3ISHA

Crystal structure of helicobacter pylori thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Crystal structure of Helicobacter pylori thioredoxin reductase
rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 88
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ishA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ishA02
4BK1A 2XFPA 5CQFA 4LIIA 4YWOA 4Z2RA 3SGLA 1KNRA 2X99A 2YR6A 1VDCA 4K5RA 5KVHA 1TYPA 2GMJA 4GCMA 2WEUA 1LJ1A 2V3BA 3SM8A 4JQ9A 1JNZA 3UKKA 3LZXA 4D03A 3GMCA 3FIMB 3DK8A 1KSSA 4CNKA 2YM1A 2YR5A 2CULA 1PDHA 4M52A 2Q7VA 1PS9A 3ICRA 2WDRA 1F8WA 2WETA 3K7MX 1H7XA 1CJ3A 1TDOA 2YR4A 1H86A 3B3RA 3IWAA 4U2SA 1GXFA 3II4A 2C65A 4H2NA 5U25A 1EBDA 4X9NA 4IV9A 1NG3A 1D4CA 4AOXA 2YG6A 4U8LA 1S3BA 3QFAA 1Q9IA 4EQSA 3UKAA 1GEUA 3BNUA 3LOVA 2WP9A 3IC9A 5BVAA 4EIQA 4H2RA 1D4DA 1XANA 2VVLG 1SEZA 3AXBA 4OPGA 4AT0A 2W0HA 3GWFA 2YVFA 2YG4A 1QO8A 1OJDA 3AECA 3QFBA 1X31B 3CIRA 1BZLA 2BS2A 2YVJA 3EPTA 2AR8A 2CVJA 4J57A 2BCPA 3DJJA 1E1MA 4YKFA 3UOYA 2WS3A 5FS7A 4GDPA 4OPCA 3NKSA 3CNPA 3CGEA 4AP1A 1YY5A 1TDEA 1ZOVA 4BJYA 4ECHA 1F6MA 3NYCA 4C77A 4H4RA 4UDRA 3NLCA 3KD9A 2RGOA 3K7QX 1XPQA 2AAQA 3AYJA 2BS4A 4NEVA 4NEWA 1PXBA 2Z5XA 2B9WA 3FPZA 3K7TA 2A8XA 4J56A 1GERA 4JDRA 4WX1A 5KWFA 4U8KA 3VR9A 3BHFA 1PBDA 3D8XA 4CRTA 2JB3A 2X50A 2WP5A 5U63A 4A9WA 1S3EA 2C3CA 2ZBWA 1COYA 3AE1A 2VRMA 3AE8A 2VRLA 3ICSA 1OJ9A 4DSGA 3GDNA 5JCLA 4ADWA 2WPEA 4B67A 3BI2A 4J2WA 1E1LA 2OLNA 1Y56A 4DSHA 3O0HA 5HYMA 1H83A 4U8IA 1DJQA 4GRTA 4C5OA 3RP6A 4CY6A 1K4QA 1RYIA 3AE6A 4B65A 3ADAB 2B9YA 3QVRA 2OAMA 1B4VA 2WHDA 3VR8A 4OVIA 1Q1WA 1E39A 3FG2P 1M6IA 3GD3A 4UDPA 2Q6UA 1DOCA 1NG4A 3UP5A 1PN0A 1DNCA 1H6VA 3RP8A 1GSNA 2ZZBA 4H4TA 2WPCA 1L0VA 1PJ6A 2YG5A 1KFYA 3CNDA 3URHA 4CCRA 4GR1A 1BGNA 1D4EA 3SFEA 5DBJA 2Q0KA 2Y6RA 4H4SA 1PBFA 2GAHB 4OCGA 4Z26A 3G5SA 2VQ7A 1RSGA 3GD4A 2E5VA 2WOIA 3Q9TA 4USQA 1DJNA 2BC0A 1NDAA 3P4PA 3I6DA 1ZP0A 3COXA 5JCIA 1F8SA 3ALLA 4RG3A 2IVEA 4RSLA 3UOVA 5KRQA 2E1MA 4NZHA 3JSKA 4C3YA 1D5TA 1GESA 2JB1A 1MOKA 2XFOA 3H4KA 4N9XA 4TM1A 4U8PA 3V3OA 5BRTA 2C7GA 4ICYA 3KLJA 4B64A 1S2QA 1ZX9A 2QAEA 3AEBA 2WOWA 1IUUA 2XVIA 1E1KA 3LZWA 3AEGA 4H4WA 4WCTA 3REDA 3GYJA 4DGKA 3AE9A 4XXGA 2FJEA 1Z6LA 3DMEA 2C66A 3G5RA 4B66A 4RG4A 3GRTA 4H4UA 3AD8B 1XHCA 5BUKA 3IHGA 4D04A 5HHFA 1VG9A 3ITJA 3LXDA 4EMIA 4EM3A 1W4XA 2EQ9A 2FJDA 4Z24A 4A79A 3F8RA 1TRBA 1ZKQA 2WU2A 1DXLA 3PS9A 2WDQA 4PAAA 4K2XA 4A5LA 1NHPA 3VRBA 2EQ8A 3LJPA 1PJ7A 4ZCDA 1LVLA 2V6OA 4B68A 4UDQA 5ER0A 1YQ3A 2C70A 5HXIA 2V5ZA 4Z43A 1Y56B 2C3DA 2NVKX 3I3LA 4P9SA 2V3AA 1JNRA 2R45A 2GB0A 1IUXA 4UP3A 3AEFA 4NTDA 2A89A 3LADA 4JY3A 5TR3A 1FCDA 2R4JA 5FMHA 2XLTA 1IUSA 4YTPA 1UKVG 3P4SA 1ELIA 2VVMA 4KX6A 3ATRA 1TDFA 1IUVA 3DJGX 3GSIA 2IIDA 4AT2A 3L8KA 4H4PA 3AE5A 1V59A 1OJAA 3KA7A 2GMHA 2YLZA 4J34A 2BA9A 3OC4A 4U8JA 4JNAA 2YLTA 3AD9B 1GRAA 1B8SA 1K0JA 2X8CA 4LU6A 4Y4MA 4ZCCA 1DOEA 1MXTA 2PHHA 5U1OA 2CDUA 3AYLA 3UCLA 2WOVA 3V76A 2ZZCA 4USRA 4CBQA 2GQWA 2Y6QA 3OZ2A 2YLXA 3CNTA 3ALMA 3AE2A 1IUTA 1VRQB 3KVEA 3UP4A 3QSSA 1D7LA 3GWDA 1EL7A 1E1NA 1IJHA 3D1CA 1EL9A 4H4YA 2RGHA 1CC4A 2GR2A 5LV9A 1H7WA 4U8OA 3UTFA 3UOZA 5L46A 1GALA 1CF3A 4EQRA 4HA6A 3NIXA 1Q1RA 2C73A 1VQWA 2CFYA 2JBVA 2B76A 5KXJA 1IUWA 3NRNA 1D7YA 4YTMA 3NTDA 1S2YA 2A87A 3AWIA 2XLRA 4J33A 1FEAA 4H4ZA 3ICTA 3SFDA 4BURA 2ARDA 2XLUA 3NN0X 1XDIA 3DGHA 2XVFA 1B5QA 3DJDA 3NK1X 5GSNA 1YQZA 1ONFA 4C74A 4BK2A 1NPXA 2XFNA 2R0CA 2YM2A 3DH9A 4FK1A 4OPDA 4JNQA 4OPUA 1ZDLA 1GNDA 3FMWA 3BI5A 3VRAA 2R0GA 3FBSA 1BF3A 2DKIA 4REKA 2TMDA 5CKUA 2GVCA 3NHOX 1PBEA 4DNAA 3KU9A 2I0ZA 4FX9A 1KDGA 3NYFA 4B69A 3UKQA 3DK4A 2B7SA 3M0OA 4XWZA 1GTHA 2YQUA 3QSEA 4H4QA 2RGJA 4EMWA 3CN8A 3V3NA 4TM3A 1NHSA 4B63A 2R0PA 3CGDA 3G5QA 3C4NA 2HQMA 4PABA 2OLOA 3AE4A 3HZLA 1O94A 5KOWA 2BCGG 3AE3A 3UKHA 4APNA 1Y0PA 3EAOA 2GQFA 3C96A 1TYTA 1NAAA 2UZZA 1O95A 1ZMCA 3GDPA 4J36A 2BACA 4H2PA 4LA1A 4X4JA 5GRTA 3F8DA 1H84A 4U2LA 3F8PA 3PVCA 1JRXA 4JY2A 3DA1A 1L9DA 3VRDB 2XLPA 3C4AA 3P9UA 3S61A 2BXRA 4YSYA 1PXAA 2C64A 1RP0A 3DJEA 5IQ4A 2WQYA 1OJTA 2C67A 4A7AA 1BGJA 2R46A 2EQ7A 3P4QA 1K0IA 3ALJA 1FEBA 3IHMA 1KNPA 1FECA 3UTGA 1TDNA 5KVIA 4ZN0A 3RNMA 1JOAA 1NHQA 4Z2TA 3CNJA 3RP7A 3CPHG 2V60A 2XVEA 3NTAA 2C76A 1E7PA 1KSUA 2GAGB 4Y4NA 5IPYA 2H89A 5FS8A 3AEEA 4CNJA 2VQBA 1FL2A 4Z25A 4A99A 4OPIA 1NEKA 3NK0X 2BK5A 5J60A 3NYEA 5IQ1A 2GH5A 3CGBA 4U8MA 2XFUA 4HB9A 2V61A 2GEWA 4BV6A 1CJCA 1ZMDA 2GR3A 5KOXA 1N1PA 4H7UA 2Q0LA 1ZOYA 4U8NA 1L9EA 2YG3A 4FK1C 4H4XA 2YLRA 4YSZA 3ISHA 2BS3A 4BK3A 1HYUA 4K5SA 2WESA 2YLSA 2QA1A 1LQUA 2WBAA 2FJBA 3AE7A 4U2TA 4IVMB 2X8GA 5C3JA 4IA6A 1DOBA 4BJZA 2GV8A 2J3NA 1PXCA 3CPJG 1GRHA 3H8LA 1N4UA 3NGCX 4NTCA 1YKJA 3BHKA 4AOSA 4XWRA 2WU5A 1O5WA 4TLXA 2Z5YA 4O5QA 4EIPA 3KKJA 4YKGA 2XCGA 4I58A 1P2HA 2JAEA 2YG7A 1BWCA 1VG0A 1REOA 3CGCA 4A65A 4K22A 1CC6A 1EL8A 1L9CA 1GPEA 3DGZA 2B9XA 3AD7B 3UOXA 1QJDA 3ABVA 3H8IA 3M13A 3ZDNA 2BK3A 4CCQA 1GRGA 4GUVA 5JCMA 2APGA 1JRZA 3QJ4A 3R9UA 3CTYA 4CY8A 1JRYA 1PBCA 2YVGA 5FS6A 1F8RA 3UKLA 1GRFA 2JKCA 3EF6A 2QA2A 1NENA 2WPFA 4EM4A 2PYXA 2YWLA 4J31A 3QVPA 4YXDA 2B7RA 2FJAA 2XLSA 4IA5A 5M0ZA 3UTHA 3T37A 3L1RA 3DK9A 4MJWA 4KPRA 4Y4LA 3CPIG 1CL0A 4A6NB 3VQRA 1CC2A 2BK4A 2XVJA 4Z2UA 3BNMA 4EQXA 4YSXA 3IF9A 1CJ4A 3NG7X 3AYIA 4O5UA 3WE0A 2QCUA 5HY5A 1GOSA 2E4GA 5JCKA 4B1BA 3CNSA 1QLBA 4NTEA 1GV4A 1YQ4A 5EBKA 3NT6A 2DKHA 4EMJA 4H4VA 2TPRA 4EQWA 2F5ZA 1FOHA 5C2TA 2FBWA 1JU2A 4TM4A 4E0VA 5EB5A 1ZK7A 2ZZ0A 3M12A 3NH3X 1LPFA 3QSMA 4K8DA 4YT0A 4OPTA 3NN6X 4TLZA 2YAUA 1N4WA 3NNEA 3EANA 3NK2X 2BYBA 1CBOA 3SQPA 3S5WA 2XVHA 2EQ6A 2C72A 3AB1A 3ATQA 3GRSA 5BULA 1F3PA 1PBBA 1B37A 2NPXA 2O9ZA 3AEAA 3E1TA 3AEDA 3KPFA 1GRBA 5J7XA 3UTEA 4YSHA 2X3NA 1LV0A 1CJ2A 4AP3A 1M64A 1PJ5A 3GYIA 1E6EA 4OPLA 2VZ2A 2RABA 4FDCB 4JN9A 5EB4A 5FS9A 4C3XA 4K7ZA 1K0LA 1MO9A 1P2EA 2GRTA 1OJCA 2YLWA 1JEHA 2XFQA 4Z44A 2OALA 5EOWA 1H81A 1DODA 2C75A 2GR0A 2JK6A 4GF7A 2H88A 1BKWA 1GT8A 3P1WA 2XDOA 2GF3A 2GR1A 3K30A 2JB2A 4GDEA 4H2QA 1LQTA 3RHAA 4A6NA 3Q6JA 1AOGA 3LB8A 2IVDA 2OA1A 3ZYXA 1GREA 1TDKA 4X9MA 5M10A 4TM0A 2ACZA 1NHRA 1H82A 1N4VA 3B6DA 1ZY8A 2VVLA 5JCNA 4YTNA 2BXSA 1GTEA 3UKFA 1GETA 2XYOA 2BC1A 2WDVA 3BI4A 4IVOB 1GRTA 2X8HA 3PO7A 1LTXR 2BABA 2WP6A 3P4RA 3UKPA 1CHUA 1KF6A 2AQJA 2VOUA 1PHHA 4H50A 4I59A 3GMBA 2R4EA 1EL5A 2R9ZA
chains in the Genus database with same CATH superfamily
4BK1A 2XFPA 5CQFA 4LIIA 4YWOA 4Z2RA 3SGLA 1KNRA 2X99A 2YR6A 1VDCA 4K5RA 5KVHA 1TYPA 2BRAA 2GMJA 4GCMA 2WEUA 1LJ1A 2V3BA 3SM8A 4JQ9A 1JNZA 3UKKA 3LZXA 4D03A 3GMCA 3FIMB 3DK8A 1KSSA 4CNKA 2YM1A 2YR5A 2CULA 1PDHA 4M52A 2Q7VA 1PS9A 3ICRA 2WDRA 1F8WA 2WETA 3K7MX 1H7XA 1CJ3A 1TDOA 2YR4A 1H86A 3B3RA 3IWAA 4U2SA 1GXFA 3II4A 2C65A 4H2NA 5U25A 1EBDA 4X9NA 4IV9A 1NG3A 1D4CA 4AOXA 2YG6A 4U8LA 1S3BA 3QFAA 1Q9IA 4EQSA 3UKAA 1GEUA 3BNUA 3LOVA 2WP9A 3IC9A 5BVAA 4EIQA 4H2RA 1D4DA 1XANA 2VVLG 1SEZA 3AXBA 4OPGA 4AT0A 2W0HA 3GWFA 2YVFA 2YG4A 1QO8A 1OJDA 3AECA 3QFBA 1X31B 3CIRA 1BZLA 2BS2A 2YVJA 3EPTA 2AR8A 2CVJA 4J57A 2BCPA 3DJJA 1E1MA 4NNJA 4YKFA 3UOYA 2WS3A 5FS7A 4GDPA 4OPCA 3NKSA 3CNPA 3CGEA 4AP1A 1YY5A 1TDEA 1ZOVA 4BJYA 4ECHA 1F6MA 3NYCA 4C77A 4H4RA 4UDRA 3NLCA 3KD9A 2RGOA 3K7QX 1XPQA 2AAQA 3AYJA 2BS4A 4NEVA 4NEWA 1PXBA 2Z5XA 2B9WA 3FPZA 3K7TA 2A8XA 4J56A 1GERA 4JDRA 4WX1A 5KWFA 4U8KA 3VR9A 3BHFA 1PBDA 3D8XA 4CRTA 2JB3A 2X50A 2WP5A 5U63A 4A9WA 1S3EA 2C3CA 2ZBWA 1COYA 3AE1A 2VRMA 3AE8A 2VRLA 3ICSA 1OJ9A 4DSGA 3GDNA 5JCLA 4ADWA 2WPEA 4B67A 3BI2A 4J2WA 1E1LA 2OLNA 1Y56A 3HYXA 4DSHA 3O0HA 5HYMA 1H83A 4U8IA 1DJQA 4GRTA 4C5OA 3RP6A 4CY6A 1K4QA 1RYIA 3AE6A 4B65A 3ADAB 2B9YA 3QVRA 2OAMA 1B4VA 2WHDA 3VR8A 4OVIA 1Q1WA 1E39A 3FG2P 1M6IA 3GD3A 4UDPA 2Q6UA 1DOCA 1NG4A 3UP5A 1PN0A 1DNCA 1H6VA 3HYVA 3RP8A 1GSNA 2ZZBA 4H4TA 2WPCA 1L0VA 1PJ6A 2YG5A 1KFYA 3CNDA 3URHA 4CCRA 4GR1A 1BGNA 1D4EA 3SFEA 5DBJA 2Q0KA 2Y6RA 4H4SA 1PBFA 2GAHB 4OCGA 4Z26A 3G5SA 2VQ7A 1RSGA 3GD4A 2E5VA 4GAPA 2WOIA 3Q9TA 4USQA 1DJNA 2BC0A 1NDAA 3P4PA 3I6DA 1ZP0A 3COXA 5JCIA 1F8SA 3ALLA 4RG3A 2IVEA 4RSLA 3UOVA 5KRQA 2E1MA 4NZHA 3JSKA 4C3YA 1D5TA 1GESA 2JB1A 1MOKA 2XFOA 3H4KA 4N9XA 4TM1A 4U8PA 3V3OA 5BRTA 2C7GA 4ICYA 3KLJA 3T2ZA 4B64A 1S2QA 1ZX9A 2QAEA 3AEBA 2WOWA 1IUUA 2XVIA 1E1KA 3LZWA 3AEGA 4H4WA 4WCTA 3REDA 3GYJA 4DGKA 3AE9A 4XXGA 2FJEA 1Z6LA 3DMEA 2C66A 3G5RA 4B66A 4RG4A 3GRTA 4H4UA 3AD8B 1XHCA 5BUKA 3IHGA 4D04A 5HHFA 1VG9A 3ITJA 3CMMA 3LXDA 4EMIA 4EM3A 1W4XA 2EQ9A 2FJDA 4Z24A 4A79A 3F8RA 1TRBA 1ZKQA 2WU2A 1DXLA 3PS9A 2WDQA 4PAAA 3SYIA 4K2XA 4A5LA 1NHPA 2BRYA 3VRBA 2EQ8A 3LJPA 1PJ7A 4ZCDA 1LVLA 2V6OA 4B68A 4UDQA 5ER0A 1YQ3A 2C70A 5HXIA 2V5ZA 4Z43A 1Y56B 2C3DA 2NVKX 3I3LA 4P9SA 2V3AA 1JNRA 2R45A 2GB0A 1IUXA 4UP3A 3AEFA 5KNLA 4NTDA 2A89A 3LADA 4JY3A 5TR3A 1FCDA 2R4JA 5FMHA 2XLTA 1IUSA 4YTPA 1UKVG 3P4SA 3SY4A 3T2YA 1ELIA 2VVMA 4KX6A 3ATRA 1TDFA 1IUVA 4G6HA 3DJGX 3GSIA 2IIDA 4AT2A 3L8KA 4H4PA 3AE5A 1V59A 1OJAA 3KA7A 2GMHA 2YLZA 4G73A 4J34A 2BA9A 3T2KA 3OC4A 4U8JA 4JNAA 2YLTA 3AD9B 1GRAA 1B8SA 1K0JA 2X8CA 4LU6A 4Y4MA 4ZCCA 1DOEA 1MXTA 2PHHA 5U1OA 2CDUA 3AYLA 3UCLA 2WOVA 3KPKA 4G6GA 3V76A 2ZZCA 4USRA 4CBQA 2GQWA 2Y6QA 3OZ2A 2YLXA 3CNTA 3ALMA 3AE2A 1IUTA 1VRQB 3KVEA 3UP4A 3QSSA 1D7LA 3GWDA 1EL7A 1E1NA 1IJHA 3D1CA 1EL9A 4H4YA 2RGHA 1CC4A 2GR2A 5LV9A 1H7WA 4U8OA 3T14A 3UTFA 3UOZA 5L46A 1GALA 1CF3A 4EQRA 4HA6A 3NIXA 1Q1RA 2C73A 1VQWA 2CFYA 2JBVA 2B76A 5KXJA 1IUWA 3NRNA 1D7YA 4YTMA 3NTDA 1S2YA 2A87A 3AWIA 2XLRA 4J33A 1FEAA 4H4ZA 3ICTA 3SFDA 4BURA 2ARDA 2XLUA 3NN0X 1XDIA 3DGHA 2XVFA 1B5QA 3DJDA 3NK1X 5GSNA 1YQZA 3SZFA 1ONFA 4C74A 4BK2A 1NPXA 2XFNA 2R0CA 2YM2A 3DH9A 4FK1A 4OPDA 5KMPA 4JNQA 3SX6A 4OPUA 1ZDLA 1GNDA 3FMWA 3BI5A 3VRAA 2R0GA 3FBSA 1BF3A 2DKIA 4REKA 2TMDA 5CKUA 2GVCA 3NHOX 1PBEA 4DNAA 3KU9A 2I0ZA 4FX9A 1KDGA 3NYFA 4B69A 3UKQA 3DK4A 2B7SA 3M0OA 4XWZA 1GTHA 2YQUA 3QSEA 4H4QA 2RGJA 4EMWA 3CN8A 3V3NA 4TM3A 1NHSA 4B63A 2R0PA 3CGDA 3G5QA 3C4NA 2HQMA 4PABA 3SZ0A 2OLOA 3AE4A 3HZLA 1O94A 5KOWA 2BCGG 3AE3A 3UKHA 4APNA 1Y0PA 3EAOA 2GQFA 3C96A 1TYTA 1NAAA 2UZZA 1O95A 1ZMCA 3GDPA 4G74A 2BACA 4H2PA 4LA1A 4X4JA 5GRTA 3F8DA 1H84A 4U2LA 3F8PA 3PVCA 1JRXA 4JY2A 3DA1A 1L9DA 3VRDB 2XLPA 3C4AA 3P9UA 3S61A 2BXRA 4YSYA 1PXAA 2C64A 1RP0A 3DJEA 5IQ4A 2WQYA 1OJTA 2C67A 5KMQA 4A7AA 1BGJA 2R46A 2EQ7A 3P4QA 1K0IA 3ALJA 1FEBA 3IHMA 1KNPA 1FECA 3UTGA 3T0KA 1TDNA 5KVIA 4ZN0A 3RNMA 1JOAA 1NHQA 4Z2TA 3CNJA 3RP7A 3CPHG 2V60A 2XVEA 3NTAA 4II3A 2C76A 1E7PA 1KSUA 2GAGB 4Y4NA 5IPYA 2H89A 5FS8A 3AEEA 4CNJA 2VQBA 1FL2A 4Z25A 4A99A 4OPIA 1NEKA 3NK0X 2BK5A 5J60A 3NYEA 5IQ1A 2GH5A 3CGBA 4U8MA 2XFUA 4HB9A 2V61A 2GEWA 3HYWA 4BV6A 1CJCA 1ZMDA 2GR3A 5KOXA 1N1PA 4H7UA 2Q0LA 1ZOYA 4U8NA 1L9EA 2YG3A 4FK1C 4H4XA 2YLRA 4YSZA 3ISHA 2BS3A 4BK3A 1HYUA 4K5SA 2WESA 2YLSA 2QA1A 1LQUA 2WBAA 2FJBA 3AE7A 4U2TA 4IVMB 2X8GA 5C3JA 4IA6A 1DOBA 4BJZA 2GV8A 2J3NA 1PXCA 3CPJG 1GRHA 3H8LA 1N4UA 3NGCX 4NTCA 1YKJA 3BHKA 4AOSA 4XWRA 2WU5A 1O5WA 4TLXA 2Z5YA 4O5QA 4EIPA 3SZWA 3KKJA 4YKGA 2XCGA 4I58A 1P2HA 2JAEA 2YG7A 1BWCA 1VG0A 1REOA 4NWZA 3CGCA 4A65A 4K22A 1CC6A 1EL8A 1L9CA 1GPEA 3DGZA 2B9XA 3AD7B 3UOXA 1QJDA 3ABVA 3H8IA 3M13A 3ZDNA 2BK3A 4CCQA 1GRGA 4GUVA 5JCMA 2APGA 1JRZA 3QJ4A 5KMSA 3R9UA 3CTYA 4CY8A 1JRYA 2C4CA 1PBCA 2YVGA 5FS6A 1F8RA 3UKLA 1GRFA 2JKCA 3EF6A 2QA2A 1NENA 2WPFA 4EM4A 2PYXA 2YWLA 4J31A 3QVPA 4YXDA 2B7RA 2FJAA 2XLSA 4IA5A 5M0ZA 3UTHA 3T37A 3L1RA 3DK9A 4MJWA 4KPRA 4Y4LA 3CPIG 1CL0A 4A6NB 3VQRA 1CC2A 2BK4A 2XVJA 4GAVA 4Z2UA 3BNMA 4EQXA 4YSXA 3IF9A 1CJ4A 3NG7X 3AYIA 4O5UA 3WE0A 2QCUA 5HY5A 1GOSA 2E4GA 5JCKA 4B1BA 3CNSA 1QLBA 4NTEA 1GV4A 1YQ4A 5EBKA 3NT6A 2DKHA 4EMJA 4H4VA 2TPRA 4EQWA 2F5ZA 1FOHA 5C2TA 2FBWA 1JU2A 4TM4A 4E0VA 5EB5A 1ZK7A 2ZZ0A 3M12A 3NH3X 1LPFA 3GYXA 3QSMA 4K8DA 4OPTA 4YT0A 3NN6X 4II2A 3SZCA 4TLZA 2YAUA 1N4WA 3NNEA 3EANA 3NK2X 2BYBA 3SXIA 1CBOA 3SQPA 3S5WA 2XVHA 2EQ6A 2C72A 3AB1A 3ATQA 3GRSA 5BULA 1F3PA 1PBBA 1B37A 2NPXA 2O9ZA 3AEAA 3E1TA 3AEDA 3KPFA 1GRBA 5J7XA 3UTEA 4YSHA 2X3NA 1LV0A 1CJ2A 4AP3A 1M64A 1PJ5A 3GYIA 1E6EA 4OPLA 2VZ2A 2RABA 4G9KA 4FDCB 4JN9A 5EB4A 5FS9A 4C3XA 4K7ZA 1K0LA 1MO9A 1P2EA 2GRTA 1OJCA 2YLWA 1JEHA 2XFQA 4Z44A 2OALA 5EOWA 1H81A 1DODA 2C75A 2GR0A 2JK6A 4GF7A 2H88A 1BKWA 1GT8A 4J36A 3P1WA 3T31A 2XDOA 2GF3A 2GR1A 3K30A 2JB2A 4GDEA 4H2QA 1LQTA 3RHAA 5KMRA 4A6NA 3Q6JA 1AOGA 3LB8A 2IVDA 2OA1A 3ZYXA 1GREA 1TDKA 4X9MA 5M10A 4TM0A 2ACZA 1NHRA 1H82A 1N4VA 3B6DA 1ZY8A 2VVLA 5JCNA 4YTNA 2BXSA 1GTEA 3UKFA 1GETA 2XYOA 2BC1A 2WDVA 3BI4A 4IVOB 1GRTA 2X8HA 3PO7A 1LTXR 2BABA 2WP6A 3P4RA 3UKPA 1CHUA 1KF6A 2AQJA 2VOUA 1PHHA 4H50A 4I59A 3GMBA 2R4EA 1EL5A 2R9ZA
chains in the Genus database with same CATH topology
4BK1A 2XFPA 5CQFA 4LIIA 4YWOA 4Z2RA 3SGLA 1KNRA 2X99A 2YR6A 1VDCA 4K5RA 5KVHA 1TYPA 2BRAA 2GMJA 4GCMA 2WEUA 1LJ1A 2V3BA 3SM8A 4JQ9A 1JNZA 3UKKA 3LZXA 4D03A 3GMCA 3FIMB 3DK8A 1KSSA 4CNKA 2YM1A 2YR5A 2CULA 1PDHA 4M52A 2Q7VA 1PS9A 3ICRA 2WDRA 1F8WA 2WETA 3K7MX 1H7XA 1CJ3A 1TDOA 2YR4A 1H86A 3B3RA 3IWAA 4U2SA 1GXFA 3II4A 2C65A 4H2NA 5U25A 1EBDA 4X9NA 4IV9A 1NG3A 1D4CA 4AOXA 2YG6A 4U8LA 1S3BA 3QFAA 1Q9IA 4EQSA 3UKAA 1GEUA 3BNUA 3LOVA 2WP9A 3IC9A 5BVAA 4EIQA 4H2RA 1D4DA 1XANA 2VVLG 1SEZA 3AXBA 4OPGA 4AT0A 2W0HA 3GWFA 2YVFA 2YG4A 1QO8A 1OJDA 3AECA 3QFBA 1X31B 3CIRA 1BZLA 2BS2A 2YVJA 3EPTA 2AR8A 2CVJA 4J57A 2BCPA 3DJJA 1E1MA 4NNJA 4YKFA 3UOYA 2WS3A 5FS7A 4GDPA 4OPCA 3NKSA 3CNPA 3CGEA 4AP1A 1YY5A 1TDEA 1ZOVA 4BJYA 4ECHA 1F6MA 3NYCA 4C77A 4H4RA 4UDRA 3NLCA 3KD9A 2RGOA 3K7QX 1XPQA 2AAQA 3AYJA 2BS4A 4NEVA 4NEWA 1PXBA 2Z5XA 2B9WA 3FPZA 3K7TA 2A8XA 4J56A 1GERA 4JDRA 4WX1A 5KWFA 4U8KA 3VR9A 3BHFA 1PBDA 3D8XA 4CRTA 2JB3A 2X50A 2WP5A 5U63A 4A9WA 1S3EA 2C3CA 2ZBWA 1COYA 3AE1A 2VRMA 3AE8A 2VRLA 3ICSA 1OJ9A 4DSGA 3GDNA 5JCLA 4ADWA 2WPEA 4B67A 3BI2A 4J2WA 1E1LA 2OLNA 1Y56A 3HYXA 4DSHA 3O0HA 5HYMA 1H83A 4U8IA 1DJQA 4GRTA 4C5OA 3RP6A 4CY6A 1K4QA 1RYIA 3AE6A 4B65A 3ADAB 2B9YA 3QVRA 2OAMA 1B4VA 2WHDA 3VR8A 4OVIA 1Q1WA 1E39A 3FG2P 1M6IA 3GD3A 4UDPA 2Q6UA 1DOCA 1NG4A 3UP5A 1PN0A 1DNCA 1H6VA 3HYVA 3RP8A 1GSNA 2ZZBA 4H4TA 2WPCA 1L0VA 1PJ6A 2YG5A 1KFYA 3CNDA 3URHA 4CCRA 4GR1A 1BGNA 1D4EA 3SFEA 5DBJA 2Q0KA 2Y6RA 4H4SA 1PBFA 2GAHB 4OCGA 4Z26A 3G5SA 2VQ7A 1RSGA 3GD4A 2E5VA 4GAPA 2WOIA 3Q9TA 4USQA 1DJNA 2BC0A 1NDAA 3P4PA 3I6DA 1ZP0A 3COXA 5JCIA 1F8SA 3ALLA 4RG3A 2IVEA 4RSLA 3UOVA 5KRQA 2E1MA 4NZHA 3JSKA 4C3YA 1D5TA 1GESA 2JB1A 1MOKA 2XFOA 3H4KA 4N9XA 4TM1A 4U8PA 3V3OA 5BRTA 2C7GA 4ICYA 3KLJA 3T2ZA 4B64A 1S2QA 1ZX9A 2QAEA 3AEBA 2WOWA 1IUUA 2XVIA 1E1KA 3LZWA 3AEGA 4H4WA 4WCTA 3REDA 3GYJA 4DGKA 3AE9A 4XXGA 2FJEA 1Z6LA 3DMEA 2C66A 3G5RA 4B66A 4RG4A 3GRTA 4H4UA 3AD8B 1XHCA 5BUKA 3IHGA 4D04A 5HHFA 1VG9A 3ITJA 3CMMA 3LXDA 4EMIA 4EM3A 1W4XA 2EQ9A 2FJDA 4Z24A 4A79A 3F8RA 1TRBA 1ZKQA 2WU2A 1DXLA 3PS9A 2WDQA 4PAAA 3SYIA 4K2XA 4A5LA 1NHPA 2BRYA 3VRBA 2EQ8A 3LJPA 1PJ7A 4ZCDA 1LVLA 2V6OA 4B68A 4UDQA 5ER0A 1YQ3A 2C70A 5HXIA 2V5ZA 4Z43A 1Y56B 2C3DA 2NVKX 3I3LA 4P9SA 2V3AA 1JNRA 2R45A 2GB0A 1IUXA 4UP3A 3AEFA 5KNLA 4NTDA 2A89A 3LADA 4JY3A 5TR3A 1FCDA 2R4JA 5FMHA 2XLTA 1IUSA 4YTPA 1UKVG 3P4SA 3SY4A 3T2YA 1ELIA 2VVMA 4KX6A 3ATRA 1TDFA 1IUVA 4G6HA 3DJGX 3GSIA 2IIDA 4AT2A 3L8KA 4H4PA 3AE5A 1V59A 1OJAA 3KA7A 2GMHA 2YLZA 4G73A 4J34A 2BA9A 3T2KA 3OC4A 4U8JA 4JNAA 2YLTA 3AD9B 1GRAA 1B8SA 1K0JA 2X8CA 4LU6A 4Y4MA 4ZCCA 1DOEA 1MXTA 2PHHA 5U1OA 2CDUA 3AYLA 3UCLA 2WOVA 3KPKA 4G6GA 3V76A 2ZZCA 4USRA 4CBQA 2GQWA 2Y6QA 3OZ2A 2YLXA 3CNTA 3ALMA 3AE2A 1IUTA 1VRQB 3KVEA 3UP4A 3QSSA 1D7LA 3GWDA 1EL7A 1E1NA 1IJHA 3D1CA 1EL9A 4H4YA 2RGHA 1CC4A 2GR2A 5LV9A 1H7WA 4U8OA 3T14A 3UTFA 3UOZA 5L46A 1GALA 1CF3A 4EQRA 4HA6A 3NIXA 1Q1RA 2C73A 1VQWA 2CFYA 2JBVA 2B76A 5KXJA 1IUWA 3NRNA 1D7YA 4YTMA 3NTDA 1S2YA 2A87A 3AWIA 2XLRA 4J33A 1FEAA 4H4ZA 3ICTA 3SFDA 4BURA 2ARDA 2XLUA 3NN0X 1XDIA 3DGHA 2XVFA 1B5QA 3DJDA 3NK1X 5GSNA 1YQZA 3SZFA 1ONFA 4C74A 4BK2A 1NPXA 2XFNA 2R0CA 2YM2A 3DH9A 4FK1A 4OPDA 5KMPA 4JNQA 3SX6A 4OPUA 1ZDLA 1GNDA 3FMWA 3BI5A 3VRAA 2R0GA 3FBSA 1BF3A 2DKIA 4REKA 2TMDA 5CKUA 2GVCA 3NHOX 1PBEA 4DNAA 3KU9A 2I0ZA 4FX9A 1KDGA 3NYFA 4B69A 3UKQA 3DK4A 2B7SA 3M0OA 4XWZA 1GTHA 2YQUA 3QSEA 4H4QA 2RGJA 4EMWA 3CN8A 3V3NA 4TM3A 1NHSA 4B63A 2R0PA 3CGDA 3G5QA 3C4NA 2HQMA 4PABA 3SZ0A 2OLOA 3AE4A 3HZLA 1O94A 5KOWA 2BCGG 3AE3A 3UKHA 4APNA 1Y0PA 3EAOA 2GQFA 3C96A 1TYTA 1NAAA 2UZZA 1O95A 1ZMCA 3GDPA 4G74A 2BACA 4H2PA 4LA1A 4X4JA 5GRTA 3F8DA 1H84A 4U2LA 3F8PA 3PVCA 1JRXA 4JY2A 3DA1A 1L9DA 3VRDB 2XLPA 3C4AA 3P9UA 3S61A 2BXRA 4YSYA 1PXAA 2C64A 1RP0A 3DJEA 5IQ4A 2WQYA 1OJTA 2C67A 5KMQA 4A7AA 1BGJA 2R46A 2EQ7A 3P4QA 1K0IA 3ALJA 1FEBA 3IHMA 1KNPA 1FECA 3UTGA 3T0KA 1TDNA 5KVIA 4ZN0A 3RNMA 1JOAA 1NHQA 4Z2TA 3CNJA 3RP7A 3CPHG 2V60A 2XVEA 3NTAA 4II3A 2C76A 1E7PA 1KSUA 2GAGB 4Y4NA 5IPYA 2H89A 5FS8A 3AEEA 4CNJA 2VQBA 1FL2A 4Z25A 4A99A 4OPIA 1NEKA 3NK0X 2BK5A 5J60A 3NYEA 5IQ1A 2GH5A 3CGBA 4U8MA 2XFUA 4HB9A 2V61A 2GEWA 3HYWA 4BV6A 1CJCA 1ZMDA 2GR3A 5KOXA 1N1PA 4H7UA 2Q0LA 1ZOYA 4U8NA 1L9EA 2YG3A 4FK1C 4H4XA 2YLRA 4YSZA 3ISHA 2BS3A 4BK3A 1HYUA 4K5SA 2WESA 2YLSA 2QA1A 1LQUA 2WBAA 2FJBA 3AE7A 4U2TA 4IVMB 2X8GA 5C3JA 4IA6A 1DOBA 4BJZA 2GV8A 2J3NA 1PXCA 3CPJG 1GRHA 3H8LA 1N4UA 3NGCX 4NTCA 1YKJA 3BHKA 4AOSA 4XWRA 2WU5A 1O5WA 4TLXA 2Z5YA 4O5QA 4EIPA 3SZWA 3KKJA 4YKGA 2XCGA 4I58A 1P2HA 2JAEA 2YG7A 1BWCA 1VG0A 1REOA 4NWZA 3CGCA 4A65A 4K22A 1CC6A 1EL8A 1L9CA 1GPEA 3DGZA 2B9XA 3AD7B 3UOXA 1QJDA 3ABVA 3H8IA 3M13A 3ZDNA 2BK3A 4CCQA 1GRGA 4GUVA 5JCMA 2APGA 1JRZA 3QJ4A 5KMSA 3R9UA 3CTYA 4CY8A 1JRYA 2C4CA 1PBCA 2YVGA 5FS6A 1F8RA 3UKLA 1GRFA 2JKCA 3EF6A 2QA2A 1NENA 2WPFA 4EM4A 2PYXA 2YWLA 4J31A 3QVPA 4YXDA 2B7RA 2FJAA 2XLSA 4IA5A 5M0ZA 3UTHA 3T37A 3L1RA 3DK9A 4MJWA 4KPRA 4Y4LA 3CPIG 1CL0A 4A6NB 3VQRA 1CC2A 2BK4A 2XVJA 4GAVA 4Z2UA 3BNMA 4EQXA 4YSXA 3IF9A 1CJ4A 3NG7X 3AYIA 4O5UA 3WE0A 2QCUA 5HY5A 1GOSA 2E4GA 5JCKA 4B1BA 3CNSA 1QLBA 4NTEA 1GV4A 1YQ4A 5EBKA 3NT6A 2DKHA 4EMJA 4H4VA 2TPRA 4EQWA 2F5ZA 1FOHA 5C2TA 2FBWA 1JU2A 4TM4A 4E0VA 5EB5A 1ZK7A 2ZZ0A 3M12A 3NH3X 1LPFA 3GYXA 3QSMA 4K8DA 4OPTA 4YT0A 3NN6X 4II2A 3SZCA 4TLZA 2YAUA 1N4WA 3NNEA 3EANA 3NK2X 2BYBA 3SXIA 1CBOA 3SQPA 3S5WA 2XVHA 2EQ6A 2C72A 3AB1A 3ATQA 3GRSA 5BULA 1F3PA 1PBBA 1B37A 2NPXA 2O9ZA 3AEAA 3E1TA 3AEDA 3KPFA 1GRBA 5J7XA 3UTEA 4YSHA 2X3NA 1LV0A 1CJ2A 4AP3A 1M64A 1PJ5A 3GYIA 1E6EA 4OPLA 2VZ2A 2RABA 4G9KA 4FDCB 4JN9A 5EB4A 5FS9A 4C3XA 4K7ZA 1K0LA 1MO9A 1P2EA 2GRTA 1OJCA 2YLWA 1JEHA 2XFQA 4Z44A 2OALA 5EOWA 1H81A 1DODA 2C75A 2GR0A 2JK6A 4GF7A 2H88A 1BKWA 1GT8A 4J36A 3P1WA 3T31A 2XDOA 2GF3A 2GR1A 3K30A 2JB2A 4GDEA 4H2QA 1LQTA 3RHAA 5KMRA 4A6NA 3Q6JA 1AOGA 3LB8A 2IVDA 2OA1A 3ZYXA 1GREA 1TDKA 4X9MA 5M10A 4TM0A 2ACZA 1NHRA 1H82A 1N4VA 3B6DA 1ZY8A 2VVLA 5JCNA 4YTNA 2BXSA 1GTEA 3UKFA 1GETA 2XYOA 2BC1A 2WDVA 3BI4A 4IVOB 1GRTA 2X8HA 3PO7A 1LTXR 2BABA 2WP6A 3P4RA 3UKPA 1CHUA 1KF6A 2AQJA 2VOUA 1PHHA 4H50A 4I59A 3GMBA 2R4EA 1EL5A 2R9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BK1 A;  2XFP A;  5CQF A;  4LII A;  4YWO A;  4Z2R A;  3SGL A;  1KNR A;  2X99 A;  2YR6 A;  1VDC A;  4K5R A;  5KVH A;  1TYP A;  2GMJ A;  4GCM A;  2WEU A;  1LJ1 A;  2V3B A;  3SM8 A;  4JQ9 A;  1JNZ A;  3UKK A;  3LZX A;  4D03 A;  3GMC A;  3FIM B;  3DK8 A;  1KSS A;  4CNK A;  2YM1 A;  2YR5 A;  2CUL A;  1PDH A;  4M52 A;  2Q7V A;  1PS9 A;  3ICR A;  2WDR A;  1F8W A;  2WET A;  3K7M X;  1H7X A;  1CJ3 A;  1TDO A;  2YR4 A;  1H86 A;  3B3R A;  3IWA A;  4U2S A;  1GXF A;  3II4 A;  2C65 A;  4H2N A;  5U25 A;  1EBD A;  4X9N A;  4IV9 A;  1NG3 A;  1D4C A;  4AOX A;  2YG6 A;  4U8L A;  1S3B A;  3QFA A;  1Q9I A;  4EQS A;  3UKA A;  1GEU A;  3BNU A;  3LOV A;  2WP9 A;  3IC9 A;  5BVA A;  4EIQ A;  4H2R A;  1D4D A;  1XAN A;  2VVL G;  1SEZ A;  3AXB A;  4OPG A;  4AT0 A;  2W0H A;  3GWF A;  2YVF A;  2YG4 A;  1QO8 A;  1OJD A;  3AEC A;  3QFB A;  1X31 B;  3CIR A;  1BZL A;  2BS2 A;  2YVJ A;  3EPT A;  2AR8 A;  2CVJ A;  4J57 A;  2BCP A;  3DJJ A;  1E1M A;  4YKF A;  3UOY A;  2WS3 A;  5FS7 A;  4GDP A;  4OPC A;  3NKS A;  3CNP A;  3CGE A;  4AP1 A;  1YY5 A;  1TDE A;  1ZOV A;  4BJY A;  4ECH A;  1F6M A;  3NYC A;  4C77 A;  4H4R A;  4UDR A;  3NLC A;  3KD9 A;  2RGO A;  3K7Q X;  1XPQ A;  2AAQ A;  3AYJ A;  2BS4 A;  4NEV A;  4NEW A;  1PXB A;  2Z5X A;  2B9W A;  3FPZ A;  3K7T A;  2A8X A;  4J56 A;  1GER A;  4JDR A;  4WX1 A;  5KWF A;  4U8K A;  3VR9 A;  3BHF A;  1PBD A;  3D8X A;  4CRT A;  2JB3 A;  2X50 A;  2WP5 A;  5U63 A;  4A9W A;  1S3E A;  2C3C A;  2ZBW A;  1COY A;  3AE1 A;  2VRM A;  3AE8 A;  2VRL A;  3ICS A;  1OJ9 A;  4DSG A;  3GDN A;  5JCL A;  4ADW A;  2WPE A;  4B67 A;  3BI2 A;  4J2W A;  1E1L A;  2OLN A;  1Y56 A;  4DSH A;  3O0H A;  5HYM A;  1H83 A;  4U8I A;  1DJQ A;  4GRT A;  4C5O A;  3RP6 A;  4CY6 A;  1K4Q A;  1RYI A;  3AE6 A;  4B65 A;  3ADA B;  2B9Y A;  3QVR A;  2OAM A;  1B4V A;  2WHD A;  3VR8 A;  4OVI A;  1Q1W A;  1E39 A;  3FG2 P;  1M6I A;  3GD3 A;  4UDP A;  2Q6U A;  1DOC A;  1NG4 A;  3UP5 A;  1PN0 A;  1DNC A;  1H6V A;  3RP8 A;  1GSN A;  2ZZB A;  4H4T A;  2WPC A;  1L0V A;  1PJ6 A;  2YG5 A;  1KFY A;  3CND A;  3URH A;  4CCR A;  4GR1 A;  1BGN A;  1D4E A;  3SFE A;  5DBJ A;  2Q0K A;  2Y6R A;  4H4S A;  1PBF A;  2GAH B;  4OCG A;  4Z26 A;  3G5S A;  2VQ7 A;  1RSG A;  3GD4 A;  2E5V A;  2WOI A;  3Q9T A;  4USQ A;  1DJN A;  2BC0 A;  1NDA A;  3P4P A;  3I6D A;  1ZP0 A;  3COX A;  5JCI A;  1F8S A;  3ALL A;  4RG3 A;  2IVE A;  4RSL A;  3UOV A;  5KRQ A;  2E1M A;  4NZH A;  3JSK A;  4C3Y A;  1D5T A;  1GES A;  2JB1 A;  1MOK A;  2XFO A;  3H4K A;  4N9X A;  4TM1 A;  4U8P A;  3V3O A;  5BRT A;  2C7G A;  4ICY A;  3KLJ A;  4B64 A;  1S2Q A;  1ZX9 A;  2QAE A;  3AEB A;  2WOW A;  1IUU A;  2XVI A;  1E1K A;  3LZW A;  3AEG A;  4H4W A;  4WCT A;  3RED A;  3GYJ A;  4DGK A;  3AE9 A;  4XXG A;  2FJE A;  1Z6L A;  3DME A;  2C66 A;  3G5R A;  4B66 A;  4RG4 A;  3GRT A;  4H4U A;  3AD8 B;  1XHC A;  5BUK A;  3IHG A;  4D04 A;  5HHF A;  1VG9 A;  3ITJ A;  3LXD A;  4EMI A;  4EM3 A;  1W4X A;  2EQ9 A;  2FJD A;  4Z24 A;  4A79 A;  3F8R A;  1TRB A;  1ZKQ A;  2WU2 A;  1DXL A;  3PS9 A;  2WDQ A;  4PAA A;  4K2X A;  4A5L A;  1NHP A;  3VRB A;  2EQ8 A;  3LJP A;  1PJ7 A;  4ZCD A;  1LVL A;  2V6O A;  4B68 A;  4UDQ A;  5ER0 A;  1YQ3 A;  2C70 A;  5HXI A;  2V5Z A;  4Z43 A;  1Y56 B;  2C3D A;  2NVK X;  3I3L A;  4P9S A;  2V3A A;  1JNR A;  2R45 A;  2GB0 A;  1IUX A;  4UP3 A;  3AEF A;  4NTD A;  2A89 A;  3LAD A;  4JY3 A;  5TR3 A;  1FCD A;  2R4J A;  5FMH A;  2XLT A;  1IUS A;  4YTP A;  1UKV G;  3P4S A;  1ELI A;  2VVM A;  4KX6 A;  3ATR A;  1TDF A;  1IUV A;  3DJG X;  3GSI A;  2IID A;  4AT2 A;  3L8K A;  4H4P A;  3AE5 A;  1V59 A;  1OJA A;  3KA7 A;  2GMH A;  2YLZ A;  4J34 A;  2BA9 A;  3OC4 A;  4U8J A;  4JNA A;  2YLT A;  3AD9 B;  1GRA A;  1B8S A;  1K0J A;  2X8C A;  4LU6 A;  4Y4M A;  4ZCC A;  1DOE A;  1MXT A;  2PHH A;  5U1O A;  2CDU A;  3AYL A;  3UCL A;  2WOV A;  3V76 A;  2ZZC A;  4USR A;  4CBQ A;  2GQW A;  2Y6Q A;  3OZ2 A;  2YLX A;  3CNT A;  3ALM A;  3AE2 A;  1IUT A;  1VRQ B;  3KVE A;  3UP4 A;  3QSS A;  1D7L A;  3GWD A;  1EL7 A;  1E1N A;  1IJH A;  3D1C A;  1EL9 A;  4H4Y A;  2RGH A;  1CC4 A;  2GR2 A;  5LV9 A;  1H7W A;  4U8O A;  3UTF A;  3UOZ A;  5L46 A;  1GAL A;  1CF3 A;  4EQR A;  4HA6 A;  3NIX A;  1Q1R A;  2C73 A;  1VQW A;  2CFY A;  2JBV A;  2B76 A;  5KXJ A;  1IUW A;  3NRN A;  1D7Y A;  4YTM A;  3NTD A;  1S2Y A;  2A87 A;  3AWI A;  2XLR A;  4J33 A;  1FEA A;  4H4Z A;  3ICT A;  3SFD A;  4BUR A;  2ARD A;  2XLU A;  3NN0 X;  1XDI A;  3DGH A;  2XVF A;  1B5Q A;  3DJD A;  3NK1 X;  5GSN A;  1YQZ A;  1ONF A;  4C74 A;  4BK2 A;  1NPX A;  2XFN A;  2R0C A;  2YM2 A;  3DH9 A;  4FK1 A;  4OPD A;  4JNQ A;  4OPU A;  1ZDL A;  1GND A;  3FMW A;  3BI5 A;  3VRA A;  2R0G A;  3FBS A;  1BF3 A;  2DKI A;  4REK A;  2TMD A;  5CKU A;  2GVC A;  3NHO X;  1PBE A;  4DNA A;  3KU9 A;  2I0Z A;  4FX9 A;  1KDG A;  3NYF A;  4B69 A;  3UKQ A;  3DK4 A;  2B7S A;  3M0O A;  4XWZ A;  1GTH A;  2YQU A;  3QSE A;  4H4Q A;  2RGJ A;  4EMW A;  3CN8 A;  3V3N A;  4TM3 A;  1NHS A;  4B63 A;  2R0P A;  3CGD A;  3G5Q A;  3C4N A;  2HQM A;  4PAB A;  2OLO A;  3AE4 A;  3HZL A;  1O94 A;  5KOW A;  2BCG G;  3AE3 A;  3UKH A;  4APN A;  1Y0P A;  3EAO A;  2GQF A;  3C96 A;  1TYT A;  1NAA A;  2UZZ A;  1O95 A;  1ZMC A;  3GDP A;  4J36 A;  2BAC A;  4H2P A;  4LA1 A;  4X4J A;  5GRT A;  3F8D A;  1H84 A;  4U2L A;  3F8P A;  3PVC A;  1JRX A;  4JY2 A;  3DA1 A;  1L9D A;  3VRD B;  2XLP A;  3C4A A;  3P9U A;  3S61 A;  2BXR A;  4YSY A;  1PXA A;  2C64 A;  1RP0 A;  3DJE A;  5IQ4 A;  2WQY A;  1OJT A;  2C67 A;  4A7A A;  1BGJ A;  2R46 A;  2EQ7 A;  3P4Q A;  1K0I A;  3ALJ A;  1FEB A;  3IHM A;  1KNP A;  1FEC A;  3UTG A;  1TDN A;  5KVI A;  4ZN0 A;  3RNM A;  1JOA A;  1NHQ A;  4Z2T A;  3CNJ A;  3RP7 A;  3CPH G;  2V60 A;  2XVE A;  3NTA A;  2C76 A;  1E7P A;  1KSU A;  2GAG B;  4Y4N A;  5IPY A;  2H89 A;  5FS8 A;  3AEE A;  4CNJ A;  2VQB A;  1FL2 A;  4Z25 A;  4A99 A;  4OPI A;  1NEK A;  3NK0 X;  2BK5 A;  5J60 A;  3NYE A;  5IQ1 A;  2GH5 A;  3CGB A;  4U8M A;  2XFU A;  4HB9 A;  2V61 A;  2GEW A;  4BV6 A;  1CJC A;  1ZMD A;  2GR3 A;  5KOX A;  1N1P A;  4H7U A;  2Q0L A;  1ZOY A;  4U8N A;  1L9E A;  2YG3 A;  4FK1 C;  4H4X A;  2YLR A;  4YSZ A;  3ISH A;  2BS3 A;  4BK3 A;  1HYU A;  4K5S A;  2WES A;  2YLS A;  2QA1 A;  1LQU A;  2WBA A;  2FJB A;  3AE7 A;  4U2T A;  4IVM B;  2X8G A;  5C3J A;  4IA6 A;  1DOB A;  4BJZ A;  2GV8 A;  2J3N A;  1PXC A;  3CPJ G;  1GRH A;  3H8L A;  1N4U A;  3NGC X;  4NTC A;  1YKJ A;  3BHK A;  4AOS A;  4XWR A;  2WU5 A;  1O5W A;  4TLX A;  2Z5Y A;  4O5Q A;  4EIP A;  3KKJ A;  4YKG A;  2XCG A;  4I58 A;  1P2H A;  2JAE A;  2YG7 A;  1BWC A;  1VG0 A;  1REO A;  3CGC A;  4A65 A;  4K22 A;  1CC6 A;  1EL8 A;  1L9C A;  1GPE A;  3DGZ A;  2B9X A;  3AD7 B;  3UOX A;  1QJD A;  3ABV A;  3H8I A;  3M13 A;  3ZDN A;  2BK3 A;  4CCQ A;  1GRG A;  4GUV A;  5JCM A;  2APG A;  1JRZ A;  3QJ4 A;  3R9U A;  3CTY A;  4CY8 A;  1JRY A;  1PBC A;  2YVG A;  5FS6 A;  1F8R A;  3UKL A;  1GRF A;  2JKC A;  3EF6 A;  2QA2 A;  1NEN A;  2WPF A;  4EM4 A;  2PYX A;  2YWL A;  4J31 A;  3QVP A;  4YXD A;  2B7R A;  2FJA A;  2XLS A;  4IA5 A;  5M0Z A;  3UTH A;  3T37 A;  3L1R A;  3DK9 A;  4MJW A;  4KPR A;  4Y4L A;  3CPI G;  1CL0 A;  4A6N B;  3VQR A;  1CC2 A;  2BK4 A;  2XVJ A;  4Z2U A;  3BNM A;  4EQX A;  4YSX A;  3IF9 A;  1CJ4 A;  3NG7 X;  3AYI A;  4O5U A;  3WE0 A;  2QCU A;  5HY5 A;  1GOS A;  2E4G A;  5JCK A;  4B1B A;  3CNS A;  1QLB A;  4NTE A;  1GV4 A;  1YQ4 A;  5EBK A;  3NT6 A;  2DKH A;  4EMJ A;  4H4V A;  2TPR A;  4EQW A;  2F5Z A;  1FOH A;  5C2T A;  2FBW A;  1JU2 A;  4TM4 A;  4E0V A;  5EB5 A;  1ZK7 A;  2ZZ0 A;  3M12 A;  3NH3 X;  1LPF A;  3QSM A;  4K8D A;  4YT0 A;  4OPT A;  3NN6 X;  4TLZ A;  2YAU A;  1N4W A;  3NNE A;  3EAN A;  3NK2 X;  2BYB A;  1CBO A;  3SQP A;  3S5W A;  2XVH A;  2EQ6 A;  2C72 A;  3AB1 A;  3ATQ A;  3GRS A;  5BUL A;  1F3P A;  1PBB A;  1B37 A;  2NPX A;  2O9Z A;  3AEA A;  3E1T A;  3AED A;  3KPF A;  1GRB A;  5J7X A;  3UTE A;  4YSH A;  2X3N A;  1LV0 A;  1CJ2 A;  4AP3 A;  1M64 A;  1PJ5 A;  3GYI A;  1E6E A;  4OPL A;  2VZ2 A;  2RAB A;  4FDC B;  4JN9 A;  5EB4 A;  5FS9 A;  4C3X A;  4K7Z A;  1K0L A;  1MO9 A;  1P2E A;  2GRT A;  1OJC A;  2YLW A;  1JEH A;  2XFQ A;  4Z44 A;  2OAL A;  5EOW A;  1H81 A;  1DOD A;  2C75 A;  2GR0 A;  2JK6 A;  4GF7 A;  2H88 A;  1BKW A;  1GT8 A;  3P1W A;  2XDO A;  2GF3 A;  2GR1 A;  3K30 A;  2JB2 A;  4GDE A;  4H2Q A;  1LQT A;  3RHA A;  4A6N A;  3Q6J A;  1AOG A;  3LB8 A;  2IVD A;  2OA1 A;  3ZYX A;  1GRE A;  1TDK A;  4X9M A;  5M10 A;  4TM0 A;  2ACZ A;  1NHR A;  1H82 A;  1N4V A;  3B6D A;  1ZY8 A;  2VVL A;  5JCN A;  4YTN A;  2BXS A;  1GTE A;  3UKF A;  1GET A;  2XYO A;  2BC1 A;  2WDV A;  3BI4 A;  4IVO B;  1GRT A;  2X8H A;  3PO7 A;  1LTX R;  2BAB A;  2WP6 A;  3P4R A;  3UKP A;  1CHU A;  1KF6 A;  2AQJ A;  2VOU A;  1PHH A;  4H50 A;  4I59 A;  3GMB A;  2R4E A;  1EL5 A;  2R9Z A; 
#chains in the Genus database with same CATH topology
 4BK1 A;  2XFP A;  5CQF A;  4LII A;  4YWO A;  4Z2R A;  3SGL A;  1KNR A;  2X99 A;  2YR6 A;  1VDC A;  4K5R A;  5KVH A;  1TYP A;  2BRA A;  2GMJ A;  4GCM A;  2WEU A;  1LJ1 A;  2V3B A;  3SM8 A;  4JQ9 A;  1JNZ A;  3UKK A;  3LZX A;  4D03 A;  3GMC A;  3FIM B;  3DK8 A;  1KSS A;  4CNK A;  2YM1 A;  2YR5 A;  2CUL A;  1PDH A;  4M52 A;  2Q7V A;  1PS9 A;  3ICR A;  2WDR A;  1F8W A;  2WET A;  3K7M X;  1H7X A;  1CJ3 A;  1TDO A;  2YR4 A;  1H86 A;  3B3R A;  3IWA A;  4U2S A;  1GXF A;  3II4 A;  2C65 A;  4H2N A;  5U25 A;  1EBD A;  4X9N A;  4IV9 A;  1NG3 A;  1D4C A;  4AOX A;  2YG6 A;  4U8L A;  1S3B A;  3QFA A;  1Q9I A;  4EQS A;  3UKA A;  1GEU A;  3BNU A;  3LOV A;  2WP9 A;  3IC9 A;  5BVA A;  4EIQ A;  4H2R A;  1D4D A;  1XAN A;  2VVL G;  1SEZ A;  3AXB A;  4OPG A;  4AT0 A;  2W0H A;  3GWF A;  2YVF A;  2YG4 A;  1QO8 A;  1OJD A;  3AEC A;  3QFB A;  1X31 B;  3CIR A;  1BZL A;  2BS2 A;  2YVJ A;  3EPT A;  2AR8 A;  2CVJ A;  4J57 A;  2BCP A;  3DJJ A;  1E1M A;  4NNJ A;  4YKF A;  3UOY A;  2WS3 A;  5FS7 A;  4GDP A;  4OPC A;  3NKS A;  3CNP A;  3CGE A;  4AP1 A;  1YY5 A;  1TDE A;  1ZOV A;  4BJY A;  4ECH A;  1F6M A;  3NYC A;  4C77 A;  4H4R A;  4UDR A;  3NLC A;  3KD9 A;  2RGO A;  3K7Q X;  1XPQ A;  2AAQ A;  3AYJ A;  2BS4 A;  4NEV A;  4NEW A;  1PXB A;  2Z5X A;  2B9W A;  3FPZ A;  3K7T A;  2A8X A;  4J56 A;  1GER A;  4JDR A;  4WX1 A;  5KWF A;  4U8K A;  3VR9 A;  3BHF A;  1PBD A;  3D8X A;  4CRT A;  2JB3 A;  2X50 A;  2WP5 A;  5U63 A;  4A9W A;  1S3E A;  2C3C A;  2ZBW A;  1COY A;  3AE1 A;  2VRM A;  3AE8 A;  2VRL A;  3ICS A;  1OJ9 A;  4DSG A;  3GDN A;  5JCL A;  4ADW A;  2WPE A;  4B67 A;  3BI2 A;  4J2W A;  1E1L A;  2OLN A;  1Y56 A;  3HYX A;  4DSH A;  3O0H A;  5HYM A;  1H83 A;  4U8I A;  1DJQ A;  4GRT A;  4C5O A;  3RP6 A;  4CY6 A;  1K4Q A;  1RYI A;  3AE6 A;  4B65 A;  3ADA B;  2B9Y A;  3QVR A;  2OAM A;  1B4V A;  2WHD A;  3VR8 A;  4OVI A;  1Q1W A;  1E39 A;  3FG2 P;  1M6I A;  3GD3 A;  4UDP A;  2Q6U A;  1DOC A;  1NG4 A;  3UP5 A;  1PN0 A;  1DNC A;  1H6V A;  3HYV A;  3RP8 A;  1GSN A;  2ZZB A;  4H4T A;  2WPC A;  1L0V A;  1PJ6 A;  2YG5 A;  1KFY A;  3CND A;  3URH A;  4CCR A;  4GR1 A;  1BGN A;  1D4E A;  3SFE A;  5DBJ A;  2Q0K A;  2Y6R A;  4H4S A;  1PBF A;  2GAH B;  4OCG A;  4Z26 A;  3G5S A;  2VQ7 A;  1RSG A;  3GD4 A;  2E5V A;  4GAP A;  2WOI A;  3Q9T A;  4USQ A;  1DJN A;  2BC0 A;  1NDA A;  3P4P A;  3I6D A;  1ZP0 A;  3COX A;  5JCI A;  1F8S A;  3ALL A;  4RG3 A;  2IVE A;  4RSL A;  3UOV A;  5KRQ A;  2E1M A;  4NZH A;  3JSK A;  4C3Y A;  1D5T A;  1GES A;  2JB1 A;  1MOK A;  2XFO A;  3H4K A;  4N9X A;  4TM1 A;  4U8P A;  3V3O A;  5BRT A;  2C7G A;  4ICY A;  3KLJ A;  3T2Z A;  4B64 A;  1S2Q A;  1ZX9 A;  2QAE A;  3AEB A;  2WOW A;  1IUU A;  2XVI A;  1E1K A;  3LZW A;  3AEG A;  4H4W A;  4WCT A;  3RED A;  3GYJ A;  4DGK A;  3AE9 A;  4XXG A;  2FJE A;  1Z6L A;  3DME A;  2C66 A;  3G5R A;  4B66 A;  4RG4 A;  3GRT A;  4H4U A;  3AD8 B;  1XHC A;  5BUK A;  3IHG A;  4D04 A;  5HHF A;  1VG9 A;  3ITJ A;  3CMM A;  3LXD A;  4EMI A;  4EM3 A;  1W4X A;  2EQ9 A;  2FJD A;  4Z24 A;  4A79 A;  3F8R A;  1TRB A;  1ZKQ A;  2WU2 A;  1DXL A;  3PS9 A;  2WDQ A;  4PAA A;  3SYI A;  4K2X A;  4A5L A;  1NHP A;  2BRY A;  3VRB A;  2EQ8 A;  3LJP A;  1PJ7 A;  4ZCD A;  1LVL A;  2V6O A;  4B68 A;  4UDQ A;  5ER0 A;  1YQ3 A;  2C70 A;  5HXI A;  2V5Z A;  4Z43 A;  1Y56 B;  2C3D A;  2NVK X;  3I3L A;  4P9S A;  2V3A A;  1JNR A;  2R45 A;  2GB0 A;  1IUX A;  4UP3 A;  3AEF A;  5KNL A;  4NTD A;  2A89 A;  3LAD A;  4JY3 A;  5TR3 A;  1FCD A;  2R4J A;  5FMH A;  2XLT A;  1IUS A;  4YTP A;  1UKV G;  3P4S A;  3SY4 A;  3T2Y A;  1ELI A;  2VVM A;  4KX6 A;  3ATR A;  1TDF A;  1IUV A;  4G6H A;  3DJG X;  3GSI A;  2IID A;  4AT2 A;  3L8K A;  4H4P A;  3AE5 A;  1V59 A;  1OJA A;  3KA7 A;  2GMH A;  2YLZ A;  4G73 A;  4J34 A;  2BA9 A;  3T2K A;  3OC4 A;  4U8J A;  4JNA A;  2YLT A;  3AD9 B;  1GRA A;  1B8S A;  1K0J A;  2X8C A;  4LU6 A;  4Y4M A;  4ZCC A;  1DOE A;  1MXT A;  2PHH A;  5U1O A;  2CDU A;  3AYL A;  3UCL A;  2WOV A;  3KPK A;  4G6G A;  3V76 A;  2ZZC A;  4USR A;  4CBQ A;  2GQW A;  2Y6Q A;  3OZ2 A;  2YLX A;  3CNT A;  3ALM A;  3AE2 A;  1IUT A;  1VRQ B;  3KVE A;  3UP4 A;  3QSS A;  1D7L A;  3GWD A;  1EL7 A;  1E1N A;  1IJH A;  3D1C A;  1EL9 A;  4H4Y A;  2RGH A;  1CC4 A;  2GR2 A;  5LV9 A;  1H7W A;  4U8O A;  3T14 A;  3UTF A;  3UOZ A;  5L46 A;  1GAL A;  1CF3 A;  4EQR A;  4HA6 A;  3NIX A;  1Q1R A;  2C73 A;  1VQW A;  2CFY A;  2JBV A;  2B76 A;  5KXJ A;  1IUW A;  3NRN A;  1D7Y A;  4YTM A;  3NTD A;  1S2Y A;  2A87 A;  3AWI A;  2XLR A;  4J33 A;  1FEA A;  4H4Z A;  3ICT A;  3SFD A;  4BUR A;  2ARD A;  2XLU A;  3NN0 X;  1XDI A;  3DGH A;  2XVF A;  1B5Q A;  3DJD A;  3NK1 X;  5GSN A;  1YQZ A;  3SZF A;  1ONF A;  4C74 A;  4BK2 A;  1NPX A;  2XFN A;  2R0C A;  2YM2 A;  3DH9 A;  4FK1 A;  4OPD A;  5KMP A;  4JNQ A;  3SX6 A;  4OPU A;  1ZDL A;  1GND A;  3FMW A;  3BI5 A;  3VRA A;  2R0G A;  3FBS A;  1BF3 A;  2DKI A;  4REK A;  2TMD A;  5CKU A;  2GVC A;  3NHO X;  1PBE A;  4DNA A;  3KU9 A;  2I0Z A;  4FX9 A;  1KDG A;  3NYF A;  4B69 A;  3UKQ A;  3DK4 A;  2B7S A;  3M0O A;  4XWZ A;  1GTH A;  2YQU A;  3QSE A;  4H4Q A;  2RGJ A;  4EMW A;  3CN8 A;  3V3N A;  4TM3 A;  1NHS A;  4B63 A;  2R0P A;  3CGD A;  3G5Q A;  3C4N A;  2HQM A;  4PAB A;  3SZ0 A;  2OLO A;  3AE4 A;  3HZL A;  1O94 A;  5KOW A;  2BCG G;  3AE3 A;  3UKH A;  4APN A;  1Y0P A;  3EAO A;  2GQF A;  3C96 A;  1TYT A;  1NAA A;  2UZZ A;  1O95 A;  1ZMC A;  3GDP A;  4G74 A;  2BAC A;  4H2P A;  4LA1 A;  4X4J A;  5GRT A;  3F8D A;  1H84 A;  4U2L A;  3F8P A;  3PVC A;  1JRX A;  4JY2 A;  3DA1 A;  1L9D A;  3VRD B;  2XLP A;  3C4A A;  3P9U A;  3S61 A;  2BXR A;  4YSY A;  1PXA A;  2C64 A;  1RP0 A;  3DJE A;  5IQ4 A;  2WQY A;  1OJT A;  2C67 A;  5KMQ A;  4A7A A;  1BGJ A;  2R46 A;  2EQ7 A;  3P4Q A;  1K0I A;  3ALJ A;  1FEB A;  3IHM A;  1KNP A;  1FEC A;  3UTG A;  3T0K A;  1TDN A;  5KVI A;  4ZN0 A;  3RNM A;  1JOA A;  1NHQ A;  4Z2T A;  3CNJ A;  3RP7 A;  3CPH G;  2V60 A;  2XVE A;  3NTA A;  4II3 A;  2C76 A;  1E7P A;  1KSU A;  2GAG B;  4Y4N A;  5IPY A;  2H89 A;  5FS8 A;  3AEE A;  4CNJ A;  2VQB A;  1FL2 A;  4Z25 A;  4A99 A;  4OPI A;  1NEK A;  3NK0 X;  2BK5 A;  5J60 A;  3NYE A;  5IQ1 A;  2GH5 A;  3CGB A;  4U8M A;  2XFU A;  4HB9 A;  2V61 A;  2GEW A;  3HYW A;  4BV6 A;  1CJC A;  1ZMD A;  2GR3 A;  5KOX A;  1N1P A;  4H7U A;  2Q0L A;  1ZOY A;  4U8N A;  1L9E A;  2YG3 A;  4FK1 C;  4H4X A;  2YLR A;  4YSZ A;  3ISH A;  2BS3 A;  4BK3 A;  1HYU A;  4K5S A;  2WES A;  2YLS A;  2QA1 A;  1LQU A;  2WBA A;  2FJB A;  3AE7 A;  4U2T A;  4IVM B;  2X8G A;  5C3J A;  4IA6 A;  1DOB A;  4BJZ A;  2GV8 A;  2J3N A;  1PXC A;  3CPJ G;  1GRH A;  3H8L A;  1N4U A;  3NGC X;  4NTC A;  1YKJ A;  3BHK A;  4AOS A;  4XWR A;  2WU5 A;  1O5W A;  4TLX A;  2Z5Y A;  4O5Q A;  4EIP A;  3SZW A;  3KKJ A;  4YKG A;  2XCG A;  4I58 A;  1P2H A;  2JAE A;  2YG7 A;  1BWC A;  1VG0 A;  1REO A;  4NWZ A;  3CGC A;  4A65 A;  4K22 A;  1CC6 A;  1EL8 A;  1L9C A;  1GPE A;  3DGZ A;  2B9X A;  3AD7 B;  3UOX A;  1QJD A;  3ABV A;  3H8I A;  3M13 A;  3ZDN A;  2BK3 A;  4CCQ A;  1GRG A;  4GUV A;  5JCM A;  2APG A;  1JRZ A;  3QJ4 A;  5KMS A;  3R9U A;  3CTY A;  4CY8 A;  1JRY A;  2C4C A;  1PBC A;  2YVG A;  5FS6 A;  1F8R A;  3UKL A;  1GRF A;  2JKC A;  3EF6 A;  2QA2 A;  1NEN A;  2WPF A;  4EM4 A;  2PYX A;  2YWL A;  4J31 A;  3QVP A;  4YXD A;  2B7R A;  2FJA A;  2XLS A;  4IA5 A;  5M0Z A;  3UTH A;  3T37 A;  3L1R A;  3DK9 A;  4MJW A;  4KPR A;  4Y4L A;  3CPI G;  1CL0 A;  4A6N B;  3VQR A;  1CC2 A;  2BK4 A;  2XVJ A;  4GAV A;  4Z2U A;  3BNM A;  4EQX A;  4YSX A;  3IF9 A;  1CJ4 A;  3NG7 X;  3AYI A;  4O5U A;  3WE0 A;  2QCU A;  5HY5 A;  1GOS A;  2E4G A;  5JCK A;  4B1B A;  3CNS A;  1QLB A;  4NTE A;  1GV4 A;  1YQ4 A;  5EBK A;  3NT6 A;  2DKH A;  4EMJ A;  4H4V A;  2TPR A;  4EQW A;  2F5Z A;  1FOH A;  5C2T A;  2FBW A;  1JU2 A;  4TM4 A;  4E0V A;  5EB5 A;  1ZK7 A;  2ZZ0 A;  3M12 A;  3NH3 X;  1LPF A;  3GYX A;  3QSM A;  4K8D A;  4OPT A;  4YT0 A;  3NN6 X;  4II2 A;  3SZC A;  4TLZ A;  2YAU A;  1N4W A;  3NNE A;  3EAN A;  3NK2 X;  2BYB A;  3SXI A;  1CBO A;  3SQP A;  3S5W A;  2XVH A;  2EQ6 A;  2C72 A;  3AB1 A;  3ATQ A;  3GRS A;  5BUL A;  1F3P A;  1PBB A;  1B37 A;  2NPX A;  2O9Z A;  3AEA A;  3E1T A;  3AED A;  3KPF A;  1GRB A;  5J7X A;  3UTE A;  4YSH A;  2X3N A;  1LV0 A;  1CJ2 A;  4AP3 A;  1M64 A;  1PJ5 A;  3GYI A;  1E6E A;  4OPL A;  2VZ2 A;  2RAB A;  4G9K A;  4FDC B;  4JN9 A;  5EB4 A;  5FS9 A;  4C3X A;  4K7Z A;  1K0L A;  1MO9 A;  1P2E A;  2GRT A;  1OJC A;  2YLW A;  1JEH A;  2XFQ A;  4Z44 A;  2OAL A;  5EOW A;  1H81 A;  1DOD A;  2C75 A;  2GR0 A;  2JK6 A;  4GF7 A;  2H88 A;  1BKW A;  1GT8 A;  4J36 A;  3P1W A;  3T31 A;  2XDO A;  2GF3 A;  2GR1 A;  3K30 A;  2JB2 A;  4GDE A;  4H2Q A;  1LQT A;  3RHA A;  5KMR A;  4A6N A;  3Q6J A;  1AOG A;  3LB8 A;  2IVD A;  2OA1 A;  3ZYX A;  1GRE A;  1TDK A;  4X9M A;  5M10 A;  4TM0 A;  2ACZ A;  1NHR A;  1H82 A;  1N4V A;  3B6D A;  1ZY8 A;  2VVL A;  5JCN A;  4YTN A;  2BXS A;  1GTE A;  3UKF A;  1GET A;  2XYO A;  2BC1 A;  2WDV A;  3BI4 A;  4IVO B;  1GRT A;  2X8H A;  3PO7 A;  1LTX R;  2BAB A;  2WP6 A;  3P4R A;  3UKP A;  1CHU A;  1KF6 A;  2AQJ A;  2VOU A;  1PHH A;  4H50 A;  4I59 A;  3GMB A;  2R4E A;  1EL5 A;  2R9Z A; 
#chains in the Genus database with same CATH homology
 4BK1 A;  2XFP A;  5CQF A;  4LII A;  4YWO A;  4Z2R A;  3SGL A;  1KNR A;  2X99 A;  2YR6 A;  1VDC A;  4K5R A;  5KVH A;  1TYP A;  2BRA A;  2GMJ A;  4GCM A;  2WEU A;  1LJ1 A;  2V3B A;  3SM8 A;  4JQ9 A;  1JNZ A;  3UKK A;  3LZX A;  4D03 A;  3GMC A;  3FIM B;  3DK8 A;  1KSS A;  4CNK A;  2YM1 A;  2YR5 A;  2CUL A;  1PDH A;  4M52 A;  2Q7V A;  1PS9 A;  3ICR A;  2WDR A;  1F8W A;  2WET A;  3K7M X;  1H7X A;  1CJ3 A;  1TDO A;  2YR4 A;  1H86 A;  3B3R A;  3IWA A;  4U2S A;  1GXF A;  3II4 A;  2C65 A;  4H2N A;  5U25 A;  1EBD A;  4X9N A;  4IV9 A;  1NG3 A;  1D4C A;  4AOX A;  2YG6 A;  4U8L A;  1S3B A;  3QFA A;  1Q9I A;  4EQS A;  3UKA A;  1GEU A;  3BNU A;  3LOV A;  2WP9 A;  3IC9 A;  5BVA A;  4EIQ A;  4H2R A;  1D4D A;  1XAN A;  2VVL G;  1SEZ A;  3AXB A;  4OPG A;  4AT0 A;  2W0H A;  3GWF A;  2YVF A;  2YG4 A;  1QO8 A;  1OJD A;  3AEC A;  3QFB A;  1X31 B;  3CIR A;  1BZL A;  2BS2 A;  2YVJ A;  3EPT A;  2AR8 A;  2CVJ A;  4J57 A;  2BCP A;  3DJJ A;  1E1M A;  4NNJ A;  4YKF A;  3UOY A;  2WS3 A;  5FS7 A;  4GDP A;  4OPC A;  3NKS A;  3CNP A;  3CGE A;  4AP1 A;  1YY5 A;  1TDE A;  1ZOV A;  4BJY A;  4ECH A;  1F6M A;  3NYC A;  4C77 A;  4H4R A;  4UDR A;  3NLC A;  3KD9 A;  2RGO A;  3K7Q X;  1XPQ A;  2AAQ A;  3AYJ A;  2BS4 A;  4NEV A;  4NEW A;  1PXB A;  2Z5X A;  2B9W A;  3FPZ A;  3K7T A;  2A8X A;  4J56 A;  1GER A;  4JDR A;  4WX1 A;  5KWF A;  4U8K A;  3VR9 A;  3BHF A;  1PBD A;  3D8X A;  4CRT A;  2JB3 A;  2X50 A;  2WP5 A;  5U63 A;  4A9W A;  1S3E A;  2C3C A;  2ZBW A;  1COY A;  3AE1 A;  2VRM A;  3AE8 A;  2VRL A;  3ICS A;  1OJ9 A;  4DSG A;  3GDN A;  5JCL A;  4ADW A;  2WPE A;  4B67 A;  3BI2 A;  4J2W A;  1E1L A;  2OLN A;  1Y56 A;  3HYX A;  4DSH A;  3O0H A;  5HYM A;  1H83 A;  4U8I A;  1DJQ A;  4GRT A;  4C5O A;  3RP6 A;  4CY6 A;  1K4Q A;  1RYI A;  3AE6 A;  4B65 A;  3ADA B;  2B9Y A;  3QVR A;  2OAM A;  1B4V A;  2WHD A;  3VR8 A;  4OVI A;  1Q1W A;  1E39 A;  3FG2 P;  1M6I A;  3GD3 A;  4UDP A;  2Q6U A;  1DOC A;  1NG4 A;  3UP5 A;  1PN0 A;  1DNC A;  1H6V A;  3HYV A;  3RP8 A;  1GSN A;  2ZZB A;  4H4T A;  2WPC A;  1L0V A;  1PJ6 A;  2YG5 A;  1KFY A;  3CND A;  3URH A;  4CCR A;  4GR1 A;  1BGN A;  1D4E A;  3SFE A;  5DBJ A;  2Q0K A;  2Y6R A;  4H4S A;  1PBF A;  2GAH B;  4OCG A;  4Z26 A;  3G5S A;  2VQ7 A;  1RSG A;  3GD4 A;  2E5V A;  4GAP A;  2WOI A;  3Q9T A;  4USQ A;  1DJN A;  2BC0 A;  1NDA A;  3P4P A;  3I6D A;  1ZP0 A;  3COX A;  5JCI A;  1F8S A;  3ALL A;  4RG3 A;  2IVE A;  4RSL A;  3UOV A;  5KRQ A;  2E1M A;  4NZH A;  3JSK A;  4C3Y A;  1D5T A;  1GES A;  2JB1 A;  1MOK A;  2XFO A;  3H4K A;  4N9X A;  4TM1 A;  4U8P A;  3V3O A;  5BRT A;  2C7G A;  4ICY A;  3KLJ A;  3T2Z A;  4B64 A;  1S2Q A;  1ZX9 A;  2QAE A;  3AEB A;  2WOW A;  1IUU A;  2XVI A;  1E1K A;  3LZW A;  3AEG A;  4H4W A;  4WCT A;  3RED A;  3GYJ A;  4DGK A;  3AE9 A;  4XXG A;  2FJE A;  1Z6L A;  3DME A;  2C66 A;  3G5R A;  4B66 A;  4RG4 A;  3GRT A;  4H4U A;  3AD8 B;  1XHC A;  5BUK A;  3IHG A;  4D04 A;  5HHF A;  1VG9 A;  3ITJ A;  3CMM A;  3LXD A;  4EMI A;  4EM3 A;  1W4X A;  2EQ9 A;  2FJD A;  4Z24 A;  4A79 A;  3F8R A;  1TRB A;  1ZKQ A;  2WU2 A;  1DXL A;  3PS9 A;  2WDQ A;  4PAA A;  3SYI A;  4K2X A;  4A5L A;  1NHP A;  2BRY A;  3VRB A;  2EQ8 A;  3LJP A;  1PJ7 A;  4ZCD A;  1LVL A;  2V6O A;  4B68 A;  4UDQ A;  5ER0 A;  1YQ3 A;  2C70 A;  5HXI A;  2V5Z A;  4Z43 A;  1Y56 B;  2C3D A;  2NVK X;  3I3L A;  4P9S A;  2V3A A;  1JNR A;  2R45 A;  2GB0 A;  1IUX A;  4UP3 A;  3AEF A;  5KNL A;  4NTD A;  2A89 A;  3LAD A;  4JY3 A;  5TR3 A;  1FCD A;  2R4J A;  5FMH A;  2XLT A;  1IUS A;  4YTP A;  1UKV G;  3P4S A;  3SY4 A;  3T2Y A;  1ELI A;  2VVM A;  4KX6 A;  3ATR A;  1TDF A;  1IUV A;  4G6H A;  3DJG X;  3GSI A;  2IID A;  4AT2 A;  3L8K A;  4H4P A;  3AE5 A;  1V59 A;  1OJA A;  3KA7 A;  2GMH A;  2YLZ A;  4G73 A;  4J34 A;  2BA9 A;  3T2K A;  3OC4 A;  4U8J A;  4JNA A;  2YLT A;  3AD9 B;  1GRA A;  1B8S A;  1K0J A;  2X8C A;  4LU6 A;  4Y4M A;  4ZCC A;  1DOE A;  1MXT A;  2PHH A;  5U1O A;  2CDU A;  3AYL A;  3UCL A;  2WOV A;  3KPK A;  4G6G A;  3V76 A;  2ZZC A;  4USR A;  4CBQ A;  2GQW A;  2Y6Q A;  3OZ2 A;  2YLX A;  3CNT A;  3ALM A;  3AE2 A;  1IUT A;  1VRQ B;  3KVE A;  3UP4 A;  3QSS A;  1D7L A;  3GWD A;  1EL7 A;  1E1N A;  1IJH A;  3D1C A;  1EL9 A;  4H4Y A;  2RGH A;  1CC4 A;  2GR2 A;  5LV9 A;  1H7W A;  4U8O A;  3T14 A;  3UTF A;  3UOZ A;  5L46 A;  1GAL A;  1CF3 A;  4EQR A;  4HA6 A;  3NIX A;  1Q1R A;  2C73 A;  1VQW A;  2CFY A;  2JBV A;  2B76 A;  5KXJ A;  1IUW A;  3NRN A;  1D7Y A;  4YTM A;  3NTD A;  1S2Y A;  2A87 A;  3AWI A;  2XLR A;  4J33 A;  1FEA A;  4H4Z A;  3ICT A;  3SFD A;  4BUR A;  2ARD A;  2XLU A;  3NN0 X;  1XDI A;  3DGH A;  2XVF A;  1B5Q A;  3DJD A;  3NK1 X;  5GSN A;  1YQZ A;  3SZF A;  1ONF A;  4C74 A;  4BK2 A;  1NPX A;  2XFN A;  2R0C A;  2YM2 A;  3DH9 A;  4FK1 A;  4OPD A;  5KMP A;  4JNQ A;  3SX6 A;  4OPU A;  1ZDL A;  1GND A;  3FMW A;  3BI5 A;  3VRA A;  2R0G A;  3FBS A;  1BF3 A;  2DKI A;  4REK A;  2TMD A;  5CKU A;  2GVC A;  3NHO X;  1PBE A;  4DNA A;  3KU9 A;  2I0Z A;  4FX9 A;  1KDG A;  3NYF A;  4B69 A;  3UKQ A;  3DK4 A;  2B7S A;  3M0O A;  4XWZ A;  1GTH A;  2YQU A;  3QSE A;  4H4Q A;  2RGJ A;  4EMW A;  3CN8 A;  3V3N A;  4TM3 A;  1NHS A;  4B63 A;  2R0P A;  3CGD A;  3G5Q A;  3C4N A;  2HQM A;  4PAB A;  3SZ0 A;  2OLO A;  3AE4 A;  3HZL A;  1O94 A;  5KOW A;  2BCG G;  3AE3 A;  3UKH A;  4APN A;  1Y0P A;  3EAO A;  2GQF A;  3C96 A;  1TYT A;  1NAA A;  2UZZ A;  1O95 A;  1ZMC A;  3GDP A;  4G74 A;  2BAC A;  4H2P A;  4LA1 A;  4X4J A;  5GRT A;  3F8D A;  1H84 A;  4U2L A;  3F8P A;  3PVC A;  1JRX A;  4JY2 A;  3DA1 A;  1L9D A;  3VRD B;  2XLP A;  3C4A A;  3P9U A;  3S61 A;  2BXR A;  4YSY A;  1PXA A;  2C64 A;  1RP0 A;  3DJE A;  5IQ4 A;  2WQY A;  1OJT A;  2C67 A;  5KMQ A;  4A7A A;  1BGJ A;  2R46 A;  2EQ7 A;  3P4Q A;  1K0I A;  3ALJ A;  1FEB A;  3IHM A;  1KNP A;  1FEC A;  3UTG A;  3T0K A;  1TDN A;  5KVI A;  4ZN0 A;  3RNM A;  1JOA A;  1NHQ A;  4Z2T A;  3CNJ A;  3RP7 A;  3CPH G;  2V60 A;  2XVE A;  3NTA A;  4II3 A;  2C76 A;  1E7P A;  1KSU A;  2GAG B;  4Y4N A;  5IPY A;  2H89 A;  5FS8 A;  3AEE A;  4CNJ A;  2VQB A;  1FL2 A;  4Z25 A;  4A99 A;  4OPI A;  1NEK A;  3NK0 X;  2BK5 A;  5J60 A;  3NYE A;  5IQ1 A;  2GH5 A;  3CGB A;  4U8M A;  2XFU A;  4HB9 A;  2V61 A;  2GEW A;  3HYW A;  4BV6 A;  1CJC A;  1ZMD A;  2GR3 A;  5KOX A;  1N1P A;  4H7U A;  2Q0L A;  1ZOY A;  4U8N A;  1L9E A;  2YG3 A;  4FK1 C;  4H4X A;  2YLR A;  4YSZ A;  3ISH A;  2BS3 A;  4BK3 A;  1HYU A;  4K5S A;  2WES A;  2YLS A;  2QA1 A;  1LQU A;  2WBA A;  2FJB A;  3AE7 A;  4U2T A;  4IVM B;  2X8G A;  5C3J A;  4IA6 A;  1DOB A;  4BJZ A;  2GV8 A;  2J3N A;  1PXC A;  3CPJ G;  1GRH A;  3H8L A;  1N4U A;  3NGC X;  4NTC A;  1YKJ A;  3BHK A;  4AOS A;  4XWR A;  2WU5 A;  1O5W A;  4TLX A;  2Z5Y A;  4O5Q A;  4EIP A;  3SZW A;  3KKJ A;  4YKG A;  2XCG A;  4I58 A;  1P2H A;  2JAE A;  2YG7 A;  1BWC A;  1VG0 A;  1REO A;  4NWZ A;  3CGC A;  4A65 A;  4K22 A;  1CC6 A;  1EL8 A;  1L9C A;  1GPE A;  3DGZ A;  2B9X A;  3AD7 B;  3UOX A;  1QJD A;  3ABV A;  3H8I A;  3M13 A;  3ZDN A;  2BK3 A;  4CCQ A;  1GRG A;  4GUV A;  5JCM A;  2APG A;  1JRZ A;  3QJ4 A;  5KMS A;  3R9U A;  3CTY A;  4CY8 A;  1JRY A;  2C4C A;  1PBC A;  2YVG A;  5FS6 A;  1F8R A;  3UKL A;  1GRF A;  2JKC A;  3EF6 A;  2QA2 A;  1NEN A;  2WPF A;  4EM4 A;  2PYX A;  2YWL A;  4J31 A;  3QVP A;  4YXD A;  2B7R A;  2FJA A;  2XLS A;  4IA5 A;  5M0Z A;  3UTH A;  3T37 A;  3L1R A;  3DK9 A;  4MJW A;  4KPR A;  4Y4L A;  3CPI G;  1CL0 A;  4A6N B;  3VQR A;  1CC2 A;  2BK4 A;  2XVJ A;  4GAV A;  4Z2U A;  3BNM A;  4EQX A;  4YSX A;  3IF9 A;  1CJ4 A;  3NG7 X;  3AYI A;  4O5U A;  3WE0 A;  2QCU A;  5HY5 A;  1GOS A;  2E4G A;  5JCK A;  4B1B A;  3CNS A;  1QLB A;  4NTE A;  1GV4 A;  1YQ4 A;  5EBK A;  3NT6 A;  2DKH A;  4EMJ A;  4H4V A;  2TPR A;  4EQW A;  2F5Z A;  1FOH A;  5C2T A;  2FBW A;  1JU2 A;  4TM4 A;  4E0V A;  5EB5 A;  1ZK7 A;  2ZZ0 A;  3M12 A;  3NH3 X;  1LPF A;  3GYX A;  3QSM A;  4K8D A;  4OPT A;  4YT0 A;  3NN6 X;  4II2 A;  3SZC A;  4TLZ A;  2YAU A;  1N4W A;  3NNE A;  3EAN A;  3NK2 X;  2BYB A;  3SXI A;  1CBO A;  3SQP A;  3S5W A;  2XVH A;  2EQ6 A;  2C72 A;  3AB1 A;  3ATQ A;  3GRS A;  5BUL A;  1F3P A;  1PBB A;  1B37 A;  2NPX A;  2O9Z A;  3AEA A;  3E1T A;  3AED A;  3KPF A;  1GRB A;  5J7X A;  3UTE A;  4YSH A;  2X3N A;  1LV0 A;  1CJ2 A;  4AP3 A;  1M64 A;  1PJ5 A;  3GYI A;  1E6E A;  4OPL A;  2VZ2 A;  2RAB A;  4G9K A;  4FDC B;  4JN9 A;  5EB4 A;  5FS9 A;  4C3X A;  4K7Z A;  1K0L A;  1MO9 A;  1P2E A;  2GRT A;  1OJC A;  2YLW A;  1JEH A;  2XFQ A;  4Z44 A;  2OAL A;  5EOW A;  1H81 A;  1DOD A;  2C75 A;  2GR0 A;  2JK6 A;  4GF7 A;  2H88 A;  1BKW A;  1GT8 A;  4J36 A;  3P1W A;  3T31 A;  2XDO A;  2GF3 A;  2GR1 A;  3K30 A;  2JB2 A;  4GDE A;  4H2Q A;  1LQT A;  3RHA A;  5KMR A;  4A6N A;  3Q6J A;  1AOG A;  3LB8 A;  2IVD A;  2OA1 A;  3ZYX A;  1GRE A;  1TDK A;  4X9M A;  5M10 A;  4TM0 A;  2ACZ A;  1NHR A;  1H82 A;  1N4V A;  3B6D A;  1ZY8 A;  2VVL A;  5JCN A;  4YTN A;  2BXS A;  1GTE A;  3UKF A;  1GET A;  2XYO A;  2BC1 A;  2WDV A;  3BI4 A;  4IVO B;  1GRT A;  2X8H A;  3PO7 A;  1LTX R;  2BAB A;  2WP6 A;  3P4R A;  3UKP A;  1CHU A;  1KF6 A;  2AQJ A;  2VOU A;  1PHH A;  4H50 A;  4I59 A;  3GMB A;  2R4E A;  1EL5 A;  2R9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...