2VOUA

Structure of 2,6-dihydroxypyridine-3-hydroxylase from arthrobacter nicotinovorans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
393
structure length
393
Chain Sequence
SPTTDRIAVVGGSISGLTAALMLRDAGVDVDVYERSPQPLSGFGTGIVVQPELVHYLLEQGVELDSISVPSSSMEYVDALTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADGGASVVRKRLLGIEPTYAGYVTWRGVLQPGEVADDVWNYFNDKFTYGLLDDGHLIAYPIPGRENAESPRLNFQWYWNVAEGPDLDELMTDVRGIRLPTSVHNNSLNPHNLRQFHSKGESLFKPFRDLVLNASSPFVTVVADATVDRMVHGRVLLIGDAAVTPRPHAAAGGAKASDDARTLAEVFTKNHDLRGSLQSWETRQLQQGHAYLNKVKKMASRLQHGGSFEPGNPAFAFGLPKVDEPSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 2,6-DIHYDROXYPYRIDINE HYDROXYLASE
publication title Structure of 2,6-Dihydroxypyridine 3-Hydroxylase from a Nicotine-Degrading Pathway.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 128
structure length 393
sequence length 393
chains with identical sequence B, C
ec nomenclature ec 1.14.13.10: 2,6-dihydroxypyridine 3-monooxygenase.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.60 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 2vouA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vouA01
5KRQA 3SGLA 4K22A 2C3DA 2GB0A 2V61A 2IVDA 2YG4A 4B1BA 2PYXA 4J2WA 4H2RA 1VQWA 2BXRA 3NGCX 2XLSA 5ER0A 3F8RA 1CJCA 1E1KA 1GALA 3NK0X 2GMJA 5U25A 3NK2X 3URHA 1D4EA 4Y4NA 3C4AA 2WETA 2YG6A 4J36A 4AOXA 2B7RA 3BHKA 1KFYA 4RSLA 3IHGA 4UDRA 1CC2A 4H4RA 2YR5A 4Z26A 2WDQA 3NHOX 3P4QA 3NYCA 1TRBA 2BA9A 4X9NA 3ZYXA 3G5QA 3PS9A 2GAHB 1VG9A 2JB2A 3AB1A 4U8MA 4A9WA 2FJBA 2E1MA 4A99A 4OPUA 1GRHA 3ICRA 5IQ4A 1D7YA 2OA1A 1BGNA 1Q1WA 4WCTA 2XVHA 3NYFA 1KNPA 2B9YA 3CPHG 5LV9A 3Q6JA 3LZWA 4YT0A 1XHCA 2JAEA 2CFYA 4UDPA 3DK9A 4O5UA 1CJ2A 1Z6LA 2XLTA 4GDPA 2R0CA 2GH5A 4ICYA 4CY6A 4AT2A 4XXGA 2F5ZA 1PBEA 4XWRA 3BNMA 1PHHA 2BYBA 1EL9A 2XFOA 2C67A 2C75A 4UP3A 4CNJA 5EB5A 1B8SA 2X3NA 4B67A 4OVIA 1NDAA 1GRAA 2YWLA 4BK2A 4Z25A 3CPIG 4C5OA 1GT8A 1E1MA 2BCGG 3DA1A 3GRSA 2FJAA 2RABA 1D5TA 1GRGA 1S2QA 1ZOVA 1K0IA 3CNDA 4A65A 4HA6A 4B68A 1ELIA 4YSHA 3DJDA 5EB4A 1NHPA 4NEWA 1KF6A 2Q0KA 4Z2UA 1VDCA 3L8KA 1PJ5A 2WESA 4YTPA 2WEUA 3DGHA 2Q0LA 4GR1A 3IF9A 4U8NA 1PXCA 4H2PA 3L1RA 3CNTA 2E5VA 4BK1A 4LIIA 3FBSA 4DNAA 2WDVA 1QO8A 4K5RA 4KPRA 1ONFA 5DBJA 1XANA 4BURA 4FK1C 3K7QX 1KSSA 2BXSA 3LOVA 3ATQA 4B65A 4DSGA 5JCNA 4A7AA 1NHRA 1GSNA 3QFBA 1P2HA 1ZMCA 4H4UA 3RP7A 1M6IA 1SEZA 2BK4A 4K8DA 1NPXA 1COYA 1TDFA 3CNJA 1F8WA 4K7ZA 2Q7VA 5KXJA 3P9UA 4YSXA 4NTCA 5FS9A 1OJAA 2RGOA 5HYMA 2PHHA 4JY3A 2VOUA 4IVMB 3AE8A 3AE4A 2XVJA 1JNRA 2GR3A 5C2TA 1L9EA 2QAEA 3UKQA 1KSUA 3CGEA 4NZHA 5JCLA 4LA1A 5BVAA 3GWFA 2ZZ0A 1JRXA 5IQ1A 1B37A 1L9DA 1ZP0A 2JBVA 3VRAA 1L0VA 1BWCA 1H84A 4RG3A 4EIPA 4H4SA 4Z2RA 1BGJA 2XLUA 3S61A 1NHSA 3G5SA 2JKCA 2NVKX 4GF7A 1TYTA 3RP8A 4EMJA 2CULA 2XFUA 1Q1RA 4C74A 1DOCA 3AE7A 3M13A 2R0PA 3I6DA 3OC4A 3KKJA 1F8RA 3EANA 3UOXA 5KWFA 2HQMA 3GMCA 3UKFA 4H4TA 4A79A 2AQJA 5BULA 3REDA 5FS8A 4YXDA 3T37A 4YTNA 3LZXA 1PDHA 2C7GA 4U2LA 4X9MA 1OJDA 4EM3A 4FX9A 5U1OA 4B64A 2GQWA 4O5QA 4C3XA 2B9XA 2CVJA 2DKIA 1JOAA 1Y56A 3KVEA 1KNRA 1PJ7A 2Y6QA 3CNSA 4H2NA 3AE5A 3AYJA 2YLWA 4DSHA 2APGA 2GAGB 3H4KA 3JSKA 4BJZA 2YR6A 3GDNA 3V3OA 2W0HA 2XVFA 4AT0A 3ICSA 3I3LA 3KA7A 1QJDA 2J3NA 3VQRA 2XFPA 3CPJG 4YKFA 2BACA 5HY5A 1PXBA 1GRFA 4EMIA 3QFAA 2BK3A 3NTDA 5KVIA 2WP5A 4YSZA 3CGCA 2OALA 3FMWA 5FS7A 2OLOA 1CF3A 5EOWA 4Z2TA 1CJ3A 4FDCB 1ZOYA 3ICTA 3B6DA 3DJGX 2X50A 3IC9A 4HB9A 1IUWA 2EQ9A 2VRLA 2WQYA 3UKHA 5IPYA 3NN6X 3AEEA 4I58A 3AE6A 4TM3A 2A89A 1H83A 2C3CA 3ALLA 3FIMB 2WU2A 1GOSA 1PN0A 4MJWA 4EQXA 5KOWA 4IA6A 4ZCCA 1FOHA 2V60A 3UTEA 4NEVA 2V5ZA 3UKAA 2XFNA 5C3JA 2GQFA 4XWZA 4WX1A 5KVHA 1ZY8A 1GERA 3F8DA 4J34A 4KX6A 2AR8A 4JY2A 4N9XA 1F3PA 2QA1A 5FMHA 4ECHA 4GUVA 3BI4A 2NPXA 4DGKA 3BNUA 4JNAA 1E7PA 4EQWA 3DH9A 2FBWA 1NG4A 5FS6A 3IWAA 1JEHA 1FL2A 1D4CA 4Y4MA 2C76A 3SFDA 4CCRA 1REOA 1GXFA 4J33A 2V3AA 5JCMA 3V76A 3P1WA 2RGJA 1CHUA 2IIDA 4I59A 4YKGA 2X8HA 3UKKA 3UP4A 2GR0A 2IVEA 3ADAB 1IUVA 4YWOA 1IJHA 3C96A 1O5WA 1K4QA 4YSYA 4AP1A 2WP6A 1PBDA 4JN9A 2JB3A 3UKPA 4IA5A 4OPIA 2JK6A 1Y56B 1E39A 1JRYA 3AXBA 2B9WA 3DK8A 3EAOA 4M52A 1M64A 1AOGA 3P4PA 4BV6A 2XDOA 2XCGA 3ATRA 4EM4A 1IUXA 2XVIA 1GETA 5EBKA 4CNKA 4Z44A 2WOWA 1OJTA 2BABA 2GV8A 1TDKA 3SM8A 1ZX9A 2GVCA 4OPCA 1F6MA 3NRNA 4C77A 1PJ6A 3P4RA 2C66A 3NK1X 2ZZCA 1H7WA 3AEBA 2BS3A 3GMBA 2VVLG 3AYLA 3BI5A 3UP5A 4B66A 1NAAA 2YAUA 4C3YA 1TDNA 2YG5A 4TM0A 4H50A 1PBFA 2YM2A 3QSEA 1H6VA 2Q6UA 2WPEA 3UOVA 2WPFA 3ALJA 1GRTA 1RSGA 1H81A 3VR8A 1K0JA 1O95A 3Q9TA 3SQPA 2XLRA 3AECA 2V3BA 3AE3A 1H7XA 3D1CA 2WPCA 5HXIA 4EIQA 4J57A 1YQ3A 2ARDA 2AAQA 2GRTA 2VVMA 2YVJA 3B3RA 1PXAA 5U63A 5BUKA 2X8GA 2VQBA 4BJYA 1FCDA 2C70A 3KLJA 1S3BA 2GR1A 2R46A 2OAMA 3VRDB 4ZN0A 1EL7A 3QSSA 4REKA 1XPQA 1GESA 4B63A 1PBCA 3NT6A 3PO7A 3RP6A 3BHFA 4H4WA 2XLPA 4U2SA 2Y6RA 1IUUA 1LV0A 3NNEA 3LB8A 3CGDA 1FEBA 3AEAA 4K5SA 2VRMA 3K7TA 5JCKA 3UTFA 3K30A 2YLXA 3ITJA 3AE2A 4TM4A 4U8LA 4U8OA 1ZK7A 4ZCDA 3LXDA 4TLXA 1UKVG 4IV9A 1YY5A 3AYIA 3ISHA 1BKWA 2GMHA 1FECA 4CY8A 4EMWA 3ZDNA 5JCIA 1YKJA 1H82A 3E1TA 4H4PA 2GR2A 2XVEA 1MO9A 4P9SA 1OJ9A 1CC6A 1N4VA 3QJ4A 3M12A 1VG0A 2R4JA 3CNPA 1GEUA 4PABA 1TDOA 1CL0A 3HZLA 4A6NB 1L9CA 4Z43A 2WP9A 1TDEA 1CJ4A 2A87A 2GF3A 1F8SA 2YLSA 3IHMA 1LPFA 1E6EA 2B76A 1E1NA 1D4DA 4CBQA 2EQ6A 1Q9IA 2QCUA 1KDGA 4Z24A 3UCLA 3COXA 1RP0A 2VQ7A 5M0ZA 4Y4LA 4JDRA 2ACZA 3GWDA 2EQ8A 3FPZA 1D7LA 3AD7B 5L46A 1ZKQA 2ZBWA 3H8IA 1BF3A 3QVPA 3DJJA 2FJDA 3PVCA 4PAAA 4U8IA 1JU2A 2BK5A 2RGHA 2XYOA 1DODA 3AWIA 1CC4A 2H89A 2O9ZA 1Y0PA 3GRTA 2A8XA 5CQFA 1MXTA 1V59A 2JB1A 2YLZA 3NG7X 5BRTA 2TPRA 1LTXR 2YVGA 2VVLA 4K2XA 3OZ2A 4U2TA 3V3NA 1H86A 1NENA 4X4JA 1N4WA 3LADA 4EQSA 3UTGA 5GRTA 4ADWA 4FK1A 1DOEA 2BC0A 2YLTA 2WS3A 3DK4A 1EL8A 3DJEA 4J31A 1RYIA 1PS9A 3D8XA 4TM1A 3VRBA 1GTEA 4U8PA 1P2EA 2V6OA 3NH3X 5J60A 2R45A 2X99A 4H4XA 4H4QA 4E0VA 3KPFA 4GRTA 2YG3A 1BZLA 3AD8B 4GDEA 2Z5YA 2Z5XA 2C64A 1W4XA 3DMEA 1NHQA 2BS4A 3C4NA 3CTYA 1HYUA 2WOVA 3UKLA 2WOIA 2YM1A 3M0OA 3UOYA 2UZZA 3NTAA 3AEFA 4D03A 2DKHA 3UOZA 4RG4A 4H4YA 3GYJA 4A6NA 4JQ9A 5TR3A 2I0ZA 4YTMA 1NEKA 2WU5A 4NTDA 3FG2P 4H4ZA 4OPGA 3DGZA 1YQZA 2YR4A 4H2QA 1N4UA 2C73A 3AD9B 4USQA 1GNDA 3NKSA 4EQRA 1GV4A 5J7XA 1FEAA 1CBOA 2B7SA 3KD9A 3KU9A 3QVRA 1XDIA 1B5QA 1PBBA 2QA2A 2YQUA 1N1PA 3CGBA 3QSMA 4H4VA 1GRBA 3GYIA 1GREA 4GCMA 3AE1A 3GSIA 3WE0A 2EQ7A 4UDQA 1DJQA 1EL5A 2BC1A 1S2YA 2CDUA 1LJ1A 1S3EA 1ZMDA 1LVLA 2BS2A 1OJCA 4OPLA 2H88A 1K0LA 1EBDA 3UTHA 4A5LA 1GPEA 1VRQB 2R4EA 3ABVA 5M10A 3II4A 3CN8A 3GD4A 3CIRA 2R9ZA 4U8KA 3F8PA 4OPDA 4B69A 5CKUA 1DOBA 2TMDA 4D04A 2YVFA 3K7MX 2XFQA 3NLCA 1LQTA 4OCGA 2OLNA 2ZZBA 3ALMA 3EF6A 3EPTA 4USRA 3SFEA 4BK3A 1IUTA 4CCQA 1NG3A 1MOKA 2E4GA 4CRTA 2C72A 3AE9A 3AEDA 3S5WA 2YLRA 1JNZA 1ZDLA 5KOXA 2FJEA 3P4SA 3RNMA 1GTHA 4TLZA 3GD3A 3RHAA 1O94A 3LJPA 4NTEA 2R0GA 4JNQA 1DXLA 2WDRA 5HHFA 2WBAA 4IVOB 4J56A 3NYEA 4AOSA 1JRZA 4H7UA 2C65A 1B4VA 3R9UA 2BCPA 3GDPA 3AEGA 3G5RA 3NIXA 3O0HA 1LQUA 5GSNA 3BI2A 2GEWA 2YG7A 1IUSA 1DNCA 2X8CA 1X31B 1QLBA 4LU6A 2VZ2A 3H8LA 1TYPA 1DJNA 1YQ4A 3VR9A 3NN0X 4APNA 2WHDA 4AP3A 4U8JA 1E1LA 4OPTA
chains in the Genus database with same CATH superfamily
5KRQA 3SGLA 5KMPA 4K22A 2C3DA 2GB0A 2V61A 2IVDA 2YG4A 4B1BA 3T14A 2PYXA 4J2WA 4H2RA 1VQWA 3SY4A 2BXRA 3NGCX 2XLSA 5ER0A 3F8RA 5KMQA 1CJCA 1E1KA 1GALA 3NK0X 2GMJA 5U25A 3NK2X 3URHA 1D4EA 4Y4NA 3C4AA 2WETA 2YG6A 4J36A 4AOXA 2B7RA 3BHKA 1KFYA 4RSLA 3IHGA 4UDRA 1CC2A 4H4RA 2YR5A 4Z26A 2WDQA 3NHOX 3P4QA 3NYCA 1TRBA 2BA9A 4X9NA 4YJGB 3ZYXA 3PS9A 3G5QA 2GAHB 1VG9A 2JB2A 3AB1A 2DU8A 4U8MA 4A9WA 2FJBA 2E1MA 4A99A 4OPUA 1GRHA 3ICRA 5IQ4A 1D7YA 2OA1A 1BGNA 4WCTA 1Q1WA 2XVHA 3NYFA 3T2KA 1KNPA 2B9YA 3CPHG 3T31A 5LV9A 3Q6JA 3LZWA 4YT0A 1XHCA 2JAEA 2CFYA 4UDPA 3DK9A 4O5UA 1CJ2A 1Z6LA 2XLTA 4GDPA 2R0CA 2GH5A 4ICYA 4CY6A 4AT2A 4XXGA 2F5ZA 1PBEA 4XWRA 3BNMA 1PHHA 2BYBA 1EL9A 2XFOA 2C67A 2C75A 4UP3A 4CNJA 5EB5A 1B8SA 2X3NA 4B67A 4OVIA 4BK2A 1GRAA 1NDAA 2YWLA 4Z25A 3CPIG 4C5OA 1GT8A 3DA1A 1E1MA 2BCGG 3GRSA 2FJAA 2RABA 1D5TA 1GRGA 1S2QA 1ZOVA 1K0IA 3CNDA 4A65A 4HA6A 4B68A 3ZNQA 3SYIA 1ELIA 4YSHA 3DJDA 5EB4A 1NHPA 4NEWA 1KF6A 2Q0KA 4Z2UA 3ZNPA 1VDCA 3L8KA 1PJ5A 2WESA 4YTPA 2WEUA 3DGHA 2Q0LA 4GR1A 3IF9A 4U8NA 3T2ZA 1C0KA 1PXCA 4H2PA 3L1RA 3CNTA 2E5VA 4BK1A 4LIIA 3FBSA 4DNAA 2WDVA 1QO8A 4K5RA 4KPRA 1ONFA 5DBJA 1XANA 4BURA 4FK1C 3K7QX 1KSSA 2BXSA 3LOVA 3ATQA 4B65A 4DSGA 5JCNA 4YJGA 4A7AA 1NHRA 1GSNA 3QFBA 1P2HA 1ZMCA 4H4UA 3RP7A 3HYWA 1M6IA 1SEZA 2BK4A 4K8DA 1NPXA 1COYA 1TDFA 3CNJA 1F8WA 4K7ZA 2Q7VA 5KXJA 3P9UA 5HYMA 4NTCA 5FS9A 1OJAA 2RGOA 4YSXA 2PHHA 4JY3A 2VOUA 3CMMA 4IVMB 3AE8A 3AE4A 2XVJA 1JNRA 2GR3A 5C2TA 1L9EA 2QAEA 3UKQA 5KMRA 1KSUA 3CGEA 4NZHA 5JCLA 4LA1A 5BVAA 3GWFA 2ZZ0A 1JRXA 1C0PA 5IQ1A 1L9DA 1B37A 1ZP0A 2JBVA 3VRAA 1L0VA 1BWCA 1H84A 4EIPA 4RG3A 4H4SA 4Z2RA 1BGJA 2XLUA 3G3EA 3S61A 1NHSA 3G5SA 2JKCA 4GF7A 3RP8A 1TYTA 2NVKX 4EMJA 2CULA 2XFUA 1Q1RA 4C74A 1DOCA 3AE7A 3M13A 2R0PA 3I6DA 3OC4A 3KKJA 1F8RA 3EANA 3UOXA 5KWFA 2HQMA 3T2YA 3GMCA 3UKFA 4H4TA 4A79A 2AQJA 5BULA 3REDA 5FS8A 4YXDA 3T37A 4YTNA 3LZXA 1PDHA 4X9MA 2C7GA 4U2LA 1OJDA 4EM3A 4FX9A 5U1OA 4B64A 2GQWA 4O5QA 4C3XA 1AN9A 2B9XA 2CVJA 2DKIA 1JOAA 4H2NA 1Y56A 1KNRA 1PJ7A 2Y6QA 3CNSA 3KVEA 4G73A 4G9KA 3SX6A 3AE5A 3AYJA 2YLWA 4DSHA 2GAGB 2APGA 3H4KA 4BJZA 3JSKA 2YR6A 3GDNA 3V3OA 2W0HA 2XVFA 4AT0A 3ICSA 3I3LA 3KA7A 3VQRA 1QJDA 2J3NA 2XFPA 3CPJG 4YKFA 2BACA 5HY5A 1PXBA 1GRFA 4EMIA 3QFAA 2E4AA 2BK3A 3W4KA 3NTDA 5KVIA 2WP5A 4YSZA 3CGCA 2OALA 3FMWA 5FS7A 2OLOA 1CF3A 5EOWA 4Z2TA 1CJ3A 4FDCB 1ZOYA 3ICTA 3B6DA 3DJGX 2X50A 3IC9A 4HB9A 1IUWA 2EQ9A 2VRLA 2WQYA 3UKHA 5IPYA 3NN6X 3AEEA 4I58A 3AE6A 4TM3A 2A89A 1H83A 2C3CA 3ALLA 3FIMB 2WU2A 1GOSA 1PN0A 3KPKA 4MJWA 3W4JA 4IA6A 4ZCCA 4EQXA 1FOHA 5KOWA 2V60A 4YJHA 3UTEA 4NEVA 2V5ZA 3UKAA 2XFNA 5C3JA 4XWZA 2GQFA 4WX1A 4II3A 5KVHA 1ZY8A 1GERA 3F8DA 4J34A 4KX6A 2AR8A 4JY2A 4N9XA 1F3PA 2QA1A 5FMHA 4ECHA 4GUVA 3BI4A 2NPXA 4DGKA 3BNUA 2BRYA 5KMSA 4JNAA 1E7PA 4EQWA 3DH9A 2FBWA 1NG4A 5FS6A 3SXIA 3IWAA 1JEHA 1FL2A 1D4CA 4Y4MA 2C76A 3SFDA 4CCRA 1REOA 1GXFA 4J33A 2V3AA 5JCMA 3V76A 3P1WA 2RGJA 1CHUA 2IIDA 4I59A 4YKGA 2X8HA 3UKKA 3UP4A 2GR0A 2IVEA 3ADAB 1IUVA 4YWOA 1IJHA 3C96A 1O5WA 1K4QA 4YSYA 4AP1A 2WP6A 1PBDA 4JN9A 2JB3A 3UKPA 4IA5A 4OPIA 2JK6A 1Y56B 1E39A 3AXBA 1JRYA 4G6HA 2B9WA 3DK8A 3EAOA 4M52A 1M64A 1AOGA 3P4PA 4BV6A 2XDOA 2E82A 2XCGA 3ATRA 4EM4A 1IUXA 2XVIA 1GETA 5EBKA 4CNKA 4Z44A 2WOWA 1OJTA 2BABA 4G6GA 2GV8A 1TDKA 3SM8A 1ZX9A 2GVCA 4OPCA 1F6MA 3NRNA 4C77A 1PJ6A 3P4RA 2C66A 4GAPA 3NK1X 2ZZCA 1H7WA 3AEBA 2BS3A 3GMBA 2VVLG 3AYLA 3BI5A 3UP5A 4B66A 1NAAA 2YAUA 4C3YA 1TDNA 2YG5A 4TM0A 4H50A 1PBFA 2YM2A 5KNLA 3QSEA 1H6VA 2Q6UA 2WPEA 3UOVA 2WPFA 1C0LA 3ALJA 1GRTA 1RSGA 1H81A 3VR8A 1K0JA 1O95A 3Q9TA 3SQPA 2XLRA 3AECA 2V3BA 4YJHB 1H7XA 3AE3A 5HXIA 2WPCA 3D1CA 4EIQA 4J57A 1YQ3A 2ARDA 2AAQA 2GRTA 2VVMA 1DAOA 2YVJA 3B3RA 4NNJA 1PXAA 5U63A 2C4CA 2X8GA 5BUKA 4BJYA 2VQBA 1FCDA 2C70A 3KLJA 2R46A 1S3BA 2GR1A 2OAMA 3VRDB 4ZN0A 1EL7A 3QSSA 4REKA 1XPQA 1GESA 4B63A 1PBCA 3NT6A 3PO7A 3RP6A 3BHFA 4H4WA 2XLPA 4U2SA 2Y6RA 1IUUA 1LV0A 3NNEA 3SZCA 3LB8A 3CGDA 1FEBA 3AEAA 4K5SA 2VRMA 3K7TA 5JCKA 3UTFA 3K30A 2YLXA 3ITJA 3WGTA 3AE2A 1C0IA 4TM4A 4U8LA 4YJDA 1ZK7A 4U8OA 4ZCDA 3LXDA 4TLXA 1UKVG 4IV9A 1YY5A 3AYIA 3ISHA 1BKWA 2GMHA 1FECA 4CY8A 4EMWA 3ZDNA 5JCIA 1YKJA 3E1TA 1H82A 4H4PA 2GR2A 2XVEA 4P9SA 1MO9A 1OJ9A 1CC6A 1N4VA 3QJ4A 3M12A 1VG0A 2R4JA 3CNPA 4G74A 1GEUA 4PABA 1TDOA 1CL0A 3HZLA 4A6NB 1L9CA 4Z43A 2WP9A 1TDEA 1CJ4A 3SZ0A 3T0KA 3W4IA 2A87A 2GF3A 1F8SA 2YLSA 1DDOA 3IHMA 1LPFA 1E6EA 2B76A 1E1NA 1D4DA 4CBQA 2EQ6A 2QCUA 1Q9IA 1KDGA 4Z24A 3SZFA 3UCLA 3COXA 1RP0A 2VQ7A 5M0ZA 4Y4LA 4JDRA 2ACZA 3GWDA 2E49A 2EQ8A 3FPZA 1D7LA 3AD7B 5L46A 1ZKQA 2ZBWA 3H8IA 1BF3A 4PAAA 3DJJA 2FJDA 3PVCA 3QVPA 4U8IA 4QFCA 1JU2A 2BK5A 2RGHA 3AWIA 1DODA 4YJFA 2XYOA 1CC4A 4GAVA 2H89A 4QFDA 2O9ZA 1Y0PA 3GRTA 2A8XA 5CQFA 1MXTA 1V59A 2JB1A 3HYXA 2YLZA 3NG7X 5BRTA 2TPRA 1LTXR 2YVGA 2VVLA 4K2XA 3OZ2A 4U2TA 3V3NA 1H86A 1NENA 4X4JA 4NWZA 1N4WA 3LADA 4EQSA 3UTGA 5GRTA 4ADWA 4FK1A 1DOEA 2BC0A 2YLTA 2WS3A 3DK4A 1EL8A 3DJEA 4J31A 1RYIA 1PS9A 3D8XA 4TM1A 3VRBA 1GTEA 4U8PA 1EVIA 1P2EA 2V6OA 3NH3X 5J60A 2R45A 2X99A 4H4XA 3SZWA 4H4QA 4E0VA 1VE9A 3KPFA 4GRTA 2YG3A 1BZLA 3AD8B 4GDEA 2Z5YA 2Z5XA 2C64A 3DMEA 1W4XA 1NHQA 3C4NA 2BS4A 3CTYA 1HYUA 2WOVA 3UKLA 3M0OA 2WOIA 2YM1A 3UOYA 2UZZA 3NTAA 3AEFA 4D03A 2DKHA 3UOZA 4RG4A 4H4YA 3GYJA 4A6NA 4JQ9A 5TR3A 2I0ZA 2E48A 1NEKA 2WU5A 4YTMA 4NTDA 3FG2P 3ZNOA 4H4ZA 4OPGA 3DGZA 1YQZA 2YR4A 4H2QA 3AD9B 1N4UA 2C73A 4USQA 1GNDA 3NKSA 4EQRA 1GV4A 5J7XA 1FEAA 1CBOA 2B7SA 3KD9A 3KU9A 3QVRA 1XDIA 1B5QA 1PBBA 3QSMA 2BRAA 3ZNNA 1N1PA 2QA2A 2YQUA 1GRBA 3CGBA 3GYIA 4H4VA 1GREA 4GCMA 3AE1A 3HYVA 3GSIA 3WE0A 2EQ7A 4UDQA 1EL5A 1DJQA 2BC1A 1S2YA 2CDUA 1LJ1A 3CUKA 1S3EA 1ZMDA 1LVLA 2BS2A 1OJCA 4II2A 4OPLA 2H88A 1K0LA 1EBDA 3UTHA 4A5LA 1GPEA 1VRQB 2R4EA 3ABVA 5M10A 3II4A 3CN8A 3GD4A 3CIRA 2R9ZA 4U8KA 3F8PA 4OPDA 4B69A 5CKUA 1DOBA 4YJFB 2TMDA 4D04A 2YVFA 3K7MX 2XFQA 3NLCA 1LQTA 4OCGA 2OLNA 2ZZBA 3ALMA 3EPTA 3EF6A 4BK3A 4USRA 3SFEA 1IUTA 4CCQA 1NG3A 1MOKA 2E4GA 4CRTA 2C72A 3AE9A 3AEDA 3S5WA 2YLRA 1JNZA 1ZDLA 5KOXA 2FJEA 3P4SA 3RNMA 1GTHA 4TLZA 3GD3A 3RHAA 1O94A 3LJPA 4NTEA 1KIFA 2R0GA 4JNQA 1DXLA 2WDRA 5HHFA 2WBAA 4IVOB 4J56A 3NYEA 4AOSA 1JRZA 4H7UA 2C65A 1B4VA 3R9UA 2BCPA 3GDPA 3AEGA 3G5RA 3NIXA 3O0HA 1LQUA 5GSNA 3BI2A 2GEWA 2YG7A 1IUSA 1DNCA 2X8CA 1X31B 1QLBA 4LU6A 2VZ2A 3H8LA 1TYPA 1DJNA 1YQ4A 3VR9A 3GYXA 3NN0X 2WHDA 4APNA 4U8JA 4AP3A 1E1LA 4OPTA
chains in the Genus database with same CATH topology
5KRQA 3SGLA 5KMPA 4K22A 2C3DA 2GB0A 2V61A 2IVDA 2YG4A 4B1BA 3T14A 2PYXA 4J2WA 4H2RA 1VQWA 3SY4A 2BXRA 3NGCX 2XLSA 5ER0A 3F8RA 5KMQA 1CJCA 1E1KA 1GALA 3NK0X 2GMJA 5U25A 3NK2X 3URHA 1D4EA 4Y4NA 3C4AA 2WETA 2YG6A 4J36A 4AOXA 2B7RA 3BHKA 1KFYA 4RSLA 3IHGA 4UDRA 1CC2A 4H4RA 2YR5A 4Z26A 2WDQA 3NHOX 3P4QA 3NYCA 1TRBA 2BA9A 4X9NA 3ZYXA 3G5QA 3PS9A 2GAHB 1VG9A 2JB2A 3AB1A 4U8MA 4A9WA 2FJBA 2E1MA 4A99A 4OPUA 1GRHA 3ICRA 5IQ4A 1D7YA 2OA1A 1BGNA 1Q1WA 4WCTA 2XVHA 3NYFA 3T2KA 1KNPA 2B9YA 3CPHG 3T31A 5LV9A 3Q6JA 3LZWA 4YT0A 1XHCA 2JAEA 2CFYA 4UDPA 3DK9A 4O5UA 1CJ2A 1Z6LA 2XLTA 4GDPA 2R0CA 2GH5A 4ICYA 4CY6A 4AT2A 4XXGA 2F5ZA 1PBEA 4XWRA 3BNMA 1PHHA 2BYBA 1EL9A 2XFOA 2C67A 2C75A 4UP3A 4CNJA 5EB5A 1B8SA 2X3NA 4B67A 4OVIA 4BK2A 1GRAA 1NDAA 2YWLA 4Z25A 3CPIG 4C5OA 1GT8A 1E1MA 2BCGG 3DA1A 3GRSA 2FJAA 2RABA 1D5TA 1GRGA 1S2QA 1ZOVA 1K0IA 3CNDA 4A65A 4HA6A 4B68A 3SYIA 1ELIA 4YSHA 3DJDA 5EB4A 1NHPA 4NEWA 1KF6A 2Q0KA 4Z2UA 1VDCA 3L8KA 1PJ5A 2WESA 4YTPA 2WEUA 3DGHA 2Q0LA 4GR1A 3IF9A 4U8NA 3T2ZA 1PXCA 4H2PA 3L1RA 3CNTA 2E5VA 4BK1A 4LIIA 3FBSA 4DNAA 2WDVA 1QO8A 4K5RA 4KPRA 1ONFA 5DBJA 1XANA 4BURA 4FK1C 3K7QX 1KSSA 2BXSA 3LOVA 3ATQA 4B65A 4DSGA 5JCNA 4A7AA 1NHRA 1GSNA 3QFBA 1P2HA 1ZMCA 4H4UA 3RP7A 3HYWA 1M6IA 1SEZA 2BK4A 4K8DA 1NPXA 1COYA 1TDFA 3CNJA 1F8WA 4K7ZA 2Q7VA 5KXJA 3P9UA 5HYMA 4NTCA 5FS9A 1OJAA 2RGOA 4YSXA 4JY3A 2PHHA 2VOUA 3CMMA 4IVMB 3AE8A 3AE4A 2XVJA 1JNRA 2GR3A 5C2TA 1L9EA 2QAEA 3UKQA 5KMRA 1KSUA 3CGEA 4NZHA 5JCLA 4LA1A 5BVAA 3GWFA 2ZZ0A 1JRXA 5IQ1A 1B37A 1L9DA 1ZP0A 2JBVA 3VRAA 1L0VA 1BWCA 1H84A 4EIPA 4RG3A 4H4SA 4Z2RA 1BGJA 2XLUA 3S61A 1NHSA 3G5SA 2JKCA 4GF7A 3RP8A 1TYTA 2NVKX 4EMJA 2CULA 2XFUA 1Q1RA 4C74A 1DOCA 3AE7A 3M13A 2R0PA 3I6DA 3OC4A 3KKJA 1F8RA 3EANA 3UOXA 5KWFA 2HQMA 3T2YA 3GMCA 3UKFA 4H4TA 4A79A 2AQJA 5BULA 3REDA 5FS8A 4YXDA 3T37A 4YTNA 3LZXA 1PDHA 2C7GA 4U2LA 4X9MA 1OJDA 4EM3A 4FX9A 5U1OA 4B64A 2GQWA 4O5QA 4C3XA 2B9XA 2CVJA 2DKIA 1JOAA 4H2NA 1Y56A 1KNRA 1PJ7A 2Y6QA 3CNSA 3KVEA 4G73A 4G9KA 3SX6A 3AE5A 3AYJA 2YLWA 4DSHA 2APGA 2GAGB 3H4KA 4BJZA 3JSKA 2YR6A 3GDNA 3V3OA 2W0HA 2XVFA 4AT0A 3ICSA 3I3LA 3KA7A 1QJDA 2J3NA 3VQRA 2XFPA 3CPJG 4YKFA 2BACA 5HY5A 1PXBA 1GRFA 4EMIA 3QFAA 2BK3A 3NTDA 5KVIA 2WP5A 4YSZA 3CGCA 2OALA 3FMWA 5FS7A 2OLOA 1CF3A 5EOWA 4Z2TA 1CJ3A 4FDCB 1ZOYA 3ICTA 3B6DA 3DJGX 2X50A 3IC9A 4HB9A 1IUWA 2EQ9A 2VRLA 2WQYA 3UKHA 5IPYA 3NN6X 3AEEA 4I58A 3AE6A 4TM3A 2A89A 1H83A 2C3CA 3ALLA 3FIMB 2WU2A 1GOSA 1PN0A 3KPKA 4MJWA 4EQXA 4IA6A 4ZCCA 5KOWA 1FOHA 2V60A 3UTEA 4NEVA 2V5ZA 3UKAA 2XFNA 5C3JA 2GQFA 4XWZA 4WX1A 4II3A 5KVHA 1ZY8A 1GERA 3F8DA 4J34A 4KX6A 2AR8A 4JY2A 4N9XA 1F3PA 2QA1A 5FMHA 4ECHA 4GUVA 3BI4A 2NPXA 4DGKA 3BNUA 2BRYA 5KMSA 4JNAA 1E7PA 4EQWA 3DH9A 2FBWA 1NG4A 5FS6A 3SXIA 3IWAA 1JEHA 1FL2A 1D4CA 4Y4MA 2C76A 3SFDA 4CCRA 1REOA 1GXFA 4J33A 2V3AA 5JCMA 3V76A 3P1WA 2RGJA 1CHUA 2IIDA 4I59A 4YKGA 2X8HA 3UKKA 3UP4A 2GR0A 2IVEA 3ADAB 1IUVA 4YWOA 1IJHA 3C96A 1O5WA 1K4QA 4YSYA 4AP1A 2WP6A 1PBDA 4JN9A 2JB3A 3UKPA 4IA5A 4OPIA 2JK6A 1Y56B 1E39A 1JRYA 3AXBA 4G6HA 2B9WA 3DK8A 3EAOA 4M52A 1M64A 1AOGA 3P4PA 4BV6A 2XDOA 2XCGA 3ATRA 4EM4A 1IUXA 2XVIA 1GETA 5EBKA 4CNKA 4Z44A 2WOWA 1OJTA 2BABA 4G6GA 2GV8A 1TDKA 3SM8A 1ZX9A 2GVCA 4OPCA 1F6MA 3NRNA 4C77A 1PJ6A 3P4RA 2C66A 4GAPA 3NK1X 2ZZCA 1H7WA 3AEBA 2BS3A 3GMBA 2VVLG 3AYLA 3BI5A 3UP5A 4B66A 1NAAA 2YAUA 4C3YA 1TDNA 2YG5A 4TM0A 4H50A 1PBFA 2YM2A 5KNLA 3QSEA 1H6VA 2Q6UA 2WPEA 3UOVA 2WPFA 3ALJA 1GRTA 1RSGA 1H81A 3VR8A 1K0JA 1O95A 3Q9TA 3SQPA 2XLRA 3AECA 2V3BA 3AE3A 1H7XA 5HXIA 2WPCA 3D1CA 4EIQA 4J57A 1YQ3A 2ARDA 2AAQA 2GRTA 2VVMA 2YVJA 3B3RA 4NNJA 1PXAA 5U63A 2C4CA 2X8GA 5BUKA 4BJYA 2VQBA 1FCDA 2C70A 3KLJA 1S3BA 2GR1A 2R46A 2OAMA 3VRDB 4ZN0A 1EL7A 3QSSA 4REKA 1XPQA 1GESA 4B63A 1PBCA 3NT6A 3PO7A 3RP6A 3BHFA 4H4WA 2XLPA 4U2SA 2Y6RA 1IUUA 1LV0A 3NNEA 3SZCA 3LB8A 3CGDA 1FEBA 3AEAA 4K5SA 2VRMA 3K7TA 5JCKA 3UTFA 3K30A 2YLXA 3ITJA 3AE2A 4TM4A 4U8LA 4U8OA 1ZK7A 4ZCDA 3LXDA 4TLXA 1UKVG 4IV9A 1YY5A 3AYIA 3ISHA 2GMHA 1BKWA 1FECA 4CY8A 4EMWA 3ZDNA 5JCIA 1YKJA 3E1TA 1H82A 4H4PA 2GR2A 2XVEA 1MO9A 4P9SA 1OJ9A 1CC6A 1N4VA 3QJ4A 3M12A 1VG0A 2R4JA 3CNPA 4G74A 1GEUA 4PABA 1TDOA 1CL0A 3HZLA 4A6NB 1L9CA 4Z43A 2WP9A 1TDEA 1CJ4A 3SZ0A 3T0KA 2A87A 2GF3A 1F8SA 2YLSA 3IHMA 1LPFA 1E6EA 2B76A 1E1NA 1D4DA 4CBQA 2EQ6A 1Q9IA 2QCUA 1KDGA 4Z24A 3SZFA 3UCLA 3COXA 1RP0A 2VQ7A 5M0ZA 4Y4LA 4JDRA 2ACZA 3GWDA 2EQ8A 3FPZA 1D7LA 3AD7B 5L46A 1ZKQA 2ZBWA 3H8IA 1BF3A 3QVPA 3DJJA 2FJDA 3PVCA 4PAAA 4U8IA 1JU2A 2BK5A 2RGHA 2XYOA 1DODA 3AWIA 1CC4A 4GAVA 2H89A 2O9ZA 1Y0PA 3GRTA 2A8XA 5CQFA 1MXTA 1V59A 2JB1A 3HYXA 2YLZA 3NG7X 5BRTA 2TPRA 1LTXR 2YVGA 2VVLA 4K2XA 3OZ2A 4U2TA 3V3NA 1H86A 1NENA 4X4JA 4NWZA 1N4WA 3LADA 4EQSA 3UTGA 5GRTA 4ADWA 4FK1A 1DOEA 2BC0A 2YLTA 2WS3A 3DK4A 1EL8A 3DJEA 4J31A 1RYIA 1PS9A 3D8XA 4TM1A 3VRBA 1GTEA 4U8PA 1P2EA 2V6OA 3NH3X 5J60A 2R45A 2X99A 4H4XA 3SZWA 4H4QA 4E0VA 3KPFA 4GRTA 2YG3A 1BZLA 3AD8B 4GDEA 2Z5YA 2Z5XA 2C64A 1W4XA 3DMEA 1NHQA 2BS4A 3C4NA 3CTYA 1HYUA 2WOVA 3UKLA 2WOIA 2YM1A 3M0OA 3UOYA 2UZZA 3NTAA 3AEFA 4D03A 2DKHA 3UOZA 4RG4A 4H4YA 3GYJA 4A6NA 4JQ9A 5TR3A 2I0ZA 4YTMA 1NEKA 2WU5A 4NTDA 3FG2P 4H4ZA 4OPGA 3DGZA 1YQZA 2YR4A 4H2QA 1N4UA 2C73A 3AD9B 4USQA 1GNDA 3NKSA 4EQRA 1GV4A 5J7XA 1FEAA 1CBOA 2B7SA 3KD9A 3KU9A 3QVRA 1XDIA 1B5QA 1PBBA 2BRAA 2QA2A 1N1PA 2YQUA 3CGBA 3QSMA 1GRBA 3GYIA 4H4VA 1GREA 4GCMA 3AE1A 3HYVA 3GSIA 3WE0A 2EQ7A 4UDQA 1DJQA 1EL5A 2BC1A 1S2YA 2CDUA 1LJ1A 1S3EA 4II2A 1ZMDA 1LVLA 2BS2A 1OJCA 4OPLA 2H88A 1K0LA 1EBDA 3UTHA 4A5LA 1GPEA 1VRQB 2R4EA 3ABVA 5M10A 3II4A 3CN8A 3GD4A 3CIRA 2R9ZA 4U8KA 3F8PA 4OPDA 4B69A 5CKUA 1DOBA 2TMDA 4D04A 2YVFA 3K7MX 2XFQA 3NLCA 1LQTA 4OCGA 2OLNA 2ZZBA 3ALMA 3EPTA 3EF6A 4BK3A 4USRA 3SFEA 1IUTA 4CCQA 1NG3A 1MOKA 2E4GA 4CRTA 2C72A 3AE9A 3AEDA 3S5WA 2YLRA 1JNZA 1ZDLA 5KOXA 2FJEA 3P4SA 3RNMA 1GTHA 4TLZA 3GD3A 3RHAA 1O94A 3LJPA 4NTEA 2R0GA 4JNQA 1DXLA 2WDRA 5HHFA 2WBAA 4IVOB 4J56A 3NYEA 4AOSA 1JRZA 4H7UA 2C65A 1B4VA 3R9UA 2BCPA 3GDPA 3AEGA 3G5RA 3NIXA 3O0HA 1LQUA 5GSNA 3BI2A 2GEWA 2YG7A 1IUSA 1DNCA 2X8CA 1X31B 1QLBA 4LU6A 2VZ2A 3H8LA 1TYPA 1DJNA 1YQ4A 3VR9A 3GYXA 3NN0X 2WHDA 4APNA 4U8JA 4AP3A 1E1LA 4OPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KRQ A;  3SGL A;  4K22 A;  2C3D A;  2GB0 A;  2V61 A;  2IVD A;  2YG4 A;  4B1B A;  2PYX A;  4J2W A;  4H2R A;  1VQW A;  2BXR A;  3NGC X;  2XLS A;  5ER0 A;  3F8R A;  1CJC A;  1E1K A;  1GAL A;  3NK0 X;  2GMJ A;  5U25 A;  3NK2 X;  3URH A;  1D4E A;  4Y4N A;  3C4A A;  2WET A;  2YG6 A;  4J36 A;  4AOX A;  2B7R A;  3BHK A;  1KFY A;  4RSL A;  3IHG A;  4UDR A;  1CC2 A;  4H4R A;  2YR5 A;  4Z26 A;  2WDQ A;  3NHO X;  3P4Q A;  3NYC A;  1TRB A;  2BA9 A;  4X9N A;  3ZYX A;  3G5Q A;  3PS9 A;  2GAH B;  1VG9 A;  2JB2 A;  3AB1 A;  4U8M A;  4A9W A;  2FJB A;  2E1M A;  4A99 A;  4OPU A;  1GRH A;  3ICR A;  5IQ4 A;  1D7Y A;  2OA1 A;  1BGN A;  1Q1W A;  4WCT A;  2XVH A;  3NYF A;  1KNP A;  2B9Y A;  3CPH G;  5LV9 A;  3Q6J A;  3LZW A;  4YT0 A;  1XHC A;  2JAE A;  2CFY A;  4UDP A;  3DK9 A;  4O5U A;  1CJ2 A;  1Z6L A;  2XLT A;  4GDP A;  2R0C A;  2GH5 A;  4ICY A;  4CY6 A;  4AT2 A;  4XXG A;  2F5Z A;  1PBE A;  4XWR A;  3BNM A;  1PHH A;  2BYB A;  1EL9 A;  2XFO A;  2C67 A;  2C75 A;  4UP3 A;  4CNJ A;  5EB5 A;  1B8S A;  2X3N A;  4B67 A;  4OVI A;  1NDA A;  1GRA A;  2YWL A;  4BK2 A;  4Z25 A;  3CPI G;  4C5O A;  1GT8 A;  1E1M A;  2BCG G;  3DA1 A;  3GRS A;  2FJA A;  2RAB A;  1D5T A;  1GRG A;  1S2Q A;  1ZOV A;  1K0I A;  3CND A;  4A65 A;  4HA6 A;  4B68 A;  1ELI A;  4YSH A;  3DJD A;  5EB4 A;  1NHP A;  4NEW A;  1KF6 A;  2Q0K A;  4Z2U A;  1VDC A;  3L8K A;  1PJ5 A;  2WES A;  4YTP A;  2WEU A;  3DGH A;  2Q0L A;  4GR1 A;  3IF9 A;  4U8N A;  1PXC A;  4H2P A;  3L1R A;  3CNT A;  2E5V A;  4BK1 A;  4LII A;  3FBS A;  4DNA A;  2WDV A;  1QO8 A;  4K5R A;  4KPR A;  1ONF A;  5DBJ A;  1XAN A;  4BUR A;  4FK1 C;  3K7Q X;  1KSS A;  2BXS A;  3LOV A;  3ATQ A;  4B65 A;  4DSG A;  5JCN A;  4A7A A;  1NHR A;  1GSN A;  3QFB A;  1P2H A;  1ZMC A;  4H4U A;  3RP7 A;  1M6I A;  1SEZ A;  2BK4 A;  4K8D A;  1NPX A;  1COY A;  1TDF A;  3CNJ A;  1F8W A;  4K7Z A;  2Q7V A;  5KXJ A;  3P9U A;  4YSX A;  4NTC A;  5FS9 A;  1OJA A;  2RGO A;  5HYM A;  2PHH A;  4JY3 A;  2VOU A;  4IVM B;  3AE8 A;  3AE4 A;  2XVJ A;  1JNR A;  2GR3 A;  5C2T A;  1L9E A;  2QAE A;  3UKQ A;  1KSU A;  3CGE A;  4NZH A;  5JCL A;  4LA1 A;  5BVA A;  3GWF A;  2ZZ0 A;  1JRX A;  5IQ1 A;  1B37 A;  1L9D A;  1ZP0 A;  2JBV A;  3VRA A;  1L0V A;  1BWC A;  1H84 A;  4RG3 A;  4EIP A;  4H4S A;  4Z2R A;  1BGJ A;  2XLU A;  3S61 A;  1NHS A;  3G5S A;  2JKC A;  2NVK X;  4GF7 A;  1TYT A;  3RP8 A;  4EMJ A;  2CUL A;  2XFU A;  1Q1R A;  4C74 A;  1DOC A;  3AE7 A;  3M13 A;  2R0P A;  3I6D A;  3OC4 A;  3KKJ A;  1F8R A;  3EAN A;  3UOX A;  5KWF A;  2HQM A;  3GMC A;  3UKF A;  4H4T A;  4A79 A;  2AQJ A;  5BUL A;  3RED A;  5FS8 A;  4YXD A;  3T37 A;  4YTN A;  3LZX A;  1PDH A;  2C7G A;  4U2L A;  4X9M A;  1OJD A;  4EM3 A;  4FX9 A;  5U1O A;  4B64 A;  2GQW A;  4O5Q A;  4C3X A;  2B9X A;  2CVJ A;  2DKI A;  1JOA A;  1Y56 A;  3KVE A;  1KNR A;  1PJ7 A;  2Y6Q A;  3CNS A;  4H2N A;  3AE5 A;  3AYJ A;  2YLW A;  4DSH A;  2APG A;  2GAG B;  3H4K A;  3JSK A;  4BJZ A;  2YR6 A;  3GDN A;  3V3O A;  2W0H A;  2XVF A;  4AT0 A;  3ICS A;  3I3L A;  3KA7 A;  1QJD A;  2J3N A;  3VQR A;  2XFP A;  3CPJ G;  4YKF A;  2BAC A;  5HY5 A;  1PXB A;  1GRF A;  4EMI A;  3QFA A;  2BK3 A;  3NTD A;  5KVI A;  2WP5 A;  4YSZ A;  3CGC A;  2OAL A;  3FMW A;  5FS7 A;  2OLO A;  1CF3 A;  5EOW A;  4Z2T A;  1CJ3 A;  4FDC B;  1ZOY A;  3ICT A;  3B6D A;  3DJG X;  2X50 A;  3IC9 A;  4HB9 A;  1IUW A;  2EQ9 A;  2VRL A;  2WQY A;  3UKH A;  5IPY A;  3NN6 X;  3AEE A;  4I58 A;  3AE6 A;  4TM3 A;  2A89 A;  1H83 A;  2C3C A;  3ALL A;  3FIM B;  2WU2 A;  1GOS A;  1PN0 A;  4MJW A;  4EQX A;  5KOW A;  4IA6 A;  4ZCC A;  1FOH A;  2V60 A;  3UTE A;  4NEV A;  2V5Z A;  3UKA A;  2XFN A;  5C3J A;  2GQF A;  4XWZ A;  4WX1 A;  5KVH A;  1ZY8 A;  1GER A;  3F8D A;  4J34 A;  4KX6 A;  2AR8 A;  4JY2 A;  4N9X A;  1F3P A;  2QA1 A;  5FMH A;  4ECH A;  4GUV A;  3BI4 A;  2NPX A;  4DGK A;  3BNU A;  4JNA A;  1E7P A;  4EQW A;  3DH9 A;  2FBW A;  1NG4 A;  5FS6 A;  3IWA A;  1JEH A;  1FL2 A;  1D4C A;  4Y4M A;  2C76 A;  3SFD A;  4CCR A;  1REO A;  1GXF A;  4J33 A;  2V3A A;  5JCM A;  3V76 A;  3P1W A;  2RGJ A;  1CHU A;  2IID A;  4I59 A;  4YKG A;  2X8H A;  3UKK A;  3UP4 A;  2GR0 A;  2IVE A;  3ADA B;  1IUV A;  4YWO A;  1IJH A;  3C96 A;  1O5W A;  1K4Q A;  4YSY A;  4AP1 A;  2WP6 A;  1PBD A;  4JN9 A;  2JB3 A;  3UKP A;  4IA5 A;  4OPI A;  2JK6 A;  1Y56 B;  1E39 A;  1JRY A;  3AXB A;  2B9W A;  3DK8 A;  3EAO A;  4M52 A;  1M64 A;  1AOG A;  3P4P A;  4BV6 A;  2XDO A;  2XCG A;  3ATR A;  4EM4 A;  1IUX A;  2XVI A;  1GET A;  5EBK A;  4CNK A;  4Z44 A;  2WOW A;  1OJT A;  2BAB A;  2GV8 A;  1TDK A;  3SM8 A;  1ZX9 A;  2GVC A;  4OPC A;  1F6M A;  3NRN A;  4C77 A;  1PJ6 A;  3P4R A;  2C66 A;  3NK1 X;  2ZZC A;  1H7W A;  3AEB A;  2BS3 A;  3GMB A;  2VVL G;  3AYL A;  3BI5 A;  3UP5 A;  4B66 A;  1NAA A;  2YAU A;  4C3Y A;  1TDN A;  2YG5 A;  4TM0 A;  4H50 A;  1PBF A;  2YM2 A;  3QSE A;  1H6V A;  2Q6U A;  2WPE A;  3UOV A;  2WPF A;  3ALJ A;  1GRT A;  1RSG A;  1H81 A;  3VR8 A;  1K0J A;  1O95 A;  3Q9T A;  3SQP A;  2XLR A;  3AEC A;  2V3B A;  3AE3 A;  1H7X A;  3D1C A;  2WPC A;  5HXI A;  4EIQ A;  4J57 A;  1YQ3 A;  2ARD A;  2AAQ A;  2GRT A;  2VVM A;  2YVJ A;  3B3R A;  1PXA A;  5U63 A;  5BUK A;  2X8G A;  2VQB A;  4BJY A;  1FCD A;  2C70 A;  3KLJ A;  1S3B A;  2GR1 A;  2R46 A;  2OAM A;  3VRD B;  4ZN0 A;  1EL7 A;  3QSS A;  4REK A;  1XPQ A;  1GES A;  4B63 A;  1PBC A;  3NT6 A;  3PO7 A;  3RP6 A;  3BHF A;  4H4W A;  2XLP A;  4U2S A;  2Y6R A;  1IUU A;  1LV0 A;  3NNE A;  3LB8 A;  3CGD A;  1FEB A;  3AEA A;  4K5S A;  2VRM A;  3K7T A;  5JCK A;  3UTF A;  3K30 A;  2YLX A;  3ITJ A;  3AE2 A;  4TM4 A;  4U8L A;  4U8O A;  1ZK7 A;  4ZCD A;  3LXD A;  4TLX A;  1UKV G;  4IV9 A;  1YY5 A;  3AYI A;  3ISH A;  1BKW A;  2GMH A;  1FEC A;  4CY8 A;  4EMW A;  3ZDN A;  5JCI A;  1YKJ A;  1H82 A;  3E1T A;  4H4P A;  2GR2 A;  2XVE A;  1MO9 A;  4P9S A;  1OJ9 A;  1CC6 A;  1N4V A;  3QJ4 A;  3M12 A;  1VG0 A;  2R4J A;  3CNP A;  1GEU A;  4PAB A;  1TDO A;  1CL0 A;  3HZL A;  4A6N B;  1L9C A;  4Z43 A;  2WP9 A;  1TDE A;  1CJ4 A;  2A87 A;  2GF3 A;  1F8S A;  2YLS A;  3IHM A;  1LPF A;  1E6E A;  2B76 A;  1E1N A;  1D4D A;  4CBQ A;  2EQ6 A;  1Q9I A;  2QCU A;  1KDG A;  4Z24 A;  3UCL A;  3COX A;  1RP0 A;  2VQ7 A;  5M0Z A;  4Y4L A;  4JDR A;  2ACZ A;  3GWD A;  2EQ8 A;  3FPZ A;  1D7L A;  3AD7 B;  5L46 A;  1ZKQ A;  2ZBW A;  3H8I A;  1BF3 A;  3QVP A;  3DJJ A;  2FJD A;  3PVC A;  4PAA A;  4U8I A;  1JU2 A;  2BK5 A;  2RGH A;  2XYO A;  1DOD A;  3AWI A;  1CC4 A;  2H89 A;  2O9Z A;  1Y0P A;  3GRT A;  2A8X A;  5CQF A;  1MXT A;  1V59 A;  2JB1 A;  2YLZ A;  3NG7 X;  5BRT A;  2TPR A;  1LTX R;  2YVG A;  2VVL A;  4K2X A;  3OZ2 A;  4U2T A;  3V3N A;  1H86 A;  1NEN A;  4X4J A;  1N4W A;  3LAD A;  4EQS A;  3UTG A;  5GRT A;  4ADW A;  4FK1 A;  1DOE A;  2BC0 A;  2YLT A;  2WS3 A;  3DK4 A;  1EL8 A;  3DJE A;  4J31 A;  1RYI A;  1PS9 A;  3D8X A;  4TM1 A;  3VRB A;  1GTE A;  4U8P A;  1P2E A;  2V6O A;  3NH3 X;  5J60 A;  2R45 A;  2X99 A;  4H4X A;  4H4Q A;  4E0V A;  3KPF A;  4GRT A;  2YG3 A;  1BZL A;  3AD8 B;  4GDE A;  2Z5Y A;  2Z5X A;  2C64 A;  1W4X A;  3DME A;  1NHQ A;  2BS4 A;  3C4N A;  3CTY A;  1HYU A;  2WOV A;  3UKL A;  2WOI A;  2YM1 A;  3M0O A;  3UOY A;  2UZZ A;  3NTA A;  3AEF A;  4D03 A;  2DKH A;  3UOZ A;  4RG4 A;  4H4Y A;  3GYJ A;  4A6N A;  4JQ9 A;  5TR3 A;  2I0Z A;  4YTM A;  1NEK A;  2WU5 A;  4NTD A;  3FG2 P;  4H4Z A;  4OPG A;  3DGZ A;  1YQZ A;  2YR4 A;  4H2Q A;  1N4U A;  2C73 A;  3AD9 B;  4USQ A;  1GND A;  3NKS A;  4EQR A;  1GV4 A;  5J7X A;  1FEA A;  1CBO A;  2B7S A;  3KD9 A;  3KU9 A;  3QVR A;  1XDI A;  1B5Q A;  1PBB A;  2QA2 A;  2YQU A;  1N1P A;  3CGB A;  3QSM A;  4H4V A;  1GRB A;  3GYI A;  1GRE A;  4GCM A;  3AE1 A;  3GSI A;  3WE0 A;  2EQ7 A;  4UDQ A;  1DJQ A;  1EL5 A;  2BC1 A;  1S2Y A;  2CDU A;  1LJ1 A;  1S3E A;  1ZMD A;  1LVL A;  2BS2 A;  1OJC A;  4OPL A;  2H88 A;  1K0L A;  1EBD A;  3UTH A;  4A5L A;  1GPE A;  1VRQ B;  2R4E A;  3ABV A;  5M10 A;  3II4 A;  3CN8 A;  3GD4 A;  3CIR A;  2R9Z A;  4U8K A;  3F8P A;  4OPD A;  4B69 A;  5CKU A;  1DOB A;  2TMD A;  4D04 A;  2YVF A;  3K7M X;  2XFQ A;  3NLC A;  1LQT A;  4OCG A;  2OLN A;  2ZZB A;  3ALM A;  3EF6 A;  3EPT A;  4USR A;  3SFE A;  4BK3 A;  1IUT A;  4CCQ A;  1NG3 A;  1MOK A;  2E4G A;  4CRT A;  2C72 A;  3AE9 A;  3AED A;  3S5W A;  2YLR A;  1JNZ A;  1ZDL A;  5KOX A;  2FJE A;  3P4S A;  3RNM A;  1GTH A;  4TLZ A;  3GD3 A;  3RHA A;  1O94 A;  3LJP A;  4NTE A;  2R0G A;  4JNQ A;  1DXL A;  2WDR A;  5HHF A;  2WBA A;  4IVO B;  4J56 A;  3NYE A;  4AOS A;  1JRZ A;  4H7U A;  2C65 A;  1B4V A;  3R9U A;  2BCP A;  3GDP A;  3AEG A;  3G5R A;  3NIX A;  3O0H A;  1LQU A;  5GSN A;  3BI2 A;  2GEW A;  2YG7 A;  1IUS A;  1DNC A;  2X8C A;  1X31 B;  1QLB A;  4LU6 A;  2VZ2 A;  3H8L A;  1TYP A;  1DJN A;  1YQ4 A;  3VR9 A;  3NN0 X;  4APN A;  2WHD A;  4AP3 A;  4U8J A;  1E1L A;  4OPT A; 
#chains in the Genus database with same CATH topology
 5KRQ A;  3SGL A;  5KMP A;  4K22 A;  2C3D A;  2GB0 A;  2V61 A;  2IVD A;  2YG4 A;  4B1B A;  3T14 A;  2PYX A;  4J2W A;  4H2R A;  1VQW A;  3SY4 A;  2BXR A;  3NGC X;  2XLS A;  5ER0 A;  3F8R A;  5KMQ A;  1CJC A;  1E1K A;  1GAL A;  3NK0 X;  2GMJ A;  5U25 A;  3NK2 X;  3URH A;  1D4E A;  4Y4N A;  3C4A A;  2WET A;  2YG6 A;  4J36 A;  4AOX A;  2B7R A;  3BHK A;  1KFY A;  4RSL A;  3IHG A;  4UDR A;  1CC2 A;  4H4R A;  2YR5 A;  4Z26 A;  2WDQ A;  3NHO X;  3P4Q A;  3NYC A;  1TRB A;  2BA9 A;  4X9N A;  4YJG B;  3ZYX A;  3PS9 A;  3G5Q A;  2GAH B;  1VG9 A;  2JB2 A;  3AB1 A;  2DU8 A;  4U8M A;  4A9W A;  2FJB A;  2E1M A;  4A99 A;  4OPU A;  1GRH A;  3ICR A;  5IQ4 A;  1D7Y A;  2OA1 A;  1BGN A;  4WCT A;  1Q1W A;  2XVH A;  3NYF A;  3T2K A;  1KNP A;  2B9Y A;  3CPH G;  3T31 A;  5LV9 A;  3Q6J A;  3LZW A;  4YT0 A;  1XHC A;  2JAE A;  2CFY A;  4UDP A;  3DK9 A;  4O5U A;  1CJ2 A;  1Z6L A;  2XLT A;  4GDP A;  2R0C A;  2GH5 A;  4ICY A;  4CY6 A;  4AT2 A;  4XXG A;  2F5Z A;  1PBE A;  4XWR A;  3BNM A;  1PHH A;  2BYB A;  1EL9 A;  2XFO A;  2C67 A;  2C75 A;  4UP3 A;  4CNJ A;  5EB5 A;  1B8S A;  2X3N A;  4B67 A;  4OVI A;  4BK2 A;  1GRA A;  1NDA A;  2YWL A;  4Z25 A;  3CPI G;  4C5O A;  1GT8 A;  3DA1 A;  1E1M A;  2BCG G;  3GRS A;  2FJA A;  2RAB A;  1D5T A;  1GRG A;  1S2Q A;  1ZOV A;  1K0I A;  3CND A;  4A65 A;  4HA6 A;  4B68 A;  3ZNQ A;  3SYI A;  1ELI A;  4YSH A;  3DJD A;  5EB4 A;  1NHP A;  4NEW A;  1KF6 A;  2Q0K A;  4Z2U A;  3ZNP A;  1VDC A;  3L8K A;  1PJ5 A;  2WES A;  4YTP A;  2WEU A;  3DGH A;  2Q0L A;  4GR1 A;  3IF9 A;  4U8N A;  3T2Z A;  1C0K A;  1PXC A;  4H2P A;  3L1R A;  3CNT A;  2E5V A;  4BK1 A;  4LII A;  3FBS A;  4DNA A;  2WDV A;  1QO8 A;  4K5R A;  4KPR A;  1ONF A;  5DBJ A;  1XAN A;  4BUR A;  4FK1 C;  3K7Q X;  1KSS A;  2BXS A;  3LOV A;  3ATQ A;  4B65 A;  4DSG A;  5JCN A;  4YJG A;  4A7A A;  1NHR A;  1GSN A;  3QFB A;  1P2H A;  1ZMC A;  4H4U A;  3RP7 A;  3HYW A;  1M6I A;  1SEZ A;  2BK4 A;  4K8D A;  1NPX A;  1COY A;  1TDF A;  3CNJ A;  1F8W A;  4K7Z A;  2Q7V A;  5KXJ A;  3P9U A;  5HYM A;  4NTC A;  5FS9 A;  1OJA A;  2RGO A;  4YSX A;  2PHH A;  4JY3 A;  2VOU A;  3CMM A;  4IVM B;  3AE8 A;  3AE4 A;  2XVJ A;  1JNR A;  2GR3 A;  5C2T A;  1L9E A;  2QAE A;  3UKQ A;  5KMR A;  1KSU A;  3CGE A;  4NZH A;  5JCL A;  4LA1 A;  5BVA A;  3GWF A;  2ZZ0 A;  1JRX A;  1C0P A;  5IQ1 A;  1L9D A;  1B37 A;  1ZP0 A;  2JBV A;  3VRA A;  1L0V A;  1BWC A;  1H84 A;  4EIP A;  4RG3 A;  4H4S A;  4Z2R A;  1BGJ A;  2XLU A;  3G3E A;  3S61 A;  1NHS A;  3G5S A;  2JKC A;  4GF7 A;  3RP8 A;  1TYT A;  2NVK X;  4EMJ A;  2CUL A;  2XFU A;  1Q1R A;  4C74 A;  1DOC A;  3AE7 A;  3M13 A;  2R0P A;  3I6D A;  3OC4 A;  3KKJ A;  1F8R A;  3EAN A;  3UOX A;  5KWF A;  2HQM A;  3T2Y A;  3GMC A;  3UKF A;  4H4T A;  4A79 A;  2AQJ A;  5BUL A;  3RED A;  5FS8 A;  4YXD A;  3T37 A;  4YTN A;  3LZX A;  1PDH A;  4X9M A;  2C7G A;  4U2L A;  1OJD A;  4EM3 A;  4FX9 A;  5U1O A;  4B64 A;  2GQW A;  4O5Q A;  4C3X A;  1AN9 A;  2B9X A;  2CVJ A;  2DKI A;  1JOA A;  4H2N A;  1Y56 A;  1KNR A;  1PJ7 A;  2Y6Q A;  3CNS A;  3KVE A;  4G73 A;  4G9K A;  3SX6 A;  3AE5 A;  3AYJ A;  2YLW A;  4DSH A;  2GAG B;  2APG A;  3H4K A;  4BJZ A;  3JSK A;  2YR6 A;  3GDN A;  3V3O A;  2W0H A;  2XVF A;  4AT0 A;  3ICS A;  3I3L A;  3KA7 A;  3VQR A;  1QJD A;  2J3N A;  2XFP A;  3CPJ G;  4YKF A;  2BAC A;  5HY5 A;  1PXB A;  1GRF A;  4EMI A;  3QFA A;  2E4A A;  2BK3 A;  3W4K A;  3NTD A;  5KVI A;  2WP5 A;  4YSZ A;  3CGC A;  2OAL A;  3FMW A;  5FS7 A;  2OLO A;  1CF3 A;  5EOW A;  4Z2T A;  1CJ3 A;  4FDC B;  1ZOY A;  3ICT A;  3B6D A;  3DJG X;  2X50 A;  3IC9 A;  4HB9 A;  1IUW A;  2EQ9 A;  2VRL A;  2WQY A;  3UKH A;  5IPY A;  3NN6 X;  3AEE A;  4I58 A;  3AE6 A;  4TM3 A;  2A89 A;  1H83 A;  2C3C A;  3ALL A;  3FIM B;  2WU2 A;  1GOS A;  1PN0 A;  3KPK A;  4MJW A;  3W4J A;  4IA6 A;  4ZCC A;  4EQX A;  1FOH A;  5KOW A;  2V60 A;  4YJH A;  3UTE A;  4NEV A;  2V5Z A;  3UKA A;  2XFN A;  5C3J A;  4XWZ A;  2GQF A;  4WX1 A;  4II3 A;  5KVH A;  1ZY8 A;  1GER A;  3F8D A;  4J34 A;  4KX6 A;  2AR8 A;  4JY2 A;  4N9X A;  1F3P A;  2QA1 A;  5FMH A;  4ECH A;  4GUV A;  3BI4 A;  2NPX A;  4DGK A;  3BNU A;  2BRY A;  5KMS A;  4JNA A;  1E7P A;  4EQW A;  3DH9 A;  2FBW A;  1NG4 A;  5FS6 A;  3SXI A;  3IWA A;  1JEH A;  1FL2 A;  1D4C A;  4Y4M A;  2C76 A;  3SFD A;  4CCR A;  1REO A;  1GXF A;  4J33 A;  2V3A A;  5JCM A;  3V76 A;  3P1W A;  2RGJ A;  1CHU A;  2IID A;  4I59 A;  4YKG A;  2X8H A;  3UKK A;  3UP4 A;  2GR0 A;  2IVE A;  3ADA B;  1IUV A;  4YWO A;  1IJH A;  3C96 A;  1O5W A;  1K4Q A;  4YSY A;  4AP1 A;  2WP6 A;  1PBD A;  4JN9 A;  2JB3 A;  3UKP A;  4IA5 A;  4OPI A;  2JK6 A;  1Y56 B;  1E39 A;  3AXB A;  1JRY A;  4G6H A;  2B9W A;  3DK8 A;  3EAO A;  4M52 A;  1M64 A;  1AOG A;  3P4P A;  4BV6 A;  2XDO A;  2E82 A;  2XCG A;  3ATR A;  4EM4 A;  1IUX A;  2XVI A;  1GET A;  5EBK A;  4CNK A;  4Z44 A;  2WOW A;  1OJT A;  2BAB A;  4G6G A;  2GV8 A;  1TDK A;  3SM8 A;  1ZX9 A;  2GVC A;  4OPC A;  1F6M A;  3NRN A;  4C77 A;  1PJ6 A;  3P4R A;  2C66 A;  4GAP A;  3NK1 X;  2ZZC A;  1H7W A;  3AEB A;  2BS3 A;  3GMB A;  2VVL G;  3AYL A;  3BI5 A;  3UP5 A;  4B66 A;  1NAA A;  2YAU A;  4C3Y A;  1TDN A;  2YG5 A;  4TM0 A;  4H50 A;  1PBF A;  2YM2 A;  5KNL A;  3QSE A;  1H6V A;  2Q6U A;  2WPE A;  3UOV A;  2WPF A;  1C0L A;  3ALJ A;  1GRT A;  1RSG A;  1H81 A;  3VR8 A;  1K0J A;  1O95 A;  3Q9T A;  3SQP A;  2XLR A;  3AEC A;  2V3B A;  4YJH B;  1H7X A;  3AE3 A;  5HXI A;  2WPC A;  3D1C A;  4EIQ A;  4J57 A;  1YQ3 A;  2ARD A;  2AAQ A;  2GRT A;  2VVM A;  1DAO A;  2YVJ A;  3B3R A;  4NNJ A;  1PXA A;  5U63 A;  2C4C A;  2X8G A;  5BUK A;  4BJY A;  2VQB A;  1FCD A;  2C70 A;  3KLJ A;  2R46 A;  1S3B A;  2GR1 A;  2OAM A;  3VRD B;  4ZN0 A;  1EL7 A;  3QSS A;  4REK A;  1XPQ A;  1GES A;  4B63 A;  1PBC A;  3NT6 A;  3PO7 A;  3RP6 A;  3BHF A;  4H4W A;  2XLP A;  4U2S A;  2Y6R A;  1IUU A;  1LV0 A;  3NNE A;  3SZC A;  3LB8 A;  3CGD A;  1FEB A;  3AEA A;  4K5S A;  2VRM A;  3K7T A;  5JCK A;  3UTF A;  3K30 A;  2YLX A;  3ITJ A;  3WGT A;  3AE2 A;  1C0I A;  4TM4 A;  4U8L A;  4YJD A;  1ZK7 A;  4U8O A;  4ZCD A;  3LXD A;  4TLX A;  1UKV G;  4IV9 A;  1YY5 A;  3AYI A;  3ISH A;  1BKW A;  2GMH A;  1FEC A;  4CY8 A;  4EMW A;  3ZDN A;  5JCI A;  1YKJ A;  3E1T A;  1H82 A;  4H4P A;  2GR2 A;  2XVE A;  4P9S A;  1MO9 A;  1OJ9 A;  1CC6 A;  1N4V A;  3QJ4 A;  3M12 A;  1VG0 A;  2R4J A;  3CNP A;  4G74 A;  1GEU A;  4PAB A;  1TDO A;  1CL0 A;  3HZL A;  4A6N B;  1L9C A;  4Z43 A;  2WP9 A;  1TDE A;  1CJ4 A;  3SZ0 A;  3T0K A;  3W4I A;  2A87 A;  2GF3 A;  1F8S A;  2YLS A;  1DDO A;  3IHM A;  1LPF A;  1E6E A;  2B76 A;  1E1N A;  1D4D A;  4CBQ A;  2EQ6 A;  2QCU A;  1Q9I A;  1KDG A;  4Z24 A;  3SZF A;  3UCL A;  3COX A;  1RP0 A;  2VQ7 A;  5M0Z A;  4Y4L A;  4JDR A;  2ACZ A;  3GWD A;  2E49 A;  2EQ8 A;  3FPZ A;  1D7L A;  3AD7 B;  5L46 A;  1ZKQ A;  2ZBW A;  3H8I A;  1BF3 A;  4PAA A;  3DJJ A;  2FJD A;  3PVC A;  3QVP A;  4U8I A;  4QFC A;  1JU2 A;  2BK5 A;  2RGH A;  3AWI A;  1DOD A;  4YJF A;  2XYO A;  1CC4 A;  4GAV A;  2H89 A;  4QFD A;  2O9Z A;  1Y0P A;  3GRT A;  2A8X A;  5CQF A;  1MXT A;  1V59 A;  2JB1 A;  3HYX A;  2YLZ A;  3NG7 X;  5BRT A;  2TPR A;  1LTX R;  2YVG A;  2VVL A;  4K2X A;  3OZ2 A;  4U2T A;  3V3N A;  1H86 A;  1NEN A;  4X4J A;  4NWZ A;  1N4W A;  3LAD A;  4EQS A;  3UTG A;  5GRT A;  4ADW A;  4FK1 A;  1DOE A;  2BC0 A;  2YLT A;  2WS3 A;  3DK4 A;  1EL8 A;  3DJE A;  4J31 A;  1RYI A;  1PS9 A;  3D8X A;  4TM1 A;  3VRB A;  1GTE A;  4U8P A;  1EVI A;  1P2E A;  2V6O A;  3NH3 X;  5J60 A;  2R45 A;  2X99 A;  4H4X A;  3SZW A;  4H4Q A;  4E0V A;  1VE9 A;  3KPF A;  4GRT A;  2YG3 A;  1BZL A;  3AD8 B;  4GDE A;  2Z5Y A;  2Z5X A;  2C64 A;  3DME A;  1W4X A;  1NHQ A;  3C4N A;  2BS4 A;  3CTY A;  1HYU A;  2WOV A;  3UKL A;  3M0O A;  2WOI A;  2YM1 A;  3UOY A;  2UZZ A;  3NTA A;  3AEF A;  4D03 A;  2DKH A;  3UOZ A;  4RG4 A;  4H4Y A;  3GYJ A;  4A6N A;  4JQ9 A;  5TR3 A;  2I0Z A;  2E48 A;  1NEK A;  2WU5 A;  4YTM A;  4NTD A;  3FG2 P;  3ZNO A;  4H4Z A;  4OPG A;  3DGZ A;  1YQZ A;  2YR4 A;  4H2Q A;  3AD9 B;  1N4U A;  2C73 A;  4USQ A;  1GND A;  3NKS A;  4EQR A;  1GV4 A;  5J7X A;  1FEA A;  1CBO A;  2B7S A;  3KD9 A;  3KU9 A;  3QVR A;  1XDI A;  1B5Q A;  1PBB A;  3QSM A;  2BRA A;  3ZNN A;  1N1P A;  2QA2 A;  2YQU A;  1GRB A;  3CGB A;  3GYI A;  4H4V A;  1GRE A;  4GCM A;  3AE1 A;  3HYV A;  3GSI A;  3WE0 A;  2EQ7 A;  4UDQ A;  1EL5 A;  1DJQ A;  2BC1 A;  1S2Y A;  2CDU A;  1LJ1 A;  3CUK A;  1S3E A;  1ZMD A;  1LVL A;  2BS2 A;  1OJC A;  4II2 A;  4OPL A;  2H88 A;  1K0L A;  1EBD A;  3UTH A;  4A5L A;  1GPE A;  1VRQ B;  2R4E A;  3ABV A;  5M10 A;  3II4 A;  3CN8 A;  3GD4 A;  3CIR A;  2R9Z A;  4U8K A;  3F8P A;  4OPD A;  4B69 A;  5CKU A;  1DOB A;  4YJF B;  2TMD A;  4D04 A;  2YVF A;  3K7M X;  2XFQ A;  3NLC A;  1LQT A;  4OCG A;  2OLN A;  2ZZB A;  3ALM A;  3EPT A;  3EF6 A;  4BK3 A;  4USR A;  3SFE A;  1IUT A;  4CCQ A;  1NG3 A;  1MOK A;  2E4G A;  4CRT A;  2C72 A;  3AE9 A;  3AED A;  3S5W A;  2YLR A;  1JNZ A;  1ZDL A;  5KOX A;  2FJE A;  3P4S A;  3RNM A;  1GTH A;  4TLZ A;  3GD3 A;  3RHA A;  1O94 A;  3LJP A;  4NTE A;  1KIF A;  2R0G A;  4JNQ A;  1DXL A;  2WDR A;  5HHF A;  2WBA A;  4IVO B;  4J56 A;  3NYE A;  4AOS A;  1JRZ A;  4H7U A;  2C65 A;  1B4V A;  3R9U A;  2BCP A;  3GDP A;  3AEG A;  3G5R A;  3NIX A;  3O0H A;  1LQU A;  5GSN A;  3BI2 A;  2GEW A;  2YG7 A;  1IUS A;  1DNC A;  2X8C A;  1X31 B;  1QLB A;  4LU6 A;  2VZ2 A;  3H8L A;  1TYP A;  1DJN A;  1YQ4 A;  3VR9 A;  3GYX A;  3NN0 X;  2WHD A;  4APN A;  4U8J A;  4AP3 A;  1E1L A;  4OPT A; 
#chains in the Genus database with same CATH homology
 5KRQ A;  3SGL A;  5KMP A;  4K22 A;  2C3D A;  2GB0 A;  2V61 A;  2IVD A;  2YG4 A;  4B1B A;  3T14 A;  2PYX A;  4J2W A;  4H2R A;  1VQW A;  3SY4 A;  2BXR A;  3NGC X;  2XLS A;  5ER0 A;  3F8R A;  5KMQ A;  1CJC A;  1E1K A;  1GAL A;  3NK0 X;  2GMJ A;  5U25 A;  3NK2 X;  3URH A;  1D4E A;  4Y4N A;  3C4A A;  2WET A;  2YG6 A;  4J36 A;  4AOX A;  2B7R A;  3BHK A;  1KFY A;  4RSL A;  3IHG A;  4UDR A;  1CC2 A;  4H4R A;  2YR5 A;  4Z26 A;  2WDQ A;  3NHO X;  3P4Q A;  3NYC A;  1TRB A;  2BA9 A;  4X9N A;  3ZYX A;  3G5Q A;  3PS9 A;  2GAH B;  1VG9 A;  2JB2 A;  3AB1 A;  4U8M A;  4A9W A;  2FJB A;  2E1M A;  4A99 A;  4OPU A;  1GRH A;  3ICR A;  5IQ4 A;  1D7Y A;  2OA1 A;  1BGN A;  1Q1W A;  4WCT A;  2XVH A;  3NYF A;  3T2K A;  1KNP A;  2B9Y A;  3CPH G;  3T31 A;  5LV9 A;  3Q6J A;  3LZW A;  4YT0 A;  1XHC A;  2JAE A;  2CFY A;  4UDP A;  3DK9 A;  4O5U A;  1CJ2 A;  1Z6L A;  2XLT A;  4GDP A;  2R0C A;  2GH5 A;  4ICY A;  4CY6 A;  4AT2 A;  4XXG A;  2F5Z A;  1PBE A;  4XWR A;  3BNM A;  1PHH A;  2BYB A;  1EL9 A;  2XFO A;  2C67 A;  2C75 A;  4UP3 A;  4CNJ A;  5EB5 A;  1B8S A;  2X3N A;  4B67 A;  4OVI A;  4BK2 A;  1GRA A;  1NDA A;  2YWL A;  4Z25 A;  3CPI G;  4C5O A;  1GT8 A;  1E1M A;  2BCG G;  3DA1 A;  3GRS A;  2FJA A;  2RAB A;  1D5T A;  1GRG A;  1S2Q A;  1ZOV A;  1K0I A;  3CND A;  4A65 A;  4HA6 A;  4B68 A;  3SYI A;  1ELI A;  4YSH A;  3DJD A;  5EB4 A;  1NHP A;  4NEW A;  1KF6 A;  2Q0K A;  4Z2U A;  1VDC A;  3L8K A;  1PJ5 A;  2WES A;  4YTP A;  2WEU A;  3DGH A;  2Q0L A;  4GR1 A;  3IF9 A;  4U8N A;  3T2Z A;  1PXC A;  4H2P A;  3L1R A;  3CNT A;  2E5V A;  4BK1 A;  4LII A;  3FBS A;  4DNA A;  2WDV A;  1QO8 A;  4K5R A;  4KPR A;  1ONF A;  5DBJ A;  1XAN A;  4BUR A;  4FK1 C;  3K7Q X;  1KSS A;  2BXS A;  3LOV A;  3ATQ A;  4B65 A;  4DSG A;  5JCN A;  4A7A A;  1NHR A;  1GSN A;  3QFB A;  1P2H A;  1ZMC A;  4H4U A;  3RP7 A;  3HYW A;  1M6I A;  1SEZ A;  2BK4 A;  4K8D A;  1NPX A;  1COY A;  1TDF A;  3CNJ A;  1F8W A;  4K7Z A;  2Q7V A;  5KXJ A;  3P9U A;  5HYM A;  4NTC A;  5FS9 A;  1OJA A;  2RGO A;  4YSX A;  4JY3 A;  2PHH A;  2VOU A;  3CMM A;  4IVM B;  3AE8 A;  3AE4 A;  2XVJ A;  1JNR A;  2GR3 A;  5C2T A;  1L9E A;  2QAE A;  3UKQ A;  5KMR A;  1KSU A;  3CGE A;  4NZH A;  5JCL A;  4LA1 A;  5BVA A;  3GWF A;  2ZZ0 A;  1JRX A;  5IQ1 A;  1B37 A;  1L9D A;  1ZP0 A;  2JBV A;  3VRA A;  1L0V A;  1BWC A;  1H84 A;  4EIP A;  4RG3 A;  4H4S A;  4Z2R A;  1BGJ A;  2XLU A;  3S61 A;  1NHS A;  3G5S A;  2JKC A;  4GF7 A;  3RP8 A;  1TYT A;  2NVK X;  4EMJ A;  2CUL A;  2XFU A;  1Q1R A;  4C74 A;  1DOC A;  3AE7 A;  3M13 A;  2R0P A;  3I6D A;  3OC4 A;  3KKJ A;  1F8R A;  3EAN A;  3UOX A;  5KWF A;  2HQM A;  3T2Y A;  3GMC A;  3UKF A;  4H4T A;  4A79 A;  2AQJ A;  5BUL A;  3RED A;  5FS8 A;  4YXD A;  3T37 A;  4YTN A;  3LZX A;  1PDH A;  2C7G A;  4U2L A;  4X9M A;  1OJD A;  4EM3 A;  4FX9 A;  5U1O A;  4B64 A;  2GQW A;  4O5Q A;  4C3X A;  2B9X A;  2CVJ A;  2DKI A;  1JOA A;  4H2N A;  1Y56 A;  1KNR A;  1PJ7 A;  2Y6Q A;  3CNS A;  3KVE A;  4G73 A;  4G9K A;  3SX6 A;  3AE5 A;  3AYJ A;  2YLW A;  4DSH A;  2APG A;  2GAG B;  3H4K A;  4BJZ A;  3JSK A;  2YR6 A;  3GDN A;  3V3O A;  2W0H A;  2XVF A;  4AT0 A;  3ICS A;  3I3L A;  3KA7 A;  1QJD A;  2J3N A;  3VQR A;  2XFP A;  3CPJ G;  4YKF A;  2BAC A;  5HY5 A;  1PXB A;  1GRF A;  4EMI A;  3QFA A;  2BK3 A;  3NTD A;  5KVI A;  2WP5 A;  4YSZ A;  3CGC A;  2OAL A;  3FMW A;  5FS7 A;  2OLO A;  1CF3 A;  5EOW A;  4Z2T A;  1CJ3 A;  4FDC B;  1ZOY A;  3ICT A;  3B6D A;  3DJG X;  2X50 A;  3IC9 A;  4HB9 A;  1IUW A;  2EQ9 A;  2VRL A;  2WQY A;  3UKH A;  5IPY A;  3NN6 X;  3AEE A;  4I58 A;  3AE6 A;  4TM3 A;  2A89 A;  1H83 A;  2C3C A;  3ALL A;  3FIM B;  2WU2 A;  1GOS A;  1PN0 A;  3KPK A;  4MJW A;  4EQX A;  4IA6 A;  4ZCC A;  5KOW A;  1FOH A;  2V60 A;  3UTE A;  4NEV A;  2V5Z A;  3UKA A;  2XFN A;  5C3J A;  2GQF A;  4XWZ A;  4WX1 A;  4II3 A;  5KVH A;  1ZY8 A;  1GER A;  3F8D A;  4J34 A;  4KX6 A;  2AR8 A;  4JY2 A;  4N9X A;  1F3P A;  2QA1 A;  5FMH A;  4ECH A;  4GUV A;  3BI4 A;  2NPX A;  4DGK A;  3BNU A;  2BRY A;  5KMS A;  4JNA A;  1E7P A;  4EQW A;  3DH9 A;  2FBW A;  1NG4 A;  5FS6 A;  3SXI A;  3IWA A;  1JEH A;  1FL2 A;  1D4C A;  4Y4M A;  2C76 A;  3SFD A;  4CCR A;  1REO A;  1GXF A;  4J33 A;  2V3A A;  5JCM A;  3V76 A;  3P1W A;  2RGJ A;  1CHU A;  2IID A;  4I59 A;  4YKG A;  2X8H A;  3UKK A;  3UP4 A;  2GR0 A;  2IVE A;  3ADA B;  1IUV A;  4YWO A;  1IJH A;  3C96 A;  1O5W A;  1K4Q A;  4YSY A;  4AP1 A;  2WP6 A;  1PBD A;  4JN9 A;  2JB3 A;  3UKP A;  4IA5 A;  4OPI A;  2JK6 A;  1Y56 B;  1E39 A;  1JRY A;  3AXB A;  4G6H A;  2B9W A;  3DK8 A;  3EAO A;  4M52 A;  1M64 A;  1AOG A;  3P4P A;  4BV6 A;  2XDO A;  2XCG A;  3ATR A;  4EM4 A;  1IUX A;  2XVI A;  1GET A;  5EBK A;  4CNK A;  4Z44 A;  2WOW A;  1OJT A;  2BAB A;  4G6G A;  2GV8 A;  1TDK A;  3SM8 A;  1ZX9 A;  2GVC A;  4OPC A;  1F6M A;  3NRN A;  4C77 A;  1PJ6 A;  3P4R A;  2C66 A;  4GAP A;  3NK1 X;  2ZZC A;  1H7W A;  3AEB A;  2BS3 A;  3GMB A;  2VVL G;  3AYL A;  3BI5 A;  3UP5 A;  4B66 A;  1NAA A;  2YAU A;  4C3Y A;  1TDN A;  2YG5 A;  4TM0 A;  4H50 A;  1PBF A;  2YM2 A;  5KNL A;  3QSE A;  1H6V A;  2Q6U A;  2WPE A;  3UOV A;  2WPF A;  3ALJ A;  1GRT A;  1RSG A;  1H81 A;  3VR8 A;  1K0J A;  1O95 A;  3Q9T A;  3SQP A;  2XLR A;  3AEC A;  2V3B A;  3AE3 A;  1H7X A;  5HXI A;  2WPC A;  3D1C A;  4EIQ A;  4J57 A;  1YQ3 A;  2ARD A;  2AAQ A;  2GRT A;  2VVM A;  2YVJ A;  3B3R A;  4NNJ A;  1PXA A;  5U63 A;  2C4C A;  2X8G A;  5BUK A;  4BJY A;  2VQB A;  1FCD A;  2C70 A;  3KLJ A;  1S3B A;  2GR1 A;  2R46 A;  2OAM A;  3VRD B;  4ZN0 A;  1EL7 A;  3QSS A;  4REK A;  1XPQ A;  1GES A;  4B63 A;  1PBC A;  3NT6 A;  3PO7 A;  3RP6 A;  3BHF A;  4H4W A;  2XLP A;  4U2S A;  2Y6R A;  1IUU A;  1LV0 A;  3NNE A;  3SZC A;  3LB8 A;  3CGD A;  1FEB A;  3AEA A;  4K5S A;  2VRM A;  3K7T A;  5JCK A;  3UTF A;  3K30 A;  2YLX A;  3ITJ A;  3AE2 A;  4TM4 A;  4U8L A;  4U8O A;  1ZK7 A;  4ZCD A;  3LXD A;  4TLX A;  1UKV G;  4IV9 A;  1YY5 A;  3AYI A;  3ISH A;  2GMH A;  1BKW A;  1FEC A;  4CY8 A;  4EMW A;  3ZDN A;  5JCI A;  1YKJ A;  3E1T A;  1H82 A;  4H4P A;  2GR2 A;  2XVE A;  1MO9 A;  4P9S A;  1OJ9 A;  1CC6 A;  1N4V A;  3QJ4 A;  3M12 A;  1VG0 A;  2R4J A;  3CNP A;  4G74 A;  1GEU A;  4PAB A;  1TDO A;  1CL0 A;  3HZL A;  4A6N B;  1L9C A;  4Z43 A;  2WP9 A;  1TDE A;  1CJ4 A;  3SZ0 A;  3T0K A;  2A87 A;  2GF3 A;  1F8S A;  2YLS A;  3IHM A;  1LPF A;  1E6E A;  2B76 A;  1E1N A;  1D4D A;  4CBQ A;  2EQ6 A;  1Q9I A;  2QCU A;  1KDG A;  4Z24 A;  3SZF A;  3UCL A;  3COX A;  1RP0 A;  2VQ7 A;  5M0Z A;  4Y4L A;  4JDR A;  2ACZ A;  3GWD A;  2EQ8 A;  3FPZ A;  1D7L A;  3AD7 B;  5L46 A;  1ZKQ A;  2ZBW A;  3H8I A;  1BF3 A;  3QVP A;  3DJJ A;  2FJD A;  3PVC A;  4PAA A;  4U8I A;  1JU2 A;  2BK5 A;  2RGH A;  2XYO A;  1DOD A;  3AWI A;  1CC4 A;  4GAV A;  2H89 A;  2O9Z A;  1Y0P A;  3GRT A;  2A8X A;  5CQF A;  1MXT A;  1V59 A;  2JB1 A;  3HYX A;  2YLZ A;  3NG7 X;  5BRT A;  2TPR A;  1LTX R;  2YVG A;  2VVL A;  4K2X A;  3OZ2 A;  4U2T A;  3V3N A;  1H86 A;  1NEN A;  4X4J A;  4NWZ A;  1N4W A;  3LAD A;  4EQS A;  3UTG A;  5GRT A;  4ADW A;  4FK1 A;  1DOE A;  2BC0 A;  2YLT A;  2WS3 A;  3DK4 A;  1EL8 A;  3DJE A;  4J31 A;  1RYI A;  1PS9 A;  3D8X A;  4TM1 A;  3VRB A;  1GTE A;  4U8P A;  1P2E A;  2V6O A;  3NH3 X;  5J60 A;  2R45 A;  2X99 A;  4H4X A;  3SZW A;  4H4Q A;  4E0V A;  3KPF A;  4GRT A;  2YG3 A;  1BZL A;  3AD8 B;  4GDE A;  2Z5Y A;  2Z5X A;  2C64 A;  1W4X A;  3DME A;  1NHQ A;  2BS4 A;  3C4N A;  3CTY A;  1HYU A;  2WOV A;  3UKL A;  2WOI A;  2YM1 A;  3M0O A;  3UOY A;  2UZZ A;  3NTA A;  3AEF A;  4D03 A;  2DKH A;  3UOZ A;  4RG4 A;  4H4Y A;  3GYJ A;  4A6N A;  4JQ9 A;  5TR3 A;  2I0Z A;  4YTM A;  1NEK A;  2WU5 A;  4NTD A;  3FG2 P;  4H4Z A;  4OPG A;  3DGZ A;  1YQZ A;  2YR4 A;  4H2Q A;  1N4U A;  2C73 A;  3AD9 B;  4USQ A;  1GND A;  3NKS A;  4EQR A;  1GV4 A;  5J7X A;  1FEA A;  1CBO A;  2B7S A;  3KD9 A;  3KU9 A;  3QVR A;  1XDI A;  1B5Q A;  1PBB A;  2BRA A;  2QA2 A;  1N1P A;  2YQU A;  3CGB A;  3QSM A;  1GRB A;  3GYI A;  4H4V A;  1GRE A;  4GCM A;  3AE1 A;  3HYV A;  3GSI A;  3WE0 A;  2EQ7 A;  4UDQ A;  1DJQ A;  1EL5 A;  2BC1 A;  1S2Y A;  2CDU A;  1LJ1 A;  1S3E A;  4II2 A;  1ZMD A;  1LVL A;  2BS2 A;  1OJC A;  4OPL A;  2H88 A;  1K0L A;  1EBD A;  3UTH A;  4A5L A;  1GPE A;  1VRQ B;  2R4E A;  3ABV A;  5M10 A;  3II4 A;  3CN8 A;  3GD4 A;  3CIR A;  2R9Z A;  4U8K A;  3F8P A;  4OPD A;  4B69 A;  5CKU A;  1DOB A;  2TMD A;  4D04 A;  2YVF A;  3K7M X;  2XFQ A;  3NLC A;  1LQT A;  4OCG A;  2OLN A;  2ZZB A;  3ALM A;  3EPT A;  3EF6 A;  4BK3 A;  4USR A;  3SFE A;  1IUT A;  4CCQ A;  1NG3 A;  1MOK A;  2E4G A;  4CRT A;  2C72 A;  3AE9 A;  3AED A;  3S5W A;  2YLR A;  1JNZ A;  1ZDL A;  5KOX A;  2FJE A;  3P4S A;  3RNM A;  1GTH A;  4TLZ A;  3GD3 A;  3RHA A;  1O94 A;  3LJP A;  4NTE A;  2R0G A;  4JNQ A;  1DXL A;  2WDR A;  5HHF A;  2WBA A;  4IVO B;  4J56 A;  3NYE A;  4AOS A;  1JRZ A;  4H7U A;  2C65 A;  1B4V A;  3R9U A;  2BCP A;  3GDP A;  3AEG A;  3G5R A;  3NIX A;  3O0H A;  1LQU A;  5GSN A;  3BI2 A;  2GEW A;  2YG7 A;  1IUS A;  1DNC A;  2X8C A;  1X31 B;  1QLB A;  4LU6 A;  2VZ2 A;  3H8L A;  1TYP A;  1DJN A;  1YQ4 A;  3VR9 A;  3GYX A;  3NN0 X;  2WHD A;  4APN A;  4U8J A;  4AP3 A;  1E1L A;  4OPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...