2VOUA

Structure of 2,6-dihydroxypyridine-3-hydroxylase from arthrobacter nicotinovorans
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
393
structure length
393
Chain Sequence
SPTTDRIAVVGGSISGLTAALMLRDAGVDVDVYERSPQPLSGFGTGIVVQPELVHYLLEQGVELDSISVPSSSMEYVDALTGERVGSVPADWRFTSYDSIYGGLYELFGPERYHTSKCLVGLSQDSETVQMRFSDGTKAEANWVIGADGGASVVRKRLLGIEPTYAGYVTWRGVLQPGEVADDVWNYFNDKFTYGLLDDGHLIAYPIPGRENAESPRLNFQWYWNVAEGPDLDELMTDVRGIRLPTSVHNNSLNPHNLRQFHSKGESLFKPFRDLVLNASSPFVTVVADATVDRMVHGRVLLIGDAAVTPRPHAAAGGAKASDDARTLAEVFTKNHDLRGSLQSWETRQLQQGHAYLNKVKKMASRLQHGGSFEPGNPAFAFGLPKVDEPSVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of 2,6-Dihydroxypyridine 3-Hydroxylase from a Nicotine-Degrading Pathway.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 2,6-DIHYDROXYPYRIDINE HYDROXYLASE
total genus 128
structure length 393
sequence length 393
chains with identical sequence B, C
ec nomenclature ec 1.14.13.10: 2,6-dihydroxypyridine 3-monooxygenase.
pdb deposition date 2008-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.60 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 2vouA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2vouA01
3H8IA 1H86A 2YVGA 2WU2A 3NLCA 4OPIA 1B4VA 3II4A 4Y4MA 1O5WA 4P9SA 1GRHA 3GWDA 4H4RA 3AB1A 1D7YA 4O5UA 1Q9IA 2XDOA 1NG4A 1S2QA 4C3XA 1PN0A 4OCGA 1RSGA 2B7SA 2FJBA 3CNPA 2APGA 2CULA 4JY2A 4N9XA 2ZZ0A 2V3AA 5KVHA 5FS9A 3DJDA 2V61A 3Q6JA 4APNA 4X9NA 4BURA 5HYMA 2XFOA 2XVEA 1KF6A 4UP3A 4J2WA 3CNDA 3D1CA 4B69A 3GMCA 2B9WA 3LB8A 1VG9A 4B63A 1CJCA 2ACZA 1B37A 1DODA 2XLTA 3KD9A 1XANA 3P4SA 3DGHA 2A87A 1PJ5A 4REKA 4BJZA 4EIPA 2ZBWA 3EANA 3NYCA 5IQ1A 5KWFA 1QO8A 5CQFA 3AYJA 2WDQA 2BCGG 3EPTA 5CKUA 3SM8A 3RP8A 4ZN0A 2EQ8A 4YTNA 1EL8A 3UKLA 4H4SA 4CY6A 4J33A 2GR3A 4H4TA 2XFPA 5JCIA 4AT0A 2WOWA 1KNPA 3ALJA 3DJEA 4GCMA 2C65A 3GRSA 4FK1C 3BNUA 2A89A 2JK6A 2WP5A 4B66A 1ZOYA 3P4QA 2BA9A 2BCPA 3QFAA 1DJNA 5DBJA 5KOXA 4C74A 2X99A 3FPZA 1KNRA 5HY5A 2GAHB 4AOXA 3CPIG 4H4UA 3IF9A 1GT8A 2R0PA 2WOIA 4H4WA 1GTHA 2XLRA 5BUKA 4YSZA 3CNJA 1PBBA 4UDRA 1JU2A 3ICRA 4U8IA 2XLPA 4YKFA 1FCDA 2GR2A 2YQUA 2YG4A 4UDPA 4RG3A 1TYPA 3ADAB 1YQ3A 2E5VA 5J7XA 4U2TA 4A6NA 3F8RA 1IUSA 3LZXA 4U8JA 5KVIA 1CF3A 1PBCA 4J36A 2IVDA 2WEUA 4BJYA 1VDCA 4FK1A 2UZZA 4O5QA 3NK0X 3BHKA 5HXIA 3NNEA 2BC0A 1TDOA 1Y0PA 2EQ6A 4ZCCA 5BULA 1FEBA 4J34A 3NN0X 4GDEA 4JNAA 3KU9A 3AXBA 3GRTA 4U8MA 4TLZA 1P2EA 1PBFA 2VRLA 4YWOA 3QVRA 1HYUA 2FJEA 2GQWA 3KLJA 3UOYA 3G5SA 3IHMA 1F3PA 1LQUA 2WU5A 2QAEA 3QFBA 1MO9A 3CPHG 3QSSA 2X50A 2JB1A 4C77A 2RGOA 1GETA 2X8GA 2BS3A 1IUVA 4JNQA 3EAOA 5LV9A 4B65A 1ZMDA 2IVEA 4JDRA 4U8PA 4CNKA 1BF3A 3UOZA 3UTEA 4RG4A 3GDPA 4D03A 1OJTA 1Z6LA 2EQ9A 4BK2A 4EQRA 1BKWA 1L9CA 1E1MA 4FDCB 1PXBA 2Y6RA 4ICYA 3CPJG 5BRTA 2VVLA 4TM0A 3CNTA 3UOVA 4YSXA 1BZLA 4BK3A 5C2TA 1F8RA 4Z25A 1LJ1A 2NVKX 2XFUA 1JRZA 3UTHA 4TM1A 3ITJA 4NEVA 3V3NA 3AEEA 1NEKA 1D5TA 3GD4A 2RGHA 1FECA 2YLWA 3AECA 3LXDA 2ZZBA 4OPGA 2BS4A 1DOCA 3ATRA 1NHQA 3K7QX 1L9DA 2Q7VA 2R0GA 2YLRA 1E1LA 2C67A 1IUUA 4A9WA 1LQTA 4GRTA 4H4YA 3IWAA 1CJ4A 1YKJA 3ZDNA 5EBKA 3OC4A 1BGJA 3AE1A 3M13A 2RABA 1JEHA 3ALMA 4HB9A 1O94A 1LPFA 3P4PA 1KDGA 1VRQB 1PBDA 3CGBA 1IUTA 2GMHA 5C3JA 2VVMA 3AWIA 2WESA 1O95A 4LIIA 4EQWA 4Z2RA 1KSSA 2H89A 3GDNA 3C96A 2Z5YA 4ZCDA 4NEWA 3CTYA 2GMJA 2RGJA 4JN9A 2XVFA 3CIRA 3F8PA 1PDHA 4EMWA 3NG7X 3PO7A 2ZZCA 1E39A 4YTMA 3G5QA 1QLBA 4J31A 1BGNA 3DK8A 3FG2P 3CNSA 3QVPA 4IV9A 1PXAA 4K22A 3AD8B 3VRDB 5JCLA 2XYOA 3T37A 2WOVA 3K7TA 1B5QA 3DJJA 1D4DA 2Q6UA 1KFYA 3VRBA 5KXJA 2X8HA 3EF6A 3NTAA 3P4RA 4B67A 1X31B 2BS2A 2O9ZA 3AYIA 1NHRA 2GAGB 3Q9TA 4EMJA 3GMBA 3QJ4A 2JAEA 3BI2A 4AP3A 3URHA 3KKJA 1N1PA 1SEZA 1ZOVA 2GVCA 3F8DA 1RYIA 2VOUA 2YM1A 5U25A 2V5ZA 3AE7A 2PYXA 1VG0A 4D04A 1GV4A 3DK4A 1Q1RA 2QCUA 5GSNA 5U1OA 4B64A 1EL9A 1JRXA 1H83A 4NZHA 4AT2A 5EB4A 3AE6A 1ZP0A 1TDKA 3GYJA 2V3BA 4IA6A 3CGDA 1REOA 4RSLA 1CHUA 3UKAA 5L46A 2WDVA 3NN6X 4BK1A 2VQ7A 4YT0A 3O0HA 2OAMA 1K0IA 2CVJA 3S61A 5U63A 2VZ2A 3IC9A 3FMWA 2VQBA 1YY5A 3ICSA 4H4QA 2AQJA 1MOKA 1PBEA 3ISHA 3NYEA 4JY3A 2WP6A 3OZ2A 2Z5XA 2E4GA 4EQSA 2BYBA 4KPRA 1NHSA 3CGEA 2GQFA 1UKVG 3AEDA 3K7MX 4TM3A 3UTFA 2BK3A 3VRAA 3AE5A 2GEWA 2GR1A 3AE9A 1LV0A 2C72A 3NK1X 3REDA 4AOSA 2X3NA 3BI5A 3P1WA 4NTCA 4Z44A 1NPXA 2FJAA 1V59A 1LVLA 3NYFA 3QSMA 2NPXA 1CC4A 1ZMCA 4A99A 1N4VA 4U2SA 2Q0KA 4E0VA 1S3EA 3NRNA 2HQMA 1ZK7A 3K30A 2C73A 5EB5A 3PS9A 1D4EA 2DKIA 4TM4A 4CRTA 4K7ZA 2VVLG 2PHHA 2B7RA 2YAUA 1L0VA 3UTGA 2WPFA 4K2XA 4USRA 1FOHA 4C3YA 3LZWA 1GERA 2JKCA 4YSHA 4Y4LA 3LOVA 1GRGA 2EQ7A 2R46A 3E1TA 3G5RA 3DH9A 4EMIA 1MXTA 2BK5A 2BABA 1NDAA 1ZX9A 2XFQA 3AEFA 3DGZA 1F8WA 2BK4A 4K8DA 1H7WA 4H2QA 4Z2UA 4ECHA 2BC1A 3ALLA 3ICTA 2GRTA 2WPEA 2C7GA 1FL2A 2WDRA 1Y56A 2YG5A 4B68A 4EQXA 4H7UA 3ATQA 1NENA 1F8SA 2B9XA 1GRAA 4OPLA 4Z2TA 2C75A 2E1MA 1E7PA 3NTDA 3L1RA 4NTDA 1COYA 2IIDA 3SGLA 1GREA 1KSUA 4H4VA 3KA7A 2YLZA 3CGCA 4A65A 2X8CA 3DK9A 2CDUA 2Y6QA 4H2PA 2XLUA 4LU6A 2DKHA 2YG6A 4GUVA 4JQ9A 2YM2A 4H4ZA 1PJ6A 3NKSA 3UKQA 1GTEA 5FMHA 2R4JA 1CJ3A 2XFNA 2YVFA 5BVAA 2AR8A 3AEAA 4OVIA 1TYTA 2FBWA 1NHPA 1DJQA 4GDPA 1JRYA 3H8LA 2C64A 2GV8A 4Z43A 2XCGA 3SQPA 5FS6A 2GH5A 4U8KA 3WE0A 2GR0A 3C4NA 2R45A 2YG3A 4GR1A 1JNRA 4H4PA 4OPTA 1K0JA 2R4EA 1AOGA 3NK2X 3V3OA 2VRMA 4A6NB 1H82A 4WX1A 3UOXA 3M0OA 1D7LA 1B8SA 3AEBA 4MJWA 3VQRA 2WP9A 4U8NA 4IVOB 1EBDA 1FEAA 4YTPA 1E1NA 2V60A 4X4JA 1F6MA 1YQ4A 4X9MA 2OLNA 1ONFA 3HZLA 4YKGA 1BWCA 5IQ4A 5M10A 3C4AA 1K4QA 3GSIA 1EL7A 4OPUA 3BNMA 5IPYA 4Y4NA 1OJDA 1ELIA 2OLOA 3I3LA 3UCLA 4IVMB 1GSNA 1XPQA 2Q0LA 1TDNA 2BACA 4EIQA 1TDFA 1LTXR 5JCNA 2TPRA 3JSKA 2XVJA 4UDQA 1S2YA 4WCTA 1CL0A 2H88A 3DA1A 2J3NA 1JNZA 2YLXA 5FS7A 2BXSA 1RP0A 4I59A 3NT6A 1OJAA 4TLXA 3NH3X 3V76A 2WS3A 4ADWA 2W0HA 3KPFA 2BXRA 3LADA 4U8LA 1M64A 1GRTA 4CBQA 3H4KA 3P9UA 3AD9B 1ZDLA 1GEUA 1IUXA 4U2LA 4PABA 3SFDA 3SFEA 1PS9A 3COXA 2CFYA 1TRBA 4H50A 2WPCA 4Z26A 1S3BA 2OA1A 1CJ2A 5TR3A 4Z24A 1TDEA 2YVJA 4A7AA 2YLSA 2R0CA 2TMDA 4J57A 4DNAA 1DOBA 1PJ7A 4XWRA 4C5OA 2WBAA 2FJDA 1GALA 1GRFA 3KVEA 3AE8A 2ARDA 3DJGX 3UKHA 3VR8A 5ER0A 5JCMA 1CBOA 3R9UA 4EM3A 1IUWA 2WHDA 3CN8A 1NAAA 1P2HA 1E1KA 2XLSA 3AD7B 4I58A 3RP6A 3RP7A 1IJHA 1Q1WA 3AE4A 3UKPA 1CC2A 1NG3A 1Y56B 3LJPA 3UKKA 3NIXA 4CCRA 2V6OA 4IA5A 1DNCA 1GNDA 3NHOX 4B1BA 1E6EA 2B9YA 4DSHA 2WETA 1N4WA 3AE2A 2R9ZA 2YG7A 3B6DA 4H4XA 1XDIA 1M6IA 3GD3A 4LA1A 3UKFA 3VR9A 2JBVA 3ABVA 1GOSA 4CNJA 4H2RA 2YR5A 3NGCX 3I6DA 5GRTA 1H81A 1H6VA 1ZY8A 3D8XA 4FX9A 3S5WA 2QA2A 1OJCA 4DGKA 2QA1A 3AYLA 3BI4A 3ZYXA 2A8XA 3PVCA 1ZKQA 4PAAA 3B3RA 1EL5A 2XVHA 4A5LA 4A79A 2C3DA 2JB2A 1XHCA 3AEGA 3QSEA 1K0LA 1GESA 4AP1A 1VQWA 4BV6A 4CY8A 2C76A 4U8OA 1GXFA 4H2NA 1PXCA 4OPCA 1W4XA 3DMEA 5KRQA 5KOWA 4OPDA 4XWZA 5JCKA 2JB3A 2YR6A 2C70A 3FBSA 2OALA 4EM4A 4CCQA 1CC6A 2YR4A 2C66A 3UP4A 3BHFA 1H84A 1QJDA 1YQZA 4YSYA 2XVIA 3UP5A 1DOEA 1JOAA 4DSGA 1GRBA 3IHGA 4J56A 1GPEA 1OJ9A 3M12A 3L8KA 5HHFA 3RNMA 1PHHA 3GYIA 4GF7A 5M0ZA 2GF3A 5FS8A 4YXDA 1L9EA 2C3CA 2I0ZA 2B76A 2YWLA 3FIMB 2F5ZA 1H7XA 3GWFA 4HA6A 4K5SA 4M52A 4NTEA 4XXGA 5EOWA 4USQA 3AE3A 2WQYA 2GB0A 1DXLA 2YLTA 4K5RA 1D4CA 4KX6A 3RHAA 5J60A 1N4UA 2AAQA
chains in the Genus database with same CATH superfamily
3H8IA 1H86A 2YVGA 2WU2A 3NLCA 4OPIA 1B4VA 3II4A 4Y4MA 4P9SA 1O5WA 1GRHA 3GWDA 4H4RA 3AB1A 1D7YA 3HYWA 4O5UA 1Q9IA 2XDOA 1NG4A 1S2QA 4C3XA 1PN0A 4OCGA 1RSGA 2B7SA 2FJBA 3CNPA 2APGA 2CULA 4JY2A 4N9XA 2ZZ0A 2V3AA 5KVHA 5FS9A 3DJDA 2V61A 3Q6JA 4APNA 4X9NA 5HYMA 4BURA 2XFOA 2XVEA 1KF6A 4UP3A 4J2WA 3CNDA 3D1CA 3HYVA 4B69A 3GMCA 2B9WA 3LB8A 1VG9A 4B63A 1CJCA 2ACZA 1B37A 1DODA 2XLTA 3KD9A 1XANA 3P4SA 4BJZA 2A87A 1PJ5A 4EIPA 3DGHA 4REKA 3T14A 3NYCA 2ZBWA 3EANA 5IQ1A 5KWFA 1QO8A 5CQFA 3EPTA 3SM8A 2BCGG 2WDQA 3AYJA 4GAVA 5CKUA 3RP8A 4ZN0A 2EQ8A 4YTNA 1EL8A 3UKLA 1KIFA 4H4SA 4CY6A 4J33A 2GR3A 4H4TA 2XFPA 5JCIA 4AT0A 2WOWA 1KNPA 3ALJA 3DJEA 4GCMA 2C65A 3GRSA 4FK1C 3BNUA 2A89A 2JK6A 2WP5A 4B66A 1ZOYA 3P4QA 2BA9A 2BCPA 3QFAA 1DJNA 5DBJA 5KOXA 4C74A 2X99A 3FPZA 1KNRA 5HY5A 2GAHB 4AOXA 3CPIG 4H4UA 3IF9A 2R0PA 1GT8A 2WOIA 4H4WA 1GTHA 2XLRA 5BUKA 4YSZA 3CNJA 1PBBA 4UDRA 1JU2A 3ICRA 4U8IA 2XLPA 4YKFA 1FCDA 1C0KA 2GR2A 2YG4A 2YQUA 4UDPA 4RG3A 3ADAB 1TYPA 1YQ3A 2E5VA 4QFDA 5J7XA 4U2TA 4A6NA 3F8RA 1IUSA 3LZXA 4U8JA 5KVIA 1CF3A 4II3A 1PBCA 4J36A 2IVDA 2WEUA 4BJYA 1VDCA 4FK1A 2UZZA 4O5QA 3NK0X 3BHKA 5HXIA 3NNEA 2BC0A 1TDOA 1Y0PA 2EQ6A 4ZCCA 5BULA 1FEBA 4J34A 3NN0X 4GDEA 4JNAA 3KU9A 3AXBA 3GRTA 4U8MA 4TLZA 1P2EA 1PBFA 2VRLA 4YWOA 4NNJA 3QVRA 1HYUA 2FJEA 2GQWA 3KLJA 4G74A 3UOYA 3G5SA 3IHMA 1F3PA 1LQUA 2WU5A 2QAEA 3QFBA 1MO9A 3CPHG 3QSSA 2X50A 2BRYA 2JB1A 4C77A 2RGOA 1GETA 2X8GA 2BS3A 1IUVA 4JNQA 3EAOA 5LV9A 4B65A 1ZMDA 2IVEA 4JDRA 4U8PA 4CNKA 1BF3A 3UOZA 3UTEA 4RG4A 3GDPA 4D03A 1OJTA 1Z6LA 4BK2A 2EQ9A 4EQRA 1BKWA 1L9CA 1E1MA 3ZNNA 1PXBA 2Y6RA 4FDCB 4ICYA 3CPJG 5BRTA 2VVLA 3W4KA 4TM0A 3CNTA 3UOVA 4YSXA 4BK3A 1BZLA 3GYXA 5C2TA 1F8RA 4Z25A 1LJ1A 2NVKX 2XFUA 1JRZA 3UTHA 4TM1A 3ITJA 4NEVA 4NWZA 3V3NA 3AEEA 1NEKA 1D5TA 3GD4A 2RGHA 1FECA 2YLWA 3AECA 3LXDA 4AP1A 2ZZBA 4OPGA 2BS4A 1DOCA 3ATRA 1NHQA 3K7QX 1L9DA 2Q7VA 3T31A 2R0GA 2YLRA 1E1LA 2E49A 2C67A 1IUUA 4A9WA 1LQTA 4GRTA 4H4YA 3IWAA 1CJ4A 1YKJA 3ZDNA 3CMMA 5EBKA 2BRAA 1BGJA 3OC4A 3AE1A 3M13A 4GAPA 2RABA 1JEHA 1C0IA 3ALMA 4HB9A 1O94A 1LPFA 3P4PA 1VRQB 1KDGA 1PBDA 3CGBA 1IUTA 2GMHA 5C3JA 2VVMA 3AWIA 2WESA 3KPKA 1O95A 4LIIA 4EQWA 4Z2RA 1KSSA 4QFCA 2H89A 3GDNA 3C96A 2Z5YA 4ZCDA 4NEWA 3SZCA 2DU8A 3CTYA 2GMJA 2RGJA 4JN9A 2XVFA 3CIRA 3F8PA 1PDHA 4EMWA 3NG7X 3PO7A 2ZZCA 1E39A 4YTMA 3G5QA 1QLBA 4J31A 1BGNA 3DK8A 3FG2P 3CNSA 3QVPA 4IV9A 1PXAA 4K22A 3AD8B 3VRDB 5JCLA 2XYOA 3T37A 2WOVA 3K7TA 1B5QA 3DJJA 2Q6UA 3ZNPA 1D4DA 1KFYA 3VRBA 2X8HA 3EF6A 3NTAA 5KXJA 5KMSA 3P4RA 4B67A 1X31B 2BS2A 2O9ZA 3AYIA 1NHRA 2GAGB 3Q9TA 4G73A 3GMBA 4EMJA 3QJ4A 2JAEA 3BI2A 4AP3A 1DDOA 3URHA 3KKJA 1N1PA 1SEZA 1ZOVA 2GVCA 3F8DA 1RYIA 2VOUA 2YM1A 5U25A 3HYXA 2V5ZA 3AE7A 2PYXA 1VG0A 4D04A 1GV4A 3DK4A 1Q1RA 2QCUA 5GSNA 5U1OA 4II2A 4B64A 1EL9A 1JRXA 1H83A 4NZHA 4AT2A 5EB4A 3AE6A 1ZP0A 1TDKA 3GYJA 5KMRA 4IA6A 2V3BA 4RSLA 1REOA 3CGDA 1CHUA 1AN9A 5L46A 3UKAA 2WDVA 3NN6X 4BK1A 2VQ7A 4YT0A 3O0HA 2OAMA 3ZNOA 1K0IA 2CVJA 3S61A 5U63A 2VZ2A 3IC9A 3FMWA 2VQBA 1YY5A 3ICSA 4H4QA 2AQJA 1MOKA 1PBEA 3NYEA 4JY3A 3ISHA 3OZ2A 2WP6A 2Z5XA 2E4GA 4EQSA 2BYBA 4YJHB 4KPRA 1NHSA 3CGEA 2GQFA 1UKVG 3AEDA 3K7MX 4TM3A 3UTFA 4YJDA 2BK3A 3VRAA 3AE5A 2GEWA 2GR1A 3AE9A 1LV0A 2C72A 3NK1X 3REDA 4AOSA 2X3NA 3SY4A 3T2ZA 3BI5A 3P1WA 4NTCA 4Z44A 1NPXA 2FJAA 1V59A 3NYFA 1LVLA 3QSMA 2NPXA 1CC4A 1ZMCA 4A99A 1N4VA 4U2SA 2Q0KA 4E0VA 1S3EA 3NRNA 2HQMA 1ZK7A 3K30A 2C73A 5EB5A 3PS9A 4YJFA 1D4EA 2DKIA 4TM4A 5KMPA 4CRTA 4K7ZA 2VVLG 2PHHA 2B7RA 2YAUA 1L0VA 3UTGA 2WPFA 1EVIA 4K2XA 3SX6A 4USRA 1FOHA 4C3YA 3LZWA 1GERA 2JKCA 4YSHA 4Y4LA 3SXIA 3LOVA 1GRGA 2EQ7A 2R46A 3E1TA 3G5RA 3DH9A 4EMIA 1MXTA 1NDAA 2BABA 2BK5A 1ZX9A 2XFQA 3AEFA 3DGZA 1F8WA 2BK4A 4K8DA 4H2QA 1H7WA 4Z2UA 4ECHA 2BC1A 3ALLA 3ICTA 2GRTA 2WPEA 2C7GA 1FL2A 2WDRA 1Y56A 2YG5A 4B68A 4EQXA 4H7UA 3ATQA 1NENA 1F8SA 2B9XA 4G9KA 1GRAA 4OPLA 4Z2TA 2C75A 2E1MA 1E7PA 3NTDA 3L1RA 4NTDA 1COYA 3T2KA 2IIDA 3SGLA 4YJGB 1GREA 1KSUA 4H4VA 3KA7A 2YLZA 3CGCA 4A65A 1DAOA 2X8CA 3DK9A 4H2PA 2CDUA 2Y6QA 2XLUA 4LU6A 2DKHA 2YG6A 4GUVA 4JQ9A 2YM2A 4H4ZA 1PJ6A 3NKSA 3UKQA 1GTEA 5FMHA 2R4JA 1CJ3A 2XFNA 2YVFA 5BVAA 2AR8A 3AEAA 4OVIA 1TYTA 2FBWA 5KNLA 1NHPA 1DJQA 4GDPA 1JRYA 3H8LA 2C64A 2GV8A 4G6HA 4Z43A 2XCGA 3SQPA 5FS6A 2GH5A 4U8KA 3WE0A 3CUKA 2GR0A 3C4NA 2R45A 2YG3A 4GR1A 1JNRA 4H4PA 4OPTA 1K0JA 2R4EA 1AOGA 3NK2X 3V3OA 2VRMA 4A6NB 1C0LA 1H82A 4WX1A 3UOXA 3M0OA 1D7LA 1B8SA 3AEBA 4MJWA 3VQRA 2WP9A 4U8NA 4IVOB 1EBDA 1FEAA 4YTPA 1E1NA 2V60A 4X4JA 1F6MA 1YQ4A 4X9MA 2OLNA 1ONFA 3HZLA 4YKGA 1BWCA 5IQ4A 2E48A 3C4AA 4YJHA 5M10A 1K4QA 3GSIA 1EL7A 4OPUA 3BNMA 5IPYA 4Y4NA 1OJDA 1ELIA 2OLOA 3I3LA 3UCLA 1C0PA 4IVMB 1GSNA 1XPQA 2Q0LA 1TDNA 2BACA 4EIQA 1TDFA 1LTXR 5JCNA 2TPRA 3JSKA 2XVJA 4UDQA 1S2YA 3WGTA 2E4AA 4WCTA 1CL0A 2H88A 3DA1A 2J3NA 1JNZA 2YLXA 5FS7A 2BXSA 1RP0A 4I59A 3NT6A 1OJAA 4TLXA 3NH3X 3V76A 2WS3A 4ADWA 2W0HA 4YJFB 3KPFA 2BXRA 3LADA 4U8LA 1M64A 1GRTA 4CBQA 3H4KA 3P9UA 3AD9B 1ZDLA 1GEUA 1IUXA 3ZNQA 4U2LA 4PABA 3SFDA 3SFEA 1PS9A 3COXA 2CFYA 1TRBA 4H50A 3SYIA 3W4IA 3T2YA 2WPCA 4Z26A 1S3BA 2OA1A 1CJ2A 5TR3A 4Z24A 1TDEA 2YVJA 4A7AA 1VE9A 2YLSA 3T0KA 2R0CA 2TMDA 4J57A 4DNAA 1DOBA 1PJ7A 4XWRA 4C5OA 2C4CA 2FJDA 2WBAA 1GALA 1GRFA 3KVEA 3AE8A 2ARDA 3DJGX 3UKHA 3VR8A 5ER0A 5JCMA 1CBOA 3R9UA 4EM3A 1IUWA 2WHDA 3CN8A 1NAAA 1P2HA 3RP7A 3AD7B 1E1KA 3RP6A 2XLSA 4I58A 1IJHA 1Q1WA 3AE4A 3UKPA 1NG3A 1Y56B 1CC2A 3LJPA 3UKKA 3G3EA 3NIXA 4CCRA 2V6OA 4IA5A 1DNCA 1GNDA 3W4JA 3NHOX 4B1BA 1E6EA 2E82A 2B9YA 4DSHA 2WETA 1N4WA 3AE2A 2R9ZA 2YG7A 3B6DA 4H4XA 1XDIA 1M6IA 3GD3A 4LA1A 3SZ0A 3UKFA 3VR9A 2JBVA 3ABVA 1GOSA 4CNJA 4H2RA 2YR5A 3NGCX 3I6DA 5GRTA 1H81A 1H6VA 1ZY8A 3D8XA 4FX9A 3S5WA 2QA2A 1OJCA 4DGKA 2QA1A 3AYLA 3BI4A 5KMQA 3ZYXA 2A8XA 3PVCA 1ZKQA 4PAAA 3B3RA 1EL5A 2XVHA 4A5LA 4A79A 2C3DA 2JB2A 1XHCA 3QSEA 3AEGA 1K0LA 1GESA 4G6GA 1VQWA 4BV6A 4CY8A 2C76A 4U8OA 4H2NA 1GXFA 1PXCA 4OPCA 1W4XA 3DMEA 5KRQA 5KOWA 4XWZA 4OPDA 5JCKA 2JB3A 2YR6A 2C70A 3FBSA 2OALA 4EM4A 4CCQA 1CC6A 2YR4A 2C66A 3UP4A 3BHFA 1H84A 1QJDA 1YQZA 4YSYA 3SZWA 2XVIA 3UP5A 1DOEA 1JOAA 4DSGA 1GRBA 3IHGA 4J56A 1GPEA 3M12A 1OJ9A 3L8KA 5HHFA 3RNMA 1PHHA 3GYIA 4GF7A 5M0ZA 2GF3A 5FS8A 4YXDA 1L9EA 2C3CA 2I0ZA 2B76A 2YWLA 3FIMB 2F5ZA 1H7XA 3GWFA 4HA6A 4K5SA 4M52A 4NTEA 4XXGA 5EOWA 3SZFA 4USQA 3AE3A 2WQYA 2GB0A 1DXLA 2YLTA 4K5RA 1D4CA 4KX6A 3RHAA 5J60A 4YJGA 1N4UA 2AAQA
chains in the Genus database with same CATH topology
3H8IA 1H86A 2YVGA 2WU2A 3NLCA 4OPIA 1B4VA 3II4A 4Y4MA 1O5WA 4P9SA 1GRHA 3GWDA 4H4RA 3AB1A 1D7YA 3HYWA 4O5UA 1Q9IA 2XDOA 1NG4A 1S2QA 4C3XA 1PN0A 4OCGA 1RSGA 2B7SA 2FJBA 3CNPA 2APGA 2CULA 4JY2A 4N9XA 2ZZ0A 2V3AA 5KVHA 5FS9A 3DJDA 2V61A 3Q6JA 4APNA 4X9NA 5HYMA 4BURA 2XFOA 2XVEA 1KF6A 4UP3A 4J2WA 3CNDA 3D1CA 3HYVA 4B69A 3GMCA 2B9WA 3LB8A 1VG9A 4B63A 1CJCA 2ACZA 1B37A 1DODA 2XLTA 3KD9A 1XANA 3P4SA 4BJZA 2A87A 1PJ5A 4EIPA 3DGHA 4REKA 3T14A 2ZBWA 3EANA 3NYCA 5IQ1A 5KWFA 1QO8A 5CQFA 3EPTA 2WDQA 2BCGG 3AYJA 5CKUA 4GAVA 3SM8A 3RP8A 4ZN0A 2EQ8A 4YTNA 1EL8A 3UKLA 4H4SA 4CY6A 4J33A 2GR3A 4H4TA 2XFPA 5JCIA 4AT0A 2WOWA 1KNPA 3ALJA 3DJEA 4GCMA 2C65A 3GRSA 4FK1C 3BNUA 2A89A 2JK6A 2WP5A 4B66A 1ZOYA 3P4QA 2BA9A 2BCPA 3QFAA 1DJNA 5DBJA 5KOXA 4C74A 2X99A 3FPZA 1KNRA 5HY5A 2GAHB 4AOXA 3CPIG 4H4UA 3IF9A 2R0PA 1GT8A 2WOIA 4H4WA 1GTHA 2XLRA 5BUKA 4YSZA 3CNJA 1PBBA 4UDRA 1JU2A 3ICRA 4U8IA 2XLPA 4YKFA 1FCDA 2GR2A 2YQUA 2YG4A 4UDPA 4RG3A 1TYPA 3ADAB 1YQ3A 2E5VA 5J7XA 4U2TA 4A6NA 3F8RA 1IUSA 3LZXA 4U8JA 5KVIA 1CF3A 4II3A 1PBCA 4J36A 2IVDA 2WEUA 4BJYA 1VDCA 4FK1A 2UZZA 4O5QA 3NK0X 3BHKA 5HXIA 3NNEA 2BC0A 1TDOA 1Y0PA 2EQ6A 4ZCCA 5BULA 1FEBA 4J34A 3NN0X 4GDEA 4JNAA 3KU9A 3AXBA 3GRTA 4U8MA 4TLZA 1P2EA 1PBFA 2VRLA 4YWOA 4NNJA 3QVRA 1HYUA 2FJEA 2GQWA 3KLJA 4G74A 3UOYA 3G5SA 3IHMA 1F3PA 1LQUA 2WU5A 2QAEA 3QFBA 1MO9A 3CPHG 3QSSA 2X50A 2BRYA 2JB1A 4C77A 2RGOA 1GETA 2X8GA 2BS3A 1IUVA 4JNQA 3EAOA 5LV9A 4B65A 1ZMDA 2IVEA 4JDRA 4U8PA 4CNKA 1BF3A 3UOZA 3UTEA 4RG4A 3GDPA 4D03A 1OJTA 1Z6LA 2EQ9A 4BK2A 4EQRA 1BKWA 1L9CA 1E1MA 4FDCB 1PXBA 2Y6RA 4ICYA 3CPJG 5BRTA 2VVLA 4TM0A 3CNTA 3UOVA 4YSXA 4BK3A 1BZLA 3GYXA 5C2TA 1F8RA 4Z25A 1LJ1A 2NVKX 2XFUA 1JRZA 3UTHA 4TM1A 3ITJA 4NEVA 4NWZA 3V3NA 3AEEA 1NEKA 1D5TA 3GD4A 2RGHA 1FECA 2YLWA 3AECA 3LXDA 4AP1A 2ZZBA 4OPGA 2BS4A 1DOCA 3ATRA 1NHQA 3K7QX 1L9DA 2Q7VA 3T31A 2R0GA 2YLRA 1E1LA 2C67A 1IUUA 4A9WA 1LQTA 4GRTA 4H4YA 3IWAA 1CJ4A 1YKJA 3ZDNA 3CMMA 5EBKA 2BRAA 1BGJA 3OC4A 3AE1A 3M13A 4GAPA 2RABA 1JEHA 3ALMA 4HB9A 1O94A 1LPFA 3P4PA 1KDGA 1VRQB 1PBDA 3CGBA 1IUTA 2GMHA 5C3JA 2VVMA 3AWIA 2WESA 3KPKA 1O95A 4LIIA 4EQWA 4Z2RA 1KSSA 2H89A 3GDNA 3C96A 2Z5YA 4ZCDA 4NEWA 3SZCA 3CTYA 2GMJA 2RGJA 4JN9A 2XVFA 3CIRA 3F8PA 1PDHA 4EMWA 3NG7X 3PO7A 2ZZCA 1E39A 4YTMA 3G5QA 1QLBA 4J31A 1BGNA 3DK8A 3FG2P 3CNSA 3QVPA 4IV9A 1PXAA 4K22A 3AD8B 3VRDB 5JCLA 2XYOA 3T37A 2WOVA 3K7TA 1B5QA 3DJJA 1D4DA 2Q6UA 1KFYA 3VRBA 5KXJA 2X8HA 3EF6A 3NTAA 5KMSA 3P4RA 4B67A 1X31B 2BS2A 2O9ZA 3AYIA 1NHRA 2GAGB 3Q9TA 4G73A 3GMBA 4EMJA 3QJ4A 2JAEA 3BI2A 4AP3A 3URHA 3KKJA 1N1PA 1SEZA 1ZOVA 2GVCA 3F8DA 1RYIA 2VOUA 2YM1A 5U25A 3HYXA 2V5ZA 3AE7A 2PYXA 1VG0A 4D04A 1GV4A 3DK4A 1Q1RA 2QCUA 5GSNA 5U1OA 4II2A 4B64A 1EL9A 1JRXA 1H83A 4NZHA 4AT2A 5EB4A 3AE6A 1ZP0A 1TDKA 3GYJA 5KMRA 4IA6A 2V3BA 3CGDA 1REOA 4RSLA 1CHUA 3UKAA 5L46A 2WDVA 3NN6X 4BK1A 2VQ7A 4YT0A 3O0HA 2OAMA 1K0IA 2CVJA 3S61A 5U63A 2VZ2A 3IC9A 3FMWA 2VQBA 1YY5A 3ICSA 4H4QA 2AQJA 1MOKA 4JY3A 1PBEA 3ISHA 3NYEA 2WP6A 3OZ2A 2Z5XA 2E4GA 4EQSA 2BYBA 4KPRA 1NHSA 3CGEA 2GQFA 1UKVG 3AEDA 3K7MX 4TM3A 3UTFA 2BK3A 3VRAA 3AE5A 2GEWA 2GR1A 3AE9A 1LV0A 2C72A 3NK1X 3REDA 4AOSA 2X3NA 3SY4A 3T2ZA 3BI5A 3P1WA 4NTCA 4Z44A 1NPXA 2FJAA 1V59A 1LVLA 3NYFA 3QSMA 2NPXA 1CC4A 1ZMCA 4A99A 1N4VA 4U2SA 2Q0KA 4E0VA 1S3EA 3NRNA 2HQMA 1ZK7A 3K30A 2C73A 5EB5A 3PS9A 1D4EA 2DKIA 4TM4A 5KMPA 4CRTA 4K7ZA 2VVLG 2PHHA 2B7RA 2YAUA 1L0VA 3UTGA 2WPFA 4K2XA 3SX6A 4USRA 1FOHA 4C3YA 3LZWA 1GERA 2JKCA 4YSHA 4Y4LA 3SXIA 3LOVA 1GRGA 2EQ7A 2R46A 3E1TA 3G5RA 3DH9A 4EMIA 1MXTA 2BK5A 2BABA 1NDAA 1ZX9A 2XFQA 3AEFA 3DGZA 1F8WA 2BK4A 4K8DA 4H2QA 1H7WA 4Z2UA 4ECHA 2BC1A 3ALLA 3ICTA 2GRTA 2WPEA 2C7GA 1FL2A 2WDRA 1Y56A 2YG5A 4B68A 4EQXA 4H7UA 3ATQA 1NENA 1F8SA 2B9XA 4G9KA 1GRAA 4OPLA 4Z2TA 2C75A 2E1MA 1E7PA 3NTDA 3L1RA 4NTDA 1COYA 3T2KA 2IIDA 3SGLA 1GREA 1KSUA 4H4VA 3KA7A 2YLZA 3CGCA 4A65A 2X8CA 3DK9A 4H2PA 2CDUA 2Y6QA 2XLUA 4LU6A 2DKHA 2YG6A 4GUVA 4JQ9A 2YM2A 4H4ZA 1PJ6A 3NKSA 3UKQA 1GTEA 5FMHA 2R4JA 1CJ3A 2XFNA 2YVFA 5BVAA 2AR8A 3AEAA 4OVIA 1TYTA 2FBWA 5KNLA 1NHPA 1DJQA 4GDPA 1JRYA 3H8LA 2C64A 2GV8A 4G6HA 4Z43A 2XCGA 3SQPA 5FS6A 2GH5A 4U8KA 3WE0A 2GR0A 3C4NA 2R45A 2YG3A 4GR1A 1JNRA 4H4PA 4OPTA 1K0JA 2R4EA 1AOGA 3NK2X 3V3OA 2VRMA 4A6NB 1H82A 4WX1A 3UOXA 3M0OA 1D7LA 1B8SA 3AEBA 4MJWA 3VQRA 2WP9A 4U8NA 4IVOB 1EBDA 1FEAA 4YTPA 1E1NA 2V60A 4X4JA 1F6MA 1YQ4A 4X9MA 2OLNA 1ONFA 3HZLA 4YKGA 1BWCA 5IQ4A 5M10A 3C4AA 1K4QA 3GSIA 1EL7A 4OPUA 3BNMA 5IPYA 4Y4NA 1OJDA 1ELIA 2OLOA 3I3LA 3UCLA 4IVMB 1GSNA 1XPQA 2Q0LA 1TDNA 2BACA 4EIQA 1TDFA 1LTXR 5JCNA 2TPRA 3JSKA 2XVJA 4UDQA 1S2YA 4WCTA 1CL0A 2H88A 3DA1A 2J3NA 1JNZA 2YLXA 5FS7A 2BXSA 1RP0A 4I59A 3NT6A 1OJAA 4TLXA 3NH3X 3V76A 2WS3A 4ADWA 2W0HA 3KPFA 2BXRA 3LADA 4U8LA 1M64A 1GRTA 4CBQA 3H4KA 3P9UA 3AD9B 1ZDLA 1GEUA 1IUXA 4U2LA 4PABA 3SFDA 3SFEA 1PS9A 3COXA 2CFYA 1TRBA 4H50A 3SYIA 3T2YA 2WPCA 4Z26A 1S3BA 2OA1A 1CJ2A 5TR3A 4Z24A 1TDEA 2YVJA 4A7AA 2YLSA 3T0KA 2R0CA 2TMDA 4J57A 4DNAA 1DOBA 1PJ7A 4XWRA 4C5OA 2C4CA 2FJDA 2WBAA 1GALA 1GRFA 3KVEA 3AE8A 2ARDA 3DJGX 3UKHA 3VR8A 5ER0A 5JCMA 1CBOA 3R9UA 4EM3A 1IUWA 2WHDA 3CN8A 3RP7A 1NAAA 1E1KA 1P2HA 3RP6A 2XLSA 3AD7B 4I58A 1IJHA 1Q1WA 3AE4A 3UKPA 1CC2A 1NG3A 1Y56B 3LJPA 3UKKA 3NIXA 4CCRA 2V6OA 4IA5A 1DNCA 1GNDA 3NHOX 4B1BA 1E6EA 2B9YA 4DSHA 2WETA 1N4WA 3AE2A 2R9ZA 2YG7A 3B6DA 4H4XA 1XDIA 1M6IA 3GD3A 4LA1A 3SZ0A 3UKFA 3VR9A 2JBVA 3ABVA 1GOSA 4CNJA 4H2RA 2YR5A 3NGCX 3I6DA 5GRTA 1H81A 1H6VA 1ZY8A 3D8XA 4FX9A 3S5WA 2QA2A 1OJCA 4DGKA 2QA1A 3AYLA 3BI4A 5KMQA 3ZYXA 2A8XA 3PVCA 1ZKQA 4PAAA 3B3RA 1EL5A 2XVHA 4A5LA 4A79A 2C3DA 2JB2A 1XHCA 3AEGA 3QSEA 1K0LA 1GESA 4G6GA 1VQWA 4BV6A 4CY8A 2C76A 4U8OA 4H2NA 1GXFA 1PXCA 4OPCA 1W4XA 3DMEA 5KRQA 5KOWA 4OPDA 4XWZA 5JCKA 2JB3A 2YR6A 2C70A 3FBSA 2OALA 4EM4A 4CCQA 1CC6A 2YR4A 2C66A 3UP4A 3BHFA 1H84A 1QJDA 1YQZA 4YSYA 3SZWA 2XVIA 3UP5A 1DOEA 1JOAA 4DSGA 1GRBA 3IHGA 4J56A 1GPEA 1OJ9A 3M12A 3L8KA 5HHFA 3RNMA 1PHHA 3GYIA 4GF7A 5M0ZA 2GF3A 5FS8A 4YXDA 1L9EA 2C3CA 2I0ZA 2B76A 2YWLA 3FIMB 2F5ZA 1H7XA 3GWFA 4HA6A 4K5SA 4M52A 4NTEA 4XXGA 5EOWA 3SZFA 4USQA 3AE3A 2WQYA 2GB0A 1DXLA 2YLTA 4K5RA 1D4CA 4KX6A 3RHAA 5J60A 1N4UA 2AAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H8I A;  1H86 A;  2YVG A;  2WU2 A;  3NLC A;  4OPI A;  1B4V A;  3II4 A;  4Y4M A;  1O5W A;  4P9S A;  1GRH A;  3GWD A;  4H4R A;  3AB1 A;  1D7Y A;  4O5U A;  1Q9I A;  2XDO A;  1NG4 A;  1S2Q A;  4C3X A;  1PN0 A;  4OCG A;  1RSG A;  2B7S A;  2FJB A;  3CNP A;  2APG A;  2CUL A;  4JY2 A;  4N9X A;  2ZZ0 A;  2V3A A;  5KVH A;  5FS9 A;  3DJD A;  2V61 A;  3Q6J A;  4APN A;  4X9N A;  4BUR A;  5HYM A;  2XFO A;  2XVE A;  1KF6 A;  4UP3 A;  4J2W A;  3CND A;  3D1C A;  4B69 A;  3GMC A;  2B9W A;  3LB8 A;  1VG9 A;  4B63 A;  1CJC A;  2ACZ A;  1B37 A;  1DOD A;  2XLT A;  3KD9 A;  1XAN A;  3P4S A;  3DGH A;  2A87 A;  1PJ5 A;  4REK A;  4BJZ A;  4EIP A;  2ZBW A;  3EAN A;  3NYC A;  5IQ1 A;  5KWF A;  1QO8 A;  5CQF A;  3AYJ A;  2WDQ A;  2BCG G;  3EPT A;  5CKU A;  3SM8 A;  3RP8 A;  4ZN0 A;  2EQ8 A;  4YTN A;  1EL8 A;  3UKL A;  4H4S A;  4CY6 A;  4J33 A;  2GR3 A;  4H4T A;  2XFP A;  5JCI A;  4AT0 A;  2WOW A;  1KNP A;  3ALJ A;  3DJE A;  4GCM A;  2C65 A;  3GRS A;  4FK1 C;  3BNU A;  2A89 A;  2JK6 A;  2WP5 A;  4B66 A;  1ZOY A;  3P4Q A;  2BA9 A;  2BCP A;  3QFA A;  1DJN A;  5DBJ A;  5KOX A;  4C74 A;  2X99 A;  3FPZ A;  1KNR A;  5HY5 A;  2GAH B;  4AOX A;  3CPI G;  4H4U A;  3IF9 A;  1GT8 A;  2R0P A;  2WOI A;  4H4W A;  1GTH A;  2XLR A;  5BUK A;  4YSZ A;  3CNJ A;  1PBB A;  4UDR A;  1JU2 A;  3ICR A;  4U8I A;  2XLP A;  4YKF A;  1FCD A;  2GR2 A;  2YQU A;  2YG4 A;  4UDP A;  4RG3 A;  1TYP A;  3ADA B;  1YQ3 A;  2E5V A;  5J7X A;  4U2T A;  4A6N A;  3F8R A;  1IUS A;  3LZX A;  4U8J A;  5KVI A;  1CF3 A;  1PBC A;  4J36 A;  2IVD A;  2WEU A;  4BJY A;  1VDC A;  4FK1 A;  2UZZ A;  4O5Q A;  3NK0 X;  3BHK A;  5HXI A;  3NNE A;  2BC0 A;  1TDO A;  1Y0P A;  2EQ6 A;  4ZCC A;  5BUL A;  1FEB A;  4J34 A;  3NN0 X;  4GDE A;  4JNA A;  3KU9 A;  3AXB A;  3GRT A;  4U8M A;  4TLZ A;  1P2E A;  1PBF A;  2VRL A;  4YWO A;  3QVR A;  1HYU A;  2FJE A;  2GQW A;  3KLJ A;  3UOY A;  3G5S A;  3IHM A;  1F3P A;  1LQU A;  2WU5 A;  2QAE A;  3QFB A;  1MO9 A;  3CPH G;  3QSS A;  2X50 A;  2JB1 A;  4C77 A;  2RGO A;  1GET A;  2X8G A;  2BS3 A;  1IUV A;  4JNQ A;  3EAO A;  5LV9 A;  4B65 A;  1ZMD A;  2IVE A;  4JDR A;  4U8P A;  4CNK A;  1BF3 A;  3UOZ A;  3UTE A;  4RG4 A;  3GDP A;  4D03 A;  1OJT A;  1Z6L A;  2EQ9 A;  4BK2 A;  4EQR A;  1BKW A;  1L9C A;  1E1M A;  4FDC B;  1PXB A;  2Y6R A;  4ICY A;  3CPJ G;  5BRT A;  2VVL A;  4TM0 A;  3CNT A;  3UOV A;  4YSX A;  1BZL A;  4BK3 A;  5C2T A;  1F8R A;  4Z25 A;  1LJ1 A;  2NVK X;  2XFU A;  1JRZ A;  3UTH A;  4TM1 A;  3ITJ A;  4NEV A;  3V3N A;  3AEE A;  1NEK A;  1D5T A;  3GD4 A;  2RGH A;  1FEC A;  2YLW A;  3AEC A;  3LXD A;  2ZZB A;  4OPG A;  2BS4 A;  1DOC A;  3ATR A;  1NHQ A;  3K7Q X;  1L9D A;  2Q7V A;  2R0G A;  2YLR A;  1E1L A;  2C67 A;  1IUU A;  4A9W A;  1LQT A;  4GRT A;  4H4Y A;  3IWA A;  1CJ4 A;  1YKJ A;  3ZDN A;  5EBK A;  3OC4 A;  1BGJ A;  3AE1 A;  3M13 A;  2RAB A;  1JEH A;  3ALM A;  4HB9 A;  1O94 A;  1LPF A;  3P4P A;  1KDG A;  1VRQ B;  1PBD A;  3CGB A;  1IUT A;  2GMH A;  5C3J A;  2VVM A;  3AWI A;  2WES A;  1O95 A;  4LII A;  4EQW A;  4Z2R A;  1KSS A;  2H89 A;  3GDN A;  3C96 A;  2Z5Y A;  4ZCD A;  4NEW A;  3CTY A;  2GMJ A;  2RGJ A;  4JN9 A;  2XVF A;  3CIR A;  3F8P A;  1PDH A;  4EMW A;  3NG7 X;  3PO7 A;  2ZZC A;  1E39 A;  4YTM A;  3G5Q A;  1QLB A;  4J31 A;  1BGN A;  3DK8 A;  3FG2 P;  3CNS A;  3QVP A;  4IV9 A;  1PXA A;  4K22 A;  3AD8 B;  3VRD B;  5JCL A;  2XYO A;  3T37 A;  2WOV A;  3K7T A;  1B5Q A;  3DJJ A;  1D4D A;  2Q6U A;  1KFY A;  3VRB A;  5KXJ A;  2X8H A;  3EF6 A;  3NTA A;  3P4R A;  4B67 A;  1X31 B;  2BS2 A;  2O9Z A;  3AYI A;  1NHR A;  2GAG B;  3Q9T A;  4EMJ A;  3GMB A;  3QJ4 A;  2JAE A;  3BI2 A;  4AP3 A;  3URH A;  3KKJ A;  1N1P A;  1SEZ A;  1ZOV A;  2GVC A;  3F8D A;  1RYI A;  2VOU A;  2YM1 A;  5U25 A;  2V5Z A;  3AE7 A;  2PYX A;  1VG0 A;  4D04 A;  1GV4 A;  3DK4 A;  1Q1R A;  2QCU A;  5GSN A;  5U1O A;  4B64 A;  1EL9 A;  1JRX A;  1H83 A;  4NZH A;  4AT2 A;  5EB4 A;  3AE6 A;  1ZP0 A;  1TDK A;  3GYJ A;  2V3B A;  4IA6 A;  3CGD A;  1REO A;  4RSL A;  1CHU A;  3UKA A;  5L46 A;  2WDV A;  3NN6 X;  4BK1 A;  2VQ7 A;  4YT0 A;  3O0H A;  2OAM A;  1K0I A;  2CVJ A;  3S61 A;  5U63 A;  2VZ2 A;  3IC9 A;  3FMW A;  2VQB A;  1YY5 A;  3ICS A;  4H4Q A;  2AQJ A;  1MOK A;  1PBE A;  3ISH A;  3NYE A;  4JY3 A;  2WP6 A;  3OZ2 A;  2Z5X A;  2E4G A;  4EQS A;  2BYB A;  4KPR A;  1NHS A;  3CGE A;  2GQF A;  1UKV G;  3AED A;  3K7M X;  4TM3 A;  3UTF A;  2BK3 A;  3VRA A;  3AE5 A;  2GEW A;  2GR1 A;  3AE9 A;  1LV0 A;  2C72 A;  3NK1 X;  3RED A;  4AOS A;  2X3N A;  3BI5 A;  3P1W A;  4NTC A;  4Z44 A;  1NPX A;  2FJA A;  1V59 A;  1LVL A;  3NYF A;  3QSM A;  2NPX A;  1CC4 A;  1ZMC A;  4A99 A;  1N4V A;  4U2S A;  2Q0K A;  4E0V A;  1S3E A;  3NRN A;  2HQM A;  1ZK7 A;  3K30 A;  2C73 A;  5EB5 A;  3PS9 A;  1D4E A;  2DKI A;  4TM4 A;  4CRT A;  4K7Z A;  2VVL G;  2PHH A;  2B7R A;  2YAU A;  1L0V A;  3UTG A;  2WPF A;  4K2X A;  4USR A;  1FOH A;  4C3Y A;  3LZW A;  1GER A;  2JKC A;  4YSH A;  4Y4L A;  3LOV A;  1GRG A;  2EQ7 A;  2R46 A;  3E1T A;  3G5R A;  3DH9 A;  4EMI A;  1MXT A;  2BK5 A;  2BAB A;  1NDA A;  1ZX9 A;  2XFQ A;  3AEF A;  3DGZ A;  1F8W A;  2BK4 A;  4K8D A;  1H7W A;  4H2Q A;  4Z2U A;  4ECH A;  2BC1 A;  3ALL A;  3ICT A;  2GRT A;  2WPE A;  2C7G A;  1FL2 A;  2WDR A;  1Y56 A;  2YG5 A;  4B68 A;  4EQX A;  4H7U A;  3ATQ A;  1NEN A;  1F8S A;  2B9X A;  1GRA A;  4OPL A;  4Z2T A;  2C75 A;  2E1M A;  1E7P A;  3NTD A;  3L1R A;  4NTD A;  1COY A;  2IID A;  3SGL A;  1GRE A;  1KSU A;  4H4V A;  3KA7 A;  2YLZ A;  3CGC A;  4A65 A;  2X8C A;  3DK9 A;  2CDU A;  2Y6Q A;  4H2P A;  2XLU A;  4LU6 A;  2DKH A;  2YG6 A;  4GUV A;  4JQ9 A;  2YM2 A;  4H4Z A;  1PJ6 A;  3NKS A;  3UKQ A;  1GTE A;  5FMH A;  2R4J A;  1CJ3 A;  2XFN A;  2YVF A;  5BVA A;  2AR8 A;  3AEA A;  4OVI A;  1TYT A;  2FBW A;  1NHP A;  1DJQ A;  4GDP A;  1JRY A;  3H8L A;  2C64 A;  2GV8 A;  4Z43 A;  2XCG A;  3SQP A;  5FS6 A;  2GH5 A;  4U8K A;  3WE0 A;  2GR0 A;  3C4N A;  2R45 A;  2YG3 A;  4GR1 A;  1JNR A;  4H4P A;  4OPT A;  1K0J A;  2R4E A;  1AOG A;  3NK2 X;  3V3O A;  2VRM A;  4A6N B;  1H82 A;  4WX1 A;  3UOX A;  3M0O A;  1D7L A;  1B8S A;  3AEB A;  4MJW A;  3VQR A;  2WP9 A;  4U8N A;  4IVO B;  1EBD A;  1FEA A;  4YTP A;  1E1N A;  2V60 A;  4X4J A;  1F6M A;  1YQ4 A;  4X9M A;  2OLN A;  1ONF A;  3HZL A;  4YKG A;  1BWC A;  5IQ4 A;  5M10 A;  3C4A A;  1K4Q A;  3GSI A;  1EL7 A;  4OPU A;  3BNM A;  5IPY A;  4Y4N A;  1OJD A;  1ELI A;  2OLO A;  3I3L A;  3UCL A;  4IVM B;  1GSN A;  1XPQ A;  2Q0L A;  1TDN A;  2BAC A;  4EIQ A;  1TDF A;  1LTX R;  5JCN A;  2TPR A;  3JSK A;  2XVJ A;  4UDQ A;  1S2Y A;  4WCT A;  1CL0 A;  2H88 A;  3DA1 A;  2J3N A;  1JNZ A;  2YLX A;  5FS7 A;  2BXS A;  1RP0 A;  4I59 A;  3NT6 A;  1OJA A;  4TLX A;  3NH3 X;  3V76 A;  2WS3 A;  4ADW A;  2W0H A;  3KPF A;  2BXR A;  3LAD A;  4U8L A;  1M64 A;  1GRT A;  4CBQ A;  3H4K A;  3P9U A;  3AD9 B;  1ZDL A;  1GEU A;  1IUX A;  4U2L A;  4PAB A;  3SFD A;  3SFE A;  1PS9 A;  3COX A;  2CFY A;  1TRB A;  4H50 A;  2WPC A;  4Z26 A;  1S3B A;  2OA1 A;  1CJ2 A;  5TR3 A;  4Z24 A;  1TDE A;  2YVJ A;  4A7A A;  2YLS A;  2R0C A;  2TMD A;  4J57 A;  4DNA A;  1DOB A;  1PJ7 A;  4XWR A;  4C5O A;  2WBA A;  2FJD A;  1GAL A;  1GRF A;  3KVE A;  3AE8 A;  2ARD A;  3DJG X;  3UKH A;  3VR8 A;  5ER0 A;  5JCM A;  1CBO A;  3R9U A;  4EM3 A;  1IUW A;  2WHD A;  3CN8 A;  1NAA A;  1P2H A;  1E1K A;  2XLS A;  3AD7 B;  4I58 A;  3RP6 A;  3RP7 A;  1IJH A;  1Q1W A;  3AE4 A;  3UKP A;  1CC2 A;  1NG3 A;  1Y56 B;  3LJP A;  3UKK A;  3NIX A;  4CCR A;  2V6O A;  4IA5 A;  1DNC A;  1GND A;  3NHO X;  4B1B A;  1E6E A;  2B9Y A;  4DSH A;  2WET A;  1N4W A;  3AE2 A;  2R9Z A;  2YG7 A;  3B6D A;  4H4X A;  1XDI A;  1M6I A;  3GD3 A;  4LA1 A;  3UKF A;  3VR9 A;  2JBV A;  3ABV A;  1GOS A;  4CNJ A;  4H2R A;  2YR5 A;  3NGC X;  3I6D A;  5GRT A;  1H81 A;  1H6V A;  1ZY8 A;  3D8X A;  4FX9 A;  3S5W A;  2QA2 A;  1OJC A;  4DGK A;  2QA1 A;  3AYL A;  3BI4 A;  3ZYX A;  2A8X A;  3PVC A;  1ZKQ A;  4PAA A;  3B3R A;  1EL5 A;  2XVH A;  4A5L A;  4A79 A;  2C3D A;  2JB2 A;  1XHC A;  3AEG A;  3QSE A;  1K0L A;  1GES A;  4AP1 A;  1VQW A;  4BV6 A;  4CY8 A;  2C76 A;  4U8O A;  1GXF A;  4H2N A;  1PXC A;  4OPC A;  1W4X A;  3DME A;  5KRQ A;  5KOW A;  4OPD A;  4XWZ A;  5JCK A;  2JB3 A;  2YR6 A;  2C70 A;  3FBS A;  2OAL A;  4EM4 A;  4CCQ A;  1CC6 A;  2YR4 A;  2C66 A;  3UP4 A;  3BHF A;  1H84 A;  1QJD A;  1YQZ A;  4YSY A;  2XVI A;  3UP5 A;  1DOE A;  1JOA A;  4DSG A;  1GRB A;  3IHG A;  4J56 A;  1GPE A;  1OJ9 A;  3M12 A;  3L8K A;  5HHF A;  3RNM A;  1PHH A;  3GYI A;  4GF7 A;  5M0Z A;  2GF3 A;  5FS8 A;  4YXD A;  1L9E A;  2C3C A;  2I0Z A;  2B76 A;  2YWL A;  3FIM B;  2F5Z A;  1H7X A;  3GWF A;  4HA6 A;  4K5S A;  4M52 A;  4NTE A;  4XXG A;  5EOW A;  4USQ A;  3AE3 A;  2WQY A;  2GB0 A;  1DXL A;  2YLT A;  4K5R A;  1D4C A;  4KX6 A;  3RHA A;  5J60 A;  1N4U A;  2AAQ A; 
#chains in the Genus database with same CATH topology
 3H8I A;  1H86 A;  2YVG A;  2WU2 A;  3NLC A;  4OPI A;  1B4V A;  3II4 A;  4Y4M A;  4P9S A;  1O5W A;  1GRH A;  3GWD A;  4H4R A;  3AB1 A;  1D7Y A;  3HYW A;  4O5U A;  1Q9I A;  2XDO A;  1NG4 A;  1S2Q A;  4C3X A;  1PN0 A;  4OCG A;  1RSG A;  2B7S A;  2FJB A;  3CNP A;  2APG A;  2CUL A;  4JY2 A;  4N9X A;  2ZZ0 A;  2V3A A;  5KVH A;  5FS9 A;  3DJD A;  2V61 A;  3Q6J A;  4APN A;  4X9N A;  5HYM A;  4BUR A;  2XFO A;  2XVE A;  1KF6 A;  4UP3 A;  4J2W A;  3CND A;  3D1C A;  3HYV A;  4B69 A;  3GMC A;  2B9W A;  3LB8 A;  1VG9 A;  4B63 A;  1CJC A;  2ACZ A;  1B37 A;  1DOD A;  2XLT A;  3KD9 A;  1XAN A;  3P4S A;  4BJZ A;  2A87 A;  1PJ5 A;  4EIP A;  3DGH A;  4REK A;  3T14 A;  3NYC A;  2ZBW A;  3EAN A;  5IQ1 A;  5KWF A;  1QO8 A;  5CQF A;  3EPT A;  3SM8 A;  2BCG G;  2WDQ A;  3AYJ A;  4GAV A;  5CKU A;  3RP8 A;  4ZN0 A;  2EQ8 A;  4YTN A;  1EL8 A;  3UKL A;  1KIF A;  4H4S A;  4CY6 A;  4J33 A;  2GR3 A;  4H4T A;  2XFP A;  5JCI A;  4AT0 A;  2WOW A;  1KNP A;  3ALJ A;  3DJE A;  4GCM A;  2C65 A;  3GRS A;  4FK1 C;  3BNU A;  2A89 A;  2JK6 A;  2WP5 A;  4B66 A;  1ZOY A;  3P4Q A;  2BA9 A;  2BCP A;  3QFA A;  1DJN A;  5DBJ A;  5KOX A;  4C74 A;  2X99 A;  3FPZ A;  1KNR A;  5HY5 A;  2GAH B;  4AOX A;  3CPI G;  4H4U A;  3IF9 A;  2R0P A;  1GT8 A;  2WOI A;  4H4W A;  1GTH A;  2XLR A;  5BUK A;  4YSZ A;  3CNJ A;  1PBB A;  4UDR A;  1JU2 A;  3ICR A;  4U8I A;  2XLP A;  4YKF A;  1FCD A;  1C0K A;  2GR2 A;  2YG4 A;  2YQU A;  4UDP A;  4RG3 A;  3ADA B;  1TYP A;  1YQ3 A;  2E5V A;  4QFD A;  5J7X A;  4U2T A;  4A6N A;  3F8R A;  1IUS A;  3LZX A;  4U8J A;  5KVI A;  1CF3 A;  4II3 A;  1PBC A;  4J36 A;  2IVD A;  2WEU A;  4BJY A;  1VDC A;  4FK1 A;  2UZZ A;  4O5Q A;  3NK0 X;  3BHK A;  5HXI A;  3NNE A;  2BC0 A;  1TDO A;  1Y0P A;  2EQ6 A;  4ZCC A;  5BUL A;  1FEB A;  4J34 A;  3NN0 X;  4GDE A;  4JNA A;  3KU9 A;  3AXB A;  3GRT A;  4U8M A;  4TLZ A;  1P2E A;  1PBF A;  2VRL A;  4YWO A;  4NNJ A;  3QVR A;  1HYU A;  2FJE A;  2GQW A;  3KLJ A;  4G74 A;  3UOY A;  3G5S A;  3IHM A;  1F3P A;  1LQU A;  2WU5 A;  2QAE A;  3QFB A;  1MO9 A;  3CPH G;  3QSS A;  2X50 A;  2BRY A;  2JB1 A;  4C77 A;  2RGO A;  1GET A;  2X8G A;  2BS3 A;  1IUV A;  4JNQ A;  3EAO A;  5LV9 A;  4B65 A;  1ZMD A;  2IVE A;  4JDR A;  4U8P A;  4CNK A;  1BF3 A;  3UOZ A;  3UTE A;  4RG4 A;  3GDP A;  4D03 A;  1OJT A;  1Z6L A;  4BK2 A;  2EQ9 A;  4EQR A;  1BKW A;  1L9C A;  1E1M A;  3ZNN A;  1PXB A;  2Y6R A;  4FDC B;  4ICY A;  3CPJ G;  5BRT A;  2VVL A;  3W4K A;  4TM0 A;  3CNT A;  3UOV A;  4YSX A;  4BK3 A;  1BZL A;  3GYX A;  5C2T A;  1F8R A;  4Z25 A;  1LJ1 A;  2NVK X;  2XFU A;  1JRZ A;  3UTH A;  4TM1 A;  3ITJ A;  4NEV A;  4NWZ A;  3V3N A;  3AEE A;  1NEK A;  1D5T A;  3GD4 A;  2RGH A;  1FEC A;  2YLW A;  3AEC A;  3LXD A;  4AP1 A;  2ZZB A;  4OPG A;  2BS4 A;  1DOC A;  3ATR A;  1NHQ A;  3K7Q X;  1L9D A;  2Q7V A;  3T31 A;  2R0G A;  2YLR A;  1E1L A;  2E49 A;  2C67 A;  1IUU A;  4A9W A;  1LQT A;  4GRT A;  4H4Y A;  3IWA A;  1CJ4 A;  1YKJ A;  3ZDN A;  3CMM A;  5EBK A;  2BRA A;  1BGJ A;  3OC4 A;  3AE1 A;  3M13 A;  4GAP A;  2RAB A;  1JEH A;  1C0I A;  3ALM A;  4HB9 A;  1O94 A;  1LPF A;  3P4P A;  1VRQ B;  1KDG A;  1PBD A;  3CGB A;  1IUT A;  2GMH A;  5C3J A;  2VVM A;  3AWI A;  2WES A;  3KPK A;  1O95 A;  4LII A;  4EQW A;  4Z2R A;  1KSS A;  4QFC A;  2H89 A;  3GDN A;  3C96 A;  2Z5Y A;  4ZCD A;  4NEW A;  3SZC A;  2DU8 A;  3CTY A;  2GMJ A;  2RGJ A;  4JN9 A;  2XVF A;  3CIR A;  3F8P A;  1PDH A;  4EMW A;  3NG7 X;  3PO7 A;  2ZZC A;  1E39 A;  4YTM A;  3G5Q A;  1QLB A;  4J31 A;  1BGN A;  3DK8 A;  3FG2 P;  3CNS A;  3QVP A;  4IV9 A;  1PXA A;  4K22 A;  3AD8 B;  3VRD B;  5JCL A;  2XYO A;  3T37 A;  2WOV A;  3K7T A;  1B5Q A;  3DJJ A;  2Q6U A;  3ZNP A;  1D4D A;  1KFY A;  3VRB A;  2X8H A;  3EF6 A;  3NTA A;  5KXJ A;  5KMS A;  3P4R A;  4B67 A;  1X31 B;  2BS2 A;  2O9Z A;  3AYI A;  1NHR A;  2GAG B;  3Q9T A;  4G73 A;  3GMB A;  4EMJ A;  3QJ4 A;  2JAE A;  3BI2 A;  4AP3 A;  1DDO A;  3URH A;  3KKJ A;  1N1P A;  1SEZ A;  1ZOV A;  2GVC A;  3F8D A;  1RYI A;  2VOU A;  2YM1 A;  5U25 A;  3HYX A;  2V5Z A;  3AE7 A;  2PYX A;  1VG0 A;  4D04 A;  1GV4 A;  3DK4 A;  1Q1R A;  2QCU A;  5GSN A;  5U1O A;  4II2 A;  4B64 A;  1EL9 A;  1JRX A;  1H83 A;  4NZH A;  4AT2 A;  5EB4 A;  3AE6 A;  1ZP0 A;  1TDK A;  3GYJ A;  5KMR A;  4IA6 A;  2V3B A;  4RSL A;  1REO A;  3CGD A;  1CHU A;  1AN9 A;  5L46 A;  3UKA A;  2WDV A;  3NN6 X;  4BK1 A;  2VQ7 A;  4YT0 A;  3O0H A;  2OAM A;  3ZNO A;  1K0I A;  2CVJ A;  3S61 A;  5U63 A;  2VZ2 A;  3IC9 A;  3FMW A;  2VQB A;  1YY5 A;  3ICS A;  4H4Q A;  2AQJ A;  1MOK A;  1PBE A;  3NYE A;  4JY3 A;  3ISH A;  3OZ2 A;  2WP6 A;  2Z5X A;  2E4G A;  4EQS A;  2BYB A;  4YJH B;  4KPR A;  1NHS A;  3CGE A;  2GQF A;  1UKV G;  3AED A;  3K7M X;  4TM3 A;  3UTF A;  4YJD A;  2BK3 A;  3VRA A;  3AE5 A;  2GEW A;  2GR1 A;  3AE9 A;  1LV0 A;  2C72 A;  3NK1 X;  3RED A;  4AOS A;  2X3N A;  3SY4 A;  3T2Z A;  3BI5 A;  3P1W A;  4NTC A;  4Z44 A;  1NPX A;  2FJA A;  1V59 A;  3NYF A;  1LVL A;  3QSM A;  2NPX A;  1CC4 A;  1ZMC A;  4A99 A;  1N4V A;  4U2S A;  2Q0K A;  4E0V A;  1S3E A;  3NRN A;  2HQM A;  1ZK7 A;  3K30 A;  2C73 A;  5EB5 A;  3PS9 A;  4YJF A;  1D4E A;  2DKI A;  4TM4 A;  5KMP A;  4CRT A;  4K7Z A;  2VVL G;  2PHH A;  2B7R A;  2YAU A;  1L0V A;  3UTG A;  2WPF A;  1EVI A;  4K2X A;  3SX6 A;  4USR A;  1FOH A;  4C3Y A;  3LZW A;  1GER A;  2JKC A;  4YSH A;  4Y4L A;  3SXI A;  3LOV A;  1GRG A;  2EQ7 A;  2R46 A;  3E1T A;  3G5R A;  3DH9 A;  4EMI A;  1MXT A;  1NDA A;  2BAB A;  2BK5 A;  1ZX9 A;  2XFQ A;  3AEF A;  3DGZ A;  1F8W A;  2BK4 A;  4K8D A;  4H2Q A;  1H7W A;  4Z2U A;  4ECH A;  2BC1 A;  3ALL A;  3ICT A;  2GRT A;  2WPE A;  2C7G A;  1FL2 A;  2WDR A;  1Y56 A;  2YG5 A;  4B68 A;  4EQX A;  4H7U A;  3ATQ A;  1NEN A;  1F8S A;  2B9X A;  4G9K A;  1GRA A;  4OPL A;  4Z2T A;  2C75 A;  2E1M A;  1E7P A;  3NTD A;  3L1R A;  4NTD A;  1COY A;  3T2K A;  2IID A;  3SGL A;  4YJG B;  1GRE A;  1KSU A;  4H4V A;  3KA7 A;  2YLZ A;  3CGC A;  4A65 A;  1DAO A;  2X8C A;  3DK9 A;  4H2P A;  2CDU A;  2Y6Q A;  2XLU A;  4LU6 A;  2DKH A;  2YG6 A;  4GUV A;  4JQ9 A;  2YM2 A;  4H4Z A;  1PJ6 A;  3NKS A;  3UKQ A;  1GTE A;  5FMH A;  2R4J A;  1CJ3 A;  2XFN A;  2YVF A;  5BVA A;  2AR8 A;  3AEA A;  4OVI A;  1TYT A;  2FBW A;  5KNL A;  1NHP A;  1DJQ A;  4GDP A;  1JRY A;  3H8L A;  2C64 A;  2GV8 A;  4G6H A;  4Z43 A;  2XCG A;  3SQP A;  5FS6 A;  2GH5 A;  4U8K A;  3WE0 A;  3CUK A;  2GR0 A;  3C4N A;  2R45 A;  2YG3 A;  4GR1 A;  1JNR A;  4H4P A;  4OPT A;  1K0J A;  2R4E A;  1AOG A;  3NK2 X;  3V3O A;  2VRM A;  4A6N B;  1C0L A;  1H82 A;  4WX1 A;  3UOX A;  3M0O A;  1D7L A;  1B8S A;  3AEB A;  4MJW A;  3VQR A;  2WP9 A;  4U8N A;  4IVO B;  1EBD A;  1FEA A;  4YTP A;  1E1N A;  2V60 A;  4X4J A;  1F6M A;  1YQ4 A;  4X9M A;  2OLN A;  1ONF A;  3HZL A;  4YKG A;  1BWC A;  5IQ4 A;  2E48 A;  3C4A A;  4YJH A;  5M10 A;  1K4Q A;  3GSI A;  1EL7 A;  4OPU A;  3BNM A;  5IPY A;  4Y4N A;  1OJD A;  1ELI A;  2OLO A;  3I3L A;  3UCL A;  1C0P A;  4IVM B;  1GSN A;  1XPQ A;  2Q0L A;  1TDN A;  2BAC A;  4EIQ A;  1TDF A;  1LTX R;  5JCN A;  2TPR A;  3JSK A;  2XVJ A;  4UDQ A;  1S2Y A;  3WGT A;  2E4A A;  4WCT A;  1CL0 A;  2H88 A;  3DA1 A;  2J3N A;  1JNZ A;  2YLX A;  5FS7 A;  2BXS A;  1RP0 A;  4I59 A;  3NT6 A;  1OJA A;  4TLX A;  3NH3 X;  3V76 A;  2WS3 A;  4ADW A;  2W0H A;  4YJF B;  3KPF A;  2BXR A;  3LAD A;  4U8L A;  1M64 A;  1GRT A;  4CBQ A;  3H4K A;  3P9U A;  3AD9 B;  1ZDL A;  1GEU A;  1IUX A;  3ZNQ A;  4U2L A;  4PAB A;  3SFD A;  3SFE A;  1PS9 A;  3COX A;  2CFY A;  1TRB A;  4H50 A;  3SYI A;  3W4I A;  3T2Y A;  2WPC A;  4Z26 A;  1S3B A;  2OA1 A;  1CJ2 A;  5TR3 A;  4Z24 A;  1TDE A;  2YVJ A;  4A7A A;  1VE9 A;  2YLS A;  3T0K A;  2R0C A;  2TMD A;  4J57 A;  4DNA A;  1DOB A;  1PJ7 A;  4XWR A;  4C5O A;  2C4C A;  2FJD A;  2WBA A;  1GAL A;  1GRF A;  3KVE A;  3AE8 A;  2ARD A;  3DJG X;  3UKH A;  3VR8 A;  5ER0 A;  5JCM A;  1CBO A;  3R9U A;  4EM3 A;  1IUW A;  2WHD A;  3CN8 A;  1NAA A;  1P2H A;  3RP7 A;  3AD7 B;  1E1K A;  3RP6 A;  2XLS A;  4I58 A;  1IJH A;  1Q1W A;  3AE4 A;  3UKP A;  1NG3 A;  1Y56 B;  1CC2 A;  3LJP A;  3UKK A;  3G3E A;  3NIX A;  4CCR A;  2V6O A;  4IA5 A;  1DNC A;  1GND A;  3W4J A;  3NHO X;  4B1B A;  1E6E A;  2E82 A;  2B9Y A;  4DSH A;  2WET A;  1N4W A;  3AE2 A;  2R9Z A;  2YG7 A;  3B6D A;  4H4X A;  1XDI A;  1M6I A;  3GD3 A;  4LA1 A;  3SZ0 A;  3UKF A;  3VR9 A;  2JBV A;  3ABV A;  1GOS A;  4CNJ A;  4H2R A;  2YR5 A;  3NGC X;  3I6D A;  5GRT A;  1H81 A;  1H6V A;  1ZY8 A;  3D8X A;  4FX9 A;  3S5W A;  2QA2 A;  1OJC A;  4DGK A;  2QA1 A;  3AYL A;  3BI4 A;  5KMQ A;  3ZYX A;  2A8X A;  3PVC A;  1ZKQ A;  4PAA A;  3B3R A;  1EL5 A;  2XVH A;  4A5L A;  4A79 A;  2C3D A;  2JB2 A;  1XHC A;  3QSE A;  3AEG A;  1K0L A;  1GES A;  4G6G A;  1VQW A;  4BV6 A;  4CY8 A;  2C76 A;  4U8O A;  4H2N A;  1GXF A;  1PXC A;  4OPC A;  1W4X A;  3DME A;  5KRQ A;  5KOW A;  4XWZ A;  4OPD A;  5JCK A;  2JB3 A;  2YR6 A;  2C70 A;  3FBS A;  2OAL A;  4EM4 A;  4CCQ A;  1CC6 A;  2YR4 A;  2C66 A;  3UP4 A;  3BHF A;  1H84 A;  1QJD A;  1YQZ A;  4YSY A;  3SZW A;  2XVI A;  3UP5 A;  1DOE A;  1JOA A;  4DSG A;  1GRB A;  3IHG A;  4J56 A;  1GPE A;  3M12 A;  1OJ9 A;  3L8K A;  5HHF A;  3RNM A;  1PHH A;  3GYI A;  4GF7 A;  5M0Z A;  2GF3 A;  5FS8 A;  4YXD A;  1L9E A;  2C3C A;  2I0Z A;  2B76 A;  2YWL A;  3FIM B;  2F5Z A;  1H7X A;  3GWF A;  4HA6 A;  4K5S A;  4M52 A;  4NTE A;  4XXG A;  5EOW A;  3SZF A;  4USQ A;  3AE3 A;  2WQY A;  2GB0 A;  1DXL A;  2YLT A;  4K5R A;  1D4C A;  4KX6 A;  3RHA A;  5J60 A;  4YJG A;  1N4U A;  2AAQ A; 
#chains in the Genus database with same CATH homology
 3H8I A;  1H86 A;  2YVG A;  2WU2 A;  3NLC A;  4OPI A;  1B4V A;  3II4 A;  4Y4M A;  1O5W A;  4P9S A;  1GRH A;  3GWD A;  4H4R A;  3AB1 A;  1D7Y A;  3HYW A;  4O5U A;  1Q9I A;  2XDO A;  1NG4 A;  1S2Q A;  4C3X A;  1PN0 A;  4OCG A;  1RSG A;  2B7S A;  2FJB A;  3CNP A;  2APG A;  2CUL A;  4JY2 A;  4N9X A;  2ZZ0 A;  2V3A A;  5KVH A;  5FS9 A;  3DJD A;  2V61 A;  3Q6J A;  4APN A;  4X9N A;  5HYM A;  4BUR A;  2XFO A;  2XVE A;  1KF6 A;  4UP3 A;  4J2W A;  3CND A;  3D1C A;  3HYV A;  4B69 A;  3GMC A;  2B9W A;  3LB8 A;  1VG9 A;  4B63 A;  1CJC A;  2ACZ A;  1B37 A;  1DOD A;  2XLT A;  3KD9 A;  1XAN A;  3P4S A;  4BJZ A;  2A87 A;  1PJ5 A;  4EIP A;  3DGH A;  4REK A;  3T14 A;  2ZBW A;  3EAN A;  3NYC A;  5IQ1 A;  5KWF A;  1QO8 A;  5CQF A;  3EPT A;  2WDQ A;  2BCG G;  3AYJ A;  5CKU A;  4GAV A;  3SM8 A;  3RP8 A;  4ZN0 A;  2EQ8 A;  4YTN A;  1EL8 A;  3UKL A;  4H4S A;  4CY6 A;  4J33 A;  2GR3 A;  4H4T A;  2XFP A;  5JCI A;  4AT0 A;  2WOW A;  1KNP A;  3ALJ A;  3DJE A;  4GCM A;  2C65 A;  3GRS A;  4FK1 C;  3BNU A;  2A89 A;  2JK6 A;  2WP5 A;  4B66 A;  1ZOY A;  3P4Q A;  2BA9 A;  2BCP A;  3QFA A;  1DJN A;  5DBJ A;  5KOX A;  4C74 A;  2X99 A;  3FPZ A;  1KNR A;  5HY5 A;  2GAH B;  4AOX A;  3CPI G;  4H4U A;  3IF9 A;  2R0P A;  1GT8 A;  2WOI A;  4H4W A;  1GTH A;  2XLR A;  5BUK A;  4YSZ A;  3CNJ A;  1PBB A;  4UDR A;  1JU2 A;  3ICR A;  4U8I A;  2XLP A;  4YKF A;  1FCD A;  2GR2 A;  2YQU A;  2YG4 A;  4UDP A;  4RG3 A;  1TYP A;  3ADA B;  1YQ3 A;  2E5V A;  5J7X A;  4U2T A;  4A6N A;  3F8R A;  1IUS A;  3LZX A;  4U8J A;  5KVI A;  1CF3 A;  4II3 A;  1PBC A;  4J36 A;  2IVD A;  2WEU A;  4BJY A;  1VDC A;  4FK1 A;  2UZZ A;  4O5Q A;  3NK0 X;  3BHK A;  5HXI A;  3NNE A;  2BC0 A;  1TDO A;  1Y0P A;  2EQ6 A;  4ZCC A;  5BUL A;  1FEB A;  4J34 A;  3NN0 X;  4GDE A;  4JNA A;  3KU9 A;  3AXB A;  3GRT A;  4U8M A;  4TLZ A;  1P2E A;  1PBF A;  2VRL A;  4YWO A;  4NNJ A;  3QVR A;  1HYU A;  2FJE A;  2GQW A;  3KLJ A;  4G74 A;  3UOY A;  3G5S A;  3IHM A;  1F3P A;  1LQU A;  2WU5 A;  2QAE A;  3QFB A;  1MO9 A;  3CPH G;  3QSS A;  2X50 A;  2BRY A;  2JB1 A;  4C77 A;  2RGO A;  1GET A;  2X8G A;  2BS3 A;  1IUV A;  4JNQ A;  3EAO A;  5LV9 A;  4B65 A;  1ZMD A;  2IVE A;  4JDR A;  4U8P A;  4CNK A;  1BF3 A;  3UOZ A;  3UTE A;  4RG4 A;  3GDP A;  4D03 A;  1OJT A;  1Z6L A;  2EQ9 A;  4BK2 A;  4EQR A;  1BKW A;  1L9C A;  1E1M A;  4FDC B;  1PXB A;  2Y6R A;  4ICY A;  3CPJ G;  5BRT A;  2VVL A;  4TM0 A;  3CNT A;  3UOV A;  4YSX A;  4BK3 A;  1BZL A;  3GYX A;  5C2T A;  1F8R A;  4Z25 A;  1LJ1 A;  2NVK X;  2XFU A;  1JRZ A;  3UTH A;  4TM1 A;  3ITJ A;  4NEV A;  4NWZ A;  3V3N A;  3AEE A;  1NEK A;  1D5T A;  3GD4 A;  2RGH A;  1FEC A;  2YLW A;  3AEC A;  3LXD A;  4AP1 A;  2ZZB A;  4OPG A;  2BS4 A;  1DOC A;  3ATR A;  1NHQ A;  3K7Q X;  1L9D A;  2Q7V A;  3T31 A;  2R0G A;  2YLR A;  1E1L A;  2C67 A;  1IUU A;  4A9W A;  1LQT A;  4GRT A;  4H4Y A;  3IWA A;  1CJ4 A;  1YKJ A;  3ZDN A;  3CMM A;  5EBK A;  2BRA A;  1BGJ A;  3OC4 A;  3AE1 A;  3M13 A;  4GAP A;  2RAB A;  1JEH A;  3ALM A;  4HB9 A;  1O94 A;  1LPF A;  3P4P A;  1KDG A;  1VRQ B;  1PBD A;  3CGB A;  1IUT A;  2GMH A;  5C3J A;  2VVM A;  3AWI A;  2WES A;  3KPK A;  1O95 A;  4LII A;  4EQW A;  4Z2R A;  1KSS A;  2H89 A;  3GDN A;  3C96 A;  2Z5Y A;  4ZCD A;  4NEW A;  3SZC A;  3CTY A;  2GMJ A;  2RGJ A;  4JN9 A;  2XVF A;  3CIR A;  3F8P A;  1PDH A;  4EMW A;  3NG7 X;  3PO7 A;  2ZZC A;  1E39 A;  4YTM A;  3G5Q A;  1QLB A;  4J31 A;  1BGN A;  3DK8 A;  3FG2 P;  3CNS A;  3QVP A;  4IV9 A;  1PXA A;  4K22 A;  3AD8 B;  3VRD B;  5JCL A;  2XYO A;  3T37 A;  2WOV A;  3K7T A;  1B5Q A;  3DJJ A;  1D4D A;  2Q6U A;  1KFY A;  3VRB A;  5KXJ A;  2X8H A;  3EF6 A;  3NTA A;  5KMS A;  3P4R A;  4B67 A;  1X31 B;  2BS2 A;  2O9Z A;  3AYI A;  1NHR A;  2GAG B;  3Q9T A;  4G73 A;  3GMB A;  4EMJ A;  3QJ4 A;  2JAE A;  3BI2 A;  4AP3 A;  3URH A;  3KKJ A;  1N1P A;  1SEZ A;  1ZOV A;  2GVC A;  3F8D A;  1RYI A;  2VOU A;  2YM1 A;  5U25 A;  3HYX A;  2V5Z A;  3AE7 A;  2PYX A;  1VG0 A;  4D04 A;  1GV4 A;  3DK4 A;  1Q1R A;  2QCU A;  5GSN A;  5U1O A;  4II2 A;  4B64 A;  1EL9 A;  1JRX A;  1H83 A;  4NZH A;  4AT2 A;  5EB4 A;  3AE6 A;  1ZP0 A;  1TDK A;  3GYJ A;  5KMR A;  4IA6 A;  2V3B A;  3CGD A;  1REO A;  4RSL A;  1CHU A;  3UKA A;  5L46 A;  2WDV A;  3NN6 X;  4BK1 A;  2VQ7 A;  4YT0 A;  3O0H A;  2OAM A;  1K0I A;  2CVJ A;  3S61 A;  5U63 A;  2VZ2 A;  3IC9 A;  3FMW A;  2VQB A;  1YY5 A;  3ICS A;  4H4Q A;  2AQJ A;  1MOK A;  4JY3 A;  1PBE A;  3ISH A;  3NYE A;  2WP6 A;  3OZ2 A;  2Z5X A;  2E4G A;  4EQS A;  2BYB A;  4KPR A;  1NHS A;  3CGE A;  2GQF A;  1UKV G;  3AED A;  3K7M X;  4TM3 A;  3UTF A;  2BK3 A;  3VRA A;  3AE5 A;  2GEW A;  2GR1 A;  3AE9 A;  1LV0 A;  2C72 A;  3NK1 X;  3RED A;  4AOS A;  2X3N A;  3SY4 A;  3T2Z A;  3BI5 A;  3P1W A;  4NTC A;  4Z44 A;  1NPX A;  2FJA A;  1V59 A;  1LVL A;  3NYF A;  3QSM A;  2NPX A;  1CC4 A;  1ZMC A;  4A99 A;  1N4V A;  4U2S A;  2Q0K A;  4E0V A;  1S3E A;  3NRN A;  2HQM A;  1ZK7 A;  3K30 A;  2C73 A;  5EB5 A;  3PS9 A;  1D4E A;  2DKI A;  4TM4 A;  5KMP A;  4CRT A;  4K7Z A;  2VVL G;  2PHH A;  2B7R A;  2YAU A;  1L0V A;  3UTG A;  2WPF A;  4K2X A;  3SX6 A;  4USR A;  1FOH A;  4C3Y A;  3LZW A;  1GER A;  2JKC A;  4YSH A;  4Y4L A;  3SXI A;  3LOV A;  1GRG A;  2EQ7 A;  2R46 A;  3E1T A;  3G5R A;  3DH9 A;  4EMI A;  1MXT A;  2BK5 A;  2BAB A;  1NDA A;  1ZX9 A;  2XFQ A;  3AEF A;  3DGZ A;  1F8W A;  2BK4 A;  4K8D A;  4H2Q A;  1H7W A;  4Z2U A;  4ECH A;  2BC1 A;  3ALL A;  3ICT A;  2GRT A;  2WPE A;  2C7G A;  1FL2 A;  2WDR A;  1Y56 A;  2YG5 A;  4B68 A;  4EQX A;  4H7U A;  3ATQ A;  1NEN A;  1F8S A;  2B9X A;  4G9K A;  1GRA A;  4OPL A;  4Z2T A;  2C75 A;  2E1M A;  1E7P A;  3NTD A;  3L1R A;  4NTD A;  1COY A;  3T2K A;  2IID A;  3SGL A;  1GRE A;  1KSU A;  4H4V A;  3KA7 A;  2YLZ A;  3CGC A;  4A65 A;  2X8C A;  3DK9 A;  4H2P A;  2CDU A;  2Y6Q A;  2XLU A;  4LU6 A;  2DKH A;  2YG6 A;  4GUV A;  4JQ9 A;  2YM2 A;  4H4Z A;  1PJ6 A;  3NKS A;  3UKQ A;  1GTE A;  5FMH A;  2R4J A;  1CJ3 A;  2XFN A;  2YVF A;  5BVA A;  2AR8 A;  3AEA A;  4OVI A;  1TYT A;  2FBW A;  5KNL A;  1NHP A;  1DJQ A;  4GDP A;  1JRY A;  3H8L A;  2C64 A;  2GV8 A;  4G6H A;  4Z43 A;  2XCG A;  3SQP A;  5FS6 A;  2GH5 A;  4U8K A;  3WE0 A;  2GR0 A;  3C4N A;  2R45 A;  2YG3 A;  4GR1 A;  1JNR A;  4H4P A;  4OPT A;  1K0J A;  2R4E A;  1AOG A;  3NK2 X;  3V3O A;  2VRM A;  4A6N B;  1H82 A;  4WX1 A;  3UOX A;  3M0O A;  1D7L A;  1B8S A;  3AEB A;  4MJW A;  3VQR A;  2WP9 A;  4U8N A;  4IVO B;  1EBD A;  1FEA A;  4YTP A;  1E1N A;  2V60 A;  4X4J A;  1F6M A;  1YQ4 A;  4X9M A;  2OLN A;  1ONF A;  3HZL A;  4YKG A;  1BWC A;  5IQ4 A;  5M10 A;  3C4A A;  1K4Q A;  3GSI A;  1EL7 A;  4OPU A;  3BNM A;  5IPY A;  4Y4N A;  1OJD A;  1ELI A;  2OLO A;  3I3L A;  3UCL A;  4IVM B;  1GSN A;  1XPQ A;  2Q0L A;  1TDN A;  2BAC A;  4EIQ A;  1TDF A;  1LTX R;  5JCN A;  2TPR A;  3JSK A;  2XVJ A;  4UDQ A;  1S2Y A;  4WCT A;  1CL0 A;  2H88 A;  3DA1 A;  2J3N A;  1JNZ A;  2YLX A;  5FS7 A;  2BXS A;  1RP0 A;  4I59 A;  3NT6 A;  1OJA A;  4TLX A;  3NH3 X;  3V76 A;  2WS3 A;  4ADW A;  2W0H A;  3KPF A;  2BXR A;  3LAD A;  4U8L A;  1M64 A;  1GRT A;  4CBQ A;  3H4K A;  3P9U A;  3AD9 B;  1ZDL A;  1GEU A;  1IUX A;  4U2L A;  4PAB A;  3SFD A;  3SFE A;  1PS9 A;  3COX A;  2CFY A;  1TRB A;  4H50 A;  3SYI A;  3T2Y A;  2WPC A;  4Z26 A;  1S3B A;  2OA1 A;  1CJ2 A;  5TR3 A;  4Z24 A;  1TDE A;  2YVJ A;  4A7A A;  2YLS A;  3T0K A;  2R0C A;  2TMD A;  4J57 A;  4DNA A;  1DOB A;  1PJ7 A;  4XWR A;  4C5O A;  2C4C A;  2FJD A;  2WBA A;  1GAL A;  1GRF A;  3KVE A;  3AE8 A;  2ARD A;  3DJG X;  3UKH A;  3VR8 A;  5ER0 A;  5JCM A;  1CBO A;  3R9U A;  4EM3 A;  1IUW A;  2WHD A;  3CN8 A;  3RP7 A;  1NAA A;  1E1K A;  1P2H A;  3RP6 A;  2XLS A;  3AD7 B;  4I58 A;  1IJH A;  1Q1W A;  3AE4 A;  3UKP A;  1CC2 A;  1NG3 A;  1Y56 B;  3LJP A;  3UKK A;  3NIX A;  4CCR A;  2V6O A;  4IA5 A;  1DNC A;  1GND A;  3NHO X;  4B1B A;  1E6E A;  2B9Y A;  4DSH A;  2WET A;  1N4W A;  3AE2 A;  2R9Z A;  2YG7 A;  3B6D A;  4H4X A;  1XDI A;  1M6I A;  3GD3 A;  4LA1 A;  3SZ0 A;  3UKF A;  3VR9 A;  2JBV A;  3ABV A;  1GOS A;  4CNJ A;  4H2R A;  2YR5 A;  3NGC X;  3I6D A;  5GRT A;  1H81 A;  1H6V A;  1ZY8 A;  3D8X A;  4FX9 A;  3S5W A;  2QA2 A;  1OJC A;  4DGK A;  2QA1 A;  3AYL A;  3BI4 A;  5KMQ A;  3ZYX A;  2A8X A;  3PVC A;  1ZKQ A;  4PAA A;  3B3R A;  1EL5 A;  2XVH A;  4A5L A;  4A79 A;  2C3D A;  2JB2 A;  1XHC A;  3AEG A;  3QSE A;  1K0L A;  1GES A;  4G6G A;  1VQW A;  4BV6 A;  4CY8 A;  2C76 A;  4U8O A;  4H2N A;  1GXF A;  1PXC A;  4OPC A;  1W4X A;  3DME A;  5KRQ A;  5KOW A;  4OPD A;  4XWZ A;  5JCK A;  2JB3 A;  2YR6 A;  2C70 A;  3FBS A;  2OAL A;  4EM4 A;  4CCQ A;  1CC6 A;  2YR4 A;  2C66 A;  3UP4 A;  3BHF A;  1H84 A;  1QJD A;  1YQZ A;  4YSY A;  3SZW A;  2XVI A;  3UP5 A;  1DOE A;  1JOA A;  4DSG A;  1GRB A;  3IHG A;  4J56 A;  1GPE A;  1OJ9 A;  3M12 A;  3L8K A;  5HHF A;  3RNM A;  1PHH A;  3GYI A;  4GF7 A;  5M0Z A;  2GF3 A;  5FS8 A;  4YXD A;  1L9E A;  2C3C A;  2I0Z A;  2B76 A;  2YWL A;  3FIM B;  2F5Z A;  1H7X A;  3GWF A;  4HA6 A;  4K5S A;  4M52 A;  4NTE A;  4XXG A;  5EOW A;  3SZF A;  4USQ A;  3AE3 A;  2WQY A;  2GB0 A;  1DXL A;  2YLT A;  4K5R A;  1D4C A;  4KX6 A;  3RHA A;  5J60 A;  1N4U A;  2AAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...