4JY3A

Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase, 5-pyridoxic acid bound form
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
370
structure length
370
Chain Sequence
KTRRAEVAGGGFAGLTAAIALKQNGWDVRLHEKSSELRAFGAGIYLWHNGLRVLEGLGALDDVLQGSHTPPTYETWMHNKSVSKETFNGLPWRIMTRSHLHDALVNRARALGVDISVNSEAVAADPVGRLTLQTGEVLEADLIVGADGVGSKVRDSIGFKQDRWVSKDGLIRLIVPRMKKELGHGEWDNTIDMWNFWPRVQRILYSPCNENELYLGLMAPAADPRGSSVPIDLEVWVEMFPFLEPCLIEAAKLKTARYDKYETTKLDSWTRGKVALVGDAAHAMCPALAQGAGCAMVNAFSLSQDLEEGSSVEDALVAWETRIRPITDRCQALSGDYAANRSLSKGNMFTPAALEAARYDPLRRVYSWPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
publication title Crystal structure of 2-methyl-3-hydroxypyridine-5-carboxylic acid oxygenase
rcsb
source organism Mesorhizobium loti
molecule tags Oxidoreductase
total genus 129
structure length 370
sequence length 370
chains with identical sequence B
ec nomenclature ec 1.14.12.4: Transferred entry: 1.14.13.242.
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01494 FAD_binding_3 FAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.9.50 Alpha Beta 2-Layer Sandwich D-Amino Acid Oxidase; Chain A, domain 2 D-Amino Acid Oxidase; Chain A, domain 2 4jy3A02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4jy3A01
2E1MA 5EOWA 3UKHA 1PDHA 4RG4A 4A5LA 1N4UA 3BNUA 3PVCA 4AT2A 4H4WA 2JB2A 3CPJG 2IVEA 5JCLA 1TDOA 3NKSA 4TM3A 3LXDA 2ZZ0A 3R9UA 2VRLA 3UTFA 1JRZA 3L1RA 4ECHA 2DKHA 3H8IA 1P2HA 1TDKA 1PXAA 2XLTA 3P4QA 2Y6RA 3DK9A 2C75A 2VQ7A 2WP5A 2YR5A 4ICYA 4OCGA 2C70A 2VRMA 3CGEA 1PS9A 1Y56A 3DJDA 1GXFA 2WESA 4H4UA 3AD9B 3BI2A 4YWOA 2WDRA 4O5QA 1UKVG 1CC2A 1NHPA 2YR4A 2I0ZA 3AEAA 2Q7VA 1V59A 2B76A 4B64A 1BF3A 3B6DA 3P4SA 3NT6A 1EBDA 2OA1A 2GF3A 3UOZA 3C4AA 3BI4A 4USRA 4H4YA 3B3RA 3AE3A 4JY3A 2B9XA 3RNMA 5KOXA 2BCPA 4IVOB 4Y4LA 4BJZA 1IUUA 1FEBA 2XLRA 2RABA 2GQFA 4D03A 4OVIA 4H7UA 4OPDA 4NEWA 4JQ9A 5HHFA 3V76A 1LVLA 2FJAA 3AD7B 3IHMA 3NHOX 4M52A 1CBOA 2B9WA 5U63A 1PBFA 3CNTA 1E39A 2X3NA 3ALLA 1LPFA 2CFYA 4LU6A 2YR6A 2C72A 4REKA 3SFDA 4ZN0A 3GDNA 2B7SA 3PO7A 4KX6A 4AOSA 2BA9A 2BK4A 3PS9A 1GREA 1K4QA 3NK1X 4CY6A 4H4QA 1CJ3A 3ADAB 1BKWA 1LTXR 1ZMCA 3LZWA 4GR1A 3UP4A 4UDPA 3V3OA 1CJCA 4OPGA 1GRHA 1XANA 4B65A 5BVAA 4Z43A 3GD4A 2GQWA 2WS3A 1JRYA 1DOBA 2BYBA 4N9XA 3LJPA 1NHQA 3NK2X 1GRTA 4U2LA 3ZYXA 2YWLA 3FMWA 4RSLA 4A65A 5KOWA 1PXCA 1CJ2A 2GRTA 2ARDA 1TDFA 4JDRA 4TM1A 2BS4A 4EMWA 4YSZA 3URHA 2BCGG 2V5ZA 2OAMA 2DKIA 3DGZA 1O94A 3DK4A 1TYTA 1XPQA 3EF6A 4YXDA 1COYA 1F3PA 3CTYA 1ZK7A 4AT0A 1E1LA 2WDQA 3S5WA 4YSXA 5LV9A 1E1KA 4OPUA 4K7ZA 5TR3A 1DJQA 2Z5YA 3QJ4A 1VQWA 1H81A 4YSHA 3VRDB 3F8PA 1BGJA 2C76A 5M0ZA 3UKKA 1B5QA 1JNRA 1NG4A 4X9MA 4C5OA 4LA1A 3ZDNA 4A6NB 2QAEA 3UKQA 1MO9A 3GMCA 3AYJA 2XDOA 3Q6JA 1IUTA 1GTEA 2WDVA 3GRTA 2V3AA 1K0LA 1K0JA 2EQ8A 3GYJA 2Q6UA 3ALJA 1GRFA 1YKJA 4A7AA 3NH3X 2BC1A 1D7YA 1H6VA 2J3NA 3AYIA 2XVFA 4IA5A 2HQMA 4A9WA 3CNJA 3ALMA 2YVFA 5FS6A 1FCDA 2C3CA 1PXBA 4C77A 4APNA 3VRAA 1GT8A 1EL8A 3CNPA 4RG3A 2XFUA 1XHCA 4OPCA 1TRBA 1TDEA 3IF9A 1ZX9A 2VVLA 2X8CA 2XVIA 1NENA 2OALA 1Y0PA 4NTDA 3GMBA 2WP6A 3AE1A 3CGBA 1S3BA 2JBVA 4CNJA 2XLPA 3HZLA 3GSIA 3GYIA 2V6OA 4YKFA 3UKFA 1L9DA 3P9UA 4EQSA 3EANA 4X4JA 3UOYA 4XWRA 3AE4A 1BWCA 4Y4NA 1ZOVA 3AECA 4JNAA 3AE7A 5BUKA 4U8MA 3LADA 3REDA 1N1PA 1VDCA 1D7LA 1F8WA 1KF6A 1K0IA 2CDUA 2VVLG 1GETA 3E1TA 3ATRA 4C3YA 4DSHA 4B67A 1JU2A 2YLZA 4B63A 2Z5XA 2B9YA 4HA6A 2AR8A 1M6IA 3K30A 1Q1RA 4ZCCA 3O0HA 5C2TA 5J60A 2XLSA 2GVCA 4D04A 4NTEA 1GALA 1PHHA 2TPRA 2C3DA 4JY2A 4TM0A 1GNDA 2C64A 2WQYA 4J36A 2GB0A 2H89A 2R0CA 4YTNA 5IQ4A 3NTAA 4H4XA 5FMHA 1ZKQA 3SM8A 4FDCB 2JK6A 5KWFA 3RP8A 2ZZCA 1CF3A 1NEKA 1B4VA 2FJBA 1GRBA 1H83A 4H4ZA 3SQPA 3AEEA 2YQUA 4JNQA 1EL9A 2GMHA 1CL0A 2GAHB 4A79A 4K5RA 2R4JA 3ATQA 1BZLA 1CC4A 4IV9A 1LQUA 1NHRA 3K7QX 3P4RA 4Z26A 1GSNA 1MOKA 3BNMA 5GRTA 2A89A 3QVPA 1GRAA 2GR1A 5L46A 1OJDA 3UTGA 2H88A 5U25A 4AP3A 3M13A 5C3JA 1DNCA 1CHUA 2WOIA 5JCIA 3F8RA 4Z25A 3Q9TA 4H4VA 2YLSA 4H4SA 5CKUA 4U8JA 1CC6A 1B8SA 4EQRA 4Z2UA 2FJEA 3D1CA 4UDQA 2WPCA 1KSSA 3NYEA 4K22A 2Y6QA 3WE0A 2RGJA 4YKGA 1GERA 2GR2A 2PYXA 2QCUA 4Z2TA 3H8LA 1VG0A 3AE5A 1TYPA 2R4EA 1JEHA 3DGHA 3IC9A 1E7PA 3DJGX 1GTHA 3I3LA 2YM1A 3IWAA 1YQZA 1REOA 4YTPA 3AYLA 2GR0A 1JNZA 4WX1A 1KDGA 2JB1A 3QFBA 4BURA 1GV4A 4E0VA 1ZDLA 2A87A 2BXSA 2YVGA 4JN9A 2WHDA 1KNRA 2WPEA 2WP9A 2UZZA 2E4GA 3ITJA 3P4PA 2VVMA 1M64A 3ABVA 4LIIA 4H2NA 1E1NA 1LV0A 1NAAA 3UKAA 2CULA 2B7RA 1IJHA 2ZZBA 3UTEA 3G5QA 2RGHA 2R9ZA 5CQFA 3DMEA 1AOGA 5M10A 1F6MA 2WETA 1IUWA 2R0PA 4C74A 3CPHG 1GEUA 1YQ4A 5FS9A 2Q0KA 4GF7A 1QO8A 2XVHA 3KVEA 4FK1C 4NZHA 4EM4A 4K5SA 1FEAA 3QVRA 5HY5A 1O95A 1PJ5A 4GCMA 3FIMB 3UOVA 1PN0A 1DOEA 3ISHA 4U8IA 1XDIA 3G5RA 1DOCA 1F8SA 1OJAA 2WPFA 2QA2A 2YG7A 3IHGA 5JCMA 2WOVA 2BACA 2IIDA 2IVDA 3LOVA 4K8DA 3AE6A 1S2YA 3NTDA 5HYMA 1E1MA 1D5TA 3NG7X 4J33A 4GRTA 3I6DA 4KPRA 1N4VA 3SFEA 2XVJA 3C96A 4XWZA 4AOXA 4YT0A 1E6EA 1GPEA 1PJ6A 2XFNA 4CRTA 1PBCA 1PJ7A 3QFAA 2YLRA 3GD3A 1OJ9A 4BK2A 5BRTA 4K2XA 4UDRA 4EM3A 2JAEA 4J57A 5HXIA 3P1WA 4CCQA 1H84A 1Y56B 2TMDA 1FECA 1PBBA 2C7GA 3CGDA 3BI5A 3FG2P 4A6NA 1X31B 4J56A 4IA6A 1O5WA 4PAAA 2WU5A 4U8LA 3NK0X 3AE2A 4X9NA 2BXRA 1HYUA 2YLTA 3CIRA 3DK8A 1KNPA 4UP3A 4USQA 3UP5A 3BHFA 2FBWA 1DJNA 2BS2A 5BULA 2CVJA 3ICSA 4J31A 4A99A 1P2EA 3COXA 4OPLA 3GWDA 4TM4A 1BGNA 3AEDA 1TDNA 2Q0LA 2C65A 1W4XA 2FJDA 1B37A 1DODA 4FX9A 4YTMA 4CCRA 4DNAA 2W0HA 3GWFA 3UKPA 1Q9IA 4IVMB 3CNDA 4TLZA 3K7MX 3AEBA 3BHKA 2RGOA 3OZ2A 4EIQA 4GUVA 4P9SA 4DSGA 2A8XA 2GR3A 3M0OA 5DBJA 1PBDA 4B66A 4U2SA 3KD9A 1EL5A 4Z2RA 3K7TA 3KA7A 4H2QA 2GV8A 5J7XA 1L9CA 3NGCX 2ZBWA 3UCLA 1NHSA 2ACZA 2R0GA 3KLJA 2GAGB 4FK1A 3DJJA 4YSYA 1ZY8A 3CN8A 3DA1A 3DH9A 3AE9A 1NPXA 3FBSA 2F5ZA 2EQ7A 3AXBA 4CNKA 5JCKA 3NN0X 1RYIA 5KVHA 3RP6A 1JOAA 2YLWA 2BK3A 4DGKA 2O9ZA 1GESA 1IUSA 1ZMDA 2WBAA 3NLCA 3GDPA 2WU2A 1VRQB 2XYOA 2GMJA 3VQRA 4NEVA 1PBEA 2YG6A 4CY8A 3UOXA 1EL7A 4TLXA 3CGCA 3AB1A 3G5SA 3VRBA 3CPIG 2AQJA 2V61A 2X50A 1Q1WA 3AEGA 2GEWA 1OJCA 4H4TA 4H2RA 3VR9A 3H4KA 3L8KA 5IPYA 2NPXA 1D4CA 3CNSA 5EB4A 5GSNA 1KSUA 4EQXA 4PABA 4BJYA 3C4NA 1S3EA 1IUXA 1QLBA 1IUVA 4GDEA 3QSMA 4GDPA 2YVJA 2GH5A 3LZXA 3VR8A 2EQ6A 1KFYA 3OC4A 1LJ1A 5KXJA 3AE8A 1ONFA 4Z44A 3D8XA 3S61A 1YQ3A 3KU9A 2YG3A 2OLOA 2XVEA 1YY5A 2WEUA 4B69A 3GRSA 1ELIA 3QSEA 4HB9A 1JRXA 1FOHA 4U2TA 3RHAA 2X8GA 2E5VA 3NNEA 3NYCA 4J34A 4EMJA 1CJ4A 2APGA 2OLNA 4BV6A 2VQBA 2NVKX 3NIXA 1FL2A 4C3XA 4O5UA 4OPIA 4U8KA 2X8HA 2BC0A 2JKCA 4I58A 3KKJA 2R46A 2C67A 3NRNA 1OJTA 4U8NA 4B68A 2YG5A 2QA1A 1H7WA 5FS8A 3DJEA 1D4DA 4H2PA 1H82A 1SEZA 1Z6LA 2WOWA 3FPZA 3NYFA 3EAOA 1VG9A 3RP7A 2YG4A 4ADWA 1H86A 2AAQA 2YM2A 4MJWA 4EIPA 2VOUA 2XFOA 1D4EA 3SGLA 2BS3A 4H4PA 4OPTA 3JSKA 3ICRA 2YLXA 3EPTA 1S2QA 4XXGA 4AP1A 4BK3A 2XLUA 1DXLA 3LB8A 5U1OA 3F8DA 4EQWA 4EMIA 3II4A 5JCNA 4H50A 1NG3A 3AD8B 5EB5A 2YAUA 4H4RA 5KVIA 4BK1A 5IQ1A 4Y4MA 3V3NA 3AWIA 4U8OA 2JB3A 3AEFA 1ZOYA 2XCGA 3UKLA 1GOSA 4NTCA 2X99A 3M12A 1RP0A 2PHHA 1N4WA 5KRQA 4ZCDA 2BABA 2C66A 3UTHA 1LQTA 2XFQA 1L9EA 2XFPA 1H7XA 4I59A 1NDAA 5EBKA 1RSGA 2C73A 3NN6X 1QJDA 2BK5A 3QSSA 4J2WA 2EQ9A 4CBQA 5FS7A 4WCTA 1L0VA 1ZP0A 4U8PA 3KPFA 4B1BA 2V60A 3T37A 5ER0A 3ICTA 2VZ2A 1MXTA 2V3BA 2R45A 1F8RA 1GRGA 4Z24A
chains in the Genus database with same CATH superfamily
2E1MA 5EOWA 3UKHA 1PDHA 4RG4A 3SX6A 3SXIA 4A5LA 1N4UA 3BNUA 3PVCA 4AT2A 4H4WA 2JB2A 3CPJG 3T2YA 2IVEA 5JCLA 1TDOA 3NKSA 4TM3A 2E48A 3LXDA 2ZZ0A 3R9UA 2VRLA 3UTFA 1JRZA 3L1RA 4ECHA 2DKHA 3H8IA 1P2HA 1TDKA 1PXAA 2XLTA 3P4QA 2Y6RA 3DK9A 2C75A 2VQ7A 2WP5A 2YR5A 4ICYA 4OCGA 2C70A 2VRMA 3CGEA 1PS9A 3DJDA 4YJGB 1Y56A 1GXFA 2WESA 4H4UA 3AD9B 3W4KA 3BI2A 4YWOA 2WDRA 4O5QA 1UKVG 4YJFA 1CC2A 1NHPA 2YR4A 2I0ZA 3CUKA 2Q7VA 3AEAA 1V59A 2B76A 3SZWA 1BF3A 4B64A 3B6DA 3P4SA 4YJHB 3NT6A 1EBDA 2OA1A 2GF3A 3UOZA 3C4AA 3BI4A 4GAPA 4USRA 4H4YA 3B3RA 3AE3A 4JY3A 2B9XA 3RNMA 5KOXA 2BCPA 4IVOB 4Y4LA 4BJZA 1IUUA 1FEBA 5KMQA 2XLRA 2RABA 2GQFA 4D03A 4OVIA 4H7UA 4OPDA 4NEWA 4JQ9A 5HHFA 3V76A 1LVLA 2FJAA 3AD7B 3IHMA 3NHOX 4M52A 1CBOA 2B9WA 5U63A 1PBFA 3CNTA 1E39A 4G9KA 2X3NA 3ALLA 1LPFA 2CFYA 4LU6A 2YR6A 2C72A 4REKA 3SFDA 4ZN0A 3GDNA 2B7SA 3PO7A 4KX6A 4AOSA 3PS9A 2BA9A 2BK4A 1GREA 1K4QA 3NK1X 4CY6A 4H4QA 1CJ3A 3ADAB 1BKWA 1LTXR 1ZMCA 3LZWA 4GR1A 3UP4A 4G74A 4UDPA 3V3OA 1CJCA 4OPGA 1GRHA 1XANA 4B65A 5BVAA 4Z43A 3GD4A 2GQWA 2WS3A 1JRYA 1DOBA 2BYBA 4N9XA 3LJPA 1NHQA 3NK2X 1GRTA 4U2LA 3ZYXA 2YWLA 4RSLA 3FMWA 4A65A 5KOWA 1PXCA 1CJ2A 2GRTA 2ARDA 1TDFA 4JDRA 4TM1A 2BS4A 4EMWA 4YSZA 4G6HA 3URHA 2BCGG 3SYIA 2V5ZA 2OAMA 2DKIA 3DGZA 1O94A 3DK4A 1TYTA 1XPQA 3EF6A 4YXDA 1COYA 1F3PA 3CTYA 1ZK7A 3ZNQA 4AT0A 1E1LA 2WDQA 3S5WA 4YSXA 5LV9A 1E1KA 4OPUA 4K7ZA 5TR3A 1DJQA 2Z5YA 3QJ4A 1VQWA 1H81A 4YSHA 3VRDB 3F8PA 1BGJA 2C76A 5M0ZA 3UKKA 1B5QA 1NG4A 4X9MA 3WGTA 1JNRA 4C5OA 4LA1A 3ZDNA 4A6NB 2QAEA 3UKQA 1MO9A 3GMCA 3AYJA 2XDOA 3Q6JA 1IUTA 1GTEA 2WDVA 3GRTA 2V3AA 1K0LA 1K0JA 2EQ8A 3GYJA 2Q6UA 3ALJA 1YKJA 1GRFA 4A7AA 3NH3X 2BC1A 4IA5A 1D7YA 1H6VA 2J3NA 2XVFA 3AYIA 2HQMA 4A9WA 3CNJA 3ALMA 2YVFA 5FS6A 1FCDA 2C3CA 1PXBA 4C77A 4APNA 3VRAA 1GT8A 1EL8A 3CNPA 4RG3A 2XFUA 2BRYA 1XHCA 4OPCA 1TRBA 1TDEA 3IF9A 1ZX9A 2VVLA 2X8CA 2XVIA 1NENA 2OALA 1Y0PA 4NTDA 3GMBA 2WP6A 3AE1A 3CGBA 1S3BA 2JBVA 4CNJA 2XLPA 3HZLA 3GSIA 3GYIA 2V6OA 4YKFA 3UKFA 1L9DA 3HYVA 3P9UA 4EQSA 3EANA 4X4JA 3UOYA 4XWRA 3AE4A 1BWCA 4Y4NA 1ZOVA 3AECA 4JNAA 3AE7A 5BUKA 4U8MA 3LADA 3REDA 1N1PA 1VDCA 1D7LA 1F8WA 1KF6A 1K0IA 2CDUA 2VVLG 1GETA 3E1TA 3ATRA 4C3YA 4DSHA 4B67A 2DU8A 1JU2A 2YLZA 4B63A 2Z5XA 2B9YA 4HA6A 2AR8A 1M6IA 3K30A 1Q1RA 4ZCCA 3O0HA 5C2TA 5J60A 2XLSA 2GVCA 4D04A 4NTEA 1GALA 1PHHA 2TPRA 2C3DA 4JY2A 4TM0A 1GNDA 2C64A 2WQYA 3G3EA 2GB0A 4J36A 2H89A 2R0CA 4YTNA 4YJDA 5IQ4A 3NTAA 4H4XA 1EVIA 5FMHA 1ZKQA 3SM8A 4FDCB 2JK6A 5KWFA 3RP8A 2ZZCA 1CF3A 1NEKA 1B4VA 2FJBA 1GRBA 1H83A 4H4ZA 3SQPA 3AEEA 2YQUA 4JNQA 3SY4A 1EL9A 2GMHA 2GAHB 1CL0A 4A79A 4K5RA 2R4JA 3ATQA 1BZLA 1CC4A 4IV9A 1LQUA 1NHRA 3K7QX 3P4RA 4Z26A 1GSNA 1MOKA 3BNMA 5GRTA 2A89A 3QVPA 5KMRA 5L46A 1GRAA 2GR1A 1OJDA 3UTGA 2H88A 5U25A 3SZ0A 3M13A 4AP3A 5C3JA 1DNCA 1CHUA 2WOIA 5JCIA 3F8RA 4Z25A 3Q9TA 4H4VA 2YLSA 4H4SA 5CKUA 4YJGA 4U8JA 1CC6A 1B8SA 4EQRA 4Z2UA 2FJEA 3D1CA 4UDQA 3NYEA 1KSSA 2WPCA 3SZFA 4NWZA 4K22A 2E49A 2Y6QA 3WE0A 2RGJA 4YKGA 1GERA 2GR2A 2PYXA 2QCUA 4Z2TA 3H8LA 1VG0A 3AE5A 4G6GA 1TYPA 2R4EA 1JEHA 3DGHA 3IC9A 1E7PA 4YJHA 3DJGX 1GTHA 3I3LA 2YM1A 3IWAA 1YQZA 1REOA 4YTPA 3AYLA 2GR0A 1VE9A 1JNZA 4WX1A 1KDGA 2JB1A 3QFBA 4BURA 1GV4A 4E0VA 1ZDLA 2A87A 2BXSA 2YVGA 4JN9A 2WHDA 1KNRA 2WPEA 2WP9A 2UZZA 2E4GA 3ITJA 3P4PA 2VVMA 1M64A 3ABVA 3T14A 4LIIA 4H2NA 1E1NA 1LV0A 1NAAA 3UKAA 2CULA 2B7RA 1IJHA 2ZZBA 1C0KA 3UTEA 3G5QA 2RGHA 2R9ZA 5CQFA 3DMEA 1AOGA 5M10A 1F6MA 2WETA 1IUWA 2R0PA 4C74A 3CPHG 1GEUA 1YQ4A 5FS9A 2Q0KA 4GF7A 1QO8A 2XVHA 3KVEA 4FK1C 4NZHA 3SZCA 4EM4A 4K5SA 1FEAA 3QVRA 5HY5A 1PJ5A 1O95A 4GCMA 3FIMB 3UOVA 1PN0A 1DOEA 3ISHA 4U8IA 1XDIA 3G5RA 3ZNNA 1DOCA 1F8SA 1OJAA 2WPFA 2QA2A 2YG7A 3IHGA 5JCMA 2WOVA 2BACA 2IIDA 2IVDA 4QFCA 3LOVA 4K8DA 3AE6A 1S2YA 3NTDA 5HYMA 1E1MA 1D5TA 3NG7X 4J33A 4GRTA 3I6DA 4KPRA 1N4VA 3SFEA 2XVJA 3C96A 4XWZA 4AOXA 4YT0A 1E6EA 1GPEA 1PJ6A 2XFNA 4CRTA 1PBCA 1PJ7A 3QFAA 4BK2A 2YLRA 1OJ9A 3GD3A 5BRTA 4K2XA 4UDRA 4EM3A 2JAEA 4J57A 5HXIA 3P1WA 4CCQA 1Y56B 1H84A 2TMDA 1PBBA 1FECA 2C7GA 3CGDA 3BI5A 3FG2P 4A6NA 1X31B 4X9NA 4IA6A 1O5WA 4PAAA 2WU5A 4J56A 3NK0X 3AE2A 4YJFB 2BXRA 4G73A 4U8LA 1HYUA 4QFDA 2YLTA 3CIRA 3DK8A 1KNPA 4UP3A 4USQA 3UP5A 3BHFA 2FBWA 1DJNA 2BS2A 5BULA 2CVJA 3ICSA 3T0KA 4J31A 3ZNPA 1P2EA 3COXA 4OPLA 3GWDA 4A99A 4TM4A 1BGNA 3AEDA 1TDNA 2Q0LA 2C65A 1W4XA 2FJDA 1DODA 1B37A 4FX9A 4YTMA 4CCRA 4DNAA 2W0HA 3GWFA 3UKPA 1Q9IA 4IVMB 1KIFA 3CNDA 4TLZA 3K7MX 3AEBA 3BHKA 2RGOA 3OZ2A 4EIQA 4GUVA 4P9SA 4DSGA 2A8XA 4II2A 3M0OA 2GR3A 5DBJA 1PBDA 4B66A 4U2SA 3KD9A 1EL5A 4Z2RA 3K7TA 3KA7A 4H2QA 2GV8A 5J7XA 1L9CA 3NGCX 2ZBWA 3UCLA 1NHSA 2ACZA 2R0GA 3KLJA 2GAGB 4FK1A 3DJJA 4YSYA 1ZY8A 3DA1A 3CN8A 3DH9A 3AE9A 1AN9A 1NPXA 3FBSA 3CMMA 2F5ZA 2EQ7A 3AXBA 4CNKA 5JCKA 3NN0X 1RYIA 5KVHA 2E82A 3RP6A 1JOAA 5KNLA 2YLWA 2BK3A 4DGKA 2O9ZA 1GESA 1IUSA 1ZMDA 2WBAA 3NLCA 3GDPA 2WU2A 1DAOA 1VRQB 2XYOA 2GMJA 2E4AA 3VQRA 4NEVA 1PBEA 2YG6A 4CY8A 3UOXA 1EL7A 4TLXA 3CGCA 3AB1A 3G5SA 3VRBA 3CPIG 2AQJA 2V61A 2X50A 1Q1WA 3AEGA 2GEWA 1OJCA 4H4TA 4H2RA 3VR9A 3H4KA 3L8KA 5IPYA 2NPXA 1D4CA 3CNSA 5EB4A 5GSNA 1KSUA 4EQXA 4PABA 4BJYA 3C4NA 3W4JA 1IUXA 1QLBA 1IUVA 1S3EA 3QSMA 4GDEA 4GDPA 4II3A 2YVJA 2GH5A 1C0LA 3LZXA 3VR8A 2EQ6A 1KFYA 3OC4A 1LJ1A 5KXJA 3AE8A 1ONFA 4Z44A 3D8XA 3S61A 3T2ZA 1YQ3A 3KU9A 2YG3A 2OLOA 2XVEA 1YY5A 2WEUA 4B69A 3GRSA 1ELIA 1C0PA 3QSEA 4HB9A 1JRXA 1FOHA 4U2TA 3RHAA 2X8GA 2E5VA 3NNEA 3NYCA 4J34A 4EMJA 1CJ4A 2APGA 2OLNA 4BV6A 2VQBA 2NVKX 3NIXA 1FL2A 4C3XA 4O5UA 4OPIA 4U8KA 2X8HA 2BC0A 2JKCA 4I58A 3KKJA 2R46A 2C67A 3NRNA 1OJTA 4U8NA 4B68A 5KMSA 2YG5A 2QA1A 1H7WA 5FS8A 3DJEA 1D4DA 4H2PA 1H82A 3NYFA 1SEZA 1Z6LA 2WOWA 3FPZA 3RP7A 1VG9A 3EAOA 3T2KA 2YG4A 4ADWA 1H86A 2AAQA 2YM2A 4MJWA 2VOUA 4EIPA 2XFOA 1D4EA 3SGLA 3W4IA 2BS3A 4H4PA 3JSKA 4OPTA 3ICRA 2YLXA 3EPTA 1S2QA 4XXGA 4BK3A 4AP1A 2XLUA 1DXLA 3LB8A 5U1OA 3F8DA 4EQWA 4NNJA 3II4A 4EMIA 5JCNA 4H50A 1NG3A 3AD8B 5EB5A 4BK1A 2YAUA 4GAVA 4H4RA 5IQ1A 5KVIA 5KMPA 4Y4MA 3V3NA 3AWIA 4U8OA 2JB3A 3AEFA 1ZOYA 2XCGA 3GYXA 3HYXA 3UKLA 1C0IA 1GOSA 3T31A 3KPKA 4NTCA 3M12A 2X99A 1RP0A 2PHHA 1N4WA 2C4CA 4ZCDA 2BABA 2C66A 1DDOA 3UTHA 1LQTA 5KRQA 2XFQA 1L9EA 2XFPA 1H7XA 4I59A 1NDAA 5EBKA 1RSGA 2C73A 3NN6X 3QSSA 1QJDA 2BK5A 4J2WA 2EQ9A 4CBQA 5FS7A 4WCTA 1L0VA 1ZP0A 4U8PA 3KPFA 4B1BA 2V60A 3T37A 5ER0A 3ICTA 3ZNOA 2VZ2A 1MXTA 3HYWA 2V3BA 2R45A 2BRAA 1F8RA 1GRGA 4Z24A
chains in the Genus database with same CATH topology
2E1MA 5EOWA 3UKHA 1PDHA 4RG4A 3SX6A 3SXIA 4A5LA 1N4UA 3BNUA 3PVCA 4AT2A 4H4WA 2JB2A 3CPJG 3T2YA 2IVEA 5JCLA 1TDOA 3NKSA 4TM3A 3LXDA 2ZZ0A 3R9UA 2VRLA 3UTFA 1JRZA 3L1RA 4ECHA 2DKHA 3H8IA 1P2HA 1TDKA 1PXAA 2XLTA 3P4QA 2Y6RA 3DK9A 2C75A 2VQ7A 2WP5A 2YR5A 4ICYA 4OCGA 2C70A 2VRMA 3CGEA 1PS9A 1Y56A 3DJDA 1GXFA 2WESA 4H4UA 3AD9B 3BI2A 4YWOA 2WDRA 4O5QA 1UKVG 1CC2A 1NHPA 2YR4A 2I0ZA 3AEAA 2Q7VA 1V59A 2B76A 3SZWA 1BF3A 4B64A 3B6DA 3P4SA 3NT6A 1EBDA 2OA1A 2GF3A 3UOZA 3C4AA 3BI4A 4GAPA 4USRA 4H4YA 3B3RA 3AE3A 4JY3A 2B9XA 3RNMA 5KOXA 2BCPA 4IVOB 4Y4LA 4BJZA 1IUUA 1FEBA 5KMQA 2XLRA 2RABA 2GQFA 4D03A 4OVIA 4H7UA 4OPDA 4NEWA 4JQ9A 5HHFA 3V76A 1LVLA 2FJAA 3IHMA 3AD7B 3NHOX 4M52A 1CBOA 2B9WA 5U63A 1PBFA 3CNTA 1E39A 4G9KA 2X3NA 3ALLA 1LPFA 2CFYA 4LU6A 2YR6A 2C72A 4REKA 3SFDA 4ZN0A 3GDNA 2B7SA 3PO7A 4KX6A 4AOSA 2BA9A 2BK4A 3PS9A 1GREA 1K4QA 3NK1X 4CY6A 4H4QA 1CJ3A 3ADAB 1BKWA 1LTXR 1ZMCA 3LZWA 4GR1A 3UP4A 4G74A 4UDPA 3V3OA 1CJCA 4OPGA 1GRHA 1XANA 4B65A 5BVAA 4Z43A 3GD4A 2GQWA 2WS3A 1JRYA 1DOBA 2BYBA 4N9XA 3LJPA 1NHQA 3NK2X 1GRTA 4U2LA 3ZYXA 2YWLA 3FMWA 4RSLA 4A65A 5KOWA 1PXCA 1CJ2A 2GRTA 2ARDA 1TDFA 4JDRA 4TM1A 2BS4A 4EMWA 4YSZA 4G6HA 3URHA 2BCGG 3SYIA 2V5ZA 2OAMA 2DKIA 3DGZA 1O94A 3DK4A 1TYTA 1XPQA 3EF6A 4YXDA 1COYA 1F3PA 3CTYA 1ZK7A 4AT0A 1E1LA 2WDQA 3S5WA 4YSXA 5LV9A 1E1KA 4OPUA 4K7ZA 5TR3A 1DJQA 2Z5YA 3QJ4A 1VQWA 1H81A 4YSHA 3VRDB 3F8PA 1BGJA 2C76A 5M0ZA 3UKKA 1B5QA 1JNRA 1NG4A 4X9MA 4C5OA 4LA1A 3ZDNA 4A6NB 2QAEA 3UKQA 1MO9A 3GMCA 3AYJA 2XDOA 3Q6JA 1IUTA 1GTEA 2WDVA 3GRTA 2V3AA 1K0LA 1K0JA 2EQ8A 3GYJA 2Q6UA 3ALJA 1GRFA 1YKJA 4A7AA 3NH3X 2BC1A 4IA5A 1D7YA 1H6VA 2J3NA 2XVFA 3AYIA 2HQMA 4A9WA 3CNJA 3ALMA 2YVFA 5FS6A 1FCDA 2C3CA 1PXBA 4C77A 4APNA 3VRAA 1GT8A 1EL8A 3CNPA 4RG3A 2XFUA 2BRYA 1XHCA 4OPCA 1TRBA 1TDEA 3IF9A 1ZX9A 2VVLA 2X8CA 2XVIA 1NENA 2OALA 1Y0PA 4NTDA 3GMBA 2WP6A 3AE1A 3CGBA 1S3BA 2JBVA 4CNJA 2XLPA 3HZLA 3GSIA 3GYIA 2V6OA 4YKFA 3UKFA 1L9DA 3HYVA 3P9UA 4EQSA 3EANA 4X4JA 3UOYA 4XWRA 3AE4A 1BWCA 4Y4NA 1ZOVA 3AECA 4JNAA 3AE7A 5BUKA 4U8MA 3LADA 3REDA 1N1PA 1VDCA 1D7LA 1F8WA 1KF6A 1K0IA 2CDUA 2VVLG 1GETA 3E1TA 3ATRA 4C3YA 4DSHA 4B67A 1JU2A 2YLZA 4B63A 2Z5XA 2B9YA 4HA6A 2AR8A 1M6IA 3K30A 1Q1RA 4ZCCA 3O0HA 5C2TA 5J60A 2XLSA 2GVCA 4D04A 4NTEA 1GALA 1PHHA 2TPRA 2C3DA 4JY2A 4TM0A 1GNDA 2C64A 2WQYA 4J36A 2GB0A 2H89A 2R0CA 4YTNA 5IQ4A 3NTAA 4H4XA 5FMHA 1ZKQA 3SM8A 4FDCB 2JK6A 5KWFA 3RP8A 2ZZCA 1CF3A 1NEKA 1B4VA 2FJBA 1GRBA 1H83A 4H4ZA 3SQPA 3AEEA 2YQUA 4JNQA 3SY4A 1EL9A 2GMHA 1CL0A 2GAHB 4A79A 4K5RA 2R4JA 3ATQA 1BZLA 1CC4A 4IV9A 1LQUA 1NHRA 3K7QX 3P4RA 4Z26A 1GSNA 1MOKA 3BNMA 5GRTA 2A89A 3QVPA 5KMRA 1GRAA 2GR1A 5L46A 1OJDA 3UTGA 2H88A 5U25A 3SZ0A 3M13A 4AP3A 5C3JA 1DNCA 1CHUA 2WOIA 5JCIA 3F8RA 4Z25A 3Q9TA 4H4VA 2YLSA 4H4SA 5CKUA 4U8JA 1CC6A 1B8SA 4EQRA 4Z2UA 2FJEA 3D1CA 4UDQA 2WPCA 1KSSA 3NYEA 3SZFA 4NWZA 4K22A 2Y6QA 3WE0A 2RGJA 4YKGA 1GERA 2GR2A 2PYXA 2QCUA 4Z2TA 3H8LA 1VG0A 3AE5A 4G6GA 1TYPA 2R4EA 1JEHA 3DGHA 3IC9A 1E7PA 3DJGX 1GTHA 3I3LA 2YM1A 3IWAA 1YQZA 1REOA 4YTPA 3AYLA 2GR0A 1JNZA 4WX1A 1KDGA 2JB1A 3QFBA 4BURA 1GV4A 4E0VA 1ZDLA 2A87A 2BXSA 2YVGA 4JN9A 2WHDA 1KNRA 2WPEA 2WP9A 2UZZA 2E4GA 3ITJA 3P4PA 2VVMA 1M64A 3ABVA 3T14A 4LIIA 4H2NA 1E1NA 1LV0A 1NAAA 3UKAA 2CULA 2B7RA 1IJHA 2ZZBA 3UTEA 3G5QA 2RGHA 2R9ZA 5CQFA 3DMEA 1AOGA 5M10A 1F6MA 2WETA 1IUWA 2R0PA 4C74A 3CPHG 1GEUA 1YQ4A 5FS9A 2Q0KA 4GF7A 1QO8A 2XVHA 3KVEA 4FK1C 4NZHA 3SZCA 4EM4A 4K5SA 1FEAA 3QVRA 5HY5A 1O95A 1PJ5A 4GCMA 3FIMB 3UOVA 1PN0A 1DOEA 3ISHA 4U8IA 1XDIA 3G5RA 1DOCA 1F8SA 1OJAA 2WPFA 2QA2A 2YG7A 3IHGA 5JCMA 2WOVA 2BACA 2IIDA 2IVDA 3LOVA 4K8DA 3AE6A 1S2YA 3NTDA 5HYMA 1E1MA 1D5TA 3NG7X 4J33A 4GRTA 3I6DA 4KPRA 1N4VA 3SFEA 2XVJA 3C96A 4XWZA 4AOXA 4YT0A 1E6EA 1GPEA 1PJ6A 2XFNA 4CRTA 1PBCA 1PJ7A 3QFAA 4BK2A 2YLRA 1OJ9A 3GD3A 5BRTA 4K2XA 4UDRA 4EM3A 2JAEA 4J57A 5HXIA 3P1WA 4CCQA 1H84A 1Y56B 2TMDA 1FECA 1PBBA 2C7GA 3CGDA 3BI5A 3FG2P 4A6NA 1X31B 4J56A 4IA6A 1O5WA 4PAAA 2WU5A 4U8LA 3NK0X 3AE2A 4X9NA 2BXRA 4G73A 1HYUA 2YLTA 3CIRA 3DK8A 1KNPA 4UP3A 4USQA 3UP5A 3BHFA 2FBWA 1DJNA 2BS2A 5BULA 2CVJA 3ICSA 3T0KA 4J31A 4A99A 1P2EA 3COXA 4OPLA 3GWDA 4TM4A 1BGNA 3AEDA 1TDNA 2Q0LA 2C65A 1W4XA 2FJDA 1B37A 1DODA 4FX9A 4YTMA 4CCRA 4DNAA 2W0HA 3GWFA 3UKPA 1Q9IA 4IVMB 3CNDA 4TLZA 3K7MX 3AEBA 3BHKA 2RGOA 3OZ2A 4EIQA 4GUVA 4P9SA 4DSGA 2A8XA 4II2A 2GR3A 3M0OA 5DBJA 1PBDA 4B66A 4U2SA 3KD9A 1EL5A 4Z2RA 3K7TA 3KA7A 4H2QA 2GV8A 5J7XA 1L9CA 3NGCX 2ZBWA 3UCLA 1NHSA 2ACZA 2R0GA 3KLJA 2GAGB 4FK1A 3DJJA 4YSYA 1ZY8A 3CN8A 3DA1A 3DH9A 3AE9A 1NPXA 3FBSA 3CMMA 2F5ZA 2EQ7A 3AXBA 4CNKA 5JCKA 3NN0X 1RYIA 5KVHA 3RP6A 1JOAA 5KNLA 2YLWA 2BK3A 4DGKA 2O9ZA 1GESA 1IUSA 1ZMDA 2WBAA 3NLCA 3GDPA 2WU2A 1VRQB 2XYOA 2GMJA 3VQRA 4NEVA 1PBEA 2YG6A 4CY8A 3UOXA 1EL7A 4TLXA 3CGCA 3AB1A 3G5SA 3VRBA 3CPIG 2AQJA 2V61A 2X50A 1Q1WA 3AEGA 2GEWA 1OJCA 4H4TA 4H2RA 3VR9A 3H4KA 3L8KA 5IPYA 2NPXA 1D4CA 3CNSA 5EB4A 5GSNA 1KSUA 4EQXA 4PABA 4BJYA 3C4NA 1S3EA 1IUXA 1QLBA 1IUVA 4GDEA 3QSMA 4GDPA 4II3A 2YVJA 2GH5A 3LZXA 3VR8A 2EQ6A 1KFYA 3OC4A 1LJ1A 5KXJA 3AE8A 1ONFA 4Z44A 3D8XA 3S61A 3T2ZA 1YQ3A 3KU9A 2YG3A 2OLOA 2XVEA 1YY5A 2WEUA 4B69A 3GRSA 1ELIA 3QSEA 4HB9A 1JRXA 1FOHA 4U2TA 3RHAA 2X8GA 2E5VA 3NNEA 3NYCA 4J34A 4EMJA 1CJ4A 2APGA 2OLNA 4BV6A 2VQBA 2NVKX 3NIXA 1FL2A 4C3XA 4O5UA 4OPIA 4U8KA 2X8HA 2BC0A 2JKCA 4I58A 3KKJA 2R46A 2C67A 3NRNA 1OJTA 4U8NA 4B68A 5KMSA 2YG5A 2QA1A 1H7WA 5FS8A 3DJEA 1D4DA 4H2PA 1H82A 1SEZA 1Z6LA 2WOWA 3FPZA 3NYFA 3RP7A 1VG9A 3EAOA 3T2KA 2YG4A 4ADWA 1H86A 2AAQA 2YM2A 4MJWA 2VOUA 4EIPA 2XFOA 1D4EA 3SGLA 2BS3A 4H4PA 4OPTA 3JSKA 3ICRA 2YLXA 3EPTA 1S2QA 4XXGA 4BK3A 4AP1A 2XLUA 1DXLA 3LB8A 5U1OA 3F8DA 4EQWA 4NNJA 3II4A 4EMIA 5JCNA 4H50A 1NG3A 3AD8B 5EB5A 4BK1A 2YAUA 4GAVA 4H4RA 5IQ1A 5KVIA 5KMPA 4Y4MA 3V3NA 3AWIA 4U8OA 2JB3A 3AEFA 1ZOYA 2XCGA 3GYXA 3HYXA 3UKLA 1GOSA 3T31A 3KPKA 4NTCA 2X99A 3M12A 1RP0A 2C4CA 1N4WA 2PHHA 4ZCDA 2BABA 2C66A 3UTHA 5KRQA 1LQTA 2XFQA 1L9EA 2XFPA 1H7XA 4I59A 1NDAA 5EBKA 1RSGA 2C73A 3NN6X 1QJDA 2BK5A 3QSSA 4J2WA 2EQ9A 4CBQA 5FS7A 4WCTA 1L0VA 1ZP0A 4U8PA 3KPFA 4B1BA 2V60A 3T37A 5ER0A 3ICTA 2VZ2A 1MXTA 3HYWA 2V3BA 2R45A 2BRAA 1F8RA 1GRGA 4Z24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E1M A;  5EOW A;  3UKH A;  1PDH A;  4RG4 A;  4A5L A;  1N4U A;  3BNU A;  3PVC A;  4AT2 A;  4H4W A;  2JB2 A;  3CPJ G;  2IVE A;  5JCL A;  1TDO A;  3NKS A;  4TM3 A;  3LXD A;  2ZZ0 A;  3R9U A;  2VRL A;  3UTF A;  1JRZ A;  3L1R A;  4ECH A;  2DKH A;  3H8I A;  1P2H A;  1TDK A;  1PXA A;  2XLT A;  3P4Q A;  2Y6R A;  3DK9 A;  2C75 A;  2VQ7 A;  2WP5 A;  2YR5 A;  4ICY A;  4OCG A;  2C70 A;  2VRM A;  3CGE A;  1PS9 A;  1Y56 A;  3DJD A;  1GXF A;  2WES A;  4H4U A;  3AD9 B;  3BI2 A;  4YWO A;  2WDR A;  4O5Q A;  1UKV G;  1CC2 A;  1NHP A;  2YR4 A;  2I0Z A;  3AEA A;  2Q7V A;  1V59 A;  2B76 A;  4B64 A;  1BF3 A;  3B6D A;  3P4S A;  3NT6 A;  1EBD A;  2OA1 A;  2GF3 A;  3UOZ A;  3C4A A;  3BI4 A;  4USR A;  4H4Y A;  3B3R A;  3AE3 A;  4JY3 A;  2B9X A;  3RNM A;  5KOX A;  2BCP A;  4IVO B;  4Y4L A;  4BJZ A;  1IUU A;  1FEB A;  2XLR A;  2RAB A;  2GQF A;  4D03 A;  4OVI A;  4H7U A;  4OPD A;  4NEW A;  4JQ9 A;  5HHF A;  3V76 A;  1LVL A;  2FJA A;  3AD7 B;  3IHM A;  3NHO X;  4M52 A;  1CBO A;  2B9W A;  5U63 A;  1PBF A;  3CNT A;  1E39 A;  2X3N A;  3ALL A;  1LPF A;  2CFY A;  4LU6 A;  2YR6 A;  2C72 A;  4REK A;  3SFD A;  4ZN0 A;  3GDN A;  2B7S A;  3PO7 A;  4KX6 A;  4AOS A;  2BA9 A;  2BK4 A;  3PS9 A;  1GRE A;  1K4Q A;  3NK1 X;  4CY6 A;  4H4Q A;  1CJ3 A;  3ADA B;  1BKW A;  1LTX R;  1ZMC A;  3LZW A;  4GR1 A;  3UP4 A;  4UDP A;  3V3O A;  1CJC A;  4OPG A;  1GRH A;  1XAN A;  4B65 A;  5BVA A;  4Z43 A;  3GD4 A;  2GQW A;  2WS3 A;  1JRY A;  1DOB A;  2BYB A;  4N9X A;  3LJP A;  1NHQ A;  3NK2 X;  1GRT A;  4U2L A;  3ZYX A;  2YWL A;  3FMW A;  4RSL A;  4A65 A;  5KOW A;  1PXC A;  1CJ2 A;  2GRT A;  2ARD A;  1TDF A;  4JDR A;  4TM1 A;  2BS4 A;  4EMW A;  4YSZ A;  3URH A;  2BCG G;  2V5Z A;  2OAM A;  2DKI A;  3DGZ A;  1O94 A;  3DK4 A;  1TYT A;  1XPQ A;  3EF6 A;  4YXD A;  1COY A;  1F3P A;  3CTY A;  1ZK7 A;  4AT0 A;  1E1L A;  2WDQ A;  3S5W A;  4YSX A;  5LV9 A;  1E1K A;  4OPU A;  4K7Z A;  5TR3 A;  1DJQ A;  2Z5Y A;  3QJ4 A;  1VQW A;  1H81 A;  4YSH A;  3VRD B;  3F8P A;  1BGJ A;  2C76 A;  5M0Z A;  3UKK A;  1B5Q A;  1JNR A;  1NG4 A;  4X9M A;  4C5O A;  4LA1 A;  3ZDN A;  4A6N B;  2QAE A;  3UKQ A;  1MO9 A;  3GMC A;  3AYJ A;  2XDO A;  3Q6J A;  1IUT A;  1GTE A;  2WDV A;  3GRT A;  2V3A A;  1K0L A;  1K0J A;  2EQ8 A;  3GYJ A;  2Q6U A;  3ALJ A;  1GRF A;  1YKJ A;  4A7A A;  3NH3 X;  2BC1 A;  1D7Y A;  1H6V A;  2J3N A;  3AYI A;  2XVF A;  4IA5 A;  2HQM A;  4A9W A;  3CNJ A;  3ALM A;  2YVF A;  5FS6 A;  1FCD A;  2C3C A;  1PXB A;  4C77 A;  4APN A;  3VRA A;  1GT8 A;  1EL8 A;  3CNP A;  4RG3 A;  2XFU A;  1XHC A;  4OPC A;  1TRB A;  1TDE A;  3IF9 A;  1ZX9 A;  2VVL A;  2X8C A;  2XVI A;  1NEN A;  2OAL A;  1Y0P A;  4NTD A;  3GMB A;  2WP6 A;  3AE1 A;  3CGB A;  1S3B A;  2JBV A;  4CNJ A;  2XLP A;  3HZL A;  3GSI A;  3GYI A;  2V6O A;  4YKF A;  3UKF A;  1L9D A;  3P9U A;  4EQS A;  3EAN A;  4X4J A;  3UOY A;  4XWR A;  3AE4 A;  1BWC A;  4Y4N A;  1ZOV A;  3AEC A;  4JNA A;  3AE7 A;  5BUK A;  4U8M A;  3LAD A;  3RED A;  1N1P A;  1VDC A;  1D7L A;  1F8W A;  1KF6 A;  1K0I A;  2CDU A;  2VVL G;  1GET A;  3E1T A;  3ATR A;  4C3Y A;  4DSH A;  4B67 A;  1JU2 A;  2YLZ A;  4B63 A;  2Z5X A;  2B9Y A;  4HA6 A;  2AR8 A;  1M6I A;  3K30 A;  1Q1R A;  4ZCC A;  3O0H A;  5C2T A;  5J60 A;  2XLS A;  2GVC A;  4D04 A;  4NTE A;  1GAL A;  1PHH A;  2TPR A;  2C3D A;  4JY2 A;  4TM0 A;  1GND A;  2C64 A;  2WQY A;  4J36 A;  2GB0 A;  2H89 A;  2R0C A;  4YTN A;  5IQ4 A;  3NTA A;  4H4X A;  5FMH A;  1ZKQ A;  3SM8 A;  4FDC B;  2JK6 A;  5KWF A;  3RP8 A;  2ZZC A;  1CF3 A;  1NEK A;  1B4V A;  2FJB A;  1GRB A;  1H83 A;  4H4Z A;  3SQP A;  3AEE A;  2YQU A;  4JNQ A;  1EL9 A;  2GMH A;  1CL0 A;  2GAH B;  4A79 A;  4K5R A;  2R4J A;  3ATQ A;  1BZL A;  1CC4 A;  4IV9 A;  1LQU A;  1NHR A;  3K7Q X;  3P4R A;  4Z26 A;  1GSN A;  1MOK A;  3BNM A;  5GRT A;  2A89 A;  3QVP A;  1GRA A;  2GR1 A;  5L46 A;  1OJD A;  3UTG A;  2H88 A;  5U25 A;  4AP3 A;  3M13 A;  5C3J A;  1DNC A;  1CHU A;  2WOI A;  5JCI A;  3F8R A;  4Z25 A;  3Q9T A;  4H4V A;  2YLS A;  4H4S A;  5CKU A;  4U8J A;  1CC6 A;  1B8S A;  4EQR A;  4Z2U A;  2FJE A;  3D1C A;  4UDQ A;  2WPC A;  1KSS A;  3NYE A;  4K22 A;  2Y6Q A;  3WE0 A;  2RGJ A;  4YKG A;  1GER A;  2GR2 A;  2PYX A;  2QCU A;  4Z2T A;  3H8L A;  1VG0 A;  3AE5 A;  1TYP A;  2R4E A;  1JEH A;  3DGH A;  3IC9 A;  1E7P A;  3DJG X;  1GTH A;  3I3L A;  2YM1 A;  3IWA A;  1YQZ A;  1REO A;  4YTP A;  3AYL A;  2GR0 A;  1JNZ A;  4WX1 A;  1KDG A;  2JB1 A;  3QFB A;  4BUR A;  1GV4 A;  4E0V A;  1ZDL A;  2A87 A;  2BXS A;  2YVG A;  4JN9 A;  2WHD A;  1KNR A;  2WPE A;  2WP9 A;  2UZZ A;  2E4G A;  3ITJ A;  3P4P A;  2VVM A;  1M64 A;  3ABV A;  4LII A;  4H2N A;  1E1N A;  1LV0 A;  1NAA A;  3UKA A;  2CUL A;  2B7R A;  1IJH A;  2ZZB A;  3UTE A;  3G5Q A;  2RGH A;  2R9Z A;  5CQF A;  3DME A;  1AOG A;  5M10 A;  1F6M A;  2WET A;  1IUW A;  2R0P A;  4C74 A;  3CPH G;  1GEU A;  1YQ4 A;  5FS9 A;  2Q0K A;  4GF7 A;  1QO8 A;  2XVH A;  3KVE A;  4FK1 C;  4NZH A;  4EM4 A;  4K5S A;  1FEA A;  3QVR A;  5HY5 A;  1O95 A;  1PJ5 A;  4GCM A;  3FIM B;  3UOV A;  1PN0 A;  1DOE A;  3ISH A;  4U8I A;  1XDI A;  3G5R A;  1DOC A;  1F8S A;  1OJA A;  2WPF A;  2QA2 A;  2YG7 A;  3IHG A;  5JCM A;  2WOV A;  2BAC A;  2IID A;  2IVD A;  3LOV A;  4K8D A;  3AE6 A;  1S2Y A;  3NTD A;  5HYM A;  1E1M A;  1D5T A;  3NG7 X;  4J33 A;  4GRT A;  3I6D A;  4KPR A;  1N4V A;  3SFE A;  2XVJ A;  3C96 A;  4XWZ A;  4AOX A;  4YT0 A;  1E6E A;  1GPE A;  1PJ6 A;  2XFN A;  4CRT A;  1PBC A;  1PJ7 A;  3QFA A;  2YLR A;  3GD3 A;  1OJ9 A;  4BK2 A;  5BRT A;  4K2X A;  4UDR A;  4EM3 A;  2JAE A;  4J57 A;  5HXI A;  3P1W A;  4CCQ A;  1H84 A;  1Y56 B;  2TMD A;  1FEC A;  1PBB A;  2C7G A;  3CGD A;  3BI5 A;  3FG2 P;  4A6N A;  1X31 B;  4J56 A;  4IA6 A;  1O5W A;  4PAA A;  2WU5 A;  4U8L A;  3NK0 X;  3AE2 A;  4X9N A;  2BXR A;  1HYU A;  2YLT A;  3CIR A;  3DK8 A;  1KNP A;  4UP3 A;  4USQ A;  3UP5 A;  3BHF A;  2FBW A;  1DJN A;  2BS2 A;  5BUL A;  2CVJ A;  3ICS A;  4J31 A;  4A99 A;  1P2E A;  3COX A;  4OPL A;  3GWD A;  4TM4 A;  1BGN A;  3AED A;  1TDN A;  2Q0L A;  2C65 A;  1W4X A;  2FJD A;  1B37 A;  1DOD A;  4FX9 A;  4YTM A;  4CCR A;  4DNA A;  2W0H A;  3GWF A;  3UKP A;  1Q9I A;  4IVM B;  3CND A;  4TLZ A;  3K7M X;  3AEB A;  3BHK A;  2RGO A;  3OZ2 A;  4EIQ A;  4GUV A;  4P9S A;  4DSG A;  2A8X A;  2GR3 A;  3M0O A;  5DBJ A;  1PBD A;  4B66 A;  4U2S A;  3KD9 A;  1EL5 A;  4Z2R A;  3K7T A;  3KA7 A;  4H2Q A;  2GV8 A;  5J7X A;  1L9C A;  3NGC X;  2ZBW A;  3UCL A;  1NHS A;  2ACZ A;  2R0G A;  3KLJ A;  2GAG B;  4FK1 A;  3DJJ A;  4YSY A;  1ZY8 A;  3CN8 A;  3DA1 A;  3DH9 A;  3AE9 A;  1NPX A;  3FBS A;  2F5Z A;  2EQ7 A;  3AXB A;  4CNK A;  5JCK A;  3NN0 X;  1RYI A;  5KVH A;  3RP6 A;  1JOA A;  2YLW A;  2BK3 A;  4DGK A;  2O9Z A;  1GES A;  1IUS A;  1ZMD A;  2WBA A;  3NLC A;  3GDP A;  2WU2 A;  1VRQ B;  2XYO A;  2GMJ A;  3VQR A;  4NEV A;  1PBE A;  2YG6 A;  4CY8 A;  3UOX A;  1EL7 A;  4TLX A;  3CGC A;  3AB1 A;  3G5S A;  3VRB A;  3CPI G;  2AQJ A;  2V61 A;  2X50 A;  1Q1W A;  3AEG A;  2GEW A;  1OJC A;  4H4T A;  4H2R A;  3VR9 A;  3H4K A;  3L8K A;  5IPY A;  2NPX A;  1D4C A;  3CNS A;  5EB4 A;  5GSN A;  1KSU A;  4EQX A;  4PAB A;  4BJY A;  3C4N A;  1S3E A;  1IUX A;  1QLB A;  1IUV A;  4GDE A;  3QSM A;  4GDP A;  2YVJ A;  2GH5 A;  3LZX A;  3VR8 A;  2EQ6 A;  1KFY A;  3OC4 A;  1LJ1 A;  5KXJ A;  3AE8 A;  1ONF A;  4Z44 A;  3D8X A;  3S61 A;  1YQ3 A;  3KU9 A;  2YG3 A;  2OLO A;  2XVE A;  1YY5 A;  2WEU A;  4B69 A;  3GRS A;  1ELI A;  3QSE A;  4HB9 A;  1JRX A;  1FOH A;  4U2T A;  3RHA A;  2X8G A;  2E5V A;  3NNE A;  3NYC A;  4J34 A;  4EMJ A;  1CJ4 A;  2APG A;  2OLN A;  4BV6 A;  2VQB A;  2NVK X;  3NIX A;  1FL2 A;  4C3X A;  4O5U A;  4OPI A;  4U8K A;  2X8H A;  2BC0 A;  2JKC A;  4I58 A;  3KKJ A;  2R46 A;  2C67 A;  3NRN A;  1OJT A;  4U8N A;  4B68 A;  2YG5 A;  2QA1 A;  1H7W A;  5FS8 A;  3DJE A;  1D4D A;  4H2P A;  1H82 A;  1SEZ A;  1Z6L A;  2WOW A;  3FPZ A;  3NYF A;  3EAO A;  1VG9 A;  3RP7 A;  2YG4 A;  4ADW A;  1H86 A;  2AAQ A;  2YM2 A;  4MJW A;  4EIP A;  2VOU A;  2XFO A;  1D4E A;  3SGL A;  2BS3 A;  4H4P A;  4OPT A;  3JSK A;  3ICR A;  2YLX A;  3EPT A;  1S2Q A;  4XXG A;  4AP1 A;  4BK3 A;  2XLU A;  1DXL A;  3LB8 A;  5U1O A;  3F8D A;  4EQW A;  4EMI A;  3II4 A;  5JCN A;  4H50 A;  1NG3 A;  3AD8 B;  5EB5 A;  2YAU A;  4H4R A;  5KVI A;  4BK1 A;  5IQ1 A;  4Y4M A;  3V3N A;  3AWI A;  4U8O A;  2JB3 A;  3AEF A;  1ZOY A;  2XCG A;  3UKL A;  1GOS A;  4NTC A;  2X99 A;  3M12 A;  1RP0 A;  2PHH A;  1N4W A;  5KRQ A;  4ZCD A;  2BAB A;  2C66 A;  3UTH A;  1LQT A;  2XFQ A;  1L9E A;  2XFP A;  1H7X A;  4I59 A;  1NDA A;  5EBK A;  1RSG A;  2C73 A;  3NN6 X;  1QJD A;  2BK5 A;  3QSS A;  4J2W A;  2EQ9 A;  4CBQ A;  5FS7 A;  4WCT A;  1L0V A;  1ZP0 A;  4U8P A;  3KPF A;  4B1B A;  2V60 A;  3T37 A;  5ER0 A;  3ICT A;  2VZ2 A;  1MXT A;  2V3B A;  2R45 A;  1F8R A;  1GRG A;  4Z24 A; 
#chains in the Genus database with same CATH topology
 2E1M A;  5EOW A;  3UKH A;  1PDH A;  4RG4 A;  3SX6 A;  3SXI A;  4A5L A;  1N4U A;  3BNU A;  3PVC A;  4AT2 A;  4H4W A;  2JB2 A;  3CPJ G;  3T2Y A;  2IVE A;  5JCL A;  1TDO A;  3NKS A;  4TM3 A;  2E48 A;  3LXD A;  2ZZ0 A;  3R9U A;  2VRL A;  3UTF A;  1JRZ A;  3L1R A;  4ECH A;  2DKH A;  3H8I A;  1P2H A;  1TDK A;  1PXA A;  2XLT A;  3P4Q A;  2Y6R A;  3DK9 A;  2C75 A;  2VQ7 A;  2WP5 A;  2YR5 A;  4ICY A;  4OCG A;  2C70 A;  2VRM A;  3CGE A;  1PS9 A;  3DJD A;  4YJG B;  1Y56 A;  1GXF A;  2WES A;  4H4U A;  3AD9 B;  3W4K A;  3BI2 A;  4YWO A;  2WDR A;  4O5Q A;  1UKV G;  4YJF A;  1CC2 A;  1NHP A;  2YR4 A;  2I0Z A;  3CUK A;  2Q7V A;  3AEA A;  1V59 A;  2B76 A;  3SZW A;  1BF3 A;  4B64 A;  3B6D A;  3P4S A;  4YJH B;  3NT6 A;  1EBD A;  2OA1 A;  2GF3 A;  3UOZ A;  3C4A A;  3BI4 A;  4GAP A;  4USR A;  4H4Y A;  3B3R A;  3AE3 A;  4JY3 A;  2B9X A;  3RNM A;  5KOX A;  2BCP A;  4IVO B;  4Y4L A;  4BJZ A;  1IUU A;  1FEB A;  5KMQ A;  2XLR A;  2RAB A;  2GQF A;  4D03 A;  4OVI A;  4H7U A;  4OPD A;  4NEW A;  4JQ9 A;  5HHF A;  3V76 A;  1LVL A;  2FJA A;  3AD7 B;  3IHM A;  3NHO X;  4M52 A;  1CBO A;  2B9W A;  5U63 A;  1PBF A;  3CNT A;  1E39 A;  4G9K A;  2X3N A;  3ALL A;  1LPF A;  2CFY A;  4LU6 A;  2YR6 A;  2C72 A;  4REK A;  3SFD A;  4ZN0 A;  3GDN A;  2B7S A;  3PO7 A;  4KX6 A;  4AOS A;  3PS9 A;  2BA9 A;  2BK4 A;  1GRE A;  1K4Q A;  3NK1 X;  4CY6 A;  4H4Q A;  1CJ3 A;  3ADA B;  1BKW A;  1LTX R;  1ZMC A;  3LZW A;  4GR1 A;  3UP4 A;  4G74 A;  4UDP A;  3V3O A;  1CJC A;  4OPG A;  1GRH A;  1XAN A;  4B65 A;  5BVA A;  4Z43 A;  3GD4 A;  2GQW A;  2WS3 A;  1JRY A;  1DOB A;  2BYB A;  4N9X A;  3LJP A;  1NHQ A;  3NK2 X;  1GRT A;  4U2L A;  3ZYX A;  2YWL A;  4RSL A;  3FMW A;  4A65 A;  5KOW A;  1PXC A;  1CJ2 A;  2GRT A;  2ARD A;  1TDF A;  4JDR A;  4TM1 A;  2BS4 A;  4EMW A;  4YSZ A;  4G6H A;  3URH A;  2BCG G;  3SYI A;  2V5Z A;  2OAM A;  2DKI A;  3DGZ A;  1O94 A;  3DK4 A;  1TYT A;  1XPQ A;  3EF6 A;  4YXD A;  1COY A;  1F3P A;  3CTY A;  1ZK7 A;  3ZNQ A;  4AT0 A;  1E1L A;  2WDQ A;  3S5W A;  4YSX A;  5LV9 A;  1E1K A;  4OPU A;  4K7Z A;  5TR3 A;  1DJQ A;  2Z5Y A;  3QJ4 A;  1VQW A;  1H81 A;  4YSH A;  3VRD B;  3F8P A;  1BGJ A;  2C76 A;  5M0Z A;  3UKK A;  1B5Q A;  1NG4 A;  4X9M A;  3WGT A;  1JNR A;  4C5O A;  4LA1 A;  3ZDN A;  4A6N B;  2QAE A;  3UKQ A;  1MO9 A;  3GMC A;  3AYJ A;  2XDO A;  3Q6J A;  1IUT A;  1GTE A;  2WDV A;  3GRT A;  2V3A A;  1K0L A;  1K0J A;  2EQ8 A;  3GYJ A;  2Q6U A;  3ALJ A;  1YKJ A;  1GRF A;  4A7A A;  3NH3 X;  2BC1 A;  4IA5 A;  1D7Y A;  1H6V A;  2J3N A;  2XVF A;  3AYI A;  2HQM A;  4A9W A;  3CNJ A;  3ALM A;  2YVF A;  5FS6 A;  1FCD A;  2C3C A;  1PXB A;  4C77 A;  4APN A;  3VRA A;  1GT8 A;  1EL8 A;  3CNP A;  4RG3 A;  2XFU A;  2BRY A;  1XHC A;  4OPC A;  1TRB A;  1TDE A;  3IF9 A;  1ZX9 A;  2VVL A;  2X8C A;  2XVI A;  1NEN A;  2OAL A;  1Y0P A;  4NTD A;  3GMB A;  2WP6 A;  3AE1 A;  3CGB A;  1S3B A;  2JBV A;  4CNJ A;  2XLP A;  3HZL A;  3GSI A;  3GYI A;  2V6O A;  4YKF A;  3UKF A;  1L9D A;  3HYV A;  3P9U A;  4EQS A;  3EAN A;  4X4J A;  3UOY A;  4XWR A;  3AE4 A;  1BWC A;  4Y4N A;  1ZOV A;  3AEC A;  4JNA A;  3AE7 A;  5BUK A;  4U8M A;  3LAD A;  3RED A;  1N1P A;  1VDC A;  1D7L A;  1F8W A;  1KF6 A;  1K0I A;  2CDU A;  2VVL G;  1GET A;  3E1T A;  3ATR A;  4C3Y A;  4DSH A;  4B67 A;  2DU8 A;  1JU2 A;  2YLZ A;  4B63 A;  2Z5X A;  2B9Y A;  4HA6 A;  2AR8 A;  1M6I A;  3K30 A;  1Q1R A;  4ZCC A;  3O0H A;  5C2T A;  5J60 A;  2XLS A;  2GVC A;  4D04 A;  4NTE A;  1GAL A;  1PHH A;  2TPR A;  2C3D A;  4JY2 A;  4TM0 A;  1GND A;  2C64 A;  2WQY A;  3G3E A;  2GB0 A;  4J36 A;  2H89 A;  2R0C A;  4YTN A;  4YJD A;  5IQ4 A;  3NTA A;  4H4X A;  1EVI A;  5FMH A;  1ZKQ A;  3SM8 A;  4FDC B;  2JK6 A;  5KWF A;  3RP8 A;  2ZZC A;  1CF3 A;  1NEK A;  1B4V A;  2FJB A;  1GRB A;  1H83 A;  4H4Z A;  3SQP A;  3AEE A;  2YQU A;  4JNQ A;  3SY4 A;  1EL9 A;  2GMH A;  2GAH B;  1CL0 A;  4A79 A;  4K5R A;  2R4J A;  3ATQ A;  1BZL A;  1CC4 A;  4IV9 A;  1LQU A;  1NHR A;  3K7Q X;  3P4R A;  4Z26 A;  1GSN A;  1MOK A;  3BNM A;  5GRT A;  2A89 A;  3QVP A;  5KMR A;  5L46 A;  1GRA A;  2GR1 A;  1OJD A;  3UTG A;  2H88 A;  5U25 A;  3SZ0 A;  3M13 A;  4AP3 A;  5C3J A;  1DNC A;  1CHU A;  2WOI A;  5JCI A;  3F8R A;  4Z25 A;  3Q9T A;  4H4V A;  2YLS A;  4H4S A;  5CKU A;  4YJG A;  4U8J A;  1CC6 A;  1B8S A;  4EQR A;  4Z2U A;  2FJE A;  3D1C A;  4UDQ A;  3NYE A;  1KSS A;  2WPC A;  3SZF A;  4NWZ A;  4K22 A;  2E49 A;  2Y6Q A;  3WE0 A;  2RGJ A;  4YKG A;  1GER A;  2GR2 A;  2PYX A;  2QCU A;  4Z2T A;  3H8L A;  1VG0 A;  3AE5 A;  4G6G A;  1TYP A;  2R4E A;  1JEH A;  3DGH A;  3IC9 A;  1E7P A;  4YJH A;  3DJG X;  1GTH A;  3I3L A;  2YM1 A;  3IWA A;  1YQZ A;  1REO A;  4YTP A;  3AYL A;  2GR0 A;  1VE9 A;  1JNZ A;  4WX1 A;  1KDG A;  2JB1 A;  3QFB A;  4BUR A;  1GV4 A;  4E0V A;  1ZDL A;  2A87 A;  2BXS A;  2YVG A;  4JN9 A;  2WHD A;  1KNR A;  2WPE A;  2WP9 A;  2UZZ A;  2E4G A;  3ITJ A;  3P4P A;  2VVM A;  1M64 A;  3ABV A;  3T14 A;  4LII A;  4H2N A;  1E1N A;  1LV0 A;  1NAA A;  3UKA A;  2CUL A;  2B7R A;  1IJH A;  2ZZB A;  1C0K A;  3UTE A;  3G5Q A;  2RGH A;  2R9Z A;  5CQF A;  3DME A;  1AOG A;  5M10 A;  1F6M A;  2WET A;  1IUW A;  2R0P A;  4C74 A;  3CPH G;  1GEU A;  1YQ4 A;  5FS9 A;  2Q0K A;  4GF7 A;  1QO8 A;  2XVH A;  3KVE A;  4FK1 C;  4NZH A;  3SZC A;  4EM4 A;  4K5S A;  1FEA A;  3QVR A;  5HY5 A;  1PJ5 A;  1O95 A;  4GCM A;  3FIM B;  3UOV A;  1PN0 A;  1DOE A;  3ISH A;  4U8I A;  1XDI A;  3G5R A;  3ZNN A;  1DOC A;  1F8S A;  1OJA A;  2WPF A;  2QA2 A;  2YG7 A;  3IHG A;  5JCM A;  2WOV A;  2BAC A;  2IID A;  2IVD A;  4QFC A;  3LOV A;  4K8D A;  3AE6 A;  1S2Y A;  3NTD A;  5HYM A;  1E1M A;  1D5T A;  3NG7 X;  4J33 A;  4GRT A;  3I6D A;  4KPR A;  1N4V A;  3SFE A;  2XVJ A;  3C96 A;  4XWZ A;  4AOX A;  4YT0 A;  1E6E A;  1GPE A;  1PJ6 A;  2XFN A;  4CRT A;  1PBC A;  1PJ7 A;  3QFA A;  4BK2 A;  2YLR A;  1OJ9 A;  3GD3 A;  5BRT A;  4K2X A;  4UDR A;  4EM3 A;  2JAE A;  4J57 A;  5HXI A;  3P1W A;  4CCQ A;  1Y56 B;  1H84 A;  2TMD A;  1PBB A;  1FEC A;  2C7G A;  3CGD A;  3BI5 A;  3FG2 P;  4A6N A;  1X31 B;  4X9N A;  4IA6 A;  1O5W A;  4PAA A;  2WU5 A;  4J56 A;  3NK0 X;  3AE2 A;  4YJF B;  2BXR A;  4G73 A;  4U8L A;  1HYU A;  4QFD A;  2YLT A;  3CIR A;  3DK8 A;  1KNP A;  4UP3 A;  4USQ A;  3UP5 A;  3BHF A;  2FBW A;  1DJN A;  2BS2 A;  5BUL A;  2CVJ A;  3ICS A;  3T0K A;  4J31 A;  3ZNP A;  1P2E A;  3COX A;  4OPL A;  3GWD A;  4A99 A;  4TM4 A;  1BGN A;  3AED A;  1TDN A;  2Q0L A;  2C65 A;  1W4X A;  2FJD A;  1DOD A;  1B37 A;  4FX9 A;  4YTM A;  4CCR A;  4DNA A;  2W0H A;  3GWF A;  3UKP A;  1Q9I A;  4IVM B;  1KIF A;  3CND A;  4TLZ A;  3K7M X;  3AEB A;  3BHK A;  2RGO A;  3OZ2 A;  4EIQ A;  4GUV A;  4P9S A;  4DSG A;  2A8X A;  4II2 A;  3M0O A;  2GR3 A;  5DBJ A;  1PBD A;  4B66 A;  4U2S A;  3KD9 A;  1EL5 A;  4Z2R A;  3K7T A;  3KA7 A;  4H2Q A;  2GV8 A;  5J7X A;  1L9C A;  3NGC X;  2ZBW A;  3UCL A;  1NHS A;  2ACZ A;  2R0G A;  3KLJ A;  2GAG B;  4FK1 A;  3DJJ A;  4YSY A;  1ZY8 A;  3DA1 A;  3CN8 A;  3DH9 A;  3AE9 A;  1AN9 A;  1NPX A;  3FBS A;  3CMM A;  2F5Z A;  2EQ7 A;  3AXB A;  4CNK A;  5JCK A;  3NN0 X;  1RYI A;  5KVH A;  2E82 A;  3RP6 A;  1JOA A;  5KNL A;  2YLW A;  2BK3 A;  4DGK A;  2O9Z A;  1GES A;  1IUS A;  1ZMD A;  2WBA A;  3NLC A;  3GDP A;  2WU2 A;  1DAO A;  1VRQ B;  2XYO A;  2GMJ A;  2E4A A;  3VQR A;  4NEV A;  1PBE A;  2YG6 A;  4CY8 A;  3UOX A;  1EL7 A;  4TLX A;  3CGC A;  3AB1 A;  3G5S A;  3VRB A;  3CPI G;  2AQJ A;  2V61 A;  2X50 A;  1Q1W A;  3AEG A;  2GEW A;  1OJC A;  4H4T A;  4H2R A;  3VR9 A;  3H4K A;  3L8K A;  5IPY A;  2NPX A;  1D4C A;  3CNS A;  5EB4 A;  5GSN A;  1KSU A;  4EQX A;  4PAB A;  4BJY A;  3C4N A;  3W4J A;  1IUX A;  1QLB A;  1IUV A;  1S3E A;  3QSM A;  4GDE A;  4GDP A;  4II3 A;  2YVJ A;  2GH5 A;  1C0L A;  3LZX A;  3VR8 A;  2EQ6 A;  1KFY A;  3OC4 A;  1LJ1 A;  5KXJ A;  3AE8 A;  1ONF A;  4Z44 A;  3D8X A;  3S61 A;  3T2Z A;  1YQ3 A;  3KU9 A;  2YG3 A;  2OLO A;  2XVE A;  1YY5 A;  2WEU A;  4B69 A;  3GRS A;  1ELI A;  1C0P A;  3QSE A;  4HB9 A;  1JRX A;  1FOH A;  4U2T A;  3RHA A;  2X8G A;  2E5V A;  3NNE A;  3NYC A;  4J34 A;  4EMJ A;  1CJ4 A;  2APG A;  2OLN A;  4BV6 A;  2VQB A;  2NVK X;  3NIX A;  1FL2 A;  4C3X A;  4O5U A;  4OPI A;  4U8K A;  2X8H A;  2BC0 A;  2JKC A;  4I58 A;  3KKJ A;  2R46 A;  2C67 A;  3NRN A;  1OJT A;  4U8N A;  4B68 A;  5KMS A;  2YG5 A;  2QA1 A;  1H7W A;  5FS8 A;  3DJE A;  1D4D A;  4H2P A;  1H82 A;  3NYF A;  1SEZ A;  1Z6L A;  2WOW A;  3FPZ A;  3RP7 A;  1VG9 A;  3EAO A;  3T2K A;  2YG4 A;  4ADW A;  1H86 A;  2AAQ A;  2YM2 A;  4MJW A;  2VOU A;  4EIP A;  2XFO A;  1D4E A;  3SGL A;  3W4I A;  2BS3 A;  4H4P A;  3JSK A;  4OPT A;  3ICR A;  2YLX A;  3EPT A;  1S2Q A;  4XXG A;  4BK3 A;  4AP1 A;  2XLU A;  1DXL A;  3LB8 A;  5U1O A;  3F8D A;  4EQW A;  4NNJ A;  3II4 A;  4EMI A;  5JCN A;  4H50 A;  1NG3 A;  3AD8 B;  5EB5 A;  4BK1 A;  2YAU A;  4GAV A;  4H4R A;  5IQ1 A;  5KVI A;  5KMP A;  4Y4M A;  3V3N A;  3AWI A;  4U8O A;  2JB3 A;  3AEF A;  1ZOY A;  2XCG A;  3GYX A;  3HYX A;  3UKL A;  1C0I A;  1GOS A;  3T31 A;  3KPK A;  4NTC A;  3M12 A;  2X99 A;  1RP0 A;  2PHH A;  1N4W A;  2C4C A;  4ZCD A;  2BAB A;  2C66 A;  1DDO A;  3UTH A;  1LQT A;  5KRQ A;  2XFQ A;  1L9E A;  2XFP A;  1H7X A;  4I59 A;  1NDA A;  5EBK A;  1RSG A;  2C73 A;  3NN6 X;  3QSS A;  1QJD A;  2BK5 A;  4J2W A;  2EQ9 A;  4CBQ A;  5FS7 A;  4WCT A;  1L0V A;  1ZP0 A;  4U8P A;  3KPF A;  4B1B A;  2V60 A;  3T37 A;  5ER0 A;  3ICT A;  3ZNO A;  2VZ2 A;  1MXT A;  3HYW A;  2V3B A;  2R45 A;  2BRA A;  1F8R A;  1GRG A;  4Z24 A; 
#chains in the Genus database with same CATH homology
 2E1M A;  5EOW A;  3UKH A;  1PDH A;  4RG4 A;  3SX6 A;  3SXI A;  4A5L A;  1N4U A;  3BNU A;  3PVC A;  4AT2 A;  4H4W A;  2JB2 A;  3CPJ G;  3T2Y A;  2IVE A;  5JCL A;  1TDO A;  3NKS A;  4TM3 A;  3LXD A;  2ZZ0 A;  3R9U A;  2VRL A;  3UTF A;  1JRZ A;  3L1R A;  4ECH A;  2DKH A;  3H8I A;  1P2H A;  1TDK A;  1PXA A;  2XLT A;  3P4Q A;  2Y6R A;  3DK9 A;  2C75 A;  2VQ7 A;  2WP5 A;  2YR5 A;  4ICY A;  4OCG A;  2C70 A;  2VRM A;  3CGE A;  1PS9 A;  1Y56 A;  3DJD A;  1GXF A;  2WES A;  4H4U A;  3AD9 B;  3BI2 A;  4YWO A;  2WDR A;  4O5Q A;  1UKV G;  1CC2 A;  1NHP A;  2YR4 A;  2I0Z A;  3AEA A;  2Q7V A;  1V59 A;  2B76 A;  3SZW A;  1BF3 A;  4B64 A;  3B6D A;  3P4S A;  3NT6 A;  1EBD A;  2OA1 A;  2GF3 A;  3UOZ A;  3C4A A;  3BI4 A;  4GAP A;  4USR A;  4H4Y A;  3B3R A;  3AE3 A;  4JY3 A;  2B9X A;  3RNM A;  5KOX A;  2BCP A;  4IVO B;  4Y4L A;  4BJZ A;  1IUU A;  1FEB A;  5KMQ A;  2XLR A;  2RAB A;  2GQF A;  4D03 A;  4OVI A;  4H7U A;  4OPD A;  4NEW A;  4JQ9 A;  5HHF A;  3V76 A;  1LVL A;  2FJA A;  3IHM A;  3AD7 B;  3NHO X;  4M52 A;  1CBO A;  2B9W A;  5U63 A;  1PBF A;  3CNT A;  1E39 A;  4G9K A;  2X3N A;  3ALL A;  1LPF A;  2CFY A;  4LU6 A;  2YR6 A;  2C72 A;  4REK A;  3SFD A;  4ZN0 A;  3GDN A;  2B7S A;  3PO7 A;  4KX6 A;  4AOS A;  2BA9 A;  2BK4 A;  3PS9 A;  1GRE A;  1K4Q A;  3NK1 X;  4CY6 A;  4H4Q A;  1CJ3 A;  3ADA B;  1BKW A;  1LTX R;  1ZMC A;  3LZW A;  4GR1 A;  3UP4 A;  4G74 A;  4UDP A;  3V3O A;  1CJC A;  4OPG A;  1GRH A;  1XAN A;  4B65 A;  5BVA A;  4Z43 A;  3GD4 A;  2GQW A;  2WS3 A;  1JRY A;  1DOB A;  2BYB A;  4N9X A;  3LJP A;  1NHQ A;  3NK2 X;  1GRT A;  4U2L A;  3ZYX A;  2YWL A;  3FMW A;  4RSL A;  4A65 A;  5KOW A;  1PXC A;  1CJ2 A;  2GRT A;  2ARD A;  1TDF A;  4JDR A;  4TM1 A;  2BS4 A;  4EMW A;  4YSZ A;  4G6H A;  3URH A;  2BCG G;  3SYI A;  2V5Z A;  2OAM A;  2DKI A;  3DGZ A;  1O94 A;  3DK4 A;  1TYT A;  1XPQ A;  3EF6 A;  4YXD A;  1COY A;  1F3P A;  3CTY A;  1ZK7 A;  4AT0 A;  1E1L A;  2WDQ A;  3S5W A;  4YSX A;  5LV9 A;  1E1K A;  4OPU A;  4K7Z A;  5TR3 A;  1DJQ A;  2Z5Y A;  3QJ4 A;  1VQW A;  1H81 A;  4YSH A;  3VRD B;  3F8P A;  1BGJ A;  2C76 A;  5M0Z A;  3UKK A;  1B5Q A;  1JNR A;  1NG4 A;  4X9M A;  4C5O A;  4LA1 A;  3ZDN A;  4A6N B;  2QAE A;  3UKQ A;  1MO9 A;  3GMC A;  3AYJ A;  2XDO A;  3Q6J A;  1IUT A;  1GTE A;  2WDV A;  3GRT A;  2V3A A;  1K0L A;  1K0J A;  2EQ8 A;  3GYJ A;  2Q6U A;  3ALJ A;  1GRF A;  1YKJ A;  4A7A A;  3NH3 X;  2BC1 A;  4IA5 A;  1D7Y A;  1H6V A;  2J3N A;  2XVF A;  3AYI A;  2HQM A;  4A9W A;  3CNJ A;  3ALM A;  2YVF A;  5FS6 A;  1FCD A;  2C3C A;  1PXB A;  4C77 A;  4APN A;  3VRA A;  1GT8 A;  1EL8 A;  3CNP A;  4RG3 A;  2XFU A;  2BRY A;  1XHC A;  4OPC A;  1TRB A;  1TDE A;  3IF9 A;  1ZX9 A;  2VVL A;  2X8C A;  2XVI A;  1NEN A;  2OAL A;  1Y0P A;  4NTD A;  3GMB A;  2WP6 A;  3AE1 A;  3CGB A;  1S3B A;  2JBV A;  4CNJ A;  2XLP A;  3HZL A;  3GSI A;  3GYI A;  2V6O A;  4YKF A;  3UKF A;  1L9D A;  3HYV A;  3P9U A;  4EQS A;  3EAN A;  4X4J A;  3UOY A;  4XWR A;  3AE4 A;  1BWC A;  4Y4N A;  1ZOV A;  3AEC A;  4JNA A;  3AE7 A;  5BUK A;  4U8M A;  3LAD A;  3RED A;  1N1P A;  1VDC A;  1D7L A;  1F8W A;  1KF6 A;  1K0I A;  2CDU A;  2VVL G;  1GET A;  3E1T A;  3ATR A;  4C3Y A;  4DSH A;  4B67 A;  1JU2 A;  2YLZ A;  4B63 A;  2Z5X A;  2B9Y A;  4HA6 A;  2AR8 A;  1M6I A;  3K30 A;  1Q1R A;  4ZCC A;  3O0H A;  5C2T A;  5J60 A;  2XLS A;  2GVC A;  4D04 A;  4NTE A;  1GAL A;  1PHH A;  2TPR A;  2C3D A;  4JY2 A;  4TM0 A;  1GND A;  2C64 A;  2WQY A;  4J36 A;  2GB0 A;  2H89 A;  2R0C A;  4YTN A;  5IQ4 A;  3NTA A;  4H4X A;  5FMH A;  1ZKQ A;  3SM8 A;  4FDC B;  2JK6 A;  5KWF A;  3RP8 A;  2ZZC A;  1CF3 A;  1NEK A;  1B4V A;  2FJB A;  1GRB A;  1H83 A;  4H4Z A;  3SQP A;  3AEE A;  2YQU A;  4JNQ A;  3SY4 A;  1EL9 A;  2GMH A;  1CL0 A;  2GAH B;  4A79 A;  4K5R A;  2R4J A;  3ATQ A;  1BZL A;  1CC4 A;  4IV9 A;  1LQU A;  1NHR A;  3K7Q X;  3P4R A;  4Z26 A;  1GSN A;  1MOK A;  3BNM A;  5GRT A;  2A89 A;  3QVP A;  5KMR A;  1GRA A;  2GR1 A;  5L46 A;  1OJD A;  3UTG A;  2H88 A;  5U25 A;  3SZ0 A;  3M13 A;  4AP3 A;  5C3J A;  1DNC A;  1CHU A;  2WOI A;  5JCI A;  3F8R A;  4Z25 A;  3Q9T A;  4H4V A;  2YLS A;  4H4S A;  5CKU A;  4U8J A;  1CC6 A;  1B8S A;  4EQR A;  4Z2U A;  2FJE A;  3D1C A;  4UDQ A;  2WPC A;  1KSS A;  3NYE A;  3SZF A;  4NWZ A;  4K22 A;  2Y6Q A;  3WE0 A;  2RGJ A;  4YKG A;  1GER A;  2GR2 A;  2PYX A;  2QCU A;  4Z2T A;  3H8L A;  1VG0 A;  3AE5 A;  4G6G A;  1TYP A;  2R4E A;  1JEH A;  3DGH A;  3IC9 A;  1E7P A;  3DJG X;  1GTH A;  3I3L A;  2YM1 A;  3IWA A;  1YQZ A;  1REO A;  4YTP A;  3AYL A;  2GR0 A;  1JNZ A;  4WX1 A;  1KDG A;  2JB1 A;  3QFB A;  4BUR A;  1GV4 A;  4E0V A;  1ZDL A;  2A87 A;  2BXS A;  2YVG A;  4JN9 A;  2WHD A;  1KNR A;  2WPE A;  2WP9 A;  2UZZ A;  2E4G A;  3ITJ A;  3P4P A;  2VVM A;  1M64 A;  3ABV A;  3T14 A;  4LII A;  4H2N A;  1E1N A;  1LV0 A;  1NAA A;  3UKA A;  2CUL A;  2B7R A;  1IJH A;  2ZZB A;  3UTE A;  3G5Q A;  2RGH A;  2R9Z A;  5CQF A;  3DME A;  1AOG A;  5M10 A;  1F6M A;  2WET A;  1IUW A;  2R0P A;  4C74 A;  3CPH G;  1GEU A;  1YQ4 A;  5FS9 A;  2Q0K A;  4GF7 A;  1QO8 A;  2XVH A;  3KVE A;  4FK1 C;  4NZH A;  3SZC A;  4EM4 A;  4K5S A;  1FEA A;  3QVR A;  5HY5 A;  1O95 A;  1PJ5 A;  4GCM A;  3FIM B;  3UOV A;  1PN0 A;  1DOE A;  3ISH A;  4U8I A;  1XDI A;  3G5R A;  1DOC A;  1F8S A;  1OJA A;  2WPF A;  2QA2 A;  2YG7 A;  3IHG A;  5JCM A;  2WOV A;  2BAC A;  2IID A;  2IVD A;  3LOV A;  4K8D A;  3AE6 A;  1S2Y A;  3NTD A;  5HYM A;  1E1M A;  1D5T A;  3NG7 X;  4J33 A;  4GRT A;  3I6D A;  4KPR A;  1N4V A;  3SFE A;  2XVJ A;  3C96 A;  4XWZ A;  4AOX A;  4YT0 A;  1E6E A;  1GPE A;  1PJ6 A;  2XFN A;  4CRT A;  1PBC A;  1PJ7 A;  3QFA A;  4BK2 A;  2YLR A;  1OJ9 A;  3GD3 A;  5BRT A;  4K2X A;  4UDR A;  4EM3 A;  2JAE A;  4J57 A;  5HXI A;  3P1W A;  4CCQ A;  1H84 A;  1Y56 B;  2TMD A;  1FEC A;  1PBB A;  2C7G A;  3CGD A;  3BI5 A;  3FG2 P;  4A6N A;  1X31 B;  4J56 A;  4IA6 A;  1O5W A;  4PAA A;  2WU5 A;  4U8L A;  3NK0 X;  3AE2 A;  4X9N A;  2BXR A;  4G73 A;  1HYU A;  2YLT A;  3CIR A;  3DK8 A;  1KNP A;  4UP3 A;  4USQ A;  3UP5 A;  3BHF A;  2FBW A;  1DJN A;  2BS2 A;  5BUL A;  2CVJ A;  3ICS A;  3T0K A;  4J31 A;  4A99 A;  1P2E A;  3COX A;  4OPL A;  3GWD A;  4TM4 A;  1BGN A;  3AED A;  1TDN A;  2Q0L A;  2C65 A;  1W4X A;  2FJD A;  1B37 A;  1DOD A;  4FX9 A;  4YTM A;  4CCR A;  4DNA A;  2W0H A;  3GWF A;  3UKP A;  1Q9I A;  4IVM B;  3CND A;  4TLZ A;  3K7M X;  3AEB A;  3BHK A;  2RGO A;  3OZ2 A;  4EIQ A;  4GUV A;  4P9S A;  4DSG A;  2A8X A;  4II2 A;  2GR3 A;  3M0O A;  5DBJ A;  1PBD A;  4B66 A;  4U2S A;  3KD9 A;  1EL5 A;  4Z2R A;  3K7T A;  3KA7 A;  4H2Q A;  2GV8 A;  5J7X A;  1L9C A;  3NGC X;  2ZBW A;  3UCL A;  1NHS A;  2ACZ A;  2R0G A;  3KLJ A;  2GAG B;  4FK1 A;  3DJJ A;  4YSY A;  1ZY8 A;  3CN8 A;  3DA1 A;  3DH9 A;  3AE9 A;  1NPX A;  3FBS A;  3CMM A;  2F5Z A;  2EQ7 A;  3AXB A;  4CNK A;  5JCK A;  3NN0 X;  1RYI A;  5KVH A;  3RP6 A;  1JOA A;  5KNL A;  2YLW A;  2BK3 A;  4DGK A;  2O9Z A;  1GES A;  1IUS A;  1ZMD A;  2WBA A;  3NLC A;  3GDP A;  2WU2 A;  1VRQ B;  2XYO A;  2GMJ A;  3VQR A;  4NEV A;  1PBE A;  2YG6 A;  4CY8 A;  3UOX A;  1EL7 A;  4TLX A;  3CGC A;  3AB1 A;  3G5S A;  3VRB A;  3CPI G;  2AQJ A;  2V61 A;  2X50 A;  1Q1W A;  3AEG A;  2GEW A;  1OJC A;  4H4T A;  4H2R A;  3VR9 A;  3H4K A;  3L8K A;  5IPY A;  2NPX A;  1D4C A;  3CNS A;  5EB4 A;  5GSN A;  1KSU A;  4EQX A;  4PAB A;  4BJY A;  3C4N A;  1S3E A;  1IUX A;  1QLB A;  1IUV A;  4GDE A;  3QSM A;  4GDP A;  4II3 A;  2YVJ A;  2GH5 A;  3LZX A;  3VR8 A;  2EQ6 A;  1KFY A;  3OC4 A;  1LJ1 A;  5KXJ A;  3AE8 A;  1ONF A;  4Z44 A;  3D8X A;  3S61 A;  3T2Z A;  1YQ3 A;  3KU9 A;  2YG3 A;  2OLO A;  2XVE A;  1YY5 A;  2WEU A;  4B69 A;  3GRS A;  1ELI A;  3QSE A;  4HB9 A;  1JRX A;  1FOH A;  4U2T A;  3RHA A;  2X8G A;  2E5V A;  3NNE A;  3NYC A;  4J34 A;  4EMJ A;  1CJ4 A;  2APG A;  2OLN A;  4BV6 A;  2VQB A;  2NVK X;  3NIX A;  1FL2 A;  4C3X A;  4O5U A;  4OPI A;  4U8K A;  2X8H A;  2BC0 A;  2JKC A;  4I58 A;  3KKJ A;  2R46 A;  2C67 A;  3NRN A;  1OJT A;  4U8N A;  4B68 A;  5KMS A;  2YG5 A;  2QA1 A;  1H7W A;  5FS8 A;  3DJE A;  1D4D A;  4H2P A;  1H82 A;  1SEZ A;  1Z6L A;  2WOW A;  3FPZ A;  3NYF A;  3RP7 A;  1VG9 A;  3EAO A;  3T2K A;  2YG4 A;  4ADW A;  1H86 A;  2AAQ A;  2YM2 A;  4MJW A;  2VOU A;  4EIP A;  2XFO A;  1D4E A;  3SGL A;  2BS3 A;  4H4P A;  4OPT A;  3JSK A;  3ICR A;  2YLX A;  3EPT A;  1S2Q A;  4XXG A;  4BK3 A;  4AP1 A;  2XLU A;  1DXL A;  3LB8 A;  5U1O A;  3F8D A;  4EQW A;  4NNJ A;  3II4 A;  4EMI A;  5JCN A;  4H50 A;  1NG3 A;  3AD8 B;  5EB5 A;  4BK1 A;  2YAU A;  4GAV A;  4H4R A;  5IQ1 A;  5KVI A;  5KMP A;  4Y4M A;  3V3N A;  3AWI A;  4U8O A;  2JB3 A;  3AEF A;  1ZOY A;  2XCG A;  3GYX A;  3HYX A;  3UKL A;  1GOS A;  3T31 A;  3KPK A;  4NTC A;  2X99 A;  3M12 A;  1RP0 A;  2C4C A;  1N4W A;  2PHH A;  4ZCD A;  2BAB A;  2C66 A;  3UTH A;  5KRQ A;  1LQT A;  2XFQ A;  1L9E A;  2XFP A;  1H7X A;  4I59 A;  1NDA A;  5EBK A;  1RSG A;  2C73 A;  3NN6 X;  1QJD A;  2BK5 A;  3QSS A;  4J2W A;  2EQ9 A;  4CBQ A;  5FS7 A;  4WCT A;  1L0V A;  1ZP0 A;  4U8P A;  3KPF A;  4B1B A;  2V60 A;  3T37 A;  5ER0 A;  3ICT A;  2VZ2 A;  1MXT A;  3HYW A;  2V3B A;  2R45 A;  2BRA A;  1F8R A;  1GRG A;  4Z24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...