3ISHA

Crystal structure of helicobacter pylori thioredoxin reductase
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
311
structure length
311
Chain Sequence
b'MIDCAIIGGGPAGLSAGLYATRGGVKNAVLFEKGMPGGQITGSSEIENYPGVKEVVSGLDFMQPWQEQCFRFGLKHEMTAVQRVSKKDSHFVILAEDGKTFEAKSVIIATGGSPKRTGIKGESEYWGKGVSTCATCDGFFYKNKEVAVLGGGDTAVEEAIYLANICKKVYLIHRRDGFRCAPITLEHAKNNDKIEFLTPYVVEEIKGDASGVSSLSIKNTATNEKRELVVPGFFIFVGYDVNNAVLKQEDNSMLCKCDEYGSIVVDFSMKTNVQGLFAAGDIRIFAPKQVVCAASDGATAALSVISYLEHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Crystal structure of Helicobacter pylori thioredoxin reductase
rcsb
source organism Helicobacter pylori
molecule tags Oxidoreductase
total genus 88
structure length 311
sequence length 311
chains with identical sequence B, C
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2009-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ishA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ishA02
1GRHA 5C3JA 1NG4A 3AEFA 4H2NA 3VQRA 3KA7A 1D7LA 4U8JA 1K0JA 2A89A 4UP3A 2WBAA 3HZLA 4H4QA 3AE2A 2XFQA 5JCIA 1S2QA 3V3OA 3I6DA 4OPIA 2YG6A 5KXJA 5U25A 1BWCA 2C7GA 2X3NA 4N9XA 4CNJA 3GD4A 3UKHA 4Z2TA 3AEAA 4BK2A 3M0OA 2GR1A 2XLPA 5IQ4A 1ZY8A 5KWFA 1NAAA 3G5QA 1PXAA 4B65A 2C70A 3G5SA 1NG3A 2R9ZA 2YG7A 4U8OA 5U1OA 1PBEA 4WX1A 3UTGA 4Z25A 3Q6JA 1LVLA 1PJ7A 4CY8A 4O5QA 4H7UA 4JNQA 2O9ZA 4YSZA 3KD9A 4EIQA 3DGHA 3UCLA 4TM1A 3AEGA 2RGJA 5CKUA 3RP7A 3B6DA 1NPXA 4U2TA 4FK1C 1IUXA 4EMJA 4YTPA 2X8CA 1IUUA 2RABA 3IWAA 1YY5A 4FK1A 2GQFA 3UOXA 2GEWA 2IVEA 2YR4A 2BC1A 3DJGX 4BJZA 3AYLA 3AEDA 4CY6A 1D4EA 3AE5A 4A65A 1TDKA 4H4WA 4XXGA 5HY5A 3QFAA 2A8XA 2XDOA 5J60A 4EMWA 1KFYA 1BF3A 4UDPA 3AD9B 3NIXA 1TYTA 3CNSA 2YG5A 3UKQA 1VQWA 4REKA 4J34A 1CJCA 2XVJA 4K7ZA 2WOVA 3VR8A 1P2HA 1K4QA 4BK1A 1L9DA 2AQJA 5M10A 3IF9A 3DK9A 2R0GA 2WOWA 4IV9A 3UOZA 4EIPA 2WDQA 3ADAB 3QSMA 1H82A 2I0ZA 4DSGA 2ZZ0A 1GEUA 1PN0A 4XWZA 3DH9A 5KRQA 2EQ9A 4NEVA 1DJQA 3I3LA 2EQ8A 2C64A 3GMCA 2JAEA 2BC0A 4OPGA 4A5LA 2X50A 3DMEA 4Y4MA 2TPRA 2YLXA 3S5WA 3KKJA 1Y56A 1JRYA 3NYEA 3QSEA 3BHKA 4DSHA 3ISHA 2B9WA 3AXBA 5ER0A 1XPQA 1Q1WA 4YSHA 5FS8A 4H4TA 3NH3X 2GVCA 3DA1A 2Y6RA 2C75A 2C73A 1S2YA 3AEEA 3UP4A 1PS9A 2XVEA 5TR3A 2C76A 2GR0A 3KLJA 3DJEA 2PHHA 2YVGA 4K5SA 2GB0A 3ABVA 3LB8A 2GR2A 2CFYA 2WQYA 1FOHA 2Y6QA 2YR6A 3KVEA 4RG4A 4RG3A 2YM1A 1L0VA 1QLBA 1YQZA 4U2SA 4YTNA 4ECHA 1PXCA 1CC2A 5GSNA 3FMWA 1MO9A 4P9SA 3VRDB 4A9WA 1P2EA 4D04A 4OVIA 2WETA 1GNDA 3LXDA 1RSGA 5EB4A 2XLUA 5FS7A 1E1MA 4JY3A 3CGBA 3CNPA 3VR9A 1PBDA 1BKWA 1IJHA 2JB3A 3UTEA 4C77A 4EQSA 3QJ4A 3K7MX 2ARDA 1QJDA 1D5TA 1FEAA 1N4VA 1GRTA 1VRQB 2OLOA 1E1LA 1JOAA 1BGNA 2GMHA 4ZCDA 2W0HA 3D1CA 3VRBA 2WOIA 1ZK7A 4D03A 3AEBA 2GRTA 3LADA 4I58A 4J57A 3RHAA 1EL9A 1CBOA 5M0ZA 3OZ2A 4TLXA 4CCQA 1NHRA 2BS2A 3P1WA 1OJCA 1GERA 2BCPA 2R4EA 1M6IA 2V3AA 4J31A 1IUSA 3UKAA 1GALA 2YLZA 3V3NA 3PO7A 4IVOB 1LQUA 4OCGA 1KSSA 3JSKA 4JY2A 2B76A 1GSNA 2ZZCA 1GRAA 1TDNA 2H88A 4GCMA 4Z2UA 5C2TA 4HB9A 5IPYA 3KPFA 2WDVA 4RSLA 1H86A 5U63A 4BURA 2YR5A 4K2XA 4H4ZA 3CN8A 1X31B 4U8MA 2JBVA 3II4A 2GQWA 3C96A 3NG7X 3NN6X 1DXLA 1IUTA 3DK8A 2NVKX 1DOEA 2Q0LA 1F8SA 2R45A 4TM3A 1O94A 2R0CA 3ITJA 3AB1A 4B63A 3AE4A 1CC4A 1GRFA 3UKPA 4B64A 2BYBA 1EBDA 4UDRA 1OJ9A 4Z44A 3NYCA 1GRGA 3RP6A 4ZN0A 5JCLA 1L9EA 2B9XA 1GTHA 4Y4NA 3NN0X 3IC9A 4B69A 1Q9IA 3RNMA 1GT8A 3GDNA 1GETA 1H7XA 2GF3A 3UOVA 2XVIA 3L8KA 2BS4A 3CGDA 4EM3A 1W4XA 3P4QA 1OJTA 2AR8A 1TYPA 2YWLA 4TLZA 5KVHA 3LZXA 4U8PA 2B9YA 3AE8A 4NTCA 2R4JA 1LQTA 4FX9A 4J33A 1PHHA 3P4SA 4GRTA 1JRZA 2WP5A 4WCTA 4USRA 5CQFA 2WU5A 1D4DA 4H4XA 2XYOA 4YKFA 1IUVA 4ICYA 3CNDA 1RP0A 1LPFA 1N1PA 1S3EA 2WP6A 4EQWA 2YLSA 2DKIA 5KOXA 4FDCB 1JRXA 1EL5A 1K0LA 2H89A 3CNTA 4OPCA 3CPHG 3GRSA 4TM4A 1Q1RA 2X8GA 3DJJA 4APNA 4H4UA 2V3BA 5J7XA 3GWFA 2VVLA 4NZHA 1H7WA 1E1KA 3CIRA 4C5OA 2YAUA 4IA6A 4YT0A 3NYFA 4DGKA 3COXA 2JKCA 1GESA 4H2QA 3P9UA 5LV9A 3ATRA 3BI5A 2A87A 1DOBA 2XLSA 2WDRA 4JN9A 2WS3A 4J36A 3NT6A 4PAAA 1F8RA 4AP3A 3ICRA 2B7RA 3K30A 3SM8A 5JCKA 4O5UA 3K7QX 2VQ7A 1IUWA 2XFUA 3DK4A 1ZX9A 4KPRA 1XHCA 2X99A 4OPLA 2JB2A 4TM0A 2WHDA 1O5WA 2XFOA 4OPDA 3SQPA 1KNRA 2R46A 1CJ3A 3SFEA 2WU2A 1Z6LA 3BNMA 3NHOX 4X9MA 3FBSA 2QA2A 4GDEA 4YKGA 4IA5A 1PXBA 5FS6A 1YQ3A 4CBQA 1S3BA 1ZP0A 2WPFA 2ZZBA 1F3PA 3GWDA 1JNZA 1NENA 1HYUA 1TRBA 2CVJA 3FG2P 4H2RA 1ZOYA 1H81A 2VVLG 4I59A 3M13A 4BV6A 3DGZA 2YVFA 4NEWA 4LU6A 1PBCA 5EB5A 5KVIA 4UDQA 3WE0A 1BZLA 1CL0A 1OJAA 1RYIA 2XFNA 3GYJA 3CPJG 1E1NA 4NTDA 3NKSA 4YXDA 4OPUA 2JB1A 2JK6A 2R0PA 2VRMA 3V76A 2BXSA 2E1MA 3EPTA 4H50A 1D4CA 4JNAA 4A7AA 3AE9A 5JCNA 1MOKA 1N4WA 1KDGA 3GDPA 3IHMA 1QO8A 1ELIA 1LJ1A 4U8IA 5DBJA 5L46A 2OA1A 2OLNA 2GAHB 4M52A 1M64A 2BK3A 2XFPA 1GREA 3ICSA 1VG9A 4LIIA 1O95A 1Y0PA 4H4PA 5EOWA 1F8WA 1PBBA 3FIMB 2VRLA 3M12A 3ALLA 2XVHA 4H4RA 1B5QA 1D7YA 3F8DA 3E1TA 1H83A 2RGHA 1ZOVA 2QCUA 1VDCA 2C66A 4H4SA 2BA9A 5IQ1A 1EL7A 2YG4A 1NHPA 3REDA 4C3XA 4Z2RA 4A79A 2BACA 1CHUA 1DNCA 1REOA 2AAQA 1TDEA 4Y4LA 2DKHA 2TMDA 1B8SA 4J2WA 2YG3A 1XANA 2WEUA 5BRTA 1TDFA 4HA6A 5FS9A 4K5RA 3VRAA 2ACZA 3QVRA 2V61A 1DODA 3D8XA 3H8LA 3NTAA 2WESA 3QVPA 3AE3A 3S61A 1JU2A 3BI4A 1CJ2A 1NHQA 2FJEA 4EMIA 2B7SA 3C4NA 3H4KA 2CULA 1UKVG 2J3NA 4U8NA 4DNAA 3F8RA 4CNKA 3GSIA 1FCDA 1F6MA 4GR1A 4K8DA 1PDHA 4AOSA 2YQUA 5FMHA 4YSYA 1K0IA 2YLTA 2C72A 3SFDA 4Z24A 2XLRA 2RGOA 1EL8A 2V6OA 2YLRA 1GPEA 4B68A 1SEZA 2VQBA 3GYIA 2BCGG 1GTEA 2OAMA 3QSSA 3NLCA 3UOYA 3ALJA 1CC6A 3ZYXA 1YKJA 2Q7VA 3H8IA 3AD7B 2BS3A 3G5RA 1LTXR 1OJDA 2X8HA 2XVFA 4YTMA 2QAEA 4GF7A 1JEHA 4PABA 4X9NA 4OPTA 1ZMDA 4CRTA 3NK2X 2C65A 4XWRA 2E4GA 3SGLA 4J56A 2E5VA 2VVMA 2XCGA 4YWOA 4GDPA 1FL2A 1NDAA 2BK4A 2VOUA 3AWIA 4GUVA 1AOGA 4Z43A 3ZDNA 3C4AA 3UTHA 2WPEA 1MXTA 1CF3A 1PJ5A 4X4JA 3KU9A 5KOWA 3AECA 1PJ6A 4A99A 1B37A 1E7PA 1B4VA 3QFBA 3IHGA 4CCRA 4BJYA 1NHSA 3BHFA 3LJPA 2Q0KA 2C3CA 1FECA 2ZBWA 5HHFA 3EAOA 3UKKA 2BK5A 2FBWA 3K7TA 1GRBA 4LA1A 5BVAA 1YQ4A 1XDIA 3O0HA 2OALA 4Z26A 5EBKA 3OC4A 3Q9TA 1COYA 2PYXA 2Z5YA 2BXRA 3T37A 1FEBA 4KX6A 1GOSA 2APGA 3L1RA 1CJ4A 4U8KA 4YSXA 4EQRA 1N4UA 1ZDLA 3AE6A 2YVJA 3GD3A 3CNJA 3LZWA 3BNUA 4EQXA 3CPIG 4NTEA 1GV4A 1KNPA 1ZMCA 5BULA 3AYIA 2YM2A 2FJAA 4B1BA 4IVMB 4AT0A 2FJDA 4B66A 1NEKA 2V60A 3NK1X 5HYMA 1BGJA 2EQ6A 1E39A 2XLTA 4C3YA 4AP1A 2IIDA 4E0VA 3B3RA 3UKFA 3CGCA 1ONFA 4ADWA 3DJDA 4A6NA 1JNRA 2Z5XA 2Q6UA 2C3DA 5GRTA 3UTFA 3NRNA 3P4PA 3RP8A 3UKLA 1ZKQA 1TDOA 3AD8B 3EF6A 2FJBA 4JQ9A 2BABA 3GRTA 2YLWA 4H4VA 4H4YA 4BK3A 3PVCA 3ICTA 3CTYA 1VG0A 4K22A 2GMJA 1DJNA 1L9CA 4C74A 1DOCA 1Y56B 4U8LA 3AYJA 2NPXA 3NNEA 2HQMA 3URHA 1PBFA 3ALMA 3NK0X 4AOXA 5HXIA 3AE1A 3P4RA 4B67A 4USQA 1KF6A 5BUKA 4ZCCA 2GV8A 4A6NB 3UP5A 4JDRA 3F8PA 2EQ7A 4MJWA 2C67A 3LOVA 5JCMA 3FPZA 3NTDA 1H6VA 2WP9A 3BI2A 2CDUA 2VZ2A 2GH5A 3NGCX 2WPCA 4AT2A 2IVDA 2GR3A 2GAGB 3PS9A 3EANA 2UZZA 4H2PA 4EM4A 2F5ZA 1LV0A 1KSUA 2QA1A 3CGEA 3ATQA 1H84A 3GMBA 3R9UA 1V59A 2V5ZA 1E6EA 1GXFA 3AE7A 4U2LA
chains in the Genus database with same CATH superfamily
1GRHA 5C3JA 1NG4A 3AEFA 4H2NA 3VQRA 3KA7A 1D7LA 4U8JA 1K0JA 2A89A 4UP3A 2WBAA 3HZLA 4H4QA 3AE2A 2XFQA 5JCIA 1S2QA 3V3OA 3I6DA 5KMQA 4OPIA 2YG6A 5KXJA 5U25A 1BWCA 2C7GA 2X3NA 4N9XA 4CNJA 3GD4A 3UKHA 4Z2TA 3AEAA 4BK2A 3M0OA 2GR1A 2XLPA 5IQ4A 1ZY8A 3SY4A 5KWFA 1NAAA 3G5QA 1PXAA 4B65A 2C70A 3G5SA 1NG3A 2R9ZA 2YG7A 4U8OA 5U1OA 1PBEA 4WX1A 3UTGA 4Z25A 3Q6JA 1LVLA 1PJ7A 4CY8A 4O5QA 4H7UA 4JNQA 2O9ZA 4YSZA 3KD9A 4EIQA 3DGHA 3UCLA 4TM1A 3AEGA 2RGJA 5CKUA 3RP7A 5KMRA 3B6DA 1NPXA 4U2TA 4FK1C 1IUXA 4EMJA 4YTPA 2X8CA 1IUUA 2RABA 3IWAA 1YY5A 4FK1A 2GQFA 3UOXA 2GEWA 2IVEA 2YR4A 2BC1A 3DJGX 4BJZA 3AYLA 3AEDA 4CY6A 1D4EA 2C4CA 3AE5A 4A65A 1TDKA 4H4WA 4XXGA 5HY5A 3QFAA 2A8XA 2XDOA 5J60A 4EMWA 1KFYA 1BF3A 4UDPA 3AD9B 3NIXA 1TYTA 3CNSA 2YG5A 3UKQA 1VQWA 4REKA 4J34A 1CJCA 2XVJA 4K7ZA 2WOVA 3VR8A 1P2HA 1K4QA 4BK1A 1L9DA 2AQJA 5M10A 3IF9A 3DK9A 2BRYA 2R0GA 2WOWA 4IV9A 3UOZA 4EIPA 2WDQA 3CMMA 3ADAB 3QSMA 1H82A 2I0ZA 4DSGA 2ZZ0A 1GEUA 1PN0A 4XWZA 3DH9A 5KRQA 3GYXA 2EQ9A 4NEVA 1DJQA 3SZ0A 3I3LA 2EQ8A 2C64A 3GMCA 2JAEA 2BC0A 4OPGA 4A5LA 2X50A 3DMEA 4Y4MA 2TPRA 2YLXA 3S5WA 3KKJA 1Y56A 1JRYA 3NYEA 3QSEA 3BHKA 4DSHA 3ISHA 2B9WA 3AXBA 5ER0A 1XPQA 1Q1WA 4YSHA 5FS8A 4H4TA 3NH3X 2GVCA 3DA1A 2Y6RA 2C75A 2C73A 1S2YA 3AEEA 3UP4A 1PS9A 2XVEA 5TR3A 2C76A 2GR0A 3KLJA 3DJEA 2PHHA 2YVGA 4K5SA 2GB0A 3ABVA 3LB8A 2GR2A 2CFYA 2WQYA 1FOHA 2Y6QA 2YR6A 3KVEA 4RG4A 4RG3A 2YM1A 1L0VA 1QLBA 1YQZA 4U2SA 4YTNA 4ECHA 1PXCA 1CC2A 5GSNA 3FMWA 1MO9A 4P9SA 3VRDB 4A9WA 1P2EA 4D04A 4OVIA 2WETA 1GNDA 3LXDA 1RSGA 5EB4A 2XLUA 5FS7A 1E1MA 4JY3A 3CGBA 3SXIA 3CNPA 3VR9A 1PBDA 1BKWA 1IJHA 2JB3A 3UTEA 4C77A 4EQSA 3QJ4A 3K7MX 2ARDA 1QJDA 1D5TA 1FEAA 1N4VA 3HYXA 1GRTA 1VRQB 2OLOA 1E1LA 1JOAA 1BGNA 2GMHA 4ZCDA 2W0HA 3D1CA 3VRBA 2WOIA 1ZK7A 4D03A 3AEBA 2GRTA 3LADA 3HYVA 4I58A 4J57A 3RHAA 1EL9A 1CBOA 5M0ZA 3OZ2A 4TLXA 4CCQA 1NHRA 2BS2A 3P1WA 1OJCA 1GERA 2BCPA 2R4EA 1M6IA 2V3AA 4J31A 1IUSA 3UKAA 1GALA 2YLZA 3V3NA 3PO7A 4IVOB 1LQUA 4OCGA 1KSSA 3JSKA 4JY2A 2B76A 4II3A 1GSNA 2ZZCA 1GRAA 1TDNA 2H88A 4GCMA 4Z2UA 5C2TA 4HB9A 5IPYA 3KPFA 2WDVA 4RSLA 1H86A 5U63A 4BURA 2YR5A 4K2XA 4H4ZA 3CN8A 1X31B 3SZWA 4U8MA 2JBVA 3II4A 2GQWA 3C96A 3NG7X 3NN6X 1DXLA 1IUTA 3DK8A 2NVKX 1DOEA 2Q0LA 1F8SA 2R45A 4TM3A 1O94A 2R0CA 3ITJA 3AB1A 4B63A 3AE4A 1CC4A 1GRFA 3UKPA 4B64A 2BYBA 1EBDA 4UDRA 1OJ9A 4Z44A 3NYCA 1GRGA 3RP6A 4ZN0A 5JCLA 1L9EA 2B9XA 1GTHA 4Y4NA 3NN0X 3IC9A 3T31A 4B69A 1Q9IA 3RNMA 1GT8A 3T2KA 3GDNA 1GETA 1H7XA 2GF3A 3UOVA 2XVIA 3L8KA 3SX6A 2BS4A 3CGDA 4EM3A 1W4XA 3P4QA 1OJTA 2AR8A 1TYPA 2YWLA 4TLZA 5KVHA 4NWZA 3LZXA 4U8PA 2B9YA 3AE8A 4NTCA 2R4JA 1LQTA 4FX9A 4J33A 1PHHA 3P4SA 4GRTA 1JRZA 2WP5A 4WCTA 4USRA 5CQFA 2WU5A 1D4DA 4H4XA 2XYOA 4YKFA 1IUVA 4ICYA 3CNDA 1RP0A 1LPFA 1N1PA 1S3EA 2WP6A 4EQWA 2YLSA 2DKIA 5KOXA 5KNLA 4FDCB 1JRXA 1EL5A 1K0LA 2H89A 3CNTA 4G74A 3CPHG 4OPCA 3GRSA 4TM4A 1Q1RA 2X8GA 3DJJA 4APNA 4H4UA 2V3BA 4G9KA 5J7XA 3GWFA 2VVLA 4NZHA 1H7WA 1E1KA 3CIRA 4C5OA 2YAUA 4IA6A 4YT0A 3NYFA 4DGKA 3COXA 2JKCA 1GESA 4H2QA 3P9UA 5LV9A 3ATRA 3BI5A 2A87A 1DOBA 2XLSA 2WDRA 4JN9A 2WS3A 4J36A 3NT6A 4PAAA 1F8RA 4AP3A 3ICRA 2B7RA 3K30A 3SM8A 5JCKA 4O5UA 3K7QX 2VQ7A 1IUWA 2XFUA 3DK4A 1ZX9A 4KPRA 1XHCA 2X99A 4OPLA 2JB2A 4TM0A 2WHDA 1O5WA 2XFOA 4OPDA 3SQPA 1KNRA 2R46A 1CJ3A 3SFEA 2WU2A 1Z6LA 3BNMA 3NHOX 4X9MA 3FBSA 2QA2A 4GDEA 4YKGA 4IA5A 1PXBA 5FS6A 1YQ3A 4NNJA 4CBQA 1S3BA 1ZP0A 2WPFA 2ZZBA 1F3PA 3GWDA 1JNZA 1NENA 1HYUA 1TRBA 2CVJA 3FG2P 4H2RA 1ZOYA 1H81A 2VVLG 4I59A 3M13A 4BV6A 3DGZA 2YVFA 4NEWA 4LU6A 1PBCA 5EB5A 5KVIA 4UDQA 3WE0A 1BZLA 1CL0A 1OJAA 1RYIA 2XFNA 3GYJA 3CPJG 1E1NA 4NTDA 3NKSA 4YXDA 4OPUA 2JB1A 2JK6A 2R0PA 2VRMA 4G6HA 3V76A 2BXSA 2E1MA 3EPTA 4H50A 1D4CA 4JNAA 4A7AA 3AE9A 5JCNA 1MOKA 1N4WA 1KDGA 3GDPA 3IHMA 1QO8A 3SYIA 1ELIA 1LJ1A 4U8IA 5DBJA 5L46A 2OA1A 4G6GA 2OLNA 2GAHB 4M52A 1M64A 2BK3A 2XFPA 1GREA 3ICSA 1VG9A 4LIIA 1O95A 1Y0PA 4H4PA 5EOWA 1F8WA 1PBBA 3FIMB 2VRLA 3M12A 3ALLA 2XVHA 4H4RA 1B5QA 1D7YA 3F8DA 3E1TA 1H83A 2RGHA 1ZOVA 2QCUA 1VDCA 2C66A 4H4SA 2BA9A 5IQ1A 1EL7A 2YG4A 1NHPA 3REDA 4C3XA 4Z2RA 4A79A 3SZFA 2BACA 1CHUA 1DNCA 1REOA 2AAQA 1TDEA 3T0KA 4Y4LA 2DKHA 2TMDA 1B8SA 4J2WA 2YG3A 1XANA 2WEUA 5BRTA 1TDFA 4HA6A 5FS9A 4K5RA 3VRAA 2ACZA 3QVRA 2V61A 1DODA 3D8XA 3H8LA 3NTAA 5KMPA 2WESA 3QVPA 3AE3A 3S61A 1JU2A 3BI4A 5KMSA 3T2YA 1CJ2A 1NHQA 2FJEA 3SZCA 4EMIA 2B7SA 3C4NA 3H4KA 2CULA 1UKVG 2J3NA 4U8NA 4DNAA 3F8RA 4CNKA 3GSIA 1FCDA 1F6MA 4GR1A 4K8DA 1PDHA 4AOSA 2YQUA 5FMHA 4YSYA 1K0IA 2YLTA 2C72A 3SFDA 4Z24A 2XLRA 2RGOA 1EL8A 2V6OA 2YLRA 1GPEA 4B68A 1SEZA 2VQBA 3GYIA 2BCGG 1GTEA 3T14A 2OAMA 3QSSA 3NLCA 3UOYA 3ALJA 1CC6A 3ZYXA 1YKJA 2Q7VA 3H8IA 3AD7B 2BS3A 2BRAA 1LTXR 3G5RA 1OJDA 2X8HA 2XVFA 4YTMA 2QAEA 4GF7A 1JEHA 4PABA 4X9NA 4OPTA 1ZMDA 4CRTA 3NK2X 2C65A 4XWRA 2E4GA 3SGLA 4J56A 2E5VA 2VVMA 2XCGA 4YWOA 4GDPA 1FL2A 1NDAA 2BK4A 2VOUA 3AWIA 4GUVA 1AOGA 4Z43A 3ZDNA 3C4AA 3UTHA 2WPEA 1MXTA 1CF3A 1PJ5A 4X4JA 3KU9A 5KOWA 3AECA 1PJ6A 4A99A 1B37A 4II2A 1E7PA 1B4VA 3QFBA 3IHGA 4CCRA 4BJYA 1NHSA 3BHFA 3LJPA 2Q0KA 2C3CA 1FECA 2ZBWA 5HHFA 3EAOA 3UKKA 2BK5A 2FBWA 3K7TA 1GRBA 4LA1A 5BVAA 1YQ4A 1XDIA 3O0HA 2OALA 4Z26A 5EBKA 3OC4A 3Q9TA 1COYA 2PYXA 2Z5YA 2BXRA 3T37A 1FEBA 4KX6A 1GOSA 2APGA 3L1RA 1CJ4A 4U8KA 4YSXA 4EQRA 1N4UA 1ZDLA 3AE6A 2YVJA 3GD3A 3CNJA 3LZWA 3BNUA 4GAVA 4EQXA 3CPIG 3KPKA 4NTEA 1GV4A 1KNPA 1ZMCA 5BULA 3AYIA 2YM2A 2FJAA 4B1BA 4IVMB 3T2ZA 4AT0A 2FJDA 4B66A 1NEKA 2V60A 4G73A 3NK1X 5HYMA 1BGJA 2EQ6A 1E39A 2XLTA 4C3YA 4AP1A 2IIDA 4E0VA 3B3RA 3UKFA 3CGCA 1ONFA 4ADWA 3DJDA 4A6NA 1JNRA 2Z5XA 2Q6UA 2C3DA 5GRTA 3UTFA 3NRNA 3P4PA 3RP8A 3UKLA 1ZKQA 1TDOA 3AD8B 3EF6A 2FJBA 3HYWA 2BABA 3GRTA 2YLWA 4H4VA 4H4YA 4JQ9A 4BK3A 3PVCA 3ICTA 3CTYA 1VG0A 4K22A 2GMJA 1DJNA 1L9CA 4GAPA 4C74A 1DOCA 1Y56B 4U8LA 3AYJA 2NPXA 3NNEA 2HQMA 3URHA 1PBFA 3ALMA 3NK0X 4AOXA 5HXIA 3AE1A 3P4RA 4B67A 4USQA 1KF6A 5BUKA 4ZCCA 2GV8A 4A6NB 3UP5A 4JDRA 3F8PA 2EQ7A 4MJWA 2C67A 3LOVA 5JCMA 3FPZA 3NTDA 1H6VA 2WP9A 3BI2A 2CDUA 2VZ2A 2GH5A 3NGCX 2WPCA 4AT2A 2IVDA 2GR3A 2GAGB 3PS9A 3EANA 2UZZA 4H2PA 4EM4A 2F5ZA 1LV0A 1KSUA 2QA1A 3CGEA 3ATQA 1H84A 3GMBA 3R9UA 1V59A 2V5ZA 1E6EA 1GXFA 3AE7A 4U2LA
chains in the Genus database with same CATH topology
1GRHA 5C3JA 1NG4A 3AEFA 4H2NA 3VQRA 3KA7A 1D7LA 4U8JA 1K0JA 2A89A 4UP3A 2WBAA 3HZLA 4H4QA 3AE2A 2XFQA 5JCIA 1S2QA 3V3OA 3I6DA 5KMQA 4OPIA 2YG6A 5KXJA 5U25A 1BWCA 2C7GA 2X3NA 4N9XA 4CNJA 3GD4A 3UKHA 4Z2TA 3AEAA 4BK2A 3M0OA 2GR1A 2XLPA 5IQ4A 1ZY8A 3SY4A 5KWFA 1NAAA 3G5QA 1PXAA 4B65A 2C70A 3G5SA 1NG3A 2R9ZA 2YG7A 4U8OA 5U1OA 1PBEA 4WX1A 3UTGA 4Z25A 3Q6JA 1LVLA 1PJ7A 4CY8A 4O5QA 4H7UA 4JNQA 2O9ZA 4YSZA 3KD9A 4EIQA 3DGHA 3UCLA 4TM1A 3AEGA 2RGJA 5CKUA 3RP7A 5KMRA 3B6DA 1NPXA 4U2TA 4FK1C 1IUXA 4EMJA 4YTPA 2X8CA 1IUUA 2RABA 3IWAA 1YY5A 4FK1A 2GQFA 3UOXA 2GEWA 2IVEA 2YR4A 2BC1A 3DJGX 4BJZA 3AYLA 3AEDA 4CY6A 1D4EA 2C4CA 3AE5A 4A65A 1TDKA 4H4WA 4XXGA 5HY5A 3QFAA 2A8XA 2XDOA 5J60A 4EMWA 1KFYA 1BF3A 4UDPA 3AD9B 3NIXA 1TYTA 3CNSA 2YG5A 3UKQA 1VQWA 4REKA 4J34A 1CJCA 2XVJA 4K7ZA 2WOVA 3VR8A 1P2HA 1K4QA 4BK1A 1L9DA 2AQJA 5M10A 3IF9A 3DK9A 2BRYA 2R0GA 2WOWA 4IV9A 3UOZA 4EIPA 2WDQA 3CMMA 3ADAB 3QSMA 1H82A 2I0ZA 4DSGA 2ZZ0A 1GEUA 1PN0A 4XWZA 3DH9A 5KRQA 3GYXA 2EQ9A 4NEVA 1DJQA 3SZ0A 3I3LA 2EQ8A 2C64A 3GMCA 2JAEA 2BC0A 4OPGA 4A5LA 2X50A 3DMEA 4Y4MA 2TPRA 2YLXA 3S5WA 3KKJA 1Y56A 1JRYA 3NYEA 3QSEA 3BHKA 4DSHA 3ISHA 2B9WA 3AXBA 5ER0A 1XPQA 1Q1WA 4YSHA 5FS8A 4H4TA 3NH3X 2GVCA 3DA1A 2Y6RA 2C75A 2C73A 1S2YA 3AEEA 3UP4A 1PS9A 2XVEA 5TR3A 2C76A 2GR0A 3KLJA 3DJEA 2PHHA 2YVGA 4K5SA 2GB0A 3ABVA 3LB8A 2GR2A 2CFYA 2WQYA 1FOHA 2Y6QA 2YR6A 3KVEA 4RG4A 4RG3A 2YM1A 1L0VA 1QLBA 1YQZA 4U2SA 4YTNA 4ECHA 1PXCA 1CC2A 5GSNA 3FMWA 1MO9A 4P9SA 3VRDB 4A9WA 1P2EA 4D04A 4OVIA 2WETA 1GNDA 3LXDA 1RSGA 5EB4A 2XLUA 5FS7A 1E1MA 4JY3A 3CGBA 3SXIA 3CNPA 3VR9A 1PBDA 1BKWA 1IJHA 2JB3A 3UTEA 4C77A 4EQSA 3QJ4A 3K7MX 2ARDA 1QJDA 1D5TA 1FEAA 1N4VA 3HYXA 1GRTA 1VRQB 2OLOA 1E1LA 1JOAA 1BGNA 2GMHA 4ZCDA 2W0HA 3D1CA 3VRBA 2WOIA 1ZK7A 4D03A 3AEBA 2GRTA 3LADA 3HYVA 4I58A 4J57A 3RHAA 1EL9A 1CBOA 5M0ZA 3OZ2A 4TLXA 4CCQA 1NHRA 2BS2A 3P1WA 1OJCA 1GERA 2BCPA 2R4EA 1M6IA 2V3AA 4J31A 1IUSA 3UKAA 1GALA 2YLZA 3V3NA 3PO7A 4IVOB 1LQUA 4OCGA 1KSSA 3JSKA 4JY2A 2B76A 4II3A 1GSNA 2ZZCA 1GRAA 1TDNA 2H88A 4GCMA 4Z2UA 5C2TA 4HB9A 5IPYA 3KPFA 2WDVA 4RSLA 1H86A 5U63A 4BURA 2YR5A 4K2XA 4H4ZA 3CN8A 1X31B 3SZWA 4U8MA 2JBVA 3II4A 2GQWA 3C96A 3NG7X 3NN6X 1DXLA 1IUTA 3DK8A 2NVKX 1DOEA 2Q0LA 1F8SA 2R45A 4TM3A 1O94A 2R0CA 3ITJA 3AB1A 4B63A 3AE4A 1CC4A 1GRFA 3UKPA 4B64A 2BYBA 1EBDA 4UDRA 1OJ9A 4Z44A 3NYCA 1GRGA 3RP6A 4ZN0A 5JCLA 1L9EA 2B9XA 1GTHA 4Y4NA 3NN0X 3IC9A 3T31A 4B69A 1Q9IA 3RNMA 1GT8A 3T2KA 3GDNA 1GETA 1H7XA 2GF3A 3UOVA 2XVIA 3L8KA 3SX6A 2BS4A 3CGDA 4EM3A 1W4XA 3P4QA 1OJTA 2AR8A 1TYPA 2YWLA 4TLZA 5KVHA 4NWZA 3LZXA 4U8PA 2B9YA 3AE8A 4NTCA 2R4JA 1LQTA 4FX9A 4J33A 1PHHA 3P4SA 4GRTA 1JRZA 2WP5A 4WCTA 4USRA 5CQFA 2WU5A 1D4DA 4H4XA 2XYOA 4YKFA 1IUVA 4ICYA 3CNDA 1RP0A 1LPFA 1N1PA 1S3EA 2WP6A 4EQWA 2YLSA 2DKIA 5KOXA 5KNLA 4FDCB 1JRXA 1EL5A 1K0LA 2H89A 3CNTA 4G74A 3CPHG 4OPCA 3GRSA 4TM4A 1Q1RA 2X8GA 3DJJA 4APNA 4H4UA 2V3BA 4G9KA 5J7XA 3GWFA 2VVLA 4NZHA 1H7WA 1E1KA 3CIRA 4C5OA 2YAUA 4IA6A 4YT0A 3NYFA 4DGKA 3COXA 2JKCA 1GESA 4H2QA 3P9UA 5LV9A 3ATRA 3BI5A 2A87A 1DOBA 2XLSA 2WDRA 4JN9A 2WS3A 4J36A 3NT6A 4PAAA 1F8RA 4AP3A 3ICRA 2B7RA 3K30A 3SM8A 5JCKA 4O5UA 3K7QX 2VQ7A 1IUWA 2XFUA 3DK4A 1ZX9A 4KPRA 1XHCA 2X99A 4OPLA 2JB2A 4TM0A 2WHDA 1O5WA 2XFOA 4OPDA 3SQPA 1KNRA 2R46A 1CJ3A 3SFEA 2WU2A 1Z6LA 3BNMA 3NHOX 4X9MA 3FBSA 2QA2A 4GDEA 4YKGA 4IA5A 1PXBA 5FS6A 1YQ3A 4NNJA 4CBQA 1S3BA 1ZP0A 2WPFA 2ZZBA 1F3PA 3GWDA 1JNZA 1NENA 1HYUA 1TRBA 2CVJA 3FG2P 4H2RA 1ZOYA 1H81A 2VVLG 4I59A 3M13A 4BV6A 3DGZA 2YVFA 4NEWA 4LU6A 1PBCA 5EB5A 5KVIA 4UDQA 3WE0A 1BZLA 1CL0A 1OJAA 1RYIA 2XFNA 3GYJA 3CPJG 1E1NA 4NTDA 3NKSA 4YXDA 4OPUA 2JB1A 2JK6A 2R0PA 2VRMA 4G6HA 3V76A 2BXSA 2E1MA 3EPTA 4H50A 1D4CA 4JNAA 4A7AA 3AE9A 5JCNA 1MOKA 1N4WA 1KDGA 3GDPA 3IHMA 1QO8A 3SYIA 1ELIA 1LJ1A 4U8IA 5DBJA 5L46A 2OA1A 4G6GA 2OLNA 2GAHB 4M52A 1M64A 2BK3A 2XFPA 1GREA 3ICSA 1VG9A 4LIIA 1O95A 1Y0PA 4H4PA 5EOWA 1F8WA 1PBBA 3FIMB 2VRLA 3M12A 3ALLA 2XVHA 4H4RA 1B5QA 1D7YA 3F8DA 3E1TA 1H83A 2RGHA 1ZOVA 2QCUA 1VDCA 2C66A 4H4SA 2BA9A 5IQ1A 1EL7A 2YG4A 1NHPA 3REDA 4C3XA 4Z2RA 4A79A 3SZFA 2BACA 1CHUA 1DNCA 1REOA 2AAQA 1TDEA 3T0KA 4Y4LA 2DKHA 2TMDA 1B8SA 4J2WA 2YG3A 1XANA 2WEUA 5BRTA 1TDFA 4HA6A 5FS9A 4K5RA 3VRAA 2ACZA 3QVRA 2V61A 1DODA 3D8XA 3H8LA 3NTAA 5KMPA 2WESA 3QVPA 3AE3A 3S61A 1JU2A 3BI4A 5KMSA 3T2YA 1CJ2A 1NHQA 2FJEA 3SZCA 4EMIA 2B7SA 3C4NA 3H4KA 2CULA 1UKVG 2J3NA 4U8NA 4DNAA 3F8RA 4CNKA 3GSIA 1FCDA 1F6MA 4GR1A 4K8DA 1PDHA 4AOSA 2YQUA 5FMHA 4YSYA 1K0IA 2YLTA 2C72A 3SFDA 4Z24A 2XLRA 2RGOA 1EL8A 2V6OA 2YLRA 1GPEA 4B68A 1SEZA 2VQBA 3GYIA 2BCGG 1GTEA 3T14A 2OAMA 3QSSA 3NLCA 3UOYA 3ALJA 1CC6A 3ZYXA 1YKJA 2Q7VA 3H8IA 3AD7B 2BS3A 2BRAA 1LTXR 3G5RA 1OJDA 2X8HA 2XVFA 4YTMA 2QAEA 4GF7A 1JEHA 4PABA 4X9NA 4OPTA 1ZMDA 4CRTA 3NK2X 2C65A 4XWRA 2E4GA 3SGLA 4J56A 2E5VA 2VVMA 2XCGA 4YWOA 4GDPA 1FL2A 1NDAA 2BK4A 2VOUA 3AWIA 4GUVA 1AOGA 4Z43A 3ZDNA 3C4AA 3UTHA 2WPEA 1MXTA 1CF3A 1PJ5A 4X4JA 3KU9A 5KOWA 3AECA 1PJ6A 4A99A 1B37A 4II2A 1E7PA 1B4VA 3QFBA 3IHGA 4CCRA 4BJYA 1NHSA 3BHFA 3LJPA 2Q0KA 2C3CA 1FECA 2ZBWA 5HHFA 3EAOA 3UKKA 2BK5A 2FBWA 3K7TA 1GRBA 4LA1A 5BVAA 1YQ4A 1XDIA 3O0HA 2OALA 4Z26A 5EBKA 3OC4A 3Q9TA 1COYA 2PYXA 2Z5YA 2BXRA 3T37A 1FEBA 4KX6A 1GOSA 2APGA 3L1RA 1CJ4A 4U8KA 4YSXA 4EQRA 1N4UA 1ZDLA 3AE6A 2YVJA 3GD3A 3CNJA 3LZWA 3BNUA 4GAVA 4EQXA 3CPIG 3KPKA 4NTEA 1GV4A 1KNPA 1ZMCA 5BULA 3AYIA 2YM2A 2FJAA 4B1BA 4IVMB 3T2ZA 4AT0A 2FJDA 4B66A 1NEKA 2V60A 4G73A 3NK1X 5HYMA 1BGJA 2EQ6A 1E39A 2XLTA 4C3YA 4AP1A 2IIDA 4E0VA 3B3RA 3UKFA 3CGCA 1ONFA 4ADWA 3DJDA 4A6NA 1JNRA 2Z5XA 2Q6UA 2C3DA 5GRTA 3UTFA 3NRNA 3P4PA 3RP8A 3UKLA 1ZKQA 1TDOA 3AD8B 3EF6A 2FJBA 3HYWA 2BABA 3GRTA 2YLWA 4H4VA 4H4YA 4JQ9A 4BK3A 3PVCA 3ICTA 3CTYA 1VG0A 4K22A 2GMJA 1DJNA 1L9CA 4GAPA 4C74A 1DOCA 1Y56B 4U8LA 3AYJA 2NPXA 3NNEA 2HQMA 3URHA 1PBFA 3ALMA 3NK0X 4AOXA 5HXIA 3AE1A 3P4RA 4B67A 4USQA 1KF6A 5BUKA 4ZCCA 2GV8A 4A6NB 3UP5A 4JDRA 3F8PA 2EQ7A 4MJWA 2C67A 3LOVA 5JCMA 3FPZA 3NTDA 1H6VA 2WP9A 3BI2A 2CDUA 2VZ2A 2GH5A 3NGCX 2WPCA 4AT2A 2IVDA 2GR3A 2GAGB 3PS9A 3EANA 2UZZA 4H2PA 4EM4A 2F5ZA 1LV0A 1KSUA 2QA1A 3CGEA 3ATQA 1H84A 3GMBA 3R9UA 1V59A 2V5ZA 1E6EA 1GXFA 3AE7A 4U2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GRH A;  5C3J A;  1NG4 A;  3AEF A;  4H2N A;  3VQR A;  3KA7 A;  1D7L A;  4U8J A;  1K0J A;  2A89 A;  4UP3 A;  2WBA A;  3HZL A;  4H4Q A;  3AE2 A;  2XFQ A;  5JCI A;  1S2Q A;  3V3O A;  3I6D A;  4OPI A;  2YG6 A;  5KXJ A;  5U25 A;  1BWC A;  2C7G A;  2X3N A;  4N9X A;  4CNJ A;  3GD4 A;  3UKH A;  4Z2T A;  3AEA A;  4BK2 A;  3M0O A;  2GR1 A;  2XLP A;  5IQ4 A;  1ZY8 A;  5KWF A;  1NAA A;  3G5Q A;  1PXA A;  4B65 A;  2C70 A;  3G5S A;  1NG3 A;  2R9Z A;  2YG7 A;  4U8O A;  5U1O A;  1PBE A;  4WX1 A;  3UTG A;  4Z25 A;  3Q6J A;  1LVL A;  1PJ7 A;  4CY8 A;  4O5Q A;  4H7U A;  4JNQ A;  2O9Z A;  4YSZ A;  3KD9 A;  4EIQ A;  3DGH A;  3UCL A;  4TM1 A;  3AEG A;  2RGJ A;  5CKU A;  3RP7 A;  3B6D A;  1NPX A;  4U2T A;  4FK1 C;  1IUX A;  4EMJ A;  4YTP A;  2X8C A;  1IUU A;  2RAB A;  3IWA A;  1YY5 A;  4FK1 A;  2GQF A;  3UOX A;  2GEW A;  2IVE A;  2YR4 A;  2BC1 A;  3DJG X;  4BJZ A;  3AYL A;  3AED A;  4CY6 A;  1D4E A;  3AE5 A;  4A65 A;  1TDK A;  4H4W A;  4XXG A;  5HY5 A;  3QFA A;  2A8X A;  2XDO A;  5J60 A;  4EMW A;  1KFY A;  1BF3 A;  4UDP A;  3AD9 B;  3NIX A;  1TYT A;  3CNS A;  2YG5 A;  3UKQ A;  1VQW A;  4REK A;  4J34 A;  1CJC A;  2XVJ A;  4K7Z A;  2WOV A;  3VR8 A;  1P2H A;  1K4Q A;  4BK1 A;  1L9D A;  2AQJ A;  5M10 A;  3IF9 A;  3DK9 A;  2R0G A;  2WOW A;  4IV9 A;  3UOZ A;  4EIP A;  2WDQ A;  3ADA B;  3QSM A;  1H82 A;  2I0Z A;  4DSG A;  2ZZ0 A;  1GEU A;  1PN0 A;  4XWZ A;  3DH9 A;  5KRQ A;  2EQ9 A;  4NEV A;  1DJQ A;  3I3L A;  2EQ8 A;  2C64 A;  3GMC A;  2JAE A;  2BC0 A;  4OPG A;  4A5L A;  2X50 A;  3DME A;  4Y4M A;  2TPR A;  2YLX A;  3S5W A;  3KKJ A;  1Y56 A;  1JRY A;  3NYE A;  3QSE A;  3BHK A;  4DSH A;  3ISH A;  2B9W A;  3AXB A;  5ER0 A;  1XPQ A;  1Q1W A;  4YSH A;  5FS8 A;  4H4T A;  3NH3 X;  2GVC A;  3DA1 A;  2Y6R A;  2C75 A;  2C73 A;  1S2Y A;  3AEE A;  3UP4 A;  1PS9 A;  2XVE A;  5TR3 A;  2C76 A;  2GR0 A;  3KLJ A;  3DJE A;  2PHH A;  2YVG A;  4K5S A;  2GB0 A;  3ABV A;  3LB8 A;  2GR2 A;  2CFY A;  2WQY A;  1FOH A;  2Y6Q A;  2YR6 A;  3KVE A;  4RG4 A;  4RG3 A;  2YM1 A;  1L0V A;  1QLB A;  1YQZ A;  4U2S A;  4YTN A;  4ECH A;  1PXC A;  1CC2 A;  5GSN A;  3FMW A;  1MO9 A;  4P9S A;  3VRD B;  4A9W A;  1P2E A;  4D04 A;  4OVI A;  2WET A;  1GND A;  3LXD A;  1RSG A;  5EB4 A;  2XLU A;  5FS7 A;  1E1M A;  4JY3 A;  3CGB A;  3CNP A;  3VR9 A;  1PBD A;  1BKW A;  1IJH A;  2JB3 A;  3UTE A;  4C77 A;  4EQS A;  3QJ4 A;  3K7M X;  2ARD A;  1QJD A;  1D5T A;  1FEA A;  1N4V A;  1GRT A;  1VRQ B;  2OLO A;  1E1L A;  1JOA A;  1BGN A;  2GMH A;  4ZCD A;  2W0H A;  3D1C A;  3VRB A;  2WOI A;  1ZK7 A;  4D03 A;  3AEB A;  2GRT A;  3LAD A;  4I58 A;  4J57 A;  3RHA A;  1EL9 A;  1CBO A;  5M0Z A;  3OZ2 A;  4TLX A;  4CCQ A;  1NHR A;  2BS2 A;  3P1W A;  1OJC A;  1GER A;  2BCP A;  2R4E A;  1M6I A;  2V3A A;  4J31 A;  1IUS A;  3UKA A;  1GAL A;  2YLZ A;  3V3N A;  3PO7 A;  4IVO B;  1LQU A;  4OCG A;  1KSS A;  3JSK A;  4JY2 A;  2B76 A;  1GSN A;  2ZZC A;  1GRA A;  1TDN A;  2H88 A;  4GCM A;  4Z2U A;  5C2T A;  4HB9 A;  5IPY A;  3KPF A;  2WDV A;  4RSL A;  1H86 A;  5U63 A;  4BUR A;  2YR5 A;  4K2X A;  4H4Z A;  3CN8 A;  1X31 B;  4U8M A;  2JBV A;  3II4 A;  2GQW A;  3C96 A;  3NG7 X;  3NN6 X;  1DXL A;  1IUT A;  3DK8 A;  2NVK X;  1DOE A;  2Q0L A;  1F8S A;  2R45 A;  4TM3 A;  1O94 A;  2R0C A;  3ITJ A;  3AB1 A;  4B63 A;  3AE4 A;  1CC4 A;  1GRF A;  3UKP A;  4B64 A;  2BYB A;  1EBD A;  4UDR A;  1OJ9 A;  4Z44 A;  3NYC A;  1GRG A;  3RP6 A;  4ZN0 A;  5JCL A;  1L9E A;  2B9X A;  1GTH A;  4Y4N A;  3NN0 X;  3IC9 A;  4B69 A;  1Q9I A;  3RNM A;  1GT8 A;  3GDN A;  1GET A;  1H7X A;  2GF3 A;  3UOV A;  2XVI A;  3L8K A;  2BS4 A;  3CGD A;  4EM3 A;  1W4X A;  3P4Q A;  1OJT A;  2AR8 A;  1TYP A;  2YWL A;  4TLZ A;  5KVH A;  3LZX A;  4U8P A;  2B9Y A;  3AE8 A;  4NTC A;  2R4J A;  1LQT A;  4FX9 A;  4J33 A;  1PHH A;  3P4S A;  4GRT A;  1JRZ A;  2WP5 A;  4WCT A;  4USR A;  5CQF A;  2WU5 A;  1D4D A;  4H4X A;  2XYO A;  4YKF A;  1IUV A;  4ICY A;  3CND A;  1RP0 A;  1LPF A;  1N1P A;  1S3E A;  2WP6 A;  4EQW A;  2YLS A;  2DKI A;  5KOX A;  4FDC B;  1JRX A;  1EL5 A;  1K0L A;  2H89 A;  3CNT A;  4OPC A;  3CPH G;  3GRS A;  4TM4 A;  1Q1R A;  2X8G A;  3DJJ A;  4APN A;  4H4U A;  2V3B A;  5J7X A;  3GWF A;  2VVL A;  4NZH A;  1H7W A;  1E1K A;  3CIR A;  4C5O A;  2YAU A;  4IA6 A;  4YT0 A;  3NYF A;  4DGK A;  3COX A;  2JKC A;  1GES A;  4H2Q A;  3P9U A;  5LV9 A;  3ATR A;  3BI5 A;  2A87 A;  1DOB A;  2XLS A;  2WDR A;  4JN9 A;  2WS3 A;  4J36 A;  3NT6 A;  4PAA A;  1F8R A;  4AP3 A;  3ICR A;  2B7R A;  3K30 A;  3SM8 A;  5JCK A;  4O5U A;  3K7Q X;  2VQ7 A;  1IUW A;  2XFU A;  3DK4 A;  1ZX9 A;  4KPR A;  1XHC A;  2X99 A;  4OPL A;  2JB2 A;  4TM0 A;  2WHD A;  1O5W A;  2XFO A;  4OPD A;  3SQP A;  1KNR A;  2R46 A;  1CJ3 A;  3SFE A;  2WU2 A;  1Z6L A;  3BNM A;  3NHO X;  4X9M A;  3FBS A;  2QA2 A;  4GDE A;  4YKG A;  4IA5 A;  1PXB A;  5FS6 A;  1YQ3 A;  4CBQ A;  1S3B A;  1ZP0 A;  2WPF A;  2ZZB A;  1F3P A;  3GWD A;  1JNZ A;  1NEN A;  1HYU A;  1TRB A;  2CVJ A;  3FG2 P;  4H2R A;  1ZOY A;  1H81 A;  2VVL G;  4I59 A;  3M13 A;  4BV6 A;  3DGZ A;  2YVF A;  4NEW A;  4LU6 A;  1PBC A;  5EB5 A;  5KVI A;  4UDQ A;  3WE0 A;  1BZL A;  1CL0 A;  1OJA A;  1RYI A;  2XFN A;  3GYJ A;  3CPJ G;  1E1N A;  4NTD A;  3NKS A;  4YXD A;  4OPU A;  2JB1 A;  2JK6 A;  2R0P A;  2VRM A;  3V76 A;  2BXS A;  2E1M A;  3EPT A;  4H50 A;  1D4C A;  4JNA A;  4A7A A;  3AE9 A;  5JCN A;  1MOK A;  1N4W A;  1KDG A;  3GDP A;  3IHM A;  1QO8 A;  1ELI A;  1LJ1 A;  4U8I A;  5DBJ A;  5L46 A;  2OA1 A;  2OLN A;  2GAH B;  4M52 A;  1M64 A;  2BK3 A;  2XFP A;  1GRE A;  3ICS A;  1VG9 A;  4LII A;  1O95 A;  1Y0P A;  4H4P A;  5EOW A;  1F8W A;  1PBB A;  3FIM B;  2VRL A;  3M12 A;  3ALL A;  2XVH A;  4H4R A;  1B5Q A;  1D7Y A;  3F8D A;  3E1T A;  1H83 A;  2RGH A;  1ZOV A;  2QCU A;  1VDC A;  2C66 A;  4H4S A;  2BA9 A;  5IQ1 A;  1EL7 A;  2YG4 A;  1NHP A;  3RED A;  4C3X A;  4Z2R A;  4A79 A;  2BAC A;  1CHU A;  1DNC A;  1REO A;  2AAQ A;  1TDE A;  4Y4L A;  2DKH A;  2TMD A;  1B8S A;  4J2W A;  2YG3 A;  1XAN A;  2WEU A;  5BRT A;  1TDF A;  4HA6 A;  5FS9 A;  4K5R A;  3VRA A;  2ACZ A;  3QVR A;  2V61 A;  1DOD A;  3D8X A;  3H8L A;  3NTA A;  2WES A;  3QVP A;  3AE3 A;  3S61 A;  1JU2 A;  3BI4 A;  1CJ2 A;  1NHQ A;  2FJE A;  4EMI A;  2B7S A;  3C4N A;  3H4K A;  2CUL A;  1UKV G;  2J3N A;  4U8N A;  4DNA A;  3F8R A;  4CNK A;  3GSI A;  1FCD A;  1F6M A;  4GR1 A;  4K8D A;  1PDH A;  4AOS A;  2YQU A;  5FMH A;  4YSY A;  1K0I A;  2YLT A;  2C72 A;  3SFD A;  4Z24 A;  2XLR A;  2RGO A;  1EL8 A;  2V6O A;  2YLR A;  1GPE A;  4B68 A;  1SEZ A;  2VQB A;  3GYI A;  2BCG G;  1GTE A;  2OAM A;  3QSS A;  3NLC A;  3UOY A;  3ALJ A;  1CC6 A;  3ZYX A;  1YKJ A;  2Q7V A;  3H8I A;  3AD7 B;  2BS3 A;  3G5R A;  1LTX R;  1OJD A;  2X8H A;  2XVF A;  4YTM A;  2QAE A;  4GF7 A;  1JEH A;  4PAB A;  4X9N A;  4OPT A;  1ZMD A;  4CRT A;  3NK2 X;  2C65 A;  4XWR A;  2E4G A;  3SGL A;  4J56 A;  2E5V A;  2VVM A;  2XCG A;  4YWO A;  4GDP A;  1FL2 A;  1NDA A;  2BK4 A;  2VOU A;  3AWI A;  4GUV A;  1AOG A;  4Z43 A;  3ZDN A;  3C4A A;  3UTH A;  2WPE A;  1MXT A;  1CF3 A;  1PJ5 A;  4X4J A;  3KU9 A;  5KOW A;  3AEC A;  1PJ6 A;  4A99 A;  1B37 A;  1E7P A;  1B4V A;  3QFB A;  3IHG A;  4CCR A;  4BJY A;  1NHS A;  3BHF A;  3LJP A;  2Q0K A;  2C3C A;  1FEC A;  2ZBW A;  5HHF A;  3EAO A;  3UKK A;  2BK5 A;  2FBW A;  3K7T A;  1GRB A;  4LA1 A;  5BVA A;  1YQ4 A;  1XDI A;  3O0H A;  2OAL A;  4Z26 A;  5EBK A;  3OC4 A;  3Q9T A;  1COY A;  2PYX A;  2Z5Y A;  2BXR A;  3T37 A;  1FEB A;  4KX6 A;  1GOS A;  2APG A;  3L1R A;  1CJ4 A;  4U8K A;  4YSX A;  4EQR A;  1N4U A;  1ZDL A;  3AE6 A;  2YVJ A;  3GD3 A;  3CNJ A;  3LZW A;  3BNU A;  4EQX A;  3CPI G;  4NTE A;  1GV4 A;  1KNP A;  1ZMC A;  5BUL A;  3AYI A;  2YM2 A;  2FJA A;  4B1B A;  4IVM B;  4AT0 A;  2FJD A;  4B66 A;  1NEK A;  2V60 A;  3NK1 X;  5HYM A;  1BGJ A;  2EQ6 A;  1E39 A;  2XLT A;  4C3Y A;  4AP1 A;  2IID A;  4E0V A;  3B3R A;  3UKF A;  3CGC A;  1ONF A;  4ADW A;  3DJD A;  4A6N A;  1JNR A;  2Z5X A;  2Q6U A;  2C3D A;  5GRT A;  3UTF A;  3NRN A;  3P4P A;  3RP8 A;  3UKL A;  1ZKQ A;  1TDO A;  3AD8 B;  3EF6 A;  2FJB A;  4JQ9 A;  2BAB A;  3GRT A;  2YLW A;  4H4V A;  4H4Y A;  4BK3 A;  3PVC A;  3ICT A;  3CTY A;  1VG0 A;  4K22 A;  2GMJ A;  1DJN A;  1L9C A;  4C74 A;  1DOC A;  1Y56 B;  4U8L A;  3AYJ A;  2NPX A;  3NNE A;  2HQM A;  3URH A;  1PBF A;  3ALM A;  3NK0 X;  4AOX A;  5HXI A;  3AE1 A;  3P4R A;  4B67 A;  4USQ A;  1KF6 A;  5BUK A;  4ZCC A;  2GV8 A;  4A6N B;  3UP5 A;  4JDR A;  3F8P A;  2EQ7 A;  4MJW A;  2C67 A;  3LOV A;  5JCM A;  3FPZ A;  3NTD A;  1H6V A;  2WP9 A;  3BI2 A;  2CDU A;  2VZ2 A;  2GH5 A;  3NGC X;  2WPC A;  4AT2 A;  2IVD A;  2GR3 A;  2GAG B;  3PS9 A;  3EAN A;  2UZZ A;  4H2P A;  4EM4 A;  2F5Z A;  1LV0 A;  1KSU A;  2QA1 A;  3CGE A;  3ATQ A;  1H84 A;  3GMB A;  3R9U A;  1V59 A;  2V5Z A;  1E6E A;  1GXF A;  3AE7 A;  4U2L A; 
#chains in the Genus database with same CATH topology
 1GRH A;  5C3J A;  1NG4 A;  3AEF A;  4H2N A;  3VQR A;  3KA7 A;  1D7L A;  4U8J A;  1K0J A;  2A89 A;  4UP3 A;  2WBA A;  3HZL A;  4H4Q A;  3AE2 A;  2XFQ A;  5JCI A;  1S2Q A;  3V3O A;  3I6D A;  5KMQ A;  4OPI A;  2YG6 A;  5KXJ A;  5U25 A;  1BWC A;  2C7G A;  2X3N A;  4N9X A;  4CNJ A;  3GD4 A;  3UKH A;  4Z2T A;  3AEA A;  4BK2 A;  3M0O A;  2GR1 A;  2XLP A;  5IQ4 A;  1ZY8 A;  3SY4 A;  5KWF A;  1NAA A;  3G5Q A;  1PXA A;  4B65 A;  2C70 A;  3G5S A;  1NG3 A;  2R9Z A;  2YG7 A;  4U8O A;  5U1O A;  1PBE A;  4WX1 A;  3UTG A;  4Z25 A;  3Q6J A;  1LVL A;  1PJ7 A;  4CY8 A;  4O5Q A;  4H7U A;  4JNQ A;  2O9Z A;  4YSZ A;  3KD9 A;  4EIQ A;  3DGH A;  3UCL A;  4TM1 A;  3AEG A;  2RGJ A;  5CKU A;  3RP7 A;  5KMR A;  3B6D A;  1NPX A;  4U2T A;  4FK1 C;  1IUX A;  4EMJ A;  4YTP A;  2X8C A;  1IUU A;  2RAB A;  3IWA A;  1YY5 A;  4FK1 A;  2GQF A;  3UOX A;  2GEW A;  2IVE A;  2YR4 A;  2BC1 A;  3DJG X;  4BJZ A;  3AYL A;  3AED A;  4CY6 A;  1D4E A;  2C4C A;  3AE5 A;  4A65 A;  1TDK A;  4H4W A;  4XXG A;  5HY5 A;  3QFA A;  2A8X A;  2XDO A;  5J60 A;  4EMW A;  1KFY A;  1BF3 A;  4UDP A;  3AD9 B;  3NIX A;  1TYT A;  3CNS A;  2YG5 A;  3UKQ A;  1VQW A;  4REK A;  4J34 A;  1CJC A;  2XVJ A;  4K7Z A;  2WOV A;  3VR8 A;  1P2H A;  1K4Q A;  4BK1 A;  1L9D A;  2AQJ A;  5M10 A;  3IF9 A;  3DK9 A;  2BRY A;  2R0G A;  2WOW A;  4IV9 A;  3UOZ A;  4EIP A;  2WDQ A;  3CMM A;  3ADA B;  3QSM A;  1H82 A;  2I0Z A;  4DSG A;  2ZZ0 A;  1GEU A;  1PN0 A;  4XWZ A;  3DH9 A;  5KRQ A;  3GYX A;  2EQ9 A;  4NEV A;  1DJQ A;  3SZ0 A;  3I3L A;  2EQ8 A;  2C64 A;  3GMC A;  2JAE A;  2BC0 A;  4OPG A;  4A5L A;  2X50 A;  3DME A;  4Y4M A;  2TPR A;  2YLX A;  3S5W A;  3KKJ A;  1Y56 A;  1JRY A;  3NYE A;  3QSE A;  3BHK A;  4DSH A;  3ISH A;  2B9W A;  3AXB A;  5ER0 A;  1XPQ A;  1Q1W A;  4YSH A;  5FS8 A;  4H4T A;  3NH3 X;  2GVC A;  3DA1 A;  2Y6R A;  2C75 A;  2C73 A;  1S2Y A;  3AEE A;  3UP4 A;  1PS9 A;  2XVE A;  5TR3 A;  2C76 A;  2GR0 A;  3KLJ A;  3DJE A;  2PHH A;  2YVG A;  4K5S A;  2GB0 A;  3ABV A;  3LB8 A;  2GR2 A;  2CFY A;  2WQY A;  1FOH A;  2Y6Q A;  2YR6 A;  3KVE A;  4RG4 A;  4RG3 A;  2YM1 A;  1L0V A;  1QLB A;  1YQZ A;  4U2S A;  4YTN A;  4ECH A;  1PXC A;  1CC2 A;  5GSN A;  3FMW A;  1MO9 A;  4P9S A;  3VRD B;  4A9W A;  1P2E A;  4D04 A;  4OVI A;  2WET A;  1GND A;  3LXD A;  1RSG A;  5EB4 A;  2XLU A;  5FS7 A;  1E1M A;  4JY3 A;  3CGB A;  3SXI A;  3CNP A;  3VR9 A;  1PBD A;  1BKW A;  1IJH A;  2JB3 A;  3UTE A;  4C77 A;  4EQS A;  3QJ4 A;  3K7M X;  2ARD A;  1QJD A;  1D5T A;  1FEA A;  1N4V A;  3HYX A;  1GRT A;  1VRQ B;  2OLO A;  1E1L A;  1JOA A;  1BGN A;  2GMH A;  4ZCD A;  2W0H A;  3D1C A;  3VRB A;  2WOI A;  1ZK7 A;  4D03 A;  3AEB A;  2GRT A;  3LAD A;  3HYV A;  4I58 A;  4J57 A;  3RHA A;  1EL9 A;  1CBO A;  5M0Z A;  3OZ2 A;  4TLX A;  4CCQ A;  1NHR A;  2BS2 A;  3P1W A;  1OJC A;  1GER A;  2BCP A;  2R4E A;  1M6I A;  2V3A A;  4J31 A;  1IUS A;  3UKA A;  1GAL A;  2YLZ A;  3V3N A;  3PO7 A;  4IVO B;  1LQU A;  4OCG A;  1KSS A;  3JSK A;  4JY2 A;  2B76 A;  4II3 A;  1GSN A;  2ZZC A;  1GRA A;  1TDN A;  2H88 A;  4GCM A;  4Z2U A;  5C2T A;  4HB9 A;  5IPY A;  3KPF A;  2WDV A;  4RSL A;  1H86 A;  5U63 A;  4BUR A;  2YR5 A;  4K2X A;  4H4Z A;  3CN8 A;  1X31 B;  3SZW A;  4U8M A;  2JBV A;  3II4 A;  2GQW A;  3C96 A;  3NG7 X;  3NN6 X;  1DXL A;  1IUT A;  3DK8 A;  2NVK X;  1DOE A;  2Q0L A;  1F8S A;  2R45 A;  4TM3 A;  1O94 A;  2R0C A;  3ITJ A;  3AB1 A;  4B63 A;  3AE4 A;  1CC4 A;  1GRF A;  3UKP A;  4B64 A;  2BYB A;  1EBD A;  4UDR A;  1OJ9 A;  4Z44 A;  3NYC A;  1GRG A;  3RP6 A;  4ZN0 A;  5JCL A;  1L9E A;  2B9X A;  1GTH A;  4Y4N A;  3NN0 X;  3IC9 A;  3T31 A;  4B69 A;  1Q9I A;  3RNM A;  1GT8 A;  3T2K A;  3GDN A;  1GET A;  1H7X A;  2GF3 A;  3UOV A;  2XVI A;  3L8K A;  3SX6 A;  2BS4 A;  3CGD A;  4EM3 A;  1W4X A;  3P4Q A;  1OJT A;  2AR8 A;  1TYP A;  2YWL A;  4TLZ A;  5KVH A;  4NWZ A;  3LZX A;  4U8P A;  2B9Y A;  3AE8 A;  4NTC A;  2R4J A;  1LQT A;  4FX9 A;  4J33 A;  1PHH A;  3P4S A;  4GRT A;  1JRZ A;  2WP5 A;  4WCT A;  4USR A;  5CQF A;  2WU5 A;  1D4D A;  4H4X A;  2XYO A;  4YKF A;  1IUV A;  4ICY A;  3CND A;  1RP0 A;  1LPF A;  1N1P A;  1S3E A;  2WP6 A;  4EQW A;  2YLS A;  2DKI A;  5KOX A;  5KNL A;  4FDC B;  1JRX A;  1EL5 A;  1K0L A;  2H89 A;  3CNT A;  4G74 A;  3CPH G;  4OPC A;  3GRS A;  4TM4 A;  1Q1R A;  2X8G A;  3DJJ A;  4APN A;  4H4U A;  2V3B A;  4G9K A;  5J7X A;  3GWF A;  2VVL A;  4NZH A;  1H7W A;  1E1K A;  3CIR A;  4C5O A;  2YAU A;  4IA6 A;  4YT0 A;  3NYF A;  4DGK A;  3COX A;  2JKC A;  1GES A;  4H2Q A;  3P9U A;  5LV9 A;  3ATR A;  3BI5 A;  2A87 A;  1DOB A;  2XLS A;  2WDR A;  4JN9 A;  2WS3 A;  4J36 A;  3NT6 A;  4PAA A;  1F8R A;  4AP3 A;  3ICR A;  2B7R A;  3K30 A;  3SM8 A;  5JCK A;  4O5U A;  3K7Q X;  2VQ7 A;  1IUW A;  2XFU A;  3DK4 A;  1ZX9 A;  4KPR A;  1XHC A;  2X99 A;  4OPL A;  2JB2 A;  4TM0 A;  2WHD A;  1O5W A;  2XFO A;  4OPD A;  3SQP A;  1KNR A;  2R46 A;  1CJ3 A;  3SFE A;  2WU2 A;  1Z6L A;  3BNM A;  3NHO X;  4X9M A;  3FBS A;  2QA2 A;  4GDE A;  4YKG A;  4IA5 A;  1PXB A;  5FS6 A;  1YQ3 A;  4NNJ A;  4CBQ A;  1S3B A;  1ZP0 A;  2WPF A;  2ZZB A;  1F3P A;  3GWD A;  1JNZ A;  1NEN A;  1HYU A;  1TRB A;  2CVJ A;  3FG2 P;  4H2R A;  1ZOY A;  1H81 A;  2VVL G;  4I59 A;  3M13 A;  4BV6 A;  3DGZ A;  2YVF A;  4NEW A;  4LU6 A;  1PBC A;  5EB5 A;  5KVI A;  4UDQ A;  3WE0 A;  1BZL A;  1CL0 A;  1OJA A;  1RYI A;  2XFN A;  3GYJ A;  3CPJ G;  1E1N A;  4NTD A;  3NKS A;  4YXD A;  4OPU A;  2JB1 A;  2JK6 A;  2R0P A;  2VRM A;  4G6H A;  3V76 A;  2BXS A;  2E1M A;  3EPT A;  4H50 A;  1D4C A;  4JNA A;  4A7A A;  3AE9 A;  5JCN A;  1MOK A;  1N4W A;  1KDG A;  3GDP A;  3IHM A;  1QO8 A;  3SYI A;  1ELI A;  1LJ1 A;  4U8I A;  5DBJ A;  5L46 A;  2OA1 A;  4G6G A;  2OLN A;  2GAH B;  4M52 A;  1M64 A;  2BK3 A;  2XFP A;  1GRE A;  3ICS A;  1VG9 A;  4LII A;  1O95 A;  1Y0P A;  4H4P A;  5EOW A;  1F8W A;  1PBB A;  3FIM B;  2VRL A;  3M12 A;  3ALL A;  2XVH A;  4H4R A;  1B5Q A;  1D7Y A;  3F8D A;  3E1T A;  1H83 A;  2RGH A;  1ZOV A;  2QCU A;  1VDC A;  2C66 A;  4H4S A;  2BA9 A;  5IQ1 A;  1EL7 A;  2YG4 A;  1NHP A;  3RED A;  4C3X A;  4Z2R A;  4A79 A;  3SZF A;  2BAC A;  1CHU A;  1DNC A;  1REO A;  2AAQ A;  1TDE A;  3T0K A;  4Y4L A;  2DKH A;  2TMD A;  1B8S A;  4J2W A;  2YG3 A;  1XAN A;  2WEU A;  5BRT A;  1TDF A;  4HA6 A;  5FS9 A;  4K5R A;  3VRA A;  2ACZ A;  3QVR A;  2V61 A;  1DOD A;  3D8X A;  3H8L A;  3NTA A;  5KMP A;  2WES A;  3QVP A;  3AE3 A;  3S61 A;  1JU2 A;  3BI4 A;  5KMS A;  3T2Y A;  1CJ2 A;  1NHQ A;  2FJE A;  3SZC A;  4EMI A;  2B7S A;  3C4N A;  3H4K A;  2CUL A;  1UKV G;  2J3N A;  4U8N A;  4DNA A;  3F8R A;  4CNK A;  3GSI A;  1FCD A;  1F6M A;  4GR1 A;  4K8D A;  1PDH A;  4AOS A;  2YQU A;  5FMH A;  4YSY A;  1K0I A;  2YLT A;  2C72 A;  3SFD A;  4Z24 A;  2XLR A;  2RGO A;  1EL8 A;  2V6O A;  2YLR A;  1GPE A;  4B68 A;  1SEZ A;  2VQB A;  3GYI A;  2BCG G;  1GTE A;  3T14 A;  2OAM A;  3QSS A;  3NLC A;  3UOY A;  3ALJ A;  1CC6 A;  3ZYX A;  1YKJ A;  2Q7V A;  3H8I A;  3AD7 B;  2BS3 A;  2BRA A;  1LTX R;  3G5R A;  1OJD A;  2X8H A;  2XVF A;  4YTM A;  2QAE A;  4GF7 A;  1JEH A;  4PAB A;  4X9N A;  4OPT A;  1ZMD A;  4CRT A;  3NK2 X;  2C65 A;  4XWR A;  2E4G A;  3SGL A;  4J56 A;  2E5V A;  2VVM A;  2XCG A;  4YWO A;  4GDP A;  1FL2 A;  1NDA A;  2BK4 A;  2VOU A;  3AWI A;  4GUV A;  1AOG A;  4Z43 A;  3ZDN A;  3C4A A;  3UTH A;  2WPE A;  1MXT A;  1CF3 A;  1PJ5 A;  4X4J A;  3KU9 A;  5KOW A;  3AEC A;  1PJ6 A;  4A99 A;  1B37 A;  4II2 A;  1E7P A;  1B4V A;  3QFB A;  3IHG A;  4CCR A;  4BJY A;  1NHS A;  3BHF A;  3LJP A;  2Q0K A;  2C3C A;  1FEC A;  2ZBW A;  5HHF A;  3EAO A;  3UKK A;  2BK5 A;  2FBW A;  3K7T A;  1GRB A;  4LA1 A;  5BVA A;  1YQ4 A;  1XDI A;  3O0H A;  2OAL A;  4Z26 A;  5EBK A;  3OC4 A;  3Q9T A;  1COY A;  2PYX A;  2Z5Y A;  2BXR A;  3T37 A;  1FEB A;  4KX6 A;  1GOS A;  2APG A;  3L1R A;  1CJ4 A;  4U8K A;  4YSX A;  4EQR A;  1N4U A;  1ZDL A;  3AE6 A;  2YVJ A;  3GD3 A;  3CNJ A;  3LZW A;  3BNU A;  4GAV A;  4EQX A;  3CPI G;  3KPK A;  4NTE A;  1GV4 A;  1KNP A;  1ZMC A;  5BUL A;  3AYI A;  2YM2 A;  2FJA A;  4B1B A;  4IVM B;  3T2Z A;  4AT0 A;  2FJD A;  4B66 A;  1NEK A;  2V60 A;  4G73 A;  3NK1 X;  5HYM A;  1BGJ A;  2EQ6 A;  1E39 A;  2XLT A;  4C3Y A;  4AP1 A;  2IID A;  4E0V A;  3B3R A;  3UKF A;  3CGC A;  1ONF A;  4ADW A;  3DJD A;  4A6N A;  1JNR A;  2Z5X A;  2Q6U A;  2C3D A;  5GRT A;  3UTF A;  3NRN A;  3P4P A;  3RP8 A;  3UKL A;  1ZKQ A;  1TDO A;  3AD8 B;  3EF6 A;  2FJB A;  3HYW A;  2BAB A;  3GRT A;  2YLW A;  4H4V A;  4H4Y A;  4JQ9 A;  4BK3 A;  3PVC A;  3ICT A;  3CTY A;  1VG0 A;  4K22 A;  2GMJ A;  1DJN A;  1L9C A;  4GAP A;  4C74 A;  1DOC A;  1Y56 B;  4U8L A;  3AYJ A;  2NPX A;  3NNE A;  2HQM A;  3URH A;  1PBF A;  3ALM A;  3NK0 X;  4AOX A;  5HXI A;  3AE1 A;  3P4R A;  4B67 A;  4USQ A;  1KF6 A;  5BUK A;  4ZCC A;  2GV8 A;  4A6N B;  3UP5 A;  4JDR A;  3F8P A;  2EQ7 A;  4MJW A;  2C67 A;  3LOV A;  5JCM A;  3FPZ A;  3NTD A;  1H6V A;  2WP9 A;  3BI2 A;  2CDU A;  2VZ2 A;  2GH5 A;  3NGC X;  2WPC A;  4AT2 A;  2IVD A;  2GR3 A;  2GAG B;  3PS9 A;  3EAN A;  2UZZ A;  4H2P A;  4EM4 A;  2F5Z A;  1LV0 A;  1KSU A;  2QA1 A;  3CGE A;  3ATQ A;  1H84 A;  3GMB A;  3R9U A;  1V59 A;  2V5Z A;  1E6E A;  1GXF A;  3AE7 A;  4U2L A; 
#chains in the Genus database with same CATH homology
 1GRH A;  5C3J A;  1NG4 A;  3AEF A;  4H2N A;  3VQR A;  3KA7 A;  1D7L A;  4U8J A;  1K0J A;  2A89 A;  4UP3 A;  2WBA A;  3HZL A;  4H4Q A;  3AE2 A;  2XFQ A;  5JCI A;  1S2Q A;  3V3O A;  3I6D A;  5KMQ A;  4OPI A;  2YG6 A;  5KXJ A;  5U25 A;  1BWC A;  2C7G A;  2X3N A;  4N9X A;  4CNJ A;  3GD4 A;  3UKH A;  4Z2T A;  3AEA A;  4BK2 A;  3M0O A;  2GR1 A;  2XLP A;  5IQ4 A;  1ZY8 A;  3SY4 A;  5KWF A;  1NAA A;  3G5Q A;  1PXA A;  4B65 A;  2C70 A;  3G5S A;  1NG3 A;  2R9Z A;  2YG7 A;  4U8O A;  5U1O A;  1PBE A;  4WX1 A;  3UTG A;  4Z25 A;  3Q6J A;  1LVL A;  1PJ7 A;  4CY8 A;  4O5Q A;  4H7U A;  4JNQ A;  2O9Z A;  4YSZ A;  3KD9 A;  4EIQ A;  3DGH A;  3UCL A;  4TM1 A;  3AEG A;  2RGJ A;  5CKU A;  3RP7 A;  5KMR A;  3B6D A;  1NPX A;  4U2T A;  4FK1 C;  1IUX A;  4EMJ A;  4YTP A;  2X8C A;  1IUU A;  2RAB A;  3IWA A;  1YY5 A;  4FK1 A;  2GQF A;  3UOX A;  2GEW A;  2IVE A;  2YR4 A;  2BC1 A;  3DJG X;  4BJZ A;  3AYL A;  3AED A;  4CY6 A;  1D4E A;  2C4C A;  3AE5 A;  4A65 A;  1TDK A;  4H4W A;  4XXG A;  5HY5 A;  3QFA A;  2A8X A;  2XDO A;  5J60 A;  4EMW A;  1KFY A;  1BF3 A;  4UDP A;  3AD9 B;  3NIX A;  1TYT A;  3CNS A;  2YG5 A;  3UKQ A;  1VQW A;  4REK A;  4J34 A;  1CJC A;  2XVJ A;  4K7Z A;  2WOV A;  3VR8 A;  1P2H A;  1K4Q A;  4BK1 A;  1L9D A;  2AQJ A;  5M10 A;  3IF9 A;  3DK9 A;  2BRY A;  2R0G A;  2WOW A;  4IV9 A;  3UOZ A;  4EIP A;  2WDQ A;  3CMM A;  3ADA B;  3QSM A;  1H82 A;  2I0Z A;  4DSG A;  2ZZ0 A;  1GEU A;  1PN0 A;  4XWZ A;  3DH9 A;  5KRQ A;  3GYX A;  2EQ9 A;  4NEV A;  1DJQ A;  3SZ0 A;  3I3L A;  2EQ8 A;  2C64 A;  3GMC A;  2JAE A;  2BC0 A;  4OPG A;  4A5L A;  2X50 A;  3DME A;  4Y4M A;  2TPR A;  2YLX A;  3S5W A;  3KKJ A;  1Y56 A;  1JRY A;  3NYE A;  3QSE A;  3BHK A;  4DSH A;  3ISH A;  2B9W A;  3AXB A;  5ER0 A;  1XPQ A;  1Q1W A;  4YSH A;  5FS8 A;  4H4T A;  3NH3 X;  2GVC A;  3DA1 A;  2Y6R A;  2C75 A;  2C73 A;  1S2Y A;  3AEE A;  3UP4 A;  1PS9 A;  2XVE A;  5TR3 A;  2C76 A;  2GR0 A;  3KLJ A;  3DJE A;  2PHH A;  2YVG A;  4K5S A;  2GB0 A;  3ABV A;  3LB8 A;  2GR2 A;  2CFY A;  2WQY A;  1FOH A;  2Y6Q A;  2YR6 A;  3KVE A;  4RG4 A;  4RG3 A;  2YM1 A;  1L0V A;  1QLB A;  1YQZ A;  4U2S A;  4YTN A;  4ECH A;  1PXC A;  1CC2 A;  5GSN A;  3FMW A;  1MO9 A;  4P9S A;  3VRD B;  4A9W A;  1P2E A;  4D04 A;  4OVI A;  2WET A;  1GND A;  3LXD A;  1RSG A;  5EB4 A;  2XLU A;  5FS7 A;  1E1M A;  4JY3 A;  3CGB A;  3SXI A;  3CNP A;  3VR9 A;  1PBD A;  1BKW A;  1IJH A;  2JB3 A;  3UTE A;  4C77 A;  4EQS A;  3QJ4 A;  3K7M X;  2ARD A;  1QJD A;  1D5T A;  1FEA A;  1N4V A;  3HYX A;  1GRT A;  1VRQ B;  2OLO A;  1E1L A;  1JOA A;  1BGN A;  2GMH A;  4ZCD A;  2W0H A;  3D1C A;  3VRB A;  2WOI A;  1ZK7 A;  4D03 A;  3AEB A;  2GRT A;  3LAD A;  3HYV A;  4I58 A;  4J57 A;  3RHA A;  1EL9 A;  1CBO A;  5M0Z A;  3OZ2 A;  4TLX A;  4CCQ A;  1NHR A;  2BS2 A;  3P1W A;  1OJC A;  1GER A;  2BCP A;  2R4E A;  1M6I A;  2V3A A;  4J31 A;  1IUS A;  3UKA A;  1GAL A;  2YLZ A;  3V3N A;  3PO7 A;  4IVO B;  1LQU A;  4OCG A;  1KSS A;  3JSK A;  4JY2 A;  2B76 A;  4II3 A;  1GSN A;  2ZZC A;  1GRA A;  1TDN A;  2H88 A;  4GCM A;  4Z2U A;  5C2T A;  4HB9 A;  5IPY A;  3KPF A;  2WDV A;  4RSL A;  1H86 A;  5U63 A;  4BUR A;  2YR5 A;  4K2X A;  4H4Z A;  3CN8 A;  1X31 B;  3SZW A;  4U8M A;  2JBV A;  3II4 A;  2GQW A;  3C96 A;  3NG7 X;  3NN6 X;  1DXL A;  1IUT A;  3DK8 A;  2NVK X;  1DOE A;  2Q0L A;  1F8S A;  2R45 A;  4TM3 A;  1O94 A;  2R0C A;  3ITJ A;  3AB1 A;  4B63 A;  3AE4 A;  1CC4 A;  1GRF A;  3UKP A;  4B64 A;  2BYB A;  1EBD A;  4UDR A;  1OJ9 A;  4Z44 A;  3NYC A;  1GRG A;  3RP6 A;  4ZN0 A;  5JCL A;  1L9E A;  2B9X A;  1GTH A;  4Y4N A;  3NN0 X;  3IC9 A;  3T31 A;  4B69 A;  1Q9I A;  3RNM A;  1GT8 A;  3T2K A;  3GDN A;  1GET A;  1H7X A;  2GF3 A;  3UOV A;  2XVI A;  3L8K A;  3SX6 A;  2BS4 A;  3CGD A;  4EM3 A;  1W4X A;  3P4Q A;  1OJT A;  2AR8 A;  1TYP A;  2YWL A;  4TLZ A;  5KVH A;  4NWZ A;  3LZX A;  4U8P A;  2B9Y A;  3AE8 A;  4NTC A;  2R4J A;  1LQT A;  4FX9 A;  4J33 A;  1PHH A;  3P4S A;  4GRT A;  1JRZ A;  2WP5 A;  4WCT A;  4USR A;  5CQF A;  2WU5 A;  1D4D A;  4H4X A;  2XYO A;  4YKF A;  1IUV A;  4ICY A;  3CND A;  1RP0 A;  1LPF A;  1N1P A;  1S3E A;  2WP6 A;  4EQW A;  2YLS A;  2DKI A;  5KOX A;  5KNL A;  4FDC B;  1JRX A;  1EL5 A;  1K0L A;  2H89 A;  3CNT A;  4G74 A;  3CPH G;  4OPC A;  3GRS A;  4TM4 A;  1Q1R A;  2X8G A;  3DJJ A;  4APN A;  4H4U A;  2V3B A;  4G9K A;  5J7X A;  3GWF A;  2VVL A;  4NZH A;  1H7W A;  1E1K A;  3CIR A;  4C5O A;  2YAU A;  4IA6 A;  4YT0 A;  3NYF A;  4DGK A;  3COX A;  2JKC A;  1GES A;  4H2Q A;  3P9U A;  5LV9 A;  3ATR A;  3BI5 A;  2A87 A;  1DOB A;  2XLS A;  2WDR A;  4JN9 A;  2WS3 A;  4J36 A;  3NT6 A;  4PAA A;  1F8R A;  4AP3 A;  3ICR A;  2B7R A;  3K30 A;  3SM8 A;  5JCK A;  4O5U A;  3K7Q X;  2VQ7 A;  1IUW A;  2XFU A;  3DK4 A;  1ZX9 A;  4KPR A;  1XHC A;  2X99 A;  4OPL A;  2JB2 A;  4TM0 A;  2WHD A;  1O5W A;  2XFO A;  4OPD A;  3SQP A;  1KNR A;  2R46 A;  1CJ3 A;  3SFE A;  2WU2 A;  1Z6L A;  3BNM A;  3NHO X;  4X9M A;  3FBS A;  2QA2 A;  4GDE A;  4YKG A;  4IA5 A;  1PXB A;  5FS6 A;  1YQ3 A;  4NNJ A;  4CBQ A;  1S3B A;  1ZP0 A;  2WPF A;  2ZZB A;  1F3P A;  3GWD A;  1JNZ A;  1NEN A;  1HYU A;  1TRB A;  2CVJ A;  3FG2 P;  4H2R A;  1ZOY A;  1H81 A;  2VVL G;  4I59 A;  3M13 A;  4BV6 A;  3DGZ A;  2YVF A;  4NEW A;  4LU6 A;  1PBC A;  5EB5 A;  5KVI A;  4UDQ A;  3WE0 A;  1BZL A;  1CL0 A;  1OJA A;  1RYI A;  2XFN A;  3GYJ A;  3CPJ G;  1E1N A;  4NTD A;  3NKS A;  4YXD A;  4OPU A;  2JB1 A;  2JK6 A;  2R0P A;  2VRM A;  4G6H A;  3V76 A;  2BXS A;  2E1M A;  3EPT A;  4H50 A;  1D4C A;  4JNA A;  4A7A A;  3AE9 A;  5JCN A;  1MOK A;  1N4W A;  1KDG A;  3GDP A;  3IHM A;  1QO8 A;  3SYI A;  1ELI A;  1LJ1 A;  4U8I A;  5DBJ A;  5L46 A;  2OA1 A;  4G6G A;  2OLN A;  2GAH B;  4M52 A;  1M64 A;  2BK3 A;  2XFP A;  1GRE A;  3ICS A;  1VG9 A;  4LII A;  1O95 A;  1Y0P A;  4H4P A;  5EOW A;  1F8W A;  1PBB A;  3FIM B;  2VRL A;  3M12 A;  3ALL A;  2XVH A;  4H4R A;  1B5Q A;  1D7Y A;  3F8D A;  3E1T A;  1H83 A;  2RGH A;  1ZOV A;  2QCU A;  1VDC A;  2C66 A;  4H4S A;  2BA9 A;  5IQ1 A;  1EL7 A;  2YG4 A;  1NHP A;  3RED A;  4C3X A;  4Z2R A;  4A79 A;  3SZF A;  2BAC A;  1CHU A;  1DNC A;  1REO A;  2AAQ A;  1TDE A;  3T0K A;  4Y4L A;  2DKH A;  2TMD A;  1B8S A;  4J2W A;  2YG3 A;  1XAN A;  2WEU A;  5BRT A;  1TDF A;  4HA6 A;  5FS9 A;  4K5R A;  3VRA A;  2ACZ A;  3QVR A;  2V61 A;  1DOD A;  3D8X A;  3H8L A;  3NTA A;  5KMP A;  2WES A;  3QVP A;  3AE3 A;  3S61 A;  1JU2 A;  3BI4 A;  5KMS A;  3T2Y A;  1CJ2 A;  1NHQ A;  2FJE A;  3SZC A;  4EMI A;  2B7S A;  3C4N A;  3H4K A;  2CUL A;  1UKV G;  2J3N A;  4U8N A;  4DNA A;  3F8R A;  4CNK A;  3GSI A;  1FCD A;  1F6M A;  4GR1 A;  4K8D A;  1PDH A;  4AOS A;  2YQU A;  5FMH A;  4YSY A;  1K0I A;  2YLT A;  2C72 A;  3SFD A;  4Z24 A;  2XLR A;  2RGO A;  1EL8 A;  2V6O A;  2YLR A;  1GPE A;  4B68 A;  1SEZ A;  2VQB A;  3GYI A;  2BCG G;  1GTE A;  3T14 A;  2OAM A;  3QSS A;  3NLC A;  3UOY A;  3ALJ A;  1CC6 A;  3ZYX A;  1YKJ A;  2Q7V A;  3H8I A;  3AD7 B;  2BS3 A;  2BRA A;  1LTX R;  3G5R A;  1OJD A;  2X8H A;  2XVF A;  4YTM A;  2QAE A;  4GF7 A;  1JEH A;  4PAB A;  4X9N A;  4OPT A;  1ZMD A;  4CRT A;  3NK2 X;  2C65 A;  4XWR A;  2E4G A;  3SGL A;  4J56 A;  2E5V A;  2VVM A;  2XCG A;  4YWO A;  4GDP A;  1FL2 A;  1NDA A;  2BK4 A;  2VOU A;  3AWI A;  4GUV A;  1AOG A;  4Z43 A;  3ZDN A;  3C4A A;  3UTH A;  2WPE A;  1MXT A;  1CF3 A;  1PJ5 A;  4X4J A;  3KU9 A;  5KOW A;  3AEC A;  1PJ6 A;  4A99 A;  1B37 A;  4II2 A;  1E7P A;  1B4V A;  3QFB A;  3IHG A;  4CCR A;  4BJY A;  1NHS A;  3BHF A;  3LJP A;  2Q0K A;  2C3C A;  1FEC A;  2ZBW A;  5HHF A;  3EAO A;  3UKK A;  2BK5 A;  2FBW A;  3K7T A;  1GRB A;  4LA1 A;  5BVA A;  1YQ4 A;  1XDI A;  3O0H A;  2OAL A;  4Z26 A;  5EBK A;  3OC4 A;  3Q9T A;  1COY A;  2PYX A;  2Z5Y A;  2BXR A;  3T37 A;  1FEB A;  4KX6 A;  1GOS A;  2APG A;  3L1R A;  1CJ4 A;  4U8K A;  4YSX A;  4EQR A;  1N4U A;  1ZDL A;  3AE6 A;  2YVJ A;  3GD3 A;  3CNJ A;  3LZW A;  3BNU A;  4GAV A;  4EQX A;  3CPI G;  3KPK A;  4NTE A;  1GV4 A;  1KNP A;  1ZMC A;  5BUL A;  3AYI A;  2YM2 A;  2FJA A;  4B1B A;  4IVM B;  3T2Z A;  4AT0 A;  2FJD A;  4B66 A;  1NEK A;  2V60 A;  4G73 A;  3NK1 X;  5HYM A;  1BGJ A;  2EQ6 A;  1E39 A;  2XLT A;  4C3Y A;  4AP1 A;  2IID A;  4E0V A;  3B3R A;  3UKF A;  3CGC A;  1ONF A;  4ADW A;  3DJD A;  4A6N A;  1JNR A;  2Z5X A;  2Q6U A;  2C3D A;  5GRT A;  3UTF A;  3NRN A;  3P4P A;  3RP8 A;  3UKL A;  1ZKQ A;  1TDO A;  3AD8 B;  3EF6 A;  2FJB A;  3HYW A;  2BAB A;  3GRT A;  2YLW A;  4H4V A;  4H4Y A;  4JQ9 A;  4BK3 A;  3PVC A;  3ICT A;  3CTY A;  1VG0 A;  4K22 A;  2GMJ A;  1DJN A;  1L9C A;  4GAP A;  4C74 A;  1DOC A;  1Y56 B;  4U8L A;  3AYJ A;  2NPX A;  3NNE A;  2HQM A;  3URH A;  1PBF A;  3ALM A;  3NK0 X;  4AOX A;  5HXI A;  3AE1 A;  3P4R A;  4B67 A;  4USQ A;  1KF6 A;  5BUK A;  4ZCC A;  2GV8 A;  4A6N B;  3UP5 A;  4JDR A;  3F8P A;  2EQ7 A;  4MJW A;  2C67 A;  3LOV A;  5JCM A;  3FPZ A;  3NTD A;  1H6V A;  2WP9 A;  3BI2 A;  2CDU A;  2VZ2 A;  2GH5 A;  3NGC X;  2WPC A;  4AT2 A;  2IVD A;  2GR3 A;  2GAG B;  3PS9 A;  3EAN A;  2UZZ A;  4H2P A;  4EM4 A;  2F5Z A;  1LV0 A;  1KSU A;  2QA1 A;  3CGE A;  3ATQ A;  1H84 A;  3GMB A;  3R9U A;  1V59 A;  2V5Z A;  1E6E A;  1GXF A;  3AE7 A;  4U2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...