2XLSA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78lys mutant
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
446
structure length
446
Chain Sequence
SMATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSKGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint-Functions of Protein Residues and Nadp(H) in Oxygen-Activation by Flavin-Containing Monooxygenase
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
total genus 157
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlsA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlsA02
3H4KA 3ALJA 2DKHA 3DMEA 5CKUA 4YSZA 1GTHA 2BACA 1L9CA 4AP1A 1EBDA 3UKFA 3UOYA 2YG5A 2YG3A 4H4VA 3NHOX 5FS9A 3NGCX 4YTNA 4H4RA 1D7YA 1GREA 3M13A 4YXDA 3AE2A 2WEUA 2E4GA 5IPYA 3GMCA 3AE7A 3F8RA 3JSKA 4H7UA 1P2HA 2BK3A 2OLOA 2E1MA 2Q0LA 1B8SA 3UKQA 4GF7A 4B63A 1GEUA 4CRTA 2AQJA 4X9MA 1E1LA 3NYFA 2WPEA 2XLSA 4IV9A 2X3NA 2CFYA 4AOSA 4B66A 4C74A 4EIPA 3ALLA 3CGEA 1BF3A 4WX1A 3RNMA 1GT8A 4FK1C 4XWRA 1VDCA 2WP6A 3RP6A 1SEZA 2WP5A 3REDA 1FCDA 1L0VA 1LQUA 3M0OA 1TRBA 2C65A 4LA1A 2WQYA 2VRLA 1GRGA 1F8RA 4EM3A 4UDRA 3AE4A 1NAAA 3QFBA 1XHCA 2XDOA 1L9DA 3BI5A 3NH3X 5JCNA 1M6IA 2C66A 4Z2TA 3QSEA 2TMDA 2Q0KA 4B64A 2GR0A 2I0ZA 1GPEA 1D4CA 2V61A 3NNEA 3P4SA 4NTEA 3C4NA 5IQ4A 1BWCA 1CJ2A 1S2YA 2X50A 5JCMA 1IUSA 1IUUA 2ZBWA 4H2RA 3SFDA 2DKIA 3AECA 3UOXA 4DGKA 2XLPA 3DJDA 4Y4LA 4CY8A 2VQBA 1N4WA 4B68A 1NENA 1GNDA 2B9XA 4X9NA 1B5QA 2TPRA 1B37A 3DK8A 4ECHA 2BYBA 5IQ1A 1F6MA 4E0VA 4FDCB 1NHQA 2Q7VA 1E1NA 2Y6QA 2XCGA 3AWIA 1CC2A 1ELIA 1FEAA 4TM3A 3EAOA 1JOAA 1Q1RA 1RP0A 2QA1A 3AEAA 3FPZA 2GMHA 1IJHA 3UKHA 1E39A 2OALA 1H82A 2APGA 2GR2A 3AB1A 4O5UA 3AE9A 1Y0PA 3SFEA 2BK5A 3LOVA 3AEFA 2BXSA 4H4XA 4BJYA 4JY2A 2QA2A 1GRTA 2H88A 2YR6A 3NK2X 4PABA 3ICRA 1H86A 3NKSA 2JB3A 2VOUA 3UOVA 3DA1A 5KXJA 1FOHA 3I6DA 4HB9A 4B1BA 3LB8A 4U8KA 4A99A 4LIIA 2YM2A 3AD7B 2YG7A 1S2QA 2BCGG 4H4QA 4JNQA 3DGHA 3LZXA 3UTGA 3AEGA 3AE6A 4AP3A 5KOXA 3P1WA 2JB1A 1K0JA 2CULA 2XLUA 4BK2A 5ER0A 1Q1WA 2YVJA 1OJAA 2CVJA 3DK4A 4OPIA 1LPFA 4YKGA 2C72A 2FJBA 2WU2A 1EL8A 2EQ9A 4JDRA 4DSHA 1YKJA 3DH9A 3FG2P 1TYTA 2Q6UA 4YSHA 2V3BA 1N4VA 1KF6A 3SM8A 5BVAA 5C3JA 3D1CA 3K7MX 1B4VA 5U25A 5M10A 2VVLA 4H2NA 1LJ1A 2YR4A 5GSNA 1CJ4A 3CNJA 3GDNA 4GDPA 4OPTA 1GRBA 1BZLA 4JQ9A 4A7AA 1IUVA 3V3NA 5KWFA 1GESA 1UKVG 2XVHA 5TR3A 1ZP0A 3BHKA 3I3LA 1PJ5A 4U2SA 2E5VA 2GMJA 4U8MA 2R46A 2BC1A 1VG0A 2V60A 1CC6A 1RYIA 3T37A 2ZZCA 3S61A 1N1PA 1EL5A 4UDPA 1JRYA 1EL9A 1ZMCA 2X8CA 3FBSA 3P4QA 2NVKX 4FK1A 2BS3A 5GRTA 4Z25A 3GD3A 4K22A 1PBCA 2BS4A 1JNZA 2C76A 2OAMA 1GETA 3URHA 4AT2A 2R0CA 2YQUA 2ZZBA 4NTCA 2R4JA 3CNPA 3B6DA 3VQRA 4J57A 2WESA 2BA9A 2IVEA 1KDGA 5KRQA 3ABVA 4YSXA 3G5SA 1CJ3A 1XPQA 2BXRA 3ITJA 4EQWA 2XVIA 1DNCA 3COXA 3NT6A 4Z44A 2C70A 1PXAA 3QSSA 2PYXA 1CJCA 2VZ2A 3FMWA 3KVEA 3AE8A 2VRMA 3AYIA 4C3XA 1IUXA 1ZY8A 1D4DA 4H50A 4HA6A 2FBWA 3UKAA 2FJEA 1QLBA 2R4EA 2W0HA 1DOBA 5KOWA 1D5TA 4JY3A 4DNAA 2BK4A 4USQA 3UP5A 2WETA 2V3AA 3DJJA 3NRNA 5FMHA 3GWFA 3OZ2A 4J56A 3V76A 4A6NA 2C7GA 3C4AA 4H4UA 1GXFA 2RGJA 1BKWA 3NN6X 2C75A 4M52A 1TYPA 3NIXA 3AYJA 1DJNA 2AAQA 3GWDA 2H89A 3CGBA 1NHPA 1COYA 2EQ6A 4U8IA 1O95A 3DJGX 4IVMB 5LV9A 1CC4A 2J3NA 1IUTA 4YWOA 2WDVA 3Q6JA 3ADAB 2C73A 2YVFA 2YVGA 3BHFA 3ISHA 1XDIA 4A65A 1GRAA 4EMWA 2WHDA 4PAAA 4GRTA 1LV0A 1D7LA 1O5WA 2XVEA 3H8IA 3SQPA 1HYUA 4BV6A 2C3DA 1V59A 1JRZA 2B9YA 3PVCA 4IA5A 4YTMA 4B65A 3WE0A 3FIMB 4O5QA 3CPHG 2XFNA 3QJ4A 4Y4NA 2XYOA 3F8DA 2R0PA 2YLSA 1DXLA 3AEEA 4CCQA 4NEWA 4K8DA 4TM4A 4X4JA 3AE3A 2WOVA 1QJDA 4J34A 4D04A 4BK3A 4I58A 3LZWA 1Z6LA 2ACZA 4TLXA 2GAHB 3NYCA 4IVOB 4UP3A 2UZZA 1TDFA 3UTHA 1PBFA 4FX9A 2X99A 3AXBA 3VR9A 1ZKQA 2GR3A 2YLWA 3ATRA 3CTYA 4H4TA 2GVCA 3AEDA 1TDKA 3QVRA 1H81A 3PO7A 3IHMA 2B7SA 4REKA 2FJDA 4CCRA 1YQ3A 5EB4A 3RHAA 2YAUA 1OJDA 1NDAA 4OCGA 4B67A 1VG9A 1XANA 2WP9A 4IA6A 5HY5A 3NYEA 4CNKA 5JCLA 3UKPA 2CDUA 2GQFA 1KFYA 1VRQB 3LADA 2YG6A 4NZHA 4A9WA 1F3PA 3AD8B 1TDEA 3NTAA 3GMBA 2XFOA 3AD9B 2XLRA 2WS3A 1EL7A 1PN0A 2GF3A 3D8XA 1IUWA 1GERA 1E6EA 1P2EA 3O0HA 3UKLA 1E1MA 3F8PA 3HZLA 2NPXA 2EQ8A 1QO8A 4C77A 3BI4A 4TM1A 4Z2RA 2B76A 3LXDA 4H4WA 4GR1A 4OPGA 4EQXA 1NG4A 4K2XA 3VRDB 3NTDA 4EM4A 3K30A 2GR1A 5CQFA 5DBJA 1ZX9A 1GRFA 1PS9A 5J7XA 2IVDA 4AT0A 4Z2UA 2A89A 2GRTA 4EQSA 1N4UA 2X8GA 1F8WA 2XVFA 2YLTA 1K4QA 3IHGA 1D4EA 4UDQA 1JU2A 3B3RA 1E1KA 4H4SA 1YY5A 1ZOVA 3IF9A 5HXIA 4XWZA 1ZOYA 5J60A 4ZCDA 2GH5A 1FECA 2WDRA 1DJQA 2VQ7A 3P4RA 1Y56A 2A8XA 2JK6A 1ZMDA 4RG3A 1H83A 5L46A 1GOSA 3CNDA 4GUVA 4A79A 2IIDA 3ATQA 3AYLA 1GV4A 4ADWA 1BGNA 4U8JA 3P9UA 4NTDA 2RABA 3M12A 1MO9A 1JNRA 3CGDA 2WPFA 4J2WA 5EB5A 3DK9A 4Y4MA 3QFAA 1BGJA 5EBKA 2XFPA 4K5RA 3G5QA 4U2TA 2JKCA 4H2QA 2GB0A 3QVPA 4Z43A 1H7WA 4BURA 5JCIA 4A6NB 1H6VA 1KNRA 3GRSA 2GAGB 3CPJG 4H4YA 3V3OA 4JN9A 1DOCA 1OJTA 1GTEA 1F8SA 3CN8A 4CY6A 1NPXA 4KPRA 5HHFA 4YTPA 1REOA 2OA1A 4TLZA 3AEBA 2R45A 3VR8A 1KSUA 3KA7A 1ONFA 4TM0A 1E7PA 2O9ZA 3EANA 1GSNA 5FS8A 1DODA 1S3BA 2YM1A 1CBOA 4EMJA 4AOXA 4N9XA 4OVIA 1OJCA 3GYJA 1DOEA 3IWAA 2C67A 4KX6A 3UP4A 5KVIA 2EQ7A 2ZZ0A 3SGLA 1NEKA 3NN0X 4J31A 2RGOA 3QSMA 2B9WA 1X31B 5FS7A 3CGCA 5KVHA 2PHHA 4U8PA 3CNSA 1VQWA 3S5WA 4D03A 1PJ7A 1KSSA 4XXGA 1JEHA 1W4XA 2C64A 2YLXA 3L1RA 2YLRA 1Q9IA 4NEVA 1JRXA 3EPTA 3ICTA 3BNUA 4H4PA 2XFUA 3ICSA 5HYMA 4APNA 2Z5YA 4YSYA 3GDPA 2WPCA 1LQTA 4WCTA 4C3YA 1TDOA 2RGHA 3G5RA 1O94A 3E1TA 4OPDA 3RP8A 2HQMA 1GRHA 4CBQA 1CL0A 1NHSA 1AOGA 4USRA 2BC0A 1FEBA 3ZDNA 1MOKA 3NLCA 3ZYXA 4OPLA 3K7QX 1YQZA 5U63A 4C5OA 2YR5A 5BUKA 1FL2A 3CIRA 1LVLA 1KNPA 4U8LA 3NG7X 2OLNA 2FJAA 2GEWA 1PDHA 1LTXR 2WOWA 3UTFA 5M0ZA 5EOWA 1NHRA 1PBDA 4BJZA 1OJ9A 4CNJA 2BCPA 4B69A 4J36A 2R0GA 2XFQA 4LU6A 1YQ4A 5BRTA 4U2LA 3L8KA 2WDQA 4JNAA 3NK1X 3LJPA 4ZCCA 4GDEA 2QAEA 1PBEA 3GSIA 4OPCA 3UCLA 1L9EA 2B7RA 3P4PA 1PHHA 2GV8A 3AE5A 4K7ZA 4MJWA 5U1OA 3VRAA 5C2TA 1K0LA 3EF6A 3KPFA 4H4ZA 1CHUA 3II4A 2ARDA 4ICYA 4EIQA 3VRBA 5BULA 3H8LA 3R9UA 4Z26A 3BNMA 1MXTA 2X8HA 3CPIG 4P9SA 2XLTA 4A5LA 4EMIA 4YKFA 2AR8A 1ZDLA 2WBAA 3OC4A 2WU5A 4BK1A 3NK0X 3Q9TA 2BS2A 1M64A 1Y56B 2YLZA 2QCUA 1H84A 2Y6RA 4ZN0A 2C3CA 1K0IA 2JBVA 2Z5XA 3KD9A 2A87A 4GCMA 4Z24A 2YWLA 1PJ6A 2JB2A 3AE1A 3KLJA 3RP7A 4J33A 3PS9A 2V6OA 3GD4A 3KKJA 4U8OA 1CF3A 2R9ZA 5FS6A 2JAEA 3CNTA 1PBBA 1PXBA 3ALMA 2VVMA 2WOIA 3DGZA 2BABA 3DJEA 4I59A 4U8NA 1S3EA 2YG4A 3GRTA 3UOZA 4EQRA 4RSLA 1H7XA 1PXCA 3C96A 4K5SA 4RG4A 4YT0A 3UTEA 5JCKA 1RSGA 4H2PA 2V5ZA 3UKKA 1ZK7A 2VVLG 4OPUA 1GALA 4DSGA 3K7TA 3BI2A 3IC9A 2F5ZA 1TDNA 1NG3A 2GQWA 2XVJA 3KU9A 3GYIA
chains in the Genus database with same CATH superfamily
3H4KA 3ALJA 2DKHA 3DMEA 5CKUA 4YSZA 1GTHA 2BACA 1L9CA 4AP1A 1EBDA 3UKFA 3UOYA 2YG5A 2YG3A 4H4VA 3NHOX 5FS9A 3NGCX 4YTNA 4H4RA 1D7YA 1GREA 3M13A 4YXDA 3AE2A 2WEUA 2E4GA 5IPYA 3GMCA 3AE7A 3F8RA 3JSKA 3T2KA 4H7UA 1P2HA 2BK3A 2OLOA 2E1MA 2Q0LA 1B8SA 3UKQA 4GF7A 4B63A 1GEUA 4CRTA 2AQJA 4X9MA 1E1LA 3NYFA 2WPEA 2XLSA 4IV9A 2X3NA 2CFYA 4AOSA 4B66A 4C74A 4EIPA 3ALLA 3CGEA 1BF3A 4WX1A 3RNMA 1GT8A 4FK1C 4XWRA 1VDCA 2WP6A 3RP6A 1SEZA 2WP5A 3REDA 1FCDA 1L0VA 1LQUA 3M0OA 1TRBA 2C65A 4LA1A 4G74A 2WQYA 2VRLA 1GRGA 1F8RA 4EM3A 4UDRA 3AE4A 1NAAA 3QFBA 1XHCA 2XDOA 1L9DA 3BI5A 3NH3X 5JCNA 1M6IA 2C66A 4Z2TA 3QSEA 2TMDA 2Q0KA 4B64A 2GR0A 2I0ZA 1GPEA 1D4CA 2V61A 3NNEA 3P4SA 4NTEA 3C4NA 5IQ4A 1BWCA 1CJ2A 1S2YA 2X50A 5JCMA 1IUSA 1IUUA 2ZBWA 4H2RA 3SFDA 2DKIA 3AECA 3UOXA 4DGKA 2XLPA 3DJDA 4Y4LA 4CY8A 2VQBA 1N4WA 4B68A 1NENA 1GNDA 2B9XA 4X9NA 3SY4A 1B5QA 2TPRA 1B37A 3DK8A 4ECHA 2BYBA 5IQ1A 1F6MA 4E0VA 4FDCB 1NHQA 2Q7VA 1E1NA 2Y6QA 2XCGA 3AWIA 1CC2A 1ELIA 1FEAA 4TM3A 3EAOA 1JOAA 1Q1RA 1RP0A 2QA1A 3AEAA 3FPZA 2GMHA 1IJHA 3UKHA 1E39A 2OALA 1H82A 2APGA 2GR2A 3AB1A 4O5UA 3AE9A 1Y0PA 3SFEA 2BK5A 3LOVA 3AEFA 2BXSA 4H4XA 4BJYA 4JY2A 2QA2A 1GRTA 2H88A 2YR6A 3NK2X 4PABA 3T14A 3ICRA 1H86A 3NKSA 2JB3A 2VOUA 3SYIA 3UOVA 3DA1A 5KXJA 1FOHA 3I6DA 4HB9A 4B1BA 3SZ0A 3LB8A 4U8KA 4A99A 4LIIA 2YM2A 3AD7B 2YG7A 1S2QA 2BCGG 4H4QA 4JNQA 3DGHA 3LZXA 3UTGA 3AEGA 3AE6A 4AP3A 5KOXA 3P1WA 2JB1A 1K0JA 2CULA 2XLUA 4BK2A 5ER0A 1Q1WA 2YVJA 1OJAA 2CVJA 3DK4A 4OPIA 1LPFA 4YKGA 2C72A 2FJBA 2WU2A 2BRYA 1EL8A 2EQ9A 4JDRA 4DSHA 1YKJA 3DH9A 3FG2P 1TYTA 2Q6UA 4YSHA 2V3BA 3SXIA 1N4VA 1KF6A 3SM8A 5BVAA 5C3JA 3D1CA 3K7MX 1B4VA 5U25A 5M10A 2VVLA 4H2NA 1LJ1A 2YR4A 5GSNA 1CJ4A 3CNJA 3GDNA 4GDPA 4OPTA 1GRBA 1BZLA 4JQ9A 4A7AA 1IUVA 3HYWA 3V3NA 5KWFA 1GESA 1UKVG 2XVHA 3T2YA 5TR3A 1ZP0A 3BHKA 3I3LA 1PJ5A 4U2SA 2E5VA 4G6HA 2GMJA 4U8MA 2R46A 2BC1A 1VG0A 2V60A 4II2A 1CC6A 1RYIA 3T37A 2ZZCA 3S61A 4G9KA 1N1PA 1EL5A 4UDPA 1JRYA 1EL9A 1ZMCA 2X8CA 3FBSA 3P4QA 2NVKX 4FK1A 2BS3A 5GRTA 4Z25A 3GD3A 4K22A 1PBCA 2BS4A 1JNZA 2C76A 2OAMA 1GETA 4G73A 3URHA 4AT2A 2R0CA 2YQUA 2ZZBA 4NTCA 2R4JA 3CNPA 3B6DA 3VQRA 4J57A 2WESA 2BA9A 2IVEA 1KDGA 5KRQA 3ABVA 4YSXA 3G5SA 1CJ3A 1XPQA 2BXRA 3ITJA 4EQWA 2XVIA 1DNCA 3COXA 3NT6A 4Z44A 2C70A 1PXAA 3QSSA 2PYXA 1CJCA 2VZ2A 3FMWA 3KVEA 3AE8A 2VRMA 3AYIA 4C3XA 1IUXA 1ZY8A 1D4DA 4H50A 4HA6A 2FBWA 3UKAA 2FJEA 1QLBA 2R4EA 2W0HA 1DOBA 5KOWA 1D5TA 4JY3A 4DNAA 2BK4A 4USQA 3UP5A 2WETA 2V3AA 3DJJA 3NRNA 5FMHA 3GWFA 3OZ2A 4J56A 3V76A 4A6NA 2C7GA 3C4AA 4H4UA 1GXFA 2RGJA 1BKWA 3NN6X 2C75A 4M52A 1TYPA 3NIXA 3AYJA 1DJNA 2AAQA 3GWDA 2H89A 3CGBA 1NHPA 1COYA 2EQ6A 2BRAA 4U8IA 1O95A 3DJGX 4IVMB 5KMPA 5LV9A 1CC4A 2J3NA 1IUTA 4YWOA 2WDVA 3Q6JA 3ADAB 2C73A 2YVFA 2YVGA 3BHFA 3ISHA 1XDIA 4A65A 1GRAA 4EMWA 2WHDA 4PAAA 4GRTA 1LV0A 1D7LA 1O5WA 2XVEA 3H8IA 3SQPA 1HYUA 4BV6A 2C3DA 1V59A 1JRZA 2B9YA 3PVCA 4IA5A 4YTMA 4B65A 3WE0A 3FIMB 4O5QA 3CPHG 2XFNA 3QJ4A 4Y4NA 2XYOA 3F8DA 2R0PA 2YLSA 1DXLA 3AEEA 4CCQA 4NEWA 4K8DA 4TM4A 4X4JA 3AE3A 2WOVA 1QJDA 4J34A 4D04A 4BK3A 4I58A 3LZWA 1Z6LA 2ACZA 4TLXA 2GAHB 3T31A 3NYCA 4IVOB 4UP3A 2UZZA 1TDFA 3UTHA 1PBFA 4FX9A 2X99A 3AXBA 3VR9A 1ZKQA 2GR3A 2YLWA 3ATRA 3CTYA 4H4TA 2GVCA 3AEDA 1TDKA 3QVRA 1H81A 3PO7A 4G6GA 3IHMA 2B7SA 4REKA 2FJDA 4CCRA 1YQ3A 5EB4A 3RHAA 2YAUA 1OJDA 1NDAA 4OCGA 4B67A 1VG9A 1XANA 2WP9A 4IA6A 5HY5A 3NYEA 4CNKA 5JCLA 3UKPA 2CDUA 2GQFA 1KFYA 1VRQB 3LADA 2YG6A 4NZHA 4A9WA 1F3PA 3AD8B 5KMSA 1TDEA 3NTAA 3GMBA 2XFOA 3AD9B 2XLRA 2WS3A 1EL7A 1PN0A 2GF3A 3D8XA 1IUWA 1GERA 1E6EA 1P2EA 3O0HA 3UKLA 5KMRA 1E1MA 3F8PA 3HZLA 2NPXA 2EQ8A 1QO8A 4C77A 3BI4A 4TM1A 4Z2RA 2B76A 3LXDA 4H4WA 4GR1A 4OPGA 3SX6A 1NG4A 4K2XA 4EQXA 3VRDB 3NTDA 3T0KA 4EM4A 3K30A 2GR1A 3HYXA 5CQFA 5DBJA 1ZX9A 1GRFA 1PS9A 4II3A 5J7XA 2IVDA 4AT0A 4Z2UA 2A89A 2GRTA 4EQSA 1N4UA 2X8GA 1F8WA 2XVFA 2YLTA 1K4QA 3IHGA 1D4EA 4UDQA 1JU2A 3B3RA 1E1KA 4H4SA 1YY5A 1ZOVA 3IF9A 5HXIA 4XWZA 1ZOYA 5J60A 4ZCDA 2GH5A 1FECA 2WDRA 1DJQA 2VQ7A 3P4RA 4NWZA 1Y56A 2A8XA 2JK6A 1ZMDA 4RG3A 1H83A 5L46A 1GOSA 3CNDA 4GUVA 4A79A 2IIDA 3ATQA 3AYLA 1GV4A 4ADWA 1BGNA 4U8JA 3P9UA 4NTDA 2RABA 3M12A 1MO9A 1JNRA 3CGDA 2WPFA 4J2WA 5EB5A 3DK9A 4Y4MA 3QFAA 1BGJA 5EBKA 2XFPA 4K5RA 3G5QA 4U2TA 2JKCA 4H2QA 2GB0A 3QVPA 4Z43A 1H7WA 4BURA 5JCIA 4A6NB 1H6VA 1KNRA 3GRSA 2GAGB 3CPJG 4H4YA 3V3OA 4JN9A 1DOCA 1OJTA 1GTEA 1F8SA 3CN8A 4CY6A 1NPXA 4KPRA 5HHFA 4YTPA 1REOA 2OA1A 4TLZA 3AEBA 2R45A 3VR8A 1KSUA 3KA7A 1ONFA 4TM0A 4GAVA 1E7PA 2O9ZA 3EANA 1GSNA 5FS8A 1DODA 1S3BA 2YM1A 1CBOA 4EMJA 4AOXA 4N9XA 4OVIA 1OJCA 3GYJA 1DOEA 3IWAA 2C67A 4KX6A 3UP4A 5KVIA 2EQ7A 2ZZ0A 3SGLA 1NEKA 3NN0X 4J31A 2RGOA 3QSMA 2B9WA 1X31B 5FS7A 3CGCA 5KVHA 2PHHA 4U8PA 3CNSA 1VQWA 3S5WA 4D03A 1PJ7A 1KSSA 4XXGA 1JEHA 1W4XA 2C64A 2YLXA 3L1RA 2YLRA 1Q9IA 4NEVA 1JRXA 3EPTA 3ICTA 3BNUA 4H4PA 2XFUA 3ICSA 5HYMA 4APNA 2Z5YA 4YSYA 3GDPA 2WPCA 1LQTA 4WCTA 4C3YA 1TDOA 2RGHA 3G5RA 1O94A 3E1TA 4OPDA 3RP8A 2HQMA 1GRHA 3SZWA 4CBQA 1CL0A 1NHSA 1AOGA 4USRA 2BC0A 1FEBA 3ZDNA 1MOKA 3NLCA 3ZYXA 3T2ZA 4OPLA 3K7QX 1YQZA 5U63A 3KPKA 4C5OA 2YR5A 3HYVA 5BUKA 1FL2A 3CIRA 1LVLA 1KNPA 4U8LA 3NG7X 2OLNA 3SZFA 2FJAA 2GEWA 1PDHA 1LTXR 2WOWA 3UTFA 5M0ZA 5KMQA 5EOWA 1NHRA 1PBDA 4BJZA 1OJ9A 4CNJA 5KNLA 2BCPA 4B69A 4J36A 2R0GA 2XFQA 4LU6A 1YQ4A 5BRTA 4U2LA 3L8KA 2WDQA 4JNAA 3NK1X 3LJPA 4ZCCA 4GDEA 2QAEA 1PBEA 3GSIA 3CMMA 4OPCA 3UCLA 1L9EA 2B7RA 3P4PA 1PHHA 2GV8A 3AE5A 4K7ZA 4MJWA 5U1OA 3VRAA 5C2TA 1K0LA 3EF6A 3KPFA 4H4ZA 1CHUA 3II4A 2ARDA 4ICYA 4EIQA 3VRBA 5BULA 3H8LA 3R9UA 4Z26A 3BNMA 1MXTA 2X8HA 3CPIG 4P9SA 2XLTA 4A5LA 4EMIA 4YKFA 2AR8A 1ZDLA 2WBAA 3OC4A 2WU5A 4BK1A 3NK0X 3Q9TA 2BS2A 3SZCA 1M64A 1Y56B 2YLZA 2QCUA 1H84A 2Y6RA 4ZN0A 2C3CA 1K0IA 2JBVA 2Z5XA 3KD9A 2A87A 4GCMA 4Z24A 2YWLA 1PJ6A 2JB2A 3AE1A 3KLJA 4NNJA 3RP7A 4J33A 3PS9A 2V6OA 3GD4A 3KKJA 4U8OA 1CF3A 2R9ZA 5FS6A 2JAEA 3CNTA 1PBBA 1PXBA 3ALMA 2VVMA 2WOIA 3DGZA 2BABA 3DJEA 4I59A 4U8NA 1S3EA 2YG4A 3GRTA 3UOZA 4EQRA 4RSLA 1H7XA 1PXCA 3C96A 4K5SA 4RG4A 4YT0A 3UTEA 5JCKA 1RSGA 4H2PA 2V5ZA 3UKKA 1ZK7A 2VVLG 4GAPA 1GALA 2C4CA 4OPUA 3K7TA 4DSGA 3BI2A 3IC9A 2F5ZA 1TDNA 1NG3A 2GQWA 2XVJA 3GYXA 3KU9A 3GYIA
chains in the Genus database with same CATH topology
3H4KA 3ALJA 2DKHA 3DMEA 5CKUA 4YSZA 1GTHA 2BACA 1L9CA 4AP1A 1EBDA 3UKFA 3UOYA 2YG5A 2YG3A 4H4VA 3NHOX 5FS9A 3NGCX 4YTNA 4H4RA 1D7YA 1GREA 3M13A 4YXDA 3AE2A 2WEUA 2E4GA 5IPYA 3GMCA 3AE7A 3F8RA 3JSKA 3T2KA 4H7UA 1P2HA 2BK3A 2OLOA 2E1MA 2Q0LA 1B8SA 3UKQA 4GF7A 4B63A 1GEUA 4CRTA 2AQJA 4X9MA 1E1LA 3NYFA 2WPEA 2XLSA 4IV9A 2X3NA 2CFYA 4AOSA 4B66A 4C74A 4EIPA 3ALLA 3CGEA 1BF3A 4WX1A 3RNMA 1GT8A 4FK1C 4XWRA 1VDCA 2WP6A 3RP6A 1SEZA 2WP5A 3REDA 1FCDA 1L0VA 1LQUA 3M0OA 1TRBA 2C65A 4LA1A 4G74A 2WQYA 2VRLA 1GRGA 1F8RA 4EM3A 4UDRA 3AE4A 1NAAA 3QFBA 1XHCA 2XDOA 1L9DA 3BI5A 3NH3X 5JCNA 1M6IA 2C66A 4Z2TA 3QSEA 2TMDA 2Q0KA 4B64A 2GR0A 2I0ZA 1GPEA 1D4CA 2V61A 3NNEA 3P4SA 4NTEA 3C4NA 5IQ4A 1BWCA 1CJ2A 1S2YA 2X50A 5JCMA 1IUSA 1IUUA 2ZBWA 4H2RA 3SFDA 2DKIA 3AECA 3UOXA 4DGKA 2XLPA 3DJDA 4Y4LA 4CY8A 2VQBA 1N4WA 4B68A 1NENA 1GNDA 2B9XA 4X9NA 3SY4A 1B5QA 2TPRA 1B37A 3DK8A 4ECHA 2BYBA 5IQ1A 1F6MA 4E0VA 4FDCB 1NHQA 2Q7VA 1E1NA 2Y6QA 2XCGA 3AWIA 1CC2A 1ELIA 1FEAA 4TM3A 3EAOA 1JOAA 1Q1RA 1RP0A 2QA1A 3AEAA 3FPZA 2GMHA 1IJHA 3UKHA 1E39A 2OALA 1H82A 2APGA 2GR2A 3AB1A 4O5UA 3AE9A 1Y0PA 3SFEA 2BK5A 3LOVA 3AEFA 2BXSA 4H4XA 4BJYA 4JY2A 2QA2A 1GRTA 2H88A 2YR6A 3NK2X 4PABA 3T14A 3ICRA 1H86A 3NKSA 2JB3A 2VOUA 3SYIA 3UOVA 3DA1A 5KXJA 1FOHA 3I6DA 4HB9A 4B1BA 3SZ0A 3LB8A 4U8KA 4A99A 4LIIA 2YM2A 3AD7B 2YG7A 1S2QA 2BCGG 4H4QA 4JNQA 3DGHA 3LZXA 3UTGA 3AEGA 3AE6A 4AP3A 5KOXA 3P1WA 2JB1A 1K0JA 2CULA 2XLUA 4BK2A 5ER0A 1Q1WA 2YVJA 1OJAA 2CVJA 3DK4A 4OPIA 1LPFA 4YKGA 2C72A 2FJBA 2WU2A 2BRYA 1EL8A 2EQ9A 4JDRA 4DSHA 1YKJA 3DH9A 3FG2P 1TYTA 2Q6UA 4YSHA 2V3BA 3SXIA 1N4VA 1KF6A 3SM8A 5BVAA 5C3JA 3D1CA 3K7MX 1B4VA 5U25A 5M10A 2VVLA 4H2NA 1LJ1A 2YR4A 5GSNA 1CJ4A 3CNJA 3GDNA 4GDPA 4OPTA 1GRBA 1BZLA 4JQ9A 4A7AA 1IUVA 3HYWA 3V3NA 5KWFA 1GESA 1UKVG 2XVHA 3T2YA 5TR3A 1ZP0A 3BHKA 3I3LA 1PJ5A 4U2SA 2E5VA 4G6HA 2GMJA 4U8MA 2R46A 2BC1A 1VG0A 2V60A 4II2A 1CC6A 1RYIA 3T37A 2ZZCA 3S61A 4G9KA 1N1PA 1EL5A 4UDPA 1JRYA 1EL9A 1ZMCA 2X8CA 3FBSA 3P4QA 2NVKX 4FK1A 2BS3A 5GRTA 4Z25A 3GD3A 4K22A 1PBCA 2BS4A 1JNZA 2C76A 2OAMA 1GETA 4G73A 3URHA 4AT2A 2R0CA 2YQUA 2ZZBA 4NTCA 2R4JA 3CNPA 3B6DA 3VQRA 4J57A 2WESA 2BA9A 2IVEA 1KDGA 5KRQA 3ABVA 4YSXA 3G5SA 1CJ3A 1XPQA 2BXRA 3ITJA 4EQWA 2XVIA 1DNCA 3COXA 3NT6A 4Z44A 2C70A 1PXAA 3QSSA 2PYXA 1CJCA 2VZ2A 3FMWA 3KVEA 3AE8A 2VRMA 3AYIA 4C3XA 1IUXA 1ZY8A 1D4DA 4H50A 4HA6A 2FBWA 3UKAA 2FJEA 1QLBA 2R4EA 2W0HA 1DOBA 5KOWA 1D5TA 4JY3A 4DNAA 2BK4A 4USQA 3UP5A 2WETA 2V3AA 3DJJA 3NRNA 5FMHA 3GWFA 3OZ2A 4J56A 3V76A 4A6NA 2C7GA 3C4AA 4H4UA 1GXFA 2RGJA 1BKWA 3NN6X 2C75A 4M52A 1TYPA 3NIXA 3AYJA 1DJNA 2AAQA 3GWDA 2H89A 3CGBA 1NHPA 1COYA 2EQ6A 2BRAA 4U8IA 1O95A 3DJGX 4IVMB 5KMPA 5LV9A 1CC4A 2J3NA 1IUTA 4YWOA 2WDVA 3Q6JA 3ADAB 2C73A 2YVFA 2YVGA 3BHFA 3ISHA 1XDIA 4A65A 1GRAA 4EMWA 2WHDA 4PAAA 4GRTA 1LV0A 1D7LA 1O5WA 2XVEA 3H8IA 3SQPA 1HYUA 4BV6A 2C3DA 1V59A 1JRZA 2B9YA 3PVCA 4IA5A 4YTMA 4B65A 3WE0A 3FIMB 4O5QA 3CPHG 2XFNA 3QJ4A 4Y4NA 2XYOA 3F8DA 2R0PA 2YLSA 1DXLA 3AEEA 4CCQA 4NEWA 4K8DA 4TM4A 4X4JA 3AE3A 2WOVA 1QJDA 4J34A 4D04A 4BK3A 4I58A 3LZWA 1Z6LA 2ACZA 4TLXA 2GAHB 3T31A 3NYCA 4IVOB 4UP3A 2UZZA 1TDFA 3UTHA 1PBFA 4FX9A 2X99A 3AXBA 3VR9A 1ZKQA 2GR3A 2YLWA 3ATRA 3CTYA 4H4TA 2GVCA 3AEDA 1TDKA 3QVRA 1H81A 3PO7A 4G6GA 3IHMA 2B7SA 4REKA 2FJDA 4CCRA 1YQ3A 5EB4A 3RHAA 2YAUA 1OJDA 1NDAA 4OCGA 4B67A 1VG9A 1XANA 2WP9A 4IA6A 5HY5A 3NYEA 4CNKA 5JCLA 3UKPA 2CDUA 2GQFA 1KFYA 1VRQB 3LADA 2YG6A 4NZHA 4A9WA 1F3PA 3AD8B 5KMSA 1TDEA 3NTAA 3GMBA 2XFOA 3AD9B 2XLRA 2WS3A 1EL7A 1PN0A 2GF3A 3D8XA 1IUWA 1GERA 1E6EA 1P2EA 3O0HA 3UKLA 5KMRA 1E1MA 3F8PA 3HZLA 2NPXA 2EQ8A 1QO8A 4C77A 3BI4A 4TM1A 4Z2RA 2B76A 3LXDA 4H4WA 4GR1A 4OPGA 3SX6A 1NG4A 4K2XA 4EQXA 3VRDB 3NTDA 3T0KA 4EM4A 3K30A 2GR1A 3HYXA 5CQFA 5DBJA 1ZX9A 1GRFA 1PS9A 4II3A 5J7XA 2IVDA 4AT0A 4Z2UA 2A89A 2GRTA 4EQSA 1N4UA 2X8GA 1F8WA 2XVFA 2YLTA 1K4QA 3IHGA 1D4EA 4UDQA 1JU2A 3B3RA 1E1KA 4H4SA 1YY5A 1ZOVA 3IF9A 5HXIA 4XWZA 1ZOYA 5J60A 4ZCDA 2GH5A 1FECA 2WDRA 1DJQA 2VQ7A 3P4RA 4NWZA 1Y56A 2A8XA 2JK6A 1ZMDA 4RG3A 1H83A 5L46A 1GOSA 3CNDA 4GUVA 4A79A 2IIDA 3ATQA 3AYLA 1GV4A 4ADWA 1BGNA 4U8JA 3P9UA 4NTDA 2RABA 3M12A 1MO9A 1JNRA 3CGDA 2WPFA 4J2WA 5EB5A 3DK9A 4Y4MA 3QFAA 1BGJA 5EBKA 2XFPA 4K5RA 3G5QA 4U2TA 2JKCA 4H2QA 2GB0A 3QVPA 4Z43A 1H7WA 4BURA 5JCIA 4A6NB 1H6VA 1KNRA 3GRSA 2GAGB 3CPJG 4H4YA 3V3OA 4JN9A 1DOCA 1OJTA 1GTEA 1F8SA 3CN8A 4CY6A 1NPXA 4KPRA 5HHFA 4YTPA 1REOA 2OA1A 4TLZA 3AEBA 2R45A 3VR8A 1KSUA 3KA7A 1ONFA 4TM0A 4GAVA 1E7PA 2O9ZA 3EANA 1GSNA 5FS8A 1DODA 1S3BA 2YM1A 1CBOA 4EMJA 4AOXA 4N9XA 4OVIA 1OJCA 3GYJA 1DOEA 3IWAA 2C67A 4KX6A 3UP4A 5KVIA 2EQ7A 2ZZ0A 3SGLA 1NEKA 3NN0X 4J31A 2RGOA 3QSMA 2B9WA 1X31B 5FS7A 3CGCA 5KVHA 2PHHA 4U8PA 3CNSA 1VQWA 3S5WA 4D03A 1PJ7A 1KSSA 4XXGA 1JEHA 1W4XA 2C64A 2YLXA 3L1RA 2YLRA 1Q9IA 4NEVA 1JRXA 3EPTA 3ICTA 3BNUA 4H4PA 2XFUA 3ICSA 5HYMA 4APNA 2Z5YA 4YSYA 3GDPA 2WPCA 1LQTA 4WCTA 4C3YA 1TDOA 2RGHA 3G5RA 1O94A 3E1TA 4OPDA 3RP8A 2HQMA 1GRHA 3SZWA 4CBQA 1CL0A 1NHSA 1AOGA 4USRA 2BC0A 1FEBA 3ZDNA 1MOKA 3NLCA 3ZYXA 3T2ZA 4OPLA 3K7QX 1YQZA 5U63A 3KPKA 4C5OA 2YR5A 3HYVA 5BUKA 1FL2A 3CIRA 1LVLA 1KNPA 4U8LA 3NG7X 2OLNA 3SZFA 2FJAA 2GEWA 1PDHA 1LTXR 2WOWA 3UTFA 5M0ZA 5KMQA 5EOWA 1NHRA 1PBDA 4BJZA 1OJ9A 4CNJA 5KNLA 2BCPA 4B69A 4J36A 2R0GA 2XFQA 4LU6A 1YQ4A 5BRTA 4U2LA 3L8KA 2WDQA 4JNAA 3NK1X 3LJPA 4ZCCA 4GDEA 2QAEA 1PBEA 3GSIA 3CMMA 4OPCA 3UCLA 1L9EA 2B7RA 3P4PA 1PHHA 2GV8A 3AE5A 4K7ZA 4MJWA 5U1OA 3VRAA 5C2TA 1K0LA 3EF6A 3KPFA 4H4ZA 1CHUA 3II4A 2ARDA 4ICYA 4EIQA 3VRBA 5BULA 3H8LA 3R9UA 4Z26A 3BNMA 1MXTA 2X8HA 3CPIG 4P9SA 2XLTA 4A5LA 4EMIA 4YKFA 2AR8A 1ZDLA 2WBAA 3OC4A 2WU5A 4BK1A 3NK0X 3Q9TA 2BS2A 3SZCA 1M64A 1Y56B 2YLZA 2QCUA 1H84A 2Y6RA 4ZN0A 2C3CA 1K0IA 2JBVA 2Z5XA 3KD9A 2A87A 4GCMA 4Z24A 2YWLA 1PJ6A 2JB2A 3AE1A 3KLJA 4NNJA 3RP7A 4J33A 3PS9A 2V6OA 3GD4A 3KKJA 4U8OA 1CF3A 2R9ZA 5FS6A 2JAEA 3CNTA 1PBBA 1PXBA 3ALMA 2VVMA 2WOIA 3DGZA 2BABA 3DJEA 4I59A 4U8NA 1S3EA 2YG4A 3GRTA 3UOZA 4EQRA 4RSLA 1H7XA 1PXCA 3C96A 4K5SA 4RG4A 4YT0A 3UTEA 5JCKA 1RSGA 4H2PA 2V5ZA 3UKKA 1ZK7A 2VVLG 4GAPA 1GALA 2C4CA 4OPUA 3K7TA 4DSGA 3BI2A 3IC9A 2F5ZA 1TDNA 1NG3A 2GQWA 2XVJA 3GYXA 3KU9A 3GYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4K A;  3ALJ A;  2DKH A;  3DME A;  5CKU A;  4YSZ A;  1GTH A;  2BAC A;  1L9C A;  4AP1 A;  1EBD A;  3UKF A;  3UOY A;  2YG5 A;  2YG3 A;  4H4V A;  3NHO X;  5FS9 A;  3NGC X;  4YTN A;  4H4R A;  1D7Y A;  1GRE A;  3M13 A;  4YXD A;  3AE2 A;  2WEU A;  2E4G A;  5IPY A;  3GMC A;  3AE7 A;  3F8R A;  3JSK A;  4H7U A;  1P2H A;  2BK3 A;  2OLO A;  2E1M A;  2Q0L A;  1B8S A;  3UKQ A;  4GF7 A;  4B63 A;  1GEU A;  4CRT A;  2AQJ A;  4X9M A;  1E1L A;  3NYF A;  2WPE A;  2XLS A;  4IV9 A;  2X3N A;  2CFY A;  4AOS A;  4B66 A;  4C74 A;  4EIP A;  3ALL A;  3CGE A;  1BF3 A;  4WX1 A;  3RNM A;  1GT8 A;  4FK1 C;  4XWR A;  1VDC A;  2WP6 A;  3RP6 A;  1SEZ A;  2WP5 A;  3RED A;  1FCD A;  1L0V A;  1LQU A;  3M0O A;  1TRB A;  2C65 A;  4LA1 A;  2WQY A;  2VRL A;  1GRG A;  1F8R A;  4EM3 A;  4UDR A;  3AE4 A;  1NAA A;  3QFB A;  1XHC A;  2XDO A;  1L9D A;  3BI5 A;  3NH3 X;  5JCN A;  1M6I A;  2C66 A;  4Z2T A;  3QSE A;  2TMD A;  2Q0K A;  4B64 A;  2GR0 A;  2I0Z A;  1GPE A;  1D4C A;  2V61 A;  3NNE A;  3P4S A;  4NTE A;  3C4N A;  5IQ4 A;  1BWC A;  1CJ2 A;  1S2Y A;  2X50 A;  5JCM A;  1IUS A;  1IUU A;  2ZBW A;  4H2R A;  3SFD A;  2DKI A;  3AEC A;  3UOX A;  4DGK A;  2XLP A;  3DJD A;  4Y4L A;  4CY8 A;  2VQB A;  1N4W A;  4B68 A;  1NEN A;  1GND A;  2B9X A;  4X9N A;  1B5Q A;  2TPR A;  1B37 A;  3DK8 A;  4ECH A;  2BYB A;  5IQ1 A;  1F6M A;  4E0V A;  4FDC B;  1NHQ A;  2Q7V A;  1E1N A;  2Y6Q A;  2XCG A;  3AWI A;  1CC2 A;  1ELI A;  1FEA A;  4TM3 A;  3EAO A;  1JOA A;  1Q1R A;  1RP0 A;  2QA1 A;  3AEA A;  3FPZ A;  2GMH A;  1IJH A;  3UKH A;  1E39 A;  2OAL A;  1H82 A;  2APG A;  2GR2 A;  3AB1 A;  4O5U A;  3AE9 A;  1Y0P A;  3SFE A;  2BK5 A;  3LOV A;  3AEF A;  2BXS A;  4H4X A;  4BJY A;  4JY2 A;  2QA2 A;  1GRT A;  2H88 A;  2YR6 A;  3NK2 X;  4PAB A;  3ICR A;  1H86 A;  3NKS A;  2JB3 A;  2VOU A;  3UOV A;  3DA1 A;  5KXJ A;  1FOH A;  3I6D A;  4HB9 A;  4B1B A;  3LB8 A;  4U8K A;  4A99 A;  4LII A;  2YM2 A;  3AD7 B;  2YG7 A;  1S2Q A;  2BCG G;  4H4Q A;  4JNQ A;  3DGH A;  3LZX A;  3UTG A;  3AEG A;  3AE6 A;  4AP3 A;  5KOX A;  3P1W A;  2JB1 A;  1K0J A;  2CUL A;  2XLU A;  4BK2 A;  5ER0 A;  1Q1W A;  2YVJ A;  1OJA A;  2CVJ A;  3DK4 A;  4OPI A;  1LPF A;  4YKG A;  2C72 A;  2FJB A;  2WU2 A;  1EL8 A;  2EQ9 A;  4JDR A;  4DSH A;  1YKJ A;  3DH9 A;  3FG2 P;  1TYT A;  2Q6U A;  4YSH A;  2V3B A;  1N4V A;  1KF6 A;  3SM8 A;  5BVA A;  5C3J A;  3D1C A;  3K7M X;  1B4V A;  5U25 A;  5M10 A;  2VVL A;  4H2N A;  1LJ1 A;  2YR4 A;  5GSN A;  1CJ4 A;  3CNJ A;  3GDN A;  4GDP A;  4OPT A;  1GRB A;  1BZL A;  4JQ9 A;  4A7A A;  1IUV A;  3V3N A;  5KWF A;  1GES A;  1UKV G;  2XVH A;  5TR3 A;  1ZP0 A;  3BHK A;  3I3L A;  1PJ5 A;  4U2S A;  2E5V A;  2GMJ A;  4U8M A;  2R46 A;  2BC1 A;  1VG0 A;  2V60 A;  1CC6 A;  1RYI A;  3T37 A;  2ZZC A;  3S61 A;  1N1P A;  1EL5 A;  4UDP A;  1JRY A;  1EL9 A;  1ZMC A;  2X8C A;  3FBS A;  3P4Q A;  2NVK X;  4FK1 A;  2BS3 A;  5GRT A;  4Z25 A;  3GD3 A;  4K22 A;  1PBC A;  2BS4 A;  1JNZ A;  2C76 A;  2OAM A;  1GET A;  3URH A;  4AT2 A;  2R0C A;  2YQU A;  2ZZB A;  4NTC A;  2R4J A;  3CNP A;  3B6D A;  3VQR A;  4J57 A;  2WES A;  2BA9 A;  2IVE A;  1KDG A;  5KRQ A;  3ABV A;  4YSX A;  3G5S A;  1CJ3 A;  1XPQ A;  2BXR A;  3ITJ A;  4EQW A;  2XVI A;  1DNC A;  3COX A;  3NT6 A;  4Z44 A;  2C70 A;  1PXA A;  3QSS A;  2PYX A;  1CJC A;  2VZ2 A;  3FMW A;  3KVE A;  3AE8 A;  2VRM A;  3AYI A;  4C3X A;  1IUX A;  1ZY8 A;  1D4D A;  4H50 A;  4HA6 A;  2FBW A;  3UKA A;  2FJE A;  1QLB A;  2R4E A;  2W0H A;  1DOB A;  5KOW A;  1D5T A;  4JY3 A;  4DNA A;  2BK4 A;  4USQ A;  3UP5 A;  2WET A;  2V3A A;  3DJJ A;  3NRN A;  5FMH A;  3GWF A;  3OZ2 A;  4J56 A;  3V76 A;  4A6N A;  2C7G A;  3C4A A;  4H4U A;  1GXF A;  2RGJ A;  1BKW A;  3NN6 X;  2C75 A;  4M52 A;  1TYP A;  3NIX A;  3AYJ A;  1DJN A;  2AAQ A;  3GWD A;  2H89 A;  3CGB A;  1NHP A;  1COY A;  2EQ6 A;  4U8I A;  1O95 A;  3DJG X;  4IVM B;  5LV9 A;  1CC4 A;  2J3N A;  1IUT A;  4YWO A;  2WDV A;  3Q6J A;  3ADA B;  2C73 A;  2YVF A;  2YVG A;  3BHF A;  3ISH A;  1XDI A;  4A65 A;  1GRA A;  4EMW A;  2WHD A;  4PAA A;  4GRT A;  1LV0 A;  1D7L A;  1O5W A;  2XVE A;  3H8I A;  3SQP A;  1HYU A;  4BV6 A;  2C3D A;  1V59 A;  1JRZ A;  2B9Y A;  3PVC A;  4IA5 A;  4YTM A;  4B65 A;  3WE0 A;  3FIM B;  4O5Q A;  3CPH G;  2XFN A;  3QJ4 A;  4Y4N A;  2XYO A;  3F8D A;  2R0P A;  2YLS A;  1DXL A;  3AEE A;  4CCQ A;  4NEW A;  4K8D A;  4TM4 A;  4X4J A;  3AE3 A;  2WOV A;  1QJD A;  4J34 A;  4D04 A;  4BK3 A;  4I58 A;  3LZW A;  1Z6L A;  2ACZ A;  4TLX A;  2GAH B;  3NYC A;  4IVO B;  4UP3 A;  2UZZ A;  1TDF A;  3UTH A;  1PBF A;  4FX9 A;  2X99 A;  3AXB A;  3VR9 A;  1ZKQ A;  2GR3 A;  2YLW A;  3ATR A;  3CTY A;  4H4T A;  2GVC A;  3AED A;  1TDK A;  3QVR A;  1H81 A;  3PO7 A;  3IHM A;  2B7S A;  4REK A;  2FJD A;  4CCR A;  1YQ3 A;  5EB4 A;  3RHA A;  2YAU A;  1OJD A;  1NDA A;  4OCG A;  4B67 A;  1VG9 A;  1XAN A;  2WP9 A;  4IA6 A;  5HY5 A;  3NYE A;  4CNK A;  5JCL A;  3UKP A;  2CDU A;  2GQF A;  1KFY A;  1VRQ B;  3LAD A;  2YG6 A;  4NZH A;  4A9W A;  1F3P A;  3AD8 B;  1TDE A;  3NTA A;  3GMB A;  2XFO A;  3AD9 B;  2XLR A;  2WS3 A;  1EL7 A;  1PN0 A;  2GF3 A;  3D8X A;  1IUW A;  1GER A;  1E6E A;  1P2E A;  3O0H A;  3UKL A;  1E1M A;  3F8P A;  3HZL A;  2NPX A;  2EQ8 A;  1QO8 A;  4C77 A;  3BI4 A;  4TM1 A;  4Z2R A;  2B76 A;  3LXD A;  4H4W A;  4GR1 A;  4OPG A;  4EQX A;  1NG4 A;  4K2X A;  3VRD B;  3NTD A;  4EM4 A;  3K30 A;  2GR1 A;  5CQF A;  5DBJ A;  1ZX9 A;  1GRF A;  1PS9 A;  5J7X A;  2IVD A;  4AT0 A;  4Z2U A;  2A89 A;  2GRT A;  4EQS A;  1N4U A;  2X8G A;  1F8W A;  2XVF A;  2YLT A;  1K4Q A;  3IHG A;  1D4E A;  4UDQ A;  1JU2 A;  3B3R A;  1E1K A;  4H4S A;  1YY5 A;  1ZOV A;  3IF9 A;  5HXI A;  4XWZ A;  1ZOY A;  5J60 A;  4ZCD A;  2GH5 A;  1FEC A;  2WDR A;  1DJQ A;  2VQ7 A;  3P4R A;  1Y56 A;  2A8X A;  2JK6 A;  1ZMD A;  4RG3 A;  1H83 A;  5L46 A;  1GOS A;  3CND A;  4GUV A;  4A79 A;  2IID A;  3ATQ A;  3AYL A;  1GV4 A;  4ADW A;  1BGN A;  4U8J A;  3P9U A;  4NTD A;  2RAB A;  3M12 A;  1MO9 A;  1JNR A;  3CGD A;  2WPF A;  4J2W A;  5EB5 A;  3DK9 A;  4Y4M A;  3QFA A;  1BGJ A;  5EBK A;  2XFP A;  4K5R A;  3G5Q A;  4U2T A;  2JKC A;  4H2Q A;  2GB0 A;  3QVP A;  4Z43 A;  1H7W A;  4BUR A;  5JCI A;  4A6N B;  1H6V A;  1KNR A;  3GRS A;  2GAG B;  3CPJ G;  4H4Y A;  3V3O A;  4JN9 A;  1DOC A;  1OJT A;  1GTE A;  1F8S A;  3CN8 A;  4CY6 A;  1NPX A;  4KPR A;  5HHF A;  4YTP A;  1REO A;  2OA1 A;  4TLZ A;  3AEB A;  2R45 A;  3VR8 A;  1KSU A;  3KA7 A;  1ONF A;  4TM0 A;  1E7P A;  2O9Z A;  3EAN A;  1GSN A;  5FS8 A;  1DOD A;  1S3B A;  2YM1 A;  1CBO A;  4EMJ A;  4AOX A;  4N9X A;  4OVI A;  1OJC A;  3GYJ A;  1DOE A;  3IWA A;  2C67 A;  4KX6 A;  3UP4 A;  5KVI A;  2EQ7 A;  2ZZ0 A;  3SGL A;  1NEK A;  3NN0 X;  4J31 A;  2RGO A;  3QSM A;  2B9W A;  1X31 B;  5FS7 A;  3CGC A;  5KVH A;  2PHH A;  4U8P A;  3CNS A;  1VQW A;  3S5W A;  4D03 A;  1PJ7 A;  1KSS A;  4XXG A;  1JEH A;  1W4X A;  2C64 A;  2YLX A;  3L1R A;  2YLR A;  1Q9I A;  4NEV A;  1JRX A;  3EPT A;  3ICT A;  3BNU A;  4H4P A;  2XFU A;  3ICS A;  5HYM A;  4APN A;  2Z5Y A;  4YSY A;  3GDP A;  2WPC A;  1LQT A;  4WCT A;  4C3Y A;  1TDO A;  2RGH A;  3G5R A;  1O94 A;  3E1T A;  4OPD A;  3RP8 A;  2HQM A;  1GRH A;  4CBQ A;  1CL0 A;  1NHS A;  1AOG A;  4USR A;  2BC0 A;  1FEB A;  3ZDN A;  1MOK A;  3NLC A;  3ZYX A;  4OPL A;  3K7Q X;  1YQZ A;  5U63 A;  4C5O A;  2YR5 A;  5BUK A;  1FL2 A;  3CIR A;  1LVL A;  1KNP A;  4U8L A;  3NG7 X;  2OLN A;  2FJA A;  2GEW A;  1PDH A;  1LTX R;  2WOW A;  3UTF A;  5M0Z A;  5EOW A;  1NHR A;  1PBD A;  4BJZ A;  1OJ9 A;  4CNJ A;  2BCP A;  4B69 A;  4J36 A;  2R0G A;  2XFQ A;  4LU6 A;  1YQ4 A;  5BRT A;  4U2L A;  3L8K A;  2WDQ A;  4JNA A;  3NK1 X;  3LJP A;  4ZCC A;  4GDE A;  2QAE A;  1PBE A;  3GSI A;  4OPC A;  3UCL A;  1L9E A;  2B7R A;  3P4P A;  1PHH A;  2GV8 A;  3AE5 A;  4K7Z A;  4MJW A;  5U1O A;  3VRA A;  5C2T A;  1K0L A;  3EF6 A;  3KPF A;  4H4Z A;  1CHU A;  3II4 A;  2ARD A;  4ICY A;  4EIQ A;  3VRB A;  5BUL A;  3H8L A;  3R9U A;  4Z26 A;  3BNM A;  1MXT A;  2X8H A;  3CPI G;  4P9S A;  2XLT A;  4A5L A;  4EMI A;  4YKF A;  2AR8 A;  1ZDL A;  2WBA A;  3OC4 A;  2WU5 A;  4BK1 A;  3NK0 X;  3Q9T A;  2BS2 A;  1M64 A;  1Y56 B;  2YLZ A;  2QCU A;  1H84 A;  2Y6R A;  4ZN0 A;  2C3C A;  1K0I A;  2JBV A;  2Z5X A;  3KD9 A;  2A87 A;  4GCM A;  4Z24 A;  2YWL A;  1PJ6 A;  2JB2 A;  3AE1 A;  3KLJ A;  3RP7 A;  4J33 A;  3PS9 A;  2V6O A;  3GD4 A;  3KKJ A;  4U8O A;  1CF3 A;  2R9Z A;  5FS6 A;  2JAE A;  3CNT A;  1PBB A;  1PXB A;  3ALM A;  2VVM A;  2WOI A;  3DGZ A;  2BAB A;  3DJE A;  4I59 A;  4U8N A;  1S3E A;  2YG4 A;  3GRT A;  3UOZ A;  4EQR A;  4RSL A;  1H7X A;  1PXC A;  3C96 A;  4K5S A;  4RG4 A;  4YT0 A;  3UTE A;  5JCK A;  1RSG A;  4H2P A;  2V5Z A;  3UKK A;  1ZK7 A;  2VVL G;  4OPU A;  1GAL A;  4DSG A;  3K7T A;  3BI2 A;  3IC9 A;  2F5Z A;  1TDN A;  1NG3 A;  2GQW A;  2XVJ A;  3KU9 A;  3GYI A; 
#chains in the Genus database with same CATH topology
 3H4K A;  3ALJ A;  2DKH A;  3DME A;  5CKU A;  4YSZ A;  1GTH A;  2BAC A;  1L9C A;  4AP1 A;  1EBD A;  3UKF A;  3UOY A;  2YG5 A;  2YG3 A;  4H4V A;  3NHO X;  5FS9 A;  3NGC X;  4YTN A;  4H4R A;  1D7Y A;  1GRE A;  3M13 A;  4YXD A;  3AE2 A;  2WEU A;  2E4G A;  5IPY A;  3GMC A;  3AE7 A;  3F8R A;  3JSK A;  3T2K A;  4H7U A;  1P2H A;  2BK3 A;  2OLO A;  2E1M A;  2Q0L A;  1B8S A;  3UKQ A;  4GF7 A;  4B63 A;  1GEU A;  4CRT A;  2AQJ A;  4X9M A;  1E1L A;  3NYF A;  2WPE A;  2XLS A;  4IV9 A;  2X3N A;  2CFY A;  4AOS A;  4B66 A;  4C74 A;  4EIP A;  3ALL A;  3CGE A;  1BF3 A;  4WX1 A;  3RNM A;  1GT8 A;  4FK1 C;  4XWR A;  1VDC A;  2WP6 A;  3RP6 A;  1SEZ A;  2WP5 A;  3RED A;  1FCD A;  1L0V A;  1LQU A;  3M0O A;  1TRB A;  2C65 A;  4LA1 A;  4G74 A;  2WQY A;  2VRL A;  1GRG A;  1F8R A;  4EM3 A;  4UDR A;  3AE4 A;  1NAA A;  3QFB A;  1XHC A;  2XDO A;  1L9D A;  3BI5 A;  3NH3 X;  5JCN A;  1M6I A;  2C66 A;  4Z2T A;  3QSE A;  2TMD A;  2Q0K A;  4B64 A;  2GR0 A;  2I0Z A;  1GPE A;  1D4C A;  2V61 A;  3NNE A;  3P4S A;  4NTE A;  3C4N A;  5IQ4 A;  1BWC A;  1CJ2 A;  1S2Y A;  2X50 A;  5JCM A;  1IUS A;  1IUU A;  2ZBW A;  4H2R A;  3SFD A;  2DKI A;  3AEC A;  3UOX A;  4DGK A;  2XLP A;  3DJD A;  4Y4L A;  4CY8 A;  2VQB A;  1N4W A;  4B68 A;  1NEN A;  1GND A;  2B9X A;  4X9N A;  3SY4 A;  1B5Q A;  2TPR A;  1B37 A;  3DK8 A;  4ECH A;  2BYB A;  5IQ1 A;  1F6M A;  4E0V A;  4FDC B;  1NHQ A;  2Q7V A;  1E1N A;  2Y6Q A;  2XCG A;  3AWI A;  1CC2 A;  1ELI A;  1FEA A;  4TM3 A;  3EAO A;  1JOA A;  1Q1R A;  1RP0 A;  2QA1 A;  3AEA A;  3FPZ A;  2GMH A;  1IJH A;  3UKH A;  1E39 A;  2OAL A;  1H82 A;  2APG A;  2GR2 A;  3AB1 A;  4O5U A;  3AE9 A;  1Y0P A;  3SFE A;  2BK5 A;  3LOV A;  3AEF A;  2BXS A;  4H4X A;  4BJY A;  4JY2 A;  2QA2 A;  1GRT A;  2H88 A;  2YR6 A;  3NK2 X;  4PAB A;  3T14 A;  3ICR A;  1H86 A;  3NKS A;  2JB3 A;  2VOU A;  3SYI A;  3UOV A;  3DA1 A;  5KXJ A;  1FOH A;  3I6D A;  4HB9 A;  4B1B A;  3SZ0 A;  3LB8 A;  4U8K A;  4A99 A;  4LII A;  2YM2 A;  3AD7 B;  2YG7 A;  1S2Q A;  2BCG G;  4H4Q A;  4JNQ A;  3DGH A;  3LZX A;  3UTG A;  3AEG A;  3AE6 A;  4AP3 A;  5KOX A;  3P1W A;  2JB1 A;  1K0J A;  2CUL A;  2XLU A;  4BK2 A;  5ER0 A;  1Q1W A;  2YVJ A;  1OJA A;  2CVJ A;  3DK4 A;  4OPI A;  1LPF A;  4YKG A;  2C72 A;  2FJB A;  2WU2 A;  2BRY A;  1EL8 A;  2EQ9 A;  4JDR A;  4DSH A;  1YKJ A;  3DH9 A;  3FG2 P;  1TYT A;  2Q6U A;  4YSH A;  2V3B A;  3SXI A;  1N4V A;  1KF6 A;  3SM8 A;  5BVA A;  5C3J A;  3D1C A;  3K7M X;  1B4V A;  5U25 A;  5M10 A;  2VVL A;  4H2N A;  1LJ1 A;  2YR4 A;  5GSN A;  1CJ4 A;  3CNJ A;  3GDN A;  4GDP A;  4OPT A;  1GRB A;  1BZL A;  4JQ9 A;  4A7A A;  1IUV A;  3HYW A;  3V3N A;  5KWF A;  1GES A;  1UKV G;  2XVH A;  3T2Y A;  5TR3 A;  1ZP0 A;  3BHK A;  3I3L A;  1PJ5 A;  4U2S A;  2E5V A;  4G6H A;  2GMJ A;  4U8M A;  2R46 A;  2BC1 A;  1VG0 A;  2V60 A;  4II2 A;  1CC6 A;  1RYI A;  3T37 A;  2ZZC A;  3S61 A;  4G9K A;  1N1P A;  1EL5 A;  4UDP A;  1JRY A;  1EL9 A;  1ZMC A;  2X8C A;  3FBS A;  3P4Q A;  2NVK X;  4FK1 A;  2BS3 A;  5GRT A;  4Z25 A;  3GD3 A;  4K22 A;  1PBC A;  2BS4 A;  1JNZ A;  2C76 A;  2OAM A;  1GET A;  4G73 A;  3URH A;  4AT2 A;  2R0C A;  2YQU A;  2ZZB A;  4NTC A;  2R4J A;  3CNP A;  3B6D A;  3VQR A;  4J57 A;  2WES A;  2BA9 A;  2IVE A;  1KDG A;  5KRQ A;  3ABV A;  4YSX A;  3G5S A;  1CJ3 A;  1XPQ A;  2BXR A;  3ITJ A;  4EQW A;  2XVI A;  1DNC A;  3COX A;  3NT6 A;  4Z44 A;  2C70 A;  1PXA A;  3QSS A;  2PYX A;  1CJC A;  2VZ2 A;  3FMW A;  3KVE A;  3AE8 A;  2VRM A;  3AYI A;  4C3X A;  1IUX A;  1ZY8 A;  1D4D A;  4H50 A;  4HA6 A;  2FBW A;  3UKA A;  2FJE A;  1QLB A;  2R4E A;  2W0H A;  1DOB A;  5KOW A;  1D5T A;  4JY3 A;  4DNA A;  2BK4 A;  4USQ A;  3UP5 A;  2WET A;  2V3A A;  3DJJ A;  3NRN A;  5FMH A;  3GWF A;  3OZ2 A;  4J56 A;  3V76 A;  4A6N A;  2C7G A;  3C4A A;  4H4U A;  1GXF A;  2RGJ A;  1BKW A;  3NN6 X;  2C75 A;  4M52 A;  1TYP A;  3NIX A;  3AYJ A;  1DJN A;  2AAQ A;  3GWD A;  2H89 A;  3CGB A;  1NHP A;  1COY A;  2EQ6 A;  2BRA A;  4U8I A;  1O95 A;  3DJG X;  4IVM B;  5KMP A;  5LV9 A;  1CC4 A;  2J3N A;  1IUT A;  4YWO A;  2WDV A;  3Q6J A;  3ADA B;  2C73 A;  2YVF A;  2YVG A;  3BHF A;  3ISH A;  1XDI A;  4A65 A;  1GRA A;  4EMW A;  2WHD A;  4PAA A;  4GRT A;  1LV0 A;  1D7L A;  1O5W A;  2XVE A;  3H8I A;  3SQP A;  1HYU A;  4BV6 A;  2C3D A;  1V59 A;  1JRZ A;  2B9Y A;  3PVC A;  4IA5 A;  4YTM A;  4B65 A;  3WE0 A;  3FIM B;  4O5Q A;  3CPH G;  2XFN A;  3QJ4 A;  4Y4N A;  2XYO A;  3F8D A;  2R0P A;  2YLS A;  1DXL A;  3AEE A;  4CCQ A;  4NEW A;  4K8D A;  4TM4 A;  4X4J A;  3AE3 A;  2WOV A;  1QJD A;  4J34 A;  4D04 A;  4BK3 A;  4I58 A;  3LZW A;  1Z6L A;  2ACZ A;  4TLX A;  2GAH B;  3T31 A;  3NYC A;  4IVO B;  4UP3 A;  2UZZ A;  1TDF A;  3UTH A;  1PBF A;  4FX9 A;  2X99 A;  3AXB A;  3VR9 A;  1ZKQ A;  2GR3 A;  2YLW A;  3ATR A;  3CTY A;  4H4T A;  2GVC A;  3AED A;  1TDK A;  3QVR A;  1H81 A;  3PO7 A;  4G6G A;  3IHM A;  2B7S A;  4REK A;  2FJD A;  4CCR A;  1YQ3 A;  5EB4 A;  3RHA A;  2YAU A;  1OJD A;  1NDA A;  4OCG A;  4B67 A;  1VG9 A;  1XAN A;  2WP9 A;  4IA6 A;  5HY5 A;  3NYE A;  4CNK A;  5JCL A;  3UKP A;  2CDU A;  2GQF A;  1KFY A;  1VRQ B;  3LAD A;  2YG6 A;  4NZH A;  4A9W A;  1F3P A;  3AD8 B;  5KMS A;  1TDE A;  3NTA A;  3GMB A;  2XFO A;  3AD9 B;  2XLR A;  2WS3 A;  1EL7 A;  1PN0 A;  2GF3 A;  3D8X A;  1IUW A;  1GER A;  1E6E A;  1P2E A;  3O0H A;  3UKL A;  5KMR A;  1E1M A;  3F8P A;  3HZL A;  2NPX A;  2EQ8 A;  1QO8 A;  4C77 A;  3BI4 A;  4TM1 A;  4Z2R A;  2B76 A;  3LXD A;  4H4W A;  4GR1 A;  4OPG A;  3SX6 A;  1NG4 A;  4K2X A;  4EQX A;  3VRD B;  3NTD A;  3T0K A;  4EM4 A;  3K30 A;  2GR1 A;  3HYX A;  5CQF A;  5DBJ A;  1ZX9 A;  1GRF A;  1PS9 A;  4II3 A;  5J7X A;  2IVD A;  4AT0 A;  4Z2U A;  2A89 A;  2GRT A;  4EQS A;  1N4U A;  2X8G A;  1F8W A;  2XVF A;  2YLT A;  1K4Q A;  3IHG A;  1D4E A;  4UDQ A;  1JU2 A;  3B3R A;  1E1K A;  4H4S A;  1YY5 A;  1ZOV A;  3IF9 A;  5HXI A;  4XWZ A;  1ZOY A;  5J60 A;  4ZCD A;  2GH5 A;  1FEC A;  2WDR A;  1DJQ A;  2VQ7 A;  3P4R A;  4NWZ A;  1Y56 A;  2A8X A;  2JK6 A;  1ZMD A;  4RG3 A;  1H83 A;  5L46 A;  1GOS A;  3CND A;  4GUV A;  4A79 A;  2IID A;  3ATQ A;  3AYL A;  1GV4 A;  4ADW A;  1BGN A;  4U8J A;  3P9U A;  4NTD A;  2RAB A;  3M12 A;  1MO9 A;  1JNR A;  3CGD A;  2WPF A;  4J2W A;  5EB5 A;  3DK9 A;  4Y4M A;  3QFA A;  1BGJ A;  5EBK A;  2XFP A;  4K5R A;  3G5Q A;  4U2T A;  2JKC A;  4H2Q A;  2GB0 A;  3QVP A;  4Z43 A;  1H7W A;  4BUR A;  5JCI A;  4A6N B;  1H6V A;  1KNR A;  3GRS A;  2GAG B;  3CPJ G;  4H4Y A;  3V3O A;  4JN9 A;  1DOC A;  1OJT A;  1GTE A;  1F8S A;  3CN8 A;  4CY6 A;  1NPX A;  4KPR A;  5HHF A;  4YTP A;  1REO A;  2OA1 A;  4TLZ A;  3AEB A;  2R45 A;  3VR8 A;  1KSU A;  3KA7 A;  1ONF A;  4TM0 A;  4GAV A;  1E7P A;  2O9Z A;  3EAN A;  1GSN A;  5FS8 A;  1DOD A;  1S3B A;  2YM1 A;  1CBO A;  4EMJ A;  4AOX A;  4N9X A;  4OVI A;  1OJC A;  3GYJ A;  1DOE A;  3IWA A;  2C67 A;  4KX6 A;  3UP4 A;  5KVI A;  2EQ7 A;  2ZZ0 A;  3SGL A;  1NEK A;  3NN0 X;  4J31 A;  2RGO A;  3QSM A;  2B9W A;  1X31 B;  5FS7 A;  3CGC A;  5KVH A;  2PHH A;  4U8P A;  3CNS A;  1VQW A;  3S5W A;  4D03 A;  1PJ7 A;  1KSS A;  4XXG A;  1JEH A;  1W4X A;  2C64 A;  2YLX A;  3L1R A;  2YLR A;  1Q9I A;  4NEV A;  1JRX A;  3EPT A;  3ICT A;  3BNU A;  4H4P A;  2XFU A;  3ICS A;  5HYM A;  4APN A;  2Z5Y A;  4YSY A;  3GDP A;  2WPC A;  1LQT A;  4WCT A;  4C3Y A;  1TDO A;  2RGH A;  3G5R A;  1O94 A;  3E1T A;  4OPD A;  3RP8 A;  2HQM A;  1GRH A;  3SZW A;  4CBQ A;  1CL0 A;  1NHS A;  1AOG A;  4USR A;  2BC0 A;  1FEB A;  3ZDN A;  1MOK A;  3NLC A;  3ZYX A;  3T2Z A;  4OPL A;  3K7Q X;  1YQZ A;  5U63 A;  3KPK A;  4C5O A;  2YR5 A;  3HYV A;  5BUK A;  1FL2 A;  3CIR A;  1LVL A;  1KNP A;  4U8L A;  3NG7 X;  2OLN A;  3SZF A;  2FJA A;  2GEW A;  1PDH A;  1LTX R;  2WOW A;  3UTF A;  5M0Z A;  5KMQ A;  5EOW A;  1NHR A;  1PBD A;  4BJZ A;  1OJ9 A;  4CNJ A;  5KNL A;  2BCP A;  4B69 A;  4J36 A;  2R0G A;  2XFQ A;  4LU6 A;  1YQ4 A;  5BRT A;  4U2L A;  3L8K A;  2WDQ A;  4JNA A;  3NK1 X;  3LJP A;  4ZCC A;  4GDE A;  2QAE A;  1PBE A;  3GSI A;  3CMM A;  4OPC A;  3UCL A;  1L9E A;  2B7R A;  3P4P A;  1PHH A;  2GV8 A;  3AE5 A;  4K7Z A;  4MJW A;  5U1O A;  3VRA A;  5C2T A;  1K0L A;  3EF6 A;  3KPF A;  4H4Z A;  1CHU A;  3II4 A;  2ARD A;  4ICY A;  4EIQ A;  3VRB A;  5BUL A;  3H8L A;  3R9U A;  4Z26 A;  3BNM A;  1MXT A;  2X8H A;  3CPI G;  4P9S A;  2XLT A;  4A5L A;  4EMI A;  4YKF A;  2AR8 A;  1ZDL A;  2WBA A;  3OC4 A;  2WU5 A;  4BK1 A;  3NK0 X;  3Q9T A;  2BS2 A;  3SZC A;  1M64 A;  1Y56 B;  2YLZ A;  2QCU A;  1H84 A;  2Y6R A;  4ZN0 A;  2C3C A;  1K0I A;  2JBV A;  2Z5X A;  3KD9 A;  2A87 A;  4GCM A;  4Z24 A;  2YWL A;  1PJ6 A;  2JB2 A;  3AE1 A;  3KLJ A;  4NNJ A;  3RP7 A;  4J33 A;  3PS9 A;  2V6O A;  3GD4 A;  3KKJ A;  4U8O A;  1CF3 A;  2R9Z A;  5FS6 A;  2JAE A;  3CNT A;  1PBB A;  1PXB A;  3ALM A;  2VVM A;  2WOI A;  3DGZ A;  2BAB A;  3DJE A;  4I59 A;  4U8N A;  1S3E A;  2YG4 A;  3GRT A;  3UOZ A;  4EQR A;  4RSL A;  1H7X A;  1PXC A;  3C96 A;  4K5S A;  4RG4 A;  4YT0 A;  3UTE A;  5JCK A;  1RSG A;  4H2P A;  2V5Z A;  3UKK A;  1ZK7 A;  2VVL G;  4GAP A;  1GAL A;  2C4C A;  4OPU A;  3K7T A;  4DSG A;  3BI2 A;  3IC9 A;  2F5Z A;  1TDN A;  1NG3 A;  2GQW A;  2XVJ A;  3GYX A;  3KU9 A;  3GYI A; 
#chains in the Genus database with same CATH homology
 3H4K A;  3ALJ A;  2DKH A;  3DME A;  5CKU A;  4YSZ A;  1GTH A;  2BAC A;  1L9C A;  4AP1 A;  1EBD A;  3UKF A;  3UOY A;  2YG5 A;  2YG3 A;  4H4V A;  3NHO X;  5FS9 A;  3NGC X;  4YTN A;  4H4R A;  1D7Y A;  1GRE A;  3M13 A;  4YXD A;  3AE2 A;  2WEU A;  2E4G A;  5IPY A;  3GMC A;  3AE7 A;  3F8R A;  3JSK A;  3T2K A;  4H7U A;  1P2H A;  2BK3 A;  2OLO A;  2E1M A;  2Q0L A;  1B8S A;  3UKQ A;  4GF7 A;  4B63 A;  1GEU A;  4CRT A;  2AQJ A;  4X9M A;  1E1L A;  3NYF A;  2WPE A;  2XLS A;  4IV9 A;  2X3N A;  2CFY A;  4AOS A;  4B66 A;  4C74 A;  4EIP A;  3ALL A;  3CGE A;  1BF3 A;  4WX1 A;  3RNM A;  1GT8 A;  4FK1 C;  4XWR A;  1VDC A;  2WP6 A;  3RP6 A;  1SEZ A;  2WP5 A;  3RED A;  1FCD A;  1L0V A;  1LQU A;  3M0O A;  1TRB A;  2C65 A;  4LA1 A;  4G74 A;  2WQY A;  2VRL A;  1GRG A;  1F8R A;  4EM3 A;  4UDR A;  3AE4 A;  1NAA A;  3QFB A;  1XHC A;  2XDO A;  1L9D A;  3BI5 A;  3NH3 X;  5JCN A;  1M6I A;  2C66 A;  4Z2T A;  3QSE A;  2TMD A;  2Q0K A;  4B64 A;  2GR0 A;  2I0Z A;  1GPE A;  1D4C A;  2V61 A;  3NNE A;  3P4S A;  4NTE A;  3C4N A;  5IQ4 A;  1BWC A;  1CJ2 A;  1S2Y A;  2X50 A;  5JCM A;  1IUS A;  1IUU A;  2ZBW A;  4H2R A;  3SFD A;  2DKI A;  3AEC A;  3UOX A;  4DGK A;  2XLP A;  3DJD A;  4Y4L A;  4CY8 A;  2VQB A;  1N4W A;  4B68 A;  1NEN A;  1GND A;  2B9X A;  4X9N A;  3SY4 A;  1B5Q A;  2TPR A;  1B37 A;  3DK8 A;  4ECH A;  2BYB A;  5IQ1 A;  1F6M A;  4E0V A;  4FDC B;  1NHQ A;  2Q7V A;  1E1N A;  2Y6Q A;  2XCG A;  3AWI A;  1CC2 A;  1ELI A;  1FEA A;  4TM3 A;  3EAO A;  1JOA A;  1Q1R A;  1RP0 A;  2QA1 A;  3AEA A;  3FPZ A;  2GMH A;  1IJH A;  3UKH A;  1E39 A;  2OAL A;  1H82 A;  2APG A;  2GR2 A;  3AB1 A;  4O5U A;  3AE9 A;  1Y0P A;  3SFE A;  2BK5 A;  3LOV A;  3AEF A;  2BXS A;  4H4X A;  4BJY A;  4JY2 A;  2QA2 A;  1GRT A;  2H88 A;  2YR6 A;  3NK2 X;  4PAB A;  3T14 A;  3ICR A;  1H86 A;  3NKS A;  2JB3 A;  2VOU A;  3SYI A;  3UOV A;  3DA1 A;  5KXJ A;  1FOH A;  3I6D A;  4HB9 A;  4B1B A;  3SZ0 A;  3LB8 A;  4U8K A;  4A99 A;  4LII A;  2YM2 A;  3AD7 B;  2YG7 A;  1S2Q A;  2BCG G;  4H4Q A;  4JNQ A;  3DGH A;  3LZX A;  3UTG A;  3AEG A;  3AE6 A;  4AP3 A;  5KOX A;  3P1W A;  2JB1 A;  1K0J A;  2CUL A;  2XLU A;  4BK2 A;  5ER0 A;  1Q1W A;  2YVJ A;  1OJA A;  2CVJ A;  3DK4 A;  4OPI A;  1LPF A;  4YKG A;  2C72 A;  2FJB A;  2WU2 A;  2BRY A;  1EL8 A;  2EQ9 A;  4JDR A;  4DSH A;  1YKJ A;  3DH9 A;  3FG2 P;  1TYT A;  2Q6U A;  4YSH A;  2V3B A;  3SXI A;  1N4V A;  1KF6 A;  3SM8 A;  5BVA A;  5C3J A;  3D1C A;  3K7M X;  1B4V A;  5U25 A;  5M10 A;  2VVL A;  4H2N A;  1LJ1 A;  2YR4 A;  5GSN A;  1CJ4 A;  3CNJ A;  3GDN A;  4GDP A;  4OPT A;  1GRB A;  1BZL A;  4JQ9 A;  4A7A A;  1IUV A;  3HYW A;  3V3N A;  5KWF A;  1GES A;  1UKV G;  2XVH A;  3T2Y A;  5TR3 A;  1ZP0 A;  3BHK A;  3I3L A;  1PJ5 A;  4U2S A;  2E5V A;  4G6H A;  2GMJ A;  4U8M A;  2R46 A;  2BC1 A;  1VG0 A;  2V60 A;  4II2 A;  1CC6 A;  1RYI A;  3T37 A;  2ZZC A;  3S61 A;  4G9K A;  1N1P A;  1EL5 A;  4UDP A;  1JRY A;  1EL9 A;  1ZMC A;  2X8C A;  3FBS A;  3P4Q A;  2NVK X;  4FK1 A;  2BS3 A;  5GRT A;  4Z25 A;  3GD3 A;  4K22 A;  1PBC A;  2BS4 A;  1JNZ A;  2C76 A;  2OAM A;  1GET A;  4G73 A;  3URH A;  4AT2 A;  2R0C A;  2YQU A;  2ZZB A;  4NTC A;  2R4J A;  3CNP A;  3B6D A;  3VQR A;  4J57 A;  2WES A;  2BA9 A;  2IVE A;  1KDG A;  5KRQ A;  3ABV A;  4YSX A;  3G5S A;  1CJ3 A;  1XPQ A;  2BXR A;  3ITJ A;  4EQW A;  2XVI A;  1DNC A;  3COX A;  3NT6 A;  4Z44 A;  2C70 A;  1PXA A;  3QSS A;  2PYX A;  1CJC A;  2VZ2 A;  3FMW A;  3KVE A;  3AE8 A;  2VRM A;  3AYI A;  4C3X A;  1IUX A;  1ZY8 A;  1D4D A;  4H50 A;  4HA6 A;  2FBW A;  3UKA A;  2FJE A;  1QLB A;  2R4E A;  2W0H A;  1DOB A;  5KOW A;  1D5T A;  4JY3 A;  4DNA A;  2BK4 A;  4USQ A;  3UP5 A;  2WET A;  2V3A A;  3DJJ A;  3NRN A;  5FMH A;  3GWF A;  3OZ2 A;  4J56 A;  3V76 A;  4A6N A;  2C7G A;  3C4A A;  4H4U A;  1GXF A;  2RGJ A;  1BKW A;  3NN6 X;  2C75 A;  4M52 A;  1TYP A;  3NIX A;  3AYJ A;  1DJN A;  2AAQ A;  3GWD A;  2H89 A;  3CGB A;  1NHP A;  1COY A;  2EQ6 A;  2BRA A;  4U8I A;  1O95 A;  3DJG X;  4IVM B;  5KMP A;  5LV9 A;  1CC4 A;  2J3N A;  1IUT A;  4YWO A;  2WDV A;  3Q6J A;  3ADA B;  2C73 A;  2YVF A;  2YVG A;  3BHF A;  3ISH A;  1XDI A;  4A65 A;  1GRA A;  4EMW A;  2WHD A;  4PAA A;  4GRT A;  1LV0 A;  1D7L A;  1O5W A;  2XVE A;  3H8I A;  3SQP A;  1HYU A;  4BV6 A;  2C3D A;  1V59 A;  1JRZ A;  2B9Y A;  3PVC A;  4IA5 A;  4YTM A;  4B65 A;  3WE0 A;  3FIM B;  4O5Q A;  3CPH G;  2XFN A;  3QJ4 A;  4Y4N A;  2XYO A;  3F8D A;  2R0P A;  2YLS A;  1DXL A;  3AEE A;  4CCQ A;  4NEW A;  4K8D A;  4TM4 A;  4X4J A;  3AE3 A;  2WOV A;  1QJD A;  4J34 A;  4D04 A;  4BK3 A;  4I58 A;  3LZW A;  1Z6L A;  2ACZ A;  4TLX A;  2GAH B;  3T31 A;  3NYC A;  4IVO B;  4UP3 A;  2UZZ A;  1TDF A;  3UTH A;  1PBF A;  4FX9 A;  2X99 A;  3AXB A;  3VR9 A;  1ZKQ A;  2GR3 A;  2YLW A;  3ATR A;  3CTY A;  4H4T A;  2GVC A;  3AED A;  1TDK A;  3QVR A;  1H81 A;  3PO7 A;  4G6G A;  3IHM A;  2B7S A;  4REK A;  2FJD A;  4CCR A;  1YQ3 A;  5EB4 A;  3RHA A;  2YAU A;  1OJD A;  1NDA A;  4OCG A;  4B67 A;  1VG9 A;  1XAN A;  2WP9 A;  4IA6 A;  5HY5 A;  3NYE A;  4CNK A;  5JCL A;  3UKP A;  2CDU A;  2GQF A;  1KFY A;  1VRQ B;  3LAD A;  2YG6 A;  4NZH A;  4A9W A;  1F3P A;  3AD8 B;  5KMS A;  1TDE A;  3NTA A;  3GMB A;  2XFO A;  3AD9 B;  2XLR A;  2WS3 A;  1EL7 A;  1PN0 A;  2GF3 A;  3D8X A;  1IUW A;  1GER A;  1E6E A;  1P2E A;  3O0H A;  3UKL A;  5KMR A;  1E1M A;  3F8P A;  3HZL A;  2NPX A;  2EQ8 A;  1QO8 A;  4C77 A;  3BI4 A;  4TM1 A;  4Z2R A;  2B76 A;  3LXD A;  4H4W A;  4GR1 A;  4OPG A;  3SX6 A;  1NG4 A;  4K2X A;  4EQX A;  3VRD B;  3NTD A;  3T0K A;  4EM4 A;  3K30 A;  2GR1 A;  3HYX A;  5CQF A;  5DBJ A;  1ZX9 A;  1GRF A;  1PS9 A;  4II3 A;  5J7X A;  2IVD A;  4AT0 A;  4Z2U A;  2A89 A;  2GRT A;  4EQS A;  1N4U A;  2X8G A;  1F8W A;  2XVF A;  2YLT A;  1K4Q A;  3IHG A;  1D4E A;  4UDQ A;  1JU2 A;  3B3R A;  1E1K A;  4H4S A;  1YY5 A;  1ZOV A;  3IF9 A;  5HXI A;  4XWZ A;  1ZOY A;  5J60 A;  4ZCD A;  2GH5 A;  1FEC A;  2WDR A;  1DJQ A;  2VQ7 A;  3P4R A;  4NWZ A;  1Y56 A;  2A8X A;  2JK6 A;  1ZMD A;  4RG3 A;  1H83 A;  5L46 A;  1GOS A;  3CND A;  4GUV A;  4A79 A;  2IID A;  3ATQ A;  3AYL A;  1GV4 A;  4ADW A;  1BGN A;  4U8J A;  3P9U A;  4NTD A;  2RAB A;  3M12 A;  1MO9 A;  1JNR A;  3CGD A;  2WPF A;  4J2W A;  5EB5 A;  3DK9 A;  4Y4M A;  3QFA A;  1BGJ A;  5EBK A;  2XFP A;  4K5R A;  3G5Q A;  4U2T A;  2JKC A;  4H2Q A;  2GB0 A;  3QVP A;  4Z43 A;  1H7W A;  4BUR A;  5JCI A;  4A6N B;  1H6V A;  1KNR A;  3GRS A;  2GAG B;  3CPJ G;  4H4Y A;  3V3O A;  4JN9 A;  1DOC A;  1OJT A;  1GTE A;  1F8S A;  3CN8 A;  4CY6 A;  1NPX A;  4KPR A;  5HHF A;  4YTP A;  1REO A;  2OA1 A;  4TLZ A;  3AEB A;  2R45 A;  3VR8 A;  1KSU A;  3KA7 A;  1ONF A;  4TM0 A;  4GAV A;  1E7P A;  2O9Z A;  3EAN A;  1GSN A;  5FS8 A;  1DOD A;  1S3B A;  2YM1 A;  1CBO A;  4EMJ A;  4AOX A;  4N9X A;  4OVI A;  1OJC A;  3GYJ A;  1DOE A;  3IWA A;  2C67 A;  4KX6 A;  3UP4 A;  5KVI A;  2EQ7 A;  2ZZ0 A;  3SGL A;  1NEK A;  3NN0 X;  4J31 A;  2RGO A;  3QSM A;  2B9W A;  1X31 B;  5FS7 A;  3CGC A;  5KVH A;  2PHH A;  4U8P A;  3CNS A;  1VQW A;  3S5W A;  4D03 A;  1PJ7 A;  1KSS A;  4XXG A;  1JEH A;  1W4X A;  2C64 A;  2YLX A;  3L1R A;  2YLR A;  1Q9I A;  4NEV A;  1JRX A;  3EPT A;  3ICT A;  3BNU A;  4H4P A;  2XFU A;  3ICS A;  5HYM A;  4APN A;  2Z5Y A;  4YSY A;  3GDP A;  2WPC A;  1LQT A;  4WCT A;  4C3Y A;  1TDO A;  2RGH A;  3G5R A;  1O94 A;  3E1T A;  4OPD A;  3RP8 A;  2HQM A;  1GRH A;  3SZW A;  4CBQ A;  1CL0 A;  1NHS A;  1AOG A;  4USR A;  2BC0 A;  1FEB A;  3ZDN A;  1MOK A;  3NLC A;  3ZYX A;  3T2Z A;  4OPL A;  3K7Q X;  1YQZ A;  5U63 A;  3KPK A;  4C5O A;  2YR5 A;  3HYV A;  5BUK A;  1FL2 A;  3CIR A;  1LVL A;  1KNP A;  4U8L A;  3NG7 X;  2OLN A;  3SZF A;  2FJA A;  2GEW A;  1PDH A;  1LTX R;  2WOW A;  3UTF A;  5M0Z A;  5KMQ A;  5EOW A;  1NHR A;  1PBD A;  4BJZ A;  1OJ9 A;  4CNJ A;  5KNL A;  2BCP A;  4B69 A;  4J36 A;  2R0G A;  2XFQ A;  4LU6 A;  1YQ4 A;  5BRT A;  4U2L A;  3L8K A;  2WDQ A;  4JNA A;  3NK1 X;  3LJP A;  4ZCC A;  4GDE A;  2QAE A;  1PBE A;  3GSI A;  3CMM A;  4OPC A;  3UCL A;  1L9E A;  2B7R A;  3P4P A;  1PHH A;  2GV8 A;  3AE5 A;  4K7Z A;  4MJW A;  5U1O A;  3VRA A;  5C2T A;  1K0L A;  3EF6 A;  3KPF A;  4H4Z A;  1CHU A;  3II4 A;  2ARD A;  4ICY A;  4EIQ A;  3VRB A;  5BUL A;  3H8L A;  3R9U A;  4Z26 A;  3BNM A;  1MXT A;  2X8H A;  3CPI G;  4P9S A;  2XLT A;  4A5L A;  4EMI A;  4YKF A;  2AR8 A;  1ZDL A;  2WBA A;  3OC4 A;  2WU5 A;  4BK1 A;  3NK0 X;  3Q9T A;  2BS2 A;  3SZC A;  1M64 A;  1Y56 B;  2YLZ A;  2QCU A;  1H84 A;  2Y6R A;  4ZN0 A;  2C3C A;  1K0I A;  2JBV A;  2Z5X A;  3KD9 A;  2A87 A;  4GCM A;  4Z24 A;  2YWL A;  1PJ6 A;  2JB2 A;  3AE1 A;  3KLJ A;  4NNJ A;  3RP7 A;  4J33 A;  3PS9 A;  2V6O A;  3GD4 A;  3KKJ A;  4U8O A;  1CF3 A;  2R9Z A;  5FS6 A;  2JAE A;  3CNT A;  1PBB A;  1PXB A;  3ALM A;  2VVM A;  2WOI A;  3DGZ A;  2BAB A;  3DJE A;  4I59 A;  4U8N A;  1S3E A;  2YG4 A;  3GRT A;  3UOZ A;  4EQR A;  4RSL A;  1H7X A;  1PXC A;  3C96 A;  4K5S A;  4RG4 A;  4YT0 A;  3UTE A;  5JCK A;  1RSG A;  4H2P A;  2V5Z A;  3UKK A;  1ZK7 A;  2VVL G;  4GAP A;  1GAL A;  2C4C A;  4OPU A;  3K7T A;  4DSG A;  3BI2 A;  3IC9 A;  2F5Z A;  1TDN A;  1NG3 A;  2GQW A;  2XVJ A;  3GYX A;  3KU9 A;  3GYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...