2XLSA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78lys mutant
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
446
structure length
446
Chain Sequence
b'SMATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSKGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint-Functions of Protein Residues and Nadp(H) in Oxygen-Activation by Flavin-Containing Monooxygenase
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 157
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlsA02
2GH5A 1S2QA 3AEGA 1P2EA 2YQUA 3QVPA 3CNSA 1D4DA 1LPFA 2C65A 2X8GA 2NVKX 2ACZA 2YVFA 3NN0X 1H82A 4H4VA 2GVCA 3DJEA 4AT2A 4BJYA 3DJJA 3QSMA 2JB3A 2ZZ0A 4AP3A 1GALA 5KVIA 3RP8A 4B67A 4C3XA 4NTEA 1YQ3A 3O0HA 4EQWA 3AEFA 2WHDA 1PN0A 3AE8A 3COXA 1E1NA 1ZMCA 2YLZA 4NEWA 4EMJA 2OALA 1IUXA 2YM2A 1YQZA 2B7RA 1M64A 1GEUA 2JKCA 3PO7A 4K2XA 1JNZA 1DNCA 2DKHA 2Q0LA 3ABVA 3K7MX 1Y0PA 3DH9A 4PAAA 1ZOYA 1NPXA 3EPTA 3IWAA 3ZYXA 1CC4A 1IUTA 2WU5A 3ALMA 3FMWA 3UP5A 5JCIA 4U8OA 3EAOA 1ZK7A 2GAGB 1FOHA 2YM1A 2AR8A 1KNRA 3ZDNA 4A5LA 1CC2A 2R4EA 2VRLA 1IUVA 2YG7A 3AE6A 4JY3A 4N9XA 4AOSA 3CN8A 3P4SA 4J56A 4KPRA 1B4VA 1OJDA 1NG4A 2BCGG 2CDUA 4B65A 1E1KA 4J2WA 1D7LA 1NAAA 2C3CA 4K22A 2WPCA 3CGBA 4NZHA 2C76A 4CY8A 3E1TA 2WDRA 1GRGA 4H2RA 2Q0KA 3NT6A 5HY5A 4C3YA 4H2NA 3GMCA 2C3DA 5JCLA 2QCUA 3NNEA 2VVLG 2H88A 1UKVG 3DGHA 4B1BA 4Z2TA 1OJCA 5EB4A 4U2TA 4USRA 3V3NA 2GB0A 3DK4A 1DOBA 3FIMB 4XWZA 3GRSA 4I59A 1F8RA 3F8DA 3QSSA 2YWLA 3BNUA 1ZKQA 3REDA 2EQ6A 3IHMA 1NEKA 3CNPA 4TLZA 3M13A 2EQ9A 5U1OA 3ICRA 5U63A 2V6OA 3AWIA 2JAEA 1GNDA 2BS2A 4EIPA 3CNDA 1NHRA 1GRFA 1E1LA 2YG3A 4BURA 4CBQA 4OPDA 2NPXA 2XFUA 3AEEA 3UOZA 5EBKA 1HYUA 1XDIA 2WP6A 1GTHA 1BZLA 2QA1A 3R9UA 2WP9A 1TDEA 2BS3A 3Q6JA 2VVLA 4TM3A 2BACA 1LV0A 5J7XA 3ALJA 3GD3A 3GDNA 3QSEA 5EB5A 2E5VA 1DOCA 2WOIA 3NK1X 1PBFA 2A87A 5L46A 4DSHA 1F3PA 1D5TA 1XANA 2GMHA 1GOSA 4YSXA 5M0ZA 5JCKA 1PBCA 3PS9A 2YLSA 4EQXA 4YTNA 4H4YA 3QJ4A 4I58A 3BI2A 1GRAA 3VR8A 4LU6A 3NH3X 4OVIA 4H50A 2R0CA 1N4WA 1ONFA 4B64A 4BK1A 1NHSA 3DK9A 3GDPA 1N4UA 3CNJA 1RP0A 2YG5A 1MOKA 3AECA 3BNMA 4Z2RA 4Y4NA 2OA1A 4E0VA 2R0GA 4TM4A 1RYIA 2WOVA 2YG4A 3AE3A 3D8XA 4H4QA 2DKIA 2ZBWA 3NN6X 1EL7A 1CF3A 4H4ZA 4IA6A 5JCMA 2XLSA 1TYPA 2BABA 5TR3A 4GDEA 4OPTA 2V3AA 1W4XA 1KF6A 4Z44A 1Y56B 4DGKA 2XCGA 1AOGA 1N4VA 2WESA 3BI4A 3AEBA 1E39A 3CGDA 1LQTA 2XYOA 3AE4A 2E4GA 3K7TA 4GDPA 1Z6LA 2QA2A 4OCGA 3QFAA 5KVHA 2IIDA 1FEAA 1ZY8A 2YVGA 5FMHA 1KDGA 4U8LA 4OPLA 3CPIG 1ZOVA 1F8SA 1E6EA 1GSNA 3CNTA 3B6DA 5IQ1A 3LXDA 1KSSA 5CKUA 5BRTA 1GRTA 3GWFA 3KLJA 4H4UA 4CCRA 1TDOA 2W0HA 1ZDLA 3NRNA 4EMWA 4BK2A 3CGCA 4YSHA 5HYMA 4UP3A 5DBJA 4Z43A 2R45A 2R4JA 5KWFA 2ZZBA 2VQ7A 2B9XA 2C7GA 4YKFA 2JB1A 2XVFA 2WDVA 2GR0A 1Q1RA 1CJ2A 2X99A 3VRBA 2WU2A 1ELIA 3AE7A 2VZ2A 2XVHA 4U2LA 4Y4MA 3VRDB 4REKA 3FG2P 5LV9A 2VVMA 3KA7A 2IVDA 1D4CA 1GRBA 3UKHA 4U8MA 3UKPA 1B37A 3AB1A 1GERA 1QJDA 2F5ZA 4EMIA 1PJ5A 3II4A 4JQ9A 4B66A 2RGHA 3DJGX 1FEBA 2XLRA 1OJTA 1BGNA 4A6NB 1O5WA 2V60A 5EOWA 3RHAA 2VRMA 1JU2A 2C75A 1Q9IA 3L1RA 4J36A 4IV9A 4IVOB 1K0JA 4BV6A 1PXBA 3SFDA 1GESA 3CIRA 4YTMA 2CFYA 3UKQA 5BULA 3V76A 2WQYA 2BA9A 2XVJA 1EL8A 3P4PA 2IVEA 2J3NA 5GRTA 2X8HA 3IF9A 3UTHA 4ECHA 3BHKA 2B9WA 1P2HA 1H84A 2YAUA 5BVAA 3NYFA 4CNJA 3IC9A 1KFYA 1L9CA 1JEHA 2X8CA 2GV8A 4PABA 4K8DA 1M6IA 3F8RA 2YR4A 4OPGA 1VG0A 4ADWA 2PHHA 1TDKA 2QAEA 5HHFA 3D1CA 1H81A 1SEZA 5FS8A 3ATRA 3SM8A 2AAQA 3AE9A 4YTPA 3S61A 3AYJA 4H4PA 3UTFA 3S5WA 4A65A 2XFOA 3H8IA 4CRTA 3NK2X 4GCMA 1LTXR 4O5UA 3ADAB 4JY2A 1CJ4A 4AOXA 1EL9A 4K5RA 3AYIA 5HXIA 4UDRA 1PDHA 2WP5A 3K7QX 5ER0A 3UOXA 2B7SA 2R9ZA 1TDNA 3C4AA 4YKGA 2C72A 3GYIA 2R0PA 4NTDA 3WE0A 1K0LA 4YWOA 3V3OA 3ATQA 2WETA 4J34A 2OLNA 3ITJA 2BS4A 3UOYA 1S3EA 1H86A 3CPJG 4ICYA 3C4NA 3GMBA 4JN9A 2UZZA 1RSGA 4CCQA 2BC1A 3B3RA 4OPIA 1K0IA 1PHHA 3PVCA 3VR9A 5C3JA 4LIIA 3LOVA 4U8PA 1JOAA 2CVJA 1PXAA 4OPUA 3UKLA 3DK8A 1GRHA 2HQMA 4A9WA 2TMDA 4YT0A 5GSNA 1ZMDA 2Y6QA 1ZP0A 3F8PA 2WPFA 1NHQA 4EQSA 1GXFA 1DJNA 3BHFA 3G5RA 4TM1A 4UDQA 3K30A 2A8XA 2JBVA 3G5QA 1IUWA 4J57A 2X50A 4CY6A 1H6VA 1V59A 1NG3A 4DNAA 4USQA 1KSUA 1H83A 3M0OA 4BK3A 1NENA 2BXRA 4TLXA 4GRTA 2GEWA 3KVEA 1N1PA 1DOEA 4TM0A 2WEUA 4B69A 1PBBA 4U8JA 3P1WA 1VQWA 1LVLA 1REOA 1JNRA 4Y4LA 5JCNA 1F8WA 2V3BA 3CPHG 5KXJA 4A99A 3KPFA 4OPCA 2XLPA 3UKFA 4X9MA 3ICSA 1GREA 1TDFA 3DGZA 2BK5A 3P9UA 5IQ4A 3GYJA 5CQFA 4U8IA 1EBDA 2RABA 4J33A 3NTAA 4M52A 2CULA 1PBEA 1XPQA 1XHCA 1EL5A 4HA6A 2WOWA 3GRTA 3SGLA 2X3NA 1GTEA 2RGOA 2VOUA 4MJWA 2GR1A 4FK1C 4C74A 1ZX9A 2XVIA 2ZZCA 2RGJA 2GRTA 3AE5A 4JNAA 5C2TA 3GWDA 4RG3A 1FECA 3P4RA 1DODA 3NTDA 3QFBA 4XWRA 4B63A 5KOXA 3HZLA 4C77A 4U8KA 4B68A 4FDCB 4GR1A 1NDAA 3NK0X 4H4SA 4U2SA 1F6MA 2YG6A 5BUKA 3UTGA 3AXBA 2B9YA 5FS7A 1CJCA 2WDQA 4NEVA 3T37A 2GQWA 2XFNA 2I0ZA 4H4RA 2FJDA 1MO9A 4YSYA 2Q7VA 3C96A 4Z25A 4K5SA 3ALLA 2FBWA 1FCDA 1S3BA 2FJAA 4A7AA 4DSGA 4K7ZA 3AD9B 3G5SA 2WS3A 4WX1A 2A89A 2GR2A 2XLUA 3GD4A 4Z2UA 4RSLA 1GPEA 2Q6UA 2Y6RA 3EANA 3KKJA 3P4QA 2BK4A 3SQPA 3AYLA 4WCTA 4ZCCA 2XVEA 3OC4A 2C67A 2XFQA 2YLRA 1KNPA 1IUSA 3KU9A 4BJZA 5IPYA 1DJQA 4NTCA 2YVJA 4JNQA 2YLXA 4UDPA 3AD8B 1CL0A 1VDCA 2GMJA 1GT8A 1IUUA 2XDOA 3NG7X 1YY5A 3ISHA 2YR5A 3FPZA 1FL2A 1K4QA 2PYXA 2APGA 3NIXA 2JK6A 3NLCA 2E1MA 2OAMA 4EQRA 4RG4A 2H89A 4Z26A 4A79A 2GF3A 4EM3A 2GAHB 2C70A 1COYA 3H4KA 1PS9A 1H7XA 3JSKA 3L8KA 4H2PA 4AP1A 3NHOX 1D7YA 3AE2A 5KOWA 1E1MA 1TRBA 4H4WA 4APNA 1B8SA 2C66A 2YR6A 1GETA 1CJ3A 3AE1A 4ZN0A 2JB2A 3AEAA 1Q1WA 3RNMA 3CGEA 4H4TA 3LZWA 1S2YA 3ICTA 3H8LA 4GUVA 1B5QA 2ARDA 4C5OA 2O9ZA 2FJEA 2B76A 4X4JA 4ZCDA 2R46A 3UKAA 1PJ7A 2YLWA 3LJPA 4IVMB 1Y56A 3FBSA 3SFEA 1JRXA 2XFPA 3LADA 2BK3A 1BWCA 3IHGA 5U25A 1QLBA 1TYTA 2V5ZA 1CC6A 3BI5A 3LB8A 1CBOA 3I6DA 2Z5YA 3VRAA 5FS9A 1O94A 4X9NA 3UCLA 2YLTA 1LJ1A 1PBDA 2AQJA 1VRQB 3Q9TA 2V61A 2BCPA 5J60A 2C64A 4D03A 4KX6A 3RP6A 3UP4A 1D4EA 1JRYA 3UTEA 1OJ9A 2EQ7A 1O95A 3OZ2A 1L0VA 1E7PA 4P9SA 2EQ8A 3GSIA 3M12A 3KD9A 1DXLA 4EIQA 4D04A 3QVRA 2GR3A 1BKWA 1L9DA 1PXCA 4LA1A 5M10A 1PJ6A 4HB9A 4IA5A 3UKKA 1OJAA 4H4XA 1JRZA 5FS6A 1H7WA 3DA1A 3RP7A 4XXGA 4AT0A 5KRQA 3LZXA 3CTYA 1GV4A 1NHPA 2BXSA 3NGCX 4FX9A 4H2QA 4YSZA 4H7UA 1BF3A 4O5QA 3AD7B 4GF7A 3NKSA 1YQ4A 2GQFA 1MXTA 2C73A 3AEDA 3DJDA 3EF6A 1VG9A 1IJHA 3I3LA 1CHUA 1L9EA 1X31B 2WBAA 4FK1A 3UOVA 1YKJA 3VQRA 4U8NA 2XLTA 2BYBA 2Z5XA 3NYCA 4YXDA 4A6NA 4EM4A 3URHA 2WPEA 1BGJA 1QO8A 2OLOA 2FJBA 2VQBA 4Z24A 2TPRA 4CNKA 2BC0A 3NYEA 3DMEA 4J31A 4JDRA 1LQUA
chains in the Genus database with same CATH superfamily
2GH5A 1S2QA 3AEGA 1P2EA 2YQUA 3QVPA 3CNSA 1D4DA 1LPFA 2C65A 2X8GA 2NVKX 2ACZA 2YVFA 3NN0X 1H82A 4H4VA 2GVCA 3DJEA 4AT2A 4BJYA 3DJJA 3QSMA 2JB3A 2ZZ0A 4AP3A 1GALA 5KVIA 3RP8A 4B67A 4C3XA 4NTEA 1YQ3A 3O0HA 4EQWA 3AEFA 2WHDA 1PN0A 3AE8A 3COXA 1E1NA 1ZMCA 2YLZA 4NEWA 4EMJA 2OALA 1IUXA 2YM2A 1YQZA 2B7RA 1M64A 1GEUA 2JKCA 3PO7A 4K2XA 1JNZA 1DNCA 2DKHA 2Q0LA 3ABVA 3K7MX 1Y0PA 3DH9A 4PAAA 1ZOYA 1NPXA 3EPTA 3IWAA 3ZYXA 1CC4A 1IUTA 2WU5A 3ALMA 3FMWA 3UP5A 5JCIA 4U8OA 3EAOA 1ZK7A 2GAGB 1FOHA 2YM1A 2AR8A 1KNRA 3ZDNA 4A5LA 1CC2A 2R4EA 2VRLA 1IUVA 2YG7A 3AE6A 4JY3A 4N9XA 4AOSA 3CN8A 3P4SA 4J56A 4KPRA 1B4VA 1OJDA 1NG4A 2BCGG 2CDUA 4B65A 1E1KA 4J2WA 1D7LA 1NAAA 2C3CA 4K22A 2WPCA 3CGBA 4NZHA 2C76A 4CY8A 3E1TA 2WDRA 1GRGA 4H2RA 2Q0KA 3NT6A 5HY5A 4C3YA 4H2NA 3GMCA 2C3DA 5JCLA 2QCUA 3NNEA 2VVLG 2H88A 1UKVG 3DGHA 4B1BA 4Z2TA 1OJCA 5EB4A 4U2TA 4USRA 3V3NA 2GB0A 3DK4A 1DOBA 3FIMB 4XWZA 3GRSA 4I59A 1F8RA 3F8DA 3QSSA 2YWLA 3BNUA 1ZKQA 3REDA 2EQ6A 3IHMA 1NEKA 3CNPA 4TLZA 3M13A 2EQ9A 5U1OA 3ICRA 5U63A 2V6OA 3AWIA 2JAEA 1GNDA 2BS2A 4EIPA 3CNDA 1NHRA 1GRFA 1E1LA 2YG3A 3GYXA 4BURA 4CBQA 4OPDA 2NPXA 2XFUA 3AEEA 3UOZA 5EBKA 1HYUA 1XDIA 2WP6A 1GTHA 1BZLA 2QA1A 3R9UA 2WP9A 1TDEA 2BS3A 3Q6JA 2VVLA 4TM3A 2BACA 1LV0A 5J7XA 3ALJA 3GD3A 3GDNA 3QSEA 5EB5A 2E5VA 1DOCA 2WOIA 3NK1X 1PBFA 2A87A 5L46A 4DSHA 1F3PA 1D5TA 1XANA 2GMHA 1GOSA 3T14A 4II3A 5M0ZA 1PBCA 3PS9A 2YLSA 4YSXA 4EQXA 5JCKA 4YTNA 4H4YA 3QJ4A 4I58A 3BI2A 1GRAA 3VR8A 4LU6A 3NH3X 4OVIA 4H50A 2R0CA 1N4WA 3SY4A 1ONFA 4B64A 4BK1A 1NHSA 3DK9A 3GDPA 1N4UA 3CNJA 1RP0A 2YG5A 1MOKA 3AECA 3BNMA 4Z2RA 4Y4NA 2OA1A 4E0VA 2R0GA 4TM4A 1RYIA 2WOVA 2YG4A 3AE3A 3D8XA 4H4QA 2DKIA 2ZBWA 3NN6X 1EL7A 3CMMA 1CF3A 4H4ZA 4IA6A 5JCMA 2XLSA 1TYPA 2BABA 5TR3A 4GDEA 4OPTA 2V3AA 1W4XA 1KF6A 4Z44A 1Y56B 4DGKA 2XCGA 1AOGA 1N4VA 2WESA 3BI4A 3AEBA 1E39A 3CGDA 1LQTA 2XYOA 3AE4A 2E4GA 3K7TA 4GDPA 1Z6LA 2QA2A 4OCGA 3QFAA 5KVHA 2IIDA 1FEAA 1ZY8A 2YVGA 3HYWA 5FMHA 1KDGA 4U8LA 4OPLA 3CPIG 1ZOVA 1F8SA 1E6EA 1GSNA 3CNTA 3B6DA 5IQ1A 3LXDA 1KSSA 5CKUA 5BRTA 1GRTA 3GWFA 3KLJA 4H4UA 4CCRA 1TDOA 2W0HA 1ZDLA 3NRNA 4EMWA 4BK2A 3CGCA 4YSHA 5HYMA 4UP3A 5DBJA 4Z43A 2R45A 2R4JA 5KWFA 2ZZBA 2VQ7A 2B9XA 2C7GA 4YKFA 2JB1A 2XVFA 2WDVA 2GR0A 1Q1RA 1CJ2A 2X99A 3T31A 2WU2A 3VRBA 1ELIA 3AE7A 2VZ2A 2XVHA 4U2LA 4Y4MA 3VRDB 4REKA 3FG2P 5LV9A 2VVMA 3KA7A 4GAVA 1D4CA 1GRBA 2IVDA 3UKHA 4U8MA 3UKPA 1B37A 3AB1A 1GERA 1QJDA 2F5ZA 4EMIA 1PJ5A 3II4A 4JQ9A 4B66A 2RGHA 3DJGX 1FEBA 2XLRA 1OJTA 1BGNA 4G6GA 4A6NB 1O5WA 2V60A 5EOWA 3RHAA 2VRMA 1JU2A 2C75A 4GAPA 1Q9IA 3L1RA 4J36A 4IV9A 4IVOB 1K0JA 4BV6A 1PXBA 3SFDA 1GESA 3CIRA 4YTMA 2CFYA 3UKQA 5BULA 3V76A 2WQYA 2BA9A 2XVJA 1EL8A 3P4PA 4G74A 2IVEA 2J3NA 5GRTA 2X8HA 3IF9A 3UTHA 4ECHA 3BHKA 2B9WA 1P2HA 1H84A 2YAUA 3KPKA 5BVAA 3NYFA 4CNJA 3IC9A 1KFYA 1L9CA 1JEHA 2X8CA 2GV8A 4PABA 4K8DA 1M6IA 3F8RA 2YR4A 4OPGA 1VG0A 4ADWA 2PHHA 1TDKA 2QAEA 5HHFA 3D1CA 1H81A 1SEZA 5FS8A 5KMPA 3ATRA 3SM8A 2AAQA 3AE9A 4YTPA 3S61A 3AYJA 4H4PA 3UTFA 3S5WA 4A65A 3HYXA 2XFOA 3H8IA 4CRTA 4NWZA 3NK2X 4GCMA 1LTXR 4O5UA 3ADAB 4JY2A 1CJ4A 4AOXA 1EL9A 4K5RA 3HYVA 3AYIA 5HXIA 4UDRA 1PDHA 2WP5A 3K7QX 5ER0A 3UOXA 2B7SA 2R9ZA 1TDNA 3C4AA 4YKGA 5KMRA 2C72A 3GYIA 2R0PA 4NTDA 3WE0A 1K0LA 4YWOA 3V3OA 3ATQA 2WETA 4J34A 2OLNA 3ITJA 2BS4A 3UOYA 1S3EA 1H86A 3CPJG 4ICYA 3C4NA 3GMBA 4JN9A 2UZZA 1RSGA 4CCQA 2BC1A 3B3RA 4OPIA 1K0IA 1PHHA 3PVCA 3T2ZA 3VR9A 5C3JA 4LIIA 3T2KA 3LOVA 4U8PA 1JOAA 2CVJA 1PXAA 4OPUA 3UKLA 3DK8A 1GRHA 2HQMA 4A9WA 2TMDA 4YT0A 5GSNA 1ZMDA 2Y6QA 1ZP0A 3F8PA 2WPFA 1NHQA 4EQSA 1GXFA 1DJNA 3BHFA 3G5RA 4TM1A 4UDQA 3K30A 2A8XA 2JBVA 3G5QA 1IUWA 4J57A 2X50A 4CY6A 1H6VA 4II2A 1V59A 1NG3A 4DNAA 4USQA 1KSUA 1H83A 3M0OA 4BK3A 1NENA 2BXRA 4TLXA 4GRTA 3SXIA 2GEWA 3KVEA 1N1PA 1DOEA 4TM0A 2WEUA 4B69A 1PBBA 4U8JA 3P1WA 1VQWA 1LVLA 1REOA 1JNRA 4Y4LA 5JCNA 1F8WA 2V3BA 3CPHG 5KXJA 4A99A 3KPFA 4OPCA 2XLPA 3UKFA 4X9MA 3ICSA 1GREA 1TDFA 3DGZA 2BK5A 3P9UA 5IQ4A 3GYJA 5CQFA 4U8IA 3SX6A 1EBDA 2RABA 4J33A 3NTAA 4M52A 2CULA 1PBEA 1XPQA 1XHCA 1EL5A 4HA6A 2WOWA 3GRTA 3SGLA 2X3NA 1GTEA 2RGOA 2VOUA 4MJWA 2GR1A 4FK1C 4C74A 1ZX9A 2XVIA 2ZZCA 2RGJA 2GRTA 3AE5A 4JNAA 5C2TA 3GWDA 4RG3A 1FECA 3P4RA 1DODA 3NTDA 3QFBA 4XWRA 4B63A 5KOXA 3HZLA 4C77A 4U8KA 4B68A 4FDCB 4GR1A 1NDAA 3NK0X 4H4SA 4U2SA 1F6MA 2YG6A 5BUKA 3UTGA 3AXBA 2B9YA 5FS7A 1CJCA 2WDQA 4NEVA 3T37A 2GQWA 2XFNA 2I0ZA 4H4RA 2FJDA 1MO9A 4YSYA 2Q7VA 3C96A 4Z25A 4K5SA 3ALLA 3SZ0A 2FBWA 1FCDA 1S3BA 2FJAA 4A7AA 4DSGA 4K7ZA 3AD9B 3SZWA 3G5SA 2WS3A 4WX1A 2A89A 2GR2A 2XLUA 3GD4A 4Z2UA 4RSLA 1GPEA 2Q6UA 2Y6RA 3EANA 3KKJA 3P4QA 2BK4A 3SQPA 3AYLA 4WCTA 4ZCCA 2XVEA 3OC4A 2C67A 2XFQA 2YLRA 5KMQA 1KNPA 1IUSA 3KU9A 4BJZA 5IPYA 1DJQA 4NTCA 4G73A 2YVJA 4JNQA 2YLXA 4UDPA 3AD8B 4G6HA 1CL0A 1VDCA 2GMJA 1GT8A 1IUUA 2XDOA 3NG7X 1YY5A 3ISHA 2YR5A 3FPZA 1FL2A 1K4QA 2PYXA 2APGA 3NIXA 2JK6A 3NLCA 2E1MA 2OAMA 4EQRA 4RG4A 2H89A 4Z26A 4A79A 2GF3A 2BRYA 4EM3A 2GAHB 2C70A 1COYA 3H4KA 1PS9A 1H7XA 3JSKA 3L8KA 4H2PA 4AP1A 3NHOX 1D7YA 3AE2A 3T0KA 1E1MA 1TRBA 4H4WA 4APNA 1B8SA 5KOWA 2C66A 2YR6A 4G9KA 1GETA 1CJ3A 3AE1A 4ZN0A 2JB2A 3AEAA 1Q1WA 3RNMA 3CGEA 4H4TA 3LZWA 1S2YA 3ICTA 3H8LA 4GUVA 3SYIA 1B5QA 2ARDA 4C5OA 2O9ZA 2FJEA 2C4CA 2B76A 4X4JA 4ZCDA 4NNJA 2R46A 3UKAA 1PJ7A 2YLWA 3LJPA 4IVMB 1Y56A 3FBSA 3SFEA 1JRXA 2XFPA 3LADA 2BK3A 1BWCA 3IHGA 5U25A 1QLBA 1TYTA 2V5ZA 1CC6A 3BI5A 3LB8A 1CBOA 3I6DA 2Z5YA 3VRAA 3SZCA 5FS9A 1O94A 4X9NA 3UCLA 2YLTA 1LJ1A 1PBDA 2AQJA 1VRQB 2BRAA 3Q9TA 2V61A 2BCPA 5J60A 2C64A 4D03A 3T2YA 5KMSA 4KX6A 3RP6A 3UP4A 1D4EA 1JRYA 3UTEA 1OJ9A 2EQ7A 1O95A 3OZ2A 1L0VA 1E7PA 4P9SA 2EQ8A 3GSIA 3M12A 3KD9A 1DXLA 3SZFA 4EIQA 4D04A 3QVRA 2GR3A 1BKWA 1L9DA 1PXCA 4LA1A 5M10A 1PJ6A 4HB9A 4IA5A 3UKKA 1OJAA 4H4XA 1JRZA 5FS6A 1H7WA 3DA1A 3RP7A 4XXGA 4AT0A 5KRQA 3LZXA 3CTYA 1GV4A 1NHPA 2BXSA 3NGCX 4FX9A 4H2QA 4YSZA 4H7UA 1BF3A 4O5QA 3AD7B 4GF7A 3NKSA 1YQ4A 2GQFA 1MXTA 2C73A 3AEDA 3DJDA 3EF6A 1VG9A 1IJHA 3I3LA 1CHUA 1L9EA 1X31B 2WBAA 4FK1A 3UOVA 1YKJA 3VQRA 4U8NA 2XLTA 2BYBA 2Z5XA 3NYCA 4YXDA 4A6NA 4EM4A 3URHA 2WPEA 1BGJA 1QO8A 2OLOA 2FJBA 2VQBA 4Z24A 2TPRA 4CNKA 2BC0A 3NYEA 3DMEA 4J31A 4JDRA 5KNLA 1LQUA
chains in the Genus database with same CATH topology
2GH5A 1S2QA 3AEGA 1P2EA 2YQUA 3QVPA 3CNSA 1D4DA 1LPFA 2C65A 2X8GA 2NVKX 2ACZA 2YVFA 3NN0X 1H82A 4H4VA 2GVCA 3DJEA 4AT2A 4BJYA 3DJJA 3QSMA 2JB3A 2ZZ0A 4AP3A 1GALA 5KVIA 3RP8A 4B67A 4C3XA 4NTEA 1YQ3A 3O0HA 4EQWA 3AEFA 2WHDA 1PN0A 3AE8A 3COXA 1E1NA 1ZMCA 2YLZA 4NEWA 4EMJA 2OALA 1IUXA 2YM2A 1YQZA 2B7RA 1M64A 1GEUA 2JKCA 3PO7A 4K2XA 1JNZA 1DNCA 2DKHA 2Q0LA 3ABVA 3K7MX 1Y0PA 3DH9A 4PAAA 1ZOYA 1NPXA 3EPTA 3IWAA 3ZYXA 1CC4A 1IUTA 2WU5A 3ALMA 3FMWA 3UP5A 5JCIA 4U8OA 3EAOA 1ZK7A 2GAGB 1FOHA 2YM1A 2AR8A 1KNRA 3ZDNA 4A5LA 1CC2A 2R4EA 2VRLA 1IUVA 2YG7A 3AE6A 4JY3A 4N9XA 4AOSA 3CN8A 3P4SA 4J56A 4KPRA 1B4VA 1OJDA 1NG4A 2BCGG 2CDUA 4B65A 1E1KA 4J2WA 1D7LA 1NAAA 2C3CA 4K22A 2WPCA 3CGBA 4NZHA 2C76A 4CY8A 3E1TA 2WDRA 1GRGA 4H2RA 2Q0KA 3NT6A 5HY5A 4C3YA 4H2NA 3GMCA 2C3DA 5JCLA 2QCUA 3NNEA 2VVLG 2H88A 1UKVG 3DGHA 4B1BA 4Z2TA 1OJCA 5EB4A 4U2TA 4USRA 3V3NA 2GB0A 3DK4A 1DOBA 3FIMB 4XWZA 3GRSA 4I59A 1F8RA 3F8DA 3QSSA 2YWLA 3BNUA 1ZKQA 3REDA 2EQ6A 3IHMA 1NEKA 3CNPA 4TLZA 3M13A 2EQ9A 5U1OA 3ICRA 5U63A 2V6OA 3AWIA 2JAEA 1GNDA 2BS2A 4EIPA 3CNDA 1NHRA 1GRFA 1E1LA 2YG3A 3GYXA 4BURA 4CBQA 4OPDA 2NPXA 2XFUA 3AEEA 3UOZA 5EBKA 1HYUA 1XDIA 2WP6A 1GTHA 1BZLA 2QA1A 3R9UA 2WP9A 1TDEA 2BS3A 3Q6JA 2VVLA 4TM3A 2BACA 1LV0A 5J7XA 3ALJA 3GD3A 3GDNA 3QSEA 5EB5A 2E5VA 1DOCA 2WOIA 3NK1X 1PBFA 2A87A 5L46A 4DSHA 1F3PA 1D5TA 1XANA 2GMHA 1GOSA 3T14A 4II3A 5M0ZA 1PBCA 3PS9A 2YLSA 4YSXA 4EQXA 5JCKA 4YTNA 4H4YA 3QJ4A 4I58A 3BI2A 1GRAA 3VR8A 4LU6A 3NH3X 4OVIA 4H50A 2R0CA 1N4WA 3SY4A 1ONFA 4B64A 4BK1A 1NHSA 3DK9A 3GDPA 1N4UA 3CNJA 1RP0A 2YG5A 1MOKA 3AECA 3BNMA 4Z2RA 4Y4NA 2OA1A 4E0VA 2R0GA 4TM4A 1RYIA 2WOVA 2YG4A 3AE3A 3D8XA 4H4QA 2DKIA 2ZBWA 3NN6X 1EL7A 3CMMA 1CF3A 4H4ZA 4IA6A 5JCMA 2XLSA 1TYPA 2BABA 5TR3A 4GDEA 4OPTA 2V3AA 1W4XA 1KF6A 4Z44A 1Y56B 4DGKA 2XCGA 1AOGA 1N4VA 2WESA 3BI4A 3AEBA 1E39A 3CGDA 1LQTA 2XYOA 3AE4A 2E4GA 3K7TA 4GDPA 1Z6LA 2QA2A 4OCGA 3QFAA 5KVHA 2IIDA 1FEAA 1ZY8A 2YVGA 3HYWA 5FMHA 1KDGA 4U8LA 4OPLA 3CPIG 1ZOVA 1F8SA 1E6EA 1GSNA 3CNTA 3B6DA 5IQ1A 3LXDA 1KSSA 5CKUA 5BRTA 1GRTA 3GWFA 3KLJA 4H4UA 4CCRA 1TDOA 2W0HA 1ZDLA 3NRNA 4EMWA 4BK2A 3CGCA 4YSHA 5HYMA 4UP3A 5DBJA 4Z43A 2R45A 2R4JA 5KWFA 2ZZBA 2VQ7A 2B9XA 2C7GA 4YKFA 2JB1A 2XVFA 2WDVA 2GR0A 1Q1RA 1CJ2A 2X99A 3T31A 2WU2A 3VRBA 1ELIA 3AE7A 2VZ2A 2XVHA 4U2LA 4Y4MA 3VRDB 4REKA 3FG2P 5LV9A 2VVMA 3KA7A 4GAVA 1D4CA 1GRBA 2IVDA 3UKHA 4U8MA 3UKPA 1B37A 3AB1A 1GERA 1QJDA 2F5ZA 4EMIA 1PJ5A 3II4A 4JQ9A 4B66A 2RGHA 3DJGX 1FEBA 2XLRA 1OJTA 1BGNA 4G6GA 4A6NB 1O5WA 2V60A 5EOWA 3RHAA 2VRMA 1JU2A 2C75A 4GAPA 1Q9IA 3L1RA 4J36A 4IV9A 4IVOB 1K0JA 4BV6A 1PXBA 3SFDA 1GESA 3CIRA 4YTMA 2CFYA 3UKQA 5BULA 3V76A 2WQYA 2BA9A 2XVJA 1EL8A 3P4PA 4G74A 2IVEA 2J3NA 5GRTA 2X8HA 3IF9A 3UTHA 4ECHA 3BHKA 2B9WA 1P2HA 1H84A 2YAUA 3KPKA 5BVAA 3NYFA 4CNJA 3IC9A 1KFYA 1L9CA 1JEHA 2X8CA 2GV8A 4PABA 4K8DA 1M6IA 3F8RA 2YR4A 4OPGA 1VG0A 4ADWA 2PHHA 1TDKA 2QAEA 5HHFA 3D1CA 1H81A 1SEZA 5FS8A 5KMPA 3ATRA 3SM8A 2AAQA 3AE9A 4YTPA 3S61A 3AYJA 4H4PA 3UTFA 3S5WA 4A65A 3HYXA 2XFOA 3H8IA 4CRTA 4NWZA 3NK2X 4GCMA 1LTXR 4O5UA 3ADAB 4JY2A 1CJ4A 4AOXA 1EL9A 4K5RA 3HYVA 3AYIA 5HXIA 4UDRA 1PDHA 2WP5A 3K7QX 5ER0A 3UOXA 2B7SA 2R9ZA 1TDNA 3C4AA 4YKGA 5KMRA 2C72A 3GYIA 2R0PA 4NTDA 3WE0A 1K0LA 4YWOA 3V3OA 3ATQA 2WETA 4J34A 2OLNA 3ITJA 2BS4A 3UOYA 1S3EA 1H86A 3CPJG 4ICYA 3C4NA 3GMBA 4JN9A 2UZZA 1RSGA 4CCQA 2BC1A 3B3RA 4OPIA 1K0IA 1PHHA 3PVCA 3T2ZA 3VR9A 5C3JA 4LIIA 3T2KA 3LOVA 4U8PA 1JOAA 2CVJA 1PXAA 4OPUA 3UKLA 3DK8A 1GRHA 2HQMA 4A9WA 2TMDA 4YT0A 5GSNA 1ZMDA 2Y6QA 1ZP0A 3F8PA 2WPFA 1NHQA 4EQSA 1GXFA 1DJNA 3BHFA 3G5RA 4TM1A 4UDQA 3K30A 2A8XA 2JBVA 3G5QA 1IUWA 4J57A 2X50A 4CY6A 1H6VA 4II2A 1V59A 1NG3A 4DNAA 4USQA 1KSUA 1H83A 3M0OA 4BK3A 1NENA 2BXRA 4TLXA 4GRTA 3SXIA 2GEWA 3KVEA 1N1PA 1DOEA 4TM0A 2WEUA 4B69A 1PBBA 4U8JA 3P1WA 1VQWA 1LVLA 1REOA 1JNRA 4Y4LA 5JCNA 1F8WA 2V3BA 3CPHG 5KXJA 4A99A 3KPFA 4OPCA 2XLPA 3UKFA 4X9MA 3ICSA 1GREA 1TDFA 3DGZA 2BK5A 3P9UA 5IQ4A 3GYJA 5CQFA 4U8IA 3SX6A 1EBDA 2RABA 4J33A 3NTAA 4M52A 2CULA 1PBEA 1XPQA 1XHCA 1EL5A 4HA6A 2WOWA 3GRTA 3SGLA 2X3NA 1GTEA 2RGOA 2VOUA 4MJWA 2GR1A 4FK1C 4C74A 1ZX9A 2XVIA 2ZZCA 2RGJA 2GRTA 3AE5A 4JNAA 5C2TA 3GWDA 4RG3A 1FECA 3P4RA 1DODA 3NTDA 3QFBA 4XWRA 4B63A 5KOXA 3HZLA 4C77A 4U8KA 4B68A 4FDCB 4GR1A 1NDAA 3NK0X 4H4SA 4U2SA 1F6MA 2YG6A 5BUKA 3UTGA 3AXBA 2B9YA 5FS7A 1CJCA 2WDQA 4NEVA 3T37A 2GQWA 2XFNA 2I0ZA 4H4RA 2FJDA 1MO9A 4YSYA 2Q7VA 3C96A 4Z25A 4K5SA 3ALLA 3SZ0A 2FBWA 1FCDA 1S3BA 2FJAA 4A7AA 4DSGA 4K7ZA 3AD9B 3SZWA 3G5SA 2WS3A 4WX1A 2A89A 2GR2A 2XLUA 3GD4A 4Z2UA 4RSLA 1GPEA 2Q6UA 2Y6RA 3EANA 3KKJA 3P4QA 2BK4A 3SQPA 3AYLA 4WCTA 4ZCCA 2XVEA 3OC4A 2C67A 2XFQA 2YLRA 5KMQA 1KNPA 1IUSA 3KU9A 4BJZA 5IPYA 1DJQA 4NTCA 4G73A 2YVJA 4JNQA 2YLXA 4UDPA 3AD8B 4G6HA 1CL0A 1VDCA 2GMJA 1GT8A 1IUUA 2XDOA 3NG7X 1YY5A 3ISHA 2YR5A 3FPZA 1FL2A 1K4QA 2PYXA 2APGA 3NIXA 2JK6A 3NLCA 2E1MA 2OAMA 4EQRA 4RG4A 2H89A 4Z26A 4A79A 2GF3A 2BRYA 4EM3A 2GAHB 2C70A 1COYA 3H4KA 1PS9A 1H7XA 3JSKA 3L8KA 4H2PA 4AP1A 3NHOX 1D7YA 3AE2A 3T0KA 1E1MA 1TRBA 4H4WA 4APNA 1B8SA 5KOWA 2C66A 2YR6A 4G9KA 1GETA 1CJ3A 3AE1A 4ZN0A 2JB2A 3AEAA 1Q1WA 3RNMA 3CGEA 4H4TA 3LZWA 1S2YA 3ICTA 3H8LA 4GUVA 3SYIA 1B5QA 2ARDA 4C5OA 2O9ZA 2FJEA 2C4CA 2B76A 4X4JA 4ZCDA 4NNJA 2R46A 3UKAA 1PJ7A 2YLWA 3LJPA 4IVMB 1Y56A 3FBSA 3SFEA 1JRXA 2XFPA 3LADA 2BK3A 1BWCA 3IHGA 5U25A 1QLBA 1TYTA 2V5ZA 1CC6A 3BI5A 3LB8A 1CBOA 3I6DA 2Z5YA 3VRAA 3SZCA 5FS9A 1O94A 4X9NA 3UCLA 2YLTA 1LJ1A 1PBDA 2AQJA 1VRQB 2BRAA 3Q9TA 2V61A 2BCPA 5J60A 2C64A 4D03A 3T2YA 5KMSA 4KX6A 3RP6A 3UP4A 1D4EA 1JRYA 3UTEA 1OJ9A 2EQ7A 1O95A 3OZ2A 1L0VA 1E7PA 4P9SA 2EQ8A 3GSIA 3M12A 3KD9A 1DXLA 3SZFA 4EIQA 4D04A 3QVRA 2GR3A 1BKWA 1L9DA 1PXCA 4LA1A 5M10A 1PJ6A 4HB9A 4IA5A 3UKKA 1OJAA 4H4XA 1JRZA 5FS6A 1H7WA 3DA1A 3RP7A 4XXGA 4AT0A 5KRQA 3LZXA 3CTYA 1GV4A 1NHPA 2BXSA 3NGCX 4FX9A 4H2QA 4YSZA 4H7UA 1BF3A 4O5QA 3AD7B 4GF7A 3NKSA 1YQ4A 2GQFA 1MXTA 2C73A 3AEDA 3DJDA 3EF6A 1VG9A 1IJHA 3I3LA 1CHUA 1L9EA 1X31B 2WBAA 4FK1A 3UOVA 1YKJA 3VQRA 4U8NA 2XLTA 2BYBA 2Z5XA 3NYCA 4YXDA 4A6NA 4EM4A 3URHA 2WPEA 1BGJA 1QO8A 2OLOA 2FJBA 2VQBA 4Z24A 2TPRA 4CNKA 2BC0A 3NYEA 3DMEA 4J31A 4JDRA 5KNLA 1LQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GH5 A;  1S2Q A;  3AEG A;  1P2E A;  2YQU A;  3QVP A;  3CNS A;  1D4D A;  1LPF A;  2C65 A;  2X8G A;  2NVK X;  2ACZ A;  2YVF A;  3NN0 X;  1H82 A;  4H4V A;  2GVC A;  3DJE A;  4AT2 A;  4BJY A;  3DJJ A;  3QSM A;  2JB3 A;  2ZZ0 A;  4AP3 A;  1GAL A;  5KVI A;  3RP8 A;  4B67 A;  4C3X A;  4NTE A;  1YQ3 A;  3O0H A;  4EQW A;  3AEF A;  2WHD A;  1PN0 A;  3AE8 A;  3COX A;  1E1N A;  1ZMC A;  2YLZ A;  4NEW A;  4EMJ A;  2OAL A;  1IUX A;  2YM2 A;  1YQZ A;  2B7R A;  1M64 A;  1GEU A;  2JKC A;  3PO7 A;  4K2X A;  1JNZ A;  1DNC A;  2DKH A;  2Q0L A;  3ABV A;  3K7M X;  1Y0P A;  3DH9 A;  4PAA A;  1ZOY A;  1NPX A;  3EPT A;  3IWA A;  3ZYX A;  1CC4 A;  1IUT A;  2WU5 A;  3ALM A;  3FMW A;  3UP5 A;  5JCI A;  4U8O A;  3EAO A;  1ZK7 A;  2GAG B;  1FOH A;  2YM1 A;  2AR8 A;  1KNR A;  3ZDN A;  4A5L A;  1CC2 A;  2R4E A;  2VRL A;  1IUV A;  2YG7 A;  3AE6 A;  4JY3 A;  4N9X A;  4AOS A;  3CN8 A;  3P4S A;  4J56 A;  4KPR A;  1B4V A;  1OJD A;  1NG4 A;  2BCG G;  2CDU A;  4B65 A;  1E1K A;  4J2W A;  1D7L A;  1NAA A;  2C3C A;  4K22 A;  2WPC A;  3CGB A;  4NZH A;  2C76 A;  4CY8 A;  3E1T A;  2WDR A;  1GRG A;  4H2R A;  2Q0K A;  3NT6 A;  5HY5 A;  4C3Y A;  4H2N A;  3GMC A;  2C3D A;  5JCL A;  2QCU A;  3NNE A;  2VVL G;  2H88 A;  1UKV G;  3DGH A;  4B1B A;  4Z2T A;  1OJC A;  5EB4 A;  4U2T A;  4USR A;  3V3N A;  2GB0 A;  3DK4 A;  1DOB A;  3FIM B;  4XWZ A;  3GRS A;  4I59 A;  1F8R A;  3F8D A;  3QSS A;  2YWL A;  3BNU A;  1ZKQ A;  3RED A;  2EQ6 A;  3IHM A;  1NEK A;  3CNP A;  4TLZ A;  3M13 A;  2EQ9 A;  5U1O A;  3ICR A;  5U63 A;  2V6O A;  3AWI A;  2JAE A;  1GND A;  2BS2 A;  4EIP A;  3CND A;  1NHR A;  1GRF A;  1E1L A;  2YG3 A;  4BUR A;  4CBQ A;  4OPD A;  2NPX A;  2XFU A;  3AEE A;  3UOZ A;  5EBK A;  1HYU A;  1XDI A;  2WP6 A;  1GTH A;  1BZL A;  2QA1 A;  3R9U A;  2WP9 A;  1TDE A;  2BS3 A;  3Q6J A;  2VVL A;  4TM3 A;  2BAC A;  1LV0 A;  5J7X A;  3ALJ A;  3GD3 A;  3GDN A;  3QSE A;  5EB5 A;  2E5V A;  1DOC A;  2WOI A;  3NK1 X;  1PBF A;  2A87 A;  5L46 A;  4DSH A;  1F3P A;  1D5T A;  1XAN A;  2GMH A;  1GOS A;  4YSX A;  5M0Z A;  5JCK A;  1PBC A;  3PS9 A;  2YLS A;  4EQX A;  4YTN A;  4H4Y A;  3QJ4 A;  4I58 A;  3BI2 A;  1GRA A;  3VR8 A;  4LU6 A;  3NH3 X;  4OVI A;  4H50 A;  2R0C A;  1N4W A;  1ONF A;  4B64 A;  4BK1 A;  1NHS A;  3DK9 A;  3GDP A;  1N4U A;  3CNJ A;  1RP0 A;  2YG5 A;  1MOK A;  3AEC A;  3BNM A;  4Z2R A;  4Y4N A;  2OA1 A;  4E0V A;  2R0G A;  4TM4 A;  1RYI A;  2WOV A;  2YG4 A;  3AE3 A;  3D8X A;  4H4Q A;  2DKI A;  2ZBW A;  3NN6 X;  1EL7 A;  1CF3 A;  4H4Z A;  4IA6 A;  5JCM A;  2XLS A;  1TYP A;  2BAB A;  5TR3 A;  4GDE A;  4OPT A;  2V3A A;  1W4X A;  1KF6 A;  4Z44 A;  1Y56 B;  4DGK A;  2XCG A;  1AOG A;  1N4V A;  2WES A;  3BI4 A;  3AEB A;  1E39 A;  3CGD A;  1LQT A;  2XYO A;  3AE4 A;  2E4G A;  3K7T A;  4GDP A;  1Z6L A;  2QA2 A;  4OCG A;  3QFA A;  5KVH A;  2IID A;  1FEA A;  1ZY8 A;  2YVG A;  5FMH A;  1KDG A;  4U8L A;  4OPL A;  3CPI G;  1ZOV A;  1F8S A;  1E6E A;  1GSN A;  3CNT A;  3B6D A;  5IQ1 A;  3LXD A;  1KSS A;  5CKU A;  5BRT A;  1GRT A;  3GWF A;  3KLJ A;  4H4U A;  4CCR A;  1TDO A;  2W0H A;  1ZDL A;  3NRN A;  4EMW A;  4BK2 A;  3CGC A;  4YSH A;  5HYM A;  4UP3 A;  5DBJ A;  4Z43 A;  2R45 A;  2R4J A;  5KWF A;  2ZZB A;  2VQ7 A;  2B9X A;  2C7G A;  4YKF A;  2JB1 A;  2XVF A;  2WDV A;  2GR0 A;  1Q1R A;  1CJ2 A;  2X99 A;  3VRB A;  2WU2 A;  1ELI A;  3AE7 A;  2VZ2 A;  2XVH A;  4U2L A;  4Y4M A;  3VRD B;  4REK A;  3FG2 P;  5LV9 A;  2VVM A;  3KA7 A;  2IVD A;  1D4C A;  1GRB A;  3UKH A;  4U8M A;  3UKP A;  1B37 A;  3AB1 A;  1GER A;  1QJD A;  2F5Z A;  4EMI A;  1PJ5 A;  3II4 A;  4JQ9 A;  4B66 A;  2RGH A;  3DJG X;  1FEB A;  2XLR A;  1OJT A;  1BGN A;  4A6N B;  1O5W A;  2V60 A;  5EOW A;  3RHA A;  2VRM A;  1JU2 A;  2C75 A;  1Q9I A;  3L1R A;  4J36 A;  4IV9 A;  4IVO B;  1K0J A;  4BV6 A;  1PXB A;  3SFD A;  1GES A;  3CIR A;  4YTM A;  2CFY A;  3UKQ A;  5BUL A;  3V76 A;  2WQY A;  2BA9 A;  2XVJ A;  1EL8 A;  3P4P A;  2IVE A;  2J3N A;  5GRT A;  2X8H A;  3IF9 A;  3UTH A;  4ECH A;  3BHK A;  2B9W A;  1P2H A;  1H84 A;  2YAU A;  5BVA A;  3NYF A;  4CNJ A;  3IC9 A;  1KFY A;  1L9C A;  1JEH A;  2X8C A;  2GV8 A;  4PAB A;  4K8D A;  1M6I A;  3F8R A;  2YR4 A;  4OPG A;  1VG0 A;  4ADW A;  2PHH A;  1TDK A;  2QAE A;  5HHF A;  3D1C A;  1H81 A;  1SEZ A;  5FS8 A;  3ATR A;  3SM8 A;  2AAQ A;  3AE9 A;  4YTP A;  3S61 A;  3AYJ A;  4H4P A;  3UTF A;  3S5W A;  4A65 A;  2XFO A;  3H8I A;  4CRT A;  3NK2 X;  4GCM A;  1LTX R;  4O5U A;  3ADA B;  4JY2 A;  1CJ4 A;  4AOX A;  1EL9 A;  4K5R A;  3AYI A;  5HXI A;  4UDR A;  1PDH A;  2WP5 A;  3K7Q X;  5ER0 A;  3UOX A;  2B7S A;  2R9Z A;  1TDN A;  3C4A A;  4YKG A;  2C72 A;  3GYI A;  2R0P A;  4NTD A;  3WE0 A;  1K0L A;  4YWO A;  3V3O A;  3ATQ A;  2WET A;  4J34 A;  2OLN A;  3ITJ A;  2BS4 A;  3UOY A;  1S3E A;  1H86 A;  3CPJ G;  4ICY A;  3C4N A;  3GMB A;  4JN9 A;  2UZZ A;  1RSG A;  4CCQ A;  2BC1 A;  3B3R A;  4OPI A;  1K0I A;  1PHH A;  3PVC A;  3VR9 A;  5C3J A;  4LII A;  3LOV A;  4U8P A;  1JOA A;  2CVJ A;  1PXA A;  4OPU A;  3UKL A;  3DK8 A;  1GRH A;  2HQM A;  4A9W A;  2TMD A;  4YT0 A;  5GSN A;  1ZMD A;  2Y6Q A;  1ZP0 A;  3F8P A;  2WPF A;  1NHQ A;  4EQS A;  1GXF A;  1DJN A;  3BHF A;  3G5R A;  4TM1 A;  4UDQ A;  3K30 A;  2A8X A;  2JBV A;  3G5Q A;  1IUW A;  4J57 A;  2X50 A;  4CY6 A;  1H6V A;  1V59 A;  1NG3 A;  4DNA A;  4USQ A;  1KSU A;  1H83 A;  3M0O A;  4BK3 A;  1NEN A;  2BXR A;  4TLX A;  4GRT A;  2GEW A;  3KVE A;  1N1P A;  1DOE A;  4TM0 A;  2WEU A;  4B69 A;  1PBB A;  4U8J A;  3P1W A;  1VQW A;  1LVL A;  1REO A;  1JNR A;  4Y4L A;  5JCN A;  1F8W A;  2V3B A;  3CPH G;  5KXJ A;  4A99 A;  3KPF A;  4OPC A;  2XLP A;  3UKF A;  4X9M A;  3ICS A;  1GRE A;  1TDF A;  3DGZ A;  2BK5 A;  3P9U A;  5IQ4 A;  3GYJ A;  5CQF A;  4U8I A;  1EBD A;  2RAB A;  4J33 A;  3NTA A;  4M52 A;  2CUL A;  1PBE A;  1XPQ A;  1XHC A;  1EL5 A;  4HA6 A;  2WOW A;  3GRT A;  3SGL A;  2X3N A;  1GTE A;  2RGO A;  2VOU A;  4MJW A;  2GR1 A;  4FK1 C;  4C74 A;  1ZX9 A;  2XVI A;  2ZZC A;  2RGJ A;  2GRT A;  3AE5 A;  4JNA A;  5C2T A;  3GWD A;  4RG3 A;  1FEC A;  3P4R A;  1DOD A;  3NTD A;  3QFB A;  4XWR A;  4B63 A;  5KOX A;  3HZL A;  4C77 A;  4U8K A;  4B68 A;  4FDC B;  4GR1 A;  1NDA A;  3NK0 X;  4H4S A;  4U2S A;  1F6M A;  2YG6 A;  5BUK A;  3UTG A;  3AXB A;  2B9Y A;  5FS7 A;  1CJC A;  2WDQ A;  4NEV A;  3T37 A;  2GQW A;  2XFN A;  2I0Z A;  4H4R A;  2FJD A;  1MO9 A;  4YSY A;  2Q7V A;  3C96 A;  4Z25 A;  4K5S A;  3ALL A;  2FBW A;  1FCD A;  1S3B A;  2FJA A;  4A7A A;  4DSG A;  4K7Z A;  3AD9 B;  3G5S A;  2WS3 A;  4WX1 A;  2A89 A;  2GR2 A;  2XLU A;  3GD4 A;  4Z2U A;  4RSL A;  1GPE A;  2Q6U A;  2Y6R A;  3EAN A;  3KKJ A;  3P4Q A;  2BK4 A;  3SQP A;  3AYL A;  4WCT A;  4ZCC A;  2XVE A;  3OC4 A;  2C67 A;  2XFQ A;  2YLR A;  1KNP A;  1IUS A;  3KU9 A;  4BJZ A;  5IPY A;  1DJQ A;  4NTC A;  2YVJ A;  4JNQ A;  2YLX A;  4UDP A;  3AD8 B;  1CL0 A;  1VDC A;  2GMJ A;  1GT8 A;  1IUU A;  2XDO A;  3NG7 X;  1YY5 A;  3ISH A;  2YR5 A;  3FPZ A;  1FL2 A;  1K4Q A;  2PYX A;  2APG A;  3NIX A;  2JK6 A;  3NLC A;  2E1M A;  2OAM A;  4EQR A;  4RG4 A;  2H89 A;  4Z26 A;  4A79 A;  2GF3 A;  4EM3 A;  2GAH B;  2C70 A;  1COY A;  3H4K A;  1PS9 A;  1H7X A;  3JSK A;  3L8K A;  4H2P A;  4AP1 A;  3NHO X;  1D7Y A;  3AE2 A;  5KOW A;  1E1M A;  1TRB A;  4H4W A;  4APN A;  1B8S A;  2C66 A;  2YR6 A;  1GET A;  1CJ3 A;  3AE1 A;  4ZN0 A;  2JB2 A;  3AEA A;  1Q1W A;  3RNM A;  3CGE A;  4H4T A;  3LZW A;  1S2Y A;  3ICT A;  3H8L A;  4GUV A;  1B5Q A;  2ARD A;  4C5O A;  2O9Z A;  2FJE A;  2B76 A;  4X4J A;  4ZCD A;  2R46 A;  3UKA A;  1PJ7 A;  2YLW A;  3LJP A;  4IVM B;  1Y56 A;  3FBS A;  3SFE A;  1JRX A;  2XFP A;  3LAD A;  2BK3 A;  1BWC A;  3IHG A;  5U25 A;  1QLB A;  1TYT A;  2V5Z A;  1CC6 A;  3BI5 A;  3LB8 A;  1CBO A;  3I6D A;  2Z5Y A;  3VRA A;  5FS9 A;  1O94 A;  4X9N A;  3UCL A;  2YLT A;  1LJ1 A;  1PBD A;  2AQJ A;  1VRQ B;  3Q9T A;  2V61 A;  2BCP A;  5J60 A;  2C64 A;  4D03 A;  4KX6 A;  3RP6 A;  3UP4 A;  1D4E A;  1JRY A;  3UTE A;  1OJ9 A;  2EQ7 A;  1O95 A;  3OZ2 A;  1L0V A;  1E7P A;  4P9S A;  2EQ8 A;  3GSI A;  3M12 A;  3KD9 A;  1DXL A;  4EIQ A;  4D04 A;  3QVR A;  2GR3 A;  1BKW A;  1L9D A;  1PXC A;  4LA1 A;  5M10 A;  1PJ6 A;  4HB9 A;  4IA5 A;  3UKK A;  1OJA A;  4H4X A;  1JRZ A;  5FS6 A;  1H7W A;  3DA1 A;  3RP7 A;  4XXG A;  4AT0 A;  5KRQ A;  3LZX A;  3CTY A;  1GV4 A;  1NHP A;  2BXS A;  3NGC X;  4FX9 A;  4H2Q A;  4YSZ A;  4H7U A;  1BF3 A;  4O5Q A;  3AD7 B;  4GF7 A;  3NKS A;  1YQ4 A;  2GQF A;  1MXT A;  2C73 A;  3AED A;  3DJD A;  3EF6 A;  1VG9 A;  1IJH A;  3I3L A;  1CHU A;  1L9E A;  1X31 B;  2WBA A;  4FK1 A;  3UOV A;  1YKJ A;  3VQR A;  4U8N A;  2XLT A;  2BYB A;  2Z5X A;  3NYC A;  4YXD A;  4A6N A;  4EM4 A;  3URH A;  2WPE A;  1BGJ A;  1QO8 A;  2OLO A;  2FJB A;  2VQB A;  4Z24 A;  2TPR A;  4CNK A;  2BC0 A;  3NYE A;  3DME A;  4J31 A;  4JDR A;  1LQU A; 
#chains in the Genus database with same CATH topology
 2GH5 A;  1S2Q A;  3AEG A;  1P2E A;  2YQU A;  3QVP A;  3CNS A;  1D4D A;  1LPF A;  2C65 A;  2X8G A;  2NVK X;  2ACZ A;  2YVF A;  3NN0 X;  1H82 A;  4H4V A;  2GVC A;  3DJE A;  4AT2 A;  4BJY A;  3DJJ A;  3QSM A;  2JB3 A;  2ZZ0 A;  4AP3 A;  1GAL A;  5KVI A;  3RP8 A;  4B67 A;  4C3X A;  4NTE A;  1YQ3 A;  3O0H A;  4EQW A;  3AEF A;  2WHD A;  1PN0 A;  3AE8 A;  3COX A;  1E1N A;  1ZMC A;  2YLZ A;  4NEW A;  4EMJ A;  2OAL A;  1IUX A;  2YM2 A;  1YQZ A;  2B7R A;  1M64 A;  1GEU A;  2JKC A;  3PO7 A;  4K2X A;  1JNZ A;  1DNC A;  2DKH A;  2Q0L A;  3ABV A;  3K7M X;  1Y0P A;  3DH9 A;  4PAA A;  1ZOY A;  1NPX A;  3EPT A;  3IWA A;  3ZYX A;  1CC4 A;  1IUT A;  2WU5 A;  3ALM A;  3FMW A;  3UP5 A;  5JCI A;  4U8O A;  3EAO A;  1ZK7 A;  2GAG B;  1FOH A;  2YM1 A;  2AR8 A;  1KNR A;  3ZDN A;  4A5L A;  1CC2 A;  2R4E A;  2VRL A;  1IUV A;  2YG7 A;  3AE6 A;  4JY3 A;  4N9X A;  4AOS A;  3CN8 A;  3P4S A;  4J56 A;  4KPR A;  1B4V A;  1OJD A;  1NG4 A;  2BCG G;  2CDU A;  4B65 A;  1E1K A;  4J2W A;  1D7L A;  1NAA A;  2C3C A;  4K22 A;  2WPC A;  3CGB A;  4NZH A;  2C76 A;  4CY8 A;  3E1T A;  2WDR A;  1GRG A;  4H2R A;  2Q0K A;  3NT6 A;  5HY5 A;  4C3Y A;  4H2N A;  3GMC A;  2C3D A;  5JCL A;  2QCU A;  3NNE A;  2VVL G;  2H88 A;  1UKV G;  3DGH A;  4B1B A;  4Z2T A;  1OJC A;  5EB4 A;  4U2T A;  4USR A;  3V3N A;  2GB0 A;  3DK4 A;  1DOB A;  3FIM B;  4XWZ A;  3GRS A;  4I59 A;  1F8R A;  3F8D A;  3QSS A;  2YWL A;  3BNU A;  1ZKQ A;  3RED A;  2EQ6 A;  3IHM A;  1NEK A;  3CNP A;  4TLZ A;  3M13 A;  2EQ9 A;  5U1O A;  3ICR A;  5U63 A;  2V6O A;  3AWI A;  2JAE A;  1GND A;  2BS2 A;  4EIP A;  3CND A;  1NHR A;  1GRF A;  1E1L A;  2YG3 A;  3GYX A;  4BUR A;  4CBQ A;  4OPD A;  2NPX A;  2XFU A;  3AEE A;  3UOZ A;  5EBK A;  1HYU A;  1XDI A;  2WP6 A;  1GTH A;  1BZL A;  2QA1 A;  3R9U A;  2WP9 A;  1TDE A;  2BS3 A;  3Q6J A;  2VVL A;  4TM3 A;  2BAC A;  1LV0 A;  5J7X A;  3ALJ A;  3GD3 A;  3GDN A;  3QSE A;  5EB5 A;  2E5V A;  1DOC A;  2WOI A;  3NK1 X;  1PBF A;  2A87 A;  5L46 A;  4DSH A;  1F3P A;  1D5T A;  1XAN A;  2GMH A;  1GOS A;  3T14 A;  4II3 A;  5M0Z A;  1PBC A;  3PS9 A;  2YLS A;  4YSX A;  4EQX A;  5JCK A;  4YTN A;  4H4Y A;  3QJ4 A;  4I58 A;  3BI2 A;  1GRA A;  3VR8 A;  4LU6 A;  3NH3 X;  4OVI A;  4H50 A;  2R0C A;  1N4W A;  3SY4 A;  1ONF A;  4B64 A;  4BK1 A;  1NHS A;  3DK9 A;  3GDP A;  1N4U A;  3CNJ A;  1RP0 A;  2YG5 A;  1MOK A;  3AEC A;  3BNM A;  4Z2R A;  4Y4N A;  2OA1 A;  4E0V A;  2R0G A;  4TM4 A;  1RYI A;  2WOV A;  2YG4 A;  3AE3 A;  3D8X A;  4H4Q A;  2DKI A;  2ZBW A;  3NN6 X;  1EL7 A;  3CMM A;  1CF3 A;  4H4Z A;  4IA6 A;  5JCM A;  2XLS A;  1TYP A;  2BAB A;  5TR3 A;  4GDE A;  4OPT A;  2V3A A;  1W4X A;  1KF6 A;  4Z44 A;  1Y56 B;  4DGK A;  2XCG A;  1AOG A;  1N4V A;  2WES A;  3BI4 A;  3AEB A;  1E39 A;  3CGD A;  1LQT A;  2XYO A;  3AE4 A;  2E4G A;  3K7T A;  4GDP A;  1Z6L A;  2QA2 A;  4OCG A;  3QFA A;  5KVH A;  2IID A;  1FEA A;  1ZY8 A;  2YVG A;  3HYW A;  5FMH A;  1KDG A;  4U8L A;  4OPL A;  3CPI G;  1ZOV A;  1F8S A;  1E6E A;  1GSN A;  3CNT A;  3B6D A;  5IQ1 A;  3LXD A;  1KSS A;  5CKU A;  5BRT A;  1GRT A;  3GWF A;  3KLJ A;  4H4U A;  4CCR A;  1TDO A;  2W0H A;  1ZDL A;  3NRN A;  4EMW A;  4BK2 A;  3CGC A;  4YSH A;  5HYM A;  4UP3 A;  5DBJ A;  4Z43 A;  2R45 A;  2R4J A;  5KWF A;  2ZZB A;  2VQ7 A;  2B9X A;  2C7G A;  4YKF A;  2JB1 A;  2XVF A;  2WDV A;  2GR0 A;  1Q1R A;  1CJ2 A;  2X99 A;  3T31 A;  2WU2 A;  3VRB A;  1ELI A;  3AE7 A;  2VZ2 A;  2XVH A;  4U2L A;  4Y4M A;  3VRD B;  4REK A;  3FG2 P;  5LV9 A;  2VVM A;  3KA7 A;  4GAV A;  1D4C A;  1GRB A;  2IVD A;  3UKH A;  4U8M A;  3UKP A;  1B37 A;  3AB1 A;  1GER A;  1QJD A;  2F5Z A;  4EMI A;  1PJ5 A;  3II4 A;  4JQ9 A;  4B66 A;  2RGH A;  3DJG X;  1FEB A;  2XLR A;  1OJT A;  1BGN A;  4G6G A;  4A6N B;  1O5W A;  2V60 A;  5EOW A;  3RHA A;  2VRM A;  1JU2 A;  2C75 A;  4GAP A;  1Q9I A;  3L1R A;  4J36 A;  4IV9 A;  4IVO B;  1K0J A;  4BV6 A;  1PXB A;  3SFD A;  1GES A;  3CIR A;  4YTM A;  2CFY A;  3UKQ A;  5BUL A;  3V76 A;  2WQY A;  2BA9 A;  2XVJ A;  1EL8 A;  3P4P A;  4G74 A;  2IVE A;  2J3N A;  5GRT A;  2X8H A;  3IF9 A;  3UTH A;  4ECH A;  3BHK A;  2B9W A;  1P2H A;  1H84 A;  2YAU A;  3KPK A;  5BVA A;  3NYF A;  4CNJ A;  3IC9 A;  1KFY A;  1L9C A;  1JEH A;  2X8C A;  2GV8 A;  4PAB A;  4K8D A;  1M6I A;  3F8R A;  2YR4 A;  4OPG A;  1VG0 A;  4ADW A;  2PHH A;  1TDK A;  2QAE A;  5HHF A;  3D1C A;  1H81 A;  1SEZ A;  5FS8 A;  5KMP A;  3ATR A;  3SM8 A;  2AAQ A;  3AE9 A;  4YTP A;  3S61 A;  3AYJ A;  4H4P A;  3UTF A;  3S5W A;  4A65 A;  3HYX A;  2XFO A;  3H8I A;  4CRT A;  4NWZ A;  3NK2 X;  4GCM A;  1LTX R;  4O5U A;  3ADA B;  4JY2 A;  1CJ4 A;  4AOX A;  1EL9 A;  4K5R A;  3HYV A;  3AYI A;  5HXI A;  4UDR A;  1PDH A;  2WP5 A;  3K7Q X;  5ER0 A;  3UOX A;  2B7S A;  2R9Z A;  1TDN A;  3C4A A;  4YKG A;  5KMR A;  2C72 A;  3GYI A;  2R0P A;  4NTD A;  3WE0 A;  1K0L A;  4YWO A;  3V3O A;  3ATQ A;  2WET A;  4J34 A;  2OLN A;  3ITJ A;  2BS4 A;  3UOY A;  1S3E A;  1H86 A;  3CPJ G;  4ICY A;  3C4N A;  3GMB A;  4JN9 A;  2UZZ A;  1RSG A;  4CCQ A;  2BC1 A;  3B3R A;  4OPI A;  1K0I A;  1PHH A;  3PVC A;  3T2Z A;  3VR9 A;  5C3J A;  4LII A;  3T2K A;  3LOV A;  4U8P A;  1JOA A;  2CVJ A;  1PXA A;  4OPU A;  3UKL A;  3DK8 A;  1GRH A;  2HQM A;  4A9W A;  2TMD A;  4YT0 A;  5GSN A;  1ZMD A;  2Y6Q A;  1ZP0 A;  3F8P A;  2WPF A;  1NHQ A;  4EQS A;  1GXF A;  1DJN A;  3BHF A;  3G5R A;  4TM1 A;  4UDQ A;  3K30 A;  2A8X A;  2JBV A;  3G5Q A;  1IUW A;  4J57 A;  2X50 A;  4CY6 A;  1H6V A;  4II2 A;  1V59 A;  1NG3 A;  4DNA A;  4USQ A;  1KSU A;  1H83 A;  3M0O A;  4BK3 A;  1NEN A;  2BXR A;  4TLX A;  4GRT A;  3SXI A;  2GEW A;  3KVE A;  1N1P A;  1DOE A;  4TM0 A;  2WEU A;  4B69 A;  1PBB A;  4U8J A;  3P1W A;  1VQW A;  1LVL A;  1REO A;  1JNR A;  4Y4L A;  5JCN A;  1F8W A;  2V3B A;  3CPH G;  5KXJ A;  4A99 A;  3KPF A;  4OPC A;  2XLP A;  3UKF A;  4X9M A;  3ICS A;  1GRE A;  1TDF A;  3DGZ A;  2BK5 A;  3P9U A;  5IQ4 A;  3GYJ A;  5CQF A;  4U8I A;  3SX6 A;  1EBD A;  2RAB A;  4J33 A;  3NTA A;  4M52 A;  2CUL A;  1PBE A;  1XPQ A;  1XHC A;  1EL5 A;  4HA6 A;  2WOW A;  3GRT A;  3SGL A;  2X3N A;  1GTE A;  2RGO A;  2VOU A;  4MJW A;  2GR1 A;  4FK1 C;  4C74 A;  1ZX9 A;  2XVI A;  2ZZC A;  2RGJ A;  2GRT A;  3AE5 A;  4JNA A;  5C2T A;  3GWD A;  4RG3 A;  1FEC A;  3P4R A;  1DOD A;  3NTD A;  3QFB A;  4XWR A;  4B63 A;  5KOX A;  3HZL A;  4C77 A;  4U8K A;  4B68 A;  4FDC B;  4GR1 A;  1NDA A;  3NK0 X;  4H4S A;  4U2S A;  1F6M A;  2YG6 A;  5BUK A;  3UTG A;  3AXB A;  2B9Y A;  5FS7 A;  1CJC A;  2WDQ A;  4NEV A;  3T37 A;  2GQW A;  2XFN A;  2I0Z A;  4H4R A;  2FJD A;  1MO9 A;  4YSY A;  2Q7V A;  3C96 A;  4Z25 A;  4K5S A;  3ALL A;  3SZ0 A;  2FBW A;  1FCD A;  1S3B A;  2FJA A;  4A7A A;  4DSG A;  4K7Z A;  3AD9 B;  3SZW A;  3G5S A;  2WS3 A;  4WX1 A;  2A89 A;  2GR2 A;  2XLU A;  3GD4 A;  4Z2U A;  4RSL A;  1GPE A;  2Q6U A;  2Y6R A;  3EAN A;  3KKJ A;  3P4Q A;  2BK4 A;  3SQP A;  3AYL A;  4WCT A;  4ZCC A;  2XVE A;  3OC4 A;  2C67 A;  2XFQ A;  2YLR A;  5KMQ A;  1KNP A;  1IUS A;  3KU9 A;  4BJZ A;  5IPY A;  1DJQ A;  4NTC A;  4G73 A;  2YVJ A;  4JNQ A;  2YLX A;  4UDP A;  3AD8 B;  4G6H A;  1CL0 A;  1VDC A;  2GMJ A;  1GT8 A;  1IUU A;  2XDO A;  3NG7 X;  1YY5 A;  3ISH A;  2YR5 A;  3FPZ A;  1FL2 A;  1K4Q A;  2PYX A;  2APG A;  3NIX A;  2JK6 A;  3NLC A;  2E1M A;  2OAM A;  4EQR A;  4RG4 A;  2H89 A;  4Z26 A;  4A79 A;  2GF3 A;  2BRY A;  4EM3 A;  2GAH B;  2C70 A;  1COY A;  3H4K A;  1PS9 A;  1H7X A;  3JSK A;  3L8K A;  4H2P A;  4AP1 A;  3NHO X;  1D7Y A;  3AE2 A;  3T0K A;  1E1M A;  1TRB A;  4H4W A;  4APN A;  1B8S A;  5KOW A;  2C66 A;  2YR6 A;  4G9K A;  1GET A;  1CJ3 A;  3AE1 A;  4ZN0 A;  2JB2 A;  3AEA A;  1Q1W A;  3RNM A;  3CGE A;  4H4T A;  3LZW A;  1S2Y A;  3ICT A;  3H8L A;  4GUV A;  3SYI A;  1B5Q A;  2ARD A;  4C5O A;  2O9Z A;  2FJE A;  2C4C A;  2B76 A;  4X4J A;  4ZCD A;  4NNJ A;  2R46 A;  3UKA A;  1PJ7 A;  2YLW A;  3LJP A;  4IVM B;  1Y56 A;  3FBS A;  3SFE A;  1JRX A;  2XFP A;  3LAD A;  2BK3 A;  1BWC A;  3IHG A;  5U25 A;  1QLB A;  1TYT A;  2V5Z A;  1CC6 A;  3BI5 A;  3LB8 A;  1CBO A;  3I6D A;  2Z5Y A;  3VRA A;  3SZC A;  5FS9 A;  1O94 A;  4X9N A;  3UCL A;  2YLT A;  1LJ1 A;  1PBD A;  2AQJ A;  1VRQ B;  2BRA A;  3Q9T A;  2V61 A;  2BCP A;  5J60 A;  2C64 A;  4D03 A;  3T2Y A;  5KMS A;  4KX6 A;  3RP6 A;  3UP4 A;  1D4E A;  1JRY A;  3UTE A;  1OJ9 A;  2EQ7 A;  1O95 A;  3OZ2 A;  1L0V A;  1E7P A;  4P9S A;  2EQ8 A;  3GSI A;  3M12 A;  3KD9 A;  1DXL A;  3SZF A;  4EIQ A;  4D04 A;  3QVR A;  2GR3 A;  1BKW A;  1L9D A;  1PXC A;  4LA1 A;  5M10 A;  1PJ6 A;  4HB9 A;  4IA5 A;  3UKK A;  1OJA A;  4H4X A;  1JRZ A;  5FS6 A;  1H7W A;  3DA1 A;  3RP7 A;  4XXG A;  4AT0 A;  5KRQ A;  3LZX A;  3CTY A;  1GV4 A;  1NHP A;  2BXS A;  3NGC X;  4FX9 A;  4H2Q A;  4YSZ A;  4H7U A;  1BF3 A;  4O5Q A;  3AD7 B;  4GF7 A;  3NKS A;  1YQ4 A;  2GQF A;  1MXT A;  2C73 A;  3AED A;  3DJD A;  3EF6 A;  1VG9 A;  1IJH A;  3I3L A;  1CHU A;  1L9E A;  1X31 B;  2WBA A;  4FK1 A;  3UOV A;  1YKJ A;  3VQR A;  4U8N A;  2XLT A;  2BYB A;  2Z5X A;  3NYC A;  4YXD A;  4A6N A;  4EM4 A;  3URH A;  2WPE A;  1BGJ A;  1QO8 A;  2OLO A;  2FJB A;  2VQB A;  4Z24 A;  2TPR A;  4CNK A;  2BC0 A;  3NYE A;  3DME A;  4J31 A;  4JDR A;  5KNL A;  1LQU A; 
#chains in the Genus database with same CATH homology
 2GH5 A;  1S2Q A;  3AEG A;  1P2E A;  2YQU A;  3QVP A;  3CNS A;  1D4D A;  1LPF A;  2C65 A;  2X8G A;  2NVK X;  2ACZ A;  2YVF A;  3NN0 X;  1H82 A;  4H4V A;  2GVC A;  3DJE A;  4AT2 A;  4BJY A;  3DJJ A;  3QSM A;  2JB3 A;  2ZZ0 A;  4AP3 A;  1GAL A;  5KVI A;  3RP8 A;  4B67 A;  4C3X A;  4NTE A;  1YQ3 A;  3O0H A;  4EQW A;  3AEF A;  2WHD A;  1PN0 A;  3AE8 A;  3COX A;  1E1N A;  1ZMC A;  2YLZ A;  4NEW A;  4EMJ A;  2OAL A;  1IUX A;  2YM2 A;  1YQZ A;  2B7R A;  1M64 A;  1GEU A;  2JKC A;  3PO7 A;  4K2X A;  1JNZ A;  1DNC A;  2DKH A;  2Q0L A;  3ABV A;  3K7M X;  1Y0P A;  3DH9 A;  4PAA A;  1ZOY A;  1NPX A;  3EPT A;  3IWA A;  3ZYX A;  1CC4 A;  1IUT A;  2WU5 A;  3ALM A;  3FMW A;  3UP5 A;  5JCI A;  4U8O A;  3EAO A;  1ZK7 A;  2GAG B;  1FOH A;  2YM1 A;  2AR8 A;  1KNR A;  3ZDN A;  4A5L A;  1CC2 A;  2R4E A;  2VRL A;  1IUV A;  2YG7 A;  3AE6 A;  4JY3 A;  4N9X A;  4AOS A;  3CN8 A;  3P4S A;  4J56 A;  4KPR A;  1B4V A;  1OJD A;  1NG4 A;  2BCG G;  2CDU A;  4B65 A;  1E1K A;  4J2W A;  1D7L A;  1NAA A;  2C3C A;  4K22 A;  2WPC A;  3CGB A;  4NZH A;  2C76 A;  4CY8 A;  3E1T A;  2WDR A;  1GRG A;  4H2R A;  2Q0K A;  3NT6 A;  5HY5 A;  4C3Y A;  4H2N A;  3GMC A;  2C3D A;  5JCL A;  2QCU A;  3NNE A;  2VVL G;  2H88 A;  1UKV G;  3DGH A;  4B1B A;  4Z2T A;  1OJC A;  5EB4 A;  4U2T A;  4USR A;  3V3N A;  2GB0 A;  3DK4 A;  1DOB A;  3FIM B;  4XWZ A;  3GRS A;  4I59 A;  1F8R A;  3F8D A;  3QSS A;  2YWL A;  3BNU A;  1ZKQ A;  3RED A;  2EQ6 A;  3IHM A;  1NEK A;  3CNP A;  4TLZ A;  3M13 A;  2EQ9 A;  5U1O A;  3ICR A;  5U63 A;  2V6O A;  3AWI A;  2JAE A;  1GND A;  2BS2 A;  4EIP A;  3CND A;  1NHR A;  1GRF A;  1E1L A;  2YG3 A;  3GYX A;  4BUR A;  4CBQ A;  4OPD A;  2NPX A;  2XFU A;  3AEE A;  3UOZ A;  5EBK A;  1HYU A;  1XDI A;  2WP6 A;  1GTH A;  1BZL A;  2QA1 A;  3R9U A;  2WP9 A;  1TDE A;  2BS3 A;  3Q6J A;  2VVL A;  4TM3 A;  2BAC A;  1LV0 A;  5J7X A;  3ALJ A;  3GD3 A;  3GDN A;  3QSE A;  5EB5 A;  2E5V A;  1DOC A;  2WOI A;  3NK1 X;  1PBF A;  2A87 A;  5L46 A;  4DSH A;  1F3P A;  1D5T A;  1XAN A;  2GMH A;  1GOS A;  3T14 A;  4II3 A;  5M0Z A;  1PBC A;  3PS9 A;  2YLS A;  4YSX A;  4EQX A;  5JCK A;  4YTN A;  4H4Y A;  3QJ4 A;  4I58 A;  3BI2 A;  1GRA A;  3VR8 A;  4LU6 A;  3NH3 X;  4OVI A;  4H50 A;  2R0C A;  1N4W A;  3SY4 A;  1ONF A;  4B64 A;  4BK1 A;  1NHS A;  3DK9 A;  3GDP A;  1N4U A;  3CNJ A;  1RP0 A;  2YG5 A;  1MOK A;  3AEC A;  3BNM A;  4Z2R A;  4Y4N A;  2OA1 A;  4E0V A;  2R0G A;  4TM4 A;  1RYI A;  2WOV A;  2YG4 A;  3AE3 A;  3D8X A;  4H4Q A;  2DKI A;  2ZBW A;  3NN6 X;  1EL7 A;  3CMM A;  1CF3 A;  4H4Z A;  4IA6 A;  5JCM A;  2XLS A;  1TYP A;  2BAB A;  5TR3 A;  4GDE A;  4OPT A;  2V3A A;  1W4X A;  1KF6 A;  4Z44 A;  1Y56 B;  4DGK A;  2XCG A;  1AOG A;  1N4V A;  2WES A;  3BI4 A;  3AEB A;  1E39 A;  3CGD A;  1LQT A;  2XYO A;  3AE4 A;  2E4G A;  3K7T A;  4GDP A;  1Z6L A;  2QA2 A;  4OCG A;  3QFA A;  5KVH A;  2IID A;  1FEA A;  1ZY8 A;  2YVG A;  3HYW A;  5FMH A;  1KDG A;  4U8L A;  4OPL A;  3CPI G;  1ZOV A;  1F8S A;  1E6E A;  1GSN A;  3CNT A;  3B6D A;  5IQ1 A;  3LXD A;  1KSS A;  5CKU A;  5BRT A;  1GRT A;  3GWF A;  3KLJ A;  4H4U A;  4CCR A;  1TDO A;  2W0H A;  1ZDL A;  3NRN A;  4EMW A;  4BK2 A;  3CGC A;  4YSH A;  5HYM A;  4UP3 A;  5DBJ A;  4Z43 A;  2R45 A;  2R4J A;  5KWF A;  2ZZB A;  2VQ7 A;  2B9X A;  2C7G A;  4YKF A;  2JB1 A;  2XVF A;  2WDV A;  2GR0 A;  1Q1R A;  1CJ2 A;  2X99 A;  3T31 A;  2WU2 A;  3VRB A;  1ELI A;  3AE7 A;  2VZ2 A;  2XVH A;  4U2L A;  4Y4M A;  3VRD B;  4REK A;  3FG2 P;  5LV9 A;  2VVM A;  3KA7 A;  4GAV A;  1D4C A;  1GRB A;  2IVD A;  3UKH A;  4U8M A;  3UKP A;  1B37 A;  3AB1 A;  1GER A;  1QJD A;  2F5Z A;  4EMI A;  1PJ5 A;  3II4 A;  4JQ9 A;  4B66 A;  2RGH A;  3DJG X;  1FEB A;  2XLR A;  1OJT A;  1BGN A;  4G6G A;  4A6N B;  1O5W A;  2V60 A;  5EOW A;  3RHA A;  2VRM A;  1JU2 A;  2C75 A;  4GAP A;  1Q9I A;  3L1R A;  4J36 A;  4IV9 A;  4IVO B;  1K0J A;  4BV6 A;  1PXB A;  3SFD A;  1GES A;  3CIR A;  4YTM A;  2CFY A;  3UKQ A;  5BUL A;  3V76 A;  2WQY A;  2BA9 A;  2XVJ A;  1EL8 A;  3P4P A;  4G74 A;  2IVE A;  2J3N A;  5GRT A;  2X8H A;  3IF9 A;  3UTH A;  4ECH A;  3BHK A;  2B9W A;  1P2H A;  1H84 A;  2YAU A;  3KPK A;  5BVA A;  3NYF A;  4CNJ A;  3IC9 A;  1KFY A;  1L9C A;  1JEH A;  2X8C A;  2GV8 A;  4PAB A;  4K8D A;  1M6I A;  3F8R A;  2YR4 A;  4OPG A;  1VG0 A;  4ADW A;  2PHH A;  1TDK A;  2QAE A;  5HHF A;  3D1C A;  1H81 A;  1SEZ A;  5FS8 A;  5KMP A;  3ATR A;  3SM8 A;  2AAQ A;  3AE9 A;  4YTP A;  3S61 A;  3AYJ A;  4H4P A;  3UTF A;  3S5W A;  4A65 A;  3HYX A;  2XFO A;  3H8I A;  4CRT A;  4NWZ A;  3NK2 X;  4GCM A;  1LTX R;  4O5U A;  3ADA B;  4JY2 A;  1CJ4 A;  4AOX A;  1EL9 A;  4K5R A;  3HYV A;  3AYI A;  5HXI A;  4UDR A;  1PDH A;  2WP5 A;  3K7Q X;  5ER0 A;  3UOX A;  2B7S A;  2R9Z A;  1TDN A;  3C4A A;  4YKG A;  5KMR A;  2C72 A;  3GYI A;  2R0P A;  4NTD A;  3WE0 A;  1K0L A;  4YWO A;  3V3O A;  3ATQ A;  2WET A;  4J34 A;  2OLN A;  3ITJ A;  2BS4 A;  3UOY A;  1S3E A;  1H86 A;  3CPJ G;  4ICY A;  3C4N A;  3GMB A;  4JN9 A;  2UZZ A;  1RSG A;  4CCQ A;  2BC1 A;  3B3R A;  4OPI A;  1K0I A;  1PHH A;  3PVC A;  3T2Z A;  3VR9 A;  5C3J A;  4LII A;  3T2K A;  3LOV A;  4U8P A;  1JOA A;  2CVJ A;  1PXA A;  4OPU A;  3UKL A;  3DK8 A;  1GRH A;  2HQM A;  4A9W A;  2TMD A;  4YT0 A;  5GSN A;  1ZMD A;  2Y6Q A;  1ZP0 A;  3F8P A;  2WPF A;  1NHQ A;  4EQS A;  1GXF A;  1DJN A;  3BHF A;  3G5R A;  4TM1 A;  4UDQ A;  3K30 A;  2A8X A;  2JBV A;  3G5Q A;  1IUW A;  4J57 A;  2X50 A;  4CY6 A;  1H6V A;  4II2 A;  1V59 A;  1NG3 A;  4DNA A;  4USQ A;  1KSU A;  1H83 A;  3M0O A;  4BK3 A;  1NEN A;  2BXR A;  4TLX A;  4GRT A;  3SXI A;  2GEW A;  3KVE A;  1N1P A;  1DOE A;  4TM0 A;  2WEU A;  4B69 A;  1PBB A;  4U8J A;  3P1W A;  1VQW A;  1LVL A;  1REO A;  1JNR A;  4Y4L A;  5JCN A;  1F8W A;  2V3B A;  3CPH G;  5KXJ A;  4A99 A;  3KPF A;  4OPC A;  2XLP A;  3UKF A;  4X9M A;  3ICS A;  1GRE A;  1TDF A;  3DGZ A;  2BK5 A;  3P9U A;  5IQ4 A;  3GYJ A;  5CQF A;  4U8I A;  3SX6 A;  1EBD A;  2RAB A;  4J33 A;  3NTA A;  4M52 A;  2CUL A;  1PBE A;  1XPQ A;  1XHC A;  1EL5 A;  4HA6 A;  2WOW A;  3GRT A;  3SGL A;  2X3N A;  1GTE A;  2RGO A;  2VOU A;  4MJW A;  2GR1 A;  4FK1 C;  4C74 A;  1ZX9 A;  2XVI A;  2ZZC A;  2RGJ A;  2GRT A;  3AE5 A;  4JNA A;  5C2T A;  3GWD A;  4RG3 A;  1FEC A;  3P4R A;  1DOD A;  3NTD A;  3QFB A;  4XWR A;  4B63 A;  5KOX A;  3HZL A;  4C77 A;  4U8K A;  4B68 A;  4FDC B;  4GR1 A;  1NDA A;  3NK0 X;  4H4S A;  4U2S A;  1F6M A;  2YG6 A;  5BUK A;  3UTG A;  3AXB A;  2B9Y A;  5FS7 A;  1CJC A;  2WDQ A;  4NEV A;  3T37 A;  2GQW A;  2XFN A;  2I0Z A;  4H4R A;  2FJD A;  1MO9 A;  4YSY A;  2Q7V A;  3C96 A;  4Z25 A;  4K5S A;  3ALL A;  3SZ0 A;  2FBW A;  1FCD A;  1S3B A;  2FJA A;  4A7A A;  4DSG A;  4K7Z A;  3AD9 B;  3SZW A;  3G5S A;  2WS3 A;  4WX1 A;  2A89 A;  2GR2 A;  2XLU A;  3GD4 A;  4Z2U A;  4RSL A;  1GPE A;  2Q6U A;  2Y6R A;  3EAN A;  3KKJ A;  3P4Q A;  2BK4 A;  3SQP A;  3AYL A;  4WCT A;  4ZCC A;  2XVE A;  3OC4 A;  2C67 A;  2XFQ A;  2YLR A;  5KMQ A;  1KNP A;  1IUS A;  3KU9 A;  4BJZ A;  5IPY A;  1DJQ A;  4NTC A;  4G73 A;  2YVJ A;  4JNQ A;  2YLX A;  4UDP A;  3AD8 B;  4G6H A;  1CL0 A;  1VDC A;  2GMJ A;  1GT8 A;  1IUU A;  2XDO A;  3NG7 X;  1YY5 A;  3ISH A;  2YR5 A;  3FPZ A;  1FL2 A;  1K4Q A;  2PYX A;  2APG A;  3NIX A;  2JK6 A;  3NLC A;  2E1M A;  2OAM A;  4EQR A;  4RG4 A;  2H89 A;  4Z26 A;  4A79 A;  2GF3 A;  2BRY A;  4EM3 A;  2GAH B;  2C70 A;  1COY A;  3H4K A;  1PS9 A;  1H7X A;  3JSK A;  3L8K A;  4H2P A;  4AP1 A;  3NHO X;  1D7Y A;  3AE2 A;  3T0K A;  1E1M A;  1TRB A;  4H4W A;  4APN A;  1B8S A;  5KOW A;  2C66 A;  2YR6 A;  4G9K A;  1GET A;  1CJ3 A;  3AE1 A;  4ZN0 A;  2JB2 A;  3AEA A;  1Q1W A;  3RNM A;  3CGE A;  4H4T A;  3LZW A;  1S2Y A;  3ICT A;  3H8L A;  4GUV A;  3SYI A;  1B5Q A;  2ARD A;  4C5O A;  2O9Z A;  2FJE A;  2C4C A;  2B76 A;  4X4J A;  4ZCD A;  4NNJ A;  2R46 A;  3UKA A;  1PJ7 A;  2YLW A;  3LJP A;  4IVM B;  1Y56 A;  3FBS A;  3SFE A;  1JRX A;  2XFP A;  3LAD A;  2BK3 A;  1BWC A;  3IHG A;  5U25 A;  1QLB A;  1TYT A;  2V5Z A;  1CC6 A;  3BI5 A;  3LB8 A;  1CBO A;  3I6D A;  2Z5Y A;  3VRA A;  3SZC A;  5FS9 A;  1O94 A;  4X9N A;  3UCL A;  2YLT A;  1LJ1 A;  1PBD A;  2AQJ A;  1VRQ B;  2BRA A;  3Q9T A;  2V61 A;  2BCP A;  5J60 A;  2C64 A;  4D03 A;  3T2Y A;  5KMS A;  4KX6 A;  3RP6 A;  3UP4 A;  1D4E A;  1JRY A;  3UTE A;  1OJ9 A;  2EQ7 A;  1O95 A;  3OZ2 A;  1L0V A;  1E7P A;  4P9S A;  2EQ8 A;  3GSI A;  3M12 A;  3KD9 A;  1DXL A;  3SZF A;  4EIQ A;  4D04 A;  3QVR A;  2GR3 A;  1BKW A;  1L9D A;  1PXC A;  4LA1 A;  5M10 A;  1PJ6 A;  4HB9 A;  4IA5 A;  3UKK A;  1OJA A;  4H4X A;  1JRZ A;  5FS6 A;  1H7W A;  3DA1 A;  3RP7 A;  4XXG A;  4AT0 A;  5KRQ A;  3LZX A;  3CTY A;  1GV4 A;  1NHP A;  2BXS A;  3NGC X;  4FX9 A;  4H2Q A;  4YSZ A;  4H7U A;  1BF3 A;  4O5Q A;  3AD7 B;  4GF7 A;  3NKS A;  1YQ4 A;  2GQF A;  1MXT A;  2C73 A;  3AED A;  3DJD A;  3EF6 A;  1VG9 A;  1IJH A;  3I3L A;  1CHU A;  1L9E A;  1X31 B;  2WBA A;  4FK1 A;  3UOV A;  1YKJ A;  3VQR A;  4U8N A;  2XLT A;  2BYB A;  2Z5X A;  3NYC A;  4YXD A;  4A6N A;  4EM4 A;  3URH A;  2WPE A;  1BGJ A;  1QO8 A;  2OLO A;  2FJB A;  2VQB A;  4Z24 A;  2TPR A;  4CNK A;  2BC0 A;  3NYE A;  3DME A;  4J31 A;  4JDR A;  5KNL A;  1LQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...