3K7MX

Crystal structure of 6-hydroxy-l-nicotine oxidase from arthrobacter nicotinovorans
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
total genus 146
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7mX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7mX02
2WP9A 2BS2A 3V3NA 3UP5A 2XLUA 4YTMA 1ZK7A 1TDOA 1UKVG 3DJGX 1H82A 2QAEA 3NH3X 1TRBA 1D4DA 2BA9A 1NHPA 2FJEA 1YQ4A 3KU9A 3AECA 3VQRA 1DXLA 2JB2A 1Y0PA 2YLRA 1OJCA 1S3EA 2VVMA 3BHKA 4ADWA 4DSHA 2R0PA 2GF3A 1LVLA 2Q0KA 2BK3A 5EB5A 2WP5A 5KOWA 4EMWA 2YG5A 2AR8A 4U8JA 4X4JA 3CNDA 4BJZA 4EIPA 5JCNA 4C74A 1XHCA 2XLSA 4TLZA 3UKLA 1PBBA 1H7XA 1CL0A 3AE1A 3G5RA 1TDKA 4EQRA 4IVOB 4EMIA 2IVDA 3T37A 2GR2A 3CNTA 4U8PA 3VR9A 4Z43A 2GAGB 2R0CA 4D03A 2XVIA 1F8WA 3GD4A 2B9YA 4TM0A 2WBAA 2VZ2A 1L0VA 2BK4A 1GRBA 2XFQA 3AE7A 1E6EA 2CFYA 3NG7X 1L9DA 4H4QA 3UKQA 3BNUA 3V3OA 4A6NB 4O5QA 1VG0A 3GYIA 4IA5A 2YR4A 5JCMA 2C3DA 2VQ7A 4M52A 1RP0A 3LOVA 3CPIG 1JOAA 3ICTA 2EQ7A 1NHQA 4NTEA 1TYTA 1F8SA 2ZZ0A 4D04A 1NENA 4EM4A 4LIIA 2WQYA 1EL5A 4Z24A 1Q1WA 3C4AA 5M10A 3UCLA 3NNEA 4Y4NA 4A79A 4GDEA 2PHHA 3AYLA 2Y6QA 2O9ZA 3GWDA 4B64A 2ZBWA 3CNJA 2BYBA 1DOEA 3ADAB 2BACA 2Q6UA 3AE4A 4H7UA 1BGJA 1O95A 1Y56A 3WE0A 4DNAA 4H50A 2BXRA 5KXJA 3NKSA 3UOVA 1PJ6A 4GR1A 2C3CA 1JRXA 1PDHA 1D4EA 1M64A 3DA1A 1V59A 2X3NA 3P4SA 3P4PA 3QVPA 1NPXA 2H89A 3UOZA 1JU2A 1CF3A 2C72A 2GR1A 3AEBA 3AD9B 5FS8A 1D5TA 3IF9A 4XWRA 1ZMDA 2ZZBA 2WHDA 4WX1A 1O94A 2FJAA 3DK9A 1CJ4A 3D8XA 1QO8A 4FK1C 2YG6A 3CGEA 2XFOA 1KNPA 3NIXA 2GR3A 4H4ZA 3IHMA 4C3XA 4NTCA 4Z26A 4YT0A 2V60A 4J36A 4JY2A 2E4GA 2WPCA 4ZCDA 5EBKA 1HYUA 5FMHA 5FS6A 1AOGA 5JCIA 2X8GA 1NEKA 1ZOYA 2C65A 2YLSA 1GEUA 2C7GA 4PABA 4YTPA 3LXDA 1NDAA 4GRTA 4AP1A 4CRTA 2AAQA 5HYMA 1JEHA 3R9UA 2GRTA 4K5SA 1E1LA 2B9WA 1IUTA 2YR5A 5L46A 4NEWA 2BK5A 4XWZA 3RP8A 4J33A 1NG4A 3QFAA 4J31A 2VQBA 3FIMB 4H2PA 1D4CA 2GEWA 4H4WA 2YLTA 3VRAA 2BCGG 3NHOX 2BXSA 1FL2A 1VQWA 1D7YA 2V6OA 4B68A 1B5QA 2CDUA 2VVLG 3ITJA 3AE3A 4EQXA 1NHRA 3DGZA 1ZX9A 3NGCX 3REDA 5IPYA 3F8PA 1PBEA 3QJ4A 1VRQB 4A65A 2VRLA 4CNJA 3BHFA 4GDPA 3EAOA 2QA1A 3P1WA 4FX9A 3II4A 1LQTA 4EMJA 3IWAA 2WESA 3QSSA 1N4VA 3UOXA 3GMCA 4JN9A 3NK0X 3ATQA 2QCUA 5M0ZA 3CPHG 4K22A 4OPLA 2NPXA 3AEEA 4B66A 4YTNA 2XVHA 2XVJA 3DJEA 4H2QA 3H8IA 5EB4A 1LV0A 3EPTA 3PVCA 2YG3A 2EQ9A 4JDRA 2CVJA 4IV9A 1BF3A 4H4XA 2R9ZA 2WP6A 3L8KA 1GSNA 5C2TA 1YY5A 1P2HA 4OPTA 2C67A 1LPFA 1VDCA 4RG3A 5CQFA 3AWIA 4AT0A 3JSKA 3ALLA 3C4NA 2YAUA 4U8IA 2JAEA 1TDFA 1XANA 2IVEA 4HB9A 2V3BA 2C66A 4B69A 1N4WA 5KVIA 5HY5A 2WOIA 4LU6A 4B1BA 3NTAA 4CCQA 4YSYA 3EF6A 4CCRA 3KD9A 4NEVA 4USQA 1IUXA 3BI4A 3LB8A 2YLZA 1W4XA 1DJQA 3HZLA 2RGJA 4WCTA 3SGLA 4JY3A 2Z5XA 2AQJA 2BC0A 2A87A 5HXIA 4REKA 1PBFA 1S3BA 4UDQA 3DMEA 3UKHA 4C5OA 1YQ3A 2V5ZA 4OPIA 1EL7A 2JBVA 2WOWA 2YWLA 4OPCA 3SFDA 4I59A 2X50A 1Z6LA 4K5RA 1XPQA 4B65A 1S2QA 4H4UA 2C70A 1BZLA 2UZZA 1CJ3A 1K0IA 1PJ7A 3GDPA 4GUVA 5U1OA 3SQPA 1L9EA 4P9SA 3K7MX 2F5ZA 3UTGA 1F6MA 2X99A 2C73A 3UP4A 3GRSA 4AP3A 4CBQA 3AE8A 1Q9IA 1SEZA 2ZZCA 4ICYA 1Q1RA 3BI2A 2JB3A 2RGHA 2NVKX 2OLOA 2XFUA 4TM4A 2V3AA 5IQ1A 3F8DA 3AE9A 3H4KA 3S61A 3SFEA 4AOSA 4C3YA 3L1RA 3VR8A 1D7LA 4U2SA 1JNZA 4Y4LA 3ICRA 3KLJA 2R4EA 4TM1A 3AXBA 5JCKA 1GREA 2APGA 2XYOA 3BI5A 3GWFA 2XLPA 1IUWA 2BCPA 1PXAA 2H88A 4IA6A 2R4JA 1H7WA 2HQMA 3ICSA 1GRGA 1DOBA 4Y4MA 2YLXA 3AEAA 4B67A 2WOVA 1GRAA 1REOA 3CN8A 2GMHA 3AE5A 3G5SA 4H4VA 2GVCA 1F8RA 3M12A 1H83A 1PS9A 2B76A 1NAAA 3GD3A 3NT6A 4H4TA 4TLXA 4B63A 4EQSA 3DJDA 5IQ4A 3P4RA 1FEAA 1ZY8A 3DGHA 5BUKA 4BV6A 1PHHA 4EM3A 3NTDA 1VG9A 3K30A 5J7XA 2R0GA 2TMDA 1X31B 2A8XA 4A99A 4BURA 2XFPA 1TDEA 3GYJA 4FDCB 2IIDA 1B8SA 1ONFA 4AOXA 3UKPA 2GR0A 3RP6A 3PO7A 2Q0LA 2E1MA 4OVIA 4JQ9A 1COYA 1H86A 2PYXA 5DBJA 1PXBA 2OA1A 2OALA 1K0LA 3NYCA 4X9NA 3KKJA 4J56A 3ALMA 1L9CA 2GV8A 1F3PA 3ABVA 4U8LA 1FCDA 2CULA 2WU5A 3SM8A 5LV9A 4N9XA 2A89A 1IJHA 2Q7VA 4NZHA 1EL8A 1IUSA 1PJ5A 1GNDA 5GSNA 2E5VA 4H4YA 4DGKA 4H4PA 1JRYA 2B7SA 1ZOVA 3AD8B 3M13A 2JK6A 2YVGA 4U8KA 5KRQA 3NN0X 1NG3A 3AEFA 2YVJA 4O5UA 1OJDA 2V61A 4JNAA 4H4SA 4A6NA 1CJCA 3FPZA 2YLWA 2BS3A 1KDGA 3LJPA 4H4RA 5U63A 3D1CA 2C75A 2X8CA 2YVFA 3GSIA 2WPFA 1E1NA 1OJTA 3IHGA 2RGOA 4YSHA 1B4VA 3LADA 1ZDLA 4YKGA 3DH9A 3P4QA 4ECHA 1EBDA 4A9WA 5JCLA 1KF6A 4GF7A 1LJ1A 2OLNA 1KNRA 2VVLA 2YG7A 3LZXA 5FS7A 4DSGA 2XDOA 4RSLA 2OAMA 4J34A 2WDQA 2GB0A 3B6DA 1EL9A 3B3RA 4OPUA 4BK3A 3CGDA 4FK1A 2EQ8A 1KFYA 1JNRA 3CNPA 5BULA 5GRTA 1CHUA 3PS9A 2GH5A 4EIQA 4YWOA 3CPJG 4K8DA 1QJDA 2GMJA 1RSGA 4OCGA 3UTEA 2Y6RA 1H6VA 5KVHA 2FJDA 4APNA 1E1MA 3AB1A 3BNMA 3Q9TA 5FS9A 3NYFA 3GDNA 2WEUA 4UDPA 2BS4A 5CKUA 2YR6A 3K7TA 4K7ZA 2XLTA 1N4UA 1K0JA 3CIRA 3QSMA 2YQUA 3ATRA 3H8LA 4U8NA 1IUVA 3AEDA 3ALJA 3RHAA 4CY8A 5HHFA 1CBOA 3ISHA 2C64A 4ZN0A 2I0ZA 5J60A 2YM2A 1H84A 1GXFA 4Z2UA 3KPFA 1K4QA 3EANA 4USRA 1ELIA 4UP3A 3UKAA 1TYPA 3AE2A 1BKWA 2BC1A 3UOYA 2QA2A 3ZYXA 1M6IA 4KPRA 4KX6A 1KSSA 3FG2P 1P2EA 1NHSA 2B9XA 5C3JA 2WU2A 2RABA 1GETA 4ZCCA 4H2NA 3DJJA 2R46A 4J57A 1FOHA 3LZWA 3VRBA 3UKFA 3DK4A 1GTHA 2WDRA 4BK2A 3GMBA 3I3LA 3AD7B 3NN6X 3COXA 3FMWA 1GRHA 3F8RA 4H2RA 3KVEA 2XCGA 3NLCA 3GRTA 3UTFA 3AYIA 4UDRA 3AE6A 2DKIA 3AYJA 1DOCA 2WETA 4IVMB 1GV4A 2DKHA 1GPEA 3AEGA 1S2YA 1YQZA 1JRZA 1QLBA 4YSZA 3CNSA 1OJAA 3NRNA 2WPEA 4X9MA 3NK1X 2XLRA 3RNMA 4U8OA 2JKCA 1FECA 2FJBA 2VOUA 4U8MA 1GALA 3K7QX 3E1TA 1E1KA 1ZKQA 1CC4A 3FBSA 3KA7A 1GOSA 1N1PA 2C76A 4NTDA 3URHA 1E39A 1GT8A 4J2WA 4BJYA 2ARDA 1ZP0A 4OPGA 4PAAA 1CC6A 1ZMCA 2GAHB 4A5LA 1O5WA 1FEBA 2GQFA 4EQWA 4E0VA 2WS3A 1Y56B 3VRDB 1BWCA 3IC9A 2GQWA 5BRTA 1B37A 2JB1A 5KWFA 1KSUA 1OJ9A 4JNQA 2B7RA 4HA6A 3RP7A 2BABA 1LTXR 4GCMA 1E7PA 5U25A 4U2LA 1GERA 2X8HA 1PBCA 3QFBA 2J3NA 1BGNA 4Z25A 1H81A 4BK1A 2YG4A 4OPDA 2R45A 3CTYA 3CGBA 5TR3A 1DJNA 4A7AA 4K2XA 4MJWA 2Z5YA 5EOWA 3UTHA 1GESA 1MXTA 3Q6JA 4C77A 4Z2TA 4I58A 5BVAA 4YSXA 1DNCA 4LA1A 1YKJA 1PXCA 3M0OA 1LQUA 3G5QA 4CNKA 2ACZA 3UKKA 2WDVA 2EQ6A 1RYIA 4YKFA 1XDIA 4TM3A 4YXDA 5KOXA 4AT2A 1IUUA 3ZDNA 1DODA 2XFNA 3CGCA 3QVRA 1GRTA 1PN0A 5ER0A 1CJ2A 1TDNA 2TPRA 4Z44A 4CY6A 2XVEA 3NK2X 4RG4A 3S5WA 3OZ2A 1MOKA 3P9UA 3O0HA 2FBWA 1CC2A 2W0HA 1GTEA 4XXGA 2VRMA 1MO9A 3QSEA 2YM1A 1GRFA 3NYEA 3OC4A 3V76A 3C96A 3I6DA 4U2TA 2XVFA 3DK8A 4Z2RA 1PBDA
chains in the Genus database with same CATH superfamily
2WP9A 2BS2A 3V3NA 3UP5A 2XLUA 4YTMA 1ZK7A 1TDOA 1UKVG 3DJGX 1H82A 2QAEA 3NH3X 1TRBA 1D4DA 2BA9A 1NHPA 2FJEA 1YQ4A 3KU9A 3AECA 3VQRA 1DXLA 2JB2A 1Y0PA 2YLRA 1OJCA 1S3EA 2VVMA 3BHKA 4ADWA 4DSHA 2R0PA 2GF3A 1LVLA 2Q0KA 2BK3A 5EB5A 2WP5A 5KOWA 4EMWA 2YG5A 2AR8A 4U8JA 4X4JA 3CNDA 4BJZA 4EIPA 5JCNA 4C74A 1XHCA 2XLSA 4TLZA 3UKLA 1PBBA 1H7XA 1CL0A 3AE1A 3G5RA 1TDKA 4EQRA 4IVOB 4EMIA 2IVDA 3T37A 2GR2A 3CNTA 4U8PA 3VR9A 4Z43A 2GAGB 2R0CA 4D03A 2XVIA 1F8WA 3GD4A 2B9YA 4G73A 4TM0A 2WBAA 2VZ2A 1L0VA 2BK4A 1GRBA 3KPKA 2XFQA 3AE7A 1E6EA 2CFYA 3NG7X 1L9DA 4H4QA 3UKQA 3BNUA 3V3OA 4A6NB 4O5QA 1VG0A 3GYIA 4IA5A 2YR4A 5JCMA 2C3DA 2VQ7A 4M52A 4NNJA 1RP0A 3LOVA 3CPIG 1JOAA 3ICTA 2EQ7A 1NHQA 4NTEA 1TYTA 1F8SA 2ZZ0A 4D04A 1NENA 4EM4A 4LIIA 2WQYA 1EL5A 3GYXA 1Q1WA 3C4AA 4Z24A 5M10A 3UCLA 3NNEA 4Y4NA 4A79A 4GDEA 2PHHA 3AYLA 2Y6QA 2O9ZA 3GWDA 3HYXA 4B64A 2ZBWA 3CNJA 2BYBA 1DOEA 3ADAB 2BACA 2Q6UA 3AE4A 4H7UA 1BGJA 1O95A 1Y56A 3WE0A 4DNAA 4H50A 2BXRA 5KXJA 3NKSA 3UOVA 1PJ6A 4GR1A 2C3CA 1JRXA 1PDHA 1D4EA 1M64A 3DA1A 1V59A 2X3NA 3P4SA 3P4PA 3QVPA 1NPXA 2H89A 3UOZA 1JU2A 1CF3A 2C72A 2GR1A 3AEBA 3AD9B 5FS8A 1D5TA 3IF9A 4GAPA 4XWRA 1ZMDA 2ZZBA 2WHDA 4WX1A 1O94A 2FJAA 3SYIA 3DK9A 1CJ4A 3D8XA 1QO8A 4FK1C 2YG6A 3CGEA 2XFOA 1KNPA 3NIXA 2GR3A 4H4ZA 3IHMA 3SY4A 4NTCA 4C3XA 4Z26A 4YT0A 2V60A 4J36A 4JY2A 2E4GA 2WPCA 4ZCDA 5EBKA 1HYUA 5FMHA 5FS6A 1AOGA 5JCIA 2X8GA 1NEKA 1ZOYA 2C65A 2YLSA 1GEUA 2C7GA 4PABA 4YTPA 3LXDA 1NDAA 4GRTA 4AP1A 4CRTA 2AAQA 5HYMA 1JEHA 3R9UA 2GRTA 4K5SA 1E1LA 2B9WA 1IUTA 2YR5A 5L46A 4NEWA 2BK5A 4XWZA 3RP8A 4J33A 1NG4A 3SZWA 3QFAA 4G74A 4J31A 2VQBA 3FIMB 4H2PA 1D4CA 2GEWA 4H4WA 2YLTA 3VRAA 2BCGG 3NHOX 2BXSA 1FL2A 4II2A 1VQWA 1D7YA 2V6OA 4B68A 1B5QA 2CDUA 2VVLG 3ITJA 3AE3A 4EQXA 1NHRA 3DGZA 1ZX9A 3NGCX 3REDA 5IPYA 3F8PA 1PBEA 3QJ4A 1VRQB 4A65A 5KMRA 2VRLA 4CNJA 3BHFA 4GDPA 3EAOA 2QA1A 3P1WA 4FX9A 3II4A 1LQTA 3T0KA 3IWAA 3T14A 4EMJA 2WESA 3QSSA 1N4VA 3UOXA 3GMCA 4JN9A 3NK0X 3ATQA 2QCUA 5M0ZA 3CPHG 4K22A 4OPLA 2NPXA 3AEEA 4B66A 4YTNA 2XVHA 2XVJA 3DJEA 4H2QA 3H8IA 5EB4A 1LV0A 3EPTA 3PVCA 2YG3A 2EQ9A 4JDRA 4II3A 2CVJA 4IV9A 1BF3A 4H4XA 2R9ZA 2WP6A 3L8KA 1GSNA 5C2TA 1YY5A 1P2HA 4OPTA 2C67A 1LPFA 1VDCA 4RG3A 5CQFA 3AWIA 4AT0A 3JSKA 3ALLA 3C4NA 2YAUA 4U8IA 2JAEA 1TDFA 1XANA 2IVEA 4HB9A 2V3BA 2C66A 3SX6A 1N4WA 5KVIA 4B69A 5HY5A 2WOIA 4LU6A 4B1BA 3NTAA 4CCQA 4YSYA 3EF6A 4G6GA 4CCRA 3KD9A 5KNLA 4G6HA 4NEVA 4USQA 1IUXA 3BI4A 3LB8A 2YLZA 1W4XA 1DJQA 3HZLA 2RGJA 4WCTA 3SGLA 4JY3A 2Z5XA 2AQJA 2BC0A 2A87A 5HXIA 4REKA 1PBFA 1S3BA 4UDQA 3DMEA 3UKHA 4C5OA 1YQ3A 2V5ZA 4OPIA 1EL7A 2JBVA 2WOWA 2YWLA 4OPCA 3SFDA 4I59A 2X50A 1Z6LA 4K5RA 1XPQA 4B65A 1S2QA 4H4UA 2C70A 1BZLA 2UZZA 1CJ3A 1K0IA 1PJ7A 3GDPA 4GUVA 5U1OA 3SQPA 1L9EA 4P9SA 3K7MX 2F5ZA 3UTGA 1F6MA 2X99A 2C73A 3UP4A 3GRSA 4AP3A 4CBQA 3AE8A 1Q9IA 1SEZA 2ZZCA 4NWZA 4ICYA 1Q1RA 3HYWA 3BI2A 2JB3A 2RGHA 2NVKX 2OLOA 2XFUA 4TM4A 2V3AA 5IQ1A 3F8DA 3AE9A 3H4KA 3S61A 3SFEA 4AOSA 4C3YA 3L1RA 3VR8A 1D7LA 4U2SA 1JNZA 4Y4LA 2BRYA 3ICRA 3KLJA 2R4EA 4TM1A 3AXBA 5JCKA 1GREA 2APGA 2XYOA 3BI5A 3GWFA 2XLPA 1IUWA 2BCPA 1PXAA 2H88A 4IA6A 2R4JA 1H7WA 2HQMA 3ICSA 1GRGA 1DOBA 4Y4MA 2YLXA 3AEAA 4B67A 2WOVA 1GRAA 1REOA 3CN8A 2GMHA 3AE5A 3G5SA 4H4VA 2GVCA 1F8RA 3M12A 1H83A 1PS9A 2B76A 1NAAA 3GD3A 3NT6A 4H4TA 4TLXA 4B63A 4EQSA 3DJDA 5IQ4A 3P4RA 1FEAA 5KMSA 1ZY8A 3DGHA 5BUKA 4BV6A 1PHHA 4EM3A 3NTDA 1VG9A 3K30A 5J7XA 2R0GA 2TMDA 1X31B 2A8XA 4A99A 4BURA 2XFPA 1TDEA 3GYJA 4FDCB 2IIDA 1B8SA 1ONFA 4AOXA 3UKPA 5KMQA 2GR0A 3RP6A 3PO7A 3CMMA 2Q0LA 3T2KA 2E1MA 4OVIA 4JQ9A 1COYA 1H86A 2PYXA 5DBJA 1PXBA 2OA1A 3SZ0A 3SZFA 2OALA 1K0LA 3NYCA 4X9NA 3KKJA 4J56A 3ALMA 1L9CA 2GV8A 1F3PA 3ABVA 4U8LA 1FCDA 2CULA 2WU5A 3SM8A 5LV9A 4N9XA 2A89A 1IJHA 2Q7VA 4NZHA 1EL8A 1IUSA 1PJ5A 1GNDA 5GSNA 2E5VA 4H4YA 4DGKA 4H4PA 1JRYA 2B7SA 1ZOVA 3AD8B 3M13A 2JK6A 2YVGA 4U8KA 5KRQA 3NN0X 1NG3A 3AEFA 2YVJA 4O5UA 1OJDA 2V61A 4JNAA 4H4SA 4A6NA 1CJCA 3FPZA 2YLWA 2BS3A 1KDGA 3LJPA 4H4RA 5U63A 3D1CA 2C75A 2X8CA 2YVFA 3GSIA 3T31A 2WPFA 1E1NA 1OJTA 3IHGA 2RGOA 4YSHA 1B4VA 3LADA 1ZDLA 4YKGA 3DH9A 3P4QA 4ECHA 1EBDA 4A9WA 5JCLA 1KF6A 4GF7A 1LJ1A 2OLNA 1KNRA 2VVLA 2YG7A 3LZXA 5FS7A 4DSGA 2XDOA 4RSLA 2OAMA 4J34A 2WDQA 2GB0A 3B6DA 1EL9A 3B3RA 4OPUA 4BK3A 3CGDA 4FK1A 2EQ8A 1KFYA 1JNRA 3CNPA 5BULA 5GRTA 1CHUA 3PS9A 2GH5A 4EIQA 4YWOA 3CPJG 4K8DA 1QJDA 2GMJA 1RSGA 4OCGA 3UTEA 2Y6RA 1H6VA 5KVHA 2FJDA 4APNA 1E1MA 3AB1A 3BNMA 3Q9TA 5FS9A 3NYFA 3GDNA 2WEUA 4UDPA 2BS4A 5CKUA 2YR6A 3K7TA 4K7ZA 2XLTA 1N4UA 1K0JA 3CIRA 3QSMA 2YQUA 3ATRA 3H8LA 4U8NA 1IUVA 3AEDA 3ALJA 3RHAA 4CY8A 5HHFA 1CBOA 3ISHA 2C64A 4ZN0A 2I0ZA 5J60A 2YM2A 1H84A 1GXFA 4Z2UA 3KPFA 1K4QA 3EANA 4USRA 1ELIA 4UP3A 3UKAA 1TYPA 3AE2A 1BKWA 2BC1A 3UOYA 2QA2A 3ZYXA 1M6IA 4KPRA 4KX6A 1KSSA 3FG2P 1P2EA 1NHSA 2B9XA 5C3JA 2WU2A 2RABA 1GETA 4ZCCA 4H2NA 3DJJA 2R46A 4J57A 1FOHA 3LZWA 3SZCA 3VRBA 3UKFA 3DK4A 1GTHA 2WDRA 4BK2A 3GMBA 3I3LA 3AD7B 3NN6X 3COXA 3FMWA 1GRHA 3F8RA 4G9KA 4H2RA 3KVEA 2XCGA 3NLCA 3GRTA 3UTFA 3AYIA 4UDRA 3AE6A 2DKIA 3AYJA 1DOCA 2WETA 4IVMB 1GV4A 2DKHA 1GPEA 3AEGA 1S2YA 1YQZA 1JRZA 1QLBA 4YSZA 3CNSA 1OJAA 3NRNA 2WPEA 4X9MA 3NK1X 2XLRA 3RNMA 4U8OA 2JKCA 1FECA 2FJBA 2VOUA 4U8MA 1GALA 3K7QX 3E1TA 1E1KA 1ZKQA 1CC4A 3FBSA 3KA7A 1GOSA 1N1PA 2C76A 4NTDA 3URHA 1E39A 1GT8A 4J2WA 3T2ZA 2BRAA 4BJYA 2ARDA 1ZP0A 4OPGA 4PAAA 1CC6A 1ZMCA 2GAHB 4A5LA 1O5WA 1FEBA 2GQFA 4EQWA 4E0VA 2WS3A 1Y56B 3VRDB 1BWCA 3IC9A 2GQWA 5BRTA 1B37A 2JB1A 5KWFA 1KSUA 1OJ9A 3T2YA 5KMPA 4JNQA 2B7RA 4HA6A 3RP7A 2BABA 3HYVA 1LTXR 4GCMA 1E7PA 5U25A 2C4CA 4U2LA 1GERA 2X8HA 1PBCA 3QFBA 2J3NA 1BGNA 4Z25A 1H81A 4BK1A 2YG4A 4OPDA 2R45A 3CTYA 3CGBA 5TR3A 1DJNA 4A7AA 4K2XA 4GAVA 4MJWA 2Z5YA 5EOWA 3UTHA 1GESA 1MXTA 3Q6JA 4C77A 4Z2TA 4I58A 5BVAA 4YSXA 1DNCA 4LA1A 1YKJA 1PXCA 3M0OA 1LQUA 3G5QA 4CNKA 2ACZA 3UKKA 2WDVA 2EQ6A 1RYIA 4YKFA 3SXIA 1XDIA 4TM3A 4YXDA 5KOXA 4AT2A 1IUUA 3ZDNA 1DODA 2XFNA 3CGCA 3QVRA 1GRTA 1PN0A 5ER0A 1CJ2A 1TDNA 2TPRA 4Z44A 4CY6A 2XVEA 3NK2X 4RG4A 3S5WA 3OZ2A 1MOKA 3P9UA 3O0HA 2FBWA 1CC2A 2W0HA 1GTEA 4XXGA 2VRMA 1MO9A 3QSEA 2YM1A 1GRFA 3NYEA 3OC4A 3V76A 3C96A 3I6DA 4U2TA 2XVFA 3DK8A 4Z2RA 1PBDA
chains in the Genus database with same CATH topology
2WP9A 2BS2A 3V3NA 3UP5A 2XLUA 4YTMA 1ZK7A 1TDOA 1UKVG 3DJGX 1H82A 2QAEA 3NH3X 1TRBA 1D4DA 2BA9A 1NHPA 2FJEA 1YQ4A 3KU9A 3AECA 3VQRA 1DXLA 2JB2A 1Y0PA 2YLRA 1OJCA 1S3EA 2VVMA 3BHKA 4ADWA 4DSHA 2R0PA 2GF3A 1LVLA 2Q0KA 2BK3A 5EB5A 2WP5A 5KOWA 4EMWA 2YG5A 2AR8A 4U8JA 4X4JA 3CNDA 4BJZA 4EIPA 5JCNA 4C74A 1XHCA 2XLSA 4TLZA 3UKLA 1PBBA 1H7XA 1CL0A 3AE1A 3G5RA 1TDKA 4EQRA 4IVOB 4EMIA 2IVDA 3T37A 2GR2A 3CNTA 4U8PA 3VR9A 4Z43A 2GAGB 2R0CA 4D03A 2XVIA 1F8WA 3GD4A 2B9YA 4G73A 4TM0A 2WBAA 2VZ2A 1L0VA 2BK4A 1GRBA 3KPKA 2XFQA 3AE7A 1E6EA 2CFYA 3NG7X 1L9DA 4H4QA 3UKQA 3BNUA 3V3OA 4A6NB 4O5QA 1VG0A 3GYIA 4IA5A 2YR4A 5JCMA 2C3DA 2VQ7A 4M52A 4NNJA 1RP0A 3LOVA 3CPIG 1JOAA 3ICTA 2EQ7A 1NHQA 4NTEA 1TYTA 1F8SA 2ZZ0A 4D04A 1NENA 4EM4A 4LIIA 2WQYA 1EL5A 3GYXA 1Q1WA 3C4AA 4Z24A 5M10A 3UCLA 3NNEA 4Y4NA 4A79A 4GDEA 2PHHA 3AYLA 2Y6QA 2O9ZA 3GWDA 3HYXA 4B64A 2ZBWA 3CNJA 2BYBA 1DOEA 3ADAB 2BACA 2Q6UA 3AE4A 4H7UA 1BGJA 1O95A 1Y56A 3WE0A 4DNAA 4H50A 2BXRA 5KXJA 3NKSA 3UOVA 1PJ6A 4GR1A 2C3CA 1JRXA 1PDHA 1D4EA 1M64A 3DA1A 1V59A 2X3NA 3P4SA 3P4PA 3QVPA 1NPXA 2H89A 3UOZA 1JU2A 1CF3A 2C72A 2GR1A 3AEBA 3AD9B 5FS8A 1D5TA 3IF9A 4GAPA 4XWRA 1ZMDA 2ZZBA 2WHDA 4WX1A 1O94A 2FJAA 3SYIA 3DK9A 1CJ4A 3D8XA 1QO8A 4FK1C 2YG6A 3CGEA 2XFOA 1KNPA 3NIXA 2GR3A 4H4ZA 3IHMA 3SY4A 4NTCA 4C3XA 4Z26A 4YT0A 2V60A 4J36A 4JY2A 2E4GA 2WPCA 4ZCDA 5EBKA 1HYUA 5FMHA 5FS6A 1AOGA 5JCIA 2X8GA 1NEKA 1ZOYA 2C65A 2YLSA 1GEUA 2C7GA 4PABA 4YTPA 3LXDA 1NDAA 4GRTA 4AP1A 4CRTA 2AAQA 5HYMA 1JEHA 3R9UA 2GRTA 4K5SA 1E1LA 2B9WA 1IUTA 2YR5A 5L46A 4NEWA 2BK5A 4XWZA 3RP8A 4J33A 1NG4A 3SZWA 3QFAA 4G74A 4J31A 2VQBA 3FIMB 4H2PA 1D4CA 2GEWA 4H4WA 2YLTA 3VRAA 2BCGG 3NHOX 2BXSA 1FL2A 4II2A 1VQWA 1D7YA 2V6OA 4B68A 1B5QA 2CDUA 2VVLG 3ITJA 3AE3A 4EQXA 1NHRA 3DGZA 1ZX9A 3NGCX 3REDA 5IPYA 3F8PA 1PBEA 3QJ4A 1VRQB 4A65A 5KMRA 2VRLA 4CNJA 3BHFA 4GDPA 3EAOA 2QA1A 3P1WA 4FX9A 3II4A 1LQTA 3T0KA 3IWAA 3T14A 4EMJA 2WESA 3QSSA 1N4VA 3UOXA 3GMCA 4JN9A 3NK0X 3ATQA 2QCUA 5M0ZA 3CPHG 4K22A 4OPLA 2NPXA 3AEEA 4B66A 4YTNA 2XVHA 2XVJA 3DJEA 4H2QA 3H8IA 5EB4A 1LV0A 3EPTA 3PVCA 2YG3A 2EQ9A 4JDRA 4II3A 2CVJA 4IV9A 1BF3A 4H4XA 2R9ZA 2WP6A 3L8KA 1GSNA 5C2TA 1YY5A 1P2HA 4OPTA 2C67A 1LPFA 1VDCA 4RG3A 5CQFA 3AWIA 4AT0A 3JSKA 3ALLA 3C4NA 2YAUA 4U8IA 2JAEA 1TDFA 1XANA 2IVEA 4HB9A 2V3BA 2C66A 3SX6A 1N4WA 5KVIA 4B69A 5HY5A 2WOIA 4LU6A 4B1BA 3NTAA 4CCQA 4YSYA 3EF6A 4G6GA 4CCRA 3KD9A 5KNLA 4G6HA 4NEVA 4USQA 1IUXA 3BI4A 3LB8A 2YLZA 1W4XA 1DJQA 3HZLA 2RGJA 4WCTA 3SGLA 4JY3A 2Z5XA 2AQJA 2BC0A 2A87A 5HXIA 4REKA 1PBFA 1S3BA 4UDQA 3DMEA 3UKHA 4C5OA 1YQ3A 2V5ZA 4OPIA 1EL7A 2JBVA 2WOWA 2YWLA 4OPCA 3SFDA 4I59A 2X50A 1Z6LA 4K5RA 1XPQA 4B65A 1S2QA 4H4UA 2C70A 1BZLA 2UZZA 1CJ3A 1K0IA 1PJ7A 3GDPA 4GUVA 5U1OA 3SQPA 1L9EA 4P9SA 3K7MX 2F5ZA 3UTGA 1F6MA 2X99A 2C73A 3UP4A 3GRSA 4AP3A 4CBQA 3AE8A 1Q9IA 1SEZA 2ZZCA 4NWZA 4ICYA 1Q1RA 3HYWA 3BI2A 2JB3A 2RGHA 2NVKX 2OLOA 2XFUA 4TM4A 2V3AA 5IQ1A 3F8DA 3AE9A 3H4KA 3S61A 3SFEA 4AOSA 4C3YA 3L1RA 3VR8A 1D7LA 4U2SA 1JNZA 4Y4LA 2BRYA 3ICRA 3KLJA 2R4EA 4TM1A 3AXBA 5JCKA 1GREA 2APGA 2XYOA 3BI5A 3GWFA 2XLPA 1IUWA 2BCPA 1PXAA 2H88A 4IA6A 2R4JA 1H7WA 2HQMA 3ICSA 1GRGA 1DOBA 4Y4MA 2YLXA 3AEAA 4B67A 2WOVA 1GRAA 1REOA 3CN8A 2GMHA 3AE5A 3G5SA 4H4VA 2GVCA 1F8RA 3M12A 1H83A 1PS9A 2B76A 1NAAA 3GD3A 3NT6A 4H4TA 4TLXA 4B63A 4EQSA 3DJDA 5IQ4A 3P4RA 1FEAA 5KMSA 1ZY8A 3DGHA 5BUKA 4BV6A 1PHHA 4EM3A 3NTDA 1VG9A 3K30A 5J7XA 2R0GA 2TMDA 1X31B 2A8XA 4A99A 4BURA 2XFPA 1TDEA 3GYJA 4FDCB 2IIDA 1B8SA 1ONFA 4AOXA 3UKPA 5KMQA 2GR0A 3RP6A 3PO7A 3CMMA 2Q0LA 3T2KA 2E1MA 4OVIA 4JQ9A 1COYA 1H86A 2PYXA 5DBJA 1PXBA 2OA1A 3SZ0A 3SZFA 2OALA 1K0LA 3NYCA 4X9NA 3KKJA 4J56A 3ALMA 1L9CA 2GV8A 1F3PA 3ABVA 4U8LA 1FCDA 2CULA 2WU5A 3SM8A 5LV9A 4N9XA 2A89A 1IJHA 2Q7VA 4NZHA 1EL8A 1IUSA 1PJ5A 1GNDA 5GSNA 2E5VA 4H4YA 4DGKA 4H4PA 1JRYA 2B7SA 1ZOVA 3AD8B 3M13A 2JK6A 2YVGA 4U8KA 5KRQA 3NN0X 1NG3A 3AEFA 2YVJA 4O5UA 1OJDA 2V61A 4JNAA 4H4SA 4A6NA 1CJCA 3FPZA 2YLWA 2BS3A 1KDGA 3LJPA 4H4RA 5U63A 3D1CA 2C75A 2X8CA 2YVFA 3GSIA 3T31A 2WPFA 1E1NA 1OJTA 3IHGA 2RGOA 4YSHA 1B4VA 3LADA 1ZDLA 4YKGA 3DH9A 3P4QA 4ECHA 1EBDA 4A9WA 5JCLA 1KF6A 4GF7A 1LJ1A 2OLNA 1KNRA 2VVLA 2YG7A 3LZXA 5FS7A 4DSGA 2XDOA 4RSLA 2OAMA 4J34A 2WDQA 2GB0A 3B6DA 1EL9A 3B3RA 4OPUA 4BK3A 3CGDA 4FK1A 2EQ8A 1KFYA 1JNRA 3CNPA 5BULA 5GRTA 1CHUA 3PS9A 2GH5A 4EIQA 4YWOA 3CPJG 4K8DA 1QJDA 2GMJA 1RSGA 4OCGA 3UTEA 2Y6RA 1H6VA 5KVHA 2FJDA 4APNA 1E1MA 3AB1A 3BNMA 3Q9TA 5FS9A 3NYFA 3GDNA 2WEUA 4UDPA 2BS4A 5CKUA 2YR6A 3K7TA 4K7ZA 2XLTA 1N4UA 1K0JA 3CIRA 3QSMA 2YQUA 3ATRA 3H8LA 4U8NA 1IUVA 3AEDA 3ALJA 3RHAA 4CY8A 5HHFA 1CBOA 3ISHA 2C64A 4ZN0A 2I0ZA 5J60A 2YM2A 1H84A 1GXFA 4Z2UA 3KPFA 1K4QA 3EANA 4USRA 1ELIA 4UP3A 3UKAA 1TYPA 3AE2A 1BKWA 2BC1A 3UOYA 2QA2A 3ZYXA 1M6IA 4KPRA 4KX6A 1KSSA 3FG2P 1P2EA 1NHSA 2B9XA 5C3JA 2WU2A 2RABA 1GETA 4ZCCA 4H2NA 3DJJA 2R46A 4J57A 1FOHA 3LZWA 3SZCA 3VRBA 3UKFA 3DK4A 1GTHA 2WDRA 4BK2A 3GMBA 3I3LA 3AD7B 3NN6X 3COXA 3FMWA 1GRHA 3F8RA 4G9KA 4H2RA 3KVEA 2XCGA 3NLCA 3GRTA 3UTFA 3AYIA 4UDRA 3AE6A 2DKIA 3AYJA 1DOCA 2WETA 4IVMB 1GV4A 2DKHA 1GPEA 3AEGA 1S2YA 1YQZA 1JRZA 1QLBA 4YSZA 3CNSA 1OJAA 3NRNA 2WPEA 4X9MA 3NK1X 2XLRA 3RNMA 4U8OA 2JKCA 1FECA 2FJBA 2VOUA 4U8MA 1GALA 3K7QX 3E1TA 1E1KA 1ZKQA 1CC4A 3FBSA 3KA7A 1GOSA 1N1PA 2C76A 4NTDA 3URHA 1E39A 1GT8A 4J2WA 3T2ZA 2BRAA 4BJYA 2ARDA 1ZP0A 4OPGA 4PAAA 1CC6A 1ZMCA 2GAHB 4A5LA 1O5WA 1FEBA 2GQFA 4EQWA 4E0VA 2WS3A 1Y56B 3VRDB 1BWCA 3IC9A 2GQWA 5BRTA 1B37A 2JB1A 5KWFA 1KSUA 1OJ9A 3T2YA 5KMPA 4JNQA 2B7RA 4HA6A 3RP7A 2BABA 3HYVA 1LTXR 4GCMA 1E7PA 5U25A 2C4CA 4U2LA 1GERA 2X8HA 1PBCA 3QFBA 2J3NA 1BGNA 4Z25A 1H81A 4BK1A 2YG4A 4OPDA 2R45A 3CTYA 3CGBA 5TR3A 1DJNA 4A7AA 4K2XA 4GAVA 4MJWA 2Z5YA 5EOWA 3UTHA 1GESA 1MXTA 3Q6JA 4C77A 4Z2TA 4I58A 5BVAA 4YSXA 1DNCA 4LA1A 1YKJA 1PXCA 3M0OA 1LQUA 3G5QA 4CNKA 2ACZA 3UKKA 2WDVA 2EQ6A 1RYIA 4YKFA 3SXIA 1XDIA 4TM3A 4YXDA 5KOXA 4AT2A 1IUUA 3ZDNA 1DODA 2XFNA 3CGCA 3QVRA 1GRTA 1PN0A 5ER0A 1CJ2A 1TDNA 2TPRA 4Z44A 4CY6A 2XVEA 3NK2X 4RG4A 3S5WA 3OZ2A 1MOKA 3P9UA 3O0HA 2FBWA 1CC2A 2W0HA 1GTEA 4XXGA 2VRMA 1MO9A 3QSEA 2YM1A 1GRFA 3NYEA 3OC4A 3V76A 3C96A 3I6DA 4U2TA 2XVFA 3DK8A 4Z2RA 1PBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 A;  2BS2 A;  3V3N A;  3UP5 A;  2XLU A;  4YTM A;  1ZK7 A;  1TDO A;  1UKV G;  3DJG X;  1H82 A;  2QAE A;  3NH3 X;  1TRB A;  1D4D A;  2BA9 A;  1NHP A;  2FJE A;  1YQ4 A;  3KU9 A;  3AEC A;  3VQR A;  1DXL A;  2JB2 A;  1Y0P A;  2YLR A;  1OJC A;  1S3E A;  2VVM A;  3BHK A;  4ADW A;  4DSH A;  2R0P A;  2GF3 A;  1LVL A;  2Q0K A;  2BK3 A;  5EB5 A;  2WP5 A;  5KOW A;  4EMW A;  2YG5 A;  2AR8 A;  4U8J A;  4X4J A;  3CND A;  4BJZ A;  4EIP A;  5JCN A;  4C74 A;  1XHC A;  2XLS A;  4TLZ A;  3UKL A;  1PBB A;  1H7X A;  1CL0 A;  3AE1 A;  3G5R A;  1TDK A;  4EQR A;  4IVO B;  4EMI A;  2IVD A;  3T37 A;  2GR2 A;  3CNT A;  4U8P A;  3VR9 A;  4Z43 A;  2GAG B;  2R0C A;  4D03 A;  2XVI A;  1F8W A;  3GD4 A;  2B9Y A;  4TM0 A;  2WBA A;  2VZ2 A;  1L0V A;  2BK4 A;  1GRB A;  2XFQ A;  3AE7 A;  1E6E A;  2CFY A;  3NG7 X;  1L9D A;  4H4Q A;  3UKQ A;  3BNU A;  3V3O A;  4A6N B;  4O5Q A;  1VG0 A;  3GYI A;  4IA5 A;  2YR4 A;  5JCM A;  2C3D A;  2VQ7 A;  4M52 A;  1RP0 A;  3LOV A;  3CPI G;  1JOA A;  3ICT A;  2EQ7 A;  1NHQ A;  4NTE A;  1TYT A;  1F8S A;  2ZZ0 A;  4D04 A;  1NEN A;  4EM4 A;  4LII A;  2WQY A;  1EL5 A;  4Z24 A;  1Q1W A;  3C4A A;  5M10 A;  3UCL A;  3NNE A;  4Y4N A;  4A79 A;  4GDE A;  2PHH A;  3AYL A;  2Y6Q A;  2O9Z A;  3GWD A;  4B64 A;  2ZBW A;  3CNJ A;  2BYB A;  1DOE A;  3ADA B;  2BAC A;  2Q6U A;  3AE4 A;  4H7U A;  1BGJ A;  1O95 A;  1Y56 A;  3WE0 A;  4DNA A;  4H50 A;  2BXR A;  5KXJ A;  3NKS A;  3UOV A;  1PJ6 A;  4GR1 A;  2C3C A;  1JRX A;  1PDH A;  1D4E A;  1M64 A;  3DA1 A;  1V59 A;  2X3N A;  3P4S A;  3P4P A;  3QVP A;  1NPX A;  2H89 A;  3UOZ A;  1JU2 A;  1CF3 A;  2C72 A;  2GR1 A;  3AEB A;  3AD9 B;  5FS8 A;  1D5T A;  3IF9 A;  4XWR A;  1ZMD A;  2ZZB A;  2WHD A;  4WX1 A;  1O94 A;  2FJA A;  3DK9 A;  1CJ4 A;  3D8X A;  1QO8 A;  4FK1 C;  2YG6 A;  3CGE A;  2XFO A;  1KNP A;  3NIX A;  2GR3 A;  4H4Z A;  3IHM A;  4C3X A;  4NTC A;  4Z26 A;  4YT0 A;  2V60 A;  4J36 A;  4JY2 A;  2E4G A;  2WPC A;  4ZCD A;  5EBK A;  1HYU A;  5FMH A;  5FS6 A;  1AOG A;  5JCI A;  2X8G A;  1NEK A;  1ZOY A;  2C65 A;  2YLS A;  1GEU A;  2C7G A;  4PAB A;  4YTP A;  3LXD A;  1NDA A;  4GRT A;  4AP1 A;  4CRT A;  2AAQ A;  5HYM A;  1JEH A;  3R9U A;  2GRT A;  4K5S A;  1E1L A;  2B9W A;  1IUT A;  2YR5 A;  5L46 A;  4NEW A;  2BK5 A;  4XWZ A;  3RP8 A;  4J33 A;  1NG4 A;  3QFA A;  4J31 A;  2VQB A;  3FIM B;  4H2P A;  1D4C A;  2GEW A;  4H4W A;  2YLT A;  3VRA A;  2BCG G;  3NHO X;  2BXS A;  1FL2 A;  1VQW A;  1D7Y A;  2V6O A;  4B68 A;  1B5Q A;  2CDU A;  2VVL G;  3ITJ A;  3AE3 A;  4EQX A;  1NHR A;  3DGZ A;  1ZX9 A;  3NGC X;  3RED A;  5IPY A;  3F8P A;  1PBE A;  3QJ4 A;  1VRQ B;  4A65 A;  2VRL A;  4CNJ A;  3BHF A;  4GDP A;  3EAO A;  2QA1 A;  3P1W A;  4FX9 A;  3II4 A;  1LQT A;  4EMJ A;  3IWA A;  2WES A;  3QSS A;  1N4V A;  3UOX A;  3GMC A;  4JN9 A;  3NK0 X;  3ATQ A;  2QCU A;  5M0Z A;  3CPH G;  4K22 A;  4OPL A;  2NPX A;  3AEE A;  4B66 A;  4YTN A;  2XVH A;  2XVJ A;  3DJE A;  4H2Q A;  3H8I A;  5EB4 A;  1LV0 A;  3EPT A;  3PVC A;  2YG3 A;  2EQ9 A;  4JDR A;  2CVJ A;  4IV9 A;  1BF3 A;  4H4X A;  2R9Z A;  2WP6 A;  3L8K A;  1GSN A;  5C2T A;  1YY5 A;  1P2H A;  4OPT A;  2C67 A;  1LPF A;  1VDC A;  4RG3 A;  5CQF A;  3AWI A;  4AT0 A;  3JSK A;  3ALL A;  3C4N A;  2YAU A;  4U8I A;  2JAE A;  1TDF A;  1XAN A;  2IVE A;  4HB9 A;  2V3B A;  2C66 A;  4B69 A;  1N4W A;  5KVI A;  5HY5 A;  2WOI A;  4LU6 A;  4B1B A;  3NTA A;  4CCQ A;  4YSY A;  3EF6 A;  4CCR A;  3KD9 A;  4NEV A;  4USQ A;  1IUX A;  3BI4 A;  3LB8 A;  2YLZ A;  1W4X A;  1DJQ A;  3HZL A;  2RGJ A;  4WCT A;  3SGL A;  4JY3 A;  2Z5X A;  2AQJ A;  2BC0 A;  2A87 A;  5HXI A;  4REK A;  1PBF A;  1S3B A;  4UDQ A;  3DME A;  3UKH A;  4C5O A;  1YQ3 A;  2V5Z A;  4OPI A;  1EL7 A;  2JBV A;  2WOW A;  2YWL A;  4OPC A;  3SFD A;  4I59 A;  2X50 A;  1Z6L A;  4K5R A;  1XPQ A;  4B65 A;  1S2Q A;  4H4U A;  2C70 A;  1BZL A;  2UZZ A;  1CJ3 A;  1K0I A;  1PJ7 A;  3GDP A;  4GUV A;  5U1O A;  3SQP A;  1L9E A;  4P9S A;  3K7M X;  2F5Z A;  3UTG A;  1F6M A;  2X99 A;  2C73 A;  3UP4 A;  3GRS A;  4AP3 A;  4CBQ A;  3AE8 A;  1Q9I A;  1SEZ A;  2ZZC A;  4ICY A;  1Q1R A;  3BI2 A;  2JB3 A;  2RGH A;  2NVK X;  2OLO A;  2XFU A;  4TM4 A;  2V3A A;  5IQ1 A;  3F8D A;  3AE9 A;  3H4K A;  3S61 A;  3SFE A;  4AOS A;  4C3Y A;  3L1R A;  3VR8 A;  1D7L A;  4U2S A;  1JNZ A;  4Y4L A;  3ICR A;  3KLJ A;  2R4E A;  4TM1 A;  3AXB A;  5JCK A;  1GRE A;  2APG A;  2XYO A;  3BI5 A;  3GWF A;  2XLP A;  1IUW A;  2BCP A;  1PXA A;  2H88 A;  4IA6 A;  2R4J A;  1H7W A;  2HQM A;  3ICS A;  1GRG A;  1DOB A;  4Y4M A;  2YLX A;  3AEA A;  4B67 A;  2WOV A;  1GRA A;  1REO A;  3CN8 A;  2GMH A;  3AE5 A;  3G5S A;  4H4V A;  2GVC A;  1F8R A;  3M12 A;  1H83 A;  1PS9 A;  2B76 A;  1NAA A;  3GD3 A;  3NT6 A;  4H4T A;  4TLX A;  4B63 A;  4EQS A;  3DJD A;  5IQ4 A;  3P4R A;  1FEA A;  1ZY8 A;  3DGH A;  5BUK A;  4BV6 A;  1PHH A;  4EM3 A;  3NTD A;  1VG9 A;  3K30 A;  5J7X A;  2R0G A;  2TMD A;  1X31 B;  2A8X A;  4A99 A;  4BUR A;  2XFP A;  1TDE A;  3GYJ A;  4FDC B;  2IID A;  1B8S A;  1ONF A;  4AOX A;  3UKP A;  2GR0 A;  3RP6 A;  3PO7 A;  2Q0L A;  2E1M A;  4OVI A;  4JQ9 A;  1COY A;  1H86 A;  2PYX A;  5DBJ A;  1PXB A;  2OA1 A;  2OAL A;  1K0L A;  3NYC A;  4X9N A;  3KKJ A;  4J56 A;  3ALM A;  1L9C A;  2GV8 A;  1F3P A;  3ABV A;  4U8L A;  1FCD A;  2CUL A;  2WU5 A;  3SM8 A;  5LV9 A;  4N9X A;  2A89 A;  1IJH A;  2Q7V A;  4NZH A;  1EL8 A;  1IUS A;  1PJ5 A;  1GND A;  5GSN A;  2E5V A;  4H4Y A;  4DGK A;  4H4P A;  1JRY A;  2B7S A;  1ZOV A;  3AD8 B;  3M13 A;  2JK6 A;  2YVG A;  4U8K A;  5KRQ A;  3NN0 X;  1NG3 A;  3AEF A;  2YVJ A;  4O5U A;  1OJD A;  2V61 A;  4JNA A;  4H4S A;  4A6N A;  1CJC A;  3FPZ A;  2YLW A;  2BS3 A;  1KDG A;  3LJP A;  4H4R A;  5U63 A;  3D1C A;  2C75 A;  2X8C A;  2YVF A;  3GSI A;  2WPF A;  1E1N A;  1OJT A;  3IHG A;  2RGO A;  4YSH A;  1B4V A;  3LAD A;  1ZDL A;  4YKG A;  3DH9 A;  3P4Q A;  4ECH A;  1EBD A;  4A9W A;  5JCL A;  1KF6 A;  4GF7 A;  1LJ1 A;  2OLN A;  1KNR A;  2VVL A;  2YG7 A;  3LZX A;  5FS7 A;  4DSG A;  2XDO A;  4RSL A;  2OAM A;  4J34 A;  2WDQ A;  2GB0 A;  3B6D A;  1EL9 A;  3B3R A;  4OPU A;  4BK3 A;  3CGD A;  4FK1 A;  2EQ8 A;  1KFY A;  1JNR A;  3CNP A;  5BUL A;  5GRT A;  1CHU A;  3PS9 A;  2GH5 A;  4EIQ A;  4YWO A;  3CPJ G;  4K8D A;  1QJD A;  2GMJ A;  1RSG A;  4OCG A;  3UTE A;  2Y6R A;  1H6V A;  5KVH A;  2FJD A;  4APN A;  1E1M A;  3AB1 A;  3BNM A;  3Q9T A;  5FS9 A;  3NYF A;  3GDN A;  2WEU A;  4UDP A;  2BS4 A;  5CKU A;  2YR6 A;  3K7T A;  4K7Z A;  2XLT A;  1N4U A;  1K0J A;  3CIR A;  3QSM A;  2YQU A;  3ATR A;  3H8L A;  4U8N A;  1IUV A;  3AED A;  3ALJ A;  3RHA A;  4CY8 A;  5HHF A;  1CBO A;  3ISH A;  2C64 A;  4ZN0 A;  2I0Z A;  5J60 A;  2YM2 A;  1H84 A;  1GXF A;  4Z2U A;  3KPF A;  1K4Q A;  3EAN A;  4USR A;  1ELI A;  4UP3 A;  3UKA A;  1TYP A;  3AE2 A;  1BKW A;  2BC1 A;  3UOY A;  2QA2 A;  3ZYX A;  1M6I A;  4KPR A;  4KX6 A;  1KSS A;  3FG2 P;  1P2E A;  1NHS A;  2B9X A;  5C3J A;  2WU2 A;  2RAB A;  1GET A;  4ZCC A;  4H2N A;  3DJJ A;  2R46 A;  4J57 A;  1FOH A;  3LZW A;  3VRB A;  3UKF A;  3DK4 A;  1GTH A;  2WDR A;  4BK2 A;  3GMB A;  3I3L A;  3AD7 B;  3NN6 X;  3COX A;  3FMW A;  1GRH A;  3F8R A;  4H2R A;  3KVE A;  2XCG A;  3NLC A;  3GRT A;  3UTF A;  3AYI A;  4UDR A;  3AE6 A;  2DKI A;  3AYJ A;  1DOC A;  2WET A;  4IVM B;  1GV4 A;  2DKH A;  1GPE A;  3AEG A;  1S2Y A;  1YQZ A;  1JRZ A;  1QLB A;  4YSZ A;  3CNS A;  1OJA A;  3NRN A;  2WPE A;  4X9M A;  3NK1 X;  2XLR A;  3RNM A;  4U8O A;  2JKC A;  1FEC A;  2FJB A;  2VOU A;  4U8M A;  1GAL A;  3K7Q X;  3E1T A;  1E1K A;  1ZKQ A;  1CC4 A;  3FBS A;  3KA7 A;  1GOS A;  1N1P A;  2C76 A;  4NTD A;  3URH A;  1E39 A;  1GT8 A;  4J2W A;  4BJY A;  2ARD A;  1ZP0 A;  4OPG A;  4PAA A;  1CC6 A;  1ZMC A;  2GAH B;  4A5L A;  1O5W A;  1FEB A;  2GQF A;  4EQW A;  4E0V A;  2WS3 A;  1Y56 B;  3VRD B;  1BWC A;  3IC9 A;  2GQW A;  5BRT A;  1B37 A;  2JB1 A;  5KWF A;  1KSU A;  1OJ9 A;  4JNQ A;  2B7R A;  4HA6 A;  3RP7 A;  2BAB A;  1LTX R;  4GCM A;  1E7P A;  5U25 A;  4U2L A;  1GER A;  2X8H A;  1PBC A;  3QFB A;  2J3N A;  1BGN A;  4Z25 A;  1H81 A;  4BK1 A;  2YG4 A;  4OPD A;  2R45 A;  3CTY A;  3CGB A;  5TR3 A;  1DJN A;  4A7A A;  4K2X A;  4MJW A;  2Z5Y A;  5EOW A;  3UTH A;  1GES A;  1MXT A;  3Q6J A;  4C77 A;  4Z2T A;  4I58 A;  5BVA A;  4YSX A;  1DNC A;  4LA1 A;  1YKJ A;  1PXC A;  3M0O A;  1LQU A;  3G5Q A;  4CNK A;  2ACZ A;  3UKK A;  2WDV A;  2EQ6 A;  1RYI A;  4YKF A;  1XDI A;  4TM3 A;  4YXD A;  5KOX A;  4AT2 A;  1IUU A;  3ZDN A;  1DOD A;  2XFN A;  3CGC A;  3QVR A;  1GRT A;  1PN0 A;  5ER0 A;  1CJ2 A;  1TDN A;  2TPR A;  4Z44 A;  4CY6 A;  2XVE A;  3NK2 X;  4RG4 A;  3S5W A;  3OZ2 A;  1MOK A;  3P9U A;  3O0H A;  2FBW A;  1CC2 A;  2W0H A;  1GTE A;  4XXG A;  2VRM A;  1MO9 A;  3QSE A;  2YM1 A;  1GRF A;  3NYE A;  3OC4 A;  3V76 A;  3C96 A;  3I6D A;  4U2T A;  2XVF A;  3DK8 A;  4Z2R A;  1PBD A; 
#chains in the Genus database with same CATH topology
 2WP9 A;  2BS2 A;  3V3N A;  3UP5 A;  2XLU A;  4YTM A;  1ZK7 A;  1TDO A;  1UKV G;  3DJG X;  1H82 A;  2QAE A;  3NH3 X;  1TRB A;  1D4D A;  2BA9 A;  1NHP A;  2FJE A;  1YQ4 A;  3KU9 A;  3AEC A;  3VQR A;  1DXL A;  2JB2 A;  1Y0P A;  2YLR A;  1OJC A;  1S3E A;  2VVM A;  3BHK A;  4ADW A;  4DSH A;  2R0P A;  2GF3 A;  1LVL A;  2Q0K A;  2BK3 A;  5EB5 A;  2WP5 A;  5KOW A;  4EMW A;  2YG5 A;  2AR8 A;  4U8J A;  4X4J A;  3CND A;  4BJZ A;  4EIP A;  5JCN A;  4C74 A;  1XHC A;  2XLS A;  4TLZ A;  3UKL A;  1PBB A;  1H7X A;  1CL0 A;  3AE1 A;  3G5R A;  1TDK A;  4EQR A;  4IVO B;  4EMI A;  2IVD A;  3T37 A;  2GR2 A;  3CNT A;  4U8P A;  3VR9 A;  4Z43 A;  2GAG B;  2R0C A;  4D03 A;  2XVI A;  1F8W A;  3GD4 A;  2B9Y A;  4G73 A;  4TM0 A;  2WBA A;  2VZ2 A;  1L0V A;  2BK4 A;  1GRB A;  3KPK A;  2XFQ A;  3AE7 A;  1E6E A;  2CFY A;  3NG7 X;  1L9D A;  4H4Q A;  3UKQ A;  3BNU A;  3V3O A;  4A6N B;  4O5Q A;  1VG0 A;  3GYI A;  4IA5 A;  2YR4 A;  5JCM A;  2C3D A;  2VQ7 A;  4M52 A;  4NNJ A;  1RP0 A;  3LOV A;  3CPI G;  1JOA A;  3ICT A;  2EQ7 A;  1NHQ A;  4NTE A;  1TYT A;  1F8S A;  2ZZ0 A;  4D04 A;  1NEN A;  4EM4 A;  4LII A;  2WQY A;  1EL5 A;  3GYX A;  1Q1W A;  3C4A A;  4Z24 A;  5M10 A;  3UCL A;  3NNE A;  4Y4N A;  4A79 A;  4GDE A;  2PHH A;  3AYL A;  2Y6Q A;  2O9Z A;  3GWD A;  3HYX A;  4B64 A;  2ZBW A;  3CNJ A;  2BYB A;  1DOE A;  3ADA B;  2BAC A;  2Q6U A;  3AE4 A;  4H7U A;  1BGJ A;  1O95 A;  1Y56 A;  3WE0 A;  4DNA A;  4H50 A;  2BXR A;  5KXJ A;  3NKS A;  3UOV A;  1PJ6 A;  4GR1 A;  2C3C A;  1JRX A;  1PDH A;  1D4E A;  1M64 A;  3DA1 A;  1V59 A;  2X3N A;  3P4S A;  3P4P A;  3QVP A;  1NPX A;  2H89 A;  3UOZ A;  1JU2 A;  1CF3 A;  2C72 A;  2GR1 A;  3AEB A;  3AD9 B;  5FS8 A;  1D5T A;  3IF9 A;  4GAP A;  4XWR A;  1ZMD A;  2ZZB A;  2WHD A;  4WX1 A;  1O94 A;  2FJA A;  3SYI A;  3DK9 A;  1CJ4 A;  3D8X A;  1QO8 A;  4FK1 C;  2YG6 A;  3CGE A;  2XFO A;  1KNP A;  3NIX A;  2GR3 A;  4H4Z A;  3IHM A;  3SY4 A;  4NTC A;  4C3X A;  4Z26 A;  4YT0 A;  2V60 A;  4J36 A;  4JY2 A;  2E4G A;  2WPC A;  4ZCD A;  5EBK A;  1HYU A;  5FMH A;  5FS6 A;  1AOG A;  5JCI A;  2X8G A;  1NEK A;  1ZOY A;  2C65 A;  2YLS A;  1GEU A;  2C7G A;  4PAB A;  4YTP A;  3LXD A;  1NDA A;  4GRT A;  4AP1 A;  4CRT A;  2AAQ A;  5HYM A;  1JEH A;  3R9U A;  2GRT A;  4K5S A;  1E1L A;  2B9W A;  1IUT A;  2YR5 A;  5L46 A;  4NEW A;  2BK5 A;  4XWZ A;  3RP8 A;  4J33 A;  1NG4 A;  3SZW A;  3QFA A;  4G74 A;  4J31 A;  2VQB A;  3FIM B;  4H2P A;  1D4C A;  2GEW A;  4H4W A;  2YLT A;  3VRA A;  2BCG G;  3NHO X;  2BXS A;  1FL2 A;  4II2 A;  1VQW A;  1D7Y A;  2V6O A;  4B68 A;  1B5Q A;  2CDU A;  2VVL G;  3ITJ A;  3AE3 A;  4EQX A;  1NHR A;  3DGZ A;  1ZX9 A;  3NGC X;  3RED A;  5IPY A;  3F8P A;  1PBE A;  3QJ4 A;  1VRQ B;  4A65 A;  5KMR A;  2VRL A;  4CNJ A;  3BHF A;  4GDP A;  3EAO A;  2QA1 A;  3P1W A;  4FX9 A;  3II4 A;  1LQT A;  3T0K A;  3IWA A;  3T14 A;  4EMJ A;  2WES A;  3QSS A;  1N4V A;  3UOX A;  3GMC A;  4JN9 A;  3NK0 X;  3ATQ A;  2QCU A;  5M0Z A;  3CPH G;  4K22 A;  4OPL A;  2NPX A;  3AEE A;  4B66 A;  4YTN A;  2XVH A;  2XVJ A;  3DJE A;  4H2Q A;  3H8I A;  5EB4 A;  1LV0 A;  3EPT A;  3PVC A;  2YG3 A;  2EQ9 A;  4JDR A;  4II3 A;  2CVJ A;  4IV9 A;  1BF3 A;  4H4X A;  2R9Z A;  2WP6 A;  3L8K A;  1GSN A;  5C2T A;  1YY5 A;  1P2H A;  4OPT A;  2C67 A;  1LPF A;  1VDC A;  4RG3 A;  5CQF A;  3AWI A;  4AT0 A;  3JSK A;  3ALL A;  3C4N A;  2YAU A;  4U8I A;  2JAE A;  1TDF A;  1XAN A;  2IVE A;  4HB9 A;  2V3B A;  2C66 A;  3SX6 A;  1N4W A;  5KVI A;  4B69 A;  5HY5 A;  2WOI A;  4LU6 A;  4B1B A;  3NTA A;  4CCQ A;  4YSY A;  3EF6 A;  4G6G A;  4CCR A;  3KD9 A;  5KNL A;  4G6H A;  4NEV A;  4USQ A;  1IUX A;  3BI4 A;  3LB8 A;  2YLZ A;  1W4X A;  1DJQ A;  3HZL A;  2RGJ A;  4WCT A;  3SGL A;  4JY3 A;  2Z5X A;  2AQJ A;  2BC0 A;  2A87 A;  5HXI A;  4REK A;  1PBF A;  1S3B A;  4UDQ A;  3DME A;  3UKH A;  4C5O A;  1YQ3 A;  2V5Z A;  4OPI A;  1EL7 A;  2JBV A;  2WOW A;  2YWL A;  4OPC A;  3SFD A;  4I59 A;  2X50 A;  1Z6L A;  4K5R A;  1XPQ A;  4B65 A;  1S2Q A;  4H4U A;  2C70 A;  1BZL A;  2UZZ A;  1CJ3 A;  1K0I A;  1PJ7 A;  3GDP A;  4GUV A;  5U1O A;  3SQP A;  1L9E A;  4P9S A;  3K7M X;  2F5Z A;  3UTG A;  1F6M A;  2X99 A;  2C73 A;  3UP4 A;  3GRS A;  4AP3 A;  4CBQ A;  3AE8 A;  1Q9I A;  1SEZ A;  2ZZC A;  4NWZ A;  4ICY A;  1Q1R A;  3HYW A;  3BI2 A;  2JB3 A;  2RGH A;  2NVK X;  2OLO A;  2XFU A;  4TM4 A;  2V3A A;  5IQ1 A;  3F8D A;  3AE9 A;  3H4K A;  3S61 A;  3SFE A;  4AOS A;  4C3Y A;  3L1R A;  3VR8 A;  1D7L A;  4U2S A;  1JNZ A;  4Y4L A;  2BRY A;  3ICR A;  3KLJ A;  2R4E A;  4TM1 A;  3AXB A;  5JCK A;  1GRE A;  2APG A;  2XYO A;  3BI5 A;  3GWF A;  2XLP A;  1IUW A;  2BCP A;  1PXA A;  2H88 A;  4IA6 A;  2R4J A;  1H7W A;  2HQM A;  3ICS A;  1GRG A;  1DOB A;  4Y4M A;  2YLX A;  3AEA A;  4B67 A;  2WOV A;  1GRA A;  1REO A;  3CN8 A;  2GMH A;  3AE5 A;  3G5S A;  4H4V A;  2GVC A;  1F8R A;  3M12 A;  1H83 A;  1PS9 A;  2B76 A;  1NAA A;  3GD3 A;  3NT6 A;  4H4T A;  4TLX A;  4B63 A;  4EQS A;  3DJD A;  5IQ4 A;  3P4R A;  1FEA A;  5KMS A;  1ZY8 A;  3DGH A;  5BUK A;  4BV6 A;  1PHH A;  4EM3 A;  3NTD A;  1VG9 A;  3K30 A;  5J7X A;  2R0G A;  2TMD A;  1X31 B;  2A8X A;  4A99 A;  4BUR A;  2XFP A;  1TDE A;  3GYJ A;  4FDC B;  2IID A;  1B8S A;  1ONF A;  4AOX A;  3UKP A;  5KMQ A;  2GR0 A;  3RP6 A;  3PO7 A;  3CMM A;  2Q0L A;  3T2K A;  2E1M A;  4OVI A;  4JQ9 A;  1COY A;  1H86 A;  2PYX A;  5DBJ A;  1PXB A;  2OA1 A;  3SZ0 A;  3SZF A;  2OAL A;  1K0L A;  3NYC A;  4X9N A;  3KKJ A;  4J56 A;  3ALM A;  1L9C A;  2GV8 A;  1F3P A;  3ABV A;  4U8L A;  1FCD A;  2CUL A;  2WU5 A;  3SM8 A;  5LV9 A;  4N9X A;  2A89 A;  1IJH A;  2Q7V A;  4NZH A;  1EL8 A;  1IUS A;  1PJ5 A;  1GND A;  5GSN A;  2E5V A;  4H4Y A;  4DGK A;  4H4P A;  1JRY A;  2B7S A;  1ZOV A;  3AD8 B;  3M13 A;  2JK6 A;  2YVG A;  4U8K A;  5KRQ A;  3NN0 X;  1NG3 A;  3AEF A;  2YVJ A;  4O5U A;  1OJD A;  2V61 A;  4JNA A;  4H4S A;  4A6N A;  1CJC A;  3FPZ A;  2YLW A;  2BS3 A;  1KDG A;  3LJP A;  4H4R A;  5U63 A;  3D1C A;  2C75 A;  2X8C A;  2YVF A;  3GSI A;  3T31 A;  2WPF A;  1E1N A;  1OJT A;  3IHG A;  2RGO A;  4YSH A;  1B4V A;  3LAD A;  1ZDL A;  4YKG A;  3DH9 A;  3P4Q A;  4ECH A;  1EBD A;  4A9W A;  5JCL A;  1KF6 A;  4GF7 A;  1LJ1 A;  2OLN A;  1KNR A;  2VVL A;  2YG7 A;  3LZX A;  5FS7 A;  4DSG A;  2XDO A;  4RSL A;  2OAM A;  4J34 A;  2WDQ A;  2GB0 A;  3B6D A;  1EL9 A;  3B3R A;  4OPU A;  4BK3 A;  3CGD A;  4FK1 A;  2EQ8 A;  1KFY A;  1JNR A;  3CNP A;  5BUL A;  5GRT A;  1CHU A;  3PS9 A;  2GH5 A;  4EIQ A;  4YWO A;  3CPJ G;  4K8D A;  1QJD A;  2GMJ A;  1RSG A;  4OCG A;  3UTE A;  2Y6R A;  1H6V A;  5KVH A;  2FJD A;  4APN A;  1E1M A;  3AB1 A;  3BNM A;  3Q9T A;  5FS9 A;  3NYF A;  3GDN A;  2WEU A;  4UDP A;  2BS4 A;  5CKU A;  2YR6 A;  3K7T A;  4K7Z A;  2XLT A;  1N4U A;  1K0J A;  3CIR A;  3QSM A;  2YQU A;  3ATR A;  3H8L A;  4U8N A;  1IUV A;  3AED A;  3ALJ A;  3RHA A;  4CY8 A;  5HHF A;  1CBO A;  3ISH A;  2C64 A;  4ZN0 A;  2I0Z A;  5J60 A;  2YM2 A;  1H84 A;  1GXF A;  4Z2U A;  3KPF A;  1K4Q A;  3EAN A;  4USR A;  1ELI A;  4UP3 A;  3UKA A;  1TYP A;  3AE2 A;  1BKW A;  2BC1 A;  3UOY A;  2QA2 A;  3ZYX A;  1M6I A;  4KPR A;  4KX6 A;  1KSS A;  3FG2 P;  1P2E A;  1NHS A;  2B9X A;  5C3J A;  2WU2 A;  2RAB A;  1GET A;  4ZCC A;  4H2N A;  3DJJ A;  2R46 A;  4J57 A;  1FOH A;  3LZW A;  3SZC A;  3VRB A;  3UKF A;  3DK4 A;  1GTH A;  2WDR A;  4BK2 A;  3GMB A;  3I3L A;  3AD7 B;  3NN6 X;  3COX A;  3FMW A;  1GRH A;  3F8R A;  4G9K A;  4H2R A;  3KVE A;  2XCG A;  3NLC A;  3GRT A;  3UTF A;  3AYI A;  4UDR A;  3AE6 A;  2DKI A;  3AYJ A;  1DOC A;  2WET A;  4IVM B;  1GV4 A;  2DKH A;  1GPE A;  3AEG A;  1S2Y A;  1YQZ A;  1JRZ A;  1QLB A;  4YSZ A;  3CNS A;  1OJA A;  3NRN A;  2WPE A;  4X9M A;  3NK1 X;  2XLR A;  3RNM A;  4U8O A;  2JKC A;  1FEC A;  2FJB A;  2VOU A;  4U8M A;  1GAL A;  3K7Q X;  3E1T A;  1E1K A;  1ZKQ A;  1CC4 A;  3FBS A;  3KA7 A;  1GOS A;  1N1P A;  2C76 A;  4NTD A;  3URH A;  1E39 A;  1GT8 A;  4J2W A;  3T2Z A;  2BRA A;  4BJY A;  2ARD A;  1ZP0 A;  4OPG A;  4PAA A;  1CC6 A;  1ZMC A;  2GAH B;  4A5L A;  1O5W A;  1FEB A;  2GQF A;  4EQW A;  4E0V A;  2WS3 A;  1Y56 B;  3VRD B;  1BWC A;  3IC9 A;  2GQW A;  5BRT A;  1B37 A;  2JB1 A;  5KWF A;  1KSU A;  1OJ9 A;  3T2Y A;  5KMP A;  4JNQ A;  2B7R A;  4HA6 A;  3RP7 A;  2BAB A;  3HYV A;  1LTX R;  4GCM A;  1E7P A;  5U25 A;  2C4C A;  4U2L A;  1GER A;  2X8H A;  1PBC A;  3QFB A;  2J3N A;  1BGN A;  4Z25 A;  1H81 A;  4BK1 A;  2YG4 A;  4OPD A;  2R45 A;  3CTY A;  3CGB A;  5TR3 A;  1DJN A;  4A7A A;  4K2X A;  4GAV A;  4MJW A;  2Z5Y A;  5EOW A;  3UTH A;  1GES A;  1MXT A;  3Q6J A;  4C77 A;  4Z2T A;  4I58 A;  5BVA A;  4YSX A;  1DNC A;  4LA1 A;  1YKJ A;  1PXC A;  3M0O A;  1LQU A;  3G5Q A;  4CNK A;  2ACZ A;  3UKK A;  2WDV A;  2EQ6 A;  1RYI A;  4YKF A;  3SXI A;  1XDI A;  4TM3 A;  4YXD A;  5KOX A;  4AT2 A;  1IUU A;  3ZDN A;  1DOD A;  2XFN A;  3CGC A;  3QVR A;  1GRT A;  1PN0 A;  5ER0 A;  1CJ2 A;  1TDN A;  2TPR A;  4Z44 A;  4CY6 A;  2XVE A;  3NK2 X;  4RG4 A;  3S5W A;  3OZ2 A;  1MOK A;  3P9U A;  3O0H A;  2FBW A;  1CC2 A;  2W0H A;  1GTE A;  4XXG A;  2VRM A;  1MO9 A;  3QSE A;  2YM1 A;  1GRF A;  3NYE A;  3OC4 A;  3V76 A;  3C96 A;  3I6D A;  4U2T A;  2XVF A;  3DK8 A;  4Z2R A;  1PBD A; 
#chains in the Genus database with same CATH homology
 2WP9 A;  2BS2 A;  3V3N A;  3UP5 A;  2XLU A;  4YTM A;  1ZK7 A;  1TDO A;  1UKV G;  3DJG X;  1H82 A;  2QAE A;  3NH3 X;  1TRB A;  1D4D A;  2BA9 A;  1NHP A;  2FJE A;  1YQ4 A;  3KU9 A;  3AEC A;  3VQR A;  1DXL A;  2JB2 A;  1Y0P A;  2YLR A;  1OJC A;  1S3E A;  2VVM A;  3BHK A;  4ADW A;  4DSH A;  2R0P A;  2GF3 A;  1LVL A;  2Q0K A;  2BK3 A;  5EB5 A;  2WP5 A;  5KOW A;  4EMW A;  2YG5 A;  2AR8 A;  4U8J A;  4X4J A;  3CND A;  4BJZ A;  4EIP A;  5JCN A;  4C74 A;  1XHC A;  2XLS A;  4TLZ A;  3UKL A;  1PBB A;  1H7X A;  1CL0 A;  3AE1 A;  3G5R A;  1TDK A;  4EQR A;  4IVO B;  4EMI A;  2IVD A;  3T37 A;  2GR2 A;  3CNT A;  4U8P A;  3VR9 A;  4Z43 A;  2GAG B;  2R0C A;  4D03 A;  2XVI A;  1F8W A;  3GD4 A;  2B9Y A;  4G73 A;  4TM0 A;  2WBA A;  2VZ2 A;  1L0V A;  2BK4 A;  1GRB A;  3KPK A;  2XFQ A;  3AE7 A;  1E6E A;  2CFY A;  3NG7 X;  1L9D A;  4H4Q A;  3UKQ A;  3BNU A;  3V3O A;  4A6N B;  4O5Q A;  1VG0 A;  3GYI A;  4IA5 A;  2YR4 A;  5JCM A;  2C3D A;  2VQ7 A;  4M52 A;  4NNJ A;  1RP0 A;  3LOV A;  3CPI G;  1JOA A;  3ICT A;  2EQ7 A;  1NHQ A;  4NTE A;  1TYT A;  1F8S A;  2ZZ0 A;  4D04 A;  1NEN A;  4EM4 A;  4LII A;  2WQY A;  1EL5 A;  3GYX A;  1Q1W A;  3C4A A;  4Z24 A;  5M10 A;  3UCL A;  3NNE A;  4Y4N A;  4A79 A;  4GDE A;  2PHH A;  3AYL A;  2Y6Q A;  2O9Z A;  3GWD A;  3HYX A;  4B64 A;  2ZBW A;  3CNJ A;  2BYB A;  1DOE A;  3ADA B;  2BAC A;  2Q6U A;  3AE4 A;  4H7U A;  1BGJ A;  1O95 A;  1Y56 A;  3WE0 A;  4DNA A;  4H50 A;  2BXR A;  5KXJ A;  3NKS A;  3UOV A;  1PJ6 A;  4GR1 A;  2C3C A;  1JRX A;  1PDH A;  1D4E A;  1M64 A;  3DA1 A;  1V59 A;  2X3N A;  3P4S A;  3P4P A;  3QVP A;  1NPX A;  2H89 A;  3UOZ A;  1JU2 A;  1CF3 A;  2C72 A;  2GR1 A;  3AEB A;  3AD9 B;  5FS8 A;  1D5T A;  3IF9 A;  4GAP A;  4XWR A;  1ZMD A;  2ZZB A;  2WHD A;  4WX1 A;  1O94 A;  2FJA A;  3SYI A;  3DK9 A;  1CJ4 A;  3D8X A;  1QO8 A;  4FK1 C;  2YG6 A;  3CGE A;  2XFO A;  1KNP A;  3NIX A;  2GR3 A;  4H4Z A;  3IHM A;  3SY4 A;  4NTC A;  4C3X A;  4Z26 A;  4YT0 A;  2V60 A;  4J36 A;  4JY2 A;  2E4G A;  2WPC A;  4ZCD A;  5EBK A;  1HYU A;  5FMH A;  5FS6 A;  1AOG A;  5JCI A;  2X8G A;  1NEK A;  1ZOY A;  2C65 A;  2YLS A;  1GEU A;  2C7G A;  4PAB A;  4YTP A;  3LXD A;  1NDA A;  4GRT A;  4AP1 A;  4CRT A;  2AAQ A;  5HYM A;  1JEH A;  3R9U A;  2GRT A;  4K5S A;  1E1L A;  2B9W A;  1IUT A;  2YR5 A;  5L46 A;  4NEW A;  2BK5 A;  4XWZ A;  3RP8 A;  4J33 A;  1NG4 A;  3SZW A;  3QFA A;  4G74 A;  4J31 A;  2VQB A;  3FIM B;  4H2P A;  1D4C A;  2GEW A;  4H4W A;  2YLT A;  3VRA A;  2BCG G;  3NHO X;  2BXS A;  1FL2 A;  4II2 A;  1VQW A;  1D7Y A;  2V6O A;  4B68 A;  1B5Q A;  2CDU A;  2VVL G;  3ITJ A;  3AE3 A;  4EQX A;  1NHR A;  3DGZ A;  1ZX9 A;  3NGC X;  3RED A;  5IPY A;  3F8P A;  1PBE A;  3QJ4 A;  1VRQ B;  4A65 A;  5KMR A;  2VRL A;  4CNJ A;  3BHF A;  4GDP A;  3EAO A;  2QA1 A;  3P1W A;  4FX9 A;  3II4 A;  1LQT A;  3T0K A;  3IWA A;  3T14 A;  4EMJ A;  2WES A;  3QSS A;  1N4V A;  3UOX A;  3GMC A;  4JN9 A;  3NK0 X;  3ATQ A;  2QCU A;  5M0Z A;  3CPH G;  4K22 A;  4OPL A;  2NPX A;  3AEE A;  4B66 A;  4YTN A;  2XVH A;  2XVJ A;  3DJE A;  4H2Q A;  3H8I A;  5EB4 A;  1LV0 A;  3EPT A;  3PVC A;  2YG3 A;  2EQ9 A;  4JDR A;  4II3 A;  2CVJ A;  4IV9 A;  1BF3 A;  4H4X A;  2R9Z A;  2WP6 A;  3L8K A;  1GSN A;  5C2T A;  1YY5 A;  1P2H A;  4OPT A;  2C67 A;  1LPF A;  1VDC A;  4RG3 A;  5CQF A;  3AWI A;  4AT0 A;  3JSK A;  3ALL A;  3C4N A;  2YAU A;  4U8I A;  2JAE A;  1TDF A;  1XAN A;  2IVE A;  4HB9 A;  2V3B A;  2C66 A;  3SX6 A;  1N4W A;  5KVI A;  4B69 A;  5HY5 A;  2WOI A;  4LU6 A;  4B1B A;  3NTA A;  4CCQ A;  4YSY A;  3EF6 A;  4G6G A;  4CCR A;  3KD9 A;  5KNL A;  4G6H A;  4NEV A;  4USQ A;  1IUX A;  3BI4 A;  3LB8 A;  2YLZ A;  1W4X A;  1DJQ A;  3HZL A;  2RGJ A;  4WCT A;  3SGL A;  4JY3 A;  2Z5X A;  2AQJ A;  2BC0 A;  2A87 A;  5HXI A;  4REK A;  1PBF A;  1S3B A;  4UDQ A;  3DME A;  3UKH A;  4C5O A;  1YQ3 A;  2V5Z A;  4OPI A;  1EL7 A;  2JBV A;  2WOW A;  2YWL A;  4OPC A;  3SFD A;  4I59 A;  2X50 A;  1Z6L A;  4K5R A;  1XPQ A;  4B65 A;  1S2Q A;  4H4U A;  2C70 A;  1BZL A;  2UZZ A;  1CJ3 A;  1K0I A;  1PJ7 A;  3GDP A;  4GUV A;  5U1O A;  3SQP A;  1L9E A;  4P9S A;  3K7M X;  2F5Z A;  3UTG A;  1F6M A;  2X99 A;  2C73 A;  3UP4 A;  3GRS A;  4AP3 A;  4CBQ A;  3AE8 A;  1Q9I A;  1SEZ A;  2ZZC A;  4NWZ A;  4ICY A;  1Q1R A;  3HYW A;  3BI2 A;  2JB3 A;  2RGH A;  2NVK X;  2OLO A;  2XFU A;  4TM4 A;  2V3A A;  5IQ1 A;  3F8D A;  3AE9 A;  3H4K A;  3S61 A;  3SFE A;  4AOS A;  4C3Y A;  3L1R A;  3VR8 A;  1D7L A;  4U2S A;  1JNZ A;  4Y4L A;  2BRY A;  3ICR A;  3KLJ A;  2R4E A;  4TM1 A;  3AXB A;  5JCK A;  1GRE A;  2APG A;  2XYO A;  3BI5 A;  3GWF A;  2XLP A;  1IUW A;  2BCP A;  1PXA A;  2H88 A;  4IA6 A;  2R4J A;  1H7W A;  2HQM A;  3ICS A;  1GRG A;  1DOB A;  4Y4M A;  2YLX A;  3AEA A;  4B67 A;  2WOV A;  1GRA A;  1REO A;  3CN8 A;  2GMH A;  3AE5 A;  3G5S A;  4H4V A;  2GVC A;  1F8R A;  3M12 A;  1H83 A;  1PS9 A;  2B76 A;  1NAA A;  3GD3 A;  3NT6 A;  4H4T A;  4TLX A;  4B63 A;  4EQS A;  3DJD A;  5IQ4 A;  3P4R A;  1FEA A;  5KMS A;  1ZY8 A;  3DGH A;  5BUK A;  4BV6 A;  1PHH A;  4EM3 A;  3NTD A;  1VG9 A;  3K30 A;  5J7X A;  2R0G A;  2TMD A;  1X31 B;  2A8X A;  4A99 A;  4BUR A;  2XFP A;  1TDE A;  3GYJ A;  4FDC B;  2IID A;  1B8S A;  1ONF A;  4AOX A;  3UKP A;  5KMQ A;  2GR0 A;  3RP6 A;  3PO7 A;  3CMM A;  2Q0L A;  3T2K A;  2E1M A;  4OVI A;  4JQ9 A;  1COY A;  1H86 A;  2PYX A;  5DBJ A;  1PXB A;  2OA1 A;  3SZ0 A;  3SZF A;  2OAL A;  1K0L A;  3NYC A;  4X9N A;  3KKJ A;  4J56 A;  3ALM A;  1L9C A;  2GV8 A;  1F3P A;  3ABV A;  4U8L A;  1FCD A;  2CUL A;  2WU5 A;  3SM8 A;  5LV9 A;  4N9X A;  2A89 A;  1IJH A;  2Q7V A;  4NZH A;  1EL8 A;  1IUS A;  1PJ5 A;  1GND A;  5GSN A;  2E5V A;  4H4Y A;  4DGK A;  4H4P A;  1JRY A;  2B7S A;  1ZOV A;  3AD8 B;  3M13 A;  2JK6 A;  2YVG A;  4U8K A;  5KRQ A;  3NN0 X;  1NG3 A;  3AEF A;  2YVJ A;  4O5U A;  1OJD A;  2V61 A;  4JNA A;  4H4S A;  4A6N A;  1CJC A;  3FPZ A;  2YLW A;  2BS3 A;  1KDG A;  3LJP A;  4H4R A;  5U63 A;  3D1C A;  2C75 A;  2X8C A;  2YVF A;  3GSI A;  3T31 A;  2WPF A;  1E1N A;  1OJT A;  3IHG A;  2RGO A;  4YSH A;  1B4V A;  3LAD A;  1ZDL A;  4YKG A;  3DH9 A;  3P4Q A;  4ECH A;  1EBD A;  4A9W A;  5JCL A;  1KF6 A;  4GF7 A;  1LJ1 A;  2OLN A;  1KNR A;  2VVL A;  2YG7 A;  3LZX A;  5FS7 A;  4DSG A;  2XDO A;  4RSL A;  2OAM A;  4J34 A;  2WDQ A;  2GB0 A;  3B6D A;  1EL9 A;  3B3R A;  4OPU A;  4BK3 A;  3CGD A;  4FK1 A;  2EQ8 A;  1KFY A;  1JNR A;  3CNP A;  5BUL A;  5GRT A;  1CHU A;  3PS9 A;  2GH5 A;  4EIQ A;  4YWO A;  3CPJ G;  4K8D A;  1QJD A;  2GMJ A;  1RSG A;  4OCG A;  3UTE A;  2Y6R A;  1H6V A;  5KVH A;  2FJD A;  4APN A;  1E1M A;  3AB1 A;  3BNM A;  3Q9T A;  5FS9 A;  3NYF A;  3GDN A;  2WEU A;  4UDP A;  2BS4 A;  5CKU A;  2YR6 A;  3K7T A;  4K7Z A;  2XLT A;  1N4U A;  1K0J A;  3CIR A;  3QSM A;  2YQU A;  3ATR A;  3H8L A;  4U8N A;  1IUV A;  3AED A;  3ALJ A;  3RHA A;  4CY8 A;  5HHF A;  1CBO A;  3ISH A;  2C64 A;  4ZN0 A;  2I0Z A;  5J60 A;  2YM2 A;  1H84 A;  1GXF A;  4Z2U A;  3KPF A;  1K4Q A;  3EAN A;  4USR A;  1ELI A;  4UP3 A;  3UKA A;  1TYP A;  3AE2 A;  1BKW A;  2BC1 A;  3UOY A;  2QA2 A;  3ZYX A;  1M6I A;  4KPR A;  4KX6 A;  1KSS A;  3FG2 P;  1P2E A;  1NHS A;  2B9X A;  5C3J A;  2WU2 A;  2RAB A;  1GET A;  4ZCC A;  4H2N A;  3DJJ A;  2R46 A;  4J57 A;  1FOH A;  3LZW A;  3SZC A;  3VRB A;  3UKF A;  3DK4 A;  1GTH A;  2WDR A;  4BK2 A;  3GMB A;  3I3L A;  3AD7 B;  3NN6 X;  3COX A;  3FMW A;  1GRH A;  3F8R A;  4G9K A;  4H2R A;  3KVE A;  2XCG A;  3NLC A;  3GRT A;  3UTF A;  3AYI A;  4UDR A;  3AE6 A;  2DKI A;  3AYJ A;  1DOC A;  2WET A;  4IVM B;  1GV4 A;  2DKH A;  1GPE A;  3AEG A;  1S2Y A;  1YQZ A;  1JRZ A;  1QLB A;  4YSZ A;  3CNS A;  1OJA A;  3NRN A;  2WPE A;  4X9M A;  3NK1 X;  2XLR A;  3RNM A;  4U8O A;  2JKC A;  1FEC A;  2FJB A;  2VOU A;  4U8M A;  1GAL A;  3K7Q X;  3E1T A;  1E1K A;  1ZKQ A;  1CC4 A;  3FBS A;  3KA7 A;  1GOS A;  1N1P A;  2C76 A;  4NTD A;  3URH A;  1E39 A;  1GT8 A;  4J2W A;  3T2Z A;  2BRA A;  4BJY A;  2ARD A;  1ZP0 A;  4OPG A;  4PAA A;  1CC6 A;  1ZMC A;  2GAH B;  4A5L A;  1O5W A;  1FEB A;  2GQF A;  4EQW A;  4E0V A;  2WS3 A;  1Y56 B;  3VRD B;  1BWC A;  3IC9 A;  2GQW A;  5BRT A;  1B37 A;  2JB1 A;  5KWF A;  1KSU A;  1OJ9 A;  3T2Y A;  5KMP A;  4JNQ A;  2B7R A;  4HA6 A;  3RP7 A;  2BAB A;  3HYV A;  1LTX R;  4GCM A;  1E7P A;  5U25 A;  2C4C A;  4U2L A;  1GER A;  2X8H A;  1PBC A;  3QFB A;  2J3N A;  1BGN A;  4Z25 A;  1H81 A;  4BK1 A;  2YG4 A;  4OPD A;  2R45 A;  3CTY A;  3CGB A;  5TR3 A;  1DJN A;  4A7A A;  4K2X A;  4GAV A;  4MJW A;  2Z5Y A;  5EOW A;  3UTH A;  1GES A;  1MXT A;  3Q6J A;  4C77 A;  4Z2T A;  4I58 A;  5BVA A;  4YSX A;  1DNC A;  4LA1 A;  1YKJ A;  1PXC A;  3M0O A;  1LQU A;  3G5Q A;  4CNK A;  2ACZ A;  3UKK A;  2WDV A;  2EQ6 A;  1RYI A;  4YKF A;  3SXI A;  1XDI A;  4TM3 A;  4YXD A;  5KOX A;  4AT2 A;  1IUU A;  3ZDN A;  1DOD A;  2XFN A;  3CGC A;  3QVR A;  1GRT A;  1PN0 A;  5ER0 A;  1CJ2 A;  1TDN A;  2TPR A;  4Z44 A;  4CY6 A;  2XVE A;  3NK2 X;  4RG4 A;  3S5W A;  3OZ2 A;  1MOK A;  3P9U A;  3O0H A;  2FBW A;  1CC2 A;  2W0H A;  1GTE A;  4XXG A;  2VRM A;  1MO9 A;  3QSE A;  2YM1 A;  1GRF A;  3NYE A;  3OC4 A;  3V76 A;  3C96 A;  3I6D A;  4U2T A;  2XVF A;  3DK8 A;  4Z2R A;  1PBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...