  2BXR A;  4J36 A;  3RP8 A;  2YG4 A;  5C3J A;  3AE2 A;  2QAE A;  2VRL A;  2V61 A;  1PHH A;  2F5Z A;  5KOX A;  3NRN A;  2EQ6 A;  3AED A;  1D4E A;  1JOA A;  2ARD A;  2GQF A;  2YQU A;  1XDI A;  1ZKQ A;  1PJ6 A;  4CCQ A;  5M10 A;  2C7G A;  1H81 A;  1NHS A;  1YQZ A;  2AQJ A;  3DH9 A;  3V76 A;  1NPX A;  1GEU A;  2EQ9 A;  3EAO A;  1D7Y A;  1FCD A;  4GRT A;  5FS8 A;  1OJC A;  2CUL A;  2V3A A;  2Y6R A;  3P4S A;  3AE5 A;  4K22 A;  4YKG A;  4J2W A;  1F3P A;  4Z44 A;  3K30 A;  3PO7 A;  2C67 A;  3M13 A;  2XLP A;  1LV0 A;  4EIP A;  2XVH A;  1TDN A;  4H4Q A;  4NZH A;  5BUK A;  1Y56 A;  4UDR A;  1GOS A;  1NHR A;  4WX1 A;  1M64 A;  1LTX R;  1VQW A;  2B9W A;  3GD3 A;  1FEC A;  1TDO A;  1EBD A;  2WP5 A;  1ZX9 A;  3ABV A;  5JCL A;  1BGN A;  1PJ7 A;  4NTE A;  4U8P A;  5JCI A;  4UP3 A;  1CC2 A;  4X9N A;  1ZMC A;  2ZZB A;  3S61 A;  4B66 A;  2XFN A;  4EIQ A;  4H2N A;  4I58 A;  1AOG A;  2CVJ A;  3OC4 A;  4BK2 A;  4Y4M A;  1LPF A;  3UP5 A;  3P4R A;  1FL2 A;  1GRT A;  1GRE A;  2BAB A;  2WDR A;  4AOS A;  3KLJ A;  1BGJ A;  3F8R A;  3UCL A;  2YWL A;  3UTE A;  4H2P A;  3SFD A;  1NEN A;  2RGJ A;  1EL7 A;  1GRH A;  2GMJ A;  3GRS A;  3AE3 A;  1K0L A;  2QA2 A;  3AE7 A;  2YVG A;  3DJG X;  3G5S A;  2GH5 A;  2R0C A;  1DJQ A;  3VR8 A;  2C66 A;  1PXA A;  2C64 A;  1Q1R A;  1B5Q A;  2Q0K A;  2YLW A;  4CNJ A;  1TYP A;  1KDG A;  3SFE A;  4EM3 A;  1OJD A;  2WET A;  4H4S A;  2FJA A;  2YG3 A;  1S2Y A;  5HY5 A;  1V59 A;  1ZP0 A;  4TM4 A;  2Y6Q A;  4LII A;  1P2H A;  4J34 A;  4A99 A;  2AAQ A;  4CY8 A;  1CC6 A;  3NLC A;  5DBJ A;  3AEC A;  1B4V A;  5M0Z A;  2IVE A;  4REK A;  4U8O A;  4A6N A;  4A65 A;  4JQ9 A;  2WPC A;  2X8H A;  2XLU A;  1IUW A;  1PDH A;  4H4R A;  3FMW A;  1GXF A;  3EPT A;  4H7U A;  2QA1 A;  4N9X A;  3VQR A;  2OAM A;  3AYI A;  4ZN0 A;  4NTD A;  5CKU A;  2WOV A;  4EMJ A;  3M0O A;  5LV9 A;  1RYI A;  3UTH A;  2BA9 A;  4J31 A;  2XLR A;  3NK1 X;  4PAA A;  3RHA A;  4AP3 A;  3UKK A;  4X4J A;  2YM2 A;  2C72 A;  1L0V A;  4FX9 A;  3FIM B;  2VRM A;  2W0H A;  4YT0 A;  5EBK A;  3KD9 A;  2C3D A;  2YLZ A;  1KNR A;  3BHF A;  2XVI A;  2R0G A;  4GUV A;  1CF3 A;  5BUL A;  4EMW A;  1O94 A;  1M6I A;  3GMB A;  1TDE A;  3DK9 A;  5IQ4 A;  1GTE A;  2C73 A;  1F8W A;  1CC4 A;  2OA1 A;  1ZDL A;  4CRT A;  1Y56 B;  1IUT A;  3PVC A;  3K7M X;  4HA6 A;  1NG3 A;  4BJZ A;  2WP6 A;  2RAB A;  3NT6 A;  3QVP A;  4AOX A;  1F8S A;  2BK3 A;  1YY5 A;  3C4A A;  1KSU A;  4JNQ A;  3LOV A;  3QFA A;  3L1R A;  1D4D A;  1PBE A;  3LZW A;  3O0H A;  2EQ8 A;  1DOB A;  3QSM A;  3RED A;  5EOW A;  1ONF A;  2XLS A;  3NYC A;  4CCR A;  4C74 A;  3SGL A;  1VDC A;  2B9Y A;  4JY2 A;  1SEZ A;  4EQR A;  3I3L A;  4U8M A;  2JB1 A;  1DNC A;  2VVM A;  2YR5 A;  3GDP A;  1KSS A;  2BK4 A;  3DGH A;  4XWZ A;  2O9Z A;  4B63 A;  1S2Q A;  2R45 A;  3NN6 X;  4OPL A;  4EQW A;  5EB5 A;  2JK6 A;  3NN0 X;  4A9W A;  1VRQ B;  2TMD A;  2BS2 A;  2JB2 A;  4H4P A;  3UTG A;  1NG4 A;  2APG A;  4PAB A;  1JRZ A;  3F8P A;  3VRA A;  1CJ2 A;  2BYB A;  2BXS A;  4K5S A;  2CFY A;  2WES A;  4U8K A;  2B7S A;  2YLX A;  3SM8 A;  4D03 A;  2YG5 A;  1CJC A;  3ICS A;  1BF3 A;  2V6O A;  1H7W A;  3CND A;  2BS4 A;  4O5U A;  1E7P A;  5IQ1 A;  3D8X A;  4C77 A;  4TLX A;  2R46 A;  1ZY8 A;  1Z6L A;  3UOX A;  3QSE A;  4MJW A;  4A6N B;  4YXD A;  2TPR A;  3ALJ A;  3GWF A;  2GAG B;  3GWD A;  2XCG A;  2JBV A;  3UTF A;  5KVI A;  4P9S A;  4BK3 A;  2OLN A;  4EMI A;  3WE0 A;  1GES A;  3LZX A;  5C2T A;  5JCN A;  3KPF A;  4GDP A;  3HZL A;  3NG7 X;  2VVL G;  1GRF A;  2XFU A;  5FS6 A;  1CBO A;  3UOV A;  1E1K A;  2H89 A;  4ECH A;  3RP6 A;  3URH A;  3NKS A;  3ZYX A;  4A79 A;  3DJD A;  1K4Q A;  2VVL A;  2Q0L A;  4FK1 A;  5J7X A;  3AXB A;  4KPR A;  3D1C A;  1N1P A;  3GYI A;  4D04 A;  4EQX A;  4YKF A;  2V60 A;  2A87 A;  4YSY A;  4X9M A;  2YLR A;  1QJD A;  1REO A;  3Q9T A;  1GND A;  4BK1 A;  3AEG A;  1KNP A;  3DK4 A;  4YSZ A;  3UKF A;  3H8I A;  4LA1 A;  1E39 A;  3CGE A;  3CNS A;  3DA1 A;  2UZZ A;  1IUX A;  1DJN A;  1IUU A;  2E1M A;  2YLS A;  2YG6 A;  3GYJ A;  4Z24 A;  2IID A;  3UKP A;  5J60 A;  2GVC A;  4H4W A;  1JRX A;  3AE6 A;  4KX6 A;  4DGK A;  1O95 A;  3AD7 B;  3S5W A;  2J3N A;  1P2E A;  3RNM A;  4A5L A;  3ICR A;  4K5R A;  4Z2T A;  3C96 A;  4AT0 A;  1IUV A;  2B76 A;  3UOY A;  4H50 A;  2YVJ A;  5FS7 A;  3FG2 P;  1TDK A;  1W4X A;  3NTD A;  2WOI A;  3V3O A;  2X50 A;  1N4W A;  1L9E A;  2RGH A;  3BI4 A;  2XVE A;  3DJJ A;  3ICT A;  1H82 A;  4NTC A;  5BRT A;  3QFB A;  4H4X A;  2VOU A;  4JNA A;  3IF9 A;  4TLZ A;  3LJP A;  1H84 A;  3IC9 A;  3L8K A;  3NH3 X;  4IV9 A;  1KF6 A;  1DXL A;  1K0I A;  1LQU A;  5JCK A;  4JDR A;  1PBC A;  3ATR A;  2DKH A;  5FS9 A;  1PJ5 A;  3M12 A;  3QSS A;  3NHO X;  1MOK A;  3H8L A;  1GRB A;  1PXC A;  3DME A;  1YQ4 A;  4IA6 A;  5U25 A;  4I59 A;  2BC1 A;  4C3X A;  3QVR A;  4USQ A;  2PYX A;  2QCU A;  3GMC A;  3KKJ A;  3LB8 A;  1L9D A;  3AE9 A;  3K7Q X;  1GRG A;  3RP7 A;  1GAL A;  1GRA A;  1NAA A;  2Z5X A;  4FK1 C;  4DSH A;  1JU2 A;  1B37 A;  2GB0 A;  2GR1 A;  3AE1 A;  4K8D A;  2R9Z A;  1GSN A;  2JKC A;  2Q6U A;  4FDC B;  4YSH A;  1FEA A;  1JNZ A;  1LVL A;  1XPQ A;  2R4J A;  3NNE A;  4B64 A;  1CJ4 A;  3DJE A;  1E6E A;  4OPD A;  4EM4 A;  2FJD A;  2X99 A;  4U2S A;  4E0V A;  3K7T A;  2E5V A;  2V5Z A;  3EAN A;  1D4C A;  3VR9 A;  1DOE A;  4C3Y A;  1FEB A;  4B68 A;  2B9X A;  1MO9 A;  2A89 A;  1OJA A;  2V3B A;  3C4N A;  3BHK A;  2OLO A;  4B67 A;  3DK8 A;  4CBQ A;  2FBW A;  3AE4 A;  4WCT A;  1NHP A;  5EB4 A;  2C70 A;  1QLB A;  1H6V A;  2YR6 A;  3ALM A;  5TR3 A;  4BJY A;  1PN0 A;  4XXG A;  2Q7V A;  2WP9 A;  1GTH A;  4U2T A;  5KWF A;  1E1L A;  2X8C A;  3IWA A;  3CPH G;  2GQW A;  1D5T A;  4RSL A;  2VZ2 A;  2H88 A;  2FJB A;  1CJ3 A;  3FBS A;  3T37 A;  4H4T A;  2HQM A;  1EL8 A;  4YWO A;  4Z43 A;  3AYJ A;  1Q1W A;  1KFY A;  2YAU A;  1F6M A;  2C75 A;  2NVK X;  2R4E A;  3F8D A;  2EQ7 A;  2WPF A;  5HXI A;  2Z5Y A;  2XYO A;  3NIX A;  1QO8 A;  3UKA A;  2BS3 A;  2R0P A;  2WU2 A;  2WEU A;  3AEB A;  5KOW A;  2X8G A;  4BV6 A;  4B69 A;  1GET A;  1NHQ A;  1OJ9 A;  1VG9 A;  1YQ3 A;  5ER0 A;  4JY3 A;  3CNJ A;  1PS9 A;  4ADW A;  4GDE A;  4OPG A;  2C76 A;  4OVI A;  5CQF A;  4RG4 A; 
#chains in the Genus database with same CATH topology
 2NPX A;  2XDO A;  1DOD A;  1NEK A;  2ZBW A;  3B6D A;  4J57 A;  3UOZ A;  3AEF A;  2GRT A;  3BI5 A;  3CNP A;  4USR A;  4H4Z A;  2DKI A;  3CGC A;  3CNT A;  1CL0 A;  3CGD A;  3NK2 X;  2YVF A;  2GF3 A;  3H4K A;  1FOH A;  2BK5 A;  4U8N A;  2YLT A;  3PS9 A;  1EL5 A;  2GR2 A;  3GD4 A;  5FMH A;  1TRB A;  2WOW A;  5U1O A;  3AEE A;  2PHH A;  3ZDN A;  1YKJ A;  4OPI A;  1E1M A;  3VRD B;  3UKQ A;  1BKW A;  1LJ1 A;  2XFO A;  1GPE A;  4CNK A;  3LXD A;  3G5Q A;  3SQP A;  2XLT A;  1MXT A;  4ICY A;  1ZK7 A;  1PXB A;  4H4U A;  4Y4L A;  3NYE A;  2X3N A;  3AD9 B;  4YJF B;  4YJG A;  2WS3 A;  3B3R A;  4YTM A;  4Z25 A;  2WU5 A;  1GER A;  2WBA A;  2VQ7 A;  3COX A;  4OPC A;  4ZCD A;  5BVA A;  3UKL A;  1VE9 A;  4GCM A;  5IPY A;  3CPI G;  3R9U A;  1H7X A;  1Y0P A;  2XVF A;  3GDN A;  4YSX A;  2VQB A;  1PBF A;  3EF6 A;  4AT2 A;  5HYM A;  3ITJ A;  3KVE A;  2IVD A;  3CIR A;  4GF7 A;  2OAL A;  5KRQ A;  5KVH A;  2GAH B;  3CGB A;  2XFP A;  3BNU A;  1EVI A;  2GR3 A;  2WPE A;  3NTA A;  1NDA A;  4NEW A;  4Z2U A;  3ATQ A;  2GV8 A;  3E1T A;  5L46 A;  4UDP A;  1RSG A;  4DSG A;  3ALL A;  4XWR A;  1GV4 A;  3P4P A;  1ZMD A;  3W4I A;  3CN8 A;  2YR4 A;  3AWI A;  2JAE A;  1JRY A;  4RG3 A;  3G3E A;  2BC0 A;  3QJ4 A;  2WDQ A;  4EQS A;  1TDF A;  2I0Z A;  3KA7 A;  3NK0 X;  4NEV A;  4B1B A;  4UDQ A;  2C65 A;  5JCM A;  2AR8 A;  4JN9 A;  4YTP A;  4C5O A;  2ZZ0 A;  1L9C A;  2A8X A;  2WHD A;  3CTY A;  2YM1 A;  4AP1 A;  1S3B A;  4O5Q A;  4YTN A;  1X31 B;  1ZOY A;  3KU9 A;  2ZZC A;  4LU6 A;  4Z26 A;  4TM0 A;  1S3E A;  2RGO A;  4BUR A;  3AYL A;  4K2X A;  3T0K A;  4Y4N A;  4A7A A;  5KXJ A;  3AD8 B;  3UP4 A;  4IVO B;  1CHU A;  5GRT A;  3P4Q A;  1DDO A;  1D7L A;  1PBB A;  1O5W A;  1EL9 A;  1HYU A;  1XAN A;  3FPZ A;  5U63 A;  1H86 A;  2YG7 A;  4YJH B;  1F8R A;  2BCP A;  2WDV A;  3ZNP A;  4IA5 A;  3ISH A;  4IVM B;  4M52 A;  3IHG A;  1UKV G;  3P1W A;  2BAC A;  3UKH A;  1XHC A;  1H83 A;  4CY6 A;  4Z2R A;  1COY A;  4H4Y A;  4HB9 A;  1RP0 A;  5KNL A;  3DGZ A;  2E82 A;  2GMH A;  3BNM A;  3GSI A;  4J33 A;  1JNR A;  2WQY A;  4H4V A;  5HHF A;  4U8L A;  1E1N A;  3OZ2 A;  1K0J A;  2XFQ A;  2CDU A;  1DOC A;  2XVJ A;  3VRB A;  4APN A;  3I6D A;  4J56 A;  1LQT A;  1TYT A;  4TM3 A;  4OPT A;  4OPU A;  1KIF A;  3BI2 A;  2DU8 A;  3G5R A;  5GSN A;  2JB3 A;  4TM1 A;  2C3C A;  3V3N A;  3II4 A;  2FJE A;  3JSK A;  3HYV A;  4H2Q A;  1B8S A;  4II2 A;  4K7Z A;  4U8J A;  1ELI A;  1GT8 A;  2E4G A;  3W4J A;  3LAD A;  3T2Y A;  4QFC A;  1VG0 A;  3NYF A;  3Q6J A;  1N4U A;  4DNA A;  2GEW A;  3GRT A;  1JEH A;  2BCG G;  1IUS A;  4B65 A;  1PBD A;  2GR0 A;  4ZCC A;  4U2L A;  3IHM A;  1BWC A;  1BZL A;  2B7R A;  1ZOV A;  1OJT A;  4H2R A;  2ACZ A;  4NWZ A;  4GR1 A;  3P9U A;  1Q9I A;  3SZW A;  3T31 A;  3ADA B;  3AEA A;  4YJG B;  3NGC X;  1IJH A;  3AE8 A;  1N4V A;  3CPJ G;  4OCG A;  4U8I A;  3AB1 A;  2BXR A;  4J36 A;  3RP8 A;  2YG4 A;  5C3J A;  3AE2 A;  2QAE A;  2VRL A;  2V61 A;  1PHH A;  2F5Z A;  5KOX A;  3NRN A;  2EQ6 A;  3AED A;  3CMM A;  1D4E A;  1JOA A;  2ARD A;  2GQF A;  2YQU A;  1XDI A;  1ZKQ A;  1PJ6 A;  4CCQ A;  5M10 A;  2C7G A;  1H81 A;  1NHS A;  1YQZ A;  2AQJ A;  3DH9 A;  3V76 A;  1NPX A;  1GEU A;  2EQ9 A;  3EAO A;  1D7Y A;  1FCD A;  4GRT A;  5FS8 A;  1OJC A;  2CUL A;  2V3A A;  2Y6R A;  3P4S A;  3AE5 A;  4K22 A;  4YKG A;  4J2W A;  1F3P A;  4Z44 A;  3K30 A;  3PO7 A;  2C67 A;  3M13 A;  2XLP A;  4EIP A;  1LV0 A;  2XVH A;  1TDN A;  4H4Q A;  4NZH A;  5BUK A;  1Y56 A;  4UDR A;  1GOS A;  1NHR A;  4WX1 A;  1M64 A;  1LTX R;  1VQW A;  2B9W A;  3GD3 A;  1FEC A;  1TDO A;  1EBD A;  2WP5 A;  1ZX9 A;  3ABV A;  5JCL A;  1BGN A;  1PJ7 A;  4NTE A;  4U8P A;  5JCI A;  4UP3 A;  1CC2 A;  4X9N A;  1ZMC A;  4EIQ A;  2ZZB A;  3S61 A;  2XFN A;  4B66 A;  4H2N A;  3ZNN A;  4I58 A;  1AOG A;  2CVJ A;  3OC4 A;  4BK2 A;  4Y4M A;  1LPF A;  3UP5 A;  1C0K A;  1FL2 A;  1GRT A;  1GRE A;  2BAB A;  2WDR A;  3P4R A;  4AOS A;  3KLJ A;  1BGJ A;  3F8R A;  3UCL A;  2YWL A;  3UTE A;  4H2P A;  3SFD A;  1NEN A;  2RGJ A;  1EL7 A;  1GRH A;  2GMJ A;  3T2K A;  3GRS A;  3AE3 A;  1K0L A;  2QA2 A;  3AE7 A;  2YVG A;  3DJG X;  3G5S A;  2GH5 A;  2R0C A;  1DJQ A;  3VR8 A;  2C66 A;  1PXA A;  2C64 A;  1Q1R A;  1B5Q A;  2Q0K A;  2YLW A;  4CNJ A;  5KMQ A;  1TYP A;  1KDG A;  3SFE A;  4EM3 A;  1OJD A;  2WET A;  4H4S A;  2FJA A;  2YG3 A;  1S2Y A;  5HY5 A;  3SZC A;  1V59 A;  1ZP0 A;  4TM4 A;  2Y6Q A;  4LII A;  1P2H A;  4J34 A;  4A99 A;  4G6H A;  2AAQ A;  4CY8 A;  1CC6 A;  3SZF A;  3NLC A;  5DBJ A;  3AEC A;  1B4V A;  5M0Z A;  2IVE A;  4REK A;  4U8O A;  4A6N A;  4A65 A;  4JQ9 A;  2WPC A;  2X8H A;  2XLU A;  1IUW A;  1PDH A;  4H4R A;  3FMW A;  1GXF A;  3KPK A;  3EPT A;  4H7U A;  3SZ0 A;  2QA1 A;  4N9X A;  3VQR A;  1C0I A;  2OAM A;  3AYI A;  4ZN0 A;  4NTD A;  3SXI A;  5CKU A;  4G9K A;  2WOV A;  4EMJ A;  3M0O A;  5LV9 A;  2BRA A;  1RYI A;  3UTH A;  4PAA A;  2BA9 A;  2XLR A;  3NK1 X;  4J31 A;  3RHA A;  4AP3 A;  3UKK A;  4X4J A;  2YM2 A;  2C72 A;  1L0V A;  4FX9 A;  3FIM B;  2VRM A;  2W0H A;  4YT0 A;  5EBK A;  3SYI A;  5KMS A;  3KD9 A;  2C3D A;  2YLZ A;  1KNR A;  3BHF A;  2XVI A;  2R0G A;  4GUV A;  5KMR A;  1CF3 A;  5BUL A;  4EMW A;  1O94 A;  1M6I A;  3GMB A;  1TDE A;  3DK9 A;  5IQ4 A;  1GTE A;  4G73 A;  2C73 A;  1F8W A;  1CC4 A;  2E48 A;  2E49 A;  2OA1 A;  1ZDL A;  4CRT A;  1Y56 B;  1IUT A;  3PVC A;  3K7M X;  4HA6 A;  1NG3 A;  4BJZ A;  2WP6 A;  2RAB A;  3NT6 A;  3QVP A;  4AOX A;  1F8S A;  2BK3 A;  1YY5 A;  3C4A A;  1KSU A;  4JNQ A;  3LOV A;  3QFA A;  3L1R A;  1D4D A;  5KMP A;  1PBE A;  3LZW A;  3O0H A;  3QSM A;  1DOB A;  2EQ8 A;  2BRY A;  3RED A;  5EOW A;  1ONF A;  4NNJ A;  2XLS A;  3NYC A;  3ZNO A;  3HYX A;  3SGL A;  4CCR A;  4C74 A;  4QFD A;  1VDC A;  2B9Y A;  4JY2 A;  1SEZ A;  4EQR A;  3I3L A;  4U8M A;  2JB1 A;  1DNC A;  2VVM A;  2YR5 A;  3GDP A;  3GYX A;  1KSS A;  4XWZ A;  2BK4 A;  3DGH A;  2O9Z A;  4B63 A;  2R45 A;  1S2Q A;  3NN6 X;  4OPL A;  4EQW A;  5EB5 A;  2JK6 A;  3NN0 X;  4A9W A;  1VRQ B;  2TMD A;  2BS2 A;  2JB2 A;  4H4P A;  3UTG A;  1NG4 A;  2APG A;  1C0L A;  4PAB A;  1DAO A;  1JRZ A;  3F8P A;  3VRA A;  1CJ2 A;  2BYB A;  2BXS A;  4K5S A;  2CFY A;  3SM8 A;  2WES A;  2B7S A;  2YLX A;  4U8K A;  4D03 A;  2YG5 A;  1CJC A;  3ICS A;  1BF3 A;  2V6O A;  1H7W A;  3CND A;  2BS4 A;  4O5U A;  1E7P A;  5IQ1 A;  3D8X A;  4C77 A;  4TLX A;  2R46 A;  1ZY8 A;  1Z6L A;  3UOX A;  3QSE A;  4MJW A;  4A6N B;  4YXD A;  2TPR A;  3ALJ A;  3GWF A;  2GAG B;  3GWD A;  2XCG A;  2JBV A;  3UTF A;  5KVI A;  4P9S A;  4BK3 A;  4G6G A;  2OLN A;  4EMI A;  4G74 A;  3WE0 A;  1GES A;  3LZX A;  5C2T A;  5JCN A;  3KPF A;  4GDP A;  3HZL A;  3NG7 X;  2VVL G;  1GRF A;  2XFU A;  5FS6 A;  1CBO A;  3UOV A;  1E1K A;  2H89 A;  4ECH A;  3RP6 A;  3URH A;  3NKS A;  3ZYX A;  4A79 A;  3DJD A;  1K4Q A;  2VVL A;  2Q0L A;  4FK1 A;  5J7X A;  3AXB A;  4KPR A;  3D1C A;  1N1P A;  3GYI A;  4D04 A;  4EQX A;  4YKF A;  2V60 A;  2A87 A;  3T14 A;  4YSY A;  4X9M A;  2YLR A;  1QJD A;  1REO A;  4BK1 A;  1GND A;  3Q9T A;  3AEG A;  1KNP A;  3DK4 A;  4YSZ A;  3ZNQ A;  3UKF A;  3H8I A;  4LA1 A;  1E39 A;  3DA1 A;  3CGE A;  3CNS A;  2UZZ A;  1IUX A;  1DJN A;  1IUU A;  2E1M A;  2YLS A;  2YG6 A;  3GYJ A;  4Z24 A;  2IID A;  3UKP A;  5J60 A;  2GVC A;  4H4W A;  1JRX A;  3AE6 A;  4KX6 A;  3CUK A;  4DGK A;  3AD7 B;  1O95 A;  3S5W A;  2J3N A;  1P2E A;  3RNM A;  4A5L A;  3ICR A;  4K5R A;  4Z2T A;  3C96 A;  4AT0 A;  1IUV A;  2B76 A;  3UOY A;  4H50 A;  2YVJ A;  5FS7 A;  3FG2 P;  1TDK A;  1W4X A;  3NTD A;  2WOI A;  3V3O A;  2E4A A;  2X50 A;  1N4W A;  1L9E A;  2RGH A;  3BI4 A;  2XVE A;  3DJJ A;  3ICT A;  1H82 A;  4NTC A;  5BRT A;  3QFB A;  4H4X A;  2VOU A;  4JNA A;  3IF9 A;  4TLZ A;  3LJP A;  1H84 A;  3IC9 A;  3L8K A;  3NH3 X;  4IV9 A;  1KF6 A;  1DXL A;  1K0I A;  1LQU A;  5JCK A;  4JDR A;  1PBC A;  3ATR A;  2DKH A;  5FS9 A;  1PJ5 A;  3M12 A;  3QSS A;  4GAV A;  3NHO X;  1MOK A;  3H8L A;  1GRB A;  1PXC A;  3DME A;  1YQ4 A;  4YJF A;  4IA6 A;  5U25 A;  4I59 A;  2BC1 A;  4C3X A;  3QVR A;  4GAP A;  4USQ A;  2PYX A;  2QCU A;  3GMC A;  3KKJ A;  3LB8 A;  1L9D A;  3AE9 A;  3K7Q X;  1GRG A;  3RP7 A;  1GAL A;  1GRA A;  1NAA A;  2Z5X A;  4FK1 C;  4DSH A;  1JU2 A;  1B37 A;  2GB0 A;  2GR1 A;  3AE1 A;  4K8D A;  2R9Z A;  1GSN A;  2JKC A;  2Q6U A;  4FDC B;  3SX6 A;  4YSH A;  1FEA A;  1JNZ A;  2R4J A;  1LVL A;  1XPQ A;  3NNE A;  4B64 A;  1CJ4 A;  3DJE A;  1E6E A;  4OPD A;  3SY4 A;  4EM4 A;  1AN9 A;  2FJD A;  2X99 A;  4U2S A;  4E0V A;  3K7T A;  2E5V A;  2V5Z A;  3EAN A;  1D4C A;  2C4C A;  3VR9 A;  1DOE A;  4C3Y A;  1FEB A;  4B68 A;  2B9X A;  1MO9 A;  2A89 A;  3C4N A;  1OJA A;  2V3B A;  3BHK A;  2OLO A;  4B67 A;  3WGT A;  3DK8 A;  4CBQ A;  2FBW A;  3AE4 A;  4WCT A;  1NHP A;  5EB4 A;  1C0P A;  1QLB A;  1H6V A;  2C70 A;  3ALM A;  2YR6 A;  5TR3 A;  4BJY A;  1PN0 A;  4XXG A;  2Q7V A;  2WP9 A;  4YJD A;  1GTH A;  4U2T A;  5KWF A;  1E1L A;  2X8C A;  3IWA A;  3CPH G;  4YJH A;  2GQW A;  1D5T A;  4RSL A;  2VZ2 A;  2H88 A;  2FJB A;  1CJ3 A;  3FBS A;  4II3 A;  4H4T A;  2HQM A;  1EL8 A;  4YWO A;  3T37 A;  3AYJ A;  4Z43 A;  1Q1W A;  1KFY A;  2YAU A;  1F6M A;  2R4E A;  2C75 A;  2NVK X;  3F8D A;  2EQ7 A;  2WPF A;  5HXI A;  2Z5Y A;  2XYO A;  3NIX A;  1QO8 A;  3HYW A;  3UKA A;  2R0P A;  2BS3 A;  2WU2 A;  2WEU A;  3AEB A;  3T2Z A;  5KOW A;  3W4K A;  2X8G A;  4BV6 A;  4B69 A;  1GET A;  1NHQ A;  1OJ9 A;  1VG9 A;  1YQ3 A;  5ER0 A;  4JY3 A;  3CNJ A;  1PS9 A;  4ADW A;  4GDE A;  4OPG A;  2C76 A;  4OVI A;  5CQF A;  4RG4 A; 
#chains in the Genus database with same CATH homology
 2NPX A;  2XDO A;  1DOD A;  1NEK A;  2ZBW A;  3B6D A;  4J57 A;  3UOZ A;  3AEF A;  2GRT A;  3BI5 A;  3CNP A;  4USR A;  4H4Z A;  2DKI A;  3CGC A;  3CNT A;  1CL0 A;  3CGD A;  3NK2 X;  2YVF A;  2GF3 A;  3H4K A;  1FOH A;  2BK5 A;  4U8N A;  2YLT A;  3PS9 A;  1EL5 A;  2GR2 A;  3GD4 A;  5FMH A;  1TRB A;  2WOW A;  5U1O A;  3AEE A;  2PHH A;  3ZDN A;  1YKJ A;  4OPI A;  1E1M A;  3VRD B;  3UKQ A;  1BKW A;  1LJ1 A;  2XFO A;  1GPE A;  4CNK A;  3LXD A;  3G5Q A;  3SQP A;  2XLT A;  1MXT A;  4ICY A;  1ZK7 A;  1PXB A;  4H4U A;  4Y4L A;  3NYE A;  2X3N A;  3AD9 B;  4Z25 A;  2WS3 A;  3B3R A;  4YTM A;  2WU5 A;  1GER A;  2WBA A;  2VQ7 A;  3COX A;  4OPC A;  4ZCD A;  5BVA A;  3UKL A;  4GCM A;  5IPY A;  3CPI G;  3R9U A;  1H7X A;  1Y0P A;  2XVF A;  3GDN A;  4YSX A;  2VQB A;  1PBF A;  3EF6 A;  4AT2 A;  5HYM A;  3ITJ A;  3KVE A;  2IVD A;  3CIR A;  4GF7 A;  2OAL A;  5KRQ A;  5KVH A;  2GAH B;  3CGB A;  2XFP A;  3BNU A;  2GR3 A;  2WPE A;  3NTA A;  1NDA A;  4NEW A;  4Z2U A;  3ATQ A;  2GV8 A;  3E1T A;  5L46 A;  4UDP A;  1RSG A;  4DSG A;  3ALL A;  4XWR A;  1GV4 A;  3P4P A;  1ZMD A;  3CN8 A;  2YR4 A;  2JAE A;  3AWI A;  1JRY A;  4RG3 A;  2BC0 A;  3QJ4 A;  2WDQ A;  4EQS A;  1TDF A;  2I0Z A;  3KA7 A;  3NK0 X;  4NEV A;  4B1B A;  4UDQ A;  2C65 A;  5JCM A;  2AR8 A;  4JN9 A;  4YTP A;  4C5O A;  2ZZ0 A;  1L9C A;  2A8X A;  2WHD A;  3CTY A;  2YM1 A;  4AP1 A;  1S3B A;  4O5Q A;  4YTN A;  1X31 B;  1ZOY A;  3KU9 A;  2ZZC A;  4LU6 A;  4Z26 A;  4TM0 A;  1S3E A;  2RGO A;  4BUR A;  3AYL A;  4K2X A;  3T0K A;  4Y4N A;  4A7A A;  5KXJ A;  3AD8 B;  3UP4 A;  4IVO B;  1CHU A;  5GRT A;  3P4Q A;  5U63 A;  1D7L A;  1PBB A;  1O5W A;  1EL9 A;  1HYU A;  1XAN A;  3FPZ A;  1H86 A;  2YG7 A;  1F8R A;  2BCP A;  2WDV A;  3ISH A;  4IVM B;  4IA5 A;  4M52 A;  3IHG A;  1UKV G;  3P1W A;  2BAC A;  3UKH A;  1XHC A;  1H83 A;  4CY6 A;  4Z2R A;  1COY A;  4H4Y A;  4HB9 A;  1RP0 A;  5KNL A;  3DGZ A;  2GMH A;  3BNM A;  3GSI A;  4J33 A;  1JNR A;  2WQY A;  4H4V A;  5HHF A;  4U8L A;  1E1N A;  3OZ2 A;  1K0J A;  2XFQ A;  2CDU A;  1DOC A;  2XVJ A;  3VRB A;  4APN A;  3I6D A;  4J56 A;  1LQT A;  1TYT A;  4TM3 A;  4OPT A;  4OPU A;  3BI2 A;  3G5R A;  5GSN A;  2JB3 A;  4TM1 A;  2C3C A;  3V3N A;  3II4 A;  2FJE A;  3JSK A;  3HYV A;  4H2Q A;  1B8S A;  4II2 A;  4K7Z A;  4U8J A;  1ELI A;  1GT8 A;  2E4G A;  3LAD A;  3T2Y A;  1VG0 A;  3Q6J A;  3NYF A;  1N4U A;  4DNA A;  2GEW A;  3GRT A;  1JEH A;  2BCG G;  1IUS A;  4B65 A;  1PBD A;  2GR0 A;  4ZCC A;  4U2L A;  3IHM A;  1BWC A;  1BZL A;  2B7R A;  1ZOV A;  1OJT A;  4H2R A;  2ACZ A;  4NWZ A;  4GR1 A;  3P9U A;  1Q9I A;  3SZW A;  3T31 A;  3ADA B;  3AEA A;  3NGC X;  1IJH A;  3AE8 A;  1N4V A;  3CPJ G;  4OCG A;  4U8I A;  3AB1 A;  2BXR A;  4J36 A;  3RP8 A;  2YG4 A;  5C3J A;  3AE2 A;  2QAE A;  2VRL A;  2V61 A;  1PHH A;  2F5Z A;  5KOX A;  3NRN A;  2EQ6 A;  3AED A;  3CMM A;  1D4E A;  1JOA A;  2ARD A;  2GQF A;  2YQU A;  1XDI A;  1ZKQ A;  1PJ6 A;  4CCQ A;  5M10 A;  2C7G A;  1H81 A;  1NHS A;  1YQZ A;  2AQJ A;  3DH9 A;  3V76 A;  1NPX A;  1GEU A;  2EQ9 A;  3EAO A;  1D7Y A;  1FCD A;  4GRT A;  5FS8 A;  1OJC A;  2CUL A;  2V3A A;  2Y6R A;  3P4S A;  3AE5 A;  4K22 A;  4YKG A;  4J2W A;  1F3P A;  4Z44 A;  3K30 A;  3PO7 A;  2C67 A;  3M13 A;  2XLP A;  4EIP A;  1LV0 A;  2XVH A;  1TDN A;  4H4Q A;  4NZH A;  5BUK A;  1Y56 A;  4UDR A;  1GOS A;  1NHR A;  4WX1 A;  1M64 A;  1LTX R;  1VQW A;  2B9W A;  3GD3 A;  1FEC A;  1TDO A;  1EBD A;  2WP5 A;  1ZX9 A;  3ABV A;  5JCL A;  1BGN A;  1PJ7 A;  4NTE A;  4U8P A;  5JCI A;  4UP3 A;  1CC2 A;  4X9N A;  1ZMC A;  4EIQ A;  2ZZB A;  3S61 A;  2XFN A;  4B66 A;  4H2N A;  4I58 A;  1AOG A;  2CVJ A;  3OC4 A;  4BK2 A;  4Y4M A;  1LPF A;  3UP5 A;  3P4R A;  1FL2 A;  1GRT A;  1GRE A;  2BAB A;  2WDR A;  4AOS A;  3KLJ A;  1BGJ A;  3F8R A;  3UCL A;  2YWL A;  3UTE A;  4H2P A;  3SFD A;  1NEN A;  2RGJ A;  1EL7 A;  1GRH A;  2GMJ A;  3T2K A;  3GRS A;  3AE3 A;  1K0L A;  2QA2 A;  3AE7 A;  2YVG A;  3DJG X;  3G5S A;  2GH5 A;  2R0C A;  1DJQ A;  3VR8 A;  2C66 A;  1PXA A;  2C64 A;  1Q1R A;  1B5Q A;  2Q0K A;  2YLW A;  4CNJ A;  5KMQ A;  1TYP A;  1KDG A;  3SFE A;  4EM3 A;  1OJD A;  2WET A;  4H4S A;  2FJA A;  2YG3 A;  1S2Y A;  5HY5 A;  3SZC A;  1V59 A;  1ZP0 A;  4TM4 A;  2Y6Q A;  4LII A;  1P2H A;  4J34 A;  4A99 A;  4G6H A;  2AAQ A;  4CY8 A;  1CC6 A;  3SZF A;  3NLC A;  5DBJ A;  3AEC A;  1B4V A;  5M0Z A;  2IVE A;  4REK A;  4U8O A;  4A6N A;  4A65 A;  4JQ9 A;  2WPC A;  2X8H A;  2XLU A;  1IUW A;  1PDH A;  4H4R A;  3FMW A;  1GXF A;  3KPK A;  3EPT A;  4H7U A;  3SZ0 A;  2QA1 A;  4N9X A;  3VQR A;  2OAM A;  3AYI A;  4ZN0 A;  4NTD A;  3SXI A;  5CKU A;  4G9K A;  2WOV A;  4EMJ A;  3M0O A;  5LV9 A;  2BRA A;  1RYI A;  3UTH A;  2BA9 A;  4J31 A;  2XLR A;  3NK1 X;  4PAA A;  3RHA A;  4AP3 A;  3UKK A;  4X4J A;  2YM2 A;  2C72 A;  1L0V A;  4FX9 A;  3FIM B;  2VRM A;  2W0H A;  4YT0 A;  5EBK A;  3SYI A;  5KMS A;  3KD9 A;  2C3D A;  2YLZ A;  1KNR A;  3BHF A;  2XVI A;  2R0G A;  4GUV A;  5KMR A;  1CF3 A;  5BUL A;  4EMW A;  1O94 A;  1M6I A;  3GMB A;  1TDE A;  3DK9 A;  5IQ4 A;  1GTE A;  4G73 A;  2C73 A;  1F8W A;  1CC4 A;  2OA1 A;  1ZDL A;  4CRT A;  1Y56 B;  1IUT A;  3PVC A;  3K7M X;  4HA6 A;  1NG3 A;  4BJZ A;  2WP6 A;  2RAB A;  3NT6 A;  3QVP A;  4AOX A;  1F8S A;  2BK3 A;  1YY5 A;  3C4A A;  1KSU A;  4JNQ A;  3LOV A;  3QFA A;  3L1R A;  1D4D A;  5KMP A;  1PBE A;  3LZW A;  3O0H A;  2EQ8 A;  1DOB A;  3QSM A;  2BRY A;  3RED A;  5EOW A;  1ONF A;  4NNJ A;  2XLS A;  3HYX A;  3NYC A;  4CCR A;  3SGL A;  4C74 A;  1VDC A;  2B9Y A;  4JY2 A;  1SEZ A;  4EQR A;  3I3L A;  4U8M A;  2JB1 A;  1DNC A;  2VVM A;  2YR5 A;  3GDP A;  3GYX A;  1KSS A;  2BK4 A;  3DGH A;  4XWZ A;  2O9Z A;  4B63 A;  1S2Q A;  2R45 A;  3NN6 X;  4OPL A;  4EQW A;  5EB5 A;  2JK6 A;  3NN0 X;  4A9W A;  1VRQ B;  2TMD A;  2BS2 A;  2JB2 A;  4H4P A;  3UTG A;  1NG4 A;  2APG A;  4PAB A;  1JRZ A;  3F8P A;  3VRA A;  1CJ2 A;  2BYB A;  2BXS A;  4K5S A;  2CFY A;  2WES A;  4U8K A;  2B7S A;  2YLX A;  3SM8 A;  4D03 A;  2YG5 A;  1CJC A;  3ICS A;  1BF3 A;  2V6O A;  1H7W A;  3CND A;  2BS4 A;  4O5U A;  1E7P A;  5IQ1 A;  3D8X A;  4C77 A;  4TLX A;  2R46 A;  1ZY8 A;  1Z6L A;  3UOX A;  3QSE A;  4MJW A;  4A6N B;  4YXD A;  2TPR A;  3ALJ A;  3GWF A;  2GAG B;  3GWD A;  2XCG A;  2JBV A;  3UTF A;  5KVI A;  4P9S A;  4BK3 A;  4G6G A;  2OLN A;  4EMI A;  4G74 A;  3WE0 A;  1GES A;  3LZX A;  5C2T A;  5JCN A;  3KPF A;  4GDP A;  3HZL A;  3NG7 X;  2VVL G;  1GRF A;  2XFU A;  5FS6 A;  1CBO A;  3UOV A;  1E1K A;  2H89 A;  4ECH A;  3RP6 A;  3URH A;  3NKS A;  3ZYX A;  4A79 A;  3DJD A;  1K4Q A;  2VVL A;  2Q0L A;  4FK1 A;  5J7X A;  3AXB A;  4KPR A;  3D1C A;  1N1P A;  3GYI A;  4D04 A;  4EQX A;  4YKF A;  2V60 A;  2A87 A;  3T14 A;  4YSY A;  4X9M A;  2YLR A;  1QJD A;  1REO A;  4BK1 A;  1GND A;  3Q9T A;  3AEG A;  1KNP A;  3DK4 A;  4YSZ A;  3UKF A;  3H8I A;  4LA1 A;  1E39 A;  3CGE A;  3CNS A;  3DA1 A;  2UZZ A;  1IUX A;  1DJN A;  1IUU A;  2E1M A;  2YLS A;  2YG6 A;  3GYJ A;  4Z24 A;  2IID A;  3UKP A;  5J60 A;  2GVC A;  4H4W A;  1JRX A;  3AE6 A;  4KX6 A;  4DGK A;  1O95 A;  3AD7 B;  3S5W A;  2J3N A;  1P2E A;  3RNM A;  4A5L A;  3ICR A;  4K5R A;  4Z2T A;  3C96 A;  4AT0 A;  1IUV A;  2B76 A;  3UOY A;  4H50 A;  2YVJ A;  5FS7 A;  3FG2 P;  1TDK A;  1W4X A;  3NTD A;  2WOI A;  3V3O A;  2X50 A;  1N4W A;  1L9E A;  2RGH A;  3BI4 A;  2XVE A;  3DJJ A;  3ICT A;  1H82 A;  4NTC A;  5BRT A;  3QFB A;  4H4X A;  2VOU A;  4JNA A;  3IF9 A;  4TLZ A;  3LJP A;  1H84 A;  3IC9 A;  3L8K A;  3NH3 X;  4IV9 A;  1KF6 A;  1DXL A;  1K0I A;  1LQU A;  5JCK A;  4JDR A;  1PBC A;  3ATR A;  2DKH A;  5FS9 A;  1PJ5 A;  3M12 A;  3QSS A;  4GAV A;  3NHO X;  1MOK A;  3H8L A;  1GRB A;  1PXC A;  3DME A;  1YQ4 A;  4IA6 A;  5U25 A;  4I59 A;  2BC1 A;  4C3X A;  3QVR A;  4GAP A;  4USQ A;  2PYX A;  2QCU A;  3GMC A;  3KKJ A;  3LB8 A;  1L9D A;  3AE9 A;  3K7Q X;  1GRG A;  3RP7 A;  1GAL A;  1GRA A;  1NAA A;  2Z5X A;  4FK1 C;  4DSH A;  1JU2 A;  1B37 A;  2GB0 A;  2GR1 A;  3AE1 A;  4K8D A;  2R9Z A;  1GSN A;  2JKC A;  2Q6U A;  4FDC B;  3SX6 A;  4YSH A;  1FEA A;  1JNZ A;  1LVL A;  1XPQ A;  2R4J A;  3NNE A;  4B64 A;  1CJ4 A;  3DJE A;  1E6E A;  4OPD A;  3SY4 A;  4EM4 A;  2FJD A;  2X99 A;  4U2S A;  4E0V A;  3K7T A;  2E5V A;  2V5Z A;  3EAN A;  1D4C A;  2C4C A;  3VR9 A;  1DOE A;  4C3Y A;  1FEB A;  4B68 A;  2B9X A;  1MO9 A;  2A89 A;  1OJA A;  2V3B A;  3C4N A;  3BHK A;  2OLO A;  4B67 A;  3DK8 A;  4CBQ A;  2FBW A;  3AE4 A;  4WCT A;  1NHP A;  5EB4 A;  2C70 A;  1QLB A;  1H6V A;  2YR6 A;  3ALM A;  5TR3 A;  4BJY A;  1PN0 A;  4XXG A;  2Q7V A;  2WP9 A;  1GTH A;  4U2T A;  5KWF A;  1E1L A;  2X8C A;  3IWA A;  3CPH G;  2GQW A;  1D5T A;  4RSL A;  2VZ2 A;  2H88 A;  2FJB A;  1CJ3 A;  3FBS A;  4II3 A;  4H4T A;  2HQM A;  1EL8 A;  4YWO A;  3T37 A;  3AYJ A;  4Z43 A;  1Q1W A;  1KFY A;  2YAU A;  1F6M A;  2C75 A;  2NVK X;  2R4E A;  3F8D A;  2EQ7 A;  2WPF A;  5HXI A;  2Z5Y A;  2XYO A;  3NIX A;  1QO8 A;  3HYW A;  3UKA A;  2R0P A;  2BS3 A;  2WU2 A;  2WEU A;  3AEB A;  3T2Z A;  5KOW A;  2X8G A;  4BV6 A;  4B69 A;  1GET A;  1NHQ A;  1OJ9 A;  1VG9 A;  1YQ3 A;  5ER0 A;  4JY3 A;  3CNJ A;  1PS9 A;  4ADW A;  4GDE A;  4OPG A;  2C76 A;  4OVI A;  5CQF A;  4RG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...