3ISHA

Crystal structure of helicobacter pylori thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Helicobacter pylori thioredoxin reductase
rcsb
molecule keywords Thioredoxin reductase
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 88
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ishA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ishA02
1H6VA 2BACA 3Q6JA 4I58A 4AP3A 1H82A 1H84A 3VR8A 3EF6A 2C7GA 4IVOB 4EQRA 2WPFA 1ZK7A 3LXDA 4KPRA 4H2RA 1L0VA 4C3XA 4YKGA 2ZZ0A 4GCMA 3GMCA 4APNA 3CNTA 1K0IA 2C76A 2GEWA 2RABA 4A6NB 2Z5YA 1DNCA 1N4VA 2X8GA 1LV0A 2YLTA 3I6DA 4Z44A 2YQUA 3NHOX 5LV9A 3AWIA 3KPFA 1TDNA 2X8CA 1JRZA 4AT0A 4AT2A 2UZZA 4LU6A 2GRTA 2EQ7A 3UTHA 4O5QA 2R46A 3G5QA 2GR2A 4K8DA 3VQRA 2VOUA 1CF3A 2YLWA 5EOWA 5FS6A 2OA1A 2XCGA 2X99A 3CTYA 4C5OA 4CNJA 2PHHA 2JBVA 3AEFA 2A87A 3RP6A 3G5RA 2XFOA 4U8MA 3UP4A 4U8PA 1REOA 4OPDA 3K30A 1OJTA 3RHAA 3CN8A 4NZHA 1LTXR 5KVIA 3GDPA 2CDUA 4YT0A 2H88A 1F8SA 4Z43A 3V76A 2R4EA 3F8PA 3NTDA 1NHRA 4X9MA 1GRAA 1TYPA 3QSEA 5U63A 2WS3A 4B69A 4I59A 1OJAA 4H4SA 3ATQA 4B63A 4EMJA 1JU2A 3I3LA 1IUWA 1VG0A 1LQUA 4REKA 2X3NA 2WESA 3NK1X 4ADWA 4J2WA 3ICTA 3UCLA 2GVCA 3P4PA 4C74A 4YTMA 2QA2A 1FCDA 4K5SA 2TMDA 4OCGA 5IQ1A 3KD9A 4K7ZA 3UOVA 3DK8A 3AEBA 3M13A 3QVRA 4H2PA 3IHMA 3VRBA 2B9WA 5GRTA 2EQ8A 1CC2A 5JCLA 1F6MA 3QJ4A 1H7WA 2W0HA 3ABVA 2WBAA 4BV6A 3NGCX 4YTNA 2YR4A 1GRBA 4NEVA 4NTEA 4DNAA 4EM3A 4JNQA 4H4WA 1PXAA 2WDQA 3AEGA 4AOSA 2YG3A 4Z25A 1PS9A 4U8LA 1Y56B 3PVCA 3UP5A 3DJDA 3UTGA 3K7MX 3UKQA 1ZMDA 3EANA 4M52A 2GB0A 1GNDA 1GETA 4BK2A 1JEHA 3AE6A 3RP8A 2XLRA 4Y4NA 2H89A 2XLSA 2C3CA 2YG4A 3L8KA 4A5LA 1ZOVA 2Q0LA 3QFBA 4OPUA 2VVLG 2BXRA 4GUVA 5HY5A 3UKLA 2IVDA 3AD8B 5HHFA 2X8HA 1X31B 3NKSA 5KOXA 3C4NA 1BWCA 1H83A 1NG3A 2BC0A 4U8IA 2R0GA 3KA7A 1TDKA 2GR0A 3DK9A 3DA1A 1N4WA 2BXSA 4IVMB 1O94A 2RGJA 4U2LA 3F8DA 1EL8A 1Z6LA 2Y6QA 2GR3A 4UDRA 2YLSA 4H4UA 3ADAB 1O95A 2VVMA 3CPJG 3Q9TA 4B67A 2WP9A 4GRTA 1E7PA 3NYCA 3VRAA 3P4RA 1KDGA 1KNPA 3REDA 4U2SA 3ZYXA 2XLUA 4AP1A 3CGDA 3UKAA 2FJBA 3FBSA 1NDAA 1VQWA 2GAHB 4UP3A 3NT6A 4H4XA 3CPHG 2YAUA 2YVGA 4K5RA 4A6NA 2F5ZA 1V59A 1NAAA 1RP0A 2IVEA 2BC1A 3H8LA 4H4VA 3URHA 3AE5A 2BCGG 4H2NA 3NIXA 5IPYA 5TR3A 4C3YA 2AAQA 1CJCA 5FS9A 2V3BA 1NHQA 1JOAA 4H4PA 2YM2A 4U8KA 3GWDA 4J56A 4BJYA 1GPEA 4DSGA 2FJDA 2VQBA 1L9EA 4EQWA 4E0VA 1OJCA 3CGBA 3COXA 1L9CA 1P2HA 1E39A 1KFYA 1QLBA 4H2QA 1EL7A 2WQYA 2Q0KA 4P9SA 4CBQA 4RG4A 1KSUA 5ER0A 4Z24A 5HYMA 2DKHA 4OVIA 1PXBA 1LQTA 2OAMA 4WCTA 3SM8A 1MOKA 2OLOA 1TRBA 1GSNA 2V3AA 1D4DA 4DGKA 4FK1C 2YR5A 3KVEA 1PDHA 4AOXA 4B64A 1XHCA 1IUUA 1ZX9A 2V5ZA 1QO8A 3LOVA 2NVKX 2GQFA 2JAEA 4JY3A 2CFYA 2VRLA 2XVHA 2XVIA 1GRTA 4YSHA 1EL5A 2WETA 3LADA 5JCKA 4OPTA 2WDRA 2YR6A 1E1NA 2WDVA 2ZZCA 3BI5A 3M12A 5U25A 2C70A 3ALMA 3DH9A 3FPZA 1IUXA 1HYUA 1VG9A 3CNDA 2GR1A 4TM1A 4U8OA 1CJ2A 1PBBA 2BYBA 3GMBA 2WEUA 1TDEA 4Z2UA 5L46A 2B9XA 3PO7A 1YQ3A 4C77A 5JCMA 2YG5A 3NYEA 1B5QA 3RNMA 1GRFA 5EB4A 3UTEA 1IUSA 1GT8A 2AR8A 2YWLA 1IUVA 1B4VA 1K4QA 3AYIA 3O0HA 4YSXA 1PN0A 5KWFA 3PS9A 1VDCA 5GSNA 4O5UA 4GDPA 4J34A 1JNZA 3GRTA 1VRQB 1K0JA 1NHPA 3K7QX 5KVHA 4U8NA 3GSIA 4GR1A 1TDOA 3AE9A 3VR9A 2C72A 3KU9A 1Y56A 4D03A 3L1RA 3UKKA 1E1MA 3ICRA 2Q6UA 2A89A 1PHHA 3NLCA 1GREA 1Q1RA 3ICSA 4IA6A 1F8RA 1DXLA 4A65A 3HZLA 1Q1WA 3E1TA 4NTDA 4TLZA 2XYOA 1LVLA 2BS2A 2GQWA 1GRGA 2PYXA 2WPEA 3H4KA 3NRNA 2OALA 1GEUA 3NNEA 2V61A 1IUTA 1PXCA 1EL9A 2B9YA 2I0ZA 4NEWA 4ZCCA 5CKUA 2R0PA 2BK3A 2WOVA 4IA5A 4USQA 1TYTA 1W4XA 1FEAA 2B7SA 1M64A 2E4GA 3D8XA 1ZMCA 4OPCA 2JB3A 2O9ZA 4JDRA 1GALA 2J3NA 2BCPA 2R4JA 3ITJA 1BZLA 3ISHA 3S61A 1OJDA 4YSZA 2C67A 3NYFA 4KX6A 4USRA 1GV4A 4TM0A 4UDPA 3CNJA 1GTEA 4Z2TA 2VZ2A 4BURA 3GWFA 1ZKQA 3CPIG 1H81A 2CVJA 1D4EA 2QCUA 2E1MA 1N1PA 3GYJA 4H4TA 4A79A 2E5VA 4CCQA 4YTPA 2CULA 2ZZBA 4H50A 2FJAA 2XLPA 2C73A 3SFDA 1D4CA 2GMJA 3UKPA 2C75A 5KXJA 3LZXA 3SGLA 2XFNA 2YM1A 3AE1A 1FECA 2GH5A 1S2YA 4XXGA 1CJ4A 1GXFA 5EBKA 3UOZA 1GESA 3EPTA 4CNKA 1CHUA 4OPGA 3P9UA 1PJ7A 5FS7A 4B65A 5BRTA 5JCIA 1NENA 3BHKA 1GERA 1DJQA 4Y4LA 1BGNA 3AE4A 3G5SA 3NK2X 3AE7A 2WP5A 4CY6A 5U1OA 1XPQA 2R9ZA 1MO9A 1D7LA 5KOWA 1CBOA 4YKFA 5BULA 4MJWA 4HA6A 2WU2A 3B3RA 2XVJA 2VRMA 1GOSA 3M0OA 3GYIA 1Y0PA 1B37A 2TPRA 1UKVG 2BK5A 2WHDA 2RGOA 2Y6RA 3C96A 1IJHA 3AECA 3R9UA 1D7YA 4EIQA 3NN6X 3NTAA 2NPXA 1LJ1A 2ZBWA 1PBCA 4PABA 1ZP0A 2YLXA 1KSSA 3KKJA 1YQZA 1DODA 1PJ6A 4H4YA 5M0ZA 2XFQA 1MXTA 5BVAA 2YG6A 2XFPA 3CGEA 5HXIA 1S2QA 3AYLA 1KF6A 1YY5A 4A7AA 2WPCA 3II4A 3F8RA 5CQFA 2XLTA 2XDOA 2EQ9A 3DJEA 2XVFA 3GDNA 4FX9A 2ARDA 2BS4A 3V3NA 4H4ZA 3VRDB 2BABA 3LB8A 4HB9A 4A9WA 1CC6A 4YWOA 4TLXA 1CC4A 2FBWA 4EMWA 4DSHA 3IC9A 1BGJA 3ATRA 2Q7VA 3KLJA 4B66A 3IWAA 3DJGX 1GTHA 2R0CA 3S5WA 1RSGA 1E1LA 3P4SA 1E1KA 4K22A 4GF7A 4EQSA 2FJEA 4B1BA 2C66A 1F8WA 4Z26A 4H4QA 2DKIA 5EB5A 4FK1A 1S3EA 1RYIA 4H7UA 2WP6A 1F3PA 2C3DA 1YQ4A 3AYJA 1NPXA 2RGHA 3C4AA 3GD3A 4IV9A 2YLRA 1YKJA 3AD9B 3OZ2A 3GRSA 4D04A 2WOWA 3P4QA 3UOYA 2GMHA 2R45A 3NK0X 3UTFA 2GAGB 4EIPA 2C65A 1NHSA 4TM4A 3UKHA 1BF3A 1XANA 4BJZA 1ZOYA 1AOGA 4U2TA 3CIRA 4U8JA 3IHGA 2YLZA 3BI4A 4YXDA 1DOBA 4XWZA 2V6OA 1KNRA 1DJNA 1NEKA 1XDIA 4GDEA 3B6DA 2OLNA 4X9NA 4CCRA 3V3OA 2BS3A 4LIIA 3NH3X 2YG7A 3DK4A 4A99A 3AD7B 2V60A 1E6EA 3BNMA 1B8SA 4Y4MA 1M6IA 4ZCDA 1PBEA 4K2XA 3ALLA 3QFAA 5BUKA 3DGHA 4ECHA 2EQ6A 3CGCA 2B76A 2JB2A 3P1WA 1FOHA 3DGZA 4JY2A 3IF9A 4CRTA 1BKWA 5JCNA 5KRQA 2X50A 1EBDA 2Z5XA 1NG4A 2VVLA 2JB1A 3AB1A 5M10A 3OC4A 3AEEA 1SEZA 2BK4A 4BK3A 3EAOA 1TDFA 1H86A 3FG2P 4X4JA 4EQXA 3NG7X 1S3BA 3DJJA 1H7XA 4PAAA 1DOCA 1JNRA 4RSLA 4ZN0A 2VQ7A 4FDCB 1DOEA 2XFUA 3AXBA 2XVEA 4JQ9A 3UOXA 4OPIA 4J33A 2C64A 3RP7A 1OJ9A 4OPLA 5C2TA 1PBFA 5FMHA 4N9XA 1FEBA 1LPFA 4J36A 4UDQA 2B7RA 3CNSA 3ZDNA 1ELIA 3AE8A 4WX1A 2ACZA 3LJPA 1CJ3A 4RG3A 3BNUA 2AQJA 2WOIA 4NTCA 3QVPA 1JRYA 2YVFA 2GF3A 4J31A 3T37A 4J57A 4LA1A 3WE0A 1JRXA 4ICYA 1P2EA 3BI2A 2GV8A 1K0LA 1GRHA 5IQ4A 1QJDA 3LZWA 4EM4A 4B68A 1ONFA 4YSYA 2YVJA 2APGA 5DBJA 1L9DA 1Q9IA 1ZY8A 2JK6A 1D5TA 4JN9A 3FIMB 3FMWA 3UKFA 5J7XA 1PJ5A 2IIDA 4H4RA 2QA1A 3SFEA 1ZDLA 3QSSA 4BK1A 4EMIA 2WU5A 4TM3A 3AE2A 3AEDA 4XWRA 5C3JA 2BA9A 1CL0A 4Z2RA 5FS8A 3K7TA 2A8XA 4CY8A 3D1CA 3JSKA 2JKCA 5J60A 3DMEA 3H8IA 1N4UA 1PBDA 3GD4A 4JNAA 1COYA 3AEAA 2HQMA 1O5WA 3QSMA 3NN0X 3AE3A 3SQPA 2QAEA 3CNPA 1FL2A 3ALJA 3BHFA
chains in the Genus database with same CATH superfamily
1H6VA 2BACA 3Q6JA 4I58A 4AP3A 1H82A 1H84A 3VR8A 3EF6A 2C7GA 4IVOB 4EQRA 2WPFA 1ZK7A 3LXDA 4KPRA 4H2RA 1L0VA 4C3XA 4YKGA 2ZZ0A 4GCMA 3GMCA 4APNA 3CNTA 1K0IA 2C76A 2GEWA 2RABA 4A6NB 2Z5YA 4G74A 1DNCA 1N4VA 2X8GA 1LV0A 2YLTA 3I6DA 4Z44A 2YQUA 3NHOX 5LV9A 3AWIA 3KPFA 1TDNA 2X8CA 1JRZA 4AT0A 4AT2A 2UZZA 4G6HA 2GRTA 4LU6A 2EQ7A 3UTHA 4O5QA 2R46A 3G5QA 2GR2A 4K8DA 3VQRA 2VOUA 1CF3A 2YLWA 5EOWA 5FS6A 2OA1A 2XCGA 2X99A 3CTYA 4C5OA 4CNJA 2PHHA 2JBVA 3AEFA 2A87A 3RP6A 3G5RA 2XFOA 4U8MA 3UP4A 4U8PA 1REOA 4OPDA 3K30A 1OJTA 3RHAA 3CN8A 3GYXA 4NZHA 1LTXR 5KVIA 3GDPA 2CDUA 4YT0A 2H88A 1F8SA 4Z43A 3V76A 2R4EA 3F8PA 3NTDA 1NHRA 4X9MA 1GRAA 1TYPA 3QSEA 5U63A 2WS3A 4B69A 4I59A 1OJAA 4H4SA 3ATQA 4B63A 4EMJA 1JU2A 3I3LA 1IUWA 1VG0A 1LQUA 4REKA 2X3NA 2WESA 3NK1X 4ADWA 4J2WA 3ICTA 3SZCA 3UCLA 2GVCA 3P4PA 4C74A 4YTMA 2QA2A 1FCDA 4K5SA 2TMDA 4OCGA 5IQ1A 3KD9A 4K7ZA 3T0KA 3UOVA 3DK8A 3AEBA 3M13A 3QVRA 4H2PA 3IHMA 3VRBA 2B9WA 5GRTA 2EQ8A 1CC2A 5JCLA 1F6MA 3QJ4A 1H7WA 2W0HA 3ABVA 2WBAA 4BV6A 3NGCX 4YTNA 2YR4A 1GRBA 3HYXA 4NEVA 4NTEA 4DNAA 4EM3A 4JNQA 4H4WA 1PXAA 2WDQA 3AEGA 4AOSA 2YG3A 3SYIA 4Z25A 1PS9A 4U8LA 1Y56B 3PVCA 3UP5A 3DJDA 3UTGA 3K7MX 3UKQA 1ZMDA 3EANA 4M52A 2GB0A 1GNDA 1GETA 4BK2A 1JEHA 3AE6A 4NNJA 3RP8A 2XLRA 4Y4NA 2H89A 4GAPA 2XLSA 2C3CA 2YG4A 3L8KA 4A5LA 1ZOVA 2Q0LA 3VRDB 3QFBA 4OPUA 2VVLG 2BXRA 4GUVA 5HY5A 3UKLA 2IVDA 3AD8B 5HHFA 2X8HA 1X31B 3NKSA 5KOXA 3C4NA 1BWCA 1H83A 1NG3A 2BC0A 4U8IA 2R0GA 3KA7A 1TDKA 2GR0A 3DK9A 3DA1A 1N4WA 2BXSA 4IVMB 1O94A 2RGJA 4U2LA 3F8DA 1EL8A 1Z6LA 2Y6QA 2GR3A 4UDRA 2YLSA 4H4UA 3ADAB 1O95A 2VVMA 3CPJG 3Q9TA 4B67A 2WP9A 4GRTA 1E7PA 3NYCA 3VRAA 3P4RA 1KDGA 1KNPA 3REDA 4U2SA 3ZYXA 2XLUA 4AP1A 3CGDA 3UKAA 2FJBA 3FBSA 1NDAA 1VQWA 2GAHB 4UP3A 3NT6A 4H4XA 3CPHG 2YAUA 2YVGA 4K5RA 4A6NA 2F5ZA 1V59A 1NAAA 1RP0A 2IVEA 2BC1A 3H8LA 4H4VA 3SZWA 3URHA 3AE5A 2BCGG 4H2NA 3NIXA 5IPYA 5TR3A 4C3YA 2AAQA 1CJCA 5FS9A 2V3BA 1NHQA 1JOAA 4H4PA 2YM2A 4U8KA 3GWDA 4J56A 4BJYA 1GPEA 4DSGA 2FJDA 2VQBA 1L9EA 5KMSA 4EQWA 4E0VA 1OJCA 3CGBA 3COXA 1L9CA 1P2HA 1E39A 1KFYA 1QLBA 4H2QA 1EL7A 2WQYA 2Q0KA 4P9SA 4CBQA 4RG4A 1KSUA 5ER0A 4Z24A 5HYMA 2DKHA 4OVIA 1PXBA 1LQTA 2OAMA 4WCTA 3SM8A 1MOKA 2OLOA 1TRBA 1GSNA 2V3AA 1D4DA 4DGKA 4FK1C 2YR5A 3KVEA 3KPKA 1PDHA 4AOXA 4B64A 1XHCA 1IUUA 1ZX9A 2V5ZA 1QO8A 3LOVA 2NVKX 2GQFA 2JAEA 4JY3A 2CFYA 2VRLA 2XVHA 2XVIA 1GRTA 4YSHA 1EL5A 2WETA 3LADA 5JCKA 4OPTA 2WDRA 2YR6A 1E1NA 2WDVA 2ZZCA 3BI5A 3M12A 5U25A 2C70A 3ALMA 3DH9A 3FPZA 1IUXA 1HYUA 1VG9A 3CNDA 2GR1A 4TM1A 4U8OA 1CJ2A 1PBBA 2BYBA 3GMBA 2WEUA 1TDEA 4Z2UA 5L46A 2B9XA 3PO7A 1YQ3A 4C77A 5JCMA 2YG5A 3NYEA 1B5QA 3RNMA 1GRFA 5EB4A 3UTEA 3CMMA 1IUSA 1GT8A 2AR8A 2YWLA 1IUVA 1B4VA 1K4QA 3AYIA 3O0HA 5KMQA 1PN0A 4YSXA 3PS9A 5KMRA 3T2YA 4G6GA 1VDCA 5GSNA 4O5UA 4GDPA 4J34A 1JNZA 3GRTA 1VRQB 1K0JA 1NHPA 3K7QX 5KVHA 4U8NA 3GSIA 4GR1A 5KWFA 1TDOA 3AE9A 3VR9A 5KMPA 2C72A 3KU9A 1Y56A 4D03A 3L1RA 3UKKA 1E1MA 3ICRA 2Q6UA 2A89A 1PHHA 3NLCA 1GREA 1Q1RA 3ICSA 4IA6A 1F8RA 1DXLA 4A65A 3HZLA 1Q1WA 3E1TA 4NTDA 4TLZA 2XYOA 1LVLA 2BS2A 2GQWA 1GRGA 2PYXA 2WPEA 2C4CA 3H4KA 3NRNA 2OALA 1GEUA 3NNEA 2V61A 1IUTA 1PXCA 1EL9A 2B9YA 2I0ZA 4NEWA 4ZCCA 5CKUA 2R0PA 2BK3A 2WOVA 4IA5A 4USQA 1TYTA 1W4XA 1FEAA 2B7SA 1M64A 3T2KA 2E4GA 3D8XA 1ZMCA 4OPCA 2JB3A 2O9ZA 4JDRA 1GALA 2J3NA 2BCPA 2R4JA 3ITJA 1BZLA 3ISHA 3S61A 1OJDA 4YSZA 2C67A 3NYFA 4KX6A 4USRA 1GV4A 4TM0A 4UDPA 3CNJA 1GTEA 4Z2TA 2VZ2A 4BURA 3GWFA 1ZKQA 3CPIG 1H81A 2CVJA 1D4EA 2QCUA 2E1MA 1N1PA 3GYJA 4H4TA 4A79A 2E5VA 4CCQA 4YTPA 2CULA 2ZZBA 4H50A 2FJAA 2XLPA 2C73A 3SFDA 1D4CA 2GMJA 3UKPA 2C75A 5KXJA 3HYVA 3LZXA 3SGLA 5KNLA 2XFNA 2YM1A 3AE1A 1FECA 2GH5A 1S2YA 4XXGA 1CJ4A 1GXFA 5EBKA 3UOZA 1GESA 3EPTA 4CNKA 1CHUA 4OPGA 3P9UA 1PJ7A 5FS7A 4B65A 5BRTA 5JCIA 1NENA 3BHKA 1GERA 1DJQA 4Y4LA 1BGNA 3AE4A 3G5SA 3NK2X 3AE7A 2WP5A 4CY6A 5U1OA 1XPQA 2R9ZA 1MO9A 1D7LA 5KOWA 1CBOA 4YKFA 5BULA 4MJWA 4HA6A 2WU2A 3B3RA 2XVJA 2VRMA 1GOSA 3M0OA 3GYIA 1Y0PA 1B37A 3HYWA 2TPRA 1UKVG 2BK5A 3T2ZA 2WHDA 2RGOA 2Y6RA 3C96A 1IJHA 3AECA 3R9UA 1D7YA 4EIQA 3NN6X 3NTAA 2NPXA 4GAVA 1LJ1A 2ZBWA 1PBCA 4PABA 1ZP0A 2YLXA 1KSSA 3KKJA 1YQZA 1DODA 1PJ6A 4H4YA 5M0ZA 2XFQA 1MXTA 5BVAA 2YG6A 2XFPA 3CGEA 4NWZA 5HXIA 1S2QA 3AYLA 1KF6A 1YY5A 4A7AA 2WPCA 3II4A 3F8RA 5CQFA 2XLTA 2XDOA 2EQ9A 3DJEA 2XVFA 3GDNA 4FX9A 2ARDA 2BS4A 3V3NA 4H4ZA 3SY4A 2BABA 3LB8A 4HB9A 4A9WA 1CC6A 4YWOA 4TLXA 1CC4A 2FBWA 4EMWA 4DSHA 3IC9A 1BGJA 3ATRA 2Q7VA 3KLJA 4B66A 3IWAA 3DJGX 1GTHA 2R0CA 3S5WA 1RSGA 1E1LA 3P4SA 1E1KA 4K22A 4GF7A 4EQSA 2FJEA 4B1BA 2C66A 1F8WA 4Z26A 4H4QA 2DKIA 5EB5A 4FK1A 1S3EA 1RYIA 4H7UA 2WP6A 1F3PA 2C3DA 1YQ4A 2BRYA 3AYJA 1NPXA 2RGHA 3C4AA 3GD3A 4IV9A 3SXIA 2YLRA 1YKJA 3AD9B 3OZ2A 3GRSA 4D04A 2WOWA 3P4QA 3SZFA 3UOYA 2GMHA 2R45A 4G9KA 3NK0X 3UTFA 2GAGB 4EIPA 2C65A 1NHSA 4TM4A 3UKHA 1BF3A 1XANA 4BJZA 1ZOYA 3T31A 1AOGA 4U2TA 3CIRA 4U8JA 3IHGA 2YLZA 3BI4A 4YXDA 1DOBA 4XWZA 2V6OA 1KNRA 1DJNA 1NEKA 1XDIA 4GDEA 3B6DA 2OLNA 4X9NA 4CCRA 3SZ0A 3V3OA 2BS3A 4LIIA 3NH3X 2YG7A 3DK4A 4A99A 3AD7B 2V60A 1E6EA 3BNMA 1B8SA 4Y4MA 1M6IA 4ZCDA 1PBEA 4K2XA 4II3A 3ALLA 3QFAA 5BUKA 3DGHA 4ECHA 2EQ6A 3CGCA 2B76A 2JB2A 3P1WA 1FOHA 3DGZA 4JY2A 3IF9A 4CRTA 1BKWA 5JCNA 5KRQA 4G73A 2X50A 1EBDA 2Z5XA 1NG4A 2VVLA 2JB1A 3AB1A 5M10A 4II2A 3OC4A 3AEEA 1SEZA 2BK4A 4BK3A 3EAOA 1TDFA 1H86A 3FG2P 4X4JA 4EQXA 3NG7X 1S3BA 3DJJA 1H7XA 4PAAA 1DOCA 1JNRA 4RSLA 4ZN0A 2VQ7A 4FDCB 1DOEA 2XFUA 3AXBA 2XVEA 4JQ9A 3UOXA 4OPIA 4J33A 2C64A 3RP7A 1OJ9A 4OPLA 5C2TA 1PBFA 5FMHA 4N9XA 1FEBA 1LPFA 4J36A 4UDQA 2BRAA 2B7RA 3CNSA 3ZDNA 1ELIA 3AE8A 4WX1A 2ACZA 3LJPA 1CJ3A 4RG3A 3BNUA 2AQJA 3T14A 2WOIA 4NTCA 3QVPA 1JRYA 2YVFA 2GF3A 4J31A 3T37A 4J57A 4LA1A 3WE0A 1JRXA 4ICYA 1P2EA 3BI2A 2GV8A 1K0LA 1GRHA 5IQ4A 1QJDA 3LZWA 4EM4A 4B68A 1ONFA 3SX6A 4YSYA 2YVJA 2APGA 5DBJA 1L9DA 1Q9IA 1ZY8A 2JK6A 1D5TA 4JN9A 3FIMB 3FMWA 3UKFA 5J7XA 1PJ5A 2IIDA 4H4RA 2QA1A 3SFEA 1ZDLA 3QSSA 4BK1A 4EMIA 2WU5A 4TM3A 3AE2A 3AEDA 4XWRA 5C3JA 2BA9A 1CL0A 4Z2RA 5FS8A 3K7TA 2A8XA 4CY8A 3D1CA 3JSKA 2JKCA 5J60A 3DMEA 3H8IA 1N4UA 1PBDA 3GD4A 4JNAA 1COYA 3AEAA 2HQMA 1O5WA 3QSMA 3NN0X 3AE3A 3SQPA 2QAEA 3CNPA 1FL2A 3ALJA 3BHFA
chains in the Genus database with same CATH topology
1H6VA 2BACA 3Q6JA 4I58A 4AP3A 1H82A 1H84A 3VR8A 3EF6A 2C7GA 4IVOB 4EQRA 2WPFA 1ZK7A 3LXDA 4KPRA 4H2RA 1L0VA 4C3XA 4YKGA 2ZZ0A 4GCMA 3GMCA 4APNA 3CNTA 1K0IA 2C76A 2GEWA 2RABA 4A6NB 2Z5YA 4G74A 1DNCA 1N4VA 2X8GA 1LV0A 2YLTA 3I6DA 4Z44A 2YQUA 3NHOX 5LV9A 3AWIA 3KPFA 1TDNA 2X8CA 1JRZA 4AT0A 4AT2A 2UZZA 4G6HA 2GRTA 4LU6A 2EQ7A 3UTHA 4O5QA 2R46A 3G5QA 2GR2A 4K8DA 3VQRA 2VOUA 1CF3A 2YLWA 5EOWA 5FS6A 2OA1A 2XCGA 2X99A 3CTYA 4C5OA 4CNJA 2PHHA 2JBVA 3AEFA 2A87A 3RP6A 3G5RA 2XFOA 4U8MA 3UP4A 4U8PA 1REOA 4OPDA 3K30A 1OJTA 3RHAA 3CN8A 3GYXA 4NZHA 1LTXR 5KVIA 3GDPA 2CDUA 4YT0A 2H88A 1F8SA 4Z43A 3V76A 2R4EA 3F8PA 3NTDA 1NHRA 4X9MA 1GRAA 1TYPA 3QSEA 5U63A 2WS3A 4B69A 4I59A 1OJAA 4H4SA 3ATQA 4B63A 4EMJA 1JU2A 3I3LA 1IUWA 1VG0A 1LQUA 4REKA 2X3NA 2WESA 3NK1X 4ADWA 4J2WA 3ICTA 3SZCA 3UCLA 2GVCA 3P4PA 4C74A 4YTMA 2QA2A 1FCDA 4K5SA 2TMDA 4OCGA 5IQ1A 3KD9A 4K7ZA 3T0KA 3UOVA 3DK8A 3AEBA 3M13A 3QVRA 4H2PA 3IHMA 3VRBA 2B9WA 5GRTA 2EQ8A 1CC2A 5JCLA 1F6MA 3QJ4A 1H7WA 2W0HA 3ABVA 2WBAA 4BV6A 3NGCX 4YTNA 2YR4A 1GRBA 3HYXA 4NEVA 4NTEA 4DNAA 4EM3A 4JNQA 4H4WA 1PXAA 2WDQA 3AEGA 4AOSA 2YG3A 3SYIA 4Z25A 1PS9A 4U8LA 1Y56B 3PVCA 3UP5A 3DJDA 3UTGA 3K7MX 3UKQA 1ZMDA 3EANA 4M52A 2GB0A 1GNDA 1GETA 4BK2A 1JEHA 3AE6A 4NNJA 3RP8A 2XLRA 4Y4NA 2H89A 4GAPA 2XLSA 2C3CA 2YG4A 3L8KA 4A5LA 1ZOVA 2Q0LA 3VRDB 3QFBA 4OPUA 2VVLG 2BXRA 4GUVA 5HY5A 3UKLA 2IVDA 3AD8B 5HHFA 2X8HA 1X31B 3NKSA 5KOXA 3C4NA 1BWCA 1H83A 1NG3A 2BC0A 4U8IA 2R0GA 3KA7A 1TDKA 2GR0A 3DK9A 3DA1A 1N4WA 2BXSA 4IVMB 1O94A 2RGJA 4U2LA 3F8DA 1EL8A 1Z6LA 2Y6QA 2GR3A 4UDRA 2YLSA 4H4UA 3ADAB 1O95A 2VVMA 3CPJG 3Q9TA 4B67A 2WP9A 4GRTA 1E7PA 3NYCA 3VRAA 3P4RA 1KDGA 1KNPA 3REDA 4U2SA 3ZYXA 2XLUA 4AP1A 3CGDA 3UKAA 2FJBA 3FBSA 1NDAA 1VQWA 2GAHB 4UP3A 3NT6A 4H4XA 3CPHG 2YAUA 2YVGA 4K5RA 4A6NA 2F5ZA 1V59A 1NAAA 1RP0A 2IVEA 2BC1A 3H8LA 4H4VA 3SZWA 3URHA 3AE5A 2BCGG 4H2NA 3NIXA 5IPYA 5TR3A 4C3YA 2AAQA 1CJCA 5FS9A 2V3BA 1NHQA 1JOAA 4H4PA 2YM2A 4U8KA 3GWDA 4J56A 4BJYA 1GPEA 4DSGA 2FJDA 2VQBA 1L9EA 5KMSA 4EQWA 4E0VA 1OJCA 3CGBA 3COXA 1L9CA 1P2HA 1E39A 1KFYA 1QLBA 4H2QA 1EL7A 2WQYA 2Q0KA 4P9SA 4CBQA 4RG4A 1KSUA 5ER0A 4Z24A 5HYMA 2DKHA 4OVIA 1PXBA 1LQTA 2OAMA 4WCTA 3SM8A 1MOKA 2OLOA 1TRBA 1GSNA 2V3AA 1D4DA 4DGKA 4FK1C 2YR5A 3KVEA 3KPKA 1PDHA 4AOXA 4B64A 1XHCA 1IUUA 1ZX9A 2V5ZA 1QO8A 3LOVA 2NVKX 2GQFA 2JAEA 4JY3A 2CFYA 2VRLA 2XVHA 2XVIA 1GRTA 4YSHA 1EL5A 2WETA 3LADA 5JCKA 4OPTA 2WDRA 2YR6A 1E1NA 2WDVA 2ZZCA 3BI5A 3M12A 5U25A 2C70A 3ALMA 3DH9A 3FPZA 1IUXA 1HYUA 1VG9A 3CNDA 2GR1A 4TM1A 4U8OA 1CJ2A 1PBBA 2BYBA 3GMBA 2WEUA 1TDEA 4Z2UA 5L46A 2B9XA 3PO7A 1YQ3A 4C77A 5JCMA 2YG5A 3NYEA 1B5QA 3RNMA 1GRFA 5EB4A 3UTEA 3CMMA 1IUSA 1GT8A 2AR8A 2YWLA 1IUVA 1B4VA 1K4QA 3AYIA 3O0HA 5KMQA 1PN0A 4YSXA 3PS9A 5KMRA 3T2YA 4G6GA 1VDCA 5GSNA 4O5UA 4GDPA 4J34A 1JNZA 3GRTA 1VRQB 1K0JA 1NHPA 3K7QX 5KVHA 4U8NA 3GSIA 4GR1A 5KWFA 1TDOA 3AE9A 3VR9A 5KMPA 2C72A 3KU9A 1Y56A 4D03A 3L1RA 3UKKA 1E1MA 3ICRA 2Q6UA 2A89A 1PHHA 3NLCA 1GREA 1Q1RA 3ICSA 4IA6A 1F8RA 1DXLA 4A65A 3HZLA 1Q1WA 3E1TA 4NTDA 4TLZA 2XYOA 1LVLA 2BS2A 2GQWA 1GRGA 2PYXA 2WPEA 2C4CA 3H4KA 3NRNA 2OALA 1GEUA 3NNEA 2V61A 1IUTA 1PXCA 1EL9A 2B9YA 2I0ZA 4NEWA 4ZCCA 5CKUA 2R0PA 2BK3A 2WOVA 4IA5A 4USQA 1TYTA 1W4XA 1FEAA 2B7SA 1M64A 3T2KA 2E4GA 3D8XA 1ZMCA 4OPCA 2JB3A 2O9ZA 4JDRA 1GALA 2J3NA 2BCPA 2R4JA 3ITJA 1BZLA 3ISHA 3S61A 1OJDA 4YSZA 2C67A 3NYFA 4KX6A 4USRA 1GV4A 4TM0A 4UDPA 3CNJA 1GTEA 4Z2TA 2VZ2A 4BURA 3GWFA 1ZKQA 3CPIG 1H81A 2CVJA 1D4EA 2QCUA 2E1MA 1N1PA 3GYJA 4H4TA 4A79A 2E5VA 4CCQA 4YTPA 2CULA 2ZZBA 4H50A 2FJAA 2XLPA 2C73A 3SFDA 1D4CA 2GMJA 3UKPA 2C75A 5KXJA 3HYVA 3LZXA 3SGLA 5KNLA 2XFNA 2YM1A 3AE1A 1FECA 2GH5A 1S2YA 4XXGA 1CJ4A 1GXFA 5EBKA 3UOZA 1GESA 3EPTA 4CNKA 1CHUA 4OPGA 3P9UA 1PJ7A 5FS7A 4B65A 5BRTA 5JCIA 1NENA 3BHKA 1GERA 1DJQA 4Y4LA 1BGNA 3AE4A 3G5SA 3NK2X 3AE7A 2WP5A 4CY6A 5U1OA 1XPQA 2R9ZA 1MO9A 1D7LA 5KOWA 1CBOA 4YKFA 5BULA 4MJWA 4HA6A 2WU2A 3B3RA 2XVJA 2VRMA 1GOSA 3M0OA 3GYIA 1Y0PA 1B37A 3HYWA 2TPRA 1UKVG 2BK5A 3T2ZA 2WHDA 2RGOA 2Y6RA 3C96A 1IJHA 3AECA 3R9UA 1D7YA 4EIQA 3NN6X 3NTAA 2NPXA 4GAVA 1LJ1A 2ZBWA 1PBCA 4PABA 1ZP0A 2YLXA 1KSSA 3KKJA 1YQZA 1DODA 1PJ6A 4H4YA 5M0ZA 2XFQA 1MXTA 5BVAA 2YG6A 2XFPA 3CGEA 4NWZA 5HXIA 1S2QA 3AYLA 1KF6A 1YY5A 4A7AA 2WPCA 3II4A 3F8RA 5CQFA 2XLTA 2XDOA 2EQ9A 3DJEA 2XVFA 3GDNA 4FX9A 2ARDA 2BS4A 3V3NA 4H4ZA 3SY4A 2BABA 3LB8A 4HB9A 4A9WA 1CC6A 4YWOA 4TLXA 1CC4A 2FBWA 4EMWA 4DSHA 3IC9A 1BGJA 3ATRA 2Q7VA 3KLJA 4B66A 3IWAA 3DJGX 1GTHA 2R0CA 3S5WA 1RSGA 1E1LA 3P4SA 1E1KA 4K22A 4GF7A 4EQSA 2FJEA 4B1BA 2C66A 1F8WA 4Z26A 4H4QA 2DKIA 5EB5A 4FK1A 1S3EA 1RYIA 4H7UA 2WP6A 1F3PA 2C3DA 1YQ4A 2BRYA 3AYJA 1NPXA 2RGHA 3C4AA 3GD3A 4IV9A 3SXIA 2YLRA 1YKJA 3AD9B 3OZ2A 3GRSA 4D04A 2WOWA 3P4QA 3SZFA 3UOYA 2GMHA 2R45A 4G9KA 3NK0X 3UTFA 2GAGB 4EIPA 2C65A 1NHSA 4TM4A 3UKHA 1BF3A 1XANA 4BJZA 1ZOYA 3T31A 1AOGA 4U2TA 3CIRA 4U8JA 3IHGA 2YLZA 3BI4A 4YXDA 1DOBA 4XWZA 2V6OA 1KNRA 1DJNA 1NEKA 1XDIA 4GDEA 3B6DA 2OLNA 4X9NA 4CCRA 3SZ0A 3V3OA 2BS3A 4LIIA 3NH3X 2YG7A 3DK4A 4A99A 3AD7B 2V60A 1E6EA 3BNMA 1B8SA 4Y4MA 1M6IA 4ZCDA 1PBEA 4K2XA 4II3A 3ALLA 3QFAA 5BUKA 3DGHA 4ECHA 2EQ6A 3CGCA 2B76A 2JB2A 3P1WA 1FOHA 3DGZA 4JY2A 3IF9A 4CRTA 1BKWA 5JCNA 5KRQA 4G73A 2X50A 1EBDA 2Z5XA 1NG4A 2VVLA 2JB1A 3AB1A 5M10A 4II2A 3OC4A 3AEEA 1SEZA 2BK4A 4BK3A 3EAOA 1TDFA 1H86A 3FG2P 4X4JA 4EQXA 3NG7X 1S3BA 3DJJA 1H7XA 4PAAA 1DOCA 1JNRA 4RSLA 4ZN0A 2VQ7A 4FDCB 1DOEA 2XFUA 3AXBA 2XVEA 4JQ9A 3UOXA 4OPIA 4J33A 2C64A 3RP7A 1OJ9A 4OPLA 5C2TA 1PBFA 5FMHA 4N9XA 1FEBA 1LPFA 4J36A 4UDQA 2BRAA 2B7RA 3CNSA 3ZDNA 1ELIA 3AE8A 4WX1A 2ACZA 3LJPA 1CJ3A 4RG3A 3BNUA 2AQJA 3T14A 2WOIA 4NTCA 3QVPA 1JRYA 2YVFA 2GF3A 4J31A 3T37A 4J57A 4LA1A 3WE0A 1JRXA 4ICYA 1P2EA 3BI2A 2GV8A 1K0LA 1GRHA 5IQ4A 1QJDA 3LZWA 4EM4A 4B68A 1ONFA 3SX6A 4YSYA 2YVJA 2APGA 5DBJA 1L9DA 1Q9IA 1ZY8A 2JK6A 1D5TA 4JN9A 3FIMB 3FMWA 3UKFA 5J7XA 1PJ5A 2IIDA 4H4RA 2QA1A 3SFEA 1ZDLA 3QSSA 4BK1A 4EMIA 2WU5A 4TM3A 3AE2A 3AEDA 4XWRA 5C3JA 2BA9A 1CL0A 4Z2RA 5FS8A 3K7TA 2A8XA 4CY8A 3D1CA 3JSKA 2JKCA 5J60A 3DMEA 3H8IA 1N4UA 1PBDA 3GD4A 4JNAA 1COYA 3AEAA 2HQMA 1O5WA 3QSMA 3NN0X 3AE3A 3SQPA 2QAEA 3CNPA 1FL2A 3ALJA 3BHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H6V A;  2BAC A;  3Q6J A;  4I58 A;  4AP3 A;  1H82 A;  1H84 A;  3VR8 A;  3EF6 A;  2C7G A;  4IVO B;  4EQR A;  2WPF A;  1ZK7 A;  3LXD A;  4KPR A;  4H2R A;  1L0V A;  4C3X A;  4YKG A;  2ZZ0 A;  4GCM A;  3GMC A;  4APN A;  3CNT A;  1K0I A;  2C76 A;  2GEW A;  2RAB A;  4A6N B;  2Z5Y A;  1DNC A;  1N4V A;  2X8G A;  1LV0 A;  2YLT A;  3I6D A;  4Z44 A;  2YQU A;  3NHO X;  5LV9 A;  3AWI A;  3KPF A;  1TDN A;  2X8C A;  1JRZ A;  4AT0 A;  4AT2 A;  2UZZ A;  4LU6 A;  2GRT A;  2EQ7 A;  3UTH A;  4O5Q A;  2R46 A;  3G5Q A;  2GR2 A;  4K8D A;  3VQR A;  2VOU A;  1CF3 A;  2YLW A;  5EOW A;  5FS6 A;  2OA1 A;  2XCG A;  2X99 A;  3CTY A;  4C5O A;  4CNJ A;  2PHH A;  2JBV A;  3AEF A;  2A87 A;  3RP6 A;  3G5R A;  2XFO A;  4U8M A;  3UP4 A;  4U8P A;  1REO A;  4OPD A;  3K30 A;  1OJT A;  3RHA A;  3CN8 A;  4NZH A;  1LTX R;  5KVI A;  3GDP A;  2CDU A;  4YT0 A;  2H88 A;  1F8S A;  4Z43 A;  3V76 A;  2R4E A;  3F8P A;  3NTD A;  1NHR A;  4X9M A;  1GRA A;  1TYP A;  3QSE A;  5U63 A;  2WS3 A;  4B69 A;  4I59 A;  1OJA A;  4H4S A;  3ATQ A;  4B63 A;  4EMJ A;  1JU2 A;  3I3L A;  1IUW A;  1VG0 A;  1LQU A;  4REK A;  2X3N A;  2WES A;  3NK1 X;  4ADW A;  4J2W A;  3ICT A;  3UCL A;  2GVC A;  3P4P A;  4C74 A;  4YTM A;  2QA2 A;  1FCD A;  4K5S A;  2TMD A;  4OCG A;  5IQ1 A;  3KD9 A;  4K7Z A;  3UOV A;  3DK8 A;  3AEB A;  3M13 A;  3QVR A;  4H2P A;  3IHM A;  3VRB A;  2B9W A;  5GRT A;  2EQ8 A;  1CC2 A;  5JCL A;  1F6M A;  3QJ4 A;  1H7W A;  2W0H A;  3ABV A;  2WBA A;  4BV6 A;  3NGC X;  4YTN A;  2YR4 A;  1GRB A;  4NEV A;  4NTE A;  4DNA A;  4EM3 A;  4JNQ A;  4H4W A;  1PXA A;  2WDQ A;  3AEG A;  4AOS A;  2YG3 A;  4Z25 A;  1PS9 A;  4U8L A;  1Y56 B;  3PVC A;  3UP5 A;  3DJD A;  3UTG A;  3K7M X;  3UKQ A;  1ZMD A;  3EAN A;  4M52 A;  2GB0 A;  1GND A;  1GET A;  4BK2 A;  1JEH A;  3AE6 A;  3RP8 A;  2XLR A;  4Y4N A;  2H89 A;  2XLS A;  2C3C A;  2YG4 A;  3L8K A;  4A5L A;  1ZOV A;  2Q0L A;  3QFB A;  4OPU A;  2VVL G;  2BXR A;  4GUV A;  5HY5 A;  3UKL A;  2IVD A;  3AD8 B;  5HHF A;  2X8H A;  1X31 B;  3NKS A;  5KOX A;  3C4N A;  1BWC A;  1H83 A;  1NG3 A;  2BC0 A;  4U8I A;  2R0G A;  3KA7 A;  1TDK A;  2GR0 A;  3DK9 A;  3DA1 A;  1N4W A;  2BXS A;  4IVM B;  1O94 A;  2RGJ A;  4U2L A;  3F8D A;  1EL8 A;  1Z6L A;  2Y6Q A;  2GR3 A;  4UDR A;  2YLS A;  4H4U A;  3ADA B;  1O95 A;  2VVM A;  3CPJ G;  3Q9T A;  4B67 A;  2WP9 A;  4GRT A;  1E7P A;  3NYC A;  3VRA A;  3P4R A;  1KDG A;  1KNP A;  3RED A;  4U2S A;  3ZYX A;  2XLU A;  4AP1 A;  3CGD A;  3UKA A;  2FJB A;  3FBS A;  1NDA A;  1VQW A;  2GAH B;  4UP3 A;  3NT6 A;  4H4X A;  3CPH G;  2YAU A;  2YVG A;  4K5R A;  4A6N A;  2F5Z A;  1V59 A;  1NAA A;  1RP0 A;  2IVE A;  2BC1 A;  3H8L A;  4H4V A;  3URH A;  3AE5 A;  2BCG G;  4H2N A;  3NIX A;  5IPY A;  5TR3 A;  4C3Y A;  2AAQ A;  1CJC A;  5FS9 A;  2V3B A;  1NHQ A;  1JOA A;  4H4P A;  2YM2 A;  4U8K A;  3GWD A;  4J56 A;  4BJY A;  1GPE A;  4DSG A;  2FJD A;  2VQB A;  1L9E A;  4EQW A;  4E0V A;  1OJC A;  3CGB A;  3COX A;  1L9C A;  1P2H A;  1E39 A;  1KFY A;  1QLB A;  4H2Q A;  1EL7 A;  2WQY A;  2Q0K A;  4P9S A;  4CBQ A;  4RG4 A;  1KSU A;  5ER0 A;  4Z24 A;  5HYM A;  2DKH A;  4OVI A;  1PXB A;  1LQT A;  2OAM A;  4WCT A;  3SM8 A;  1MOK A;  2OLO A;  1TRB A;  1GSN A;  2V3A A;  1D4D A;  4DGK A;  4FK1 C;  2YR5 A;  3KVE A;  1PDH A;  4AOX A;  4B64 A;  1XHC A;  1IUU A;  1ZX9 A;  2V5Z A;  1QO8 A;  3LOV A;  2NVK X;  2GQF A;  2JAE A;  4JY3 A;  2CFY A;  2VRL A;  2XVH A;  2XVI A;  1GRT A;  4YSH A;  1EL5 A;  2WET A;  3LAD A;  5JCK A;  4OPT A;  2WDR A;  2YR6 A;  1E1N A;  2WDV A;  2ZZC A;  3BI5 A;  3M12 A;  5U25 A;  2C70 A;  3ALM A;  3DH9 A;  3FPZ A;  1IUX A;  1HYU A;  1VG9 A;  3CND A;  2GR1 A;  4TM1 A;  4U8O A;  1CJ2 A;  1PBB A;  2BYB A;  3GMB A;  2WEU A;  1TDE A;  4Z2U A;  5L46 A;  2B9X A;  3PO7 A;  1YQ3 A;  4C77 A;  5JCM A;  2YG5 A;  3NYE A;  1B5Q A;  3RNM A;  1GRF A;  5EB4 A;  3UTE A;  1IUS A;  1GT8 A;  2AR8 A;  2YWL A;  1IUV A;  1B4V A;  1K4Q A;  3AYI A;  3O0H A;  4YSX A;  1PN0 A;  5KWF A;  3PS9 A;  1VDC A;  5GSN A;  4O5U A;  4GDP A;  4J34 A;  1JNZ A;  3GRT A;  1VRQ B;  1K0J A;  1NHP A;  3K7Q X;  5KVH A;  4U8N A;  3GSI A;  4GR1 A;  1TDO A;  3AE9 A;  3VR9 A;  2C72 A;  3KU9 A;  1Y56 A;  4D03 A;  3L1R A;  3UKK A;  1E1M A;  3ICR A;  2Q6U A;  2A89 A;  1PHH A;  3NLC A;  1GRE A;  1Q1R A;  3ICS A;  4IA6 A;  1F8R A;  1DXL A;  4A65 A;  3HZL A;  1Q1W A;  3E1T A;  4NTD A;  4TLZ A;  2XYO A;  1LVL A;  2BS2 A;  2GQW A;  1GRG A;  2PYX A;  2WPE A;  3H4K A;  3NRN A;  2OAL A;  1GEU A;  3NNE A;  2V61 A;  1IUT A;  1PXC A;  1EL9 A;  2B9Y A;  2I0Z A;  4NEW A;  4ZCC A;  5CKU A;  2R0P A;  2BK3 A;  2WOV A;  4IA5 A;  4USQ A;  1TYT A;  1W4X A;  1FEA A;  2B7S A;  1M64 A;  2E4G A;  3D8X A;  1ZMC A;  4OPC A;  2JB3 A;  2O9Z A;  4JDR A;  1GAL A;  2J3N A;  2BCP A;  2R4J A;  3ITJ A;  1BZL A;  3ISH A;  3S61 A;  1OJD A;  4YSZ A;  2C67 A;  3NYF A;  4KX6 A;  4USR A;  1GV4 A;  4TM0 A;  4UDP A;  3CNJ A;  1GTE A;  4Z2T A;  2VZ2 A;  4BUR A;  3GWF A;  1ZKQ A;  3CPI G;  1H81 A;  2CVJ A;  1D4E A;  2QCU A;  2E1M A;  1N1P A;  3GYJ A;  4H4T A;  4A79 A;  2E5V A;  4CCQ A;  4YTP A;  2CUL A;  2ZZB A;  4H50 A;  2FJA A;  2XLP A;  2C73 A;  3SFD A;  1D4C A;  2GMJ A;  3UKP A;  2C75 A;  5KXJ A;  3LZX A;  3SGL A;  2XFN A;  2YM1 A;  3AE1 A;  1FEC A;  2GH5 A;  1S2Y A;  4XXG A;  1CJ4 A;  1GXF A;  5EBK A;  3UOZ A;  1GES A;  3EPT A;  4CNK A;  1CHU A;  4OPG A;  3P9U A;  1PJ7 A;  5FS7 A;  4B65 A;  5BRT A;  5JCI A;  1NEN A;  3BHK A;  1GER A;  1DJQ A;  4Y4L A;  1BGN A;  3AE4 A;  3G5S A;  3NK2 X;  3AE7 A;  2WP5 A;  4CY6 A;  5U1O A;  1XPQ A;  2R9Z A;  1MO9 A;  1D7L A;  5KOW A;  1CBO A;  4YKF A;  5BUL A;  4MJW A;  4HA6 A;  2WU2 A;  3B3R A;  2XVJ A;  2VRM A;  1GOS A;  3M0O A;  3GYI A;  1Y0P A;  1B37 A;  2TPR A;  1UKV G;  2BK5 A;  2WHD A;  2RGO A;  2Y6R A;  3C96 A;  1IJH A;  3AEC A;  3R9U A;  1D7Y A;  4EIQ A;  3NN6 X;  3NTA A;  2NPX A;  1LJ1 A;  2ZBW A;  1PBC A;  4PAB A;  1ZP0 A;  2YLX A;  1KSS A;  3KKJ A;  1YQZ A;  1DOD A;  1PJ6 A;  4H4Y A;  5M0Z A;  2XFQ A;  1MXT A;  5BVA A;  2YG6 A;  2XFP A;  3CGE A;  5HXI A;  1S2Q A;  3AYL A;  1KF6 A;  1YY5 A;  4A7A A;  2WPC A;  3II4 A;  3F8R A;  5CQF A;  2XLT A;  2XDO A;  2EQ9 A;  3DJE A;  2XVF A;  3GDN A;  4FX9 A;  2ARD A;  2BS4 A;  3V3N A;  4H4Z A;  3VRD B;  2BAB A;  3LB8 A;  4HB9 A;  4A9W A;  1CC6 A;  4YWO A;  4TLX A;  1CC4 A;  2FBW A;  4EMW A;  4DSH A;  3IC9 A;  1BGJ A;  3ATR A;  2Q7V A;  3KLJ A;  4B66 A;  3IWA A;  3DJG X;  1GTH A;  2R0C A;  3S5W A;  1RSG A;  1E1L A;  3P4S A;  1E1K A;  4K22 A;  4GF7 A;  4EQS A;  2FJE A;  4B1B A;  2C66 A;  1F8W A;  4Z26 A;  4H4Q A;  2DKI A;  5EB5 A;  4FK1 A;  1S3E A;  1RYI A;  4H7U A;  2WP6 A;  1F3P A;  2C3D A;  1YQ4 A;  3AYJ A;  1NPX A;  2RGH A;  3C4A A;  3GD3 A;  4IV9 A;  2YLR A;  1YKJ A;  3AD9 B;  3OZ2 A;  3GRS A;  4D04 A;  2WOW A;  3P4Q A;  3UOY A;  2GMH A;  2R45 A;  3NK0 X;  3UTF A;  2GAG B;  4EIP A;  2C65 A;  1NHS A;  4TM4 A;  3UKH A;  1BF3 A;  1XAN A;  4BJZ A;  1ZOY A;  1AOG A;  4U2T A;  3CIR A;  4U8J A;  3IHG A;  2YLZ A;  3BI4 A;  4YXD A;  1DOB A;  4XWZ A;  2V6O A;  1KNR A;  1DJN A;  1NEK A;  1XDI A;  4GDE A;  3B6D A;  2OLN A;  4X9N A;  4CCR A;  3V3O A;  2BS3 A;  4LII A;  3NH3 X;  2YG7 A;  3DK4 A;  4A99 A;  3AD7 B;  2V60 A;  1E6E A;  3BNM A;  1B8S A;  4Y4M A;  1M6I A;  4ZCD A;  1PBE A;  4K2X A;  3ALL A;  3QFA A;  5BUK A;  3DGH A;  4ECH A;  2EQ6 A;  3CGC A;  2B76 A;  2JB2 A;  3P1W A;  1FOH A;  3DGZ A;  4JY2 A;  3IF9 A;  4CRT A;  1BKW A;  5JCN A;  5KRQ A;  2X50 A;  1EBD A;  2Z5X A;  1NG4 A;  2VVL A;  2JB1 A;  3AB1 A;  5M10 A;  3OC4 A;  3AEE A;  1SEZ A;  2BK4 A;  4BK3 A;  3EAO A;  1TDF A;  1H86 A;  3FG2 P;  4X4J A;  4EQX A;  3NG7 X;  1S3B A;  3DJJ A;  1H7X A;  4PAA A;  1DOC A;  1JNR A;  4RSL A;  4ZN0 A;  2VQ7 A;  4FDC B;  1DOE A;  2XFU A;  3AXB A;  2XVE A;  4JQ9 A;  3UOX A;  4OPI A;  4J33 A;  2C64 A;  3RP7 A;  1OJ9 A;  4OPL A;  5C2T A;  1PBF A;  5FMH A;  4N9X A;  1FEB A;  1LPF A;  4J36 A;  4UDQ A;  2B7R A;  3CNS A;  3ZDN A;  1ELI A;  3AE8 A;  4WX1 A;  2ACZ A;  3LJP A;  1CJ3 A;  4RG3 A;  3BNU A;  2AQJ A;  2WOI A;  4NTC A;  3QVP A;  1JRY A;  2YVF A;  2GF3 A;  4J31 A;  3T37 A;  4J57 A;  4LA1 A;  3WE0 A;  1JRX A;  4ICY A;  1P2E A;  3BI2 A;  2GV8 A;  1K0L A;  1GRH A;  5IQ4 A;  1QJD A;  3LZW A;  4EM4 A;  4B68 A;  1ONF A;  4YSY A;  2YVJ A;  2APG A;  5DBJ A;  1L9D A;  1Q9I A;  1ZY8 A;  2JK6 A;  1D5T A;  4JN9 A;  3FIM B;  3FMW A;  3UKF A;  5J7X A;  1PJ5 A;  2IID A;  4H4R A;  2QA1 A;  3SFE A;  1ZDL A;  3QSS A;  4BK1 A;  4EMI A;  2WU5 A;  4TM3 A;  3AE2 A;  3AED A;  4XWR A;  5C3J A;  2BA9 A;  1CL0 A;  4Z2R A;  5FS8 A;  3K7T A;  2A8X A;  4CY8 A;  3D1C A;  3JSK A;  2JKC A;  5J60 A;  3DME A;  3H8I A;  1N4U A;  1PBD A;  3GD4 A;  4JNA A;  1COY A;  3AEA A;  2HQM A;  1O5W A;  3QSM A;  3NN0 X;  3AE3 A;  3SQP A;  2QAE A;  3CNP A;  1FL2 A;  3ALJ A;  3BHF A; 
#chains in the Genus database with same CATH topology
 1H6V A;  2BAC A;  3Q6J A;  4I58 A;  4AP3 A;  1H82 A;  1H84 A;  3VR8 A;  3EF6 A;  2C7G A;  4IVO B;  4EQR A;  2WPF A;  1ZK7 A;  3LXD A;  4KPR A;  4H2R A;  1L0V A;  4C3X A;  4YKG A;  2ZZ0 A;  4GCM A;  3GMC A;  4APN A;  3CNT A;  1K0I A;  2C76 A;  2GEW A;  2RAB A;  4A6N B;  2Z5Y A;  4G74 A;  1DNC A;  1N4V A;  2X8G A;  1LV0 A;  2YLT A;  3I6D A;  4Z44 A;  2YQU A;  3NHO X;  5LV9 A;  3AWI A;  3KPF A;  1TDN A;  2X8C A;  1JRZ A;  4AT0 A;  4AT2 A;  2UZZ A;  4G6H A;  2GRT A;  4LU6 A;  2EQ7 A;  3UTH A;  4O5Q A;  2R46 A;  3G5Q A;  2GR2 A;  4K8D A;  3VQR A;  2VOU A;  1CF3 A;  2YLW A;  5EOW A;  5FS6 A;  2OA1 A;  2XCG A;  2X99 A;  3CTY A;  4C5O A;  4CNJ A;  2PHH A;  2JBV A;  3AEF A;  2A87 A;  3RP6 A;  3G5R A;  2XFO A;  4U8M A;  3UP4 A;  4U8P A;  1REO A;  4OPD A;  3K30 A;  1OJT A;  3RHA A;  3CN8 A;  3GYX A;  4NZH A;  1LTX R;  5KVI A;  3GDP A;  2CDU A;  4YT0 A;  2H88 A;  1F8S A;  4Z43 A;  3V76 A;  2R4E A;  3F8P A;  3NTD A;  1NHR A;  4X9M A;  1GRA A;  1TYP A;  3QSE A;  5U63 A;  2WS3 A;  4B69 A;  4I59 A;  1OJA A;  4H4S A;  3ATQ A;  4B63 A;  4EMJ A;  1JU2 A;  3I3L A;  1IUW A;  1VG0 A;  1LQU A;  4REK A;  2X3N A;  2WES A;  3NK1 X;  4ADW A;  4J2W A;  3ICT A;  3SZC A;  3UCL A;  2GVC A;  3P4P A;  4C74 A;  4YTM A;  2QA2 A;  1FCD A;  4K5S A;  2TMD A;  4OCG A;  5IQ1 A;  3KD9 A;  4K7Z A;  3T0K A;  3UOV A;  3DK8 A;  3AEB A;  3M13 A;  3QVR A;  4H2P A;  3IHM A;  3VRB A;  2B9W A;  5GRT A;  2EQ8 A;  1CC2 A;  5JCL A;  1F6M A;  3QJ4 A;  1H7W A;  2W0H A;  3ABV A;  2WBA A;  4BV6 A;  3NGC X;  4YTN A;  2YR4 A;  1GRB A;  3HYX A;  4NEV A;  4NTE A;  4DNA A;  4EM3 A;  4JNQ A;  4H4W A;  1PXA A;  2WDQ A;  3AEG A;  4AOS A;  2YG3 A;  3SYI A;  4Z25 A;  1PS9 A;  4U8L A;  1Y56 B;  3PVC A;  3UP5 A;  3DJD A;  3UTG A;  3K7M X;  3UKQ A;  1ZMD A;  3EAN A;  4M52 A;  2GB0 A;  1GND A;  1GET A;  4BK2 A;  1JEH A;  3AE6 A;  4NNJ A;  3RP8 A;  2XLR A;  4Y4N A;  2H89 A;  4GAP A;  2XLS A;  2C3C A;  2YG4 A;  3L8K A;  4A5L A;  1ZOV A;  2Q0L A;  3VRD B;  3QFB A;  4OPU A;  2VVL G;  2BXR A;  4GUV A;  5HY5 A;  3UKL A;  2IVD A;  3AD8 B;  5HHF A;  2X8H A;  1X31 B;  3NKS A;  5KOX A;  3C4N A;  1BWC A;  1H83 A;  1NG3 A;  2BC0 A;  4U8I A;  2R0G A;  3KA7 A;  1TDK A;  2GR0 A;  3DK9 A;  3DA1 A;  1N4W A;  2BXS A;  4IVM B;  1O94 A;  2RGJ A;  4U2L A;  3F8D A;  1EL8 A;  1Z6L A;  2Y6Q A;  2GR3 A;  4UDR A;  2YLS A;  4H4U A;  3ADA B;  1O95 A;  2VVM A;  3CPJ G;  3Q9T A;  4B67 A;  2WP9 A;  4GRT A;  1E7P A;  3NYC A;  3VRA A;  3P4R A;  1KDG A;  1KNP A;  3RED A;  4U2S A;  3ZYX A;  2XLU A;  4AP1 A;  3CGD A;  3UKA A;  2FJB A;  3FBS A;  1NDA A;  1VQW A;  2GAH B;  4UP3 A;  3NT6 A;  4H4X A;  3CPH G;  2YAU A;  2YVG A;  4K5R A;  4A6N A;  2F5Z A;  1V59 A;  1NAA A;  1RP0 A;  2IVE A;  2BC1 A;  3H8L A;  4H4V A;  3SZW A;  3URH A;  3AE5 A;  2BCG G;  4H2N A;  3NIX A;  5IPY A;  5TR3 A;  4C3Y A;  2AAQ A;  1CJC A;  5FS9 A;  2V3B A;  1NHQ A;  1JOA A;  4H4P A;  2YM2 A;  4U8K A;  3GWD A;  4J56 A;  4BJY A;  1GPE A;  4DSG A;  2FJD A;  2VQB A;  1L9E A;  5KMS A;  4EQW A;  4E0V A;  1OJC A;  3CGB A;  3COX A;  1L9C A;  1P2H A;  1E39 A;  1KFY A;  1QLB A;  4H2Q A;  1EL7 A;  2WQY A;  2Q0K A;  4P9S A;  4CBQ A;  4RG4 A;  1KSU A;  5ER0 A;  4Z24 A;  5HYM A;  2DKH A;  4OVI A;  1PXB A;  1LQT A;  2OAM A;  4WCT A;  3SM8 A;  1MOK A;  2OLO A;  1TRB A;  1GSN A;  2V3A A;  1D4D A;  4DGK A;  4FK1 C;  2YR5 A;  3KVE A;  3KPK A;  1PDH A;  4AOX A;  4B64 A;  1XHC A;  1IUU A;  1ZX9 A;  2V5Z A;  1QO8 A;  3LOV A;  2NVK X;  2GQF A;  2JAE A;  4JY3 A;  2CFY A;  2VRL A;  2XVH A;  2XVI A;  1GRT A;  4YSH A;  1EL5 A;  2WET A;  3LAD A;  5JCK A;  4OPT A;  2WDR A;  2YR6 A;  1E1N A;  2WDV A;  2ZZC A;  3BI5 A;  3M12 A;  5U25 A;  2C70 A;  3ALM A;  3DH9 A;  3FPZ A;  1IUX A;  1HYU A;  1VG9 A;  3CND A;  2GR1 A;  4TM1 A;  4U8O A;  1CJ2 A;  1PBB A;  2BYB A;  3GMB A;  2WEU A;  1TDE A;  4Z2U A;  5L46 A;  2B9X A;  3PO7 A;  1YQ3 A;  4C77 A;  5JCM A;  2YG5 A;  3NYE A;  1B5Q A;  3RNM A;  1GRF A;  5EB4 A;  3UTE A;  3CMM A;  1IUS A;  1GT8 A;  2AR8 A;  2YWL A;  1IUV A;  1B4V A;  1K4Q A;  3AYI A;  3O0H A;  5KMQ A;  1PN0 A;  4YSX A;  3PS9 A;  5KMR A;  3T2Y A;  4G6G A;  1VDC A;  5GSN A;  4O5U A;  4GDP A;  4J34 A;  1JNZ A;  3GRT A;  1VRQ B;  1K0J A;  1NHP A;  3K7Q X;  5KVH A;  4U8N A;  3GSI A;  4GR1 A;  5KWF A;  1TDO A;  3AE9 A;  3VR9 A;  5KMP A;  2C72 A;  3KU9 A;  1Y56 A;  4D03 A;  3L1R A;  3UKK A;  1E1M A;  3ICR A;  2Q6U A;  2A89 A;  1PHH A;  3NLC A;  1GRE A;  1Q1R A;  3ICS A;  4IA6 A;  1F8R A;  1DXL A;  4A65 A;  3HZL A;  1Q1W A;  3E1T A;  4NTD A;  4TLZ A;  2XYO A;  1LVL A;  2BS2 A;  2GQW A;  1GRG A;  2PYX A;  2WPE A;  2C4C A;  3H4K A;  3NRN A;  2OAL A;  1GEU A;  3NNE A;  2V61 A;  1IUT A;  1PXC A;  1EL9 A;  2B9Y A;  2I0Z A;  4NEW A;  4ZCC A;  5CKU A;  2R0P A;  2BK3 A;  2WOV A;  4IA5 A;  4USQ A;  1TYT A;  1W4X A;  1FEA A;  2B7S A;  1M64 A;  3T2K A;  2E4G A;  3D8X A;  1ZMC A;  4OPC A;  2JB3 A;  2O9Z A;  4JDR A;  1GAL A;  2J3N A;  2BCP A;  2R4J A;  3ITJ A;  1BZL A;  3ISH A;  3S61 A;  1OJD A;  4YSZ A;  2C67 A;  3NYF A;  4KX6 A;  4USR A;  1GV4 A;  4TM0 A;  4UDP A;  3CNJ A;  1GTE A;  4Z2T A;  2VZ2 A;  4BUR A;  3GWF A;  1ZKQ A;  3CPI G;  1H81 A;  2CVJ A;  1D4E A;  2QCU A;  2E1M A;  1N1P A;  3GYJ A;  4H4T A;  4A79 A;  2E5V A;  4CCQ A;  4YTP A;  2CUL A;  2ZZB A;  4H50 A;  2FJA A;  2XLP A;  2C73 A;  3SFD A;  1D4C A;  2GMJ A;  3UKP A;  2C75 A;  5KXJ A;  3HYV A;  3LZX A;  3SGL A;  5KNL A;  2XFN A;  2YM1 A;  3AE1 A;  1FEC A;  2GH5 A;  1S2Y A;  4XXG A;  1CJ4 A;  1GXF A;  5EBK A;  3UOZ A;  1GES A;  3EPT A;  4CNK A;  1CHU A;  4OPG A;  3P9U A;  1PJ7 A;  5FS7 A;  4B65 A;  5BRT A;  5JCI A;  1NEN A;  3BHK A;  1GER A;  1DJQ A;  4Y4L A;  1BGN A;  3AE4 A;  3G5S A;  3NK2 X;  3AE7 A;  2WP5 A;  4CY6 A;  5U1O A;  1XPQ A;  2R9Z A;  1MO9 A;  1D7L A;  5KOW A;  1CBO A;  4YKF A;  5BUL A;  4MJW A;  4HA6 A;  2WU2 A;  3B3R A;  2XVJ A;  2VRM A;  1GOS A;  3M0O A;  3GYI A;  1Y0P A;  1B37 A;  3HYW A;  2TPR A;  1UKV G;  2BK5 A;  3T2Z A;  2WHD A;  2RGO A;  2Y6R A;  3C96 A;  1IJH A;  3AEC A;  3R9U A;  1D7Y A;  4EIQ A;  3NN6 X;  3NTA A;  2NPX A;  4GAV A;  1LJ1 A;  2ZBW A;  1PBC A;  4PAB A;  1ZP0 A;  2YLX A;  1KSS A;  3KKJ A;  1YQZ A;  1DOD A;  1PJ6 A;  4H4Y A;  5M0Z A;  2XFQ A;  1MXT A;  5BVA A;  2YG6 A;  2XFP A;  3CGE A;  4NWZ A;  5HXI A;  1S2Q A;  3AYL A;  1KF6 A;  1YY5 A;  4A7A A;  2WPC A;  3II4 A;  3F8R A;  5CQF A;  2XLT A;  2XDO A;  2EQ9 A;  3DJE A;  2XVF A;  3GDN A;  4FX9 A;  2ARD A;  2BS4 A;  3V3N A;  4H4Z A;  3SY4 A;  2BAB A;  3LB8 A;  4HB9 A;  4A9W A;  1CC6 A;  4YWO A;  4TLX A;  1CC4 A;  2FBW A;  4EMW A;  4DSH A;  3IC9 A;  1BGJ A;  3ATR A;  2Q7V A;  3KLJ A;  4B66 A;  3IWA A;  3DJG X;  1GTH A;  2R0C A;  3S5W A;  1RSG A;  1E1L A;  3P4S A;  1E1K A;  4K22 A;  4GF7 A;  4EQS A;  2FJE A;  4B1B A;  2C66 A;  1F8W A;  4Z26 A;  4H4Q A;  2DKI A;  5EB5 A;  4FK1 A;  1S3E A;  1RYI A;  4H7U A;  2WP6 A;  1F3P A;  2C3D A;  1YQ4 A;  2BRY A;  3AYJ A;  1NPX A;  2RGH A;  3C4A A;  3GD3 A;  4IV9 A;  3SXI A;  2YLR A;  1YKJ A;  3AD9 B;  3OZ2 A;  3GRS A;  4D04 A;  2WOW A;  3P4Q A;  3SZF A;  3UOY A;  2GMH A;  2R45 A;  4G9K A;  3NK0 X;  3UTF A;  2GAG B;  4EIP A;  2C65 A;  1NHS A;  4TM4 A;  3UKH A;  1BF3 A;  1XAN A;  4BJZ A;  1ZOY A;  3T31 A;  1AOG A;  4U2T A;  3CIR A;  4U8J A;  3IHG A;  2YLZ A;  3BI4 A;  4YXD A;  1DOB A;  4XWZ A;  2V6O A;  1KNR A;  1DJN A;  1NEK A;  1XDI A;  4GDE A;  3B6D A;  2OLN A;  4X9N A;  4CCR A;  3SZ0 A;  3V3O A;  2BS3 A;  4LII A;  3NH3 X;  2YG7 A;  3DK4 A;  4A99 A;  3AD7 B;  2V60 A;  1E6E A;  3BNM A;  1B8S A;  4Y4M A;  1M6I A;  4ZCD A;  1PBE A;  4K2X A;  4II3 A;  3ALL A;  3QFA A;  5BUK A;  3DGH A;  4ECH A;  2EQ6 A;  3CGC A;  2B76 A;  2JB2 A;  3P1W A;  1FOH A;  3DGZ A;  4JY2 A;  3IF9 A;  4CRT A;  1BKW A;  5JCN A;  5KRQ A;  4G73 A;  2X50 A;  1EBD A;  2Z5X A;  1NG4 A;  2VVL A;  2JB1 A;  3AB1 A;  5M10 A;  4II2 A;  3OC4 A;  3AEE A;  1SEZ A;  2BK4 A;  4BK3 A;  3EAO A;  1TDF A;  1H86 A;  3FG2 P;  4X4J A;  4EQX A;  3NG7 X;  1S3B A;  3DJJ A;  1H7X A;  4PAA A;  1DOC A;  1JNR A;  4RSL A;  4ZN0 A;  2VQ7 A;  4FDC B;  1DOE A;  2XFU A;  3AXB A;  2XVE A;  4JQ9 A;  3UOX A;  4OPI A;  4J33 A;  2C64 A;  3RP7 A;  1OJ9 A;  4OPL A;  5C2T A;  1PBF A;  5FMH A;  4N9X A;  1FEB A;  1LPF A;  4J36 A;  4UDQ A;  2BRA A;  2B7R A;  3CNS A;  3ZDN A;  1ELI A;  3AE8 A;  4WX1 A;  2ACZ A;  3LJP A;  1CJ3 A;  4RG3 A;  3BNU A;  2AQJ A;  3T14 A;  2WOI A;  4NTC A;  3QVP A;  1JRY A;  2YVF A;  2GF3 A;  4J31 A;  3T37 A;  4J57 A;  4LA1 A;  3WE0 A;  1JRX A;  4ICY A;  1P2E A;  3BI2 A;  2GV8 A;  1K0L A;  1GRH A;  5IQ4 A;  1QJD A;  3LZW A;  4EM4 A;  4B68 A;  1ONF A;  3SX6 A;  4YSY A;  2YVJ A;  2APG A;  5DBJ A;  1L9D A;  1Q9I A;  1ZY8 A;  2JK6 A;  1D5T A;  4JN9 A;  3FIM B;  3FMW A;  3UKF A;  5J7X A;  1PJ5 A;  2IID A;  4H4R A;  2QA1 A;  3SFE A;  1ZDL A;  3QSS A;  4BK1 A;  4EMI A;  2WU5 A;  4TM3 A;  3AE2 A;  3AED A;  4XWR A;  5C3J A;  2BA9 A;  1CL0 A;  4Z2R A;  5FS8 A;  3K7T A;  2A8X A;  4CY8 A;  3D1C A;  3JSK A;  2JKC A;  5J60 A;  3DME A;  3H8I A;  1N4U A;  1PBD A;  3GD4 A;  4JNA A;  1COY A;  3AEA A;  2HQM A;  1O5W A;  3QSM A;  3NN0 X;  3AE3 A;  3SQP A;  2QAE A;  3CNP A;  1FL2 A;  3ALJ A;  3BHF A; 
#chains in the Genus database with same CATH homology
 1H6V A;  2BAC A;  3Q6J A;  4I58 A;  4AP3 A;  1H82 A;  1H84 A;  3VR8 A;  3EF6 A;  2C7G A;  4IVO B;  4EQR A;  2WPF A;  1ZK7 A;  3LXD A;  4KPR A;  4H2R A;  1L0V A;  4C3X A;  4YKG A;  2ZZ0 A;  4GCM A;  3GMC A;  4APN A;  3CNT A;  1K0I A;  2C76 A;  2GEW A;  2RAB A;  4A6N B;  2Z5Y A;  4G74 A;  1DNC A;  1N4V A;  2X8G A;  1LV0 A;  2YLT A;  3I6D A;  4Z44 A;  2YQU A;  3NHO X;  5LV9 A;  3AWI A;  3KPF A;  1TDN A;  2X8C A;  1JRZ A;  4AT0 A;  4AT2 A;  2UZZ A;  4G6H A;  2GRT A;  4LU6 A;  2EQ7 A;  3UTH A;  4O5Q A;  2R46 A;  3G5Q A;  2GR2 A;  4K8D A;  3VQR A;  2VOU A;  1CF3 A;  2YLW A;  5EOW A;  5FS6 A;  2OA1 A;  2XCG A;  2X99 A;  3CTY A;  4C5O A;  4CNJ A;  2PHH A;  2JBV A;  3AEF A;  2A87 A;  3RP6 A;  3G5R A;  2XFO A;  4U8M A;  3UP4 A;  4U8P A;  1REO A;  4OPD A;  3K30 A;  1OJT A;  3RHA A;  3CN8 A;  3GYX A;  4NZH A;  1LTX R;  5KVI A;  3GDP A;  2CDU A;  4YT0 A;  2H88 A;  1F8S A;  4Z43 A;  3V76 A;  2R4E A;  3F8P A;  3NTD A;  1NHR A;  4X9M A;  1GRA A;  1TYP A;  3QSE A;  5U63 A;  2WS3 A;  4B69 A;  4I59 A;  1OJA A;  4H4S A;  3ATQ A;  4B63 A;  4EMJ A;  1JU2 A;  3I3L A;  1IUW A;  1VG0 A;  1LQU A;  4REK A;  2X3N A;  2WES A;  3NK1 X;  4ADW A;  4J2W A;  3ICT A;  3SZC A;  3UCL A;  2GVC A;  3P4P A;  4C74 A;  4YTM A;  2QA2 A;  1FCD A;  4K5S A;  2TMD A;  4OCG A;  5IQ1 A;  3KD9 A;  4K7Z A;  3T0K A;  3UOV A;  3DK8 A;  3AEB A;  3M13 A;  3QVR A;  4H2P A;  3IHM A;  3VRB A;  2B9W A;  5GRT A;  2EQ8 A;  1CC2 A;  5JCL A;  1F6M A;  3QJ4 A;  1H7W A;  2W0H A;  3ABV A;  2WBA A;  4BV6 A;  3NGC X;  4YTN A;  2YR4 A;  1GRB A;  3HYX A;  4NEV A;  4NTE A;  4DNA A;  4EM3 A;  4JNQ A;  4H4W A;  1PXA A;  2WDQ A;  3AEG A;  4AOS A;  2YG3 A;  3SYI A;  4Z25 A;  1PS9 A;  4U8L A;  1Y56 B;  3PVC A;  3UP5 A;  3DJD A;  3UTG A;  3K7M X;  3UKQ A;  1ZMD A;  3EAN A;  4M52 A;  2GB0 A;  1GND A;  1GET A;  4BK2 A;  1JEH A;  3AE6 A;  4NNJ A;  3RP8 A;  2XLR A;  4Y4N A;  2H89 A;  4GAP A;  2XLS A;  2C3C A;  2YG4 A;  3L8K A;  4A5L A;  1ZOV A;  2Q0L A;  3VRD B;  3QFB A;  4OPU A;  2VVL G;  2BXR A;  4GUV A;  5HY5 A;  3UKL A;  2IVD A;  3AD8 B;  5HHF A;  2X8H A;  1X31 B;  3NKS A;  5KOX A;  3C4N A;  1BWC A;  1H83 A;  1NG3 A;  2BC0 A;  4U8I A;  2R0G A;  3KA7 A;  1TDK A;  2GR0 A;  3DK9 A;  3DA1 A;  1N4W A;  2BXS A;  4IVM B;  1O94 A;  2RGJ A;  4U2L A;  3F8D A;  1EL8 A;  1Z6L A;  2Y6Q A;  2GR3 A;  4UDR A;  2YLS A;  4H4U A;  3ADA B;  1O95 A;  2VVM A;  3CPJ G;  3Q9T A;  4B67 A;  2WP9 A;  4GRT A;  1E7P A;  3NYC A;  3VRA A;  3P4R A;  1KDG A;  1KNP A;  3RED A;  4U2S A;  3ZYX A;  2XLU A;  4AP1 A;  3CGD A;  3UKA A;  2FJB A;  3FBS A;  1NDA A;  1VQW A;  2GAH B;  4UP3 A;  3NT6 A;  4H4X A;  3CPH G;  2YAU A;  2YVG A;  4K5R A;  4A6N A;  2F5Z A;  1V59 A;  1NAA A;  1RP0 A;  2IVE A;  2BC1 A;  3H8L A;  4H4V A;  3SZW A;  3URH A;  3AE5 A;  2BCG G;  4H2N A;  3NIX A;  5IPY A;  5TR3 A;  4C3Y A;  2AAQ A;  1CJC A;  5FS9 A;  2V3B A;  1NHQ A;  1JOA A;  4H4P A;  2YM2 A;  4U8K A;  3GWD A;  4J56 A;  4BJY A;  1GPE A;  4DSG A;  2FJD A;  2VQB A;  1L9E A;  5KMS A;  4EQW A;  4E0V A;  1OJC A;  3CGB A;  3COX A;  1L9C A;  1P2H A;  1E39 A;  1KFY A;  1QLB A;  4H2Q A;  1EL7 A;  2WQY A;  2Q0K A;  4P9S A;  4CBQ A;  4RG4 A;  1KSU A;  5ER0 A;  4Z24 A;  5HYM A;  2DKH A;  4OVI A;  1PXB A;  1LQT A;  2OAM A;  4WCT A;  3SM8 A;  1MOK A;  2OLO A;  1TRB A;  1GSN A;  2V3A A;  1D4D A;  4DGK A;  4FK1 C;  2YR5 A;  3KVE A;  3KPK A;  1PDH A;  4AOX A;  4B64 A;  1XHC A;  1IUU A;  1ZX9 A;  2V5Z A;  1QO8 A;  3LOV A;  2NVK X;  2GQF A;  2JAE A;  4JY3 A;  2CFY A;  2VRL A;  2XVH A;  2XVI A;  1GRT A;  4YSH A;  1EL5 A;  2WET A;  3LAD A;  5JCK A;  4OPT A;  2WDR A;  2YR6 A;  1E1N A;  2WDV A;  2ZZC A;  3BI5 A;  3M12 A;  5U25 A;  2C70 A;  3ALM A;  3DH9 A;  3FPZ A;  1IUX A;  1HYU A;  1VG9 A;  3CND A;  2GR1 A;  4TM1 A;  4U8O A;  1CJ2 A;  1PBB A;  2BYB A;  3GMB A;  2WEU A;  1TDE A;  4Z2U A;  5L46 A;  2B9X A;  3PO7 A;  1YQ3 A;  4C77 A;  5JCM A;  2YG5 A;  3NYE A;  1B5Q A;  3RNM A;  1GRF A;  5EB4 A;  3UTE A;  3CMM A;  1IUS A;  1GT8 A;  2AR8 A;  2YWL A;  1IUV A;  1B4V A;  1K4Q A;  3AYI A;  3O0H A;  5KMQ A;  1PN0 A;  4YSX A;  3PS9 A;  5KMR A;  3T2Y A;  4G6G A;  1VDC A;  5GSN A;  4O5U A;  4GDP A;  4J34 A;  1JNZ A;  3GRT A;  1VRQ B;  1K0J A;  1NHP A;  3K7Q X;  5KVH A;  4U8N A;  3GSI A;  4GR1 A;  5KWF A;  1TDO A;  3AE9 A;  3VR9 A;  5KMP A;  2C72 A;  3KU9 A;  1Y56 A;  4D03 A;  3L1R A;  3UKK A;  1E1M A;  3ICR A;  2Q6U A;  2A89 A;  1PHH A;  3NLC A;  1GRE A;  1Q1R A;  3ICS A;  4IA6 A;  1F8R A;  1DXL A;  4A65 A;  3HZL A;  1Q1W A;  3E1T A;  4NTD A;  4TLZ A;  2XYO A;  1LVL A;  2BS2 A;  2GQW A;  1GRG A;  2PYX A;  2WPE A;  2C4C A;  3H4K A;  3NRN A;  2OAL A;  1GEU A;  3NNE A;  2V61 A;  1IUT A;  1PXC A;  1EL9 A;  2B9Y A;  2I0Z A;  4NEW A;  4ZCC A;  5CKU A;  2R0P A;  2BK3 A;  2WOV A;  4IA5 A;  4USQ A;  1TYT A;  1W4X A;  1FEA A;  2B7S A;  1M64 A;  3T2K A;  2E4G A;  3D8X A;  1ZMC A;  4OPC A;  2JB3 A;  2O9Z A;  4JDR A;  1GAL A;  2J3N A;  2BCP A;  2R4J A;  3ITJ A;  1BZL A;  3ISH A;  3S61 A;  1OJD A;  4YSZ A;  2C67 A;  3NYF A;  4KX6 A;  4USR A;  1GV4 A;  4TM0 A;  4UDP A;  3CNJ A;  1GTE A;  4Z2T A;  2VZ2 A;  4BUR A;  3GWF A;  1ZKQ A;  3CPI G;  1H81 A;  2CVJ A;  1D4E A;  2QCU A;  2E1M A;  1N1P A;  3GYJ A;  4H4T A;  4A79 A;  2E5V A;  4CCQ A;  4YTP A;  2CUL A;  2ZZB A;  4H50 A;  2FJA A;  2XLP A;  2C73 A;  3SFD A;  1D4C A;  2GMJ A;  3UKP A;  2C75 A;  5KXJ A;  3HYV A;  3LZX A;  3SGL A;  5KNL A;  2XFN A;  2YM1 A;  3AE1 A;  1FEC A;  2GH5 A;  1S2Y A;  4XXG A;  1CJ4 A;  1GXF A;  5EBK A;  3UOZ A;  1GES A;  3EPT A;  4CNK A;  1CHU A;  4OPG A;  3P9U A;  1PJ7 A;  5FS7 A;  4B65 A;  5BRT A;  5JCI A;  1NEN A;  3BHK A;  1GER A;  1DJQ A;  4Y4L A;  1BGN A;  3AE4 A;  3G5S A;  3NK2 X;  3AE7 A;  2WP5 A;  4CY6 A;  5U1O A;  1XPQ A;  2R9Z A;  1MO9 A;  1D7L A;  5KOW A;  1CBO A;  4YKF A;  5BUL A;  4MJW A;  4HA6 A;  2WU2 A;  3B3R A;  2XVJ A;  2VRM A;  1GOS A;  3M0O A;  3GYI A;  1Y0P A;  1B37 A;  3HYW A;  2TPR A;  1UKV G;  2BK5 A;  3T2Z A;  2WHD A;  2RGO A;  2Y6R A;  3C96 A;  1IJH A;  3AEC A;  3R9U A;  1D7Y A;  4EIQ A;  3NN6 X;  3NTA A;  2NPX A;  4GAV A;  1LJ1 A;  2ZBW A;  1PBC A;  4PAB A;  1ZP0 A;  2YLX A;  1KSS A;  3KKJ A;  1YQZ A;  1DOD A;  1PJ6 A;  4H4Y A;  5M0Z A;  2XFQ A;  1MXT A;  5BVA A;  2YG6 A;  2XFP A;  3CGE A;  4NWZ A;  5HXI A;  1S2Q A;  3AYL A;  1KF6 A;  1YY5 A;  4A7A A;  2WPC A;  3II4 A;  3F8R A;  5CQF A;  2XLT A;  2XDO A;  2EQ9 A;  3DJE A;  2XVF A;  3GDN A;  4FX9 A;  2ARD A;  2BS4 A;  3V3N A;  4H4Z A;  3SY4 A;  2BAB A;  3LB8 A;  4HB9 A;  4A9W A;  1CC6 A;  4YWO A;  4TLX A;  1CC4 A;  2FBW A;  4EMW A;  4DSH A;  3IC9 A;  1BGJ A;  3ATR A;  2Q7V A;  3KLJ A;  4B66 A;  3IWA A;  3DJG X;  1GTH A;  2R0C A;  3S5W A;  1RSG A;  1E1L A;  3P4S A;  1E1K A;  4K22 A;  4GF7 A;  4EQS A;  2FJE A;  4B1B A;  2C66 A;  1F8W A;  4Z26 A;  4H4Q A;  2DKI A;  5EB5 A;  4FK1 A;  1S3E A;  1RYI A;  4H7U A;  2WP6 A;  1F3P A;  2C3D A;  1YQ4 A;  2BRY A;  3AYJ A;  1NPX A;  2RGH A;  3C4A A;  3GD3 A;  4IV9 A;  3SXI A;  2YLR A;  1YKJ A;  3AD9 B;  3OZ2 A;  3GRS A;  4D04 A;  2WOW A;  3P4Q A;  3SZF A;  3UOY A;  2GMH A;  2R45 A;  4G9K A;  3NK0 X;  3UTF A;  2GAG B;  4EIP A;  2C65 A;  1NHS A;  4TM4 A;  3UKH A;  1BF3 A;  1XAN A;  4BJZ A;  1ZOY A;  3T31 A;  1AOG A;  4U2T A;  3CIR A;  4U8J A;  3IHG A;  2YLZ A;  3BI4 A;  4YXD A;  1DOB A;  4XWZ A;  2V6O A;  1KNR A;  1DJN A;  1NEK A;  1XDI A;  4GDE A;  3B6D A;  2OLN A;  4X9N A;  4CCR A;  3SZ0 A;  3V3O A;  2BS3 A;  4LII A;  3NH3 X;  2YG7 A;  3DK4 A;  4A99 A;  3AD7 B;  2V60 A;  1E6E A;  3BNM A;  1B8S A;  4Y4M A;  1M6I A;  4ZCD A;  1PBE A;  4K2X A;  4II3 A;  3ALL A;  3QFA A;  5BUK A;  3DGH A;  4ECH A;  2EQ6 A;  3CGC A;  2B76 A;  2JB2 A;  3P1W A;  1FOH A;  3DGZ A;  4JY2 A;  3IF9 A;  4CRT A;  1BKW A;  5JCN A;  5KRQ A;  4G73 A;  2X50 A;  1EBD A;  2Z5X A;  1NG4 A;  2VVL A;  2JB1 A;  3AB1 A;  5M10 A;  4II2 A;  3OC4 A;  3AEE A;  1SEZ A;  2BK4 A;  4BK3 A;  3EAO A;  1TDF A;  1H86 A;  3FG2 P;  4X4J A;  4EQX A;  3NG7 X;  1S3B A;  3DJJ A;  1H7X A;  4PAA A;  1DOC A;  1JNR A;  4RSL A;  4ZN0 A;  2VQ7 A;  4FDC B;  1DOE A;  2XFU A;  3AXB A;  2XVE A;  4JQ9 A;  3UOX A;  4OPI A;  4J33 A;  2C64 A;  3RP7 A;  1OJ9 A;  4OPL A;  5C2T A;  1PBF A;  5FMH A;  4N9X A;  1FEB A;  1LPF A;  4J36 A;  4UDQ A;  2BRA A;  2B7R A;  3CNS A;  3ZDN A;  1ELI A;  3AE8 A;  4WX1 A;  2ACZ A;  3LJP A;  1CJ3 A;  4RG3 A;  3BNU A;  2AQJ A;  3T14 A;  2WOI A;  4NTC A;  3QVP A;  1JRY A;  2YVF A;  2GF3 A;  4J31 A;  3T37 A;  4J57 A;  4LA1 A;  3WE0 A;  1JRX A;  4ICY A;  1P2E A;  3BI2 A;  2GV8 A;  1K0L A;  1GRH A;  5IQ4 A;  1QJD A;  3LZW A;  4EM4 A;  4B68 A;  1ONF A;  3SX6 A;  4YSY A;  2YVJ A;  2APG A;  5DBJ A;  1L9D A;  1Q9I A;  1ZY8 A;  2JK6 A;  1D5T A;  4JN9 A;  3FIM B;  3FMW A;  3UKF A;  5J7X A;  1PJ5 A;  2IID A;  4H4R A;  2QA1 A;  3SFE A;  1ZDL A;  3QSS A;  4BK1 A;  4EMI A;  2WU5 A;  4TM3 A;  3AE2 A;  3AED A;  4XWR A;  5C3J A;  2BA9 A;  1CL0 A;  4Z2R A;  5FS8 A;  3K7T A;  2A8X A;  4CY8 A;  3D1C A;  3JSK A;  2JKC A;  5J60 A;  3DME A;  3H8I A;  1N4U A;  1PBD A;  3GD4 A;  4JNA A;  1COY A;  3AEA A;  2HQM A;  1O5W A;  3QSM A;  3NN0 X;  3AE3 A;  3SQP A;  2QAE A;  3CNP A;  1FL2 A;  3ALJ A;  3BHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...