1F8RA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
483
structure length
483
Chain Sequence
RNPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords L-AMINO ACID OXIDASE
total genus 171
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8rA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8rA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8rA01
1XHCA 1KSUA 2YLTA 1B4VA 1NPXA 4ZCDA 2XFNA 3QSEA 4TLZA 1S3EA 4A7AA 1M64A 4EQXA 2OLOA 1K0IA 3WE0A 1K4QA 1NHPA 1S2QA 3NYFA 3UOVA 1L9CA 4B1BA 3EAOA 3ALLA 3DH9A 2YG3A 1COYA 1GREA 1LTXR 4A5LA 2FJAA 2R0CA 3ALJA 4U8PA 3IC9A 3RP7A 3KLJA 3G5QA 1OJAA 3JSKA 2RABA 5JCKA 3COXA 3GYIA 3D1CA 4LU6A 2XVIA 2B7SA 3CNDA 3EF6A 2WP5A 2YWLA 1NHSA 3PS9A 4O5QA 2VOUA 5LV9A 3BI4A 3QSSA 4NTDA 4TM1A 1N4UA 3DJDA 3B6DA 5EB5A 2BA9A 3ICSA 1LPFA 3AE6A 1H6VA 1VRQB 4B64A 4BV6A 2OALA 4JY2A 4A6NB 2O9ZA 2YLWA 2XLPA 2YVGA 2BACA 4OPGA 3VR9A 5JCLA 3VQRA 1QJDA 3CN8A 3H8IA 4OCGA 5J7XA 5TR3A 1LJ1A 1QO8A 2JB1A 3AE3A 2FJEA 4Z26A 1LQTA 4X9MA 4GUVA 4M52A 4Y4LA 3IHMA 2FJBA 4RSLA 3ABVA 3ZDNA 4TLXA 4U8KA 4CY8A 2XFOA 4JNQA 2YQUA 3SM8A 4UDQA 4C77A 4H4ZA 5IQ4A 2WDVA 1CJCA 2OLNA 2R46A 4J33A 2R9ZA 3UKLA 1YQZA 3C4AA 5U1OA 1IUVA 1E1KA 1W4XA 2F5ZA 4Z25A 2XLTA 1L9EA 4AT2A 1H7XA 5FS7A 2E4GA 4ZN0A 3NYCA 2C73A 4J57A 4DGKA 2Q7VA 4IA6A 3QVPA 3RP6A 1DJQA 4EIPA 5KRQA 4YTNA 1GTHA 2AAQA 1B37A 3H8LA 2XFPA 1IUUA 3UKHA 1TDNA 4H2PA 3F8PA 4J34A 4A6NA 3AEFA 4RG4A 1PBCA 2ZZCA 4USRA 2GB0A 1TDFA 3GD4A 5HY5A 5L46A 1GRFA 4PABA 3I6DA 2XFQA 5GRTA 4Z43A 1GETA 1PXBA 3AYLA 1AOGA 4TM4A 4BK2A 2YG4A 1JNZA 4ECHA 3G5SA 3OC4A 1QLBA 3G5RA 3RNMA 3UTHA 2C66A 3ATRA 4X4JA 5JCNA 1N4VA 1GRTA 1FEBA 4GF7A 3FMWA 3NIXA 2B76A 1TRBA 1D7YA 4D04A 3SQPA 1GSNA 3CNTA 2XLUA 1GEUA 2YR5A 2QCUA 1Y0PA 3DJJA 2TMDA 4OPLA 2C72A 2NPXA 1BKWA 3OZ2A 2IIDA 1PHHA 3UOZA 4Y4MA 2WU5A 4AOXA 2IVDA 3BHKA 3NK2X 1H84A 2WOIA 4BJZA 2BS4A 3P4PA 2GF3A 2YLSA 2GQWA 5ER0A 2PHHA 3AEGA 3NK1X 4YSZA 2B9XA 4H4PA 1ZMDA 5BUKA 4OPTA 3BI5A 3AE7A 4JN9A 1JOAA 2AR8A 2JK6A 2WOVA 2XVJA 4CBQA 2XYOA 4H4TA 4C3YA 4H2QA 1CC2A 2XFUA 4H4VA 5EBKA 3V3NA 2X3NA 2VRLA 1X31B 1F8WA 1NG3A 1JEHA 2WETA 3AYIA 1EBDA 3K7MX 2R0GA 3LOVA 3NNEA 4U2SA 3V76A 1S3BA 5U63A 1KF6A 3L1RA 3GDPA 4B69A 2CULA 3B3RA 2ZZ0A 3CPIG 4DSGA 1BF3A 1TDEA 5KOWA 3AD8B 3K7TA 4H4UA 1Y56A 2AQJA 1Q1RA 1F3PA 1GV4A 1H82A 1FCDA 1FEAA 1F6MA 3GMCA 3C4NA 4H4SA 2R4JA 5KXJA 2E1MA 1ZMCA 3NK0X 4B63A 4AP1A 5BRTA 2V61A 1H86A 1GRBA 1VDCA 2WPEA 5FMHA 2EQ9A 2YR6A 3GYJA 3AXBA 4YTPA 4EM4A 4J36A 2RGJA 2YLRA 1E1MA 4JDRA 3T37A 3V3OA 4D03A 3IHGA 4J56A 1NG4A 3GDNA 4H7UA 1D7LA 1NDAA 1NHRA 5GSNA 3M13A 1ONFA 2BK4A 1E7PA 2WBAA 2WU2A 1EL9A 4EQSA 2C65A 2Q0LA 3NTDA 4H4RA 3GWFA 4EM3A 3FBSA 4CNJA 1MOKA 1GOSA 2VVLA 3ICRA 1IUWA 1GALA 2I0ZA 2JB3A 4HA6A 4UDRA 4X9NA 2WDRA 4U8JA 3CPHG 3C96A 4GDEA 4CNKA 4GCMA 4H4QA 2VQBA 2H88A 2YLZA 3UTEA 5M10A 2GR1A 2APGA 3LZWA 2XVHA 4BURA 4I58A 3UTGA 4U8OA 4B66A 2Q0KA 1DXLA 3KVEA 1FL2A 2QA2A 2NVKX 2GEWA 2YM1A 4JNAA 2ZBWA 1GPEA 2C76A 1IUTA 1S2YA 1KSSA 2R45A 3CGBA 3DK8A 3REDA 2PYXA 4Z2TA 3FIMB 1D4DA 4CCQA 2YR4A 1YKJA 4O5UA 4FK1A 5C3JA 1TYTA 3K7QX 4PAAA 3I3LA 1MXTA 3P1WA 2XCGA 3NN6X 2BXRA 3D8XA 3F8RA 3CPJG 1Z6LA 1F8SA 2WEUA 1CJ4A 1M6IA 2DKHA 4OPCA 5IPYA 2OA1A 1O95A 1CL0A 4KPRA 4AP3A 1KNPA 2GR3A 2GVCA 4IA5A 4Z24A 3H4KA 5BVAA 2JKCA 2YG6A 1O5WA 3UTFA 4YTMA 2C67A 3ZYXA 3DJEA 1CBOA 4GR1A 4YWOA 5HHFA 4IVOB 2ACZA 1GNDA 3NT6A 1GRHA 3M0OA 4C5OA 1PJ6A 2J3NA 5EB4A 2CDUA 2BYBA 4Z2UA 5J60A 2XLRA 2WOWA 1PXAA 3CTYA 1VG0A 3IWAA 4NZHA 4AT0A 3UOYA 3NRNA 4YXDA 1ZK7A 4U8IA 2UZZA 4K7ZA 2YAUA 1E1NA 3UCLA 1JU2A 4J31A 2V3AA 4C3XA 1N1PA 3ICTA 1FOHA 3FG2P 1CJ3A 3Q6JA 4U8NA 2VVMA 1CC6A 1BGJA 2CVJA 1VQWA 2QAEA 3AB1A 5KVIA 2VVLG 3EANA 4EMIA 4H2NA 2C75A 2RGOA 3UKFA 4RG3A 1IJHA 3ITJA 4A65A 2BXSA 4EMWA 4FDCB 1XANA 3BNMA 2A8XA 4KX6A 3P9UA 4H4XA 1OJDA 2JBVA 3AECA 3RHAA 2GRTA 3UOXA 1YQ4A 4P9SA 2GMJA 1B8SA 4ZCCA 3NKSA 3SFDA 4EQWA 3ISHA 2BS2A 1JRZA 2CFYA 4K5SA 2YVJA 1DOCA 5JCMA 3HZLA 1NAAA 1H7WA 4XWRA 4JQ9A 1GRAA 4U2LA 1K0JA 4A9WA 2YG5A 4YSYA 2WS3A 1BZLA 3AEBA 3AE4A 3AE1A 4A79A 2OAMA 4IVMB 5U25A 3AEDA 4EIQA 1GXFA 1ZP0A 4B68A 4GRTA 3P4QA 4K22A 3URHA 5EOWA 1PBFA 4ADWA 1JNRA 1KDGA 1KFYA 3VRDB 4N9XA 3S5WA 1PDHA 2X99A 1PBDA 2V6OA 3UP4A 1H81A 1RP0A 2WQYA 3BNUA 4U2TA 3LXDA 1XPQA 2BCPA 4B65A 1DNCA 3QFBA 4OPDA 3IF9A 2WPFA 3AE5A 2JB2A 3UP5A 1Q1WA 4WX1A 1YQ3A 1BWCA 2GR0A 4APNA 1ELIA 1GRGA 2FBWA 3ATQA 2XVEA 3QVRA 4FX9A 3LZXA 4BK3A 2EQ6A 3KA7A 3AE2A 1DODA 3R9UA 4YSHA 3CIRA 4J2WA 3S61A 3LJPA 4AOSA 2QA1A 3Q9TA 4H50A 4XXGA 2HQMA 2V5ZA 3UKAA 4Z2RA 2XDOA 5KOXA 3AE8A 2DKIA 3F8DA 4YT0A 3M12A 3NN0X 4C74A 1PJ5A 2GH5A 1LVLA 2WHDA 1TDKA 2GAGB 3GMBA 2BC0A 1ZKQA 1OJ9A 2Z5XA 2GV8A 1GT8A 2GQFA 4UP3A 1REOA 2Z5YA 1DOEA 2R0PA 5HXIA 1DJNA 2R4EA 1ZY8A 4U8LA 1PJ7A 3GSIA 2BS3A 3AEAA 5CKUA 1PBEA 5FS6A 1D4CA 1D5TA 1V59A 1ZOYA 3AE9A 1B5QA 3P4RA 5KVHA 2H89A 2FJDA 3PO7A 2V60A 4A99A 5KWFA 3FPZA 1TDOA 1GERA 1RYIA 1ZDLA 2WESA 4OVIA 4UDPA 3UKKA 4H4YA 2WDQA 4GDPA 2E5VA 2TPRA 2X8CA 2BK5A 3K30A 1O94A 3GWDA 4NTEA 5C2TA 1JRXA 1IUSA 4MJWA 2Y6QA 1E1LA 1Q9IA 3NG7X 1K0LA 3AWIA 2BCGG 1NEKA 4CCRA 3VR8A 1CC4A 1NHQA 3NYEA 1E6EA 2A87A 4K5RA 4NEWA 4E0VA 2VQ7A 1P2HA 3DJGX 2BK3A 3KPFA 2EQ8A 3NLCA 4K8DA 4YKFA 1SEZA 2W0HA 2YM2A 3O0HA 4EQRA 2BABA 3GD3A 2GR2A 3VRBA 1KNRA 5CQFA 4JY3A 2B7RA 4WCTA 5M0ZA 1FECA 2C64A 4BJYA 4FK1C 3GRSA 3ALMA 2BC1A 2WP6A 2Y6RA 3DGZA 3EPTA 3LB8A 4DSHA 3KD9A 4K2XA 3CGCA 2ARDA 1GTEA 3P4SA 2B9YA 3DA1A 3UKQA 3SGLA 3UKPA 5BULA 3CNPA 4B67A 2GMHA 1N4WA 2JAEA 3AYJA 2V3BA 4LIIA 4USQA 4Z44A 2X8HA 1ZOVA 5IQ1A 1PXCA 1EL8A 3QFAA 4HB9A 3E1TA 4YKGA 1E39A 3NGCX 5FS8A 1JRYA 3DMEA 4OPIA 2XVFA 2WPCA 1TYPA 1F8RA 3DK9A 3L8KA 1L0VA 3II4A 4YSXA 1CF3A 3QJ4A 3KU9A 4ICYA 3ADAB 4U8MA 2IVEA 1EL7A 1PN0A 2YVFA 4CRTA 3NTAA 4NTCA 3AD7B 1UKVG 4XWZA 1PS9A 5JCIA 1XDIA 1RSGA 3GRTA 2XLSA 2VZ2A 5DBJA 4H4WA 5HYMA 1CJ2A 3BI2A 4I59A 4OPUA 2YLXA 2GAHB 2YG7A 4CY6A 4DNAA 4IV9A 2Q6UA 4H2RA 4REKA 2ZZBA 2A89A 4BK1A 4EMJA 2X8GA 4NEVA 3BHFA 1Y56B 3CNJA 3DK4A 3LADA 3PVCA 1H83A 3QSMA 3RP8A 1L9DA 1OJCA 2C70A 3CGEA 2B9WA 5FS9A 1VG9A 3CNSA 1D4EA 3NH3X 1HYUA 1GESA 3DGHA 3NHOX 1OJTA 2X50A 4LA1A 3SFEA 2C3DA 2C3CA 1LV0A 1LQUA 2VRMA 1DOBA 2C7GA 1PBBA 3AD9B 1P2EA 1NENA 2WP9A 3KKJA 1BGNA 3VRAA 1EL5A 4TM3A 1ZX9A 1YY5A 1IUXA 1MO9A 4TM0A 4Y4NA 3AEEA 2EQ7A 2RGHA 1CHUA 3CGDA
chains in the Genus database with same CATH superfamily
1XHCA 1KSUA 2YLTA 1B4VA 1NPXA 4ZCDA 2XFNA 3QSEA 4TLZA 1S3EA 4A7AA 1M64A 4G73A 4EQXA 2OLOA 3WE0A 1K0IA 1K4QA 1NHPA 1S2QA 3NYFA 3UOVA 1L9CA 4B1BA 3EAOA 3ALLA 3DH9A 2YG3A 1COYA 1GREA 1LTXR 4A5LA 2FJAA 2R0CA 3HYXA 3ALJA 4U8PA 3IC9A 3RP7A 3KLJA 3G5QA 1OJAA 3JSKA 2RABA 5JCKA 3COXA 3GYIA 3D1CA 4LU6A 2XVIA 2B7SA 3CNDA 3EF6A 2WP5A 2YWLA 1NHSA 3PS9A 4O5QA 2VOUA 5LV9A 3BI4A 3QSSA 4NTDA 4TM1A 1N4UA 3DJDA 3B6DA 5EB5A 2BA9A 3ICSA 1LPFA 3AE6A 1H6VA 1VRQB 4B64A 4BV6A 2OALA 4JY2A 4A6NB 2O9ZA 2YLWA 2XLPA 2YVGA 2BACA 4OPGA 3VR9A 5JCLA 3VQRA 1QJDA 3CN8A 3H8IA 4OCGA 5J7XA 5TR3A 1LJ1A 1QO8A 2JB1A 3AE3A 2FJEA 4Z26A 1LQTA 4X9MA 4GUVA 4M52A 4Y4LA 3IHMA 2FJBA 4RSLA 3SZ0A 3ABVA 3ZDNA 4TLXA 4U8KA 4CY8A 2XFOA 4JNQA 2YQUA 3SM8A 4UDQA 4C77A 4H4ZA 5IQ4A 2WDVA 1CJCA 2OLNA 2R46A 4J33A 2R9ZA 3UKLA 1YQZA 3C4AA 5U1OA 1IUVA 1E1KA 1W4XA 2F5ZA 4Z25A 2XLTA 1L9EA 4AT2A 1H7XA 5FS7A 2E4GA 4ZN0A 3NYCA 2C73A 4J57A 4DGKA 4GAVA 2Q7VA 4IA6A 3QVPA 3RP6A 1DJQA 4EIPA 5KRQA 4YTNA 1GTHA 2AAQA 1B37A 3H8LA 2XFPA 1IUUA 3UKHA 1TDNA 4H2PA 3F8PA 4J34A 4A6NA 3AEFA 4RG4A 1PBCA 2ZZCA 4USRA 2GB0A 1TDFA 3GD4A 5HY5A 5L46A 1GRFA 4PABA 3I6DA 2XFQA 5GRTA 4Z43A 1GETA 1PXBA 3AYLA 1AOGA 4TM4A 4BK2A 2YG4A 1JNZA 4ECHA 3G5SA 3OC4A 1QLBA 3G5RA 3RNMA 3UTHA 2C66A 3ATRA 4X4JA 5JCNA 1N4VA 1GRTA 1FEBA 4GF7A 3FMWA 3NIXA 2B76A 1TRBA 1D7YA 4D04A 3SQPA 1GSNA 3CNTA 2XLUA 1GEUA 2YR5A 2QCUA 1Y0PA 3DJJA 2TMDA 4OPLA 2C72A 2NPXA 1BKWA 3OZ2A 2IIDA 1PHHA 3UOZA 4Y4MA 2WU5A 4AOXA 2IVDA 3BHKA 3NK2X 1H84A 2WOIA 4BJZA 2BS4A 3P4PA 3SZFA 2GF3A 2YLSA 2GQWA 5ER0A 2PHHA 3AEGA 3NK1X 4YSZA 2B9XA 4H4PA 1ZMDA 5BUKA 4OPTA 3BI5A 3AE7A 4JN9A 1JOAA 2AR8A 2JK6A 2WOVA 2XVJA 4G6HA 4CBQA 2XYOA 4H4TA 4C3YA 4H2QA 1CC2A 2XFUA 4H4VA 5EBKA 3V3NA 2X3NA 2VRLA 1X31B 1F8WA 1NG3A 1JEHA 2WETA 3AYIA 1EBDA 3K7MX 2R0GA 3LOVA 3NNEA 4U2SA 3V76A 1S3BA 5U63A 1KF6A 3L1RA 4GAPA 3GDPA 4B69A 2CULA 3B3RA 2ZZ0A 3CPIG 4DSGA 1BF3A 1TDEA 5KOWA 3AD8B 3K7TA 4H4UA 1Y56A 2AQJA 1Q1RA 1F3PA 1GV4A 1H82A 1FCDA 1FEAA 1F6MA 3GMCA 3C4NA 4H4SA 2R4JA 5KXJA 4G74A 2E1MA 1ZMCA 3NK0X 4B63A 4AP1A 5BRTA 2V61A 1H86A 1GRBA 1VDCA 2WPEA 5FMHA 2EQ9A 2YR6A 3GYJA 3AXBA 4YTPA 4EM4A 4J36A 2RGJA 2YLRA 1E1MA 4JDRA 3T37A 3V3OA 4D03A 3IHGA 4J56A 1NG4A 3GDNA 4H7UA 1D7LA 1NDAA 1NHRA 5GSNA 3M13A 1ONFA 2BK4A 5KMQA 1E7PA 2WBAA 2WU2A 1EL9A 3CMMA 4EQSA 2C65A 2Q0LA 3NTDA 3SX6A 4H4RA 3GWFA 4EM3A 3FBSA 4CNJA 1MOKA 1GOSA 2VVLA 3ICRA 1IUWA 1GALA 2I0ZA 2JB3A 4HA6A 4UDRA 4X9NA 2WDRA 4U8JA 3CPHG 3C96A 4GDEA 4CNKA 4GCMA 4H4QA 2VQBA 2H88A 2YLZA 3UTEA 5M10A 2GR1A 2APGA 3LZWA 2XVHA 3SZCA 4BURA 4I58A 3UTGA 4U8OA 4B66A 2Q0KA 1DXLA 3KVEA 1FL2A 2QA2A 2NVKX 2GEWA 2YM1A 3T31A 4JNAA 2ZBWA 1GPEA 2C76A 1IUTA 1S2YA 1KSSA 2R45A 3CGBA 3DK8A 3REDA 2PYXA 4Z2TA 3FIMB 1D4DA 4CCQA 2YR4A 1YKJA 4O5UA 4FK1A 5C3JA 1TYTA 3K7QX 4PAAA 3I3LA 1MXTA 3P1WA 2XCGA 3NN6X 2BXRA 3D8XA 3F8RA 2BRYA 3CPJG 1Z6LA 1F8SA 2WEUA 1CJ4A 1M6IA 2DKHA 4OPCA 3T2ZA 5IPYA 2OA1A 1O95A 1CL0A 4KPRA 4AP3A 1KNPA 2GR3A 2GVCA 4IA5A 4Z24A 3H4KA 5BVAA 2JKCA 2YG6A 1O5WA 3UTFA 4YTMA 2C67A 3ZYXA 3DJEA 1CBOA 4GR1A 4YWOA 5HHFA 4IVOB 2ACZA 1GNDA 3NT6A 1GRHA 3M0OA 4C5OA 1PJ6A 2J3NA 5EB4A 2CDUA 2BYBA 4Z2UA 5J60A 2XLRA 2WOWA 1PXAA 3CTYA 1VG0A 3IWAA 4NZHA 4AT0A 5KMSA 3UOYA 3NRNA 4YXDA 1ZK7A 4U8IA 2UZZA 4K7ZA 2YAUA 1E1NA 3UCLA 1JU2A 4J31A 2V3AA 4C3XA 1N1PA 3ICTA 1FOHA 3FG2P 1CJ3A 3Q6JA 3SY4A 4U8NA 2VVMA 1CC6A 1BGJA 2CVJA 1VQWA 2QAEA 3AB1A 5KVIA 2VVLG 3EANA 4EMIA 3GYXA 4H2NA 5KNLA 2C75A 2RGOA 3UKFA 4RG3A 1IJHA 3ITJA 4A65A 2BXSA 4EMWA 4FDCB 1XANA 3BNMA 2A8XA 4KX6A 3P9UA 4H4XA 1OJDA 2JBVA 3AECA 3RHAA 2GRTA 3UOXA 1YQ4A 4NNJA 4P9SA 2GMJA 1B8SA 4ZCCA 3NKSA 3SFDA 4EQWA 3ISHA 2BS2A 1JRZA 2CFYA 4K5SA 2YVJA 1DOCA 5JCMA 3HZLA 1NAAA 3T2YA 1H7WA 4XWRA 4JQ9A 1GRAA 4II2A 4U2LA 1K0JA 4A9WA 2YG5A 4YSYA 2WS3A 1BZLA 3AEBA 3AE4A 3AE1A 4A79A 2OAMA 4IVMB 5U25A 3AEDA 4EIQA 1GXFA 1ZP0A 4B68A 4GRTA 3P4QA 4K22A 3URHA 5EOWA 1PBFA 4ADWA 1JNRA 1KDGA 1KFYA 3VRDB 4N9XA 3S5WA 1PDHA 2X99A 1PBDA 2V6OA 3UP4A 1H81A 1RP0A 2WQYA 3BNUA 4U2TA 3LXDA 1XPQA 2BCPA 4B65A 1DNCA 3QFBA 4OPDA 3IF9A 2WPFA 3AE5A 2JB2A 3UP5A 1Q1WA 4WX1A 1YQ3A 1BWCA 2GR0A 4APNA 1ELIA 1GRGA 2FBWA 3ATQA 2XVEA 3QVRA 4FX9A 3LZXA 4BK3A 2EQ6A 3KA7A 3AE2A 5KMPA 1DODA 3R9UA 4YSHA 3CIRA 4J2WA 3S61A 3LJPA 4AOSA 2QA1A 3Q9TA 4H50A 4XXGA 2HQMA 2V5ZA 3UKAA 4Z2RA 2XDOA 5KMRA 5KOXA 3AE8A 2DKIA 3F8DA 4YT0A 3M12A 3NN0X 4C74A 1PJ5A 3SYIA 2C4CA 2GH5A 1LVLA 2WHDA 1TDKA 2GAGB 3GMBA 2BC0A 1ZKQA 1OJ9A 2Z5XA 2GV8A 1GT8A 2GQFA 4UP3A 1REOA 2Z5YA 1DOEA 2R0PA 5HXIA 1DJNA 2R4EA 1ZY8A 4U8LA 1PJ7A 3GSIA 2BS3A 3AEAA 5CKUA 1PBEA 5FS6A 1D4CA 1D5TA 1V59A 1ZOYA 3AE9A 1B5QA 3P4RA 5KVHA 2H89A 2FJDA 3PO7A 2V60A 4A99A 5KWFA 3FPZA 1TDOA 1GERA 1RYIA 1ZDLA 2WESA 4OVIA 4UDPA 3UKKA 4H4YA 2WDQA 4GDPA 2E5VA 2TPRA 2X8CA 2BK5A 3K30A 1O94A 3HYVA 3GWDA 4NTEA 5C2TA 1JRXA 1IUSA 3SXIA 4MJWA 2Y6QA 1E1LA 1Q9IA 3NG7X 1K0LA 3AWIA 2BCGG 1NEKA 4CCRA 3VR8A 1CC4A 1NHQA 2BRAA 1E6EA 3NYEA 2A87A 4K5RA 4NEWA 4E0VA 2VQ7A 1P2HA 3DJGX 2BK3A 3KPFA 2EQ8A 3NLCA 4K8DA 4YKFA 1SEZA 2W0HA 2YM2A 3O0HA 4EQRA 2BABA 4NWZA 3GD3A 2GR2A 3VRBA 1KNRA 5CQFA 4JY3A 2B7RA 4WCTA 3KPKA 5M0ZA 1FECA 2C64A 4BJYA 4FK1C 3GRSA 3ALMA 2BC1A 2WP6A 2Y6RA 3DGZA 3EPTA 3LB8A 4DSHA 3KD9A 4K2XA 3CGCA 2ARDA 1GTEA 3P4SA 2B9YA 3DA1A 3UKQA 3SGLA 3UKPA 5BULA 3CNPA 4B67A 2GMHA 1N4WA 2JAEA 3AYJA 2V3BA 4LIIA 4USQA 4Z44A 2X8HA 1ZOVA 5IQ1A 4II3A 1PXCA 1EL8A 3QFAA 4HB9A 3E1TA 4YKGA 1E39A 3NGCX 5FS8A 1JRYA 3DMEA 4OPIA 2XVFA 2WPCA 1TYPA 1F8RA 3DK9A 3L8KA 3HYWA 1L0VA 3II4A 4YSXA 1CF3A 3QJ4A 3KU9A 4ICYA 3SZWA 3ADAB 4U8MA 2IVEA 1EL7A 1PN0A 2YVFA 4CRTA 3NTAA 4NTCA 3AD7B 1UKVG 4XWZA 1PS9A 5JCIA 1XDIA 1RSGA 3GRTA 2XLSA 2VZ2A 5DBJA 4H4WA 5HYMA 1CJ2A 3BI2A 4I59A 4G6GA 4OPUA 2YLXA 2GAHB 2YG7A 4CY6A 4DNAA 4IV9A 2Q6UA 4H2RA 4REKA 2ZZBA 2A89A 4BK1A 4EMJA 2X8GA 4NEVA 3BHFA 1Y56B 3CNJA 3DK4A 3LADA 3PVCA 1H83A 3QSMA 3RP8A 1L9DA 1OJCA 2C70A 3CGEA 2B9WA 5FS9A 1VG9A 3CNSA 3T14A 1D4EA 3NH3X 1HYUA 1GESA 3DGHA 3NHOX 1OJTA 2X50A 4LA1A 3SFEA 3T2KA 2C3DA 2C3CA 1LV0A 1LQUA 2VRMA 1DOBA 2C7GA 1PBBA 3AD9B 1P2EA 1NENA 2WP9A 3KKJA 1BGNA 3VRAA 1EL5A 4TM3A 1ZX9A 1YY5A 1IUXA 1MO9A 4TM0A 4Y4NA 3AEEA 4G9KA 2EQ7A 3T0KA 2RGHA 1CHUA 3CGDA
chains in the Genus database with same CATH topology
1XHCA 1KSUA 2YLTA 1B4VA 1NPXA 4ZCDA 2XFNA 3QSEA 4TLZA 1S3EA 4A7AA 1M64A 4G73A 4EQXA 2OLOA 1K0IA 3WE0A 1K4QA 1NHPA 1S2QA 3NYFA 3UOVA 1L9CA 4B1BA 3EAOA 3ALLA 3DH9A 2YG3A 1COYA 1GREA 1LTXR 4A5LA 2FJAA 2R0CA 3HYXA 3ALJA 4U8PA 3IC9A 3RP7A 3KLJA 3G5QA 1OJAA 3JSKA 2RABA 5JCKA 3COXA 3GYIA 3D1CA 4LU6A 2XVIA 2B7SA 3CNDA 3EF6A 2WP5A 2YWLA 1NHSA 3PS9A 4O5QA 2VOUA 5LV9A 3BI4A 3QSSA 4NTDA 4TM1A 1N4UA 3DJDA 3B6DA 5EB5A 2BA9A 3ICSA 1LPFA 3AE6A 1H6VA 1VRQB 4B64A 4BV6A 2OALA 4JY2A 4A6NB 2O9ZA 2YLWA 2XLPA 2YVGA 2BACA 4OPGA 3VR9A 5JCLA 3VQRA 1QJDA 3CN8A 3H8IA 4OCGA 5J7XA 5TR3A 1LJ1A 1QO8A 2JB1A 3AE3A 2FJEA 4Z26A 1LQTA 4X9MA 4GUVA 4M52A 4Y4LA 3IHMA 2FJBA 4RSLA 3SZ0A 3ABVA 3ZDNA 4TLXA 4U8KA 4CY8A 2XFOA 4JNQA 2YQUA 3SM8A 4UDQA 4C77A 4H4ZA 5IQ4A 2WDVA 1CJCA 2OLNA 2R46A 4J33A 2R9ZA 3UKLA 1YQZA 3C4AA 5U1OA 1IUVA 1E1KA 1W4XA 2F5ZA 4Z25A 2XLTA 1L9EA 4AT2A 1H7XA 5FS7A 2E4GA 4ZN0A 3NYCA 2C73A 4J57A 4DGKA 4GAVA 2Q7VA 4IA6A 3QVPA 3RP6A 1DJQA 4EIPA 5KRQA 4YTNA 1GTHA 2AAQA 1B37A 3H8LA 2XFPA 1IUUA 3UKHA 1TDNA 4H2PA 3F8PA 4J34A 4A6NA 3AEFA 4RG4A 1PBCA 2ZZCA 4USRA 2GB0A 1TDFA 3GD4A 5HY5A 5L46A 1GRFA 4PABA 3I6DA 2XFQA 5GRTA 4Z43A 1GETA 1PXBA 3AYLA 1AOGA 4TM4A 4BK2A 2YG4A 1JNZA 4ECHA 3G5SA 3OC4A 1QLBA 3G5RA 3RNMA 3UTHA 2C66A 3ATRA 4X4JA 5JCNA 1N4VA 1GRTA 1FEBA 4GF7A 3FMWA 3NIXA 2B76A 1TRBA 1D7YA 4D04A 3SQPA 1GSNA 3CNTA 2XLUA 1GEUA 2YR5A 2QCUA 1Y0PA 3DJJA 2TMDA 4OPLA 2C72A 2NPXA 1BKWA 3OZ2A 2IIDA 1PHHA 3UOZA 4Y4MA 2WU5A 4AOXA 2IVDA 3BHKA 3NK2X 1H84A 2WOIA 4BJZA 2BS4A 3P4PA 3SZFA 2GF3A 2YLSA 2GQWA 5ER0A 2PHHA 3AEGA 3NK1X 4YSZA 2B9XA 4H4PA 1ZMDA 5BUKA 4OPTA 3BI5A 3AE7A 4JN9A 1JOAA 2AR8A 2JK6A 2WOVA 2XVJA 4G6HA 4CBQA 2XYOA 4H4TA 4C3YA 4H2QA 1CC2A 2XFUA 4H4VA 5EBKA 3V3NA 2X3NA 2VRLA 1X31B 1F8WA 1NG3A 1JEHA 2WETA 3AYIA 1EBDA 3K7MX 2R0GA 3LOVA 3NNEA 4U2SA 3V76A 1S3BA 5U63A 1KF6A 3L1RA 4GAPA 3GDPA 4B69A 2CULA 3B3RA 2ZZ0A 3CPIG 4DSGA 1BF3A 1TDEA 5KOWA 3AD8B 3K7TA 4H4UA 1Y56A 2AQJA 1Q1RA 1F3PA 1GV4A 1H82A 1FCDA 1FEAA 1F6MA 3GMCA 3C4NA 4H4SA 2R4JA 5KXJA 4G74A 2E1MA 1ZMCA 3NK0X 4B63A 4AP1A 5BRTA 2V61A 1H86A 1GRBA 1VDCA 2WPEA 5FMHA 2EQ9A 2YR6A 3GYJA 3AXBA 4YTPA 4EM4A 4J36A 2RGJA 2YLRA 1E1MA 4JDRA 3T37A 3V3OA 4D03A 3IHGA 4J56A 1NG4A 3GDNA 4H7UA 1D7LA 1NDAA 1NHRA 5GSNA 3M13A 1ONFA 2BK4A 5KMQA 1E7PA 2WBAA 2WU2A 1EL9A 3CMMA 4EQSA 2C65A 2Q0LA 3NTDA 3SX6A 4H4RA 3GWFA 4EM3A 3FBSA 4CNJA 1MOKA 1GOSA 2VVLA 3ICRA 1IUWA 1GALA 2I0ZA 2JB3A 4HA6A 4UDRA 4X9NA 2WDRA 4U8JA 3CPHG 3C96A 4GDEA 4CNKA 4GCMA 4H4QA 2VQBA 2H88A 2YLZA 3UTEA 5M10A 2GR1A 2APGA 3LZWA 2XVHA 3SZCA 4BURA 4I58A 3UTGA 4U8OA 4B66A 2Q0KA 1DXLA 3KVEA 1FL2A 2QA2A 2NVKX 2GEWA 2YM1A 3T31A 4JNAA 2ZBWA 1GPEA 2C76A 1IUTA 1S2YA 1KSSA 2R45A 3CGBA 3DK8A 3REDA 2PYXA 4Z2TA 3FIMB 1D4DA 4CCQA 2YR4A 1YKJA 4O5UA 4FK1A 5C3JA 1TYTA 3K7QX 4PAAA 3I3LA 1MXTA 3P1WA 2XCGA 3NN6X 2BXRA 3D8XA 3F8RA 2BRYA 3CPJG 1Z6LA 1F8SA 2WEUA 1CJ4A 1M6IA 2DKHA 4OPCA 3T2ZA 5IPYA 2OA1A 1O95A 1CL0A 4KPRA 4AP3A 1KNPA 2GR3A 2GVCA 4IA5A 4Z24A 3H4KA 5BVAA 2JKCA 2YG6A 1O5WA 3UTFA 4YTMA 2C67A 3ZYXA 3DJEA 1CBOA 4GR1A 4YWOA 5HHFA 4IVOB 2ACZA 1GNDA 3NT6A 1GRHA 3M0OA 4C5OA 1PJ6A 2J3NA 5EB4A 2CDUA 2BYBA 4Z2UA 5J60A 2XLRA 2WOWA 1PXAA 3CTYA 1VG0A 3IWAA 4NZHA 4AT0A 5KMSA 3UOYA 3NRNA 4YXDA 1ZK7A 4U8IA 2UZZA 4K7ZA 2YAUA 1E1NA 3UCLA 1JU2A 4J31A 2V3AA 4C3XA 1N1PA 3ICTA 1FOHA 3FG2P 1CJ3A 3Q6JA 3SY4A 4U8NA 2VVMA 1CC6A 1BGJA 2CVJA 1VQWA 2QAEA 3AB1A 5KVIA 2VVLG 3EANA 4EMIA 3GYXA 4H2NA 5KNLA 2C75A 2RGOA 3UKFA 4RG3A 1IJHA 3ITJA 4A65A 2BXSA 4EMWA 4FDCB 1XANA 3BNMA 2A8XA 4KX6A 3P9UA 4H4XA 1OJDA 2JBVA 3AECA 3RHAA 2GRTA 3UOXA 1YQ4A 4NNJA 4P9SA 2GMJA 1B8SA 4ZCCA 3NKSA 3SFDA 4EQWA 3ISHA 2BS2A 1JRZA 2CFYA 4K5SA 2YVJA 1DOCA 5JCMA 3HZLA 1NAAA 3T2YA 1H7WA 4XWRA 4JQ9A 1GRAA 4II2A 4U2LA 1K0JA 4A9WA 2YG5A 4YSYA 2WS3A 1BZLA 3AEBA 3AE4A 3AE1A 4A79A 2OAMA 4IVMB 5U25A 3AEDA 4EIQA 1GXFA 1ZP0A 4B68A 4GRTA 3P4QA 4K22A 3URHA 5EOWA 1PBFA 4ADWA 1JNRA 1KDGA 1KFYA 3VRDB 4N9XA 3S5WA 1PDHA 2X99A 1PBDA 2V6OA 3UP4A 1H81A 1RP0A 2WQYA 3BNUA 4U2TA 3LXDA 1XPQA 2BCPA 4B65A 1DNCA 3QFBA 4OPDA 3IF9A 2WPFA 3AE5A 2JB2A 3UP5A 1Q1WA 4WX1A 1YQ3A 1BWCA 2GR0A 4APNA 1ELIA 1GRGA 2FBWA 3ATQA 2XVEA 3QVRA 4FX9A 3LZXA 4BK3A 2EQ6A 3KA7A 3AE2A 5KMPA 1DODA 3R9UA 4YSHA 3CIRA 4J2WA 3S61A 3LJPA 4AOSA 2QA1A 3Q9TA 4H50A 4XXGA 2HQMA 2V5ZA 3UKAA 4Z2RA 2XDOA 5KMRA 5KOXA 3AE8A 2DKIA 3F8DA 4YT0A 3M12A 3NN0X 4C74A 1PJ5A 3SYIA 2C4CA 2GH5A 1LVLA 2WHDA 1TDKA 2GAGB 3GMBA 2BC0A 1ZKQA 1OJ9A 2Z5XA 2GV8A 1GT8A 2GQFA 4UP3A 1REOA 2Z5YA 1DOEA 2R0PA 5HXIA 1DJNA 2R4EA 1ZY8A 4U8LA 1PJ7A 3GSIA 2BS3A 3AEAA 5CKUA 1PBEA 5FS6A 1D4CA 1D5TA 1V59A 1ZOYA 3AE9A 1B5QA 3P4RA 5KVHA 2H89A 2FJDA 3PO7A 2V60A 4A99A 5KWFA 3FPZA 1TDOA 1GERA 1RYIA 1ZDLA 2WESA 4OVIA 4UDPA 3UKKA 4H4YA 2WDQA 4GDPA 2E5VA 2TPRA 2X8CA 2BK5A 3K30A 1O94A 3HYVA 3GWDA 4NTEA 5C2TA 1JRXA 1IUSA 3SXIA 4MJWA 2Y6QA 1E1LA 1Q9IA 3NG7X 1K0LA 3AWIA 2BCGG 1NEKA 4CCRA 3VR8A 1CC4A 1NHQA 2BRAA 1E6EA 3NYEA 2A87A 4K5RA 4NEWA 4E0VA 2VQ7A 1P2HA 3DJGX 2BK3A 3KPFA 2EQ8A 3NLCA 4K8DA 4YKFA 1SEZA 2W0HA 2YM2A 3O0HA 4EQRA 2BABA 4NWZA 3GD3A 2GR2A 3VRBA 1KNRA 5CQFA 4JY3A 2B7RA 4WCTA 3KPKA 5M0ZA 1FECA 2C64A 4BJYA 4FK1C 3GRSA 3ALMA 2BC1A 2WP6A 2Y6RA 3DGZA 3EPTA 3LB8A 4DSHA 3KD9A 4K2XA 3CGCA 2ARDA 1GTEA 3P4SA 2B9YA 3DA1A 3UKQA 3SGLA 3UKPA 5BULA 3CNPA 4B67A 2GMHA 1N4WA 2JAEA 3AYJA 2V3BA 4LIIA 4USQA 4Z44A 2X8HA 1ZOVA 5IQ1A 4II3A 1PXCA 1EL8A 3QFAA 4HB9A 3E1TA 4YKGA 1E39A 3NGCX 5FS8A 1JRYA 3DMEA 4OPIA 2XVFA 2WPCA 1TYPA 1F8RA 3DK9A 3L8KA 3HYWA 1L0VA 3II4A 4YSXA 1CF3A 3QJ4A 3KU9A 4ICYA 3SZWA 3ADAB 4U8MA 2IVEA 1EL7A 1PN0A 2YVFA 4CRTA 3NTAA 4NTCA 3AD7B 1UKVG 4XWZA 1PS9A 5JCIA 1XDIA 1RSGA 3GRTA 2XLSA 2VZ2A 5DBJA 4H4WA 5HYMA 1CJ2A 3BI2A 4I59A 4G6GA 4OPUA 2YLXA 2GAHB 2YG7A 4CY6A 4DNAA 4IV9A 2Q6UA 4H2RA 4REKA 2ZZBA 2A89A 4BK1A 4EMJA 2X8GA 4NEVA 3BHFA 1Y56B 3CNJA 3DK4A 3LADA 3PVCA 1H83A 3QSMA 3RP8A 1L9DA 1OJCA 2C70A 3CGEA 2B9WA 5FS9A 1VG9A 3CNSA 3T14A 1D4EA 3NH3X 1HYUA 1GESA 3DGHA 3NHOX 1OJTA 2X50A 4LA1A 3SFEA 3T2KA 2C3DA 2C3CA 1LV0A 1LQUA 2VRMA 1DOBA 2C7GA 1PBBA 3AD9B 1P2EA 1NENA 2WP9A 3KKJA 1BGNA 3VRAA 1EL5A 4TM3A 1ZX9A 1YY5A 1IUXA 1MO9A 4TM0A 4Y4NA 3AEEA 4G9KA 2EQ7A 3T0KA 2RGHA 1CHUA 3CGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHC A;  1KSU A;  2YLT A;  1B4V A;  1NPX A;  4ZCD A;  2XFN A;  3QSE A;  4TLZ A;  1S3E A;  4A7A A;  1M64 A;  4EQX A;  2OLO A;  1K0I A;  3WE0 A;  1K4Q A;  1NHP A;  1S2Q A;  3NYF A;  3UOV A;  1L9C A;  4B1B A;  3EAO A;  3ALL A;  3DH9 A;  2YG3 A;  1COY A;  1GRE A;  1LTX R;  4A5L A;  2FJA A;  2R0C A;  3ALJ A;  4U8P A;  3IC9 A;  3RP7 A;  3KLJ A;  3G5Q A;  1OJA A;  3JSK A;  2RAB A;  5JCK A;  3COX A;  3GYI A;  3D1C A;  4LU6 A;  2XVI A;  2B7S A;  3CND A;  3EF6 A;  2WP5 A;  2YWL A;  1NHS A;  3PS9 A;  4O5Q A;  2VOU A;  5LV9 A;  3BI4 A;  3QSS A;  4NTD A;  4TM1 A;  1N4U A;  3DJD A;  3B6D A;  5EB5 A;  2BA9 A;  3ICS A;  1LPF A;  3AE6 A;  1H6V A;  1VRQ B;  4B64 A;  4BV6 A;  2OAL A;  4JY2 A;  4A6N B;  2O9Z A;  2YLW A;  2XLP A;  2YVG A;  2BAC A;  4OPG A;  3VR9 A;  5JCL A;  3VQR A;  1QJD A;  3CN8 A;  3H8I A;  4OCG A;  5J7X A;  5TR3 A;  1LJ1 A;  1QO8 A;  2JB1 A;  3AE3 A;  2FJE A;  4Z26 A;  1LQT A;  4X9M A;  4GUV A;  4M52 A;  4Y4L A;  3IHM A;  2FJB A;  4RSL A;  3ABV A;  3ZDN A;  4TLX A;  4U8K A;  4CY8 A;  2XFO A;  4JNQ A;  2YQU A;  3SM8 A;  4UDQ A;  4C77 A;  4H4Z A;  5IQ4 A;  2WDV A;  1CJC A;  2OLN A;  2R46 A;  4J33 A;  2R9Z A;  3UKL A;  1YQZ A;  3C4A A;  5U1O A;  1IUV A;  1E1K A;  1W4X A;  2F5Z A;  4Z25 A;  2XLT A;  1L9E A;  4AT2 A;  1H7X A;  5FS7 A;  2E4G A;  4ZN0 A;  3NYC A;  2C73 A;  4J57 A;  4DGK A;  2Q7V A;  4IA6 A;  3QVP A;  3RP6 A;  1DJQ A;  4EIP A;  5KRQ A;  4YTN A;  1GTH A;  2AAQ A;  1B37 A;  3H8L A;  2XFP A;  1IUU A;  3UKH A;  1TDN A;  4H2P A;  3F8P A;  4J34 A;  4A6N A;  3AEF A;  4RG4 A;  1PBC A;  2ZZC A;  4USR A;  2GB0 A;  1TDF A;  3GD4 A;  5HY5 A;  5L46 A;  1GRF A;  4PAB A;  3I6D A;  2XFQ A;  5GRT A;  4Z43 A;  1GET A;  1PXB A;  3AYL A;  1AOG A;  4TM4 A;  4BK2 A;  2YG4 A;  1JNZ A;  4ECH A;  3G5S A;  3OC4 A;  1QLB A;  3G5R A;  3RNM A;  3UTH A;  2C66 A;  3ATR A;  4X4J A;  5JCN A;  1N4V A;  1GRT A;  1FEB A;  4GF7 A;  3FMW A;  3NIX A;  2B76 A;  1TRB A;  1D7Y A;  4D04 A;  3SQP A;  1GSN A;  3CNT A;  2XLU A;  1GEU A;  2YR5 A;  2QCU A;  1Y0P A;  3DJJ A;  2TMD A;  4OPL A;  2C72 A;  2NPX A;  1BKW A;  3OZ2 A;  2IID A;  1PHH A;  3UOZ A;  4Y4M A;  2WU5 A;  4AOX A;  2IVD A;  3BHK A;  3NK2 X;  1H84 A;  2WOI A;  4BJZ A;  2BS4 A;  3P4P A;  2GF3 A;  2YLS A;  2GQW A;  5ER0 A;  2PHH A;  3AEG A;  3NK1 X;  4YSZ A;  2B9X A;  4H4P A;  1ZMD A;  5BUK A;  4OPT A;  3BI5 A;  3AE7 A;  4JN9 A;  1JOA A;  2AR8 A;  2JK6 A;  2WOV A;  2XVJ A;  4CBQ A;  2XYO A;  4H4T A;  4C3Y A;  4H2Q A;  1CC2 A;  2XFU A;  4H4V A;  5EBK A;  3V3N A;  2X3N A;  2VRL A;  1X31 B;  1F8W A;  1NG3 A;  1JEH A;  2WET A;  3AYI A;  1EBD A;  3K7M X;  2R0G A;  3LOV A;  3NNE A;  4U2S A;  3V76 A;  1S3B A;  5U63 A;  1KF6 A;  3L1R A;  3GDP A;  4B69 A;  2CUL A;  3B3R A;  2ZZ0 A;  3CPI G;  4DSG A;  1BF3 A;  1TDE A;  5KOW A;  3AD8 B;  3K7T A;  4H4U A;  1Y56 A;  2AQJ A;  1Q1R A;  1F3P A;  1GV4 A;  1H82 A;  1FCD A;  1FEA A;  1F6M A;  3GMC A;  3C4N A;  4H4S A;  2R4J A;  5KXJ A;  2E1M A;  1ZMC A;  3NK0 X;  4B63 A;  4AP1 A;  5BRT A;  2V61 A;  1H86 A;  1GRB A;  1VDC A;  2WPE A;  5FMH A;  2EQ9 A;  2YR6 A;  3GYJ A;  3AXB A;  4YTP A;  4EM4 A;  4J36 A;  2RGJ A;  2YLR A;  1E1M A;  4JDR A;  3T37 A;  3V3O A;  4D03 A;  3IHG A;  4J56 A;  1NG4 A;  3GDN A;  4H7U A;  1D7L A;  1NDA A;  1NHR A;  5GSN A;  3M13 A;  1ONF A;  2BK4 A;  1E7P A;  2WBA A;  2WU2 A;  1EL9 A;  4EQS A;  2C65 A;  2Q0L A;  3NTD A;  4H4R A;  3GWF A;  4EM3 A;  3FBS A;  4CNJ A;  1MOK A;  1GOS A;  2VVL A;  3ICR A;  1IUW A;  1GAL A;  2I0Z A;  2JB3 A;  4HA6 A;  4UDR A;  4X9N A;  2WDR A;  4U8J A;  3CPH G;  3C96 A;  4GDE A;  4CNK A;  4GCM A;  4H4Q A;  2VQB A;  2H88 A;  2YLZ A;  3UTE A;  5M10 A;  2GR1 A;  2APG A;  3LZW A;  2XVH A;  4BUR A;  4I58 A;  3UTG A;  4U8O A;  4B66 A;  2Q0K A;  1DXL A;  3KVE A;  1FL2 A;  2QA2 A;  2NVK X;  2GEW A;  2YM1 A;  4JNA A;  2ZBW A;  1GPE A;  2C76 A;  1IUT A;  1S2Y A;  1KSS A;  2R45 A;  3CGB A;  3DK8 A;  3RED A;  2PYX A;  4Z2T A;  3FIM B;  1D4D A;  4CCQ A;  2YR4 A;  1YKJ A;  4O5U A;  4FK1 A;  5C3J A;  1TYT A;  3K7Q X;  4PAA A;  3I3L A;  1MXT A;  3P1W A;  2XCG A;  3NN6 X;  2BXR A;  3D8X A;  3F8R A;  3CPJ G;  1Z6L A;  1F8S A;  2WEU A;  1CJ4 A;  1M6I A;  2DKH A;  4OPC A;  5IPY A;  2OA1 A;  1O95 A;  1CL0 A;  4KPR A;  4AP3 A;  1KNP A;  2GR3 A;  2GVC A;  4IA5 A;  4Z24 A;  3H4K A;  5BVA A;  2JKC A;  2YG6 A;  1O5W A;  3UTF A;  4YTM A;  2C67 A;  3ZYX A;  3DJE A;  1CBO A;  4GR1 A;  4YWO A;  5HHF A;  4IVO B;  2ACZ A;  1GND A;  3NT6 A;  1GRH A;  3M0O A;  4C5O A;  1PJ6 A;  2J3N A;  5EB4 A;  2CDU A;  2BYB A;  4Z2U A;  5J60 A;  2XLR A;  2WOW A;  1PXA A;  3CTY A;  1VG0 A;  3IWA A;  4NZH A;  4AT0 A;  3UOY A;  3NRN A;  4YXD A;  1ZK7 A;  4U8I A;  2UZZ A;  4K7Z A;  2YAU A;  1E1N A;  3UCL A;  1JU2 A;  4J31 A;  2V3A A;  4C3X A;  1N1P A;  3ICT A;  1FOH A;  3FG2 P;  1CJ3 A;  3Q6J A;  4U8N A;  2VVM A;  1CC6 A;  1BGJ A;  2CVJ A;  1VQW A;  2QAE A;  3AB1 A;  5KVI A;  2VVL G;  3EAN A;  4EMI A;  4H2N A;  2C75 A;  2RGO A;  3UKF A;  4RG3 A;  1IJH A;  3ITJ A;  4A65 A;  2BXS A;  4EMW A;  4FDC B;  1XAN A;  3BNM A;  2A8X A;  4KX6 A;  3P9U A;  4H4X A;  1OJD A;  2JBV A;  3AEC A;  3RHA A;  2GRT A;  3UOX A;  1YQ4 A;  4P9S A;  2GMJ A;  1B8S A;  4ZCC A;  3NKS A;  3SFD A;  4EQW A;  3ISH A;  2BS2 A;  1JRZ A;  2CFY A;  4K5S A;  2YVJ A;  1DOC A;  5JCM A;  3HZL A;  1NAA A;  1H7W A;  4XWR A;  4JQ9 A;  1GRA A;  4U2L A;  1K0J A;  4A9W A;  2YG5 A;  4YSY A;  2WS3 A;  1BZL A;  3AEB A;  3AE4 A;  3AE1 A;  4A79 A;  2OAM A;  4IVM B;  5U25 A;  3AED A;  4EIQ A;  1GXF A;  1ZP0 A;  4B68 A;  4GRT A;  3P4Q A;  4K22 A;  3URH A;  5EOW A;  1PBF A;  4ADW A;  1JNR A;  1KDG A;  1KFY A;  3VRD B;  4N9X A;  3S5W A;  1PDH A;  2X99 A;  1PBD A;  2V6O A;  3UP4 A;  1H81 A;  1RP0 A;  2WQY A;  3BNU A;  4U2T A;  3LXD A;  1XPQ A;  2BCP A;  4B65 A;  1DNC A;  3QFB A;  4OPD A;  3IF9 A;  2WPF A;  3AE5 A;  2JB2 A;  3UP5 A;  1Q1W A;  4WX1 A;  1YQ3 A;  1BWC A;  2GR0 A;  4APN A;  1ELI A;  1GRG A;  2FBW A;  3ATQ A;  2XVE A;  3QVR A;  4FX9 A;  3LZX A;  4BK3 A;  2EQ6 A;  3KA7 A;  3AE2 A;  1DOD A;  3R9U A;  4YSH A;  3CIR A;  4J2W A;  3S61 A;  3LJP A;  4AOS A;  2QA1 A;  3Q9T A;  4H50 A;  4XXG A;  2HQM A;  2V5Z A;  3UKA A;  4Z2R A;  2XDO A;  5KOX A;  3AE8 A;  2DKI A;  3F8D A;  4YT0 A;  3M12 A;  3NN0 X;  4C74 A;  1PJ5 A;  2GH5 A;  1LVL A;  2WHD A;  1TDK A;  2GAG B;  3GMB A;  2BC0 A;  1ZKQ A;  1OJ9 A;  2Z5X A;  2GV8 A;  1GT8 A;  2GQF A;  4UP3 A;  1REO A;  2Z5Y A;  1DOE A;  2R0P A;  5HXI A;  1DJN A;  2R4E A;  1ZY8 A;  4U8L A;  1PJ7 A;  3GSI A;  2BS3 A;  3AEA A;  5CKU A;  1PBE A;  5FS6 A;  1D4C A;  1D5T A;  1V59 A;  1ZOY A;  3AE9 A;  1B5Q A;  3P4R A;  5KVH A;  2H89 A;  2FJD A;  3PO7 A;  2V60 A;  4A99 A;  5KWF A;  3FPZ A;  1TDO A;  1GER A;  1RYI A;  1ZDL A;  2WES A;  4OVI A;  4UDP A;  3UKK A;  4H4Y A;  2WDQ A;  4GDP A;  2E5V A;  2TPR A;  2X8C A;  2BK5 A;  3K30 A;  1O94 A;  3GWD A;  4NTE A;  5C2T A;  1JRX A;  1IUS A;  4MJW A;  2Y6Q A;  1E1L A;  1Q9I A;  3NG7 X;  1K0L A;  3AWI A;  2BCG G;  1NEK A;  4CCR A;  3VR8 A;  1CC4 A;  1NHQ A;  3NYE A;  1E6E A;  2A87 A;  4K5R A;  4NEW A;  4E0V A;  2VQ7 A;  1P2H A;  3DJG X;  2BK3 A;  3KPF A;  2EQ8 A;  3NLC A;  4K8D A;  4YKF A;  1SEZ A;  2W0H A;  2YM2 A;  3O0H A;  4EQR A;  2BAB A;  3GD3 A;  2GR2 A;  3VRB A;  1KNR A;  5CQF A;  4JY3 A;  2B7R A;  4WCT A;  5M0Z A;  1FEC A;  2C64 A;  4BJY A;  4FK1 C;  3GRS A;  3ALM A;  2BC1 A;  2WP6 A;  2Y6R A;  3DGZ A;  3EPT A;  3LB8 A;  4DSH A;  3KD9 A;  4K2X A;  3CGC A;  2ARD A;  1GTE A;  3P4S A;  2B9Y A;  3DA1 A;  3UKQ A;  3SGL A;  3UKP A;  5BUL A;  3CNP A;  4B67 A;  2GMH A;  1N4W A;  2JAE A;  3AYJ A;  2V3B A;  4LII A;  4USQ A;  4Z44 A;  2X8H A;  1ZOV A;  5IQ1 A;  1PXC A;  1EL8 A;  3QFA A;  4HB9 A;  3E1T A;  4YKG A;  1E39 A;  3NGC X;  5FS8 A;  1JRY A;  3DME A;  4OPI A;  2XVF A;  2WPC A;  1TYP A;  1F8R A;  3DK9 A;  3L8K A;  1L0V A;  3II4 A;  4YSX A;  1CF3 A;  3QJ4 A;  3KU9 A;  4ICY A;  3ADA B;  4U8M A;  2IVE A;  1EL7 A;  1PN0 A;  2YVF A;  4CRT A;  3NTA A;  4NTC A;  3AD7 B;  1UKV G;  4XWZ A;  1PS9 A;  5JCI A;  1XDI A;  1RSG A;  3GRT A;  2XLS A;  2VZ2 A;  5DBJ A;  4H4W A;  5HYM A;  1CJ2 A;  3BI2 A;  4I59 A;  4OPU A;  2YLX A;  2GAH B;  2YG7 A;  4CY6 A;  4DNA A;  4IV9 A;  2Q6U A;  4H2R A;  4REK A;  2ZZB A;  2A89 A;  4BK1 A;  4EMJ A;  2X8G A;  4NEV A;  3BHF A;  1Y56 B;  3CNJ A;  3DK4 A;  3LAD A;  3PVC A;  1H83 A;  3QSM A;  3RP8 A;  1L9D A;  1OJC A;  2C70 A;  3CGE A;  2B9W A;  5FS9 A;  1VG9 A;  3CNS A;  1D4E A;  3NH3 X;  1HYU A;  1GES A;  3DGH A;  3NHO X;  1OJT A;  2X50 A;  4LA1 A;  3SFE A;  2C3D A;  2C3C A;  1LV0 A;  1LQU A;  2VRM A;  1DOB A;  2C7G A;  1PBB A;  3AD9 B;  1P2E A;  1NEN A;  2WP9 A;  3KKJ A;  1BGN A;  3VRA A;  1EL5 A;  4TM3 A;  1ZX9 A;  1YY5 A;  1IUX A;  1MO9 A;  4TM0 A;  4Y4N A;  3AEE A;  2EQ7 A;  2RGH A;  1CHU A;  3CGD A; 
#chains in the Genus database with same CATH topology
 1XHC A;  1KSU A;  2YLT A;  1B4V A;  1NPX A;  4ZCD A;  2XFN A;  3QSE A;  4TLZ A;  1S3E A;  4A7A A;  1M64 A;  4G73 A;  4EQX A;  2OLO A;  3WE0 A;  1K0I A;  1K4Q A;  1NHP A;  1S2Q A;  3NYF A;  3UOV A;  1L9C A;  4B1B A;  3EAO A;  3ALL A;  3DH9 A;  2YG3 A;  1COY A;  1GRE A;  1LTX R;  4A5L A;  2FJA A;  2R0C A;  3HYX A;  3ALJ A;  4U8P A;  3IC9 A;  3RP7 A;  3KLJ A;  3G5Q A;  1OJA A;  3JSK A;  2RAB A;  5JCK A;  3COX A;  3GYI A;  3D1C A;  4LU6 A;  2XVI A;  2B7S A;  3CND A;  3EF6 A;  2WP5 A;  2YWL A;  1NHS A;  3PS9 A;  4O5Q A;  2VOU A;  5LV9 A;  3BI4 A;  3QSS A;  4NTD A;  4TM1 A;  1N4U A;  3DJD A;  3B6D A;  5EB5 A;  2BA9 A;  3ICS A;  1LPF A;  3AE6 A;  1H6V A;  1VRQ B;  4B64 A;  4BV6 A;  2OAL A;  4JY2 A;  4A6N B;  2O9Z A;  2YLW A;  2XLP A;  2YVG A;  2BAC A;  4OPG A;  3VR9 A;  5JCL A;  3VQR A;  1QJD A;  3CN8 A;  3H8I A;  4OCG A;  5J7X A;  5TR3 A;  1LJ1 A;  1QO8 A;  2JB1 A;  3AE3 A;  2FJE A;  4Z26 A;  1LQT A;  4X9M A;  4GUV A;  4M52 A;  4Y4L A;  3IHM A;  2FJB A;  4RSL A;  3SZ0 A;  3ABV A;  3ZDN A;  4TLX A;  4U8K A;  4CY8 A;  2XFO A;  4JNQ A;  2YQU A;  3SM8 A;  4UDQ A;  4C77 A;  4H4Z A;  5IQ4 A;  2WDV A;  1CJC A;  2OLN A;  2R46 A;  4J33 A;  2R9Z A;  3UKL A;  1YQZ A;  3C4A A;  5U1O A;  1IUV A;  1E1K A;  1W4X A;  2F5Z A;  4Z25 A;  2XLT A;  1L9E A;  4AT2 A;  1H7X A;  5FS7 A;  2E4G A;  4ZN0 A;  3NYC A;  2C73 A;  4J57 A;  4DGK A;  4GAV A;  2Q7V A;  4IA6 A;  3QVP A;  3RP6 A;  1DJQ A;  4EIP A;  5KRQ A;  4YTN A;  1GTH A;  2AAQ A;  1B37 A;  3H8L A;  2XFP A;  1IUU A;  3UKH A;  1TDN A;  4H2P A;  3F8P A;  4J34 A;  4A6N A;  3AEF A;  4RG4 A;  1PBC A;  2ZZC A;  4USR A;  2GB0 A;  1TDF A;  3GD4 A;  5HY5 A;  5L46 A;  1GRF A;  4PAB A;  3I6D A;  2XFQ A;  5GRT A;  4Z43 A;  1GET A;  1PXB A;  3AYL A;  1AOG A;  4TM4 A;  4BK2 A;  2YG4 A;  1JNZ A;  4ECH A;  3G5S A;  3OC4 A;  1QLB A;  3G5R A;  3RNM A;  3UTH A;  2C66 A;  3ATR A;  4X4J A;  5JCN A;  1N4V A;  1GRT A;  1FEB A;  4GF7 A;  3FMW A;  3NIX A;  2B76 A;  1TRB A;  1D7Y A;  4D04 A;  3SQP A;  1GSN A;  3CNT A;  2XLU A;  1GEU A;  2YR5 A;  2QCU A;  1Y0P A;  3DJJ A;  2TMD A;  4OPL A;  2C72 A;  2NPX A;  1BKW A;  3OZ2 A;  2IID A;  1PHH A;  3UOZ A;  4Y4M A;  2WU5 A;  4AOX A;  2IVD A;  3BHK A;  3NK2 X;  1H84 A;  2WOI A;  4BJZ A;  2BS4 A;  3P4P A;  3SZF A;  2GF3 A;  2YLS A;  2GQW A;  5ER0 A;  2PHH A;  3AEG A;  3NK1 X;  4YSZ A;  2B9X A;  4H4P A;  1ZMD A;  5BUK A;  4OPT A;  3BI5 A;  3AE7 A;  4JN9 A;  1JOA A;  2AR8 A;  2JK6 A;  2WOV A;  2XVJ A;  4G6H A;  4CBQ A;  2XYO A;  4H4T A;  4C3Y A;  4H2Q A;  1CC2 A;  2XFU A;  4H4V A;  5EBK A;  3V3N A;  2X3N A;  2VRL A;  1X31 B;  1F8W A;  1NG3 A;  1JEH A;  2WET A;  3AYI A;  1EBD A;  3K7M X;  2R0G A;  3LOV A;  3NNE A;  4U2S A;  3V76 A;  1S3B A;  5U63 A;  1KF6 A;  3L1R A;  4GAP A;  3GDP A;  4B69 A;  2CUL A;  3B3R A;  2ZZ0 A;  3CPI G;  4DSG A;  1BF3 A;  1TDE A;  5KOW A;  3AD8 B;  3K7T A;  4H4U A;  1Y56 A;  2AQJ A;  1Q1R A;  1F3P A;  1GV4 A;  1H82 A;  1FCD A;  1FEA A;  1F6M A;  3GMC A;  3C4N A;  4H4S A;  2R4J A;  5KXJ A;  4G74 A;  2E1M A;  1ZMC A;  3NK0 X;  4B63 A;  4AP1 A;  5BRT A;  2V61 A;  1H86 A;  1GRB A;  1VDC A;  2WPE A;  5FMH A;  2EQ9 A;  2YR6 A;  3GYJ A;  3AXB A;  4YTP A;  4EM4 A;  4J36 A;  2RGJ A;  2YLR A;  1E1M A;  4JDR A;  3T37 A;  3V3O A;  4D03 A;  3IHG A;  4J56 A;  1NG4 A;  3GDN A;  4H7U A;  1D7L A;  1NDA A;  1NHR A;  5GSN A;  3M13 A;  1ONF A;  2BK4 A;  5KMQ A;  1E7P A;  2WBA A;  2WU2 A;  1EL9 A;  3CMM A;  4EQS A;  2C65 A;  2Q0L A;  3NTD A;  3SX6 A;  4H4R A;  3GWF A;  4EM3 A;  3FBS A;  4CNJ A;  1MOK A;  1GOS A;  2VVL A;  3ICR A;  1IUW A;  1GAL A;  2I0Z A;  2JB3 A;  4HA6 A;  4UDR A;  4X9N A;  2WDR A;  4U8J A;  3CPH G;  3C96 A;  4GDE A;  4CNK A;  4GCM A;  4H4Q A;  2VQB A;  2H88 A;  2YLZ A;  3UTE A;  5M10 A;  2GR1 A;  2APG A;  3LZW A;  2XVH A;  3SZC A;  4BUR A;  4I58 A;  3UTG A;  4U8O A;  4B66 A;  2Q0K A;  1DXL A;  3KVE A;  1FL2 A;  2QA2 A;  2NVK X;  2GEW A;  2YM1 A;  3T31 A;  4JNA A;  2ZBW A;  1GPE A;  2C76 A;  1IUT A;  1S2Y A;  1KSS A;  2R45 A;  3CGB A;  3DK8 A;  3RED A;  2PYX A;  4Z2T A;  3FIM B;  1D4D A;  4CCQ A;  2YR4 A;  1YKJ A;  4O5U A;  4FK1 A;  5C3J A;  1TYT A;  3K7Q X;  4PAA A;  3I3L A;  1MXT A;  3P1W A;  2XCG A;  3NN6 X;  2BXR A;  3D8X A;  3F8R A;  2BRY A;  3CPJ G;  1Z6L A;  1F8S A;  2WEU A;  1CJ4 A;  1M6I A;  2DKH A;  4OPC A;  3T2Z A;  5IPY A;  2OA1 A;  1O95 A;  1CL0 A;  4KPR A;  4AP3 A;  1KNP A;  2GR3 A;  2GVC A;  4IA5 A;  4Z24 A;  3H4K A;  5BVA A;  2JKC A;  2YG6 A;  1O5W A;  3UTF A;  4YTM A;  2C67 A;  3ZYX A;  3DJE A;  1CBO A;  4GR1 A;  4YWO A;  5HHF A;  4IVO B;  2ACZ A;  1GND A;  3NT6 A;  1GRH A;  3M0O A;  4C5O A;  1PJ6 A;  2J3N A;  5EB4 A;  2CDU A;  2BYB A;  4Z2U A;  5J60 A;  2XLR A;  2WOW A;  1PXA A;  3CTY A;  1VG0 A;  3IWA A;  4NZH A;  4AT0 A;  5KMS A;  3UOY A;  3NRN A;  4YXD A;  1ZK7 A;  4U8I A;  2UZZ A;  4K7Z A;  2YAU A;  1E1N A;  3UCL A;  1JU2 A;  4J31 A;  2V3A A;  4C3X A;  1N1P A;  3ICT A;  1FOH A;  3FG2 P;  1CJ3 A;  3Q6J A;  3SY4 A;  4U8N A;  2VVM A;  1CC6 A;  1BGJ A;  2CVJ A;  1VQW A;  2QAE A;  3AB1 A;  5KVI A;  2VVL G;  3EAN A;  4EMI A;  3GYX A;  4H2N A;  5KNL A;  2C75 A;  2RGO A;  3UKF A;  4RG3 A;  1IJH A;  3ITJ A;  4A65 A;  2BXS A;  4EMW A;  4FDC B;  1XAN A;  3BNM A;  2A8X A;  4KX6 A;  3P9U A;  4H4X A;  1OJD A;  2JBV A;  3AEC A;  3RHA A;  2GRT A;  3UOX A;  1YQ4 A;  4NNJ A;  4P9S A;  2GMJ A;  1B8S A;  4ZCC A;  3NKS A;  3SFD A;  4EQW A;  3ISH A;  2BS2 A;  1JRZ A;  2CFY A;  4K5S A;  2YVJ A;  1DOC A;  5JCM A;  3HZL A;  1NAA A;  3T2Y A;  1H7W A;  4XWR A;  4JQ9 A;  1GRA A;  4II2 A;  4U2L A;  1K0J A;  4A9W A;  2YG5 A;  4YSY A;  2WS3 A;  1BZL A;  3AEB A;  3AE4 A;  3AE1 A;  4A79 A;  2OAM A;  4IVM B;  5U25 A;  3AED A;  4EIQ A;  1GXF A;  1ZP0 A;  4B68 A;  4GRT A;  3P4Q A;  4K22 A;  3URH A;  5EOW A;  1PBF A;  4ADW A;  1JNR A;  1KDG A;  1KFY A;  3VRD B;  4N9X A;  3S5W A;  1PDH A;  2X99 A;  1PBD A;  2V6O A;  3UP4 A;  1H81 A;  1RP0 A;  2WQY A;  3BNU A;  4U2T A;  3LXD A;  1XPQ A;  2BCP A;  4B65 A;  1DNC A;  3QFB A;  4OPD A;  3IF9 A;  2WPF A;  3AE5 A;  2JB2 A;  3UP5 A;  1Q1W A;  4WX1 A;  1YQ3 A;  1BWC A;  2GR0 A;  4APN A;  1ELI A;  1GRG A;  2FBW A;  3ATQ A;  2XVE A;  3QVR A;  4FX9 A;  3LZX A;  4BK3 A;  2EQ6 A;  3KA7 A;  3AE2 A;  5KMP A;  1DOD A;  3R9U A;  4YSH A;  3CIR A;  4J2W A;  3S61 A;  3LJP A;  4AOS A;  2QA1 A;  3Q9T A;  4H50 A;  4XXG A;  2HQM A;  2V5Z A;  3UKA A;  4Z2R A;  2XDO A;  5KMR A;  5KOX A;  3AE8 A;  2DKI A;  3F8D A;  4YT0 A;  3M12 A;  3NN0 X;  4C74 A;  1PJ5 A;  3SYI A;  2C4C A;  2GH5 A;  1LVL A;  2WHD A;  1TDK A;  2GAG B;  3GMB A;  2BC0 A;  1ZKQ A;  1OJ9 A;  2Z5X A;  2GV8 A;  1GT8 A;  2GQF A;  4UP3 A;  1REO A;  2Z5Y A;  1DOE A;  2R0P A;  5HXI A;  1DJN A;  2R4E A;  1ZY8 A;  4U8L A;  1PJ7 A;  3GSI A;  2BS3 A;  3AEA A;  5CKU A;  1PBE A;  5FS6 A;  1D4C A;  1D5T A;  1V59 A;  1ZOY A;  3AE9 A;  1B5Q A;  3P4R A;  5KVH A;  2H89 A;  2FJD A;  3PO7 A;  2V60 A;  4A99 A;  5KWF A;  3FPZ A;  1TDO A;  1GER A;  1RYI A;  1ZDL A;  2WES A;  4OVI A;  4UDP A;  3UKK A;  4H4Y A;  2WDQ A;  4GDP A;  2E5V A;  2TPR A;  2X8C A;  2BK5 A;  3K30 A;  1O94 A;  3HYV A;  3GWD A;  4NTE A;  5C2T A;  1JRX A;  1IUS A;  3SXI A;  4MJW A;  2Y6Q A;  1E1L A;  1Q9I A;  3NG7 X;  1K0L A;  3AWI A;  2BCG G;  1NEK A;  4CCR A;  3VR8 A;  1CC4 A;  1NHQ A;  2BRA A;  1E6E A;  3NYE A;  2A87 A;  4K5R A;  4NEW A;  4E0V A;  2VQ7 A;  1P2H A;  3DJG X;  2BK3 A;  3KPF A;  2EQ8 A;  3NLC A;  4K8D A;  4YKF A;  1SEZ A;  2W0H A;  2YM2 A;  3O0H A;  4EQR A;  2BAB A;  4NWZ A;  3GD3 A;  2GR2 A;  3VRB A;  1KNR A;  5CQF A;  4JY3 A;  2B7R A;  4WCT A;  3KPK A;  5M0Z A;  1FEC A;  2C64 A;  4BJY A;  4FK1 C;  3GRS A;  3ALM A;  2BC1 A;  2WP6 A;  2Y6R A;  3DGZ A;  3EPT A;  3LB8 A;  4DSH A;  3KD9 A;  4K2X A;  3CGC A;  2ARD A;  1GTE A;  3P4S A;  2B9Y A;  3DA1 A;  3UKQ A;  3SGL A;  3UKP A;  5BUL A;  3CNP A;  4B67 A;  2GMH A;  1N4W A;  2JAE A;  3AYJ A;  2V3B A;  4LII A;  4USQ A;  4Z44 A;  2X8H A;  1ZOV A;  5IQ1 A;  4II3 A;  1PXC A;  1EL8 A;  3QFA A;  4HB9 A;  3E1T A;  4YKG A;  1E39 A;  3NGC X;  5FS8 A;  1JRY A;  3DME A;  4OPI A;  2XVF A;  2WPC A;  1TYP A;  1F8R A;  3DK9 A;  3L8K A;  3HYW A;  1L0V A;  3II4 A;  4YSX A;  1CF3 A;  3QJ4 A;  3KU9 A;  4ICY A;  3SZW A;  3ADA B;  4U8M A;  2IVE A;  1EL7 A;  1PN0 A;  2YVF A;  4CRT A;  3NTA A;  4NTC A;  3AD7 B;  1UKV G;  4XWZ A;  1PS9 A;  5JCI A;  1XDI A;  1RSG A;  3GRT A;  2XLS A;  2VZ2 A;  5DBJ A;  4H4W A;  5HYM A;  1CJ2 A;  3BI2 A;  4I59 A;  4G6G A;  4OPU A;  2YLX A;  2GAH B;  2YG7 A;  4CY6 A;  4DNA A;  4IV9 A;  2Q6U A;  4H2R A;  4REK A;  2ZZB A;  2A89 A;  4BK1 A;  4EMJ A;  2X8G A;  4NEV A;  3BHF A;  1Y56 B;  3CNJ A;  3DK4 A;  3LAD A;  3PVC A;  1H83 A;  3QSM A;  3RP8 A;  1L9D A;  1OJC A;  2C70 A;  3CGE A;  2B9W A;  5FS9 A;  1VG9 A;  3CNS A;  3T14 A;  1D4E A;  3NH3 X;  1HYU A;  1GES A;  3DGH A;  3NHO X;  1OJT A;  2X50 A;  4LA1 A;  3SFE A;  3T2K A;  2C3D A;  2C3C A;  1LV0 A;  1LQU A;  2VRM A;  1DOB A;  2C7G A;  1PBB A;  3AD9 B;  1P2E A;  1NEN A;  2WP9 A;  3KKJ A;  1BGN A;  3VRA A;  1EL5 A;  4TM3 A;  1ZX9 A;  1YY5 A;  1IUX A;  1MO9 A;  4TM0 A;  4Y4N A;  3AEE A;  4G9K A;  2EQ7 A;  3T0K A;  2RGH A;  1CHU A;  3CGD A; 
#chains in the Genus database with same CATH homology
 1XHC A;  1KSU A;  2YLT A;  1B4V A;  1NPX A;  4ZCD A;  2XFN A;  3QSE A;  4TLZ A;  1S3E A;  4A7A A;  1M64 A;  4G73 A;  4EQX A;  2OLO A;  1K0I A;  3WE0 A;  1K4Q A;  1NHP A;  1S2Q A;  3NYF A;  3UOV A;  1L9C A;  4B1B A;  3EAO A;  3ALL A;  3DH9 A;  2YG3 A;  1COY A;  1GRE A;  1LTX R;  4A5L A;  2FJA A;  2R0C A;  3HYX A;  3ALJ A;  4U8P A;  3IC9 A;  3RP7 A;  3KLJ A;  3G5Q A;  1OJA A;  3JSK A;  2RAB A;  5JCK A;  3COX A;  3GYI A;  3D1C A;  4LU6 A;  2XVI A;  2B7S A;  3CND A;  3EF6 A;  2WP5 A;  2YWL A;  1NHS A;  3PS9 A;  4O5Q A;  2VOU A;  5LV9 A;  3BI4 A;  3QSS A;  4NTD A;  4TM1 A;  1N4U A;  3DJD A;  3B6D A;  5EB5 A;  2BA9 A;  3ICS A;  1LPF A;  3AE6 A;  1H6V A;  1VRQ B;  4B64 A;  4BV6 A;  2OAL A;  4JY2 A;  4A6N B;  2O9Z A;  2YLW A;  2XLP A;  2YVG A;  2BAC A;  4OPG A;  3VR9 A;  5JCL A;  3VQR A;  1QJD A;  3CN8 A;  3H8I A;  4OCG A;  5J7X A;  5TR3 A;  1LJ1 A;  1QO8 A;  2JB1 A;  3AE3 A;  2FJE A;  4Z26 A;  1LQT A;  4X9M A;  4GUV A;  4M52 A;  4Y4L A;  3IHM A;  2FJB A;  4RSL A;  3SZ0 A;  3ABV A;  3ZDN A;  4TLX A;  4U8K A;  4CY8 A;  2XFO A;  4JNQ A;  2YQU A;  3SM8 A;  4UDQ A;  4C77 A;  4H4Z A;  5IQ4 A;  2WDV A;  1CJC A;  2OLN A;  2R46 A;  4J33 A;  2R9Z A;  3UKL A;  1YQZ A;  3C4A A;  5U1O A;  1IUV A;  1E1K A;  1W4X A;  2F5Z A;  4Z25 A;  2XLT A;  1L9E A;  4AT2 A;  1H7X A;  5FS7 A;  2E4G A;  4ZN0 A;  3NYC A;  2C73 A;  4J57 A;  4DGK A;  4GAV A;  2Q7V A;  4IA6 A;  3QVP A;  3RP6 A;  1DJQ A;  4EIP A;  5KRQ A;  4YTN A;  1GTH A;  2AAQ A;  1B37 A;  3H8L A;  2XFP A;  1IUU A;  3UKH A;  1TDN A;  4H2P A;  3F8P A;  4J34 A;  4A6N A;  3AEF A;  4RG4 A;  1PBC A;  2ZZC A;  4USR A;  2GB0 A;  1TDF A;  3GD4 A;  5HY5 A;  5L46 A;  1GRF A;  4PAB A;  3I6D A;  2XFQ A;  5GRT A;  4Z43 A;  1GET A;  1PXB A;  3AYL A;  1AOG A;  4TM4 A;  4BK2 A;  2YG4 A;  1JNZ A;  4ECH A;  3G5S A;  3OC4 A;  1QLB A;  3G5R A;  3RNM A;  3UTH A;  2C66 A;  3ATR A;  4X4J A;  5JCN A;  1N4V A;  1GRT A;  1FEB A;  4GF7 A;  3FMW A;  3NIX A;  2B76 A;  1TRB A;  1D7Y A;  4D04 A;  3SQP A;  1GSN A;  3CNT A;  2XLU A;  1GEU A;  2YR5 A;  2QCU A;  1Y0P A;  3DJJ A;  2TMD A;  4OPL A;  2C72 A;  2NPX A;  1BKW A;  3OZ2 A;  2IID A;  1PHH A;  3UOZ A;  4Y4M A;  2WU5 A;  4AOX A;  2IVD A;  3BHK A;  3NK2 X;  1H84 A;  2WOI A;  4BJZ A;  2BS4 A;  3P4P A;  3SZF A;  2GF3 A;  2YLS A;  2GQW A;  5ER0 A;  2PHH A;  3AEG A;  3NK1 X;  4YSZ A;  2B9X A;  4H4P A;  1ZMD A;  5BUK A;  4OPT A;  3BI5 A;  3AE7 A;  4JN9 A;  1JOA A;  2AR8 A;  2JK6 A;  2WOV A;  2XVJ A;  4G6H A;  4CBQ A;  2XYO A;  4H4T A;  4C3Y A;  4H2Q A;  1CC2 A;  2XFU A;  4H4V A;  5EBK A;  3V3N A;  2X3N A;  2VRL A;  1X31 B;  1F8W A;  1NG3 A;  1JEH A;  2WET A;  3AYI A;  1EBD A;  3K7M X;  2R0G A;  3LOV A;  3NNE A;  4U2S A;  3V76 A;  1S3B A;  5U63 A;  1KF6 A;  3L1R A;  4GAP A;  3GDP A;  4B69 A;  2CUL A;  3B3R A;  2ZZ0 A;  3CPI G;  4DSG A;  1BF3 A;  1TDE A;  5KOW A;  3AD8 B;  3K7T A;  4H4U A;  1Y56 A;  2AQJ A;  1Q1R A;  1F3P A;  1GV4 A;  1H82 A;  1FCD A;  1FEA A;  1F6M A;  3GMC A;  3C4N A;  4H4S A;  2R4J A;  5KXJ A;  4G74 A;  2E1M A;  1ZMC A;  3NK0 X;  4B63 A;  4AP1 A;  5BRT A;  2V61 A;  1H86 A;  1GRB A;  1VDC A;  2WPE A;  5FMH A;  2EQ9 A;  2YR6 A;  3GYJ A;  3AXB A;  4YTP A;  4EM4 A;  4J36 A;  2RGJ A;  2YLR A;  1E1M A;  4JDR A;  3T37 A;  3V3O A;  4D03 A;  3IHG A;  4J56 A;  1NG4 A;  3GDN A;  4H7U A;  1D7L A;  1NDA A;  1NHR A;  5GSN A;  3M13 A;  1ONF A;  2BK4 A;  5KMQ A;  1E7P A;  2WBA A;  2WU2 A;  1EL9 A;  3CMM A;  4EQS A;  2C65 A;  2Q0L A;  3NTD A;  3SX6 A;  4H4R A;  3GWF A;  4EM3 A;  3FBS A;  4CNJ A;  1MOK A;  1GOS A;  2VVL A;  3ICR A;  1IUW A;  1GAL A;  2I0Z A;  2JB3 A;  4HA6 A;  4UDR A;  4X9N A;  2WDR A;  4U8J A;  3CPH G;  3C96 A;  4GDE A;  4CNK A;  4GCM A;  4H4Q A;  2VQB A;  2H88 A;  2YLZ A;  3UTE A;  5M10 A;  2GR1 A;  2APG A;  3LZW A;  2XVH A;  3SZC A;  4BUR A;  4I58 A;  3UTG A;  4U8O A;  4B66 A;  2Q0K A;  1DXL A;  3KVE A;  1FL2 A;  2QA2 A;  2NVK X;  2GEW A;  2YM1 A;  3T31 A;  4JNA A;  2ZBW A;  1GPE A;  2C76 A;  1IUT A;  1S2Y A;  1KSS A;  2R45 A;  3CGB A;  3DK8 A;  3RED A;  2PYX A;  4Z2T A;  3FIM B;  1D4D A;  4CCQ A;  2YR4 A;  1YKJ A;  4O5U A;  4FK1 A;  5C3J A;  1TYT A;  3K7Q X;  4PAA A;  3I3L A;  1MXT A;  3P1W A;  2XCG A;  3NN6 X;  2BXR A;  3D8X A;  3F8R A;  2BRY A;  3CPJ G;  1Z6L A;  1F8S A;  2WEU A;  1CJ4 A;  1M6I A;  2DKH A;  4OPC A;  3T2Z A;  5IPY A;  2OA1 A;  1O95 A;  1CL0 A;  4KPR A;  4AP3 A;  1KNP A;  2GR3 A;  2GVC A;  4IA5 A;  4Z24 A;  3H4K A;  5BVA A;  2JKC A;  2YG6 A;  1O5W A;  3UTF A;  4YTM A;  2C67 A;  3ZYX A;  3DJE A;  1CBO A;  4GR1 A;  4YWO A;  5HHF A;  4IVO B;  2ACZ A;  1GND A;  3NT6 A;  1GRH A;  3M0O A;  4C5O A;  1PJ6 A;  2J3N A;  5EB4 A;  2CDU A;  2BYB A;  4Z2U A;  5J60 A;  2XLR A;  2WOW A;  1PXA A;  3CTY A;  1VG0 A;  3IWA A;  4NZH A;  4AT0 A;  5KMS A;  3UOY A;  3NRN A;  4YXD A;  1ZK7 A;  4U8I A;  2UZZ A;  4K7Z A;  2YAU A;  1E1N A;  3UCL A;  1JU2 A;  4J31 A;  2V3A A;  4C3X A;  1N1P A;  3ICT A;  1FOH A;  3FG2 P;  1CJ3 A;  3Q6J A;  3SY4 A;  4U8N A;  2VVM A;  1CC6 A;  1BGJ A;  2CVJ A;  1VQW A;  2QAE A;  3AB1 A;  5KVI A;  2VVL G;  3EAN A;  4EMI A;  3GYX A;  4H2N A;  5KNL A;  2C75 A;  2RGO A;  3UKF A;  4RG3 A;  1IJH A;  3ITJ A;  4A65 A;  2BXS A;  4EMW A;  4FDC B;  1XAN A;  3BNM A;  2A8X A;  4KX6 A;  3P9U A;  4H4X A;  1OJD A;  2JBV A;  3AEC A;  3RHA A;  2GRT A;  3UOX A;  1YQ4 A;  4NNJ A;  4P9S A;  2GMJ A;  1B8S A;  4ZCC A;  3NKS A;  3SFD A;  4EQW A;  3ISH A;  2BS2 A;  1JRZ A;  2CFY A;  4K5S A;  2YVJ A;  1DOC A;  5JCM A;  3HZL A;  1NAA A;  3T2Y A;  1H7W A;  4XWR A;  4JQ9 A;  1GRA A;  4II2 A;  4U2L A;  1K0J A;  4A9W A;  2YG5 A;  4YSY A;  2WS3 A;  1BZL A;  3AEB A;  3AE4 A;  3AE1 A;  4A79 A;  2OAM A;  4IVM B;  5U25 A;  3AED A;  4EIQ A;  1GXF A;  1ZP0 A;  4B68 A;  4GRT A;  3P4Q A;  4K22 A;  3URH A;  5EOW A;  1PBF A;  4ADW A;  1JNR A;  1KDG A;  1KFY A;  3VRD B;  4N9X A;  3S5W A;  1PDH A;  2X99 A;  1PBD A;  2V6O A;  3UP4 A;  1H81 A;  1RP0 A;  2WQY A;  3BNU A;  4U2T A;  3LXD A;  1XPQ A;  2BCP A;  4B65 A;  1DNC A;  3QFB A;  4OPD A;  3IF9 A;  2WPF A;  3AE5 A;  2JB2 A;  3UP5 A;  1Q1W A;  4WX1 A;  1YQ3 A;  1BWC A;  2GR0 A;  4APN A;  1ELI A;  1GRG A;  2FBW A;  3ATQ A;  2XVE A;  3QVR A;  4FX9 A;  3LZX A;  4BK3 A;  2EQ6 A;  3KA7 A;  3AE2 A;  5KMP A;  1DOD A;  3R9U A;  4YSH A;  3CIR A;  4J2W A;  3S61 A;  3LJP A;  4AOS A;  2QA1 A;  3Q9T A;  4H50 A;  4XXG A;  2HQM A;  2V5Z A;  3UKA A;  4Z2R A;  2XDO A;  5KMR A;  5KOX A;  3AE8 A;  2DKI A;  3F8D A;  4YT0 A;  3M12 A;  3NN0 X;  4C74 A;  1PJ5 A;  3SYI A;  2C4C A;  2GH5 A;  1LVL A;  2WHD A;  1TDK A;  2GAG B;  3GMB A;  2BC0 A;  1ZKQ A;  1OJ9 A;  2Z5X A;  2GV8 A;  1GT8 A;  2GQF A;  4UP3 A;  1REO A;  2Z5Y A;  1DOE A;  2R0P A;  5HXI A;  1DJN A;  2R4E A;  1ZY8 A;  4U8L A;  1PJ7 A;  3GSI A;  2BS3 A;  3AEA A;  5CKU A;  1PBE A;  5FS6 A;  1D4C A;  1D5T A;  1V59 A;  1ZOY A;  3AE9 A;  1B5Q A;  3P4R A;  5KVH A;  2H89 A;  2FJD A;  3PO7 A;  2V60 A;  4A99 A;  5KWF A;  3FPZ A;  1TDO A;  1GER A;  1RYI A;  1ZDL A;  2WES A;  4OVI A;  4UDP A;  3UKK A;  4H4Y A;  2WDQ A;  4GDP A;  2E5V A;  2TPR A;  2X8C A;  2BK5 A;  3K30 A;  1O94 A;  3HYV A;  3GWD A;  4NTE A;  5C2T A;  1JRX A;  1IUS A;  3SXI A;  4MJW A;  2Y6Q A;  1E1L A;  1Q9I A;  3NG7 X;  1K0L A;  3AWI A;  2BCG G;  1NEK A;  4CCR A;  3VR8 A;  1CC4 A;  1NHQ A;  2BRA A;  1E6E A;  3NYE A;  2A87 A;  4K5R A;  4NEW A;  4E0V A;  2VQ7 A;  1P2H A;  3DJG X;  2BK3 A;  3KPF A;  2EQ8 A;  3NLC A;  4K8D A;  4YKF A;  1SEZ A;  2W0H A;  2YM2 A;  3O0H A;  4EQR A;  2BAB A;  4NWZ A;  3GD3 A;  2GR2 A;  3VRB A;  1KNR A;  5CQF A;  4JY3 A;  2B7R A;  4WCT A;  3KPK A;  5M0Z A;  1FEC A;  2C64 A;  4BJY A;  4FK1 C;  3GRS A;  3ALM A;  2BC1 A;  2WP6 A;  2Y6R A;  3DGZ A;  3EPT A;  3LB8 A;  4DSH A;  3KD9 A;  4K2X A;  3CGC A;  2ARD A;  1GTE A;  3P4S A;  2B9Y A;  3DA1 A;  3UKQ A;  3SGL A;  3UKP A;  5BUL A;  3CNP A;  4B67 A;  2GMH A;  1N4W A;  2JAE A;  3AYJ A;  2V3B A;  4LII A;  4USQ A;  4Z44 A;  2X8H A;  1ZOV A;  5IQ1 A;  4II3 A;  1PXC A;  1EL8 A;  3QFA A;  4HB9 A;  3E1T A;  4YKG A;  1E39 A;  3NGC X;  5FS8 A;  1JRY A;  3DME A;  4OPI A;  2XVF A;  2WPC A;  1TYP A;  1F8R A;  3DK9 A;  3L8K A;  3HYW A;  1L0V A;  3II4 A;  4YSX A;  1CF3 A;  3QJ4 A;  3KU9 A;  4ICY A;  3SZW A;  3ADA B;  4U8M A;  2IVE A;  1EL7 A;  1PN0 A;  2YVF A;  4CRT A;  3NTA A;  4NTC A;  3AD7 B;  1UKV G;  4XWZ A;  1PS9 A;  5JCI A;  1XDI A;  1RSG A;  3GRT A;  2XLS A;  2VZ2 A;  5DBJ A;  4H4W A;  5HYM A;  1CJ2 A;  3BI2 A;  4I59 A;  4G6G A;  4OPU A;  2YLX A;  2GAH B;  2YG7 A;  4CY6 A;  4DNA A;  4IV9 A;  2Q6U A;  4H2R A;  4REK A;  2ZZB A;  2A89 A;  4BK1 A;  4EMJ A;  2X8G A;  4NEV A;  3BHF A;  1Y56 B;  3CNJ A;  3DK4 A;  3LAD A;  3PVC A;  1H83 A;  3QSM A;  3RP8 A;  1L9D A;  1OJC A;  2C70 A;  3CGE A;  2B9W A;  5FS9 A;  1VG9 A;  3CNS A;  3T14 A;  1D4E A;  3NH3 X;  1HYU A;  1GES A;  3DGH A;  3NHO X;  1OJT A;  2X50 A;  4LA1 A;  3SFE A;  3T2K A;  2C3D A;  2C3C A;  1LV0 A;  1LQU A;  2VRM A;  1DOB A;  2C7G A;  1PBB A;  3AD9 B;  1P2E A;  1NEN A;  2WP9 A;  3KKJ A;  1BGN A;  3VRA A;  1EL5 A;  4TM3 A;  1ZX9 A;  1YY5 A;  1IUX A;  1MO9 A;  4TM0 A;  4Y4N A;  3AEE A;  4G9K A;  2EQ7 A;  3T0K A;  2RGH A;  1CHU A;  3CGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...