3F8DA

Structure of sulfolobus solfataricus thioredoxin reductase mutant c147a
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
310
structure length
308
Chain Sequence
VKPGEKFDVIIVGLGPAAYGAALYSARYMLKTLVIGETPGGQLTEAGIVDDYLGLIEIQASDMIKVFNKHIEKYEVPVLLDIVEKIENREFVVKTKRKGEFKADSVILGIGVKRRKLGVPGEQEFAGRGISYCSVADAPLFKNRVVAVIGGGDSALEGAEILSSYSTKVYLIHRRDTFKAQPIYVETVKKKPNVEFVLNSVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFAKSNGIETDTNGYIKVDEWMRTSVPGVFAAGDCTSAWLGFRQVITAVAQGAVAATSAYRYVTEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase (TrxB-3)
publication title Structure and stability of a thioredoxin reductase from Sulfolobus solfataricus: a thermostable protein with two functions
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 102
structure length 308
sequence length 310
chains with identical sequence B, C, D
ec nomenclature ec 1.6.4.5: Transferred entry: 1.8.1.9.
pdb deposition date 2008-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8dA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3f8dA02
3DJEA 4N9XA 4EMWA 2EQ6A 1IUVA 2RGJA 2RABA 4PABA 4AT0A 5KVIA 4CRTA 1NPXA 2C3DA 3CNTA 1ZKQA 3F8DA 4DGKA 3H4KA 2A87A 1VQWA 3ATRA 1GALA 1BKWA 4NEWA 1IUSA 1H86A 2WBAA 3DH9A 1ZMDA 3L1RA 4Z2RA 3CGEA 4J34A 3DGHA 3AWIA 3QFAA 1EL9A 4UP3A 5FS9A 4A6NA 4H4ZA 4BV6A 2PYXA 3D1CA 3P4QA 2YR4A 4EMIA 1D4CA 1NG4A 3SM8A 3DMEA 1Z6LA 3QJ4A 1SEZA 3UTFA 2YLSA 2ZBWA 5HYMA 4JNAA 3ALJA 3NYFA 5HY5A 2YG6A 3CGBA 3UTGA 1GRAA 4H4RA 3BNMA 5HHFA 3AEAA 2QAEA 2Z5XA 3SFEA 3DK9A 1PXCA 3GRSA 4Z44A 2YLZA 4CCQA 1KFYA 3QFBA 4RG3A 1RYIA 2IIDA 2XVFA 5GSNA 4K2XA 2WEUA 3AEEA 3FBSA 1ZMCA 2C66A 4B66A 4Z25A 1PXAA 5KOWA 2B7RA 3NN6X 3HZLA 1JNZA 3CTYA 2FJEA 4UDQA 5U25A 4A9WA 3FPZA 2YR6A 2E4GA 2BK4A 1GV4A 4WX1A 1GREA 1OJTA 5ER0A 4CNJA 2VOUA 2ACZA 2YG7A 1PJ5A 1TYPA 1F8WA 1Q1RA 1YY5A 1ZOVA 1ZOYA 4Z24A 3QSEA 5U1OA 1L0VA 3RP8A 1PBEA 1JU2A 2B76A 2XYOA 5IQ1A 1V59A 3AE1A 4DSHA 3CGDA 3ITJA 3VRDB 4OPIA 1RP0A 3GMCA 4K22A 5JCKA 3VRBA 4DSGA 1DOCA 3CN8A 3LZXA 3JSKA 1TDFA 2DKIA 1PHHA 4A7AA 1VRQB 1MXTA 1FL2A 3FG2P 5JCNA 1D4DA 3S61A 3NN0X 1FOHA 4EQRA 1IUTA 3C96A 3LOVA 3OZ2A 4YSXA 2YG3A 3BNUA 3ICTA 2F5ZA 2YWLA 2WP6A 4LU6A 4IVMB 3F8PA 1YQ4A 4AP3A 2XFQA 3GYIA 3NT6A 4TM3A 2VVLG 2WDVA 3B3RA 3ICSA 2B9YA 4BJZA 4H4SA 4UDRA 1GPEA 3P4SA 3IHMA 1E39A 2BCPA 1N4UA 3GD4A 1K0IA 2YAUA 1YKJA 3AXBA 4H2PA 3NH3X 1TRBA 4H4TA 5C2TA 1D5TA 1DJQA 1NDAA 2GQFA 3ISHA 3M12A 1CJ2A 5JCMA 1BWCA 3BI4A 3DGZA 4U8MA 5BULA 2XLUA 1S3EA 3ALLA 3PS9A 4OVIA 1GRBA 1CJCA 1L9EA 4P9SA 4X4JA 1PXBA 1D7YA 2C70A 1LTXR 2H88A 5CKUA 3Q6JA 4ECHA 3AYLA 2XVIA 3B6DA 1XDIA 4U8NA 2YLTA 1IJHA 4JDRA 5JCIA 4USQA 2JKCA 1IUWA 1PDHA 2X8GA 2C3CA 4KX6A 3H8IA 1CC6A 4H4YA 4X9NA 1CJ4A 2GEWA 2B7SA 4DNAA 3ICRA 3V76A 1GERA 5FS6A 3T37A 2WHDA 4H7UA 1GSNA 2RGHA 2E5VA 3GWDA 1TYTA 1NG3A 1REOA 2C73A 4C77A 1M6IA 1LPFA 2GR2A 2XFPA 3LZWA 3DK4A 1DOBA 4FX9A 2GMHA 1K0LA 2B9XA 2Y6RA 3RP7A 4NTEA 3AD7B 4TLZA 1Y56A 4TM0A 2Y6QA 4C74A 2WP5A 1F8SA 4H2RA 4K7ZA 3GMBA 2A89A 3KD9A 3UKKA 2QCUA 1L9CA 2WETA 5EBKA 1VG9A 2JB1A 3AE2A 4GCMA 2R0GA 2OLOA 1K4QA 5GRTA 3UKPA 4C3XA 3K7QX 4IA6A 2Q0KA 1BZLA 3I3LA 2Q0LA 3VQRA 3AE9A 1GETA 2GR0A 4JY2A 4M52A 2CDUA 1ZX9A 3GDNA 3I6DA 4ZN0A 2JB3A 1COYA 2VQBA 3KPFA 1VDCA 2GR3A 2O9ZA 5EB4A 2XLTA 3CPJG 2NPXA 2WP9A 5BUKA 5IPYA 4K5RA 4OPDA 3BI2A 3V3OA 3CPHG 2YLRA 3AEDA 2E1MA 3RHAA 3ATQA 3EPTA 1GTHA 4J33A 5JCLA 2TPRA 3GDPA 4REKA 4U8KA 4Y4LA 3BHKA 4X9MA 4B65A 1TDOA 1FEAA 1NEKA 4H4UA 1B37A 3EANA 2BC1A 2VVMA 3M0OA 2UZZA 5FS8A 1QLBA 1OJDA 1XHCA 2XCGA 3VR9A 2GH5A 5KXJA 4Z26A 4XWRA 5HXIA 1NENA 3EAOA 2BACA 3NLCA 3DJDA 1NAAA 3H8LA 3UOYA 1GRTA 1B5QA 1GRGA 5EB5A 2YM2A 3AEBA 4I58A 3NGCX 4JN9A 2JB2A 4MJWA 2APGA 4IA5A 1PBBA 4GDPA 1QO8A 3P4PA 4YT0A 2QA1A 2I0ZA 3URHA 4YTPA 2FBWA 1LQUA 4FDCB 2XVJA 4EM3A 2XLSA 3P1WA 2X3NA 3KVEA 3NRNA 3NK2X 1BGJA 3UTEA 1GRFA 1BGNA 2Q7VA 4U8IA 4B68A 2WPFA 3P9UA 3DJJA 1JEHA 1CJ3A 2WOIA 1B4VA 4IV9A 3M13A 4ZCCA 1P2EA 4U2LA 2GRTA 1Q1WA 2W0HA 5BVAA 1H6VA 5TR3A 1EBDA 1B8SA 3IC9A 2GB0A 1PBFA 1S2YA 4YTMA 1AOGA 3REDA 3AE3A 4LIIA 2Q6UA 2YVGA 1PJ7A 5EOWA 4CNKA 2OA1A 1KF6A 4IVOB 3VRAA 4CY8A 1QJDA 4GRTA 3BHFA 3LB8A 3UOVA 4B69A 3C4AA 4H4XA 3AECA 2WU2A 4K5SA 4A79A 2GV8A 3G5QA 2ZZ0A 3UP4A 3UCLA 1CBOA 2A8XA 3EF6A 4H4WA 3AE6A 3QSSA 3GD3A 1DXLA 1PN0A 3DA1A 3ADAB 4FK1C 2CULA 3NK0X 4ZCDA 2V60A 5U63A 3IHGA 2YG5A 3DJGX 2JBVA 5FS7A 3NNEA 2HQMA 4A6NB 4Z2UA 2YM1A 4UDPA 2Z5YA 2TMDA 4C3YA 3AE5A 4C5OA 2GVCA 2V61A 3ABVA 3CGCA 3KLJA 1OJ9A 4BK3A 4BURA 2BYBA 1NHRA 3UKLA 2J3NA 1IUUA 3NK1X 1LV0A 2JAEA 1ZP0A 3AEGA 5FMHA 4H50A 1K0JA 4E0VA 3E1TA 4YSZA 1CC4A 4ADWA 1E6EA 4GUVA 2GMJA 2XLRA 1O5WA 2XVEA 3II4A 4RG4A 2IVEA 4U2TA 3UKHA 3ZDNA 2R46A 3ZYXA 4B64A 5KOXA 1DJNA 3NHOX 1E1MA 2VRLA 2XLPA 3G5RA 1Q9IA 1MO9A 3UKAA 4EQWA 4J57A 1KSSA 1ONFA 1W4XA 1DNCA 2FJAA 3RP6A 2GQWA 2R0CA 4KPRA 2NVKX 1TDEA 5L46A 2R45A 1GOSA 2BS3A 3NKSA 1GXFA 4GF7A 4Z43A 4OPUA 1E7PA 3BI5A 4HB9A 1N4WA 4H2NA 4ICYA 4Y4MA 2GF3A 4EIQA 1JRZA 2FJBA 1CF3A 2YQUA 4Z2TA 2GR1A 2BK5A 4WCTA 1F6MA 1GEUA 4EQSA 1CHUA 3LJPA 1JRXA 3K30A 2C72A 1L9DA 1LVLA 4U2SA 3SGLA 2OAMA 4JQ9A 2AQJA 2BXSA 3P4RA 1GESA 2C76A 3GRTA 4OPCA 1GT8A 2C67A 3IWAA 2B9WA 2X50A 4B1BA 4EM4A 2YVJA 4K8DA 2C65A 2OLNA 4D03A 4YSYA 3NIXA 3Q9TA 5KRQA 3AE4A 2GAGB 1NHPA 3AE7A 1E1NA 4YWOA 2R0PA 1Y0PA 2X8HA 1EL5A 4GDEA 4TLXA 1ELIA 2XFNA 4H4PA 4YKGA 1KSUA 4NTDA 1NHSA 1GNDA 4GR1A 4J2WA 1F3PA 2OALA 3CIRA 4AOXA 1O95A 1XPQA 3CNPA 4OPGA 2IVDA 1JOAA 1KNPA 2EQ8A 4B67A 4CY6A 2VRMA 4J31A 2BXRA 5J7XA 4H4VA 1D4EA 2R4JA 4Y4NA 2AR8A 4XWZA 1H7WA 1OJAA 3COXA 4BJYA 3CNSA 4OPLA 1H84A 2RGOA 1BF3A 4U8OA 1TDNA 3AD8B 2YR5A 3G5SA 2GAHB 4U8PA 3PVCA 3CPIG 4AOSA 2WOVA 4EIPA 5KWFA 4AT2A 4B63A 3QVPA 2BK3A 1M64A 4LA1A 4D04A 3ALMA 1YQZA 4EQXA 2WPCA 4JNQA 4A5LA 1KNRA 2ZZCA 2R9ZA 2V3BA 3KU9A 1KDGA 2BA9A 4NTCA 1YQ3A 4U8LA 5M10A 3AB1A 3NG7X 2WS3A 3AEFA 4XXGA 1MOKA 2V6OA 1D7LA 1PBDA 4RSLA 1FECA 3FMWA 1GTEA 2XDOA 3AD9B 3D8XA 2VZ2A 1RSGA 1HYUA 3NTAA 1S2QA 2WPEA 3FIMB 1NHQA 2AAQA 3WE0A 2X8CA 3UKQA 1PBCA 3AYIA 2YG4A 3NYCA 3UOZA 3SFDA 3GYJA 3S5WA 3GSIA 3CNDA 4BK2A 1FEBA 1Y56B 2V3AA 4J36A 4HA6A 4A65A 4CBQA 2WU5A 4H2QA 3PO7A 1E1LA 2ZZBA 5IQ4A 3KA7A 3NTDA 1JRYA 2PHHA 1ZK7A 4USRA 1LJ1A 4AP1A 5M0ZA 4OCGA 3RNMA 1OJCA 2YLWA 4JY3A 4O5QA 2BS4A 3QSMA 1VG0A 3IF9A 1EL8A 2BC0A 3F8RA 3SQPA 1N4VA 2WQYA 4YKFA 1ZY8A 5LV9A 4BK1A 3L8KA 3NYEA 5J60A 3R9UA 1IUXA 4H4QA 2V5ZA 2WDQA 1DOEA 3O0HA 4YSHA 1H81A 4TM4A 4U8JA 1FCDA 3C4NA 1E1KA 4EMJA 5CQFA 2FJDA 1H83A 2JK6A 2XFUA 2C75A 4NEVA 1PS9A 2XFOA 1PJ6A 1XANA 2C64A 4NZHA 4O5UA 3UP5A 3VR8A 2WOWA 2YVFA 3K7TA 4YXDA 4J56A 2EQ9A 3OC4A 1H82A 1N1PA 4CCRA 5C3JA 3LXDA 3DK8A 1S3BA 4APNA 2CFYA 2EQ7A 2BCGG 3GWFA 2VVLA 3V3NA 2VQ7A 2X99A 2XVHA 1O94A 2H89A 3CNJA 1TDKA 1ZDLA 1CC2A 3KKJA 1JNRA 2WDRA 1DODA 4OPTA 5KVHA 1EL7A 2YLXA 3LADA 3UTHA 3UKFA 2BS2A 1F8RA 2R4EA 5BRTA 4PAAA 1X31B 4A99A 4I59A 2QA2A 1LQTA 2DKHA 5DBJA 2C7GA 4TM1A 1CL0A 4YTNA 3AE8A 4FK1A 3K7MX 3AYJA 2BABA 3UOXA 1H7XA 3QVRA 1GRHA 2CVJA 1P2HA 2ARDA 2WESA 1UKVG
chains in the Genus database with same CATH superfamily
3DJEA 3T2ZA 4N9XA 4EMWA 2EQ6A 1IUVA 2RGJA 2RABA 4PABA 4AT0A 5KVIA 4CRTA 1NPXA 2C3DA 3CNTA 1ZKQA 3F8DA 4DGKA 3H4KA 2A87A 1VQWA 3ATRA 1GALA 1BKWA 4NEWA 1IUSA 1H86A 2WBAA 3DH9A 1ZMDA 3L1RA 4Z2RA 3CGEA 4J34A 3DGHA 3AWIA 3HYWA 1EL9A 3HYXA 3QFAA 4UP3A 4H4ZA 5FS9A 4A6NA 4BV6A 2PYXA 3D1CA 3P4QA 2YR4A 4EMIA 1D4CA 1NG4A 3SM8A 3DMEA 1Z6LA 3QJ4A 1SEZA 4NNJA 3UTFA 2YLSA 2ZBWA 5HYMA 4JNAA 3ALJA 3NYFA 5HY5A 2YG6A 3CGBA 3UTGA 1GRAA 4H4RA 3BNMA 5HHFA 3AEAA 2QAEA 2Z5XA 3SFEA 3DK9A 1PXCA 3GRSA 4Z44A 3SY4A 2YLZA 4CCQA 1KFYA 3QFBA 4RG3A 1RYIA 2IIDA 2XVFA 5GSNA 4K2XA 2WEUA 3AEEA 3FBSA 1ZMCA 2C66A 4B66A 4Z25A 1PXAA 5KOWA 2B7RA 3NN6X 3HZLA 3T2YA 1JNZA 3T2KA 3CTYA 2FJEA 4UDQA 5U25A 4A9WA 3FPZA 2YR6A 2E4GA 2BK4A 1GV4A 4WX1A 1GREA 1OJTA 5ER0A 4GAPA 4CNJA 2VOUA 2ACZA 2YG7A 1PJ5A 1TYPA 1F8WA 1Q1RA 1YY5A 1ZOVA 1ZOYA 4Z24A 3QSEA 5U1OA 1L0VA 3RP8A 1PBEA 1JU2A 2B76A 2XYOA 5IQ1A 1V59A 3AE1A 4DSHA 3CGDA 3ITJA 2BRYA 3VRDB 4OPIA 1RP0A 3GMCA 4K22A 5JCKA 3VRBA 4DSGA 1DOCA 3CN8A 3LZXA 3JSKA 1TDFA 2DKIA 1PHHA 4A7AA 1VRQB 1MXTA 1FL2A 3FG2P 5JCNA 1D4DA 3S61A 3NN0X 1FOHA 4EQRA 1IUTA 3T31A 3C96A 3LOVA 3OZ2A 4YSXA 2YG3A 3BNUA 3ICTA 2F5ZA 2YWLA 2WP6A 4LU6A 4IVMB 3F8PA 1YQ4A 4AP3A 2XFQA 3GYIA 3NT6A 4G6GA 4TM3A 2VVLG 2WDVA 3B3RA 3ICSA 2B9YA 4BJZA 4H4SA 4UDRA 1GPEA 3P4SA 3IHMA 1E39A 2BCPA 1N4UA 3GD4A 1K0IA 2YAUA 1YKJA 3AXBA 4H2PA 3NH3X 1TRBA 4H4TA 5C2TA 1D5TA 1DJQA 1NDAA 2GQFA 3ISHA 3M12A 5KMQA 1CJ2A 5JCMA 1BWCA 3BI4A 3DGZA 4U8MA 5BULA 2XLUA 1S3EA 3ALLA 3PS9A 4OVIA 1GRBA 1CJCA 1L9EA 4P9SA 4X4JA 1PXBA 1D7YA 2C70A 1LTXR 2H88A 5CKUA 3Q6JA 4ECHA 3AYLA 2XVIA 3B6DA 1XDIA 4U8NA 2YLTA 1IJHA 4JDRA 5JCIA 4USQA 2JKCA 1IUWA 1PDHA 2X8GA 2C3CA 4KX6A 3H8IA 1CC6A 4H4YA 4X9NA 1CJ4A 2GEWA 2B7SA 4DNAA 3ICRA 3V76A 1GERA 5FS6A 3T37A 2WHDA 4H7UA 1GSNA 2RGHA 2E5VA 3GWDA 1TYTA 1NG3A 1REOA 2C73A 4C77A 1M6IA 5KNLA 1LPFA 2GR2A 2XFPA 3LZWA 3DK4A 1DOBA 4FX9A 2GMHA 1K0LA 2B9XA 2Y6RA 3RP7A 4NTEA 3AD7B 4TLZA 1Y56A 4TM0A 2Y6QA 4C74A 2WP5A 1F8SA 4H2RA 4K7ZA 3GMBA 2A89A 3KD9A 3UKKA 2QCUA 1L9CA 2WETA 5EBKA 1VG9A 2JB1A 3AE2A 4GCMA 2R0GA 2OLOA 1K4QA 5GRTA 3UKPA 4C3XA 3K7QX 4IA6A 2Q0KA 4G6HA 3SZWA 1BZLA 3I3LA 2Q0LA 3VQRA 3AE9A 1GETA 2GR0A 4JY2A 4M52A 2CDUA 1ZX9A 3GDNA 3I6DA 3T14A 2JB3A 4ZN0A 1COYA 2VQBA 3KPFA 1VDCA 2GR3A 2O9ZA 5EB4A 2XLTA 3CPJG 2NPXA 2WP9A 4G73A 4G9KA 5BUKA 4K5RA 4OPDA 5IPYA 3BI2A 3V3OA 3CPHG 2YLRA 3AEDA 2E1MA 3RHAA 3ATQA 3EPTA 1GTHA 4J33A 5JCLA 2TPRA 3GDPA 4REKA 4U8KA 4Y4LA 3BHKA 4X9MA 4B65A 1TDOA 1FEAA 1NEKA 4H4UA 1B37A 3EANA 2BC1A 2VVMA 3M0OA 2UZZA 5FS8A 1QLBA 3SXIA 1OJDA 1XHCA 2XCGA 3VR9A 2GH5A 5KXJA 4Z26A 4XWRA 5HXIA 1NENA 3EAOA 2BACA 3NLCA 3DJDA 1NAAA 3H8LA 3UOYA 1GRTA 1B5QA 1GRGA 5EB5A 2YM2A 3AEBA 4I58A 3NGCX 4JN9A 2JB2A 4MJWA 2APGA 4IA5A 1PBBA 4GDPA 1QO8A 3P4PA 4YT0A 2QA1A 3HYVA 2I0ZA 3URHA 4YTPA 2FBWA 1LQUA 4FDCB 2XVJA 4EM3A 2XLSA 3P1WA 2X3NA 3KVEA 5KMSA 3NRNA 3NK2X 1BGJA 3UTEA 1GRFA 1BGNA 2Q7VA 3CMMA 4U8IA 4B68A 2WPFA 3P9UA 3DJJA 1JEHA 1CJ3A 2WOIA 1B4VA 4IV9A 3M13A 4ZCCA 1P2EA 4U2LA 2GRTA 1Q1WA 2W0HA 5BVAA 1H6VA 5TR3A 1EBDA 1B8SA 3IC9A 2GB0A 1PBFA 1S2YA 4YTMA 1AOGA 3REDA 3AE3A 4LIIA 2Q6UA 2YVGA 1PJ7A 5EOWA 3SZCA 2OA1A 4CNKA 1KF6A 4IVOB 3VRAA 4CY8A 1QJDA 4GRTA 3BHFA 3LB8A 3UOVA 4B69A 3C4AA 4H4XA 3AECA 2WU2A 4K5SA 4A79A 2GV8A 3G5QA 2ZZ0A 3UP4A 3UCLA 1CBOA 2A8XA 3EF6A 4H4WA 3AE6A 3QSSA 3GD3A 1DXLA 1PN0A 3DA1A 3ADAB 4FK1C 2CULA 3NK0X 4ZCDA 2V60A 5U63A 3IHGA 2YG5A 3DJGX 2JBVA 5FS7A 3NNEA 2HQMA 4A6NB 4Z2UA 2YM1A 4UDPA 2Z5YA 2TMDA 4C3YA 3AE5A 4C5OA 2GVCA 2V61A 3ABVA 3CGCA 3KLJA 1OJ9A 4BK3A 4BURA 2BYBA 1NHRA 4GAVA 2J3NA 3UKLA 1IUUA 3NK1X 1LV0A 2JAEA 3SYIA 1ZP0A 3AEGA 5FMHA 4H50A 1K0JA 4E0VA 3E1TA 4YSZA 1CC4A 4ADWA 1E6EA 4GUVA 2GMJA 2XLRA 1O5WA 2XVEA 3II4A 4RG4A 2IVEA 4U2TA 3UKHA 3ZDNA 2R46A 3ZYXA 3KPKA 4B64A 5KOXA 1DJNA 3NHOX 1E1MA 2VRLA 2XLPA 3G5RA 1Q9IA 1MO9A 3UKAA 4EQWA 4J57A 1KSSA 1ONFA 1W4XA 1DNCA 2FJAA 3RP6A 2GQWA 2R0CA 4KPRA 2NVKX 1TDEA 5L46A 2R45A 1GOSA 2BS3A 3NKSA 1GXFA 4GF7A 4Z43A 4OPUA 1E7PA 3BI5A 4HB9A 1N4WA 4H2NA 4ICYA 4Y4MA 2GF3A 4EIQA 3SX6A 5KMRA 1JRZA 2FJBA 3T0KA 1CF3A 2YQUA 4Z2TA 2GR1A 2BK5A 4WCTA 1F6MA 1GEUA 4EQSA 1CHUA 3LJPA 1JRXA 3K30A 2C72A 1L9DA 1LVLA 4U2SA 3SGLA 2OAMA 4JQ9A 2AQJA 2BXSA 3P4RA 1GESA 2C76A 3GRTA 4OPCA 1GT8A 2C67A 3IWAA 2B9WA 2X50A 4B1BA 4EM4A 2YVJA 4K8DA 2C65A 2OLNA 4D03A 4YSYA 3NIXA 3Q9TA 5KRQA 3AE4A 2GAGB 1NHPA 3AE7A 1E1NA 4YWOA 2R0PA 1Y0PA 2X8HA 1EL5A 4GDEA 4TLXA 1ELIA 2XFNA 4H4PA 4YKGA 1KSUA 4NTDA 1NHSA 1GNDA 4GR1A 4J2WA 1F3PA 2OALA 3CIRA 4AOXA 1O95A 1XPQA 3CNPA 4OPGA 2IVDA 1JOAA 1KNPA 2EQ8A 4II3A 4B67A 4CY6A 2VRMA 4J31A 2BXRA 5J7XA 4H4VA 4G74A 1D4EA 2R4JA 4Y4NA 2AR8A 4XWZA 1H7WA 1OJAA 3COXA 4BJYA 3CNSA 4OPLA 1H84A 2RGOA 1BF3A 4U8OA 1TDNA 3AD8B 2YR5A 3G5SA 2GAHB 4U8PA 3PVCA 3CPIG 4AOSA 2WOVA 4EIPA 5KWFA 4AT2A 4B63A 3QVPA 4NWZA 2BK3A 2C4CA 1M64A 4LA1A 4D04A 3ALMA 1YQZA 4EQXA 2WPCA 4JNQA 4A5LA 1KNRA 2ZZCA 2R9ZA 2V3BA 3KU9A 1KDGA 2BA9A 4NTCA 4II2A 1YQ3A 4U8LA 5M10A 3AB1A 3NG7X 2WS3A 3AEFA 4XXGA 1MOKA 2V6OA 1D7LA 1PBDA 4RSLA 1FECA 3FMWA 1GTEA 2XDOA 3AD9B 3D8XA 2VZ2A 1RSGA 1HYUA 3NTAA 1S2QA 2WPEA 3FIMB 1NHQA 2AAQA 3WE0A 2X8CA 3UKQA 1PBCA 3AYIA 2YG4A 3NYCA 3SZ0A 5KMPA 3UOZA 3SFDA 3GYJA 3S5WA 3GSIA 3CNDA 4BK2A 1FEBA 1Y56B 2V3AA 4J36A 4HA6A 4A65A 4CBQA 2WU5A 4H2QA 3PO7A 1E1LA 2ZZBA 5IQ4A 3KA7A 3NTDA 1JRYA 2PHHA 1ZK7A 4USRA 1LJ1A 4AP1A 5M0ZA 4OCGA 3RNMA 1OJCA 2YLWA 4JY3A 4O5QA 2BS4A 3QSMA 1VG0A 3IF9A 1EL8A 2BC0A 3F8RA 3SQPA 1N4VA 2WQYA 4YKFA 1ZY8A 3SZFA 5LV9A 4BK1A 3L8KA 3NYEA 5J60A 3R9UA 1IUXA 4H4QA 2V5ZA 2WDQA 1DOEA 3O0HA 4YSHA 1H81A 4TM4A 4U8JA 1FCDA 3GYXA 3C4NA 1E1KA 4EMJA 5CQFA 2FJDA 1H83A 2JK6A 2XFUA 2C75A 4NEVA 1PS9A 2XFOA 1PJ6A 1XANA 2C64A 4NZHA 4O5UA 3UP5A 3VR8A 2WOWA 2YVFA 3K7TA 4YXDA 4J56A 2EQ9A 3OC4A 1H82A 1N1PA 4CCRA 5C3JA 3LXDA 3DK8A 1S3BA 4APNA 2CFYA 2EQ7A 2BCGG 3GWFA 2VVLA 3V3NA 2VQ7A 2X99A 2XVHA 1O94A 2H89A 3CNJA 1TDKA 1ZDLA 1CC2A 3KKJA 1JNRA 2WDRA 1DODA 4OPTA 5KVHA 1EL7A 2YLXA 3LADA 3UTHA 3UKFA 2BS2A 1F8RA 2R4EA 5BRTA 4PAAA 1X31B 4A99A 4I59A 2QA2A 2BRAA 1LQTA 2DKHA 5DBJA 2C7GA 4TM1A 1CL0A 4YTNA 3AE8A 4FK1A 3K7MX 3AYJA 2BABA 3UOXA 1H7XA 3QVRA 1GRHA 2CVJA 1P2HA 2ARDA 2WESA 1UKVG
chains in the Genus database with same CATH topology
3DJEA 3T2ZA 4N9XA 4EMWA 2EQ6A 1IUVA 2RGJA 2RABA 4PABA 4AT0A 5KVIA 4CRTA 1NPXA 2C3DA 3CNTA 1ZKQA 3F8DA 4DGKA 3H4KA 2A87A 1VQWA 3ATRA 1GALA 1BKWA 4NEWA 1IUSA 1H86A 2WBAA 3DH9A 1ZMDA 3L1RA 4Z2RA 3CGEA 4J34A 3DGHA 3AWIA 3HYWA 1EL9A 3HYXA 3QFAA 4UP3A 4H4ZA 5FS9A 4A6NA 4BV6A 2PYXA 3D1CA 3P4QA 2YR4A 4EMIA 1D4CA 1NG4A 3SM8A 3DMEA 1Z6LA 3QJ4A 1SEZA 4NNJA 3UTFA 2YLSA 2ZBWA 5HYMA 4JNAA 3ALJA 3NYFA 5HY5A 2YG6A 3CGBA 3UTGA 1GRAA 4H4RA 3BNMA 5HHFA 3AEAA 2QAEA 2Z5XA 3SFEA 3DK9A 1PXCA 3GRSA 4Z44A 3SY4A 2YLZA 4CCQA 1KFYA 3QFBA 4RG3A 1RYIA 2IIDA 2XVFA 5GSNA 4K2XA 2WEUA 3AEEA 3FBSA 1ZMCA 2C66A 4B66A 4Z25A 1PXAA 5KOWA 2B7RA 3NN6X 3HZLA 3T2YA 1JNZA 3T2KA 3CTYA 2FJEA 4UDQA 5U25A 4A9WA 3FPZA 2YR6A 2E4GA 2BK4A 1GV4A 4WX1A 1GREA 1OJTA 5ER0A 4GAPA 4CNJA 2VOUA 2ACZA 2YG7A 1PJ5A 1TYPA 1F8WA 1Q1RA 1YY5A 1ZOVA 1ZOYA 4Z24A 3QSEA 5U1OA 1L0VA 3RP8A 1PBEA 1JU2A 2B76A 2XYOA 5IQ1A 1V59A 3AE1A 4DSHA 3CGDA 3ITJA 2BRYA 3VRDB 4OPIA 1RP0A 3GMCA 4K22A 5JCKA 3VRBA 4DSGA 1DOCA 3CN8A 3LZXA 3JSKA 1TDFA 2DKIA 1PHHA 4A7AA 1VRQB 1MXTA 1FL2A 3FG2P 5JCNA 1D4DA 3S61A 3NN0X 1FOHA 4EQRA 1IUTA 3T31A 3C96A 3LOVA 3OZ2A 4YSXA 2YG3A 3BNUA 3ICTA 2F5ZA 2YWLA 2WP6A 4LU6A 4IVMB 3F8PA 1YQ4A 4AP3A 2XFQA 3GYIA 3NT6A 4G6GA 4TM3A 2VVLG 2WDVA 3B3RA 3ICSA 2B9YA 4BJZA 4H4SA 4UDRA 1GPEA 3P4SA 3IHMA 1E39A 2BCPA 1N4UA 3GD4A 1K0IA 2YAUA 1YKJA 3AXBA 4H2PA 3NH3X 1TRBA 4H4TA 5C2TA 1D5TA 1DJQA 1NDAA 2GQFA 3ISHA 3M12A 5KMQA 1CJ2A 5JCMA 1BWCA 3BI4A 3DGZA 4U8MA 5BULA 2XLUA 1S3EA 3ALLA 3PS9A 4OVIA 1GRBA 1CJCA 1L9EA 4P9SA 4X4JA 1PXBA 1D7YA 2C70A 1LTXR 2H88A 5CKUA 3Q6JA 4ECHA 3AYLA 2XVIA 3B6DA 1XDIA 4U8NA 2YLTA 1IJHA 4JDRA 5JCIA 4USQA 2JKCA 1IUWA 1PDHA 2X8GA 2C3CA 4KX6A 3H8IA 1CC6A 4H4YA 4X9NA 1CJ4A 2GEWA 2B7SA 4DNAA 3ICRA 3V76A 1GERA 5FS6A 3T37A 2WHDA 4H7UA 1GSNA 2RGHA 2E5VA 3GWDA 1TYTA 1NG3A 1REOA 2C73A 4C77A 1M6IA 5KNLA 1LPFA 2GR2A 2XFPA 3LZWA 3DK4A 1DOBA 4FX9A 2GMHA 1K0LA 2B9XA 2Y6RA 3RP7A 4NTEA 3AD7B 4TLZA 1Y56A 4TM0A 2Y6QA 4C74A 2WP5A 1F8SA 4H2RA 4K7ZA 3GMBA 2A89A 3KD9A 3UKKA 2QCUA 1L9CA 2WETA 5EBKA 1VG9A 2JB1A 3AE2A 4GCMA 2R0GA 2OLOA 1K4QA 5GRTA 3UKPA 4C3XA 3K7QX 4IA6A 2Q0KA 4G6HA 3SZWA 1BZLA 3I3LA 2Q0LA 3VQRA 3AE9A 1GETA 2GR0A 4JY2A 4M52A 2CDUA 1ZX9A 3GDNA 3I6DA 3T14A 2JB3A 4ZN0A 1COYA 2VQBA 3KPFA 1VDCA 2GR3A 2O9ZA 5EB4A 2XLTA 3CPJG 2NPXA 2WP9A 4G73A 4G9KA 5BUKA 4K5RA 4OPDA 5IPYA 3BI2A 3V3OA 3CPHG 2YLRA 3AEDA 2E1MA 3RHAA 3ATQA 3EPTA 1GTHA 4J33A 5JCLA 2TPRA 3GDPA 4REKA 4U8KA 4Y4LA 3BHKA 4X9MA 4B65A 1TDOA 1FEAA 1NEKA 4H4UA 1B37A 3EANA 2BC1A 2VVMA 3M0OA 2UZZA 5FS8A 1QLBA 3SXIA 1OJDA 1XHCA 2XCGA 3VR9A 2GH5A 5KXJA 4Z26A 4XWRA 5HXIA 1NENA 3EAOA 2BACA 3NLCA 3DJDA 1NAAA 3H8LA 3UOYA 1GRTA 1B5QA 1GRGA 5EB5A 2YM2A 3AEBA 4I58A 3NGCX 4JN9A 2JB2A 4MJWA 2APGA 4IA5A 1PBBA 4GDPA 1QO8A 3P4PA 4YT0A 2QA1A 3HYVA 2I0ZA 3URHA 4YTPA 2FBWA 1LQUA 4FDCB 2XVJA 4EM3A 2XLSA 3P1WA 2X3NA 3KVEA 5KMSA 3NRNA 3NK2X 1BGJA 3UTEA 1GRFA 1BGNA 2Q7VA 3CMMA 4U8IA 4B68A 2WPFA 3P9UA 3DJJA 1JEHA 1CJ3A 2WOIA 1B4VA 4IV9A 3M13A 4ZCCA 1P2EA 4U2LA 2GRTA 1Q1WA 2W0HA 5BVAA 1H6VA 5TR3A 1EBDA 1B8SA 3IC9A 2GB0A 1PBFA 1S2YA 4YTMA 1AOGA 3REDA 3AE3A 4LIIA 2Q6UA 2YVGA 1PJ7A 5EOWA 3SZCA 2OA1A 4CNKA 1KF6A 4IVOB 3VRAA 4CY8A 1QJDA 4GRTA 3BHFA 3LB8A 3UOVA 4B69A 3C4AA 4H4XA 3AECA 2WU2A 4K5SA 4A79A 2GV8A 3G5QA 2ZZ0A 3UP4A 3UCLA 1CBOA 2A8XA 3EF6A 4H4WA 3AE6A 3QSSA 3GD3A 1DXLA 1PN0A 3DA1A 3ADAB 4FK1C 2CULA 3NK0X 4ZCDA 2V60A 5U63A 3IHGA 2YG5A 3DJGX 2JBVA 5FS7A 3NNEA 2HQMA 4A6NB 4Z2UA 2YM1A 4UDPA 2Z5YA 2TMDA 4C3YA 3AE5A 4C5OA 2GVCA 2V61A 3ABVA 3CGCA 3KLJA 1OJ9A 4BK3A 4BURA 2BYBA 1NHRA 4GAVA 2J3NA 3UKLA 1IUUA 3NK1X 1LV0A 2JAEA 3SYIA 1ZP0A 3AEGA 5FMHA 4H50A 1K0JA 4E0VA 3E1TA 4YSZA 1CC4A 4ADWA 1E6EA 4GUVA 2GMJA 2XLRA 1O5WA 2XVEA 3II4A 4RG4A 2IVEA 4U2TA 3UKHA 3ZDNA 2R46A 3ZYXA 3KPKA 4B64A 5KOXA 1DJNA 3NHOX 1E1MA 2VRLA 2XLPA 3G5RA 1Q9IA 1MO9A 3UKAA 4EQWA 4J57A 1KSSA 1ONFA 1W4XA 1DNCA 2FJAA 3RP6A 2GQWA 2R0CA 4KPRA 2NVKX 1TDEA 5L46A 2R45A 1GOSA 2BS3A 3NKSA 1GXFA 4GF7A 4Z43A 4OPUA 1E7PA 3BI5A 4HB9A 1N4WA 4H2NA 4ICYA 4Y4MA 2GF3A 4EIQA 3SX6A 5KMRA 1JRZA 2FJBA 3T0KA 1CF3A 2YQUA 4Z2TA 2GR1A 2BK5A 4WCTA 1F6MA 1GEUA 4EQSA 1CHUA 3LJPA 1JRXA 3K30A 2C72A 1L9DA 1LVLA 4U2SA 3SGLA 2OAMA 4JQ9A 2AQJA 2BXSA 3P4RA 1GESA 2C76A 3GRTA 4OPCA 1GT8A 2C67A 3IWAA 2B9WA 2X50A 4B1BA 4EM4A 2YVJA 4K8DA 2C65A 2OLNA 4D03A 4YSYA 3NIXA 3Q9TA 5KRQA 3AE4A 2GAGB 1NHPA 3AE7A 1E1NA 4YWOA 2R0PA 1Y0PA 2X8HA 1EL5A 4GDEA 4TLXA 1ELIA 2XFNA 4H4PA 4YKGA 1KSUA 4NTDA 1NHSA 1GNDA 4GR1A 4J2WA 1F3PA 2OALA 3CIRA 4AOXA 1O95A 1XPQA 3CNPA 4OPGA 2IVDA 1JOAA 1KNPA 2EQ8A 4II3A 4B67A 4CY6A 2VRMA 4J31A 2BXRA 5J7XA 4H4VA 4G74A 1D4EA 2R4JA 4Y4NA 2AR8A 4XWZA 1H7WA 1OJAA 3COXA 4BJYA 3CNSA 4OPLA 1H84A 2RGOA 1BF3A 4U8OA 1TDNA 3AD8B 2YR5A 3G5SA 2GAHB 4U8PA 3PVCA 3CPIG 4AOSA 2WOVA 4EIPA 5KWFA 4AT2A 4B63A 3QVPA 4NWZA 2BK3A 2C4CA 1M64A 4LA1A 4D04A 3ALMA 1YQZA 4EQXA 2WPCA 4JNQA 4A5LA 1KNRA 2ZZCA 2R9ZA 2V3BA 3KU9A 1KDGA 2BA9A 4NTCA 4II2A 1YQ3A 4U8LA 5M10A 3AB1A 3NG7X 2WS3A 3AEFA 4XXGA 1MOKA 2V6OA 1D7LA 1PBDA 4RSLA 1FECA 3FMWA 1GTEA 2XDOA 3AD9B 3D8XA 2VZ2A 1RSGA 1HYUA 3NTAA 1S2QA 2WPEA 3FIMB 1NHQA 2AAQA 3WE0A 2X8CA 3UKQA 1PBCA 3AYIA 2YG4A 3NYCA 3SZ0A 5KMPA 3UOZA 3SFDA 3GYJA 3S5WA 3GSIA 3CNDA 4BK2A 1FEBA 1Y56B 2V3AA 4J36A 4HA6A 4A65A 4CBQA 2WU5A 4H2QA 3PO7A 1E1LA 2ZZBA 5IQ4A 3KA7A 3NTDA 1JRYA 2PHHA 1ZK7A 4USRA 1LJ1A 4AP1A 5M0ZA 4OCGA 3RNMA 1OJCA 2YLWA 4JY3A 4O5QA 2BS4A 3QSMA 1VG0A 3IF9A 1EL8A 2BC0A 3F8RA 3SQPA 1N4VA 2WQYA 4YKFA 1ZY8A 3SZFA 5LV9A 4BK1A 3L8KA 3NYEA 5J60A 3R9UA 1IUXA 4H4QA 2V5ZA 2WDQA 1DOEA 3O0HA 4YSHA 1H81A 4TM4A 4U8JA 1FCDA 3GYXA 3C4NA 1E1KA 4EMJA 5CQFA 2FJDA 1H83A 2JK6A 2XFUA 2C75A 4NEVA 1PS9A 2XFOA 1PJ6A 1XANA 2C64A 4NZHA 4O5UA 3UP5A 3VR8A 2WOWA 2YVFA 3K7TA 4YXDA 4J56A 2EQ9A 3OC4A 1H82A 1N1PA 4CCRA 5C3JA 3LXDA 3DK8A 1S3BA 4APNA 2CFYA 2EQ7A 2BCGG 3GWFA 2VVLA 3V3NA 2VQ7A 2X99A 2XVHA 1O94A 2H89A 3CNJA 1TDKA 1ZDLA 1CC2A 3KKJA 1JNRA 2WDRA 1DODA 4OPTA 5KVHA 1EL7A 2YLXA 3LADA 3UTHA 3UKFA 2BS2A 1F8RA 2R4EA 5BRTA 4PAAA 1X31B 4A99A 4I59A 2QA2A 2BRAA 1LQTA 2DKHA 5DBJA 2C7GA 4TM1A 1CL0A 4YTNA 3AE8A 4FK1A 3K7MX 3AYJA 2BABA 3UOXA 1H7XA 3QVRA 1GRHA 2CVJA 1P2HA 2ARDA 2WESA 1UKVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DJE A;  4N9X A;  4EMW A;  2EQ6 A;  1IUV A;  2RGJ A;  2RAB A;  4PAB A;  4AT0 A;  5KVI A;  4CRT A;  1NPX A;  2C3D A;  3CNT A;  1ZKQ A;  3F8D A;  4DGK A;  3H4K A;  2A87 A;  1VQW A;  3ATR A;  1GAL A;  1BKW A;  4NEW A;  1IUS A;  1H86 A;  2WBA A;  3DH9 A;  1ZMD A;  3L1R A;  4Z2R A;  3CGE A;  4J34 A;  3DGH A;  3AWI A;  3QFA A;  1EL9 A;  4UP3 A;  5FS9 A;  4A6N A;  4H4Z A;  4BV6 A;  2PYX A;  3D1C A;  3P4Q A;  2YR4 A;  4EMI A;  1D4C A;  1NG4 A;  3SM8 A;  3DME A;  1Z6L A;  3QJ4 A;  1SEZ A;  3UTF A;  2YLS A;  2ZBW A;  5HYM A;  4JNA A;  3ALJ A;  3NYF A;  5HY5 A;  2YG6 A;  3CGB A;  3UTG A;  1GRA A;  4H4R A;  3BNM A;  5HHF A;  3AEA A;  2QAE A;  2Z5X A;  3SFE A;  3DK9 A;  1PXC A;  3GRS A;  4Z44 A;  2YLZ A;  4CCQ A;  1KFY A;  3QFB A;  4RG3 A;  1RYI A;  2IID A;  2XVF A;  5GSN A;  4K2X A;  2WEU A;  3AEE A;  3FBS A;  1ZMC A;  2C66 A;  4B66 A;  4Z25 A;  1PXA A;  5KOW A;  2B7R A;  3NN6 X;  3HZL A;  1JNZ A;  3CTY A;  2FJE A;  4UDQ A;  5U25 A;  4A9W A;  3FPZ A;  2YR6 A;  2E4G A;  2BK4 A;  1GV4 A;  4WX1 A;  1GRE A;  1OJT A;  5ER0 A;  4CNJ A;  2VOU A;  2ACZ A;  2YG7 A;  1PJ5 A;  1TYP A;  1F8W A;  1Q1R A;  1YY5 A;  1ZOV A;  1ZOY A;  4Z24 A;  3QSE A;  5U1O A;  1L0V A;  3RP8 A;  1PBE A;  1JU2 A;  2B76 A;  2XYO A;  5IQ1 A;  1V59 A;  3AE1 A;  4DSH A;  3CGD A;  3ITJ A;  3VRD B;  4OPI A;  1RP0 A;  3GMC A;  4K22 A;  5JCK A;  3VRB A;  4DSG A;  1DOC A;  3CN8 A;  3LZX A;  3JSK A;  1TDF A;  2DKI A;  1PHH A;  4A7A A;  1VRQ B;  1MXT A;  1FL2 A;  3FG2 P;  5JCN A;  1D4D A;  3S61 A;  3NN0 X;  1FOH A;  4EQR A;  1IUT A;  3C96 A;  3LOV A;  3OZ2 A;  4YSX A;  2YG3 A;  3BNU A;  3ICT A;  2F5Z A;  2YWL A;  2WP6 A;  4LU6 A;  4IVM B;  3F8P A;  1YQ4 A;  4AP3 A;  2XFQ A;  3GYI A;  3NT6 A;  4TM3 A;  2VVL G;  2WDV A;  3B3R A;  3ICS A;  2B9Y A;  4BJZ A;  4H4S A;  4UDR A;  1GPE A;  3P4S A;  3IHM A;  1E39 A;  2BCP A;  1N4U A;  3GD4 A;  1K0I A;  2YAU A;  1YKJ A;  3AXB A;  4H2P A;  3NH3 X;  1TRB A;  4H4T A;  5C2T A;  1D5T A;  1DJQ A;  1NDA A;  2GQF A;  3ISH A;  3M12 A;  1CJ2 A;  5JCM A;  1BWC A;  3BI4 A;  3DGZ A;  4U8M A;  5BUL A;  2XLU A;  1S3E A;  3ALL A;  3PS9 A;  4OVI A;  1GRB A;  1CJC A;  1L9E A;  4P9S A;  4X4J A;  1PXB A;  1D7Y A;  2C70 A;  1LTX R;  2H88 A;  5CKU A;  3Q6J A;  4ECH A;  3AYL A;  2XVI A;  3B6D A;  1XDI A;  4U8N A;  2YLT A;  1IJH A;  4JDR A;  5JCI A;  4USQ A;  2JKC A;  1IUW A;  1PDH A;  2X8G A;  2C3C A;  4KX6 A;  3H8I A;  1CC6 A;  4H4Y A;  4X9N A;  1CJ4 A;  2GEW A;  2B7S A;  4DNA A;  3ICR A;  3V76 A;  1GER A;  5FS6 A;  3T37 A;  2WHD A;  4H7U A;  1GSN A;  2RGH A;  2E5V A;  3GWD A;  1TYT A;  1NG3 A;  1REO A;  2C73 A;  4C77 A;  1M6I A;  1LPF A;  2GR2 A;  2XFP A;  3LZW A;  3DK4 A;  1DOB A;  4FX9 A;  2GMH A;  1K0L A;  2B9X A;  2Y6R A;  3RP7 A;  4NTE A;  3AD7 B;  4TLZ A;  1Y56 A;  4TM0 A;  2Y6Q A;  4C74 A;  2WP5 A;  1F8S A;  4H2R A;  4K7Z A;  3GMB A;  2A89 A;  3KD9 A;  3UKK A;  2QCU A;  1L9C A;  2WET A;  5EBK A;  1VG9 A;  2JB1 A;  3AE2 A;  4GCM A;  2R0G A;  2OLO A;  1K4Q A;  5GRT A;  3UKP A;  4C3X A;  3K7Q X;  4IA6 A;  2Q0K A;  1BZL A;  3I3L A;  2Q0L A;  3VQR A;  3AE9 A;  1GET A;  2GR0 A;  4JY2 A;  4M52 A;  2CDU A;  1ZX9 A;  3GDN A;  3I6D A;  4ZN0 A;  2JB3 A;  1COY A;  2VQB A;  3KPF A;  1VDC A;  2GR3 A;  2O9Z A;  5EB4 A;  2XLT A;  3CPJ G;  2NPX A;  2WP9 A;  5BUK A;  5IPY A;  4K5R A;  4OPD A;  3BI2 A;  3V3O A;  3CPH G;  2YLR A;  3AED A;  2E1M A;  3RHA A;  3ATQ A;  3EPT A;  1GTH A;  4J33 A;  5JCL A;  2TPR A;  3GDP A;  4REK A;  4U8K A;  4Y4L A;  3BHK A;  4X9M A;  4B65 A;  1TDO A;  1FEA A;  1NEK A;  4H4U A;  1B37 A;  3EAN A;  2BC1 A;  2VVM A;  3M0O A;  2UZZ A;  5FS8 A;  1QLB A;  1OJD A;  1XHC A;  2XCG A;  3VR9 A;  2GH5 A;  5KXJ A;  4Z26 A;  4XWR A;  5HXI A;  1NEN A;  3EAO A;  2BAC A;  3NLC A;  3DJD A;  1NAA A;  3H8L A;  3UOY A;  1GRT A;  1B5Q A;  1GRG A;  5EB5 A;  2YM2 A;  3AEB A;  4I58 A;  3NGC X;  4JN9 A;  2JB2 A;  4MJW A;  2APG A;  4IA5 A;  1PBB A;  4GDP A;  1QO8 A;  3P4P A;  4YT0 A;  2QA1 A;  2I0Z A;  3URH A;  4YTP A;  2FBW A;  1LQU A;  4FDC B;  2XVJ A;  4EM3 A;  2XLS A;  3P1W A;  2X3N A;  3KVE A;  3NRN A;  3NK2 X;  1BGJ A;  3UTE A;  1GRF A;  1BGN A;  2Q7V A;  4U8I A;  4B68 A;  2WPF A;  3P9U A;  3DJJ A;  1JEH A;  1CJ3 A;  2WOI A;  1B4V A;  4IV9 A;  3M13 A;  4ZCC A;  1P2E A;  4U2L A;  2GRT A;  1Q1W A;  2W0H A;  5BVA A;  1H6V A;  5TR3 A;  1EBD A;  1B8S A;  3IC9 A;  2GB0 A;  1PBF A;  1S2Y A;  4YTM A;  1AOG A;  3RED A;  3AE3 A;  4LII A;  2Q6U A;  2YVG A;  1PJ7 A;  5EOW A;  4CNK A;  2OA1 A;  1KF6 A;  4IVO B;  3VRA A;  4CY8 A;  1QJD A;  4GRT A;  3BHF A;  3LB8 A;  3UOV A;  4B69 A;  3C4A A;  4H4X A;  3AEC A;  2WU2 A;  4K5S A;  4A79 A;  2GV8 A;  3G5Q A;  2ZZ0 A;  3UP4 A;  3UCL A;  1CBO A;  2A8X A;  3EF6 A;  4H4W A;  3AE6 A;  3QSS A;  3GD3 A;  1DXL A;  1PN0 A;  3DA1 A;  3ADA B;  4FK1 C;  2CUL A;  3NK0 X;  4ZCD A;  2V60 A;  5U63 A;  3IHG A;  2YG5 A;  3DJG X;  2JBV A;  5FS7 A;  3NNE A;  2HQM A;  4A6N B;  4Z2U A;  2YM1 A;  4UDP A;  2Z5Y A;  2TMD A;  4C3Y A;  3AE5 A;  4C5O A;  2GVC A;  2V61 A;  3ABV A;  3CGC A;  3KLJ A;  1OJ9 A;  4BK3 A;  4BUR A;  2BYB A;  1NHR A;  3UKL A;  2J3N A;  1IUU A;  3NK1 X;  1LV0 A;  2JAE A;  1ZP0 A;  3AEG A;  5FMH A;  4H50 A;  1K0J A;  4E0V A;  3E1T A;  4YSZ A;  1CC4 A;  4ADW A;  1E6E A;  4GUV A;  2GMJ A;  2XLR A;  1O5W A;  2XVE A;  3II4 A;  4RG4 A;  2IVE A;  4U2T A;  3UKH A;  3ZDN A;  2R46 A;  3ZYX A;  4B64 A;  5KOX A;  1DJN A;  3NHO X;  1E1M A;  2VRL A;  2XLP A;  3G5R A;  1Q9I A;  1MO9 A;  3UKA A;  4EQW A;  4J57 A;  1KSS A;  1ONF A;  1W4X A;  1DNC A;  2FJA A;  3RP6 A;  2GQW A;  2R0C A;  4KPR A;  2NVK X;  1TDE A;  5L46 A;  2R45 A;  1GOS A;  2BS3 A;  3NKS A;  1GXF A;  4GF7 A;  4Z43 A;  4OPU A;  1E7P A;  3BI5 A;  4HB9 A;  1N4W A;  4H2N A;  4ICY A;  4Y4M A;  2GF3 A;  4EIQ A;  1JRZ A;  2FJB A;  1CF3 A;  2YQU A;  4Z2T A;  2GR1 A;  2BK5 A;  4WCT A;  1F6M A;  1GEU A;  4EQS A;  1CHU A;  3LJP A;  1JRX A;  3K30 A;  2C72 A;  1L9D A;  1LVL A;  4U2S A;  3SGL A;  2OAM A;  4JQ9 A;  2AQJ A;  2BXS A;  3P4R A;  1GES A;  2C76 A;  3GRT A;  4OPC A;  1GT8 A;  2C67 A;  3IWA A;  2B9W A;  2X50 A;  4B1B A;  4EM4 A;  2YVJ A;  4K8D A;  2C65 A;  2OLN A;  4D03 A;  4YSY A;  3NIX A;  3Q9T A;  5KRQ A;  3AE4 A;  2GAG B;  1NHP A;  3AE7 A;  1E1N A;  4YWO A;  2R0P A;  1Y0P A;  2X8H A;  1EL5 A;  4GDE A;  4TLX A;  1ELI A;  2XFN A;  4H4P A;  4YKG A;  1KSU A;  4NTD A;  1NHS A;  1GND A;  4GR1 A;  4J2W A;  1F3P A;  2OAL A;  3CIR A;  4AOX A;  1O95 A;  1XPQ A;  3CNP A;  4OPG A;  2IVD A;  1JOA A;  1KNP A;  2EQ8 A;  4B67 A;  4CY6 A;  2VRM A;  4J31 A;  2BXR A;  5J7X A;  4H4V A;  1D4E A;  2R4J A;  4Y4N A;  2AR8 A;  4XWZ A;  1H7W A;  1OJA A;  3COX A;  4BJY A;  3CNS A;  4OPL A;  1H84 A;  2RGO A;  1BF3 A;  4U8O A;  1TDN A;  3AD8 B;  2YR5 A;  3G5S A;  2GAH B;  4U8P A;  3PVC A;  3CPI G;  4AOS A;  2WOV A;  4EIP A;  5KWF A;  4AT2 A;  4B63 A;  3QVP A;  2BK3 A;  1M64 A;  4LA1 A;  4D04 A;  3ALM A;  1YQZ A;  4EQX A;  2WPC A;  4JNQ A;  4A5L A;  1KNR A;  2ZZC A;  2R9Z A;  2V3B A;  3KU9 A;  1KDG A;  2BA9 A;  4NTC A;  1YQ3 A;  4U8L A;  5M10 A;  3AB1 A;  3NG7 X;  2WS3 A;  3AEF A;  4XXG A;  1MOK A;  2V6O A;  1D7L A;  1PBD A;  4RSL A;  1FEC A;  3FMW A;  1GTE A;  2XDO A;  3AD9 B;  3D8X A;  2VZ2 A;  1RSG A;  1HYU A;  3NTA A;  1S2Q A;  2WPE A;  3FIM B;  1NHQ A;  2AAQ A;  3WE0 A;  2X8C A;  3UKQ A;  1PBC A;  3AYI A;  2YG4 A;  3NYC A;  3UOZ A;  3SFD A;  3GYJ A;  3S5W A;  3GSI A;  3CND A;  4BK2 A;  1FEB A;  1Y56 B;  2V3A A;  4J36 A;  4HA6 A;  4A65 A;  4CBQ A;  2WU5 A;  4H2Q A;  3PO7 A;  1E1L A;  2ZZB A;  5IQ4 A;  3KA7 A;  3NTD A;  1JRY A;  2PHH A;  1ZK7 A;  4USR A;  1LJ1 A;  4AP1 A;  5M0Z A;  4OCG A;  3RNM A;  1OJC A;  2YLW A;  4JY3 A;  4O5Q A;  2BS4 A;  3QSM A;  1VG0 A;  3IF9 A;  1EL8 A;  2BC0 A;  3F8R A;  3SQP A;  1N4V A;  2WQY A;  4YKF A;  1ZY8 A;  5LV9 A;  4BK1 A;  3L8K A;  3NYE A;  5J60 A;  3R9U A;  1IUX A;  4H4Q A;  2V5Z A;  2WDQ A;  1DOE A;  3O0H A;  4YSH A;  1H81 A;  4TM4 A;  4U8J A;  1FCD A;  3C4N A;  1E1K A;  4EMJ A;  5CQF A;  2FJD A;  1H83 A;  2JK6 A;  2XFU A;  2C75 A;  4NEV A;  1PS9 A;  2XFO A;  1PJ6 A;  1XAN A;  2C64 A;  4NZH A;  4O5U A;  3UP5 A;  3VR8 A;  2WOW A;  2YVF A;  3K7T A;  4YXD A;  4J56 A;  2EQ9 A;  3OC4 A;  1H82 A;  1N1P A;  4CCR A;  5C3J A;  3LXD A;  3DK8 A;  1S3B A;  4APN A;  2CFY A;  2EQ7 A;  2BCG G;  3GWF A;  2VVL A;  3V3N A;  2VQ7 A;  2X99 A;  2XVH A;  1O94 A;  2H89 A;  3CNJ A;  1TDK A;  1ZDL A;  1CC2 A;  3KKJ A;  1JNR A;  2WDR A;  1DOD A;  4OPT A;  5KVH A;  1EL7 A;  2YLX A;  3LAD A;  3UTH A;  3UKF A;  2BS2 A;  1F8R A;  2R4E A;  5BRT A;  4PAA A;  1X31 B;  4A99 A;  4I59 A;  2QA2 A;  1LQT A;  2DKH A;  5DBJ A;  2C7G A;  4TM1 A;  1CL0 A;  4YTN A;  3AE8 A;  4FK1 A;  3K7M X;  3AYJ A;  2BAB A;  3UOX A;  1H7X A;  3QVR A;  1GRH A;  2CVJ A;  1P2H A;  2ARD A;  2WES A;  1UKV G; 
#chains in the Genus database with same CATH topology
 3DJE A;  3T2Z A;  4N9X A;  4EMW A;  2EQ6 A;  1IUV A;  2RGJ A;  2RAB A;  4PAB A;  4AT0 A;  5KVI A;  4CRT A;  1NPX A;  2C3D A;  3CNT A;  1ZKQ A;  3F8D A;  4DGK A;  3H4K A;  2A87 A;  1VQW A;  3ATR A;  1GAL A;  1BKW A;  4NEW A;  1IUS A;  1H86 A;  2WBA A;  3DH9 A;  1ZMD A;  3L1R A;  4Z2R A;  3CGE A;  4J34 A;  3DGH A;  3AWI A;  3HYW A;  1EL9 A;  3HYX A;  3QFA A;  4UP3 A;  4H4Z A;  5FS9 A;  4A6N A;  4BV6 A;  2PYX A;  3D1C A;  3P4Q A;  2YR4 A;  4EMI A;  1D4C A;  1NG4 A;  3SM8 A;  3DME A;  1Z6L A;  3QJ4 A;  1SEZ A;  4NNJ A;  3UTF A;  2YLS A;  2ZBW A;  5HYM A;  4JNA A;  3ALJ A;  3NYF A;  5HY5 A;  2YG6 A;  3CGB A;  3UTG A;  1GRA A;  4H4R A;  3BNM A;  5HHF A;  3AEA A;  2QAE A;  2Z5X A;  3SFE A;  3DK9 A;  1PXC A;  3GRS A;  4Z44 A;  3SY4 A;  2YLZ A;  4CCQ A;  1KFY A;  3QFB A;  4RG3 A;  1RYI A;  2IID A;  2XVF A;  5GSN A;  4K2X A;  2WEU A;  3AEE A;  3FBS A;  1ZMC A;  2C66 A;  4B66 A;  4Z25 A;  1PXA A;  5KOW A;  2B7R A;  3NN6 X;  3HZL A;  3T2Y A;  1JNZ A;  3T2K A;  3CTY A;  2FJE A;  4UDQ A;  5U25 A;  4A9W A;  3FPZ A;  2YR6 A;  2E4G A;  2BK4 A;  1GV4 A;  4WX1 A;  1GRE A;  1OJT A;  5ER0 A;  4GAP A;  4CNJ A;  2VOU A;  2ACZ A;  2YG7 A;  1PJ5 A;  1TYP A;  1F8W A;  1Q1R A;  1YY5 A;  1ZOV A;  1ZOY A;  4Z24 A;  3QSE A;  5U1O A;  1L0V A;  3RP8 A;  1PBE A;  1JU2 A;  2B76 A;  2XYO A;  5IQ1 A;  1V59 A;  3AE1 A;  4DSH A;  3CGD A;  3ITJ A;  2BRY A;  3VRD B;  4OPI A;  1RP0 A;  3GMC A;  4K22 A;  5JCK A;  3VRB A;  4DSG A;  1DOC A;  3CN8 A;  3LZX A;  3JSK A;  1TDF A;  2DKI A;  1PHH A;  4A7A A;  1VRQ B;  1MXT A;  1FL2 A;  3FG2 P;  5JCN A;  1D4D A;  3S61 A;  3NN0 X;  1FOH A;  4EQR A;  1IUT A;  3T31 A;  3C96 A;  3LOV A;  3OZ2 A;  4YSX A;  2YG3 A;  3BNU A;  3ICT A;  2F5Z A;  2YWL A;  2WP6 A;  4LU6 A;  4IVM B;  3F8P A;  1YQ4 A;  4AP3 A;  2XFQ A;  3GYI A;  3NT6 A;  4G6G A;  4TM3 A;  2VVL G;  2WDV A;  3B3R A;  3ICS A;  2B9Y A;  4BJZ A;  4H4S A;  4UDR A;  1GPE A;  3P4S A;  3IHM A;  1E39 A;  2BCP A;  1N4U A;  3GD4 A;  1K0I A;  2YAU A;  1YKJ A;  3AXB A;  4H2P A;  3NH3 X;  1TRB A;  4H4T A;  5C2T A;  1D5T A;  1DJQ A;  1NDA A;  2GQF A;  3ISH A;  3M12 A;  5KMQ A;  1CJ2 A;  5JCM A;  1BWC A;  3BI4 A;  3DGZ A;  4U8M A;  5BUL A;  2XLU A;  1S3E A;  3ALL A;  3PS9 A;  4OVI A;  1GRB A;  1CJC A;  1L9E A;  4P9S A;  4X4J A;  1PXB A;  1D7Y A;  2C70 A;  1LTX R;  2H88 A;  5CKU A;  3Q6J A;  4ECH A;  3AYL A;  2XVI A;  3B6D A;  1XDI A;  4U8N A;  2YLT A;  1IJH A;  4JDR A;  5JCI A;  4USQ A;  2JKC A;  1IUW A;  1PDH A;  2X8G A;  2C3C A;  4KX6 A;  3H8I A;  1CC6 A;  4H4Y A;  4X9N A;  1CJ4 A;  2GEW A;  2B7S A;  4DNA A;  3ICR A;  3V76 A;  1GER A;  5FS6 A;  3T37 A;  2WHD A;  4H7U A;  1GSN A;  2RGH A;  2E5V A;  3GWD A;  1TYT A;  1NG3 A;  1REO A;  2C73 A;  4C77 A;  1M6I A;  5KNL A;  1LPF A;  2GR2 A;  2XFP A;  3LZW A;  3DK4 A;  1DOB A;  4FX9 A;  2GMH A;  1K0L A;  2B9X A;  2Y6R A;  3RP7 A;  4NTE A;  3AD7 B;  4TLZ A;  1Y56 A;  4TM0 A;  2Y6Q A;  4C74 A;  2WP5 A;  1F8S A;  4H2R A;  4K7Z A;  3GMB A;  2A89 A;  3KD9 A;  3UKK A;  2QCU A;  1L9C A;  2WET A;  5EBK A;  1VG9 A;  2JB1 A;  3AE2 A;  4GCM A;  2R0G A;  2OLO A;  1K4Q A;  5GRT A;  3UKP A;  4C3X A;  3K7Q X;  4IA6 A;  2Q0K A;  4G6H A;  3SZW A;  1BZL A;  3I3L A;  2Q0L A;  3VQR A;  3AE9 A;  1GET A;  2GR0 A;  4JY2 A;  4M52 A;  2CDU A;  1ZX9 A;  3GDN A;  3I6D A;  3T14 A;  2JB3 A;  4ZN0 A;  1COY A;  2VQB A;  3KPF A;  1VDC A;  2GR3 A;  2O9Z A;  5EB4 A;  2XLT A;  3CPJ G;  2NPX A;  2WP9 A;  4G73 A;  4G9K A;  5BUK A;  4K5R A;  4OPD A;  5IPY A;  3BI2 A;  3V3O A;  3CPH G;  2YLR A;  3AED A;  2E1M A;  3RHA A;  3ATQ A;  3EPT A;  1GTH A;  4J33 A;  5JCL A;  2TPR A;  3GDP A;  4REK A;  4U8K A;  4Y4L A;  3BHK A;  4X9M A;  4B65 A;  1TDO A;  1FEA A;  1NEK A;  4H4U A;  1B37 A;  3EAN A;  2BC1 A;  2VVM A;  3M0O A;  2UZZ A;  5FS8 A;  1QLB A;  3SXI A;  1OJD A;  1XHC A;  2XCG A;  3VR9 A;  2GH5 A;  5KXJ A;  4Z26 A;  4XWR A;  5HXI A;  1NEN A;  3EAO A;  2BAC A;  3NLC A;  3DJD A;  1NAA A;  3H8L A;  3UOY A;  1GRT A;  1B5Q A;  1GRG A;  5EB5 A;  2YM2 A;  3AEB A;  4I58 A;  3NGC X;  4JN9 A;  2JB2 A;  4MJW A;  2APG A;  4IA5 A;  1PBB A;  4GDP A;  1QO8 A;  3P4P A;  4YT0 A;  2QA1 A;  3HYV A;  2I0Z A;  3URH A;  4YTP A;  2FBW A;  1LQU A;  4FDC B;  2XVJ A;  4EM3 A;  2XLS A;  3P1W A;  2X3N A;  3KVE A;  5KMS A;  3NRN A;  3NK2 X;  1BGJ A;  3UTE A;  1GRF A;  1BGN A;  2Q7V A;  3CMM A;  4U8I A;  4B68 A;  2WPF A;  3P9U A;  3DJJ A;  1JEH A;  1CJ3 A;  2WOI A;  1B4V A;  4IV9 A;  3M13 A;  4ZCC A;  1P2E A;  4U2L A;  2GRT A;  1Q1W A;  2W0H A;  5BVA A;  1H6V A;  5TR3 A;  1EBD A;  1B8S A;  3IC9 A;  2GB0 A;  1PBF A;  1S2Y A;  4YTM A;  1AOG A;  3RED A;  3AE3 A;  4LII A;  2Q6U A;  2YVG A;  1PJ7 A;  5EOW A;  3SZC A;  2OA1 A;  4CNK A;  1KF6 A;  4IVO B;  3VRA A;  4CY8 A;  1QJD A;  4GRT A;  3BHF A;  3LB8 A;  3UOV A;  4B69 A;  3C4A A;  4H4X A;  3AEC A;  2WU2 A;  4K5S A;  4A79 A;  2GV8 A;  3G5Q A;  2ZZ0 A;  3UP4 A;  3UCL A;  1CBO A;  2A8X A;  3EF6 A;  4H4W A;  3AE6 A;  3QSS A;  3GD3 A;  1DXL A;  1PN0 A;  3DA1 A;  3ADA B;  4FK1 C;  2CUL A;  3NK0 X;  4ZCD A;  2V60 A;  5U63 A;  3IHG A;  2YG5 A;  3DJG X;  2JBV A;  5FS7 A;  3NNE A;  2HQM A;  4A6N B;  4Z2U A;  2YM1 A;  4UDP A;  2Z5Y A;  2TMD A;  4C3Y A;  3AE5 A;  4C5O A;  2GVC A;  2V61 A;  3ABV A;  3CGC A;  3KLJ A;  1OJ9 A;  4BK3 A;  4BUR A;  2BYB A;  1NHR A;  4GAV A;  2J3N A;  3UKL A;  1IUU A;  3NK1 X;  1LV0 A;  2JAE A;  3SYI A;  1ZP0 A;  3AEG A;  5FMH A;  4H50 A;  1K0J A;  4E0V A;  3E1T A;  4YSZ A;  1CC4 A;  4ADW A;  1E6E A;  4GUV A;  2GMJ A;  2XLR A;  1O5W A;  2XVE A;  3II4 A;  4RG4 A;  2IVE A;  4U2T A;  3UKH A;  3ZDN A;  2R46 A;  3ZYX A;  3KPK A;  4B64 A;  5KOX A;  1DJN A;  3NHO X;  1E1M A;  2VRL A;  2XLP A;  3G5R A;  1Q9I A;  1MO9 A;  3UKA A;  4EQW A;  4J57 A;  1KSS A;  1ONF A;  1W4X A;  1DNC A;  2FJA A;  3RP6 A;  2GQW A;  2R0C A;  4KPR A;  2NVK X;  1TDE A;  5L46 A;  2R45 A;  1GOS A;  2BS3 A;  3NKS A;  1GXF A;  4GF7 A;  4Z43 A;  4OPU A;  1E7P A;  3BI5 A;  4HB9 A;  1N4W A;  4H2N A;  4ICY A;  4Y4M A;  2GF3 A;  4EIQ A;  3SX6 A;  5KMR A;  1JRZ A;  2FJB A;  3T0K A;  1CF3 A;  2YQU A;  4Z2T A;  2GR1 A;  2BK5 A;  4WCT A;  1F6M A;  1GEU A;  4EQS A;  1CHU A;  3LJP A;  1JRX A;  3K30 A;  2C72 A;  1L9D A;  1LVL A;  4U2S A;  3SGL A;  2OAM A;  4JQ9 A;  2AQJ A;  2BXS A;  3P4R A;  1GES A;  2C76 A;  3GRT A;  4OPC A;  1GT8 A;  2C67 A;  3IWA A;  2B9W A;  2X50 A;  4B1B A;  4EM4 A;  2YVJ A;  4K8D A;  2C65 A;  2OLN A;  4D03 A;  4YSY A;  3NIX A;  3Q9T A;  5KRQ A;  3AE4 A;  2GAG B;  1NHP A;  3AE7 A;  1E1N A;  4YWO A;  2R0P A;  1Y0P A;  2X8H A;  1EL5 A;  4GDE A;  4TLX A;  1ELI A;  2XFN A;  4H4P A;  4YKG A;  1KSU A;  4NTD A;  1NHS A;  1GND A;  4GR1 A;  4J2W A;  1F3P A;  2OAL A;  3CIR A;  4AOX A;  1O95 A;  1XPQ A;  3CNP A;  4OPG A;  2IVD A;  1JOA A;  1KNP A;  2EQ8 A;  4II3 A;  4B67 A;  4CY6 A;  2VRM A;  4J31 A;  2BXR A;  5J7X A;  4H4V A;  4G74 A;  1D4E A;  2R4J A;  4Y4N A;  2AR8 A;  4XWZ A;  1H7W A;  1OJA A;  3COX A;  4BJY A;  3CNS A;  4OPL A;  1H84 A;  2RGO A;  1BF3 A;  4U8O A;  1TDN A;  3AD8 B;  2YR5 A;  3G5S A;  2GAH B;  4U8P A;  3PVC A;  3CPI G;  4AOS A;  2WOV A;  4EIP A;  5KWF A;  4AT2 A;  4B63 A;  3QVP A;  4NWZ A;  2BK3 A;  2C4C A;  1M64 A;  4LA1 A;  4D04 A;  3ALM A;  1YQZ A;  4EQX A;  2WPC A;  4JNQ A;  4A5L A;  1KNR A;  2ZZC A;  2R9Z A;  2V3B A;  3KU9 A;  1KDG A;  2BA9 A;  4NTC A;  4II2 A;  1YQ3 A;  4U8L A;  5M10 A;  3AB1 A;  3NG7 X;  2WS3 A;  3AEF A;  4XXG A;  1MOK A;  2V6O A;  1D7L A;  1PBD A;  4RSL A;  1FEC A;  3FMW A;  1GTE A;  2XDO A;  3AD9 B;  3D8X A;  2VZ2 A;  1RSG A;  1HYU A;  3NTA A;  1S2Q A;  2WPE A;  3FIM B;  1NHQ A;  2AAQ A;  3WE0 A;  2X8C A;  3UKQ A;  1PBC A;  3AYI A;  2YG4 A;  3NYC A;  3SZ0 A;  5KMP A;  3UOZ A;  3SFD A;  3GYJ A;  3S5W A;  3GSI A;  3CND A;  4BK2 A;  1FEB A;  1Y56 B;  2V3A A;  4J36 A;  4HA6 A;  4A65 A;  4CBQ A;  2WU5 A;  4H2Q A;  3PO7 A;  1E1L A;  2ZZB A;  5IQ4 A;  3KA7 A;  3NTD A;  1JRY A;  2PHH A;  1ZK7 A;  4USR A;  1LJ1 A;  4AP1 A;  5M0Z A;  4OCG A;  3RNM A;  1OJC A;  2YLW A;  4JY3 A;  4O5Q A;  2BS4 A;  3QSM A;  1VG0 A;  3IF9 A;  1EL8 A;  2BC0 A;  3F8R A;  3SQP A;  1N4V A;  2WQY A;  4YKF A;  1ZY8 A;  3SZF A;  5LV9 A;  4BK1 A;  3L8K A;  3NYE A;  5J60 A;  3R9U A;  1IUX A;  4H4Q A;  2V5Z A;  2WDQ A;  1DOE A;  3O0H A;  4YSH A;  1H81 A;  4TM4 A;  4U8J A;  1FCD A;  3GYX A;  3C4N A;  1E1K A;  4EMJ A;  5CQF A;  2FJD A;  1H83 A;  2JK6 A;  2XFU A;  2C75 A;  4NEV A;  1PS9 A;  2XFO A;  1PJ6 A;  1XAN A;  2C64 A;  4NZH A;  4O5U A;  3UP5 A;  3VR8 A;  2WOW A;  2YVF A;  3K7T A;  4YXD A;  4J56 A;  2EQ9 A;  3OC4 A;  1H82 A;  1N1P A;  4CCR A;  5C3J A;  3LXD A;  3DK8 A;  1S3B A;  4APN A;  2CFY A;  2EQ7 A;  2BCG G;  3GWF A;  2VVL A;  3V3N A;  2VQ7 A;  2X99 A;  2XVH A;  1O94 A;  2H89 A;  3CNJ A;  1TDK A;  1ZDL A;  1CC2 A;  3KKJ A;  1JNR A;  2WDR A;  1DOD A;  4OPT A;  5KVH A;  1EL7 A;  2YLX A;  3LAD A;  3UTH A;  3UKF A;  2BS2 A;  1F8R A;  2R4E A;  5BRT A;  4PAA A;  1X31 B;  4A99 A;  4I59 A;  2QA2 A;  2BRA A;  1LQT A;  2DKH A;  5DBJ A;  2C7G A;  4TM1 A;  1CL0 A;  4YTN A;  3AE8 A;  4FK1 A;  3K7M X;  3AYJ A;  2BAB A;  3UOX A;  1H7X A;  3QVR A;  1GRH A;  2CVJ A;  1P2H A;  2ARD A;  2WES A;  1UKV G; 
#chains in the Genus database with same CATH homology
 3DJE A;  3T2Z A;  4N9X A;  4EMW A;  2EQ6 A;  1IUV A;  2RGJ A;  2RAB A;  4PAB A;  4AT0 A;  5KVI A;  4CRT A;  1NPX A;  2C3D A;  3CNT A;  1ZKQ A;  3F8D A;  4DGK A;  3H4K A;  2A87 A;  1VQW A;  3ATR A;  1GAL A;  1BKW A;  4NEW A;  1IUS A;  1H86 A;  2WBA A;  3DH9 A;  1ZMD A;  3L1R A;  4Z2R A;  3CGE A;  4J34 A;  3DGH A;  3AWI A;  3HYW A;  1EL9 A;  3HYX A;  3QFA A;  4UP3 A;  4H4Z A;  5FS9 A;  4A6N A;  4BV6 A;  2PYX A;  3D1C A;  3P4Q A;  2YR4 A;  4EMI A;  1D4C A;  1NG4 A;  3SM8 A;  3DME A;  1Z6L A;  3QJ4 A;  1SEZ A;  4NNJ A;  3UTF A;  2YLS A;  2ZBW A;  5HYM A;  4JNA A;  3ALJ A;  3NYF A;  5HY5 A;  2YG6 A;  3CGB A;  3UTG A;  1GRA A;  4H4R A;  3BNM A;  5HHF A;  3AEA A;  2QAE A;  2Z5X A;  3SFE A;  3DK9 A;  1PXC A;  3GRS A;  4Z44 A;  3SY4 A;  2YLZ A;  4CCQ A;  1KFY A;  3QFB A;  4RG3 A;  1RYI A;  2IID A;  2XVF A;  5GSN A;  4K2X A;  2WEU A;  3AEE A;  3FBS A;  1ZMC A;  2C66 A;  4B66 A;  4Z25 A;  1PXA A;  5KOW A;  2B7R A;  3NN6 X;  3HZL A;  3T2Y A;  1JNZ A;  3T2K A;  3CTY A;  2FJE A;  4UDQ A;  5U25 A;  4A9W A;  3FPZ A;  2YR6 A;  2E4G A;  2BK4 A;  1GV4 A;  4WX1 A;  1GRE A;  1OJT A;  5ER0 A;  4GAP A;  4CNJ A;  2VOU A;  2ACZ A;  2YG7 A;  1PJ5 A;  1TYP A;  1F8W A;  1Q1R A;  1YY5 A;  1ZOV A;  1ZOY A;  4Z24 A;  3QSE A;  5U1O A;  1L0V A;  3RP8 A;  1PBE A;  1JU2 A;  2B76 A;  2XYO A;  5IQ1 A;  1V59 A;  3AE1 A;  4DSH A;  3CGD A;  3ITJ A;  2BRY A;  3VRD B;  4OPI A;  1RP0 A;  3GMC A;  4K22 A;  5JCK A;  3VRB A;  4DSG A;  1DOC A;  3CN8 A;  3LZX A;  3JSK A;  1TDF A;  2DKI A;  1PHH A;  4A7A A;  1VRQ B;  1MXT A;  1FL2 A;  3FG2 P;  5JCN A;  1D4D A;  3S61 A;  3NN0 X;  1FOH A;  4EQR A;  1IUT A;  3T31 A;  3C96 A;  3LOV A;  3OZ2 A;  4YSX A;  2YG3 A;  3BNU A;  3ICT A;  2F5Z A;  2YWL A;  2WP6 A;  4LU6 A;  4IVM B;  3F8P A;  1YQ4 A;  4AP3 A;  2XFQ A;  3GYI A;  3NT6 A;  4G6G A;  4TM3 A;  2VVL G;  2WDV A;  3B3R A;  3ICS A;  2B9Y A;  4BJZ A;  4H4S A;  4UDR A;  1GPE A;  3P4S A;  3IHM A;  1E39 A;  2BCP A;  1N4U A;  3GD4 A;  1K0I A;  2YAU A;  1YKJ A;  3AXB A;  4H2P A;  3NH3 X;  1TRB A;  4H4T A;  5C2T A;  1D5T A;  1DJQ A;  1NDA A;  2GQF A;  3ISH A;  3M12 A;  5KMQ A;  1CJ2 A;  5JCM A;  1BWC A;  3BI4 A;  3DGZ A;  4U8M A;  5BUL A;  2XLU A;  1S3E A;  3ALL A;  3PS9 A;  4OVI A;  1GRB A;  1CJC A;  1L9E A;  4P9S A;  4X4J A;  1PXB A;  1D7Y A;  2C70 A;  1LTX R;  2H88 A;  5CKU A;  3Q6J A;  4ECH A;  3AYL A;  2XVI A;  3B6D A;  1XDI A;  4U8N A;  2YLT A;  1IJH A;  4JDR A;  5JCI A;  4USQ A;  2JKC A;  1IUW A;  1PDH A;  2X8G A;  2C3C A;  4KX6 A;  3H8I A;  1CC6 A;  4H4Y A;  4X9N A;  1CJ4 A;  2GEW A;  2B7S A;  4DNA A;  3ICR A;  3V76 A;  1GER A;  5FS6 A;  3T37 A;  2WHD A;  4H7U A;  1GSN A;  2RGH A;  2E5V A;  3GWD A;  1TYT A;  1NG3 A;  1REO A;  2C73 A;  4C77 A;  1M6I A;  5KNL A;  1LPF A;  2GR2 A;  2XFP A;  3LZW A;  3DK4 A;  1DOB A;  4FX9 A;  2GMH A;  1K0L A;  2B9X A;  2Y6R A;  3RP7 A;  4NTE A;  3AD7 B;  4TLZ A;  1Y56 A;  4TM0 A;  2Y6Q A;  4C74 A;  2WP5 A;  1F8S A;  4H2R A;  4K7Z A;  3GMB A;  2A89 A;  3KD9 A;  3UKK A;  2QCU A;  1L9C A;  2WET A;  5EBK A;  1VG9 A;  2JB1 A;  3AE2 A;  4GCM A;  2R0G A;  2OLO A;  1K4Q A;  5GRT A;  3UKP A;  4C3X A;  3K7Q X;  4IA6 A;  2Q0K A;  4G6H A;  3SZW A;  1BZL A;  3I3L A;  2Q0L A;  3VQR A;  3AE9 A;  1GET A;  2GR0 A;  4JY2 A;  4M52 A;  2CDU A;  1ZX9 A;  3GDN A;  3I6D A;  3T14 A;  2JB3 A;  4ZN0 A;  1COY A;  2VQB A;  3KPF A;  1VDC A;  2GR3 A;  2O9Z A;  5EB4 A;  2XLT A;  3CPJ G;  2NPX A;  2WP9 A;  4G73 A;  4G9K A;  5BUK A;  4K5R A;  4OPD A;  5IPY A;  3BI2 A;  3V3O A;  3CPH G;  2YLR A;  3AED A;  2E1M A;  3RHA A;  3ATQ A;  3EPT A;  1GTH A;  4J33 A;  5JCL A;  2TPR A;  3GDP A;  4REK A;  4U8K A;  4Y4L A;  3BHK A;  4X9M A;  4B65 A;  1TDO A;  1FEA A;  1NEK A;  4H4U A;  1B37 A;  3EAN A;  2BC1 A;  2VVM A;  3M0O A;  2UZZ A;  5FS8 A;  1QLB A;  3SXI A;  1OJD A;  1XHC A;  2XCG A;  3VR9 A;  2GH5 A;  5KXJ A;  4Z26 A;  4XWR A;  5HXI A;  1NEN A;  3EAO A;  2BAC A;  3NLC A;  3DJD A;  1NAA A;  3H8L A;  3UOY A;  1GRT A;  1B5Q A;  1GRG A;  5EB5 A;  2YM2 A;  3AEB A;  4I58 A;  3NGC X;  4JN9 A;  2JB2 A;  4MJW A;  2APG A;  4IA5 A;  1PBB A;  4GDP A;  1QO8 A;  3P4P A;  4YT0 A;  2QA1 A;  3HYV A;  2I0Z A;  3URH A;  4YTP A;  2FBW A;  1LQU A;  4FDC B;  2XVJ A;  4EM3 A;  2XLS A;  3P1W A;  2X3N A;  3KVE A;  5KMS A;  3NRN A;  3NK2 X;  1BGJ A;  3UTE A;  1GRF A;  1BGN A;  2Q7V A;  3CMM A;  4U8I A;  4B68 A;  2WPF A;  3P9U A;  3DJJ A;  1JEH A;  1CJ3 A;  2WOI A;  1B4V A;  4IV9 A;  3M13 A;  4ZCC A;  1P2E A;  4U2L A;  2GRT A;  1Q1W A;  2W0H A;  5BVA A;  1H6V A;  5TR3 A;  1EBD A;  1B8S A;  3IC9 A;  2GB0 A;  1PBF A;  1S2Y A;  4YTM A;  1AOG A;  3RED A;  3AE3 A;  4LII A;  2Q6U A;  2YVG A;  1PJ7 A;  5EOW A;  3SZC A;  2OA1 A;  4CNK A;  1KF6 A;  4IVO B;  3VRA A;  4CY8 A;  1QJD A;  4GRT A;  3BHF A;  3LB8 A;  3UOV A;  4B69 A;  3C4A A;  4H4X A;  3AEC A;  2WU2 A;  4K5S A;  4A79 A;  2GV8 A;  3G5Q A;  2ZZ0 A;  3UP4 A;  3UCL A;  1CBO A;  2A8X A;  3EF6 A;  4H4W A;  3AE6 A;  3QSS A;  3GD3 A;  1DXL A;  1PN0 A;  3DA1 A;  3ADA B;  4FK1 C;  2CUL A;  3NK0 X;  4ZCD A;  2V60 A;  5U63 A;  3IHG A;  2YG5 A;  3DJG X;  2JBV A;  5FS7 A;  3NNE A;  2HQM A;  4A6N B;  4Z2U A;  2YM1 A;  4UDP A;  2Z5Y A;  2TMD A;  4C3Y A;  3AE5 A;  4C5O A;  2GVC A;  2V61 A;  3ABV A;  3CGC A;  3KLJ A;  1OJ9 A;  4BK3 A;  4BUR A;  2BYB A;  1NHR A;  4GAV A;  2J3N A;  3UKL A;  1IUU A;  3NK1 X;  1LV0 A;  2JAE A;  3SYI A;  1ZP0 A;  3AEG A;  5FMH A;  4H50 A;  1K0J A;  4E0V A;  3E1T A;  4YSZ A;  1CC4 A;  4ADW A;  1E6E A;  4GUV A;  2GMJ A;  2XLR A;  1O5W A;  2XVE A;  3II4 A;  4RG4 A;  2IVE A;  4U2T A;  3UKH A;  3ZDN A;  2R46 A;  3ZYX A;  3KPK A;  4B64 A;  5KOX A;  1DJN A;  3NHO X;  1E1M A;  2VRL A;  2XLP A;  3G5R A;  1Q9I A;  1MO9 A;  3UKA A;  4EQW A;  4J57 A;  1KSS A;  1ONF A;  1W4X A;  1DNC A;  2FJA A;  3RP6 A;  2GQW A;  2R0C A;  4KPR A;  2NVK X;  1TDE A;  5L46 A;  2R45 A;  1GOS A;  2BS3 A;  3NKS A;  1GXF A;  4GF7 A;  4Z43 A;  4OPU A;  1E7P A;  3BI5 A;  4HB9 A;  1N4W A;  4H2N A;  4ICY A;  4Y4M A;  2GF3 A;  4EIQ A;  3SX6 A;  5KMR A;  1JRZ A;  2FJB A;  3T0K A;  1CF3 A;  2YQU A;  4Z2T A;  2GR1 A;  2BK5 A;  4WCT A;  1F6M A;  1GEU A;  4EQS A;  1CHU A;  3LJP A;  1JRX A;  3K30 A;  2C72 A;  1L9D A;  1LVL A;  4U2S A;  3SGL A;  2OAM A;  4JQ9 A;  2AQJ A;  2BXS A;  3P4R A;  1GES A;  2C76 A;  3GRT A;  4OPC A;  1GT8 A;  2C67 A;  3IWA A;  2B9W A;  2X50 A;  4B1B A;  4EM4 A;  2YVJ A;  4K8D A;  2C65 A;  2OLN A;  4D03 A;  4YSY A;  3NIX A;  3Q9T A;  5KRQ A;  3AE4 A;  2GAG B;  1NHP A;  3AE7 A;  1E1N A;  4YWO A;  2R0P A;  1Y0P A;  2X8H A;  1EL5 A;  4GDE A;  4TLX A;  1ELI A;  2XFN A;  4H4P A;  4YKG A;  1KSU A;  4NTD A;  1NHS A;  1GND A;  4GR1 A;  4J2W A;  1F3P A;  2OAL A;  3CIR A;  4AOX A;  1O95 A;  1XPQ A;  3CNP A;  4OPG A;  2IVD A;  1JOA A;  1KNP A;  2EQ8 A;  4II3 A;  4B67 A;  4CY6 A;  2VRM A;  4J31 A;  2BXR A;  5J7X A;  4H4V A;  4G74 A;  1D4E A;  2R4J A;  4Y4N A;  2AR8 A;  4XWZ A;  1H7W A;  1OJA A;  3COX A;  4BJY A;  3CNS A;  4OPL A;  1H84 A;  2RGO A;  1BF3 A;  4U8O A;  1TDN A;  3AD8 B;  2YR5 A;  3G5S A;  2GAH B;  4U8P A;  3PVC A;  3CPI G;  4AOS A;  2WOV A;  4EIP A;  5KWF A;  4AT2 A;  4B63 A;  3QVP A;  4NWZ A;  2BK3 A;  2C4C A;  1M64 A;  4LA1 A;  4D04 A;  3ALM A;  1YQZ A;  4EQX A;  2WPC A;  4JNQ A;  4A5L A;  1KNR A;  2ZZC A;  2R9Z A;  2V3B A;  3KU9 A;  1KDG A;  2BA9 A;  4NTC A;  4II2 A;  1YQ3 A;  4U8L A;  5M10 A;  3AB1 A;  3NG7 X;  2WS3 A;  3AEF A;  4XXG A;  1MOK A;  2V6O A;  1D7L A;  1PBD A;  4RSL A;  1FEC A;  3FMW A;  1GTE A;  2XDO A;  3AD9 B;  3D8X A;  2VZ2 A;  1RSG A;  1HYU A;  3NTA A;  1S2Q A;  2WPE A;  3FIM B;  1NHQ A;  2AAQ A;  3WE0 A;  2X8C A;  3UKQ A;  1PBC A;  3AYI A;  2YG4 A;  3NYC A;  3SZ0 A;  5KMP A;  3UOZ A;  3SFD A;  3GYJ A;  3S5W A;  3GSI A;  3CND A;  4BK2 A;  1FEB A;  1Y56 B;  2V3A A;  4J36 A;  4HA6 A;  4A65 A;  4CBQ A;  2WU5 A;  4H2Q A;  3PO7 A;  1E1L A;  2ZZB A;  5IQ4 A;  3KA7 A;  3NTD A;  1JRY A;  2PHH A;  1ZK7 A;  4USR A;  1LJ1 A;  4AP1 A;  5M0Z A;  4OCG A;  3RNM A;  1OJC A;  2YLW A;  4JY3 A;  4O5Q A;  2BS4 A;  3QSM A;  1VG0 A;  3IF9 A;  1EL8 A;  2BC0 A;  3F8R A;  3SQP A;  1N4V A;  2WQY A;  4YKF A;  1ZY8 A;  3SZF A;  5LV9 A;  4BK1 A;  3L8K A;  3NYE A;  5J60 A;  3R9U A;  1IUX A;  4H4Q A;  2V5Z A;  2WDQ A;  1DOE A;  3O0H A;  4YSH A;  1H81 A;  4TM4 A;  4U8J A;  1FCD A;  3GYX A;  3C4N A;  1E1K A;  4EMJ A;  5CQF A;  2FJD A;  1H83 A;  2JK6 A;  2XFU A;  2C75 A;  4NEV A;  1PS9 A;  2XFO A;  1PJ6 A;  1XAN A;  2C64 A;  4NZH A;  4O5U A;  3UP5 A;  3VR8 A;  2WOW A;  2YVF A;  3K7T A;  4YXD A;  4J56 A;  2EQ9 A;  3OC4 A;  1H82 A;  1N1P A;  4CCR A;  5C3J A;  3LXD A;  3DK8 A;  1S3B A;  4APN A;  2CFY A;  2EQ7 A;  2BCG G;  3GWF A;  2VVL A;  3V3N A;  2VQ7 A;  2X99 A;  2XVH A;  1O94 A;  2H89 A;  3CNJ A;  1TDK A;  1ZDL A;  1CC2 A;  3KKJ A;  1JNR A;  2WDR A;  1DOD A;  4OPT A;  5KVH A;  1EL7 A;  2YLX A;  3LAD A;  3UTH A;  3UKF A;  2BS2 A;  1F8R A;  2R4E A;  5BRT A;  4PAA A;  1X31 B;  4A99 A;  4I59 A;  2QA2 A;  2BRA A;  1LQT A;  2DKH A;  5DBJ A;  2C7G A;  4TM1 A;  1CL0 A;  4YTN A;  3AE8 A;  4FK1 A;  3K7M X;  3AYJ A;  2BAB A;  3UOX A;  1H7X A;  3QVR A;  1GRH A;  2CVJ A;  1P2H A;  2ARD A;  2WES A;  1UKV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...