3K7MX

Crystal structure of 6-hydroxy-l-nicotine oxidase from arthrobacter nicotinovorans
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
425
structure length
425
Chain Sequence
MYDAIVVGGGFSGLKAARDLTNAGKKVLLLEGGERLGGRAYSRESRNVPGLRVEIGGAYLHRKHHPRLAAELDRYGIPTAAASEFTSFRHRLGPTAVDQAFPIPGSEAVAVEAATYTLLRDAHRIDLEKGLENQDLEDLDIPLNEYVDKLDLPPVSRQFLLAWAWNMLGQPADQASALWMLQLVAAHHYSILGVVLSLDEVFSNGSADLVDAMSQEIPEIRLQTVVTGIDQSGDVVNVTVKDGHAFQAHSVIVATPMNTWRRIVFTPALPERRRSVIEEGHGGQGLKILIHVRGAEAGIECVGDGIFPTLYDYCEVSESERLLVAFTDSGSFDPTDIGAVKDAVLYYLPEVEVLGIDYHDWIADPLFEGPWVAPRVGQFSRVHKELGEPAGRIHFVGSDVSLEFPGYIEGALETAECAVNAILHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords 6-hydroxy-L-nicotine oxidase
publication title Crystal Structure Analysis of Free and Substrate-Bound 6-Hydroxy-l-Nicotine Oxidase from Arthrobacter nicotinovorans.
pubmed doi rcsb
source organism Arthrobacter nicotinovorans
total genus 146
structure length 425
sequence length 425
ec nomenclature ec 1.5.3.5: (S)-6-hydroxynicotine oxidase.
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3k7mX01
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 3k7mX02
2JK6A 2R9ZA 3AE2A 1ZOVA 1LV0A 2RGJA 2ZBWA 3AE8A 2Q0KA 3GD3A 2XVFA 4IA5A 4J57A 3LJPA 1NHPA 2R45A 3GRSA 4AT2A 3UKKA 1DOEA 4J56A 2RGOA 2B9YA 4OCGA 3R9UA 2I0ZA 5CKUA 1GESA 4NTEA 1MXTA 1YQZA 2C75A 4Y4LA 3Q6JA 1D5TA 2GR0A 4DNAA 1W4XA 1CC2A 1ZKQA 2C67A 3P4SA 3CGDA 2GAGB 5BUKA 4Z43A 4H4TA 4YSXA 5JCKA 2BS2A 4EQSA 4H4UA 4LA1A 3UKLA 3QVPA 2ARDA 4TM4A 1H7XA 4GUVA 4X9NA 4OPDA 1REOA 1GEUA 2X8HA 2WHDA 3FG2P 2Q7VA 2XVIA 5ER0A 3UTGA 2TPRA 4JY3A 1O95A 2GMJA 4M52A 2IVDA 4H50A 3C4AA 4DSGA 1JRYA 4YTPA 5HXIA 4LU6A 1B5QA 3OC4A 2CDUA 3VR9A 4B65A 1Q1WA 3IHGA 4CBQA 2C3CA 4OPTA 1M64A 2WP5A 4P9SA 2UZZA 4TLZA 2JAEA 2FJBA 2YLWA 2F5ZA 3KLJA 2DKHA 3ISHA 2V60A 5U63A 1GV4A 1IUXA 2XLRA 4NEWA 4H4YA 3AE5A 1FCDA 1PJ7A 3K30A 3LXDA 1GALA 4U2LA 1FEBA 2JKCA 4B69A 2AAQA 3EAOA 3F8DA 3S61A 1PBDA 2FJEA 2J3NA 2RABA 3UKQA 2OLOA 2XFOA 3SM8A 1DNCA 3EPTA 2YG5A 4AT0A 1H6VA 3G5SA 1TDNA 1NHRA 2ZZ0A 3ALLA 4J31A 1VDCA 1TYPA 4EMIA 4EQRA 4GF7A 1FECA 1NENA 5FMHA 3REDA 4KPRA 1EL7A 3NTAA 4TM3A 2VRLA 3ICSA 4Y4NA 2B9WA 1QO8A 2O9ZA 1OJCA 1M6IA 4A6NB 2X99A 4H4PA 4JN9A 2WETA 3S5WA 3SQPA 1B37A 3SFDA 1PBFA 3AEDA 3AE9A 4B63A 2AR8A 1N4VA 1ZDLA 4K7ZA 4OVIA 4A6NA 4U8OA 4XWRA 4C5OA 1BWCA 2GRTA 4FK1A 3NYFA 2WPFA 1ZOYA 2ZZBA 4FX9A 3P9UA 3CNTA 4A7AA 5KVHA 2C66A 2BXRA 1L9DA 5EB4A 4DSHA 5JCLA 1E6EA 2YR6A 3B6DA 2V3BA 1YKJA 2IVEA 3BNMA 4D04A 2AQJA 2WS3A 4J2WA 1OJAA 4YSHA 3PVCA 3BI4A 2EQ9A 3H8LA 2JB1A 3QSEA 3PS9A 2GR1A 1B4VA 3KVEA 4OPGA 2R0CA 3UOYA 3AYIA 3UOXA 3AE1A 3CPJG 4IV9A 1CBOA 1GPEA 2CFYA 2JB2A 3AD9B 2PHHA 1GXFA 3DJGX 4GRTA 2WDQA 3AECA 1CL0A 3UOZA 2YAUA 3ICRA 3IWAA 3L8KA 3L1RA 1COYA 3AD8B 2WOWA 2YVJA 2YR4A 3GD4A 4NTDA 2DKIA 3AE3A 3LB8A 3LZXA 1XANA 2XDOA 4H2NA 4PABA 3ZDNA 1TDKA 3HZLA 2BABA 2OA1A 1NG3A 3AE4A 2CULA 4UDRA 2NVKX 3AEFA 4AOSA 4CNKA 4EQWA 4EM3A 2RGHA 1K0IA 2VVLG 2WEUA 3NRNA 4BJYA 1N1PA 2WPEA 3AE7A 3IC9A 4BK3A 5JCIA 4B1BA 1PXCA 3UKFA 4FDCB 1EBDA 1ZP0A 3AEGA 3CN8A 5TR3A 5JCMA 1RP0A 2XLUA 3NN0X 3KKJA 4EIQA 4REKA 3WE0A 4RG4A 4ZCDA 1GREA 1MO9A 1XPQA 3QJ4A 4A65A 2GR3A 1GRFA 2C70A 1PXAA 3SGLA 1BKWA 4Z2UA 2GVCA 4X4JA 1F8WA 3RHAA 4BJZA 3LZWA 3DK8A 3BHFA 3NIXA 2XVHA 3O0HA 4TM0A 2YLRA 3AWIA 2APGA 3DK4A 4UDPA 1FEAA 1RYIA 1N4UA 4YTNA 2A87A 3DGZA 2YG7A 2A89A 1GERA 2CVJA 3UP4A 4N9XA 4AP1A 5L46A 2ACZA 4WCTA 1IUUA 4ZCCA 2BXSA 3QSSA 3SFEA 1ZX9A 4EMWA 2Y6RA 3NTDA 1OJTA 3URHA 1GRTA 3II4A 2OALA 3AD7B 2BYBA 1H84A 5BRTA 3E1TA 3UCLA 4YTMA 4USQA 1ZY8A 4FK1C 1F8SA 2YR5A 1OJ9A 3QVRA 1JNRA 4HB9A 4USRA 3CGEA 3F8PA 1VQWA 3M12A 3UTHA 2WU2A 2XFUA 1O5WA 1TDFA 1YY5A 2C72A 5BVAA 1Q9IA 1EL9A 3DK9A 4IVOB 3VQRA 2R0PA 1XDIA 2WOVA 2BC0A 1Y0PA 2XFQA 3DMEA 3OZ2A 4C77A 1VRQB 1O94A 1RSGA 3FIMB 1PHHA 2Y6QA 2PYXA 3KPFA 2YM1A 1D4EA 4GR1A 4HA6A 2XCGA 3NT6A 5M10A 2BK4A 4JY2A 4JNQA 4X9MA 2R0GA 2X8CA 4EQXA 4B64A 4YSYA 2X50A 3T37A 1LQUA 3FPZA 4GDPA 4A99A 2BS3A 3BNUA 2GAHB 1P2HA 1CC4A 4UP3A 1DJQA 1F3PA 4NEVA 1PJ6A 4NZHA 5U1OA 1PJ5A 2V61A 2BCGG 1GSNA 2GF3A 1FL2A 1H82A 3IHMA 1YQ3A 4CCQA 1JOAA 2C3DA 1NDAA 2C73A 3EANA 2V5ZA 4H4VA 1KF6A 1PXBA 1DXLA 1FOHA 3DH9A 4EIPA 4CCRA 3NKSA 3P1WA 4H2QA 1K0JA 1GRBA 3NK1X 1F8RA 3NHOX 5M0ZA 3UKPA 3NG7X 1DODA 4CNJA 2B9XA 4ECHA 1ONFA 1X31B 2Q6UA 2XLPA 1BF3A 5KRQA 4CY8A 3QFBA 1MOKA 2Z5XA 5IPYA 3NYCA 3ALJA 5FS8A 5JCNA 3D8XA 5U25A 2QAEA 2VQ7A 4WX1A 2EQ6A 4U8MA 2VRMA 3CNDA 4RSLA 1NHSA 1NPXA 1K0LA 2GH5A 3B3RA 3NK2X 4B67A 4Z26A 4TM1A 1GETA 2YLZA 2YQUA 3CGBA 3FBSA 3RP7A 1BGNA 2JBVA 1E39A 1NG4A 2GR2A 4D03A 4H4WA 1H86A 4Z25A 4H4RA 5KVIA 5C3JA 4H4XA 4EM4A 4OPIA 3V3OA 1KNRA 3JSKA 1CHUA 2EQ8A 1GTHA 1VG9A 5FS9A 1F6MA 2YG6A 3C96A 2YG3A 3VRBA 1S3BA 3I6DA 1VG0A 3ATRA 3NNEA 4B68A 2R46A 2C65A 3CIRA 4YWOA 4J36A 3AEAA 5KOWA 1KDGA 5KWFA 5J7XA 1KSUA 1Q1RA 1CJCA 2NPXA 4YKFA 1GOSA 5HY5A 1Z6LA 5J60A 5IQ4A 2H88A 2WP9A 4Y4MA 1PBCA 3UKHA 2FJDA 1DOBA 4JQ9A 3KD9A 1GRHA 1IJHA 2C76A 2XFPA 2WDVA 5CQFA 2V3AA 1PDHA 4U8IA 5BULA 1QJDA 1E1LA 2YLSA 4H4ZA 5C2TA 1TYTA 5FS6A 1IUTA 4E0VA 3ITJA 4K22A 4IVMB 1D7LA 1KNPA 1E1NA 3NGCX 3CNPA 4RG3A 3ZYXA 2BCPA 1JU2A 3FMWA 1QLBA 1IUWA 1E7PA 1CF3A 1S2YA 4Z2RA 1GNDA 3DJJA 4U8KA 3DJEA 1LTXR 4H2PA 1IUVA 4MJWA 3V76A 2XLTA 3GSIA 1ZMCA 2B7SA 3V3NA 1CC6A 4JDRA 4XWZA 5EOWA 3CNJA 4H7UA 1H7WA 3LADA 1GRAA 2QA2A 3GWFA 2WQYA 1TRBA 3AYLA 2XYOA 3P4PA 2W0HA 2VVLA 4XXGA 3AB1A 1PN0A 4A79A 3RP6A 3UTFA 5KOXA 3UP5A 5DBJA 3ALMA 2X8GA 2YWLA 3F8RA 3UTEA 4OPCA 2WU5A 3CNSA 3AE6A 1EL8A 3G5QA 4OPLA 3CPIG 2BACA 2R4EA 4I59A 4B66A 2VQBA 2B7RA 3H4KA 4C3YA 1CJ3A 4U8PA 3CPHG 3UKAA 5GSNA 4IA6A 4PAAA 1GT8A 3D1CA 1H83A 4I58A 1JRZA 1ZMDA 3BI2A 3EF6A 4BV6A 2E1MA 4U8LA 1V59A 2E5VA 2Z5YA 3GMCA 2BS4A 3GRTA 1NHQA 1JEHA 1KSSA 3NH3X 4APNA 4U2SA 2BC1A 1NEKA 3GDPA 5GRTA 4ICYA 3QSMA 1YQ4A 3BI5A 1L0VA 3BHKA 3ABVA 1SEZA 3VRAA 5EBKA 2YM2A 4YSZA 1NAAA 3LOVA 4EMJA 2GQFA 2V6OA 3ICTA 5IQ1A 2TMDA 3COXA 3KU9A 2WDRA 4K5SA 2WBAA 3P4RA 2HQMA 2A8XA 4H4QA 5HYMA 1L9CA 3RP8A 1E1KA 4H4SA 2YLXA 4K8DA 3NN6X 2XLSA 3K7TA 3UOVA 2H89A 3AEEA 3PO7A 5EB5A 2YVGA 3VR8A 4KX6A 1CJ4A 2YVFA 4GCMA 1XHCA 4BK1A 5KXJA 2IIDA 1HYUA 2GMHA 2YLTA 3GYJA 4U8JA 3NYEA 3GWDA 2BK5A 5LV9A 2GEWA 3K7MX 3AEBA 4LIIA 2VVMA 2WP6A 4U8NA 1S3EA 4C74A 4YXDA 3ADAB 1D4DA 1UKVG 1B8SA 2EQ7A 3AXBA 4TLXA 1DOCA 1EL5A 3KA7A 1E1MA 4DGKA 2XVEA 3NK0X 4ADWA 1IUSA 1TDOA 2FBWA 1TDEA 3I3LA 1BGJA 3M13A 2ZZCA 4YKGA 3IF9A 3GMBA 2GQWA 4ZN0A 2BK3A 1PBBA 4BURA 3G5RA 4OPUA 4A5LA 2BA9A 4YT0A 1LVLA 1PBEA 2X3NA 1D4CA 2VOUA 1D7YA 4H2RA 4K5RA 1LJ1A 4UDQA 1LQTA 1JRXA 1L9EA 2WPCA 4U2TA 4C3XA 2FJAA 3NLCA 1P2EA 2XFNA 2R4JA 3H8IA 3M0OA 4K2XA 1GTEA 1LPFA 1ELIA 2YG4A 2VZ2A 2QA1A 3QFAA 3ATQA 3Q9TA 4O5UA 3DA1A 4Z2TA 3C4NA 1GRGA 1S2QA 1OJDA 2GB0A 2XVJA 4AOXA 1KFYA 3CGCA 1CJ2A 3DJDA 4J34A 4CRTA 2B76A 3CTYA 2QCUA 2Q0LA 2OLNA 2OAMA 4A9WA 4CY6A 1JNZA 5HHFA 1H81A 1Y56B 2WESA 2WOIA 3AYJA 4GDEA 4O5QA 1PS9A 3RNMA 1N4WA 4JNAA 3VRDB 1K4QA 1AOGA 4J33A 2C64A 4AP3A 4NTCA 1Y56A 1DJNA 4Z24A 4BK2A 3DGHA 1BZLA 3K7QX 2JB3A 3GYIA 5FS7A 3P4QA 3GDNA 2GV8A 4Z44A 2E4GA 1ZK7A 2C7GA
chains in the Genus database with same CATH superfamily
2JK6A 2R9ZA 3AE2A 1ZOVA 1LV0A 2RGJA 2ZBWA 3AE8A 2Q0KA 3GD3A 2XVFA 4G6HA 4IA5A 3LJPA 1NHPA 4J57A 2R45A 3GRSA 4AT2A 3UKKA 1DOEA 4J56A 2RGOA 2B9YA 4OCGA 3R9UA 2I0ZA 5CKUA 1GESA 4NTEA 1MXTA 1YQZA 2C75A 4Y4LA 3Q6JA 1D5TA 2GR0A 4DNAA 1W4XA 1CC2A 1ZKQA 2C67A 3P4SA 3CGDA 2GAGB 5BUKA 4Z43A 4H4TA 4YSXA 5JCKA 2BS2A 4EQSA 4H4UA 4LA1A 3UKLA 3QVPA 2ARDA 4TM4A 1H7XA 4GUVA 4X9NA 4OPDA 3SZ0A 1REOA 1GEUA 2X8HA 2WHDA 3FG2P 2Q7VA 2XVIA 5ER0A 3UTGA 2TPRA 4JY3A 1O95A 2GMJA 4M52A 2IVDA 4H50A 3C4AA 4DSGA 1JRYA 4YTPA 5HXIA 4LU6A 1B5QA 3OC4A 2CDUA 3VR9A 4B65A 1Q1WA 3IHGA 4CBQA 2C3CA 4OPTA 1M64A 2WP5A 4P9SA 2UZZA 4TLZA 2JAEA 2FJBA 2YLWA 3T2KA 2F5ZA 3KLJA 2DKHA 3ISHA 3SZCA 2V60A 5U63A 1GV4A 1IUXA 2XLRA 4NEWA 4H4YA 3AE5A 1FCDA 1PJ7A 3K30A 3LXDA 1GALA 4U2LA 1FEBA 2JKCA 4B69A 2AAQA 3EAOA 3F8DA 3S61A 1PBDA 2FJEA 2J3NA 2RABA 3UKQA 2OLOA 2XFOA 3SM8A 1DNCA 3EPTA 2YG5A 4AT0A 1H6VA 3G5SA 1TDNA 1NHRA 2ZZ0A 3ALLA 4J31A 1VDCA 1TYPA 4EMIA 4EQRA 4GF7A 1FECA 1NENA 5FMHA 3REDA 4KPRA 1EL7A 3NTAA 4TM3A 2VRLA 3ICSA 4Y4NA 2B9WA 1QO8A 2O9ZA 1OJCA 1M6IA 4A6NB 2X99A 4H4PA 4JN9A 2WETA 3S5WA 3SQPA 1B37A 3SFDA 1PBFA 3AEDA 3AE9A 4B63A 2AR8A 1N4VA 1ZDLA 4K7ZA 4OVIA 4A6NA 4U8OA 4XWRA 4C5OA 1BWCA 2GRTA 4FK1A 3NYFA 2WPFA 4GAPA 1ZOYA 2ZZBA 4FX9A 3P9UA 3CNTA 4A7AA 5KVHA 2C66A 2BXRA 1L9DA 5EB4A 4DSHA 5JCLA 1E6EA 2YR6A 3B6DA 2V3BA 1YKJA 2IVEA 3BNMA 4D04A 2AQJA 2WS3A 4J2WA 1OJAA 4YSHA 3PVCA 3BI4A 2EQ9A 3H8LA 2JB1A 3QSEA 3PS9A 2GR1A 1B4VA 3KVEA 4OPGA 2R0CA 3UOYA 2BRAA 3AYIA 3UOXA 3AE1A 3CPJG 4IV9A 1CBOA 1GPEA 2CFYA 2JB2A 3AD9B 2PHHA 1GXFA 3DJGX 4GRTA 2WDQA 3AECA 1CL0A 3UOZA 2YAUA 3ICRA 3IWAA 3L8KA 3L1RA 1COYA 3AD8B 2WOWA 2YVJA 2YR4A 3GD4A 4NTDA 2DKIA 3AE3A 3LB8A 3LZXA 1XANA 2XDOA 4H2NA 4PABA 3ZDNA 1TDKA 3HZLA 5KNLA 2BABA 2OA1A 1NG3A 3AE4A 2CULA 4UDRA 2NVKX 3AEFA 4AOSA 4CNKA 4EQWA 4EM3A 2RGHA 1K0IA 2VVLG 2WEUA 3NRNA 4BJYA 1N1PA 2WPEA 3AE7A 3IC9A 4BK3A 5JCIA 4B1BA 1PXCA 3UKFA 4FDCB 1EBDA 1ZP0A 3AEGA 3CN8A 5TR3A 3T2YA 5JCMA 1RP0A 2XLUA 3NN0X 3KKJA 4EIQA 4REKA 3WE0A 4RG4A 4ZCDA 3T0KA 1GREA 1MO9A 1XPQA 3QJ4A 4A65A 2GR3A 1GRFA 2C70A 1PXAA 3SGLA 1BKWA 4Z2UA 2GVCA 4X4JA 1F8WA 3GYXA 3RHAA 4BJZA 3LZWA 3DK8A 3BHFA 3NIXA 2XVHA 3O0HA 4TM0A 2YLRA 3AWIA 2APGA 3DK4A 4UDPA 1FEAA 1RYIA 1N4UA 4YTNA 2A87A 3DGZA 2YG7A 2A89A 1GERA 2CVJA 3UP4A 4GAVA 4N9XA 4AP1A 5L46A 2ACZA 4WCTA 1IUUA 4ZCCA 2BXSA 3QSSA 3SFEA 1ZX9A 4EMWA 2Y6RA 3NTDA 1OJTA 3URHA 1GRTA 3II4A 2OALA 3AD7B 2BYBA 1H84A 5BRTA 3E1TA 3UCLA 4YTMA 4USQA 1ZY8A 4FK1C 1F8SA 2YR5A 1OJ9A 3QVRA 1JNRA 4HB9A 4USRA 3CGEA 3F8PA 1VQWA 3M12A 3UTHA 2WU2A 2XFUA 1O5WA 1TDFA 1YY5A 2C72A 5BVAA 1Q9IA 1EL9A 3DK9A 4IVOB 5KMQA 3VQRA 2R0PA 1XDIA 2WOVA 2BC0A 1Y0PA 2XFQA 3DMEA 3OZ2A 3SXIA 4C77A 1VRQB 1O94A 1RSGA 3FIMB 1PHHA 2Y6QA 2PYXA 3KPFA 2YM1A 1D4EA 4GR1A 4HA6A 2XCGA 3NT6A 5M10A 2BK4A 4JY2A 4JNQA 4X9MA 2R0GA 2X8CA 4EQXA 4B64A 4YSYA 2X50A 3T37A 1LQUA 3FPZA 3SZFA 4GDPA 4A99A 2BS3A 3BNUA 2GAHB 1P2HA 1CC4A 4UP3A 3HYWA 1DJQA 1F3PA 4NEVA 1PJ6A 4NZHA 5U1OA 3SY4A 1PJ5A 2V61A 2BCGG 1GSNA 2GF3A 1FL2A 1H82A 3SX6A 3IHMA 1YQ3A 4CCQA 1JOAA 2C3DA 1NDAA 2C73A 3EANA 2V5ZA 4H4VA 1KF6A 3T14A 1PXBA 1DXLA 1FOHA 3DH9A 4EIPA 4CCRA 3NKSA 3P1WA 4H2QA 1K0JA 1GRBA 3NK1X 1F8RA 3NHOX 5M0ZA 3UKPA 3NG7X 1DODA 4CNJA 2B9XA 4ECHA 1ONFA 1X31B 2Q6UA 2XLPA 1BF3A 5KRQA 4CY8A 3QFBA 1MOKA 2Z5XA 5IPYA 3NYCA 3ALJA 5FS8A 5JCNA 5KMRA 3D8XA 5U25A 2QAEA 2VQ7A 4WX1A 2EQ6A 4U8MA 5KMPA 2VRMA 3CNDA 4RSLA 3SZWA 1NHSA 1NPXA 1K0LA 2GH5A 3B3RA 3NK2X 4B67A 4Z26A 4TM1A 1GETA 2YLZA 4NWZA 2YQUA 3CGBA 3FBSA 3RP7A 1BGNA 2JBVA 1E39A 1NG4A 3KPKA 3CMMA 2GR2A 4D03A 4H4WA 1H86A 4Z25A 4H4RA 5KVIA 5C3JA 4H4XA 4EM4A 4OPIA 3V3OA 1KNRA 3JSKA 1CHUA 2EQ8A 1GTHA 1VG9A 5FS9A 1F6MA 2YG6A 3C96A 2YG3A 3T31A 3HYXA 3VRBA 1S3BA 3I6DA 4G6GA 1VG0A 3ATRA 3NNEA 4B68A 2R46A 2C65A 3CIRA 4YWOA 4J36A 3AEAA 5KOWA 1KDGA 5KWFA 5J7XA 1KSUA 1Q1RA 1CJCA 2NPXA 4YKFA 1GOSA 5HY5A 1Z6LA 5J60A 5IQ4A 2H88A 2WP9A 4Y4MA 3T2ZA 1PBCA 3UKHA 2FJDA 1DOBA 4JQ9A 3KD9A 1GRHA 1IJHA 2C76A 2XFPA 2WDVA 5CQFA 2V3AA 1PDHA 4U8IA 5BULA 1QJDA 1E1LA 2YLSA 4H4ZA 5C2TA 1TYTA 5FS6A 1IUTA 3HYVA 3ITJA 4E0VA 4K22A 4IVMB 1D7LA 1KNPA 1E1NA 3NGCX 3CNPA 4RG3A 3ZYXA 2BCPA 1JU2A 3FMWA 1QLBA 1IUWA 1E7PA 1CF3A 1S2YA 4Z2RA 1GNDA 3DJJA 4U8KA 3DJEA 1LTXR 4H2PA 1IUVA 4MJWA 3V76A 2XLTA 3GSIA 1ZMCA 2B7SA 3V3NA 1CC6A 4JDRA 4XWZA 5EOWA 3CNJA 4H7UA 1H7WA 3LADA 1GRAA 2QA2A 3GWFA 2WQYA 1TRBA 3AYLA 2XYOA 3P4PA 2W0HA 2VVLA 4XXGA 3AB1A 1PN0A 4A79A 3RP6A 3UTFA 5KOXA 3UP5A 5DBJA 3ALMA 2X8GA 2YWLA 3F8RA 3UTEA 4OPCA 2WU5A 3CNSA 3AE6A 1EL8A 3G5QA 4OPLA 3CPIG 2BACA 2R4EA 4I59A 4B66A 2VQBA 2B7RA 3H4KA 4C3YA 1CJ3A 4U8PA 3CPHG 3UKAA 5GSNA 4IA6A 4PAAA 1GT8A 3D1CA 4G9KA 1H83A 4I58A 1JRZA 1ZMDA 3BI2A 3EF6A 4BV6A 2E1MA 4U8LA 1V59A 2E5VA 2Z5YA 3GMCA 2BS4A 3GRTA 1NHQA 1JEHA 1KSSA 3NH3X 4APNA 4U2SA 2BC1A 1NEKA 3GDPA 4II3A 5GRTA 4ICYA 3QSMA 1YQ4A 3BI5A 1L0VA 3BHKA 3ABVA 1SEZA 3VRAA 5EBKA 2YM2A 4YSZA 1NAAA 3LOVA 4G74A 2GQFA 2V6OA 3ICTA 5IQ1A 2C4CA 4EMJA 2TMDA 3COXA 3KU9A 2WDRA 4K5SA 2WBAA 2BRYA 3P4RA 2HQMA 2A8XA 4H4QA 5HYMA 1L9CA 3RP8A 1E1KA 4H4SA 2YLXA 4K8DA 3NN6X 2XLSA 3K7TA 3UOVA 2H89A 3AEEA 3PO7A 5EB5A 2YVGA 3VR8A 4KX6A 1CJ4A 2YVFA 4GCMA 1XHCA 4BK1A 5KXJA 2IIDA 1HYUA 2GMHA 2YLTA 3GYJA 4U8JA 3NYEA 3GWDA 2BK5A 5LV9A 2GEWA 3K7MX 3AEBA 4LIIA 2VVMA 2WP6A 4U8NA 1S3EA 4C74A 4YXDA 3ADAB 1D4DA 1UKVG 1B8SA 2EQ7A 3AXBA 4TLXA 1DOCA 1EL5A 3KA7A 1E1MA 4DGKA 2XVEA 3NK0X 4ADWA 4G73A 1IUSA 1TDOA 2FBWA 1TDEA 3I3LA 1BGJA 3M13A 2ZZCA 4YKGA 3IF9A 3GMBA 2GQWA 4ZN0A 2BK3A 1PBBA 4BURA 3G5RA 4OPUA 4A5LA 2BA9A 4YT0A 1LVLA 1PBEA 2X3NA 1D4CA 2VOUA 1D7YA 4H2RA 4K5RA 1LJ1A 4UDQA 1LQTA 1JRXA 1L9EA 2WPCA 4U2TA 4C3XA 2FJAA 3NLCA 1P2EA 2XFNA 2R4JA 3H8IA 3M0OA 4K2XA 1GTEA 1LPFA 1ELIA 2YG4A 2VZ2A 2QA1A 3QFAA 3ATQA 3Q9TA 4O5UA 3DA1A 4Z2TA 3C4NA 1GRGA 1S2QA 1OJDA 3SYIA 2GB0A 2XVJA 4AOXA 1KFYA 3CGCA 1CJ2A 3DJDA 4J34A 4NNJA 4CRTA 2B76A 3CTYA 2QCUA 2Q0LA 2OLNA 2OAMA 4A9WA 4CY6A 1JNZA 5HHFA 1H81A 1Y56B 2WESA 2WOIA 3AYJA 4GDEA 4O5QA 1PS9A 3RNMA 1N4WA 4JNAA 3VRDB 1K4QA 1AOGA 4J33A 2C64A 4AP3A 4NTCA 1Y56A 1DJNA 4Z24A 4BK2A 3DGHA 1BZLA 3K7QX 2JB3A 3GYIA 5FS7A 3P4QA 3GDNA 4II2A 2GV8A 4Z44A 2E4GA 5KMSA 1ZK7A 2C7GA
chains in the Genus database with same CATH topology
2JK6A 2R9ZA 3AE2A 1ZOVA 1LV0A 2RGJA 2ZBWA 3AE8A 2Q0KA 3GD3A 2XVFA 4G6HA 4IA5A 3LJPA 1NHPA 4J57A 2R45A 3GRSA 4AT2A 3UKKA 1DOEA 4J56A 2RGOA 2B9YA 4OCGA 3R9UA 2I0ZA 5CKUA 1GESA 4NTEA 1MXTA 1YQZA 2C75A 4Y4LA 3Q6JA 1D5TA 2GR0A 4DNAA 1W4XA 1CC2A 1ZKQA 2C67A 3P4SA 3CGDA 2GAGB 5BUKA 4Z43A 4H4TA 4YSXA 5JCKA 2BS2A 4EQSA 4H4UA 4LA1A 3UKLA 3QVPA 2ARDA 4TM4A 1H7XA 4GUVA 4X9NA 4OPDA 3SZ0A 1REOA 1GEUA 2X8HA 2WHDA 3FG2P 2Q7VA 2XVIA 5ER0A 3UTGA 2TPRA 4JY3A 1O95A 2GMJA 4M52A 2IVDA 4H50A 3C4AA 4DSGA 1JRYA 4YTPA 5HXIA 4LU6A 1B5QA 3OC4A 2CDUA 3VR9A 4B65A 1Q1WA 3IHGA 4CBQA 2C3CA 4OPTA 1M64A 2WP5A 4P9SA 2UZZA 4TLZA 2JAEA 2FJBA 2YLWA 3T2KA 2F5ZA 3KLJA 2DKHA 3ISHA 3SZCA 2V60A 5U63A 1GV4A 1IUXA 2XLRA 4NEWA 4H4YA 3AE5A 1FCDA 1PJ7A 3K30A 3LXDA 1GALA 4U2LA 1FEBA 2JKCA 4B69A 2AAQA 3EAOA 3F8DA 3S61A 1PBDA 2FJEA 2J3NA 2RABA 3UKQA 2OLOA 2XFOA 3SM8A 1DNCA 3EPTA 2YG5A 4AT0A 1H6VA 3G5SA 1TDNA 1NHRA 2ZZ0A 3ALLA 4J31A 1VDCA 1TYPA 4EMIA 4EQRA 4GF7A 1FECA 1NENA 5FMHA 3REDA 4KPRA 1EL7A 3NTAA 4TM3A 2VRLA 3ICSA 4Y4NA 2B9WA 1QO8A 2O9ZA 1OJCA 1M6IA 4A6NB 2X99A 4H4PA 4JN9A 2WETA 3S5WA 3SQPA 1B37A 3SFDA 1PBFA 3AEDA 3AE9A 4B63A 2AR8A 1N4VA 1ZDLA 4K7ZA 4OVIA 4A6NA 4U8OA 4XWRA 4C5OA 1BWCA 2GRTA 4FK1A 3NYFA 2WPFA 4GAPA 1ZOYA 2ZZBA 4FX9A 3P9UA 3CNTA 4A7AA 5KVHA 2C66A 2BXRA 1L9DA 5EB4A 4DSHA 5JCLA 1E6EA 2YR6A 3B6DA 2V3BA 1YKJA 2IVEA 3BNMA 4D04A 2AQJA 2WS3A 4J2WA 1OJAA 4YSHA 3PVCA 3BI4A 2EQ9A 3H8LA 2JB1A 3QSEA 3PS9A 2GR1A 1B4VA 3KVEA 4OPGA 2R0CA 3UOYA 2BRAA 3AYIA 3UOXA 3AE1A 3CPJG 4IV9A 1CBOA 1GPEA 2CFYA 2JB2A 3AD9B 2PHHA 1GXFA 3DJGX 4GRTA 2WDQA 3AECA 1CL0A 3UOZA 2YAUA 3ICRA 3IWAA 3L8KA 3L1RA 1COYA 3AD8B 2WOWA 2YVJA 2YR4A 3GD4A 4NTDA 2DKIA 3AE3A 3LB8A 3LZXA 1XANA 2XDOA 4H2NA 4PABA 3ZDNA 1TDKA 3HZLA 5KNLA 2BABA 2OA1A 1NG3A 3AE4A 2CULA 4UDRA 2NVKX 3AEFA 4AOSA 4CNKA 4EQWA 4EM3A 2RGHA 1K0IA 2VVLG 2WEUA 3NRNA 4BJYA 1N1PA 2WPEA 3AE7A 3IC9A 4BK3A 5JCIA 4B1BA 1PXCA 3UKFA 4FDCB 1EBDA 1ZP0A 3AEGA 3CN8A 5TR3A 3T2YA 5JCMA 1RP0A 2XLUA 3NN0X 3KKJA 4EIQA 4REKA 3WE0A 4RG4A 4ZCDA 3T0KA 1GREA 1MO9A 1XPQA 3QJ4A 4A65A 2GR3A 1GRFA 2C70A 1PXAA 3SGLA 1BKWA 4Z2UA 2GVCA 4X4JA 1F8WA 3GYXA 3RHAA 4BJZA 3LZWA 3DK8A 3BHFA 3NIXA 2XVHA 3O0HA 4TM0A 2YLRA 3AWIA 2APGA 3DK4A 4UDPA 1FEAA 1RYIA 1N4UA 4YTNA 2A87A 3DGZA 2YG7A 2A89A 1GERA 2CVJA 3UP4A 4GAVA 4N9XA 4AP1A 5L46A 2ACZA 4WCTA 1IUUA 4ZCCA 2BXSA 3QSSA 3SFEA 1ZX9A 4EMWA 2Y6RA 3NTDA 1OJTA 3URHA 1GRTA 3II4A 2OALA 3AD7B 2BYBA 1H84A 5BRTA 3E1TA 3UCLA 4YTMA 4USQA 1ZY8A 4FK1C 1F8SA 2YR5A 1OJ9A 3QVRA 1JNRA 4HB9A 4USRA 3CGEA 3F8PA 1VQWA 3M12A 3UTHA 2WU2A 2XFUA 1O5WA 1TDFA 1YY5A 2C72A 5BVAA 1Q9IA 1EL9A 3DK9A 4IVOB 5KMQA 3VQRA 2R0PA 1XDIA 2WOVA 2BC0A 1Y0PA 2XFQA 3DMEA 3OZ2A 3SXIA 4C77A 1VRQB 1O94A 1RSGA 3FIMB 1PHHA 2Y6QA 2PYXA 3KPFA 2YM1A 1D4EA 4GR1A 4HA6A 2XCGA 3NT6A 5M10A 2BK4A 4JY2A 4JNQA 4X9MA 2R0GA 2X8CA 4EQXA 4B64A 4YSYA 2X50A 3T37A 1LQUA 3FPZA 3SZFA 4GDPA 4A99A 2BS3A 3BNUA 2GAHB 1P2HA 1CC4A 4UP3A 3HYWA 1DJQA 1F3PA 4NEVA 1PJ6A 4NZHA 5U1OA 3SY4A 1PJ5A 2V61A 2BCGG 1GSNA 2GF3A 1FL2A 1H82A 3SX6A 3IHMA 1YQ3A 4CCQA 1JOAA 2C3DA 1NDAA 2C73A 3EANA 2V5ZA 4H4VA 1KF6A 3T14A 1PXBA 1DXLA 1FOHA 3DH9A 4EIPA 4CCRA 3NKSA 3P1WA 4H2QA 1K0JA 1GRBA 3NK1X 1F8RA 3NHOX 5M0ZA 3UKPA 3NG7X 1DODA 4CNJA 2B9XA 4ECHA 1ONFA 1X31B 2Q6UA 2XLPA 1BF3A 5KRQA 4CY8A 3QFBA 1MOKA 2Z5XA 5IPYA 3NYCA 3ALJA 5FS8A 5JCNA 5KMRA 3D8XA 5U25A 2QAEA 2VQ7A 4WX1A 2EQ6A 4U8MA 5KMPA 2VRMA 3CNDA 4RSLA 3SZWA 1NHSA 1NPXA 1K0LA 2GH5A 3B3RA 3NK2X 4B67A 4Z26A 4TM1A 1GETA 2YLZA 4NWZA 2YQUA 3CGBA 3FBSA 3RP7A 1BGNA 2JBVA 1E39A 1NG4A 3KPKA 3CMMA 2GR2A 4D03A 4H4WA 1H86A 4Z25A 4H4RA 5KVIA 5C3JA 4H4XA 4EM4A 4OPIA 3V3OA 1KNRA 3JSKA 1CHUA 2EQ8A 1GTHA 1VG9A 5FS9A 1F6MA 2YG6A 3C96A 2YG3A 3T31A 3HYXA 3VRBA 1S3BA 3I6DA 4G6GA 1VG0A 3ATRA 3NNEA 4B68A 2R46A 2C65A 3CIRA 4YWOA 4J36A 3AEAA 5KOWA 1KDGA 5KWFA 5J7XA 1KSUA 1Q1RA 1CJCA 2NPXA 4YKFA 1GOSA 5HY5A 1Z6LA 5J60A 5IQ4A 2H88A 2WP9A 4Y4MA 3T2ZA 1PBCA 3UKHA 2FJDA 1DOBA 4JQ9A 3KD9A 1GRHA 1IJHA 2C76A 2XFPA 2WDVA 5CQFA 2V3AA 1PDHA 4U8IA 5BULA 1QJDA 1E1LA 2YLSA 4H4ZA 5C2TA 1TYTA 5FS6A 1IUTA 3HYVA 3ITJA 4E0VA 4K22A 4IVMB 1D7LA 1KNPA 1E1NA 3NGCX 3CNPA 4RG3A 3ZYXA 2BCPA 1JU2A 3FMWA 1QLBA 1IUWA 1E7PA 1CF3A 1S2YA 4Z2RA 1GNDA 3DJJA 4U8KA 3DJEA 1LTXR 4H2PA 1IUVA 4MJWA 3V76A 2XLTA 3GSIA 1ZMCA 2B7SA 3V3NA 1CC6A 4JDRA 4XWZA 5EOWA 3CNJA 4H7UA 1H7WA 3LADA 1GRAA 2QA2A 3GWFA 2WQYA 1TRBA 3AYLA 2XYOA 3P4PA 2W0HA 2VVLA 4XXGA 3AB1A 1PN0A 4A79A 3RP6A 3UTFA 5KOXA 3UP5A 5DBJA 3ALMA 2X8GA 2YWLA 3F8RA 3UTEA 4OPCA 2WU5A 3CNSA 3AE6A 1EL8A 3G5QA 4OPLA 3CPIG 2BACA 2R4EA 4I59A 4B66A 2VQBA 2B7RA 3H4KA 4C3YA 1CJ3A 4U8PA 3CPHG 3UKAA 5GSNA 4IA6A 4PAAA 1GT8A 3D1CA 4G9KA 1H83A 4I58A 1JRZA 1ZMDA 3BI2A 3EF6A 4BV6A 2E1MA 4U8LA 1V59A 2E5VA 2Z5YA 3GMCA 2BS4A 3GRTA 1NHQA 1JEHA 1KSSA 3NH3X 4APNA 4U2SA 2BC1A 1NEKA 3GDPA 4II3A 5GRTA 4ICYA 3QSMA 1YQ4A 3BI5A 1L0VA 3BHKA 3ABVA 1SEZA 3VRAA 5EBKA 2YM2A 4YSZA 1NAAA 3LOVA 4G74A 2GQFA 2V6OA 3ICTA 5IQ1A 2C4CA 4EMJA 2TMDA 3COXA 3KU9A 2WDRA 4K5SA 2WBAA 2BRYA 3P4RA 2HQMA 2A8XA 4H4QA 5HYMA 1L9CA 3RP8A 1E1KA 4H4SA 2YLXA 4K8DA 3NN6X 2XLSA 3K7TA 3UOVA 2H89A 3AEEA 3PO7A 5EB5A 2YVGA 3VR8A 4KX6A 1CJ4A 2YVFA 4GCMA 1XHCA 4BK1A 5KXJA 2IIDA 1HYUA 2GMHA 2YLTA 3GYJA 4U8JA 3NYEA 3GWDA 2BK5A 5LV9A 2GEWA 3K7MX 3AEBA 4LIIA 2VVMA 2WP6A 4U8NA 1S3EA 4C74A 4YXDA 3ADAB 1D4DA 1UKVG 1B8SA 2EQ7A 3AXBA 4TLXA 1DOCA 1EL5A 3KA7A 1E1MA 4DGKA 2XVEA 3NK0X 4ADWA 4G73A 1IUSA 1TDOA 2FBWA 1TDEA 3I3LA 1BGJA 3M13A 2ZZCA 4YKGA 3IF9A 3GMBA 2GQWA 4ZN0A 2BK3A 1PBBA 4BURA 3G5RA 4OPUA 4A5LA 2BA9A 4YT0A 1LVLA 1PBEA 2X3NA 1D4CA 2VOUA 1D7YA 4H2RA 4K5RA 1LJ1A 4UDQA 1LQTA 1JRXA 1L9EA 2WPCA 4U2TA 4C3XA 2FJAA 3NLCA 1P2EA 2XFNA 2R4JA 3H8IA 3M0OA 4K2XA 1GTEA 1LPFA 1ELIA 2YG4A 2VZ2A 2QA1A 3QFAA 3ATQA 3Q9TA 4O5UA 3DA1A 4Z2TA 3C4NA 1GRGA 1S2QA 1OJDA 3SYIA 2GB0A 2XVJA 4AOXA 1KFYA 3CGCA 1CJ2A 3DJDA 4J34A 4NNJA 4CRTA 2B76A 3CTYA 2QCUA 2Q0LA 2OLNA 2OAMA 4A9WA 4CY6A 1JNZA 5HHFA 1H81A 1Y56B 2WESA 2WOIA 3AYJA 4GDEA 4O5QA 1PS9A 3RNMA 1N4WA 4JNAA 3VRDB 1K4QA 1AOGA 4J33A 2C64A 4AP3A 4NTCA 1Y56A 1DJNA 4Z24A 4BK2A 3DGHA 1BZLA 3K7QX 2JB3A 3GYIA 5FS7A 3P4QA 3GDNA 4II2A 2GV8A 4Z44A 2E4GA 5KMSA 1ZK7A 2C7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK6 A;  2R9Z A;  3AE2 A;  1ZOV A;  1LV0 A;  2RGJ A;  2ZBW A;  3AE8 A;  2Q0K A;  3GD3 A;  2XVF A;  4IA5 A;  4J57 A;  3LJP A;  1NHP A;  2R45 A;  3GRS A;  4AT2 A;  3UKK A;  1DOE A;  4J56 A;  2RGO A;  2B9Y A;  4OCG A;  3R9U A;  2I0Z A;  5CKU A;  1GES A;  4NTE A;  1MXT A;  1YQZ A;  2C75 A;  4Y4L A;  3Q6J A;  1D5T A;  2GR0 A;  4DNA A;  1W4X A;  1CC2 A;  1ZKQ A;  2C67 A;  3P4S A;  3CGD A;  2GAG B;  5BUK A;  4Z43 A;  4H4T A;  4YSX A;  5JCK A;  2BS2 A;  4EQS A;  4H4U A;  4LA1 A;  3UKL A;  3QVP A;  2ARD A;  4TM4 A;  1H7X A;  4GUV A;  4X9N A;  4OPD A;  1REO A;  1GEU A;  2X8H A;  2WHD A;  3FG2 P;  2Q7V A;  2XVI A;  5ER0 A;  3UTG A;  2TPR A;  4JY3 A;  1O95 A;  2GMJ A;  4M52 A;  2IVD A;  4H50 A;  3C4A A;  4DSG A;  1JRY A;  4YTP A;  5HXI A;  4LU6 A;  1B5Q A;  3OC4 A;  2CDU A;  3VR9 A;  4B65 A;  1Q1W A;  3IHG A;  4CBQ A;  2C3C A;  4OPT A;  1M64 A;  2WP5 A;  4P9S A;  2UZZ A;  4TLZ A;  2JAE A;  2FJB A;  2YLW A;  2F5Z A;  3KLJ A;  2DKH A;  3ISH A;  2V60 A;  5U63 A;  1GV4 A;  1IUX A;  2XLR A;  4NEW A;  4H4Y A;  3AE5 A;  1FCD A;  1PJ7 A;  3K30 A;  3LXD A;  1GAL A;  4U2L A;  1FEB A;  2JKC A;  4B69 A;  2AAQ A;  3EAO A;  3F8D A;  3S61 A;  1PBD A;  2FJE A;  2J3N A;  2RAB A;  3UKQ A;  2OLO A;  2XFO A;  3SM8 A;  1DNC A;  3EPT A;  2YG5 A;  4AT0 A;  1H6V A;  3G5S A;  1TDN A;  1NHR A;  2ZZ0 A;  3ALL A;  4J31 A;  1VDC A;  1TYP A;  4EMI A;  4EQR A;  4GF7 A;  1FEC A;  1NEN A;  5FMH A;  3RED A;  4KPR A;  1EL7 A;  3NTA A;  4TM3 A;  2VRL A;  3ICS A;  4Y4N A;  2B9W A;  1QO8 A;  2O9Z A;  1OJC A;  1M6I A;  4A6N B;  2X99 A;  4H4P A;  4JN9 A;  2WET A;  3S5W A;  3SQP A;  1B37 A;  3SFD A;  1PBF A;  3AED A;  3AE9 A;  4B63 A;  2AR8 A;  1N4V A;  1ZDL A;  4K7Z A;  4OVI A;  4A6N A;  4U8O A;  4XWR A;  4C5O A;  1BWC A;  2GRT A;  4FK1 A;  3NYF A;  2WPF A;  1ZOY A;  2ZZB A;  4FX9 A;  3P9U A;  3CNT A;  4A7A A;  5KVH A;  2C66 A;  2BXR A;  1L9D A;  5EB4 A;  4DSH A;  5JCL A;  1E6E A;  2YR6 A;  3B6D A;  2V3B A;  1YKJ A;  2IVE A;  3BNM A;  4D04 A;  2AQJ A;  2WS3 A;  4J2W A;  1OJA A;  4YSH A;  3PVC A;  3BI4 A;  2EQ9 A;  3H8L A;  2JB1 A;  3QSE A;  3PS9 A;  2GR1 A;  1B4V A;  3KVE A;  4OPG A;  2R0C A;  3UOY A;  3AYI A;  3UOX A;  3AE1 A;  3CPJ G;  4IV9 A;  1CBO A;  1GPE A;  2CFY A;  2JB2 A;  3AD9 B;  2PHH A;  1GXF A;  3DJG X;  4GRT A;  2WDQ A;  3AEC A;  1CL0 A;  3UOZ A;  2YAU A;  3ICR A;  3IWA A;  3L8K A;  3L1R A;  1COY A;  3AD8 B;  2WOW A;  2YVJ A;  2YR4 A;  3GD4 A;  4NTD A;  2DKI A;  3AE3 A;  3LB8 A;  3LZX A;  1XAN A;  2XDO A;  4H2N A;  4PAB A;  3ZDN A;  1TDK A;  3HZL A;  2BAB A;  2OA1 A;  1NG3 A;  3AE4 A;  2CUL A;  4UDR A;  2NVK X;  3AEF A;  4AOS A;  4CNK A;  4EQW A;  4EM3 A;  2RGH A;  1K0I A;  2VVL G;  2WEU A;  3NRN A;  4BJY A;  1N1P A;  2WPE A;  3AE7 A;  3IC9 A;  4BK3 A;  5JCI A;  4B1B A;  1PXC A;  3UKF A;  4FDC B;  1EBD A;  1ZP0 A;  3AEG A;  3CN8 A;  5TR3 A;  5JCM A;  1RP0 A;  2XLU A;  3NN0 X;  3KKJ A;  4EIQ A;  4REK A;  3WE0 A;  4RG4 A;  4ZCD A;  1GRE A;  1MO9 A;  1XPQ A;  3QJ4 A;  4A65 A;  2GR3 A;  1GRF A;  2C70 A;  1PXA A;  3SGL A;  1BKW A;  4Z2U A;  2GVC A;  4X4J A;  1F8W A;  3RHA A;  4BJZ A;  3LZW A;  3DK8 A;  3BHF A;  3NIX A;  2XVH A;  3O0H A;  4TM0 A;  2YLR A;  3AWI A;  2APG A;  3DK4 A;  4UDP A;  1FEA A;  1RYI A;  1N4U A;  4YTN A;  2A87 A;  3DGZ A;  2YG7 A;  2A89 A;  1GER A;  2CVJ A;  3UP4 A;  4N9X A;  4AP1 A;  5L46 A;  2ACZ A;  4WCT A;  1IUU A;  4ZCC A;  2BXS A;  3QSS A;  3SFE A;  1ZX9 A;  4EMW A;  2Y6R A;  3NTD A;  1OJT A;  3URH A;  1GRT A;  3II4 A;  2OAL A;  3AD7 B;  2BYB A;  1H84 A;  5BRT A;  3E1T A;  3UCL A;  4YTM A;  4USQ A;  1ZY8 A;  4FK1 C;  1F8S A;  2YR5 A;  1OJ9 A;  3QVR A;  1JNR A;  4HB9 A;  4USR A;  3CGE A;  3F8P A;  1VQW A;  3M12 A;  3UTH A;  2WU2 A;  2XFU A;  1O5W A;  1TDF A;  1YY5 A;  2C72 A;  5BVA A;  1Q9I A;  1EL9 A;  3DK9 A;  4IVO B;  3VQR A;  2R0P A;  1XDI A;  2WOV A;  2BC0 A;  1Y0P A;  2XFQ A;  3DME A;  3OZ2 A;  4C77 A;  1VRQ B;  1O94 A;  1RSG A;  3FIM B;  1PHH A;  2Y6Q A;  2PYX A;  3KPF A;  2YM1 A;  1D4E A;  4GR1 A;  4HA6 A;  2XCG A;  3NT6 A;  5M10 A;  2BK4 A;  4JY2 A;  4JNQ A;  4X9M A;  2R0G A;  2X8C A;  4EQX A;  4B64 A;  4YSY A;  2X50 A;  3T37 A;  1LQU A;  3FPZ A;  4GDP A;  4A99 A;  2BS3 A;  3BNU A;  2GAH B;  1P2H A;  1CC4 A;  4UP3 A;  1DJQ A;  1F3P A;  4NEV A;  1PJ6 A;  4NZH A;  5U1O A;  1PJ5 A;  2V61 A;  2BCG G;  1GSN A;  2GF3 A;  1FL2 A;  1H82 A;  3IHM A;  1YQ3 A;  4CCQ A;  1JOA A;  2C3D A;  1NDA A;  2C73 A;  3EAN A;  2V5Z A;  4H4V A;  1KF6 A;  1PXB A;  1DXL A;  1FOH A;  3DH9 A;  4EIP A;  4CCR A;  3NKS A;  3P1W A;  4H2Q A;  1K0J A;  1GRB A;  3NK1 X;  1F8R A;  3NHO X;  5M0Z A;  3UKP A;  3NG7 X;  1DOD A;  4CNJ A;  2B9X A;  4ECH A;  1ONF A;  1X31 B;  2Q6U A;  2XLP A;  1BF3 A;  5KRQ A;  4CY8 A;  3QFB A;  1MOK A;  2Z5X A;  5IPY A;  3NYC A;  3ALJ A;  5FS8 A;  5JCN A;  3D8X A;  5U25 A;  2QAE A;  2VQ7 A;  4WX1 A;  2EQ6 A;  4U8M A;  2VRM A;  3CND A;  4RSL A;  1NHS A;  1NPX A;  1K0L A;  2GH5 A;  3B3R A;  3NK2 X;  4B67 A;  4Z26 A;  4TM1 A;  1GET A;  2YLZ A;  2YQU A;  3CGB A;  3FBS A;  3RP7 A;  1BGN A;  2JBV A;  1E39 A;  1NG4 A;  2GR2 A;  4D03 A;  4H4W A;  1H86 A;  4Z25 A;  4H4R A;  5KVI A;  5C3J A;  4H4X A;  4EM4 A;  4OPI A;  3V3O A;  1KNR A;  3JSK A;  1CHU A;  2EQ8 A;  1GTH A;  1VG9 A;  5FS9 A;  1F6M A;  2YG6 A;  3C96 A;  2YG3 A;  3VRB A;  1S3B A;  3I6D A;  1VG0 A;  3ATR A;  3NNE A;  4B68 A;  2R46 A;  2C65 A;  3CIR A;  4YWO A;  4J36 A;  3AEA A;  5KOW A;  1KDG A;  5KWF A;  5J7X A;  1KSU A;  1Q1R A;  1CJC A;  2NPX A;  4YKF A;  1GOS A;  5HY5 A;  1Z6L A;  5J60 A;  5IQ4 A;  2H88 A;  2WP9 A;  4Y4M A;  1PBC A;  3UKH A;  2FJD A;  1DOB A;  4JQ9 A;  3KD9 A;  1GRH A;  1IJH A;  2C76 A;  2XFP A;  2WDV A;  5CQF A;  2V3A A;  1PDH A;  4U8I A;  5BUL A;  1QJD A;  1E1L A;  2YLS A;  4H4Z A;  5C2T A;  1TYT A;  5FS6 A;  1IUT A;  4E0V A;  3ITJ A;  4K22 A;  4IVM B;  1D7L A;  1KNP A;  1E1N A;  3NGC X;  3CNP A;  4RG3 A;  3ZYX A;  2BCP A;  1JU2 A;  3FMW A;  1QLB A;  1IUW A;  1E7P A;  1CF3 A;  1S2Y A;  4Z2R A;  1GND A;  3DJJ A;  4U8K A;  3DJE A;  1LTX R;  4H2P A;  1IUV A;  4MJW A;  3V76 A;  2XLT A;  3GSI A;  1ZMC A;  2B7S A;  3V3N A;  1CC6 A;  4JDR A;  4XWZ A;  5EOW A;  3CNJ A;  4H7U A;  1H7W A;  3LAD A;  1GRA A;  2QA2 A;  3GWF A;  2WQY A;  1TRB A;  3AYL A;  2XYO A;  3P4P A;  2W0H A;  2VVL A;  4XXG A;  3AB1 A;  1PN0 A;  4A79 A;  3RP6 A;  3UTF A;  5KOX A;  3UP5 A;  5DBJ A;  3ALM A;  2X8G A;  2YWL A;  3F8R A;  3UTE A;  4OPC A;  2WU5 A;  3CNS A;  3AE6 A;  1EL8 A;  3G5Q A;  4OPL A;  3CPI G;  2BAC A;  2R4E A;  4I59 A;  4B66 A;  2VQB A;  2B7R A;  3H4K A;  4C3Y A;  1CJ3 A;  4U8P A;  3CPH G;  3UKA A;  5GSN A;  4IA6 A;  4PAA A;  1GT8 A;  3D1C A;  1H83 A;  4I58 A;  1JRZ A;  1ZMD A;  3BI2 A;  3EF6 A;  4BV6 A;  2E1M A;  4U8L A;  1V59 A;  2E5V A;  2Z5Y A;  3GMC A;  2BS4 A;  3GRT A;  1NHQ A;  1JEH A;  1KSS A;  3NH3 X;  4APN A;  4U2S A;  2BC1 A;  1NEK A;  3GDP A;  5GRT A;  4ICY A;  3QSM A;  1YQ4 A;  3BI5 A;  1L0V A;  3BHK A;  3ABV A;  1SEZ A;  3VRA A;  5EBK A;  2YM2 A;  4YSZ A;  1NAA A;  3LOV A;  4EMJ A;  2GQF A;  2V6O A;  3ICT A;  5IQ1 A;  2TMD A;  3COX A;  3KU9 A;  2WDR A;  4K5S A;  2WBA A;  3P4R A;  2HQM A;  2A8X A;  4H4Q A;  5HYM A;  1L9C A;  3RP8 A;  1E1K A;  4H4S A;  2YLX A;  4K8D A;  3NN6 X;  2XLS A;  3K7T A;  3UOV A;  2H89 A;  3AEE A;  3PO7 A;  5EB5 A;  2YVG A;  3VR8 A;  4KX6 A;  1CJ4 A;  2YVF A;  4GCM A;  1XHC A;  4BK1 A;  5KXJ A;  2IID A;  1HYU A;  2GMH A;  2YLT A;  3GYJ A;  4U8J A;  3NYE A;  3GWD A;  2BK5 A;  5LV9 A;  2GEW A;  3K7M X;  3AEB A;  4LII A;  2VVM A;  2WP6 A;  4U8N A;  1S3E A;  4C74 A;  4YXD A;  3ADA B;  1D4D A;  1UKV G;  1B8S A;  2EQ7 A;  3AXB A;  4TLX A;  1DOC A;  1EL5 A;  3KA7 A;  1E1M A;  4DGK A;  2XVE A;  3NK0 X;  4ADW A;  1IUS A;  1TDO A;  2FBW A;  1TDE A;  3I3L A;  1BGJ A;  3M13 A;  2ZZC A;  4YKG A;  3IF9 A;  3GMB A;  2GQW A;  4ZN0 A;  2BK3 A;  1PBB A;  4BUR A;  3G5R A;  4OPU A;  4A5L A;  2BA9 A;  4YT0 A;  1LVL A;  1PBE A;  2X3N A;  1D4C A;  2VOU A;  1D7Y A;  4H2R A;  4K5R A;  1LJ1 A;  4UDQ A;  1LQT A;  1JRX A;  1L9E A;  2WPC A;  4U2T A;  4C3X A;  2FJA A;  3NLC A;  1P2E A;  2XFN A;  2R4J A;  3H8I A;  3M0O A;  4K2X A;  1GTE A;  1LPF A;  1ELI A;  2YG4 A;  2VZ2 A;  2QA1 A;  3QFA A;  3ATQ A;  3Q9T A;  4O5U A;  3DA1 A;  4Z2T A;  3C4N A;  1GRG A;  1S2Q A;  1OJD A;  2GB0 A;  2XVJ A;  4AOX A;  1KFY A;  3CGC A;  1CJ2 A;  3DJD A;  4J34 A;  4CRT A;  2B76 A;  3CTY A;  2QCU A;  2Q0L A;  2OLN A;  2OAM A;  4A9W A;  4CY6 A;  1JNZ A;  5HHF A;  1H81 A;  1Y56 B;  2WES A;  2WOI A;  3AYJ A;  4GDE A;  4O5Q A;  1PS9 A;  3RNM A;  1N4W A;  4JNA A;  3VRD B;  1K4Q A;  1AOG A;  4J33 A;  2C64 A;  4AP3 A;  4NTC A;  1Y56 A;  1DJN A;  4Z24 A;  4BK2 A;  3DGH A;  1BZL A;  3K7Q X;  2JB3 A;  3GYI A;  5FS7 A;  3P4Q A;  3GDN A;  2GV8 A;  4Z44 A;  2E4G A;  1ZK7 A;  2C7G A; 
#chains in the Genus database with same CATH topology
 2JK6 A;  2R9Z A;  3AE2 A;  1ZOV A;  1LV0 A;  2RGJ A;  2ZBW A;  3AE8 A;  2Q0K A;  3GD3 A;  2XVF A;  4G6H A;  4IA5 A;  3LJP A;  1NHP A;  4J57 A;  2R45 A;  3GRS A;  4AT2 A;  3UKK A;  1DOE A;  4J56 A;  2RGO A;  2B9Y A;  4OCG A;  3R9U A;  2I0Z A;  5CKU A;  1GES A;  4NTE A;  1MXT A;  1YQZ A;  2C75 A;  4Y4L A;  3Q6J A;  1D5T A;  2GR0 A;  4DNA A;  1W4X A;  1CC2 A;  1ZKQ A;  2C67 A;  3P4S A;  3CGD A;  2GAG B;  5BUK A;  4Z43 A;  4H4T A;  4YSX A;  5JCK A;  2BS2 A;  4EQS A;  4H4U A;  4LA1 A;  3UKL A;  3QVP A;  2ARD A;  4TM4 A;  1H7X A;  4GUV A;  4X9N A;  4OPD A;  3SZ0 A;  1REO A;  1GEU A;  2X8H A;  2WHD A;  3FG2 P;  2Q7V A;  2XVI A;  5ER0 A;  3UTG A;  2TPR A;  4JY3 A;  1O95 A;  2GMJ A;  4M52 A;  2IVD A;  4H50 A;  3C4A A;  4DSG A;  1JRY A;  4YTP A;  5HXI A;  4LU6 A;  1B5Q A;  3OC4 A;  2CDU A;  3VR9 A;  4B65 A;  1Q1W A;  3IHG A;  4CBQ A;  2C3C A;  4OPT A;  1M64 A;  2WP5 A;  4P9S A;  2UZZ A;  4TLZ A;  2JAE A;  2FJB A;  2YLW A;  3T2K A;  2F5Z A;  3KLJ A;  2DKH A;  3ISH A;  3SZC A;  2V60 A;  5U63 A;  1GV4 A;  1IUX A;  2XLR A;  4NEW A;  4H4Y A;  3AE5 A;  1FCD A;  1PJ7 A;  3K30 A;  3LXD A;  1GAL A;  4U2L A;  1FEB A;  2JKC A;  4B69 A;  2AAQ A;  3EAO A;  3F8D A;  3S61 A;  1PBD A;  2FJE A;  2J3N A;  2RAB A;  3UKQ A;  2OLO A;  2XFO A;  3SM8 A;  1DNC A;  3EPT A;  2YG5 A;  4AT0 A;  1H6V A;  3G5S A;  1TDN A;  1NHR A;  2ZZ0 A;  3ALL A;  4J31 A;  1VDC A;  1TYP A;  4EMI A;  4EQR A;  4GF7 A;  1FEC A;  1NEN A;  5FMH A;  3RED A;  4KPR A;  1EL7 A;  3NTA A;  4TM3 A;  2VRL A;  3ICS A;  4Y4N A;  2B9W A;  1QO8 A;  2O9Z A;  1OJC A;  1M6I A;  4A6N B;  2X99 A;  4H4P A;  4JN9 A;  2WET A;  3S5W A;  3SQP A;  1B37 A;  3SFD A;  1PBF A;  3AED A;  3AE9 A;  4B63 A;  2AR8 A;  1N4V A;  1ZDL A;  4K7Z A;  4OVI A;  4A6N A;  4U8O A;  4XWR A;  4C5O A;  1BWC A;  2GRT A;  4FK1 A;  3NYF A;  2WPF A;  4GAP A;  1ZOY A;  2ZZB A;  4FX9 A;  3P9U A;  3CNT A;  4A7A A;  5KVH A;  2C66 A;  2BXR A;  1L9D A;  5EB4 A;  4DSH A;  5JCL A;  1E6E A;  2YR6 A;  3B6D A;  2V3B A;  1YKJ A;  2IVE A;  3BNM A;  4D04 A;  2AQJ A;  2WS3 A;  4J2W A;  1OJA A;  4YSH A;  3PVC A;  3BI4 A;  2EQ9 A;  3H8L A;  2JB1 A;  3QSE A;  3PS9 A;  2GR1 A;  1B4V A;  3KVE A;  4OPG A;  2R0C A;  3UOY A;  2BRA A;  3AYI A;  3UOX A;  3AE1 A;  3CPJ G;  4IV9 A;  1CBO A;  1GPE A;  2CFY A;  2JB2 A;  3AD9 B;  2PHH A;  1GXF A;  3DJG X;  4GRT A;  2WDQ A;  3AEC A;  1CL0 A;  3UOZ A;  2YAU A;  3ICR A;  3IWA A;  3L8K A;  3L1R A;  1COY A;  3AD8 B;  2WOW A;  2YVJ A;  2YR4 A;  3GD4 A;  4NTD A;  2DKI A;  3AE3 A;  3LB8 A;  3LZX A;  1XAN A;  2XDO A;  4H2N A;  4PAB A;  3ZDN A;  1TDK A;  3HZL A;  5KNL A;  2BAB A;  2OA1 A;  1NG3 A;  3AE4 A;  2CUL A;  4UDR A;  2NVK X;  3AEF A;  4AOS A;  4CNK A;  4EQW A;  4EM3 A;  2RGH A;  1K0I A;  2VVL G;  2WEU A;  3NRN A;  4BJY A;  1N1P A;  2WPE A;  3AE7 A;  3IC9 A;  4BK3 A;  5JCI A;  4B1B A;  1PXC A;  3UKF A;  4FDC B;  1EBD A;  1ZP0 A;  3AEG A;  3CN8 A;  5TR3 A;  3T2Y A;  5JCM A;  1RP0 A;  2XLU A;  3NN0 X;  3KKJ A;  4EIQ A;  4REK A;  3WE0 A;  4RG4 A;  4ZCD A;  3T0K A;  1GRE A;  1MO9 A;  1XPQ A;  3QJ4 A;  4A65 A;  2GR3 A;  1GRF A;  2C70 A;  1PXA A;  3SGL A;  1BKW A;  4Z2U A;  2GVC A;  4X4J A;  1F8W A;  3GYX A;  3RHA A;  4BJZ A;  3LZW A;  3DK8 A;  3BHF A;  3NIX A;  2XVH A;  3O0H A;  4TM0 A;  2YLR A;  3AWI A;  2APG A;  3DK4 A;  4UDP A;  1FEA A;  1RYI A;  1N4U A;  4YTN A;  2A87 A;  3DGZ A;  2YG7 A;  2A89 A;  1GER A;  2CVJ A;  3UP4 A;  4GAV A;  4N9X A;  4AP1 A;  5L46 A;  2ACZ A;  4WCT A;  1IUU A;  4ZCC A;  2BXS A;  3QSS A;  3SFE A;  1ZX9 A;  4EMW A;  2Y6R A;  3NTD A;  1OJT A;  3URH A;  1GRT A;  3II4 A;  2OAL A;  3AD7 B;  2BYB A;  1H84 A;  5BRT A;  3E1T A;  3UCL A;  4YTM A;  4USQ A;  1ZY8 A;  4FK1 C;  1F8S A;  2YR5 A;  1OJ9 A;  3QVR A;  1JNR A;  4HB9 A;  4USR A;  3CGE A;  3F8P A;  1VQW A;  3M12 A;  3UTH A;  2WU2 A;  2XFU A;  1O5W A;  1TDF A;  1YY5 A;  2C72 A;  5BVA A;  1Q9I A;  1EL9 A;  3DK9 A;  4IVO B;  5KMQ A;  3VQR A;  2R0P A;  1XDI A;  2WOV A;  2BC0 A;  1Y0P A;  2XFQ A;  3DME A;  3OZ2 A;  3SXI A;  4C77 A;  1VRQ B;  1O94 A;  1RSG A;  3FIM B;  1PHH A;  2Y6Q A;  2PYX A;  3KPF A;  2YM1 A;  1D4E A;  4GR1 A;  4HA6 A;  2XCG A;  3NT6 A;  5M10 A;  2BK4 A;  4JY2 A;  4JNQ A;  4X9M A;  2R0G A;  2X8C A;  4EQX A;  4B64 A;  4YSY A;  2X50 A;  3T37 A;  1LQU A;  3FPZ A;  3SZF A;  4GDP A;  4A99 A;  2BS3 A;  3BNU A;  2GAH B;  1P2H A;  1CC4 A;  4UP3 A;  3HYW A;  1DJQ A;  1F3P A;  4NEV A;  1PJ6 A;  4NZH A;  5U1O A;  3SY4 A;  1PJ5 A;  2V61 A;  2BCG G;  1GSN A;  2GF3 A;  1FL2 A;  1H82 A;  3SX6 A;  3IHM A;  1YQ3 A;  4CCQ A;  1JOA A;  2C3D A;  1NDA A;  2C73 A;  3EAN A;  2V5Z A;  4H4V A;  1KF6 A;  3T14 A;  1PXB A;  1DXL A;  1FOH A;  3DH9 A;  4EIP A;  4CCR A;  3NKS A;  3P1W A;  4H2Q A;  1K0J A;  1GRB A;  3NK1 X;  1F8R A;  3NHO X;  5M0Z A;  3UKP A;  3NG7 X;  1DOD A;  4CNJ A;  2B9X A;  4ECH A;  1ONF A;  1X31 B;  2Q6U A;  2XLP A;  1BF3 A;  5KRQ A;  4CY8 A;  3QFB A;  1MOK A;  2Z5X A;  5IPY A;  3NYC A;  3ALJ A;  5FS8 A;  5JCN A;  5KMR A;  3D8X A;  5U25 A;  2QAE A;  2VQ7 A;  4WX1 A;  2EQ6 A;  4U8M A;  5KMP A;  2VRM A;  3CND A;  4RSL A;  3SZW A;  1NHS A;  1NPX A;  1K0L A;  2GH5 A;  3B3R A;  3NK2 X;  4B67 A;  4Z26 A;  4TM1 A;  1GET A;  2YLZ A;  4NWZ A;  2YQU A;  3CGB A;  3FBS A;  3RP7 A;  1BGN A;  2JBV A;  1E39 A;  1NG4 A;  3KPK A;  3CMM A;  2GR2 A;  4D03 A;  4H4W A;  1H86 A;  4Z25 A;  4H4R A;  5KVI A;  5C3J A;  4H4X A;  4EM4 A;  4OPI A;  3V3O A;  1KNR A;  3JSK A;  1CHU A;  2EQ8 A;  1GTH A;  1VG9 A;  5FS9 A;  1F6M A;  2YG6 A;  3C96 A;  2YG3 A;  3T31 A;  3HYX A;  3VRB A;  1S3B A;  3I6D A;  4G6G A;  1VG0 A;  3ATR A;  3NNE A;  4B68 A;  2R46 A;  2C65 A;  3CIR A;  4YWO A;  4J36 A;  3AEA A;  5KOW A;  1KDG A;  5KWF A;  5J7X A;  1KSU A;  1Q1R A;  1CJC A;  2NPX A;  4YKF A;  1GOS A;  5HY5 A;  1Z6L A;  5J60 A;  5IQ4 A;  2H88 A;  2WP9 A;  4Y4M A;  3T2Z A;  1PBC A;  3UKH A;  2FJD A;  1DOB A;  4JQ9 A;  3KD9 A;  1GRH A;  1IJH A;  2C76 A;  2XFP A;  2WDV A;  5CQF A;  2V3A A;  1PDH A;  4U8I A;  5BUL A;  1QJD A;  1E1L A;  2YLS A;  4H4Z A;  5C2T A;  1TYT A;  5FS6 A;  1IUT A;  3HYV A;  3ITJ A;  4E0V A;  4K22 A;  4IVM B;  1D7L A;  1KNP A;  1E1N A;  3NGC X;  3CNP A;  4RG3 A;  3ZYX A;  2BCP A;  1JU2 A;  3FMW A;  1QLB A;  1IUW A;  1E7P A;  1CF3 A;  1S2Y A;  4Z2R A;  1GND A;  3DJJ A;  4U8K A;  3DJE A;  1LTX R;  4H2P A;  1IUV A;  4MJW A;  3V76 A;  2XLT A;  3GSI A;  1ZMC A;  2B7S A;  3V3N A;  1CC6 A;  4JDR A;  4XWZ A;  5EOW A;  3CNJ A;  4H7U A;  1H7W A;  3LAD A;  1GRA A;  2QA2 A;  3GWF A;  2WQY A;  1TRB A;  3AYL A;  2XYO A;  3P4P A;  2W0H A;  2VVL A;  4XXG A;  3AB1 A;  1PN0 A;  4A79 A;  3RP6 A;  3UTF A;  5KOX A;  3UP5 A;  5DBJ A;  3ALM A;  2X8G A;  2YWL A;  3F8R A;  3UTE A;  4OPC A;  2WU5 A;  3CNS A;  3AE6 A;  1EL8 A;  3G5Q A;  4OPL A;  3CPI G;  2BAC A;  2R4E A;  4I59 A;  4B66 A;  2VQB A;  2B7R A;  3H4K A;  4C3Y A;  1CJ3 A;  4U8P A;  3CPH G;  3UKA A;  5GSN A;  4IA6 A;  4PAA A;  1GT8 A;  3D1C A;  4G9K A;  1H83 A;  4I58 A;  1JRZ A;  1ZMD A;  3BI2 A;  3EF6 A;  4BV6 A;  2E1M A;  4U8L A;  1V59 A;  2E5V A;  2Z5Y A;  3GMC A;  2BS4 A;  3GRT A;  1NHQ A;  1JEH A;  1KSS A;  3NH3 X;  4APN A;  4U2S A;  2BC1 A;  1NEK A;  3GDP A;  4II3 A;  5GRT A;  4ICY A;  3QSM A;  1YQ4 A;  3BI5 A;  1L0V A;  3BHK A;  3ABV A;  1SEZ A;  3VRA A;  5EBK A;  2YM2 A;  4YSZ A;  1NAA A;  3LOV A;  4G74 A;  2GQF A;  2V6O A;  3ICT A;  5IQ1 A;  2C4C A;  4EMJ A;  2TMD A;  3COX A;  3KU9 A;  2WDR A;  4K5S A;  2WBA A;  2BRY A;  3P4R A;  2HQM A;  2A8X A;  4H4Q A;  5HYM A;  1L9C A;  3RP8 A;  1E1K A;  4H4S A;  2YLX A;  4K8D A;  3NN6 X;  2XLS A;  3K7T A;  3UOV A;  2H89 A;  3AEE A;  3PO7 A;  5EB5 A;  2YVG A;  3VR8 A;  4KX6 A;  1CJ4 A;  2YVF A;  4GCM A;  1XHC A;  4BK1 A;  5KXJ A;  2IID A;  1HYU A;  2GMH A;  2YLT A;  3GYJ A;  4U8J A;  3NYE A;  3GWD A;  2BK5 A;  5LV9 A;  2GEW A;  3K7M X;  3AEB A;  4LII A;  2VVM A;  2WP6 A;  4U8N A;  1S3E A;  4C74 A;  4YXD A;  3ADA B;  1D4D A;  1UKV G;  1B8S A;  2EQ7 A;  3AXB A;  4TLX A;  1DOC A;  1EL5 A;  3KA7 A;  1E1M A;  4DGK A;  2XVE A;  3NK0 X;  4ADW A;  4G73 A;  1IUS A;  1TDO A;  2FBW A;  1TDE A;  3I3L A;  1BGJ A;  3M13 A;  2ZZC A;  4YKG A;  3IF9 A;  3GMB A;  2GQW A;  4ZN0 A;  2BK3 A;  1PBB A;  4BUR A;  3G5R A;  4OPU A;  4A5L A;  2BA9 A;  4YT0 A;  1LVL A;  1PBE A;  2X3N A;  1D4C A;  2VOU A;  1D7Y A;  4H2R A;  4K5R A;  1LJ1 A;  4UDQ A;  1LQT A;  1JRX A;  1L9E A;  2WPC A;  4U2T A;  4C3X A;  2FJA A;  3NLC A;  1P2E A;  2XFN A;  2R4J A;  3H8I A;  3M0O A;  4K2X A;  1GTE A;  1LPF A;  1ELI A;  2YG4 A;  2VZ2 A;  2QA1 A;  3QFA A;  3ATQ A;  3Q9T A;  4O5U A;  3DA1 A;  4Z2T A;  3C4N A;  1GRG A;  1S2Q A;  1OJD A;  3SYI A;  2GB0 A;  2XVJ A;  4AOX A;  1KFY A;  3CGC A;  1CJ2 A;  3DJD A;  4J34 A;  4NNJ A;  4CRT A;  2B76 A;  3CTY A;  2QCU A;  2Q0L A;  2OLN A;  2OAM A;  4A9W A;  4CY6 A;  1JNZ A;  5HHF A;  1H81 A;  1Y56 B;  2WES A;  2WOI A;  3AYJ A;  4GDE A;  4O5Q A;  1PS9 A;  3RNM A;  1N4W A;  4JNA A;  3VRD B;  1K4Q A;  1AOG A;  4J33 A;  2C64 A;  4AP3 A;  4NTC A;  1Y56 A;  1DJN A;  4Z24 A;  4BK2 A;  3DGH A;  1BZL A;  3K7Q X;  2JB3 A;  3GYI A;  5FS7 A;  3P4Q A;  3GDN A;  4II2 A;  2GV8 A;  4Z44 A;  2E4G A;  5KMS A;  1ZK7 A;  2C7G A; 
#chains in the Genus database with same CATH homology
 2JK6 A;  2R9Z A;  3AE2 A;  1ZOV A;  1LV0 A;  2RGJ A;  2ZBW A;  3AE8 A;  2Q0K A;  3GD3 A;  2XVF A;  4G6H A;  4IA5 A;  3LJP A;  1NHP A;  4J57 A;  2R45 A;  3GRS A;  4AT2 A;  3UKK A;  1DOE A;  4J56 A;  2RGO A;  2B9Y A;  4OCG A;  3R9U A;  2I0Z A;  5CKU A;  1GES A;  4NTE A;  1MXT A;  1YQZ A;  2C75 A;  4Y4L A;  3Q6J A;  1D5T A;  2GR0 A;  4DNA A;  1W4X A;  1CC2 A;  1ZKQ A;  2C67 A;  3P4S A;  3CGD A;  2GAG B;  5BUK A;  4Z43 A;  4H4T A;  4YSX A;  5JCK A;  2BS2 A;  4EQS A;  4H4U A;  4LA1 A;  3UKL A;  3QVP A;  2ARD A;  4TM4 A;  1H7X A;  4GUV A;  4X9N A;  4OPD A;  3SZ0 A;  1REO A;  1GEU A;  2X8H A;  2WHD A;  3FG2 P;  2Q7V A;  2XVI A;  5ER0 A;  3UTG A;  2TPR A;  4JY3 A;  1O95 A;  2GMJ A;  4M52 A;  2IVD A;  4H50 A;  3C4A A;  4DSG A;  1JRY A;  4YTP A;  5HXI A;  4LU6 A;  1B5Q A;  3OC4 A;  2CDU A;  3VR9 A;  4B65 A;  1Q1W A;  3IHG A;  4CBQ A;  2C3C A;  4OPT A;  1M64 A;  2WP5 A;  4P9S A;  2UZZ A;  4TLZ A;  2JAE A;  2FJB A;  2YLW A;  3T2K A;  2F5Z A;  3KLJ A;  2DKH A;  3ISH A;  3SZC A;  2V60 A;  5U63 A;  1GV4 A;  1IUX A;  2XLR A;  4NEW A;  4H4Y A;  3AE5 A;  1FCD A;  1PJ7 A;  3K30 A;  3LXD A;  1GAL A;  4U2L A;  1FEB A;  2JKC A;  4B69 A;  2AAQ A;  3EAO A;  3F8D A;  3S61 A;  1PBD A;  2FJE A;  2J3N A;  2RAB A;  3UKQ A;  2OLO A;  2XFO A;  3SM8 A;  1DNC A;  3EPT A;  2YG5 A;  4AT0 A;  1H6V A;  3G5S A;  1TDN A;  1NHR A;  2ZZ0 A;  3ALL A;  4J31 A;  1VDC A;  1TYP A;  4EMI A;  4EQR A;  4GF7 A;  1FEC A;  1NEN A;  5FMH A;  3RED A;  4KPR A;  1EL7 A;  3NTA A;  4TM3 A;  2VRL A;  3ICS A;  4Y4N A;  2B9W A;  1QO8 A;  2O9Z A;  1OJC A;  1M6I A;  4A6N B;  2X99 A;  4H4P A;  4JN9 A;  2WET A;  3S5W A;  3SQP A;  1B37 A;  3SFD A;  1PBF A;  3AED A;  3AE9 A;  4B63 A;  2AR8 A;  1N4V A;  1ZDL A;  4K7Z A;  4OVI A;  4A6N A;  4U8O A;  4XWR A;  4C5O A;  1BWC A;  2GRT A;  4FK1 A;  3NYF A;  2WPF A;  4GAP A;  1ZOY A;  2ZZB A;  4FX9 A;  3P9U A;  3CNT A;  4A7A A;  5KVH A;  2C66 A;  2BXR A;  1L9D A;  5EB4 A;  4DSH A;  5JCL A;  1E6E A;  2YR6 A;  3B6D A;  2V3B A;  1YKJ A;  2IVE A;  3BNM A;  4D04 A;  2AQJ A;  2WS3 A;  4J2W A;  1OJA A;  4YSH A;  3PVC A;  3BI4 A;  2EQ9 A;  3H8L A;  2JB1 A;  3QSE A;  3PS9 A;  2GR1 A;  1B4V A;  3KVE A;  4OPG A;  2R0C A;  3UOY A;  2BRA A;  3AYI A;  3UOX A;  3AE1 A;  3CPJ G;  4IV9 A;  1CBO A;  1GPE A;  2CFY A;  2JB2 A;  3AD9 B;  2PHH A;  1GXF A;  3DJG X;  4GRT A;  2WDQ A;  3AEC A;  1CL0 A;  3UOZ A;  2YAU A;  3ICR A;  3IWA A;  3L8K A;  3L1R A;  1COY A;  3AD8 B;  2WOW A;  2YVJ A;  2YR4 A;  3GD4 A;  4NTD A;  2DKI A;  3AE3 A;  3LB8 A;  3LZX A;  1XAN A;  2XDO A;  4H2N A;  4PAB A;  3ZDN A;  1TDK A;  3HZL A;  5KNL A;  2BAB A;  2OA1 A;  1NG3 A;  3AE4 A;  2CUL A;  4UDR A;  2NVK X;  3AEF A;  4AOS A;  4CNK A;  4EQW A;  4EM3 A;  2RGH A;  1K0I A;  2VVL G;  2WEU A;  3NRN A;  4BJY A;  1N1P A;  2WPE A;  3AE7 A;  3IC9 A;  4BK3 A;  5JCI A;  4B1B A;  1PXC A;  3UKF A;  4FDC B;  1EBD A;  1ZP0 A;  3AEG A;  3CN8 A;  5TR3 A;  3T2Y A;  5JCM A;  1RP0 A;  2XLU A;  3NN0 X;  3KKJ A;  4EIQ A;  4REK A;  3WE0 A;  4RG4 A;  4ZCD A;  3T0K A;  1GRE A;  1MO9 A;  1XPQ A;  3QJ4 A;  4A65 A;  2GR3 A;  1GRF A;  2C70 A;  1PXA A;  3SGL A;  1BKW A;  4Z2U A;  2GVC A;  4X4J A;  1F8W A;  3GYX A;  3RHA A;  4BJZ A;  3LZW A;  3DK8 A;  3BHF A;  3NIX A;  2XVH A;  3O0H A;  4TM0 A;  2YLR A;  3AWI A;  2APG A;  3DK4 A;  4UDP A;  1FEA A;  1RYI A;  1N4U A;  4YTN A;  2A87 A;  3DGZ A;  2YG7 A;  2A89 A;  1GER A;  2CVJ A;  3UP4 A;  4GAV A;  4N9X A;  4AP1 A;  5L46 A;  2ACZ A;  4WCT A;  1IUU A;  4ZCC A;  2BXS A;  3QSS A;  3SFE A;  1ZX9 A;  4EMW A;  2Y6R A;  3NTD A;  1OJT A;  3URH A;  1GRT A;  3II4 A;  2OAL A;  3AD7 B;  2BYB A;  1H84 A;  5BRT A;  3E1T A;  3UCL A;  4YTM A;  4USQ A;  1ZY8 A;  4FK1 C;  1F8S A;  2YR5 A;  1OJ9 A;  3QVR A;  1JNR A;  4HB9 A;  4USR A;  3CGE A;  3F8P A;  1VQW A;  3M12 A;  3UTH A;  2WU2 A;  2XFU A;  1O5W A;  1TDF A;  1YY5 A;  2C72 A;  5BVA A;  1Q9I A;  1EL9 A;  3DK9 A;  4IVO B;  5KMQ A;  3VQR A;  2R0P A;  1XDI A;  2WOV A;  2BC0 A;  1Y0P A;  2XFQ A;  3DME A;  3OZ2 A;  3SXI A;  4C77 A;  1VRQ B;  1O94 A;  1RSG A;  3FIM B;  1PHH A;  2Y6Q A;  2PYX A;  3KPF A;  2YM1 A;  1D4E A;  4GR1 A;  4HA6 A;  2XCG A;  3NT6 A;  5M10 A;  2BK4 A;  4JY2 A;  4JNQ A;  4X9M A;  2R0G A;  2X8C A;  4EQX A;  4B64 A;  4YSY A;  2X50 A;  3T37 A;  1LQU A;  3FPZ A;  3SZF A;  4GDP A;  4A99 A;  2BS3 A;  3BNU A;  2GAH B;  1P2H A;  1CC4 A;  4UP3 A;  3HYW A;  1DJQ A;  1F3P A;  4NEV A;  1PJ6 A;  4NZH A;  5U1O A;  3SY4 A;  1PJ5 A;  2V61 A;  2BCG G;  1GSN A;  2GF3 A;  1FL2 A;  1H82 A;  3SX6 A;  3IHM A;  1YQ3 A;  4CCQ A;  1JOA A;  2C3D A;  1NDA A;  2C73 A;  3EAN A;  2V5Z A;  4H4V A;  1KF6 A;  3T14 A;  1PXB A;  1DXL A;  1FOH A;  3DH9 A;  4EIP A;  4CCR A;  3NKS A;  3P1W A;  4H2Q A;  1K0J A;  1GRB A;  3NK1 X;  1F8R A;  3NHO X;  5M0Z A;  3UKP A;  3NG7 X;  1DOD A;  4CNJ A;  2B9X A;  4ECH A;  1ONF A;  1X31 B;  2Q6U A;  2XLP A;  1BF3 A;  5KRQ A;  4CY8 A;  3QFB A;  1MOK A;  2Z5X A;  5IPY A;  3NYC A;  3ALJ A;  5FS8 A;  5JCN A;  5KMR A;  3D8X A;  5U25 A;  2QAE A;  2VQ7 A;  4WX1 A;  2EQ6 A;  4U8M A;  5KMP A;  2VRM A;  3CND A;  4RSL A;  3SZW A;  1NHS A;  1NPX A;  1K0L A;  2GH5 A;  3B3R A;  3NK2 X;  4B67 A;  4Z26 A;  4TM1 A;  1GET A;  2YLZ A;  4NWZ A;  2YQU A;  3CGB A;  3FBS A;  3RP7 A;  1BGN A;  2JBV A;  1E39 A;  1NG4 A;  3KPK A;  3CMM A;  2GR2 A;  4D03 A;  4H4W A;  1H86 A;  4Z25 A;  4H4R A;  5KVI A;  5C3J A;  4H4X A;  4EM4 A;  4OPI A;  3V3O A;  1KNR A;  3JSK A;  1CHU A;  2EQ8 A;  1GTH A;  1VG9 A;  5FS9 A;  1F6M A;  2YG6 A;  3C96 A;  2YG3 A;  3T31 A;  3HYX A;  3VRB A;  1S3B A;  3I6D A;  4G6G A;  1VG0 A;  3ATR A;  3NNE A;  4B68 A;  2R46 A;  2C65 A;  3CIR A;  4YWO A;  4J36 A;  3AEA A;  5KOW A;  1KDG A;  5KWF A;  5J7X A;  1KSU A;  1Q1R A;  1CJC A;  2NPX A;  4YKF A;  1GOS A;  5HY5 A;  1Z6L A;  5J60 A;  5IQ4 A;  2H88 A;  2WP9 A;  4Y4M A;  3T2Z A;  1PBC A;  3UKH A;  2FJD A;  1DOB A;  4JQ9 A;  3KD9 A;  1GRH A;  1IJH A;  2C76 A;  2XFP A;  2WDV A;  5CQF A;  2V3A A;  1PDH A;  4U8I A;  5BUL A;  1QJD A;  1E1L A;  2YLS A;  4H4Z A;  5C2T A;  1TYT A;  5FS6 A;  1IUT A;  3HYV A;  3ITJ A;  4E0V A;  4K22 A;  4IVM B;  1D7L A;  1KNP A;  1E1N A;  3NGC X;  3CNP A;  4RG3 A;  3ZYX A;  2BCP A;  1JU2 A;  3FMW A;  1QLB A;  1IUW A;  1E7P A;  1CF3 A;  1S2Y A;  4Z2R A;  1GND A;  3DJJ A;  4U8K A;  3DJE A;  1LTX R;  4H2P A;  1IUV A;  4MJW A;  3V76 A;  2XLT A;  3GSI A;  1ZMC A;  2B7S A;  3V3N A;  1CC6 A;  4JDR A;  4XWZ A;  5EOW A;  3CNJ A;  4H7U A;  1H7W A;  3LAD A;  1GRA A;  2QA2 A;  3GWF A;  2WQY A;  1TRB A;  3AYL A;  2XYO A;  3P4P A;  2W0H A;  2VVL A;  4XXG A;  3AB1 A;  1PN0 A;  4A79 A;  3RP6 A;  3UTF A;  5KOX A;  3UP5 A;  5DBJ A;  3ALM A;  2X8G A;  2YWL A;  3F8R A;  3UTE A;  4OPC A;  2WU5 A;  3CNS A;  3AE6 A;  1EL8 A;  3G5Q A;  4OPL A;  3CPI G;  2BAC A;  2R4E A;  4I59 A;  4B66 A;  2VQB A;  2B7R A;  3H4K A;  4C3Y A;  1CJ3 A;  4U8P A;  3CPH G;  3UKA A;  5GSN A;  4IA6 A;  4PAA A;  1GT8 A;  3D1C A;  4G9K A;  1H83 A;  4I58 A;  1JRZ A;  1ZMD A;  3BI2 A;  3EF6 A;  4BV6 A;  2E1M A;  4U8L A;  1V59 A;  2E5V A;  2Z5Y A;  3GMC A;  2BS4 A;  3GRT A;  1NHQ A;  1JEH A;  1KSS A;  3NH3 X;  4APN A;  4U2S A;  2BC1 A;  1NEK A;  3GDP A;  4II3 A;  5GRT A;  4ICY A;  3QSM A;  1YQ4 A;  3BI5 A;  1L0V A;  3BHK A;  3ABV A;  1SEZ A;  3VRA A;  5EBK A;  2YM2 A;  4YSZ A;  1NAA A;  3LOV A;  4G74 A;  2GQF A;  2V6O A;  3ICT A;  5IQ1 A;  2C4C A;  4EMJ A;  2TMD A;  3COX A;  3KU9 A;  2WDR A;  4K5S A;  2WBA A;  2BRY A;  3P4R A;  2HQM A;  2A8X A;  4H4Q A;  5HYM A;  1L9C A;  3RP8 A;  1E1K A;  4H4S A;  2YLX A;  4K8D A;  3NN6 X;  2XLS A;  3K7T A;  3UOV A;  2H89 A;  3AEE A;  3PO7 A;  5EB5 A;  2YVG A;  3VR8 A;  4KX6 A;  1CJ4 A;  2YVF A;  4GCM A;  1XHC A;  4BK1 A;  5KXJ A;  2IID A;  1HYU A;  2GMH A;  2YLT A;  3GYJ A;  4U8J A;  3NYE A;  3GWD A;  2BK5 A;  5LV9 A;  2GEW A;  3K7M X;  3AEB A;  4LII A;  2VVM A;  2WP6 A;  4U8N A;  1S3E A;  4C74 A;  4YXD A;  3ADA B;  1D4D A;  1UKV G;  1B8S A;  2EQ7 A;  3AXB A;  4TLX A;  1DOC A;  1EL5 A;  3KA7 A;  1E1M A;  4DGK A;  2XVE A;  3NK0 X;  4ADW A;  4G73 A;  1IUS A;  1TDO A;  2FBW A;  1TDE A;  3I3L A;  1BGJ A;  3M13 A;  2ZZC A;  4YKG A;  3IF9 A;  3GMB A;  2GQW A;  4ZN0 A;  2BK3 A;  1PBB A;  4BUR A;  3G5R A;  4OPU A;  4A5L A;  2BA9 A;  4YT0 A;  1LVL A;  1PBE A;  2X3N A;  1D4C A;  2VOU A;  1D7Y A;  4H2R A;  4K5R A;  1LJ1 A;  4UDQ A;  1LQT A;  1JRX A;  1L9E A;  2WPC A;  4U2T A;  4C3X A;  2FJA A;  3NLC A;  1P2E A;  2XFN A;  2R4J A;  3H8I A;  3M0O A;  4K2X A;  1GTE A;  1LPF A;  1ELI A;  2YG4 A;  2VZ2 A;  2QA1 A;  3QFA A;  3ATQ A;  3Q9T A;  4O5U A;  3DA1 A;  4Z2T A;  3C4N A;  1GRG A;  1S2Q A;  1OJD A;  3SYI A;  2GB0 A;  2XVJ A;  4AOX A;  1KFY A;  3CGC A;  1CJ2 A;  3DJD A;  4J34 A;  4NNJ A;  4CRT A;  2B76 A;  3CTY A;  2QCU A;  2Q0L A;  2OLN A;  2OAM A;  4A9W A;  4CY6 A;  1JNZ A;  5HHF A;  1H81 A;  1Y56 B;  2WES A;  2WOI A;  3AYJ A;  4GDE A;  4O5Q A;  1PS9 A;  3RNM A;  1N4W A;  4JNA A;  3VRD B;  1K4Q A;  1AOG A;  4J33 A;  2C64 A;  4AP3 A;  4NTC A;  1Y56 A;  1DJN A;  4Z24 A;  4BK2 A;  3DGH A;  1BZL A;  3K7Q X;  2JB3 A;  3GYI A;  5FS7 A;  3P4Q A;  3GDN A;  4II2 A;  2GV8 A;  4Z44 A;  2E4G A;  5KMS A;  1ZK7 A;  2C7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...