1F8RA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
483
structure length
483
Chain Sequence
RNPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords L-AMINO ACID OXIDASE
publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
total genus 171
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8rA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8rA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8rA01
3AEDA 1N4UA 3ALMA 3M12A 2X8CA 3BNMA 3K7TA 2BC1A 2CULA 2AAQA 4H4SA 4U8MA 3UKKA 2A87A 3UKFA 3NH3X 4YSZA 5BRTA 3C96A 2IVDA 5BULA 3H4KA 3ISHA 3RP8A 4DNAA 3AE3A 2WOVA 1L9CA 4H4ZA 2XLPA 2BC0A 3FBSA 2OAMA 2GR3A 3EANA 2YVFA 4TLZA 2XCGA 3AECA 3P9UA 4OPCA 3V3NA 1OJTA 1MOKA 3GWFA 3UTEA 2EQ8A 2OLOA 1BZLA 3ABVA 1TDFA 2NPXA 4BJYA 3VQRA 2JAEA 1D4CA 4UDPA 2EQ7A 1GERA 3EAOA 1KSUA 4JQ9A 4EQRA 3II4A 1TYTA 2WPEA 5FS9A 4IV9A 1IUXA 4A79A 2Q7VA 1COYA 1NAAA 4NTCA 3UKLA 1TDKA 5J7XA 4B64A 1PXAA 3ATQA 5JCNA 3B3RA 2C3CA 3G5QA 3GRTA 2VQ7A 2WDRA 4H4QA 2RGHA 4AT0A 3AE2A 4ZN0A 3Q6JA 2R45A 2BK4A 1GSNA 2WPFA 2XVFA 2YVGA 3P4PA 1ZP0A 1S3EA 1IUUA 1PBFA 2E1MA 3IHGA 4DGKA 4J56A 4KPRA 3UKQA 4U8JA 4EQWA 1NEKA 1PXBA 1ZY8A 2BS4A 2R0PA 3AYIA 3V3OA 2IVEA 2XLRA 3RNMA 1NDAA 1ZDLA 2XLUA 4H2PA 4EMIA 1E39A 4Z2TA 1BWCA 2XFPA 3KA7A 4AP1A 1LVLA 3DJJA 3ICRA 3CTYA 3GDPA 4C74A 1N4VA 1E1MA 2XVIA 3E1TA 2R0CA 2GR2A 3AE4A 4B67A 2FBWA 2W0HA 1E1KA 4Y4MA 1PBBA 2QAEA 4I58A 4YTNA 3FG2P 1X31B 4GUVA 4U8PA 3DH9A 3OC4A 3LZXA 4OPGA 4Z2RA 2C3DA 1Q1RA 2V61A 3L8KA 3SQPA 2ARDA 4Y4LA 1IUSA 4H2NA 1OJ9A 3AEEA 2ZBWA 3K30A 1K0LA 2RGJA 3IHMA 1LQTA 1Q1WA 3NLCA 3KPFA 4BJZA 1JNZA 1F8RA 1GPEA 1UKVG 4JNAA 2VVLA 4C3XA 2XYOA 2FJAA 5GRTA 3UTGA 1O5WA 3ALJA 3G5SA 4B63A 2CFYA 3BNUA 1NHPA 2GQFA 3GWDA 3V76A 2GRTA 4OPUA 3EF6A 1TDEA 4YKFA 3I3LA 1NPXA 1EL7A 4BK3A 4EQXA 3UKHA 3UOXA 3GD3A 2X8GA 3UOVA 4RG4A 2C73A 1EL5A 2E4GA 3VRDB 2C7GA 3BHKA 2BXSA 1P2HA 2C66A 3FMWA 1GETA 1NHRA 2BYBA 4Z24A 1KF6A 4BK1A 4EMWA 2DKHA 1TYPA 3NK2X 2OA1A 1DOBA 1ELIA 3F8DA 4E0VA 2XFUA 3CNTA 3DGZA 1F6MA 2GMJA 3DK8A 2J3NA 1CC6A 1RP0A 4IVOB 1H6VA 2R9ZA 1P2EA 4U8KA 2TPRA 2GAHB 2WU2A 1NHSA 2YG7A 4D03A 1CJ3A 3KLJA 1GRGA 1L0VA 1L9DA 2B7SA 1CJ2A 4YSHA 1YKJA 3COXA 4LA1A 1GT8A 2E5VA 2YLTA 1LV0A 1Y0PA 2BS2A 2X8HA 2IIDA 2A89A 1GRTA 2WPCA 4NTEA 4PAAA 4RG3A 3ICTA 3NN6X 4GRTA 4U8IA 3AE5A 3QJ4A 4AT2A 1DODA 2C65A 2FJDA 2WHDA 2X50A 2I0ZA 4GR1A 5HXIA 1NG3A 2GH5A 2YM2A 4JNQA 1MO9A 1JOAA 2WOWA 3GRSA 4JN9A 1H7WA 3UTHA 1JNRA 4Z26A 2XVJA 1JEHA 4H4XA 4A6NA 1DOEA 4K5SA 4GDPA 4H4UA 1F3PA 1YQ4A 4OPTA 4A65A 4D04A 4H4VA 4B68A 2R4EA 3ZYXA 2JB3A 2Y6RA 1GRAA 2B9YA 1GTEA 3NT6A 4EIPA 1OJCA 3AD7B 3VRBA 1XDIA 1N1PA 2WS3A 3ATRA 2ZZCA 4Y4NA 2YLSA 2XDOA 4I59A 1LQUA 2YLZA 3IF9A 3AB1A 3NRNA 4RSLA 4B66A 1FL2A 2EQ9A 5CQFA 3M0OA 1PBEA 2ZZ0A 3NHOX 3NYEA 3EPTA 2BABA 4CY8A 1BGNA 2DKIA 3AEGA 1D4DA 4IA6A 1JRYA 2JKCA 1GNDA 1BF3A 5KRQA 4K8DA 1AOGA 1PS9A 2B76A 5C2TA 1PDHA 4FK1C 2APGA 4U2LA 3UCLA 3UOYA 2BA9A 1Y56B 3D1CA 3GMBA 3GDNA 3IWAA 3BI4A 4YKGA 1K0IA 2X3NA 3QVPA 4Z2UA 2CVJA 2H89A 2V3AA 5LV9A 1IJHA 4NTDA 4U8NA 5U1OA 1LPFA 3BI2A 2C70A 1DOCA 4UDQA 3CNSA 3WE0A 2XLSA 4J31A 3NTDA 1RYIA 2WEUA 3RP6A 2CDUA 3P4SA 1BGJA 4M52A 2YQUA 2AR8A 2OALA 3CGEA 4FDCB 3UKPA 2YAUA 3ZDNA 4XXGA 2GF3A 1O95A 4OPIA 1VDCA 3AYLA 4A6NB 2FJBA 5FMHA 4EM3A 1D5TA 1E6EA 4C77A 4C3YA 1M64A 5EBKA 3K7QX 2QA1A 1N4WA 2GR1A 4YSXA 3AE9A 1H86A 1S2QA 1CF3A 1JRZA 1DNCA 2XFNA 3GD4A 4X9NA 3VRAA 1S3BA 2BCGG 2Q0LA 1Q9IA 3LOVA 3OZ2A 2V5ZA 1PBDA 1ZOVA 1NG4A 3AE6A 4EQSA 4OPLA 1PXCA 5J60A 3GYJA 2HQMA 1JRXA 2Q6UA 2YLRA 3SFDA 5CKUA 1F8WA 2R46A 3T37A 4CNKA 3LJPA 1TDNA 3S5WA 2GB0A 3NTAA 5GSNA 2QCUA 1H82A 3AEFA 5U25A 3L1RA 1KDGA 5KXJA 4U2SA 4OCGA 4FK1A 3ALLA 3CGCA 2WQYA 3ITJA 1EL9A 1K4QA 3K7MX 4EM4A 3HZLA 2B9XA 4X4JA 3UTFA 1CJ4A 3H8LA 4OVIA 4TM3A 4A7AA 4GDEA 2WDVA 4H4TA 5KVHA 2JB1A 1CBOA 1GRBA 1KSSA 2ZZBA 4AOSA 1GOSA 4HB9A 1GREA 2VVLG 3AEBA 1FCDA 1QLBA 2NVKX 2XFQA 1PJ6A 1QO8A 3LADA 2BACA 5BVAA 1HYUA 2C76A 2BS3A 2JB2A 3NGCX 4NEVA 2A8XA 2VRLA 3QSEA 3VR9A 2XFOA 4N9XA 3SM8A 2TMDA 4EMJA 3CGDA 5KOWA 1YY5A 2WETA 4TM0A 1PJ7A 2BK3A 4AP3A 4B69A 1BKWA 4Z44A 2PYXA 4B1BA 4YXDA 4BV6A 3AE7A 3KKJA 3NYFA 4IVMB 5L46A 1YQZA 3AEAA 5HHFA 3DJEA 4KX6A 3P1WA 3NIXA 2XVHA 2YLWA 1E1LA 5HY5A 1QJDA 2QA2A 3NNEA 3ICSA 3REDA 1GESA 1PN0A 4H2QA 4H4PA 1S2YA 5DBJA 4B65A 2C75A 1CJCA 3AD9B 3AE8A 5EOWA 2WU5A 1V59A 3FIMB 4CY6A 3DK4A 3AD8B 3BI5A 1VG9A 1OJAA 3DGHA 3C4AA 1XPQA 4ZCCA 3NG7X 2GVCA 2RABA 4IA5A 3QSMA 2YG4A 1OJDA 3DA1A 5M0ZA 2WESA 1IUTA 5U63A 2WP9A 3R9UA 3P4RA 4JDRA 1KNRA 4K5RA 4MJWA 4GF7A 2C64A 4O5QA 2H88A 1CL0A 3PVCA 5C3JA 5IQ4A 1ZOYA 5M10A 1GALA 2Q0KA 2YR4A 4K22A 4ECHA 2GV8A 4XWRA 2XVEA 1Z6LA 3IC9A 1VG0A 3GMCA 3CPIG 2OLNA 5BUKA 1FEAA 2YWLA 4TM1A 4USQA 2FJEA 2JK6A 3LB8A 1IUWA 4YTMA 2EQ6A 1REOA 5KVIA 5HYMA 4U2TA 1SEZA 2B7RA 2WOIA 2YG6A 3F8PA 3QVRA 4JY3A 4J57A 3I6DA 4UP3A 3CIRA 4A99A 5JCIA 3UKAA 1VQWA 5IPYA 2YVJA 3SGLA 1ZK7A 3ADAB 4BURA 1D4EA 3H8IA 4HA6A 1LTXR 1GTHA 1FOHA 5KOXA 4ADWA 2VOUA 1E7PA 3AE1A 5FS8A 4Z25A 1XANA 4REKA 5TR3A 1YQ3A 1CC4A 1DJNA 4K2XA 4GCMA 4XWZA 2GQWA 1TRBA 2Y6QA 4FX9A 4UDRA 1PJ5A 1ZKQA 4J33A 2R4JA 3NKSA 1B37A 1D7LA 4OPDA 4J36A 1PHHA 4CBQA 1ZX9A 3G5RA 1JU2A 2V6OA 3DJGX 3GYIA 3O0HA 2AQJA 1TDOA 3CNPA 4CCRA 1ONFA 4JY2A 1GXFA 2YM1A 3JSKA 3DMEA 1GRHA 2V3BA 3VR8A 4O5UA 4YTPA 2WP6A 4TM4A 3Q9TA 1KFYA 2YLXA 4K7ZA 2V60A 3NK1X 1B4VA 3KU9A 3CPHG 3CPJG 1KNPA 1ZMCA 2Z5XA 1O94A 2VRMA 1K0JA 1FECA 2GAGB 4J34A 4LIIA 4APNA 2WDQA 1EBDA 3CN8A 3BHFA 3P4QA 4TLXA 2F5ZA 1W4XA 3CGBA 1IUVA 4CNJA 4H4RA 1F8SA 2X99A 3QSSA 4H2RA 3PS9A 3KVEA 4ZCDA 3RP7A 4A9WA 1NHQA 2PHHA 4AOXA 4A5LA 1NENA 4P9SA 5IQ1A 3URHA 2GR0A 1B8SA 4J2WA 4YWOA 3UOZA 3DJDA 4CCQA 3AWIA 2JBVA 3GSIA 4H4WA 2VQBA 3AXBA 2BXRA 1GEUA 3B6DA 3PO7A 2YG3A 1GRFA 3NN0X 1LJ1A 1CHUA 4ICYA 1XHCA 1MXTA 1EL8A 4YSYA 3LXDA 1VRQB 2YG5A 1RSGA 3NK0X 1M6IA 3LZWA 5FS6A 1FEBA 1H83A 2Z5YA 3C4NA 1GV4A 4PABA 4U8LA 4EIQA 4CRTA 4Z43A 1H84A 3M13A 4U8OA 4WCTA 3QFBA 3F8RA 4H4YA 2O9ZA 4BK2A 1DXLA 1ZMDA 4DSGA 4DSHA 2UZZA 3AYJA 5JCLA 3NYCA 2WBAA 4USRA 2RGOA 4H7UA 2YR6A 2VZ2A 2BCPA 2XLTA 4WX1A 2YR5A 4C5OA 2GEWA 4LU6A 3KD9A 2GMHA 3RHAA 1D7YA 5FS7A 2C72A 5JCKA 2ACZA 2B9WA 1H81A 2WP5A 1B5QA 2C67A 3CNJA 4NEWA 1Y56A 4YT0A 3S61A 4NZHA 3UP5A 1L9EA 1DJQA 1CC2A 1H7XA 3DK9A 3FPZA 4H50A 3D8XA 3QFAA 5EB5A 4X9MA 5JCMA 3SFEA 1E1NA 1PBCA 2R0GA 5ER0A 5EB4A 2BK5A 2VVMA 5KWFA 3UP4A 3CNDA
chains in the Genus database with same CATH superfamily
3AEDA 1N4UA 3ALMA 3M12A 2X8CA 3BNMA 3K7TA 2BC1A 2CULA 2AAQA 4H4SA 4U8MA 3UKKA 2A87A 3UKFA 3NH3X 4YSZA 5BRTA 3C96A 2IVDA 5BULA 3H4KA 3ISHA 3RP8A 4DNAA 3AE3A 2WOVA 1L9CA 4H4ZA 2XLPA 2BC0A 3FBSA 2OAMA 2GR3A 3EANA 2YVFA 4TLZA 2XCGA 3AECA 3P9UA 3SZFA 4OPCA 3V3NA 1OJTA 3T2YA 1MOKA 3GWFA 3UTEA 2EQ8A 2OLOA 1BZLA 3ABVA 1TDFA 2NPXA 4BJYA 4II3A 3VQRA 2JAEA 1D4CA 4UDPA 2EQ7A 1GERA 3EAOA 1KSUA 4JQ9A 4EQRA 3II4A 1TYTA 2WPEA 3HYXA 5FS9A 4IV9A 1IUXA 4A79A 2Q7VA 1COYA 1NAAA 4NTCA 3UKLA 1TDKA 5J7XA 4B64A 1PXAA 3ATQA 5JCNA 3B3RA 2C3CA 3CMMA 3G5QA 3GRTA 2VQ7A 2WDRA 4H4QA 2RGHA 4AT0A 3AE2A 4ZN0A 3Q6JA 2R45A 2BK4A 1GSNA 2WPFA 2XVFA 2YVGA 3P4PA 1ZP0A 1S3EA 1IUUA 1PBFA 2E1MA 3IHGA 4DGKA 4J56A 4KPRA 3UKQA 4U8JA 4EQWA 1NEKA 1PXBA 1ZY8A 2BS4A 2R0PA 3AYIA 3V3OA 2IVEA 2XLRA 3RNMA 1NDAA 1ZDLA 2XLUA 4H2PA 4EMIA 1E39A 5KMSA 4Z2TA 1BWCA 2XFPA 3KA7A 4AP1A 1LVLA 3DJJA 3ICRA 3CTYA 3GDPA 4C74A 1N4VA 1E1MA 2XVIA 4GAPA 3E1TA 2R0CA 3KPKA 2GR2A 4NWZA 3AE4A 4B67A 5KMRA 2FBWA 2W0HA 1E1KA 4Y4MA 1PBBA 2QAEA 4I58A 4YTNA 3FG2P 1X31B 4G6HA 4GUVA 4U8PA 3DH9A 3OC4A 3LZXA 4OPGA 4Z2RA 2C3DA 1Q1RA 2V61A 3L8KA 3SQPA 2ARDA 4Y4LA 1IUSA 4H2NA 1OJ9A 3AEEA 2ZBWA 3K30A 1K0LA 2RGJA 3IHMA 1LQTA 1Q1WA 3NLCA 3KPFA 4BJZA 1JNZA 1F8RA 1GPEA 1UKVG 4JNAA 2VVLA 4C3XA 2XYOA 2FJAA 5GRTA 3UTGA 1O5WA 3ALJA 3G5SA 4B63A 2CFYA 3BNUA 1NHPA 2GQFA 3GWDA 3V76A 3GYXA 2GRTA 4OPUA 3EF6A 1TDEA 4YKFA 3I3LA 1NPXA 1EL7A 4BK3A 4EQXA 5KMPA 3UKHA 4G73A 3UOXA 3GD3A 2X8GA 3UOVA 4RG4A 2C73A 1EL5A 2E4GA 3VRDB 2C7GA 3BHKA 2BXSA 1P2HA 2C66A 3FMWA 3T0KA 1GETA 1NHRA 2BYBA 4Z24A 1KF6A 4BK1A 4EMWA 2DKHA 1TYPA 3NK2X 3HYVA 2OA1A 1DOBA 1ELIA 3F8DA 4E0VA 2XFUA 3CNTA 3DGZA 1F6MA 2GMJA 3DK8A 2J3NA 1CC6A 1RP0A 4IVOB 1H6VA 2R9ZA 1P2EA 4U8KA 2TPRA 2GAHB 2WU2A 1NHSA 2YG7A 4D03A 1CJ3A 3KLJA 1GRGA 1L0VA 1L9DA 2B7SA 1CJ2A 4YSHA 1YKJA 3COXA 4LA1A 1GT8A 2E5VA 2YLTA 1LV0A 1Y0PA 2BS2A 2X8HA 2IIDA 2A89A 1GRTA 2WPCA 3HYWA 4NTEA 4PAAA 3ICTA 3NN6X 4GRTA 4RG3A 3AE5A 3QJ4A 4U8IA 4AT2A 1DODA 2C65A 2FJDA 2WHDA 2X50A 2I0ZA 4GR1A 5HXIA 1NG3A 2GH5A 2YM2A 4JNQA 1MO9A 1JOAA 2WOWA 3GRSA 4JN9A 2BRYA 1H7WA 3UTHA 1JNRA 4Z26A 2XVJA 1JEHA 4H4XA 4A6NA 1DOEA 4K5SA 3SXIA 4GDPA 4H4UA 1F3PA 1YQ4A 4OPTA 4A65A 4D04A 4H4VA 4B68A 2R4EA 3ZYXA 2JB3A 2Y6RA 1GRAA 2B9YA 1GTEA 3NT6A 4EIPA 1OJCA 3AD7B 3VRBA 1XDIA 1N1PA 3SZ0A 2WS3A 3ATRA 2ZZCA 4Y4NA 2YLSA 2XDOA 4I59A 1LQUA 2YLZA 3IF9A 3AB1A 3NRNA 4G9KA 4G6GA 4NNJA 1FL2A 2EQ9A 4RSLA 5CQFA 3M0OA 1PBEA 2ZZ0A 3NHOX 3NYEA 3EPTA 2BABA 4CY8A 1BGNA 2DKIA 3AEGA 1D4DA 4IA6A 1JRYA 2JKCA 1GNDA 1BF3A 5KRQA 4K8DA 1AOGA 4G74A 1PS9A 2B76A 5C2TA 1PDHA 4FK1C 2APGA 4U2LA 3UCLA 3UOYA 2BA9A 1Y56B 3D1CA 3GMBA 3GDNA 3IWAA 3BI4A 4YKGA 1K0IA 2X3NA 3QVPA 4Z2UA 2CVJA 2H89A 2V3AA 5LV9A 1IJHA 4NTDA 3T14A 4U8NA 5U1OA 1LPFA 3BI2A 2C70A 1DOCA 4UDQA 3CNSA 3WE0A 2XLSA 3SY4A 4J31A 3NTDA 1RYIA 2WEUA 3SX6A 3RP6A 2CDUA 3P4SA 1BGJA 4M52A 2YQUA 2AR8A 2OALA 3CGEA 4FDCB 3UKPA 2YAUA 3ZDNA 4XXGA 2GF3A 1O95A 4OPIA 1VDCA 3AYLA 4A6NB 2FJBA 5FMHA 4EM3A 1D5TA 1E6EA 4C77A 4C3YA 1M64A 5EBKA 3K7QX 2QA1A 1N4WA 2GR1A 4YSXA 3AE9A 3SZWA 1H86A 1S2QA 1CF3A 1JRZA 1DNCA 2XFNA 3GD4A 4X9NA 3VRAA 1S3BA 2BCGG 2Q0LA 1Q9IA 3LOVA 3OZ2A 2V5ZA 1PBDA 1ZOVA 1NG4A 3AE6A 4EQSA 4OPLA 1PXCA 5J60A 3GYJA 2HQMA 1JRXA 2Q6UA 2YLRA 3SFDA 5CKUA 1F8WA 2R46A 3T37A 4CNKA 3LJPA 1TDNA 3S5WA 2GB0A 3NTAA 5GSNA 2QCUA 1H82A 3AEFA 5U25A 3L1RA 1KDGA 3SYIA 5KXJA 4U2SA 4OCGA 4FK1A 3ALLA 3CGCA 2WQYA 3ITJA 1EL9A 1K4QA 3K7MX 4EM4A 3HZLA 2B9XA 4X4JA 3UTFA 1CJ4A 3H8LA 4OVIA 4TM3A 4A7AA 4GDEA 2WDVA 4H4TA 5KVHA 2JB1A 1CBOA 1GRBA 1KSSA 2ZZBA 4AOSA 1GOSA 4HB9A 1GREA 2VVLG 3AEBA 1FCDA 1QLBA 2NVKX 2XFQA 1PJ6A 1QO8A 3LADA 2BACA 3T31A 5BVAA 1HYUA 2C76A 2BS3A 2JB2A 3NGCX 4NEVA 2A8XA 2VRLA 3QSEA 3VR9A 2XFOA 4N9XA 3SM8A 2TMDA 4EMJA 3CGDA 5KOWA 1YY5A 2WETA 4TM0A 1PJ7A 2BK3A 4AP3A 4B69A 1BKWA 4Z44A 2PYXA 4B1BA 4YXDA 4BV6A 3AE7A 3KKJA 3NYFA 4IVMB 5L46A 1YQZA 3AEAA 5HHFA 3DJEA 4KX6A 3P1WA 3NIXA 2XVHA 2YLWA 1E1LA 5HY5A 1QJDA 2QA2A 2C4CA 3NNEA 3ICSA 3REDA 1GESA 1PN0A 4H2QA 4H4PA 1S2YA 5DBJA 4B65A 2C75A 1CJCA 3AD9B 3AE8A 5EOWA 4GAVA 2WU5A 1V59A 3FIMB 4CY6A 5KNLA 3DK4A 3AD8B 3BI5A 1VG9A 3SZCA 1OJAA 3DGHA 3C4AA 1XPQA 4ZCCA 3NG7X 2GVCA 2RABA 4IA5A 3QSMA 2YG4A 1OJDA 3DA1A 5M0ZA 2WESA 1IUTA 5U63A 2WP9A 3R9UA 3P4RA 4JDRA 1KNRA 4K5RA 4MJWA 4GF7A 2C64A 4O5QA 2H88A 1CL0A 3PVCA 5C3JA 5IQ4A 1ZOYA 5M10A 1GALA 2Q0KA 2YR4A 4K22A 4ECHA 2GV8A 4XWRA 2XVEA 1Z6LA 3IC9A 1VG0A 3GMCA 3CPIG 2OLNA 5BUKA 1FEAA 2YWLA 4TM1A 4USQA 2FJEA 2JK6A 3LB8A 1IUWA 4YTMA 2EQ6A 1REOA 5KVIA 5HYMA 4U2TA 1SEZA 2B7RA 2WOIA 2YG6A 3F8PA 3QVRA 4JY3A 4J57A 3I6DA 2BRAA 3CIRA 4UP3A 4A99A 3UKAA 1VQWA 5IPYA 2YVJA 3SGLA 1ZK7A 3ADAB 4BURA 1D4EA 3H8IA 4HA6A 1LTXR 1GTHA 1FOHA 5KOXA 4ADWA 2VOUA 1E7PA 3AE1A 5FS8A 4Z25A 1XANA 4REKA 5TR3A 1YQ3A 1CC4A 1DJNA 4K2XA 4GCMA 4XWZA 2GQWA 1TRBA 2Y6QA 4FX9A 4UDRA 1PJ5A 1ZKQA 4J33A 2R4JA 3NKSA 1B37A 1D7LA 4OPDA 4J36A 1PHHA 4CBQA 1ZX9A 3G5RA 1JU2A 2V6OA 3DJGX 3GYIA 3O0HA 2AQJA 1TDOA 3CNPA 4CCRA 1ONFA 4JY2A 1GXFA 2YM1A 3JSKA 3DMEA 5KMQA 1GRHA 2V3BA 3VR8A 4O5UA 4YTPA 2WP6A 4TM4A 5JCIA 3Q9TA 1KFYA 2YLXA 4K7ZA 2V60A 3NK1X 1B4VA 3KU9A 3CPHG 3CPJG 1KNPA 1ZMCA 2Z5XA 1O94A 2VRMA 1K0JA 1FECA 2GAGB 4J34A 4LIIA 4APNA 2WDQA 1EBDA 3CN8A 3BHFA 3P4QA 4TLXA 2F5ZA 1W4XA 3CGBA 1IUVA 4CNJA 4H4RA 1F8SA 2X99A 3QSSA 4H2RA 3PS9A 3KVEA 4ZCDA 3RP7A 4A9WA 4II2A 1NHQA 2PHHA 4AOXA 4A5LA 1NENA 4P9SA 5IQ1A 3URHA 2GR0A 1B8SA 4J2WA 4YWOA 3UOZA 3DJDA 4CCQA 3AWIA 2JBVA 3GSIA 4H4WA 2VQBA 3AXBA 2BXRA 1GEUA 3B6DA 3PO7A 2YG3A 1GRFA 3NN0X 1LJ1A 1CHUA 4ICYA 1XHCA 1MXTA 1EL8A 4YSYA 3LXDA 1VRQB 2YG5A 1RSGA 3NK0X 1M6IA 3LZWA 5FS6A 1FEBA 1H83A 2Z5YA 3C4NA 1GV4A 4PABA 4U8LA 4EIQA 4CRTA 4Z43A 1H84A 3M13A 4U8OA 4WCTA 3QFBA 3F8RA 4H4YA 2O9ZA 4BK2A 1DXLA 1ZMDA 4DSGA 4DSHA 2UZZA 3AYJA 5JCLA 3NYCA 2WBAA 4USRA 2RGOA 4H7UA 2YR6A 4B66A 2VZ2A 2BCPA 2XLTA 4WX1A 2YR5A 4C5OA 2GEWA 4LU6A 3T2KA 3KD9A 2GMHA 3RHAA 1D7YA 5FS7A 2C72A 5JCKA 2B9WA 2ACZA 1H81A 2WP5A 1B5QA 2C67A 3CNJA 4NEWA 3T2ZA 1Y56A 4YT0A 3S61A 4NZHA 3UP5A 1L9EA 1DJQA 1CC2A 1H7XA 3DK9A 3FPZA 4H50A 3D8XA 3QFAA 5EB5A 4X9MA 5JCMA 3SFEA 1E1NA 1PBCA 2R0GA 5ER0A 5EB4A 2BK5A 2VVMA 5KWFA 3UP4A 3CNDA
chains in the Genus database with same CATH topology
3AEDA 1N4UA 3ALMA 3M12A 2X8CA 3BNMA 3K7TA 2BC1A 2CULA 2AAQA 4H4SA 4U8MA 3UKKA 2A87A 3UKFA 3NH3X 4YSZA 5BRTA 3C96A 2IVDA 5BULA 3H4KA 3ISHA 3RP8A 4DNAA 3AE3A 2WOVA 1L9CA 4H4ZA 2XLPA 2BC0A 3FBSA 2OAMA 2GR3A 3EANA 2YVFA 4TLZA 2XCGA 3AECA 3P9UA 3SZFA 4OPCA 3V3NA 1OJTA 3T2YA 1MOKA 3GWFA 3UTEA 2EQ8A 2OLOA 1BZLA 3ABVA 1TDFA 2NPXA 4BJYA 4II3A 3VQRA 2JAEA 1D4CA 4UDPA 2EQ7A 1GERA 3EAOA 1KSUA 4JQ9A 4EQRA 3II4A 1TYTA 2WPEA 3HYXA 5FS9A 4IV9A 1IUXA 4A79A 2Q7VA 1COYA 1NAAA 4NTCA 3UKLA 1TDKA 5J7XA 4B64A 1PXAA 3ATQA 5JCNA 3B3RA 2C3CA 3CMMA 3G5QA 3GRTA 2VQ7A 2WDRA 4H4QA 2RGHA 4AT0A 3AE2A 4ZN0A 3Q6JA 2R45A 2BK4A 1GSNA 2WPFA 2XVFA 2YVGA 3P4PA 1ZP0A 1S3EA 1IUUA 1PBFA 2E1MA 3IHGA 4DGKA 4J56A 4KPRA 3UKQA 4U8JA 4EQWA 1NEKA 1PXBA 1ZY8A 2BS4A 2R0PA 3AYIA 3V3OA 2IVEA 2XLRA 3RNMA 1NDAA 1ZDLA 2XLUA 4H2PA 4EMIA 1E39A 5KMSA 4Z2TA 1BWCA 2XFPA 3KA7A 4AP1A 1LVLA 3DJJA 3ICRA 3CTYA 3GDPA 4C74A 1N4VA 1E1MA 2XVIA 4GAPA 3E1TA 2R0CA 3KPKA 2GR2A 4NWZA 3AE4A 4B67A 5KMRA 2FBWA 2W0HA 1E1KA 4Y4MA 1PBBA 2QAEA 4I58A 4YTNA 3FG2P 1X31B 4G6HA 4GUVA 4U8PA 3DH9A 3OC4A 3LZXA 4OPGA 4Z2RA 2C3DA 1Q1RA 2V61A 3L8KA 3SQPA 2ARDA 4Y4LA 1IUSA 4H2NA 1OJ9A 3AEEA 2ZBWA 3K30A 1K0LA 2RGJA 3IHMA 1LQTA 1Q1WA 3NLCA 3KPFA 4BJZA 1JNZA 1F8RA 1GPEA 1UKVG 4JNAA 2VVLA 4C3XA 2XYOA 2FJAA 5GRTA 3UTGA 1O5WA 3ALJA 3G5SA 4B63A 2CFYA 3BNUA 1NHPA 2GQFA 3GWDA 3V76A 3GYXA 2GRTA 4OPUA 3EF6A 1TDEA 4YKFA 3I3LA 1NPXA 1EL7A 4BK3A 4EQXA 5KMPA 3UKHA 4G73A 3UOXA 3GD3A 2X8GA 3UOVA 4RG4A 2C73A 1EL5A 2E4GA 3VRDB 2C7GA 3BHKA 2BXSA 1P2HA 2C66A 3FMWA 3T0KA 1GETA 1NHRA 2BYBA 4Z24A 1KF6A 4BK1A 4EMWA 2DKHA 1TYPA 3NK2X 3HYVA 2OA1A 1DOBA 1ELIA 3F8DA 4E0VA 2XFUA 3CNTA 3DGZA 1F6MA 2GMJA 3DK8A 2J3NA 1CC6A 1RP0A 4IVOB 1H6VA 2R9ZA 1P2EA 4U8KA 2TPRA 2GAHB 2WU2A 1NHSA 2YG7A 4D03A 1CJ3A 3KLJA 1GRGA 1L0VA 1L9DA 2B7SA 1CJ2A 4YSHA 1YKJA 3COXA 4LA1A 1GT8A 2E5VA 2YLTA 1LV0A 1Y0PA 2BS2A 2X8HA 2IIDA 2A89A 1GRTA 2WPCA 3HYWA 4NTEA 4PAAA 3ICTA 3NN6X 4GRTA 4RG3A 3AE5A 3QJ4A 4U8IA 4AT2A 1DODA 2C65A 2FJDA 2WHDA 2X50A 2I0ZA 4GR1A 5HXIA 1NG3A 2GH5A 2YM2A 4JNQA 1MO9A 1JOAA 2WOWA 3GRSA 4JN9A 2BRYA 1H7WA 3UTHA 1JNRA 4Z26A 2XVJA 1JEHA 4H4XA 4A6NA 1DOEA 4K5SA 3SXIA 4GDPA 4H4UA 1F3PA 1YQ4A 4OPTA 4A65A 4D04A 4H4VA 4B68A 2R4EA 3ZYXA 2JB3A 2Y6RA 1GRAA 2B9YA 1GTEA 3NT6A 4EIPA 1OJCA 3AD7B 3VRBA 1XDIA 1N1PA 3SZ0A 2WS3A 3ATRA 2ZZCA 4Y4NA 2YLSA 2XDOA 4I59A 1LQUA 2YLZA 3IF9A 3AB1A 3NRNA 4G9KA 4G6GA 4NNJA 1FL2A 2EQ9A 4RSLA 5CQFA 3M0OA 1PBEA 2ZZ0A 3NHOX 3NYEA 3EPTA 2BABA 4CY8A 1BGNA 2DKIA 3AEGA 1D4DA 4IA6A 1JRYA 2JKCA 1GNDA 1BF3A 5KRQA 4K8DA 1AOGA 4G74A 1PS9A 2B76A 5C2TA 1PDHA 4FK1C 2APGA 4U2LA 3UCLA 3UOYA 2BA9A 1Y56B 3D1CA 3GMBA 3GDNA 3IWAA 3BI4A 4YKGA 1K0IA 2X3NA 3QVPA 4Z2UA 2CVJA 2H89A 2V3AA 5LV9A 1IJHA 4NTDA 3T14A 4U8NA 5U1OA 1LPFA 3BI2A 2C70A 1DOCA 4UDQA 3CNSA 3WE0A 2XLSA 3SY4A 4J31A 3NTDA 1RYIA 2WEUA 3SX6A 3RP6A 2CDUA 3P4SA 1BGJA 4M52A 2YQUA 2AR8A 2OALA 3CGEA 4FDCB 3UKPA 2YAUA 3ZDNA 4XXGA 2GF3A 1O95A 4OPIA 1VDCA 3AYLA 4A6NB 2FJBA 5FMHA 4EM3A 1D5TA 1E6EA 4C77A 4C3YA 1M64A 5EBKA 3K7QX 2QA1A 1N4WA 2GR1A 4YSXA 3AE9A 3SZWA 1H86A 1S2QA 1CF3A 1JRZA 1DNCA 2XFNA 3GD4A 4X9NA 3VRAA 1S3BA 2BCGG 2Q0LA 1Q9IA 3LOVA 3OZ2A 2V5ZA 1PBDA 1ZOVA 1NG4A 3AE6A 4EQSA 4OPLA 1PXCA 5J60A 3GYJA 2HQMA 1JRXA 2Q6UA 2YLRA 3SFDA 5CKUA 1F8WA 2R46A 3T37A 4CNKA 3LJPA 1TDNA 3S5WA 2GB0A 3NTAA 5GSNA 2QCUA 1H82A 3AEFA 5U25A 3L1RA 1KDGA 3SYIA 5KXJA 4U2SA 4OCGA 4FK1A 3ALLA 3CGCA 2WQYA 3ITJA 1EL9A 1K4QA 3K7MX 4EM4A 3HZLA 2B9XA 4X4JA 3UTFA 1CJ4A 3H8LA 4OVIA 4TM3A 4A7AA 4GDEA 2WDVA 4H4TA 5KVHA 2JB1A 1CBOA 1GRBA 1KSSA 2ZZBA 4AOSA 1GOSA 4HB9A 1GREA 2VVLG 3AEBA 1FCDA 1QLBA 2NVKX 2XFQA 1PJ6A 1QO8A 3LADA 2BACA 3T31A 5BVAA 1HYUA 2C76A 2BS3A 2JB2A 3NGCX 4NEVA 2A8XA 2VRLA 3QSEA 3VR9A 2XFOA 4N9XA 3SM8A 2TMDA 4EMJA 3CGDA 5KOWA 1YY5A 2WETA 4TM0A 1PJ7A 2BK3A 4AP3A 4B69A 1BKWA 4Z44A 2PYXA 4B1BA 4YXDA 4BV6A 3AE7A 3KKJA 3NYFA 4IVMB 5L46A 1YQZA 3AEAA 5HHFA 3DJEA 4KX6A 3P1WA 3NIXA 2XVHA 2YLWA 1E1LA 5HY5A 1QJDA 2QA2A 2C4CA 3NNEA 3ICSA 3REDA 1GESA 1PN0A 4H2QA 4H4PA 1S2YA 5DBJA 4B65A 2C75A 1CJCA 3AD9B 3AE8A 5EOWA 4GAVA 2WU5A 1V59A 3FIMB 4CY6A 5KNLA 3DK4A 3AD8B 3BI5A 1VG9A 3SZCA 1OJAA 3DGHA 3C4AA 1XPQA 4ZCCA 3NG7X 2GVCA 2RABA 4IA5A 3QSMA 2YG4A 1OJDA 3DA1A 5M0ZA 2WESA 1IUTA 5U63A 2WP9A 3R9UA 3P4RA 4JDRA 1KNRA 4K5RA 4MJWA 4GF7A 2C64A 4O5QA 2H88A 1CL0A 3PVCA 5C3JA 5IQ4A 1ZOYA 5M10A 1GALA 2Q0KA 2YR4A 4K22A 4ECHA 2GV8A 4XWRA 2XVEA 1Z6LA 3IC9A 1VG0A 3GMCA 3CPIG 2OLNA 5BUKA 1FEAA 2YWLA 4TM1A 4USQA 2FJEA 2JK6A 3LB8A 1IUWA 4YTMA 2EQ6A 1REOA 5KVIA 5HYMA 4U2TA 1SEZA 2B7RA 2WOIA 2YG6A 3F8PA 3QVRA 4JY3A 4J57A 3I6DA 2BRAA 3CIRA 4UP3A 4A99A 3UKAA 1VQWA 5IPYA 2YVJA 3SGLA 1ZK7A 3ADAB 4BURA 1D4EA 3H8IA 4HA6A 1LTXR 1GTHA 1FOHA 5KOXA 4ADWA 2VOUA 1E7PA 3AE1A 5FS8A 4Z25A 1XANA 4REKA 5TR3A 1YQ3A 1CC4A 1DJNA 4K2XA 4GCMA 4XWZA 2GQWA 1TRBA 2Y6QA 4FX9A 4UDRA 1PJ5A 1ZKQA 4J33A 2R4JA 3NKSA 1B37A 1D7LA 4OPDA 4J36A 1PHHA 4CBQA 1ZX9A 3G5RA 1JU2A 2V6OA 3DJGX 3GYIA 3O0HA 2AQJA 1TDOA 3CNPA 4CCRA 1ONFA 4JY2A 1GXFA 2YM1A 3JSKA 3DMEA 5KMQA 1GRHA 2V3BA 3VR8A 4O5UA 4YTPA 2WP6A 4TM4A 5JCIA 3Q9TA 1KFYA 2YLXA 4K7ZA 2V60A 3NK1X 1B4VA 3KU9A 3CPHG 3CPJG 1KNPA 1ZMCA 2Z5XA 1O94A 2VRMA 1K0JA 1FECA 2GAGB 4J34A 4LIIA 4APNA 2WDQA 1EBDA 3CN8A 3BHFA 3P4QA 4TLXA 2F5ZA 1W4XA 3CGBA 1IUVA 4CNJA 4H4RA 1F8SA 2X99A 3QSSA 4H2RA 3PS9A 3KVEA 4ZCDA 3RP7A 4A9WA 4II2A 1NHQA 2PHHA 4AOXA 4A5LA 1NENA 4P9SA 5IQ1A 3URHA 2GR0A 1B8SA 4J2WA 4YWOA 3UOZA 3DJDA 4CCQA 3AWIA 2JBVA 3GSIA 4H4WA 2VQBA 3AXBA 2BXRA 1GEUA 3B6DA 3PO7A 2YG3A 1GRFA 3NN0X 1LJ1A 1CHUA 4ICYA 1XHCA 1MXTA 1EL8A 4YSYA 3LXDA 1VRQB 2YG5A 1RSGA 3NK0X 1M6IA 3LZWA 5FS6A 1FEBA 1H83A 2Z5YA 3C4NA 1GV4A 4PABA 4U8LA 4EIQA 4CRTA 4Z43A 1H84A 3M13A 4U8OA 4WCTA 3QFBA 3F8RA 4H4YA 2O9ZA 4BK2A 1DXLA 1ZMDA 4DSGA 4DSHA 2UZZA 3AYJA 5JCLA 3NYCA 2WBAA 4USRA 2RGOA 4H7UA 2YR6A 4B66A 2VZ2A 2BCPA 2XLTA 4WX1A 2YR5A 4C5OA 2GEWA 4LU6A 3T2KA 3KD9A 2GMHA 3RHAA 1D7YA 5FS7A 2C72A 5JCKA 2ACZA 2B9WA 1H81A 2WP5A 1B5QA 2C67A 3CNJA 4NEWA 3T2ZA 1Y56A 4YT0A 3S61A 4NZHA 3UP5A 1L9EA 1DJQA 1CC2A 1H7XA 3DK9A 3FPZA 4H50A 3D8XA 3QFAA 5EB5A 4X9MA 5JCMA 3SFEA 1E1NA 1PBCA 2R0GA 5ER0A 5EB4A 2BK5A 2VVMA 5KWFA 3UP4A 3CNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AED A;  1N4U A;  3ALM A;  3M12 A;  2X8C A;  3BNM A;  3K7T A;  2BC1 A;  2CUL A;  2AAQ A;  4H4S A;  4U8M A;  3UKK A;  2A87 A;  3UKF A;  3NH3 X;  4YSZ A;  5BRT A;  3C96 A;  2IVD A;  5BUL A;  3H4K A;  3ISH A;  3RP8 A;  4DNA A;  3AE3 A;  2WOV A;  1L9C A;  4H4Z A;  2XLP A;  2BC0 A;  3FBS A;  2OAM A;  2GR3 A;  3EAN A;  2YVF A;  4TLZ A;  2XCG A;  3AEC A;  3P9U A;  4OPC A;  3V3N A;  1OJT A;  1MOK A;  3GWF A;  3UTE A;  2EQ8 A;  2OLO A;  1BZL A;  3ABV A;  1TDF A;  2NPX A;  4BJY A;  3VQR A;  2JAE A;  1D4C A;  4UDP A;  2EQ7 A;  1GER A;  3EAO A;  1KSU A;  4JQ9 A;  4EQR A;  3II4 A;  1TYT A;  2WPE A;  5FS9 A;  4IV9 A;  1IUX A;  4A79 A;  2Q7V A;  1COY A;  1NAA A;  4NTC A;  3UKL A;  1TDK A;  5J7X A;  4B64 A;  1PXA A;  3ATQ A;  5JCN A;  3B3R A;  2C3C A;  3G5Q A;  3GRT A;  2VQ7 A;  2WDR A;  4H4Q A;  2RGH A;  4AT0 A;  3AE2 A;  4ZN0 A;  3Q6J A;  2R45 A;  2BK4 A;  1GSN A;  2WPF A;  2XVF A;  2YVG A;  3P4P A;  1ZP0 A;  1S3E A;  1IUU A;  1PBF A;  2E1M A;  3IHG A;  4DGK A;  4J56 A;  4KPR A;  3UKQ A;  4U8J A;  4EQW A;  1NEK A;  1PXB A;  1ZY8 A;  2BS4 A;  2R0P A;  3AYI A;  3V3O A;  2IVE A;  2XLR A;  3RNM A;  1NDA A;  1ZDL A;  2XLU A;  4H2P A;  4EMI A;  1E39 A;  4Z2T A;  1BWC A;  2XFP A;  3KA7 A;  4AP1 A;  1LVL A;  3DJJ A;  3ICR A;  3CTY A;  3GDP A;  4C74 A;  1N4V A;  1E1M A;  2XVI A;  3E1T A;  2R0C A;  2GR2 A;  3AE4 A;  4B67 A;  2FBW A;  2W0H A;  1E1K A;  4Y4M A;  1PBB A;  2QAE A;  4I58 A;  4YTN A;  3FG2 P;  1X31 B;  4GUV A;  4U8P A;  3DH9 A;  3OC4 A;  3LZX A;  4OPG A;  4Z2R A;  2C3D A;  1Q1R A;  2V61 A;  3L8K A;  3SQP A;  2ARD A;  4Y4L A;  1IUS A;  4H2N A;  1OJ9 A;  3AEE A;  2ZBW A;  3K30 A;  1K0L A;  2RGJ A;  3IHM A;  1LQT A;  1Q1W A;  3NLC A;  3KPF A;  4BJZ A;  1JNZ A;  1F8R A;  1GPE A;  1UKV G;  4JNA A;  2VVL A;  4C3X A;  2XYO A;  2FJA A;  5GRT A;  3UTG A;  1O5W A;  3ALJ A;  3G5S A;  4B63 A;  2CFY A;  3BNU A;  1NHP A;  2GQF A;  3GWD A;  3V76 A;  2GRT A;  4OPU A;  3EF6 A;  1TDE A;  4YKF A;  3I3L A;  1NPX A;  1EL7 A;  4BK3 A;  4EQX A;  3UKH A;  3UOX A;  3GD3 A;  2X8G A;  3UOV A;  4RG4 A;  2C73 A;  1EL5 A;  2E4G A;  3VRD B;  2C7G A;  3BHK A;  2BXS A;  1P2H A;  2C66 A;  3FMW A;  1GET A;  1NHR A;  2BYB A;  4Z24 A;  1KF6 A;  4BK1 A;  4EMW A;  2DKH A;  1TYP A;  3NK2 X;  2OA1 A;  1DOB A;  1ELI A;  3F8D A;  4E0V A;  2XFU A;  3CNT A;  3DGZ A;  1F6M A;  2GMJ A;  3DK8 A;  2J3N A;  1CC6 A;  1RP0 A;  4IVO B;  1H6V A;  2R9Z A;  1P2E A;  4U8K A;  2TPR A;  2GAH B;  2WU2 A;  1NHS A;  2YG7 A;  4D03 A;  1CJ3 A;  3KLJ A;  1GRG A;  1L0V A;  1L9D A;  2B7S A;  1CJ2 A;  4YSH A;  1YKJ A;  3COX A;  4LA1 A;  1GT8 A;  2E5V A;  2YLT A;  1LV0 A;  1Y0P A;  2BS2 A;  2X8H A;  2IID A;  2A89 A;  1GRT A;  2WPC A;  4NTE A;  4PAA A;  4RG3 A;  3ICT A;  3NN6 X;  4GRT A;  4U8I A;  3AE5 A;  3QJ4 A;  4AT2 A;  1DOD A;  2C65 A;  2FJD A;  2WHD A;  2X50 A;  2I0Z A;  4GR1 A;  5HXI A;  1NG3 A;  2GH5 A;  2YM2 A;  4JNQ A;  1MO9 A;  1JOA A;  2WOW A;  3GRS A;  4JN9 A;  1H7W A;  3UTH A;  1JNR A;  4Z26 A;  2XVJ A;  1JEH A;  4H4X A;  4A6N A;  1DOE A;  4K5S A;  4GDP A;  4H4U A;  1F3P A;  1YQ4 A;  4OPT A;  4A65 A;  4D04 A;  4H4V A;  4B68 A;  2R4E A;  3ZYX A;  2JB3 A;  2Y6R A;  1GRA A;  2B9Y A;  1GTE A;  3NT6 A;  4EIP A;  1OJC A;  3AD7 B;  3VRB A;  1XDI A;  1N1P A;  2WS3 A;  3ATR A;  2ZZC A;  4Y4N A;  2YLS A;  2XDO A;  4I59 A;  1LQU A;  2YLZ A;  3IF9 A;  3AB1 A;  3NRN A;  4RSL A;  4B66 A;  1FL2 A;  2EQ9 A;  5CQF A;  3M0O A;  1PBE A;  2ZZ0 A;  3NHO X;  3NYE A;  3EPT A;  2BAB A;  4CY8 A;  1BGN A;  2DKI A;  3AEG A;  1D4D A;  4IA6 A;  1JRY A;  2JKC A;  1GND A;  1BF3 A;  5KRQ A;  4K8D A;  1AOG A;  1PS9 A;  2B76 A;  5C2T A;  1PDH A;  4FK1 C;  2APG A;  4U2L A;  3UCL A;  3UOY A;  2BA9 A;  1Y56 B;  3D1C A;  3GMB A;  3GDN A;  3IWA A;  3BI4 A;  4YKG A;  1K0I A;  2X3N A;  3QVP A;  4Z2U A;  2CVJ A;  2H89 A;  2V3A A;  5LV9 A;  1IJH A;  4NTD A;  4U8N A;  5U1O A;  1LPF A;  3BI2 A;  2C70 A;  1DOC A;  4UDQ A;  3CNS A;  3WE0 A;  2XLS A;  4J31 A;  3NTD A;  1RYI A;  2WEU A;  3RP6 A;  2CDU A;  3P4S A;  1BGJ A;  4M52 A;  2YQU A;  2AR8 A;  2OAL A;  3CGE A;  4FDC B;  3UKP A;  2YAU A;  3ZDN A;  4XXG A;  2GF3 A;  1O95 A;  4OPI A;  1VDC A;  3AYL A;  4A6N B;  2FJB A;  5FMH A;  4EM3 A;  1D5T A;  1E6E A;  4C77 A;  4C3Y A;  1M64 A;  5EBK A;  3K7Q X;  2QA1 A;  1N4W A;  2GR1 A;  4YSX A;  3AE9 A;  1H86 A;  1S2Q A;  1CF3 A;  1JRZ A;  1DNC A;  2XFN A;  3GD4 A;  4X9N A;  3VRA A;  1S3B A;  2BCG G;  2Q0L A;  1Q9I A;  3LOV A;  3OZ2 A;  2V5Z A;  1PBD A;  1ZOV A;  1NG4 A;  3AE6 A;  4EQS A;  4OPL A;  1PXC A;  5J60 A;  3GYJ A;  2HQM A;  1JRX A;  2Q6U A;  2YLR A;  3SFD A;  5CKU A;  1F8W A;  2R46 A;  3T37 A;  4CNK A;  3LJP A;  1TDN A;  3S5W A;  2GB0 A;  3NTA A;  5GSN A;  2QCU A;  1H82 A;  3AEF A;  5U25 A;  3L1R A;  1KDG A;  5KXJ A;  4U2S A;  4OCG A;  4FK1 A;  3ALL A;  3CGC A;  2WQY A;  3ITJ A;  1EL9 A;  1K4Q A;  3K7M X;  4EM4 A;  3HZL A;  2B9X A;  4X4J A;  3UTF A;  1CJ4 A;  3H8L A;  4OVI A;  4TM3 A;  4A7A A;  4GDE A;  2WDV A;  4H4T A;  5KVH A;  2JB1 A;  1CBO A;  1GRB A;  1KSS A;  2ZZB A;  4AOS A;  1GOS A;  4HB9 A;  1GRE A;  2VVL G;  3AEB A;  1FCD A;  1QLB A;  2NVK X;  2XFQ A;  1PJ6 A;  1QO8 A;  3LAD A;  2BAC A;  5BVA A;  1HYU A;  2C76 A;  2BS3 A;  2JB2 A;  3NGC X;  4NEV A;  2A8X A;  2VRL A;  3QSE A;  3VR9 A;  2XFO A;  4N9X A;  3SM8 A;  2TMD A;  4EMJ A;  3CGD A;  5KOW A;  1YY5 A;  2WET A;  4TM0 A;  1PJ7 A;  2BK3 A;  4AP3 A;  4B69 A;  1BKW A;  4Z44 A;  2PYX A;  4B1B A;  4YXD A;  4BV6 A;  3AE7 A;  3KKJ A;  3NYF A;  4IVM B;  5L46 A;  1YQZ A;  3AEA A;  5HHF A;  3DJE A;  4KX6 A;  3P1W A;  3NIX A;  2XVH A;  2YLW A;  1E1L A;  5HY5 A;  1QJD A;  2QA2 A;  3NNE A;  3ICS A;  3RED A;  1GES A;  1PN0 A;  4H2Q A;  4H4P A;  1S2Y A;  5DBJ A;  4B65 A;  2C75 A;  1CJC A;  3AD9 B;  3AE8 A;  5EOW A;  2WU5 A;  1V59 A;  3FIM B;  4CY6 A;  3DK4 A;  3AD8 B;  3BI5 A;  1VG9 A;  1OJA A;  3DGH A;  3C4A A;  1XPQ A;  4ZCC A;  3NG7 X;  2GVC A;  2RAB A;  4IA5 A;  3QSM A;  2YG4 A;  1OJD A;  3DA1 A;  5M0Z A;  2WES A;  1IUT A;  5U63 A;  2WP9 A;  3R9U A;  3P4R A;  4JDR A;  1KNR A;  4K5R A;  4MJW A;  4GF7 A;  2C64 A;  4O5Q A;  2H88 A;  1CL0 A;  3PVC A;  5C3J A;  5IQ4 A;  1ZOY A;  5M10 A;  1GAL A;  2Q0K A;  2YR4 A;  4K22 A;  4ECH A;  2GV8 A;  4XWR A;  2XVE A;  1Z6L A;  3IC9 A;  1VG0 A;  3GMC A;  3CPI G;  2OLN A;  5BUK A;  1FEA A;  2YWL A;  4TM1 A;  4USQ A;  2FJE A;  2JK6 A;  3LB8 A;  1IUW A;  4YTM A;  2EQ6 A;  1REO A;  5KVI A;  5HYM A;  4U2T A;  1SEZ A;  2B7R A;  2WOI A;  2YG6 A;  3F8P A;  3QVR A;  4JY3 A;  4J57 A;  3I6D A;  4UP3 A;  3CIR A;  4A99 A;  5JCI A;  3UKA A;  1VQW A;  5IPY A;  2YVJ A;  3SGL A;  1ZK7 A;  3ADA B;  4BUR A;  1D4E A;  3H8I A;  4HA6 A;  1LTX R;  1GTH A;  1FOH A;  5KOX A;  4ADW A;  2VOU A;  1E7P A;  3AE1 A;  5FS8 A;  4Z25 A;  1XAN A;  4REK A;  5TR3 A;  1YQ3 A;  1CC4 A;  1DJN A;  4K2X A;  4GCM A;  4XWZ A;  2GQW A;  1TRB A;  2Y6Q A;  4FX9 A;  4UDR A;  1PJ5 A;  1ZKQ A;  4J33 A;  2R4J A;  3NKS A;  1B37 A;  1D7L A;  4OPD A;  4J36 A;  1PHH A;  4CBQ A;  1ZX9 A;  3G5R A;  1JU2 A;  2V6O A;  3DJG X;  3GYI A;  3O0H A;  2AQJ A;  1TDO A;  3CNP A;  4CCR A;  1ONF A;  4JY2 A;  1GXF A;  2YM1 A;  3JSK A;  3DME A;  1GRH A;  2V3B A;  3VR8 A;  4O5U A;  4YTP A;  2WP6 A;  4TM4 A;  3Q9T A;  1KFY A;  2YLX A;  4K7Z A;  2V60 A;  3NK1 X;  1B4V A;  3KU9 A;  3CPH G;  3CPJ G;  1KNP A;  1ZMC A;  2Z5X A;  1O94 A;  2VRM A;  1K0J A;  1FEC A;  2GAG B;  4J34 A;  4LII A;  4APN A;  2WDQ A;  1EBD A;  3CN8 A;  3BHF A;  3P4Q A;  4TLX A;  2F5Z A;  1W4X A;  3CGB A;  1IUV A;  4CNJ A;  4H4R A;  1F8S A;  2X99 A;  3QSS A;  4H2R A;  3PS9 A;  3KVE A;  4ZCD A;  3RP7 A;  4A9W A;  1NHQ A;  2PHH A;  4AOX A;  4A5L A;  1NEN A;  4P9S A;  5IQ1 A;  3URH A;  2GR0 A;  1B8S A;  4J2W A;  4YWO A;  3UOZ A;  3DJD A;  4CCQ A;  3AWI A;  2JBV A;  3GSI A;  4H4W A;  2VQB A;  3AXB A;  2BXR A;  1GEU A;  3B6D A;  3PO7 A;  2YG3 A;  1GRF A;  3NN0 X;  1LJ1 A;  1CHU A;  4ICY A;  1XHC A;  1MXT A;  1EL8 A;  4YSY A;  3LXD A;  1VRQ B;  2YG5 A;  1RSG A;  3NK0 X;  1M6I A;  3LZW A;  5FS6 A;  1FEB A;  1H83 A;  2Z5Y A;  3C4N A;  1GV4 A;  4PAB A;  4U8L A;  4EIQ A;  4CRT A;  4Z43 A;  1H84 A;  3M13 A;  4U8O A;  4WCT A;  3QFB A;  3F8R A;  4H4Y A;  2O9Z A;  4BK2 A;  1DXL A;  1ZMD A;  4DSG A;  4DSH A;  2UZZ A;  3AYJ A;  5JCL A;  3NYC A;  2WBA A;  4USR A;  2RGO A;  4H7U A;  2YR6 A;  2VZ2 A;  2BCP A;  2XLT A;  4WX1 A;  2YR5 A;  4C5O A;  2GEW A;  4LU6 A;  3KD9 A;  2GMH A;  3RHA A;  1D7Y A;  5FS7 A;  2C72 A;  5JCK A;  2ACZ A;  2B9W A;  1H81 A;  2WP5 A;  1B5Q A;  2C67 A;  3CNJ A;  4NEW A;  1Y56 A;  4YT0 A;  3S61 A;  4NZH A;  3UP5 A;  1L9E A;  1DJQ A;  1CC2 A;  1H7X A;  3DK9 A;  3FPZ A;  4H50 A;  3D8X A;  3QFA A;  5EB5 A;  4X9M A;  5JCM A;  3SFE A;  1E1N A;  1PBC A;  2R0G A;  5ER0 A;  5EB4 A;  2BK5 A;  2VVM A;  5KWF A;  3UP4 A;  3CND A; 
#chains in the Genus database with same CATH topology
 3AED A;  1N4U A;  3ALM A;  3M12 A;  2X8C A;  3BNM A;  3K7T A;  2BC1 A;  2CUL A;  2AAQ A;  4H4S A;  4U8M A;  3UKK A;  2A87 A;  3UKF A;  3NH3 X;  4YSZ A;  5BRT A;  3C96 A;  2IVD A;  5BUL A;  3H4K A;  3ISH A;  3RP8 A;  4DNA A;  3AE3 A;  2WOV A;  1L9C A;  4H4Z A;  2XLP A;  2BC0 A;  3FBS A;  2OAM A;  2GR3 A;  3EAN A;  2YVF A;  4TLZ A;  2XCG A;  3AEC A;  3P9U A;  3SZF A;  4OPC A;  3V3N A;  1OJT A;  3T2Y A;  1MOK A;  3GWF A;  3UTE A;  2EQ8 A;  2OLO A;  1BZL A;  3ABV A;  1TDF A;  2NPX A;  4BJY A;  4II3 A;  3VQR A;  2JAE A;  1D4C A;  4UDP A;  2EQ7 A;  1GER A;  3EAO A;  1KSU A;  4JQ9 A;  4EQR A;  3II4 A;  1TYT A;  2WPE A;  3HYX A;  5FS9 A;  4IV9 A;  1IUX A;  4A79 A;  2Q7V A;  1COY A;  1NAA A;  4NTC A;  3UKL A;  1TDK A;  5J7X A;  4B64 A;  1PXA A;  3ATQ A;  5JCN A;  3B3R A;  2C3C A;  3CMM A;  3G5Q A;  3GRT A;  2VQ7 A;  2WDR A;  4H4Q A;  2RGH A;  4AT0 A;  3AE2 A;  4ZN0 A;  3Q6J A;  2R45 A;  2BK4 A;  1GSN A;  2WPF A;  2XVF A;  2YVG A;  3P4P A;  1ZP0 A;  1S3E A;  1IUU A;  1PBF A;  2E1M A;  3IHG A;  4DGK A;  4J56 A;  4KPR A;  3UKQ A;  4U8J A;  4EQW A;  1NEK A;  1PXB A;  1ZY8 A;  2BS4 A;  2R0P A;  3AYI A;  3V3O A;  2IVE A;  2XLR A;  3RNM A;  1NDA A;  1ZDL A;  2XLU A;  4H2P A;  4EMI A;  1E39 A;  5KMS A;  4Z2T A;  1BWC A;  2XFP A;  3KA7 A;  4AP1 A;  1LVL A;  3DJJ A;  3ICR A;  3CTY A;  3GDP A;  4C74 A;  1N4V A;  1E1M A;  2XVI A;  4GAP A;  3E1T A;  2R0C A;  3KPK A;  2GR2 A;  4NWZ A;  3AE4 A;  4B67 A;  5KMR A;  2FBW A;  2W0H A;  1E1K A;  4Y4M A;  1PBB A;  2QAE A;  4I58 A;  4YTN A;  3FG2 P;  1X31 B;  4G6H A;  4GUV A;  4U8P A;  3DH9 A;  3OC4 A;  3LZX A;  4OPG A;  4Z2R A;  2C3D A;  1Q1R A;  2V61 A;  3L8K A;  3SQP A;  2ARD A;  4Y4L A;  1IUS A;  4H2N A;  1OJ9 A;  3AEE A;  2ZBW A;  3K30 A;  1K0L A;  2RGJ A;  3IHM A;  1LQT A;  1Q1W A;  3NLC A;  3KPF A;  4BJZ A;  1JNZ A;  1F8R A;  1GPE A;  1UKV G;  4JNA A;  2VVL A;  4C3X A;  2XYO A;  2FJA A;  5GRT A;  3UTG A;  1O5W A;  3ALJ A;  3G5S A;  4B63 A;  2CFY A;  3BNU A;  1NHP A;  2GQF A;  3GWD A;  3V76 A;  3GYX A;  2GRT A;  4OPU A;  3EF6 A;  1TDE A;  4YKF A;  3I3L A;  1NPX A;  1EL7 A;  4BK3 A;  4EQX A;  5KMP A;  3UKH A;  4G73 A;  3UOX A;  3GD3 A;  2X8G A;  3UOV A;  4RG4 A;  2C73 A;  1EL5 A;  2E4G A;  3VRD B;  2C7G A;  3BHK A;  2BXS A;  1P2H A;  2C66 A;  3FMW A;  3T0K A;  1GET A;  1NHR A;  2BYB A;  4Z24 A;  1KF6 A;  4BK1 A;  4EMW A;  2DKH A;  1TYP A;  3NK2 X;  3HYV A;  2OA1 A;  1DOB A;  1ELI A;  3F8D A;  4E0V A;  2XFU A;  3CNT A;  3DGZ A;  1F6M A;  2GMJ A;  3DK8 A;  2J3N A;  1CC6 A;  1RP0 A;  4IVO B;  1H6V A;  2R9Z A;  1P2E A;  4U8K A;  2TPR A;  2GAH B;  2WU2 A;  1NHS A;  2YG7 A;  4D03 A;  1CJ3 A;  3KLJ A;  1GRG A;  1L0V A;  1L9D A;  2B7S A;  1CJ2 A;  4YSH A;  1YKJ A;  3COX A;  4LA1 A;  1GT8 A;  2E5V A;  2YLT A;  1LV0 A;  1Y0P A;  2BS2 A;  2X8H A;  2IID A;  2A89 A;  1GRT A;  2WPC A;  3HYW A;  4NTE A;  4PAA A;  3ICT A;  3NN6 X;  4GRT A;  4RG3 A;  3AE5 A;  3QJ4 A;  4U8I A;  4AT2 A;  1DOD A;  2C65 A;  2FJD A;  2WHD A;  2X50 A;  2I0Z A;  4GR1 A;  5HXI A;  1NG3 A;  2GH5 A;  2YM2 A;  4JNQ A;  1MO9 A;  1JOA A;  2WOW A;  3GRS A;  4JN9 A;  2BRY A;  1H7W A;  3UTH A;  1JNR A;  4Z26 A;  2XVJ A;  1JEH A;  4H4X A;  4A6N A;  1DOE A;  4K5S A;  3SXI A;  4GDP A;  4H4U A;  1F3P A;  1YQ4 A;  4OPT A;  4A65 A;  4D04 A;  4H4V A;  4B68 A;  2R4E A;  3ZYX A;  2JB3 A;  2Y6R A;  1GRA A;  2B9Y A;  1GTE A;  3NT6 A;  4EIP A;  1OJC A;  3AD7 B;  3VRB A;  1XDI A;  1N1P A;  3SZ0 A;  2WS3 A;  3ATR A;  2ZZC A;  4Y4N A;  2YLS A;  2XDO A;  4I59 A;  1LQU A;  2YLZ A;  3IF9 A;  3AB1 A;  3NRN A;  4G9K A;  4G6G A;  4NNJ A;  1FL2 A;  2EQ9 A;  4RSL A;  5CQF A;  3M0O A;  1PBE A;  2ZZ0 A;  3NHO X;  3NYE A;  3EPT A;  2BAB A;  4CY8 A;  1BGN A;  2DKI A;  3AEG A;  1D4D A;  4IA6 A;  1JRY A;  2JKC A;  1GND A;  1BF3 A;  5KRQ A;  4K8D A;  1AOG A;  4G74 A;  1PS9 A;  2B76 A;  5C2T A;  1PDH A;  4FK1 C;  2APG A;  4U2L A;  3UCL A;  3UOY A;  2BA9 A;  1Y56 B;  3D1C A;  3GMB A;  3GDN A;  3IWA A;  3BI4 A;  4YKG A;  1K0I A;  2X3N A;  3QVP A;  4Z2U A;  2CVJ A;  2H89 A;  2V3A A;  5LV9 A;  1IJH A;  4NTD A;  3T14 A;  4U8N A;  5U1O A;  1LPF A;  3BI2 A;  2C70 A;  1DOC A;  4UDQ A;  3CNS A;  3WE0 A;  2XLS A;  3SY4 A;  4J31 A;  3NTD A;  1RYI A;  2WEU A;  3SX6 A;  3RP6 A;  2CDU A;  3P4S A;  1BGJ A;  4M52 A;  2YQU A;  2AR8 A;  2OAL A;  3CGE A;  4FDC B;  3UKP A;  2YAU A;  3ZDN A;  4XXG A;  2GF3 A;  1O95 A;  4OPI A;  1VDC A;  3AYL A;  4A6N B;  2FJB A;  5FMH A;  4EM3 A;  1D5T A;  1E6E A;  4C77 A;  4C3Y A;  1M64 A;  5EBK A;  3K7Q X;  2QA1 A;  1N4W A;  2GR1 A;  4YSX A;  3AE9 A;  3SZW A;  1H86 A;  1S2Q A;  1CF3 A;  1JRZ A;  1DNC A;  2XFN A;  3GD4 A;  4X9N A;  3VRA A;  1S3B A;  2BCG G;  2Q0L A;  1Q9I A;  3LOV A;  3OZ2 A;  2V5Z A;  1PBD A;  1ZOV A;  1NG4 A;  3AE6 A;  4EQS A;  4OPL A;  1PXC A;  5J60 A;  3GYJ A;  2HQM A;  1JRX A;  2Q6U A;  2YLR A;  3SFD A;  5CKU A;  1F8W A;  2R46 A;  3T37 A;  4CNK A;  3LJP A;  1TDN A;  3S5W A;  2GB0 A;  3NTA A;  5GSN A;  2QCU A;  1H82 A;  3AEF A;  5U25 A;  3L1R A;  1KDG A;  3SYI A;  5KXJ A;  4U2S A;  4OCG A;  4FK1 A;  3ALL A;  3CGC A;  2WQY A;  3ITJ A;  1EL9 A;  1K4Q A;  3K7M X;  4EM4 A;  3HZL A;  2B9X A;  4X4J A;  3UTF A;  1CJ4 A;  3H8L A;  4OVI A;  4TM3 A;  4A7A A;  4GDE A;  2WDV A;  4H4T A;  5KVH A;  2JB1 A;  1CBO A;  1GRB A;  1KSS A;  2ZZB A;  4AOS A;  1GOS A;  4HB9 A;  1GRE A;  2VVL G;  3AEB A;  1FCD A;  1QLB A;  2NVK X;  2XFQ A;  1PJ6 A;  1QO8 A;  3LAD A;  2BAC A;  3T31 A;  5BVA A;  1HYU A;  2C76 A;  2BS3 A;  2JB2 A;  3NGC X;  4NEV A;  2A8X A;  2VRL A;  3QSE A;  3VR9 A;  2XFO A;  4N9X A;  3SM8 A;  2TMD A;  4EMJ A;  3CGD A;  5KOW A;  1YY5 A;  2WET A;  4TM0 A;  1PJ7 A;  2BK3 A;  4AP3 A;  4B69 A;  1BKW A;  4Z44 A;  2PYX A;  4B1B A;  4YXD A;  4BV6 A;  3AE7 A;  3KKJ A;  3NYF A;  4IVM B;  5L46 A;  1YQZ A;  3AEA A;  5HHF A;  3DJE A;  4KX6 A;  3P1W A;  3NIX A;  2XVH A;  2YLW A;  1E1L A;  5HY5 A;  1QJD A;  2QA2 A;  2C4C A;  3NNE A;  3ICS A;  3RED A;  1GES A;  1PN0 A;  4H2Q A;  4H4P A;  1S2Y A;  5DBJ A;  4B65 A;  2C75 A;  1CJC A;  3AD9 B;  3AE8 A;  5EOW A;  4GAV A;  2WU5 A;  1V59 A;  3FIM B;  4CY6 A;  5KNL A;  3DK4 A;  3AD8 B;  3BI5 A;  1VG9 A;  3SZC A;  1OJA A;  3DGH A;  3C4A A;  1XPQ A;  4ZCC A;  3NG7 X;  2GVC A;  2RAB A;  4IA5 A;  3QSM A;  2YG4 A;  1OJD A;  3DA1 A;  5M0Z A;  2WES A;  1IUT A;  5U63 A;  2WP9 A;  3R9U A;  3P4R A;  4JDR A;  1KNR A;  4K5R A;  4MJW A;  4GF7 A;  2C64 A;  4O5Q A;  2H88 A;  1CL0 A;  3PVC A;  5C3J A;  5IQ4 A;  1ZOY A;  5M10 A;  1GAL A;  2Q0K A;  2YR4 A;  4K22 A;  4ECH A;  2GV8 A;  4XWR A;  2XVE A;  1Z6L A;  3IC9 A;  1VG0 A;  3GMC A;  3CPI G;  2OLN A;  5BUK A;  1FEA A;  2YWL A;  4TM1 A;  4USQ A;  2FJE A;  2JK6 A;  3LB8 A;  1IUW A;  4YTM A;  2EQ6 A;  1REO A;  5KVI A;  5HYM A;  4U2T A;  1SEZ A;  2B7R A;  2WOI A;  2YG6 A;  3F8P A;  3QVR A;  4JY3 A;  4J57 A;  3I6D A;  2BRA A;  3CIR A;  4UP3 A;  4A99 A;  3UKA A;  1VQW A;  5IPY A;  2YVJ A;  3SGL A;  1ZK7 A;  3ADA B;  4BUR A;  1D4E A;  3H8I A;  4HA6 A;  1LTX R;  1GTH A;  1FOH A;  5KOX A;  4ADW A;  2VOU A;  1E7P A;  3AE1 A;  5FS8 A;  4Z25 A;  1XAN A;  4REK A;  5TR3 A;  1YQ3 A;  1CC4 A;  1DJN A;  4K2X A;  4GCM A;  4XWZ A;  2GQW A;  1TRB A;  2Y6Q A;  4FX9 A;  4UDR A;  1PJ5 A;  1ZKQ A;  4J33 A;  2R4J A;  3NKS A;  1B37 A;  1D7L A;  4OPD A;  4J36 A;  1PHH A;  4CBQ A;  1ZX9 A;  3G5R A;  1JU2 A;  2V6O A;  3DJG X;  3GYI A;  3O0H A;  2AQJ A;  1TDO A;  3CNP A;  4CCR A;  1ONF A;  4JY2 A;  1GXF A;  2YM1 A;  3JSK A;  3DME A;  5KMQ A;  1GRH A;  2V3B A;  3VR8 A;  4O5U A;  4YTP A;  2WP6 A;  4TM4 A;  5JCI A;  3Q9T A;  1KFY A;  2YLX A;  4K7Z A;  2V60 A;  3NK1 X;  1B4V A;  3KU9 A;  3CPH G;  3CPJ G;  1KNP A;  1ZMC A;  2Z5X A;  1O94 A;  2VRM A;  1K0J A;  1FEC A;  2GAG B;  4J34 A;  4LII A;  4APN A;  2WDQ A;  1EBD A;  3CN8 A;  3BHF A;  3P4Q A;  4TLX A;  2F5Z A;  1W4X A;  3CGB A;  1IUV A;  4CNJ A;  4H4R A;  1F8S A;  2X99 A;  3QSS A;  4H2R A;  3PS9 A;  3KVE A;  4ZCD A;  3RP7 A;  4A9W A;  4II2 A;  1NHQ A;  2PHH A;  4AOX A;  4A5L A;  1NEN A;  4P9S A;  5IQ1 A;  3URH A;  2GR0 A;  1B8S A;  4J2W A;  4YWO A;  3UOZ A;  3DJD A;  4CCQ A;  3AWI A;  2JBV A;  3GSI A;  4H4W A;  2VQB A;  3AXB A;  2BXR A;  1GEU A;  3B6D A;  3PO7 A;  2YG3 A;  1GRF A;  3NN0 X;  1LJ1 A;  1CHU A;  4ICY A;  1XHC A;  1MXT A;  1EL8 A;  4YSY A;  3LXD A;  1VRQ B;  2YG5 A;  1RSG A;  3NK0 X;  1M6I A;  3LZW A;  5FS6 A;  1FEB A;  1H83 A;  2Z5Y A;  3C4N A;  1GV4 A;  4PAB A;  4U8L A;  4EIQ A;  4CRT A;  4Z43 A;  1H84 A;  3M13 A;  4U8O A;  4WCT A;  3QFB A;  3F8R A;  4H4Y A;  2O9Z A;  4BK2 A;  1DXL A;  1ZMD A;  4DSG A;  4DSH A;  2UZZ A;  3AYJ A;  5JCL A;  3NYC A;  2WBA A;  4USR A;  2RGO A;  4H7U A;  2YR6 A;  4B66 A;  2VZ2 A;  2BCP A;  2XLT A;  4WX1 A;  2YR5 A;  4C5O A;  2GEW A;  4LU6 A;  3T2K A;  3KD9 A;  2GMH A;  3RHA A;  1D7Y A;  5FS7 A;  2C72 A;  5JCK A;  2B9W A;  2ACZ A;  1H81 A;  2WP5 A;  1B5Q A;  2C67 A;  3CNJ A;  4NEW A;  3T2Z A;  1Y56 A;  4YT0 A;  3S61 A;  4NZH A;  3UP5 A;  1L9E A;  1DJQ A;  1CC2 A;  1H7X A;  3DK9 A;  3FPZ A;  4H50 A;  3D8X A;  3QFA A;  5EB5 A;  4X9M A;  5JCM A;  3SFE A;  1E1N A;  1PBC A;  2R0G A;  5ER0 A;  5EB4 A;  2BK5 A;  2VVM A;  5KWF A;  3UP4 A;  3CND A; 
#chains in the Genus database with same CATH homology
 3AED A;  1N4U A;  3ALM A;  3M12 A;  2X8C A;  3BNM A;  3K7T A;  2BC1 A;  2CUL A;  2AAQ A;  4H4S A;  4U8M A;  3UKK A;  2A87 A;  3UKF A;  3NH3 X;  4YSZ A;  5BRT A;  3C96 A;  2IVD A;  5BUL A;  3H4K A;  3ISH A;  3RP8 A;  4DNA A;  3AE3 A;  2WOV A;  1L9C A;  4H4Z A;  2XLP A;  2BC0 A;  3FBS A;  2OAM A;  2GR3 A;  3EAN A;  2YVF A;  4TLZ A;  2XCG A;  3AEC A;  3P9U A;  3SZF A;  4OPC A;  3V3N A;  1OJT A;  3T2Y A;  1MOK A;  3GWF A;  3UTE A;  2EQ8 A;  2OLO A;  1BZL A;  3ABV A;  1TDF A;  2NPX A;  4BJY A;  4II3 A;  3VQR A;  2JAE A;  1D4C A;  4UDP A;  2EQ7 A;  1GER A;  3EAO A;  1KSU A;  4JQ9 A;  4EQR A;  3II4 A;  1TYT A;  2WPE A;  3HYX A;  5FS9 A;  4IV9 A;  1IUX A;  4A79 A;  2Q7V A;  1COY A;  1NAA A;  4NTC A;  3UKL A;  1TDK A;  5J7X A;  4B64 A;  1PXA A;  3ATQ A;  5JCN A;  3B3R A;  2C3C A;  3CMM A;  3G5Q A;  3GRT A;  2VQ7 A;  2WDR A;  4H4Q A;  2RGH A;  4AT0 A;  3AE2 A;  4ZN0 A;  3Q6J A;  2R45 A;  2BK4 A;  1GSN A;  2WPF A;  2XVF A;  2YVG A;  3P4P A;  1ZP0 A;  1S3E A;  1IUU A;  1PBF A;  2E1M A;  3IHG A;  4DGK A;  4J56 A;  4KPR A;  3UKQ A;  4U8J A;  4EQW A;  1NEK A;  1PXB A;  1ZY8 A;  2BS4 A;  2R0P A;  3AYI A;  3V3O A;  2IVE A;  2XLR A;  3RNM A;  1NDA A;  1ZDL A;  2XLU A;  4H2P A;  4EMI A;  1E39 A;  5KMS A;  4Z2T A;  1BWC A;  2XFP A;  3KA7 A;  4AP1 A;  1LVL A;  3DJJ A;  3ICR A;  3CTY A;  3GDP A;  4C74 A;  1N4V A;  1E1M A;  2XVI A;  4GAP A;  3E1T A;  2R0C A;  3KPK A;  2GR2 A;  4NWZ A;  3AE4 A;  4B67 A;  5KMR A;  2FBW A;  2W0H A;  1E1K A;  4Y4M A;  1PBB A;  2QAE A;  4I58 A;  4YTN A;  3FG2 P;  1X31 B;  4G6H A;  4GUV A;  4U8P A;  3DH9 A;  3OC4 A;  3LZX A;  4OPG A;  4Z2R A;  2C3D A;  1Q1R A;  2V61 A;  3L8K A;  3SQP A;  2ARD A;  4Y4L A;  1IUS A;  4H2N A;  1OJ9 A;  3AEE A;  2ZBW A;  3K30 A;  1K0L A;  2RGJ A;  3IHM A;  1LQT A;  1Q1W A;  3NLC A;  3KPF A;  4BJZ A;  1JNZ A;  1F8R A;  1GPE A;  1UKV G;  4JNA A;  2VVL A;  4C3X A;  2XYO A;  2FJA A;  5GRT A;  3UTG A;  1O5W A;  3ALJ A;  3G5S A;  4B63 A;  2CFY A;  3BNU A;  1NHP A;  2GQF A;  3GWD A;  3V76 A;  3GYX A;  2GRT A;  4OPU A;  3EF6 A;  1TDE A;  4YKF A;  3I3L A;  1NPX A;  1EL7 A;  4BK3 A;  4EQX A;  5KMP A;  3UKH A;  4G73 A;  3UOX A;  3GD3 A;  2X8G A;  3UOV A;  4RG4 A;  2C73 A;  1EL5 A;  2E4G A;  3VRD B;  2C7G A;  3BHK A;  2BXS A;  1P2H A;  2C66 A;  3FMW A;  3T0K A;  1GET A;  1NHR A;  2BYB A;  4Z24 A;  1KF6 A;  4BK1 A;  4EMW A;  2DKH A;  1TYP A;  3NK2 X;  3HYV A;  2OA1 A;  1DOB A;  1ELI A;  3F8D A;  4E0V A;  2XFU A;  3CNT A;  3DGZ A;  1F6M A;  2GMJ A;  3DK8 A;  2J3N A;  1CC6 A;  1RP0 A;  4IVO B;  1H6V A;  2R9Z A;  1P2E A;  4U8K A;  2TPR A;  2GAH B;  2WU2 A;  1NHS A;  2YG7 A;  4D03 A;  1CJ3 A;  3KLJ A;  1GRG A;  1L0V A;  1L9D A;  2B7S A;  1CJ2 A;  4YSH A;  1YKJ A;  3COX A;  4LA1 A;  1GT8 A;  2E5V A;  2YLT A;  1LV0 A;  1Y0P A;  2BS2 A;  2X8H A;  2IID A;  2A89 A;  1GRT A;  2WPC A;  3HYW A;  4NTE A;  4PAA A;  3ICT A;  3NN6 X;  4GRT A;  4RG3 A;  3AE5 A;  3QJ4 A;  4U8I A;  4AT2 A;  1DOD A;  2C65 A;  2FJD A;  2WHD A;  2X50 A;  2I0Z A;  4GR1 A;  5HXI A;  1NG3 A;  2GH5 A;  2YM2 A;  4JNQ A;  1MO9 A;  1JOA A;  2WOW A;  3GRS A;  4JN9 A;  2BRY A;  1H7W A;  3UTH A;  1JNR A;  4Z26 A;  2XVJ A;  1JEH A;  4H4X A;  4A6N A;  1DOE A;  4K5S A;  3SXI A;  4GDP A;  4H4U A;  1F3P A;  1YQ4 A;  4OPT A;  4A65 A;  4D04 A;  4H4V A;  4B68 A;  2R4E A;  3ZYX A;  2JB3 A;  2Y6R A;  1GRA A;  2B9Y A;  1GTE A;  3NT6 A;  4EIP A;  1OJC A;  3AD7 B;  3VRB A;  1XDI A;  1N1P A;  3SZ0 A;  2WS3 A;  3ATR A;  2ZZC A;  4Y4N A;  2YLS A;  2XDO A;  4I59 A;  1LQU A;  2YLZ A;  3IF9 A;  3AB1 A;  3NRN A;  4G9K A;  4G6G A;  4NNJ A;  1FL2 A;  2EQ9 A;  4RSL A;  5CQF A;  3M0O A;  1PBE A;  2ZZ0 A;  3NHO X;  3NYE A;  3EPT A;  2BAB A;  4CY8 A;  1BGN A;  2DKI A;  3AEG A;  1D4D A;  4IA6 A;  1JRY A;  2JKC A;  1GND A;  1BF3 A;  5KRQ A;  4K8D A;  1AOG A;  4G74 A;  1PS9 A;  2B76 A;  5C2T A;  1PDH A;  4FK1 C;  2APG A;  4U2L A;  3UCL A;  3UOY A;  2BA9 A;  1Y56 B;  3D1C A;  3GMB A;  3GDN A;  3IWA A;  3BI4 A;  4YKG A;  1K0I A;  2X3N A;  3QVP A;  4Z2U A;  2CVJ A;  2H89 A;  2V3A A;  5LV9 A;  1IJH A;  4NTD A;  3T14 A;  4U8N A;  5U1O A;  1LPF A;  3BI2 A;  2C70 A;  1DOC A;  4UDQ A;  3CNS A;  3WE0 A;  2XLS A;  3SY4 A;  4J31 A;  3NTD A;  1RYI A;  2WEU A;  3SX6 A;  3RP6 A;  2CDU A;  3P4S A;  1BGJ A;  4M52 A;  2YQU A;  2AR8 A;  2OAL A;  3CGE A;  4FDC B;  3UKP A;  2YAU A;  3ZDN A;  4XXG A;  2GF3 A;  1O95 A;  4OPI A;  1VDC A;  3AYL A;  4A6N B;  2FJB A;  5FMH A;  4EM3 A;  1D5T A;  1E6E A;  4C77 A;  4C3Y A;  1M64 A;  5EBK A;  3K7Q X;  2QA1 A;  1N4W A;  2GR1 A;  4YSX A;  3AE9 A;  3SZW A;  1H86 A;  1S2Q A;  1CF3 A;  1JRZ A;  1DNC A;  2XFN A;  3GD4 A;  4X9N A;  3VRA A;  1S3B A;  2BCG G;  2Q0L A;  1Q9I A;  3LOV A;  3OZ2 A;  2V5Z A;  1PBD A;  1ZOV A;  1NG4 A;  3AE6 A;  4EQS A;  4OPL A;  1PXC A;  5J60 A;  3GYJ A;  2HQM A;  1JRX A;  2Q6U A;  2YLR A;  3SFD A;  5CKU A;  1F8W A;  2R46 A;  3T37 A;  4CNK A;  3LJP A;  1TDN A;  3S5W A;  2GB0 A;  3NTA A;  5GSN A;  2QCU A;  1H82 A;  3AEF A;  5U25 A;  3L1R A;  1KDG A;  3SYI A;  5KXJ A;  4U2S A;  4OCG A;  4FK1 A;  3ALL A;  3CGC A;  2WQY A;  3ITJ A;  1EL9 A;  1K4Q A;  3K7M X;  4EM4 A;  3HZL A;  2B9X A;  4X4J A;  3UTF A;  1CJ4 A;  3H8L A;  4OVI A;  4TM3 A;  4A7A A;  4GDE A;  2WDV A;  4H4T A;  5KVH A;  2JB1 A;  1CBO A;  1GRB A;  1KSS A;  2ZZB A;  4AOS A;  1GOS A;  4HB9 A;  1GRE A;  2VVL G;  3AEB A;  1FCD A;  1QLB A;  2NVK X;  2XFQ A;  1PJ6 A;  1QO8 A;  3LAD A;  2BAC A;  3T31 A;  5BVA A;  1HYU A;  2C76 A;  2BS3 A;  2JB2 A;  3NGC X;  4NEV A;  2A8X A;  2VRL A;  3QSE A;  3VR9 A;  2XFO A;  4N9X A;  3SM8 A;  2TMD A;  4EMJ A;  3CGD A;  5KOW A;  1YY5 A;  2WET A;  4TM0 A;  1PJ7 A;  2BK3 A;  4AP3 A;  4B69 A;  1BKW A;  4Z44 A;  2PYX A;  4B1B A;  4YXD A;  4BV6 A;  3AE7 A;  3KKJ A;  3NYF A;  4IVM B;  5L46 A;  1YQZ A;  3AEA A;  5HHF A;  3DJE A;  4KX6 A;  3P1W A;  3NIX A;  2XVH A;  2YLW A;  1E1L A;  5HY5 A;  1QJD A;  2QA2 A;  2C4C A;  3NNE A;  3ICS A;  3RED A;  1GES A;  1PN0 A;  4H2Q A;  4H4P A;  1S2Y A;  5DBJ A;  4B65 A;  2C75 A;  1CJC A;  3AD9 B;  3AE8 A;  5EOW A;  4GAV A;  2WU5 A;  1V59 A;  3FIM B;  4CY6 A;  5KNL A;  3DK4 A;  3AD8 B;  3BI5 A;  1VG9 A;  3SZC A;  1OJA A;  3DGH A;  3C4A A;  1XPQ A;  4ZCC A;  3NG7 X;  2GVC A;  2RAB A;  4IA5 A;  3QSM A;  2YG4 A;  1OJD A;  3DA1 A;  5M0Z A;  2WES A;  1IUT A;  5U63 A;  2WP9 A;  3R9U A;  3P4R A;  4JDR A;  1KNR A;  4K5R A;  4MJW A;  4GF7 A;  2C64 A;  4O5Q A;  2H88 A;  1CL0 A;  3PVC A;  5C3J A;  5IQ4 A;  1ZOY A;  5M10 A;  1GAL A;  2Q0K A;  2YR4 A;  4K22 A;  4ECH A;  2GV8 A;  4XWR A;  2XVE A;  1Z6L A;  3IC9 A;  1VG0 A;  3GMC A;  3CPI G;  2OLN A;  5BUK A;  1FEA A;  2YWL A;  4TM1 A;  4USQ A;  2FJE A;  2JK6 A;  3LB8 A;  1IUW A;  4YTM A;  2EQ6 A;  1REO A;  5KVI A;  5HYM A;  4U2T A;  1SEZ A;  2B7R A;  2WOI A;  2YG6 A;  3F8P A;  3QVR A;  4JY3 A;  4J57 A;  3I6D A;  2BRA A;  3CIR A;  4UP3 A;  4A99 A;  3UKA A;  1VQW A;  5IPY A;  2YVJ A;  3SGL A;  1ZK7 A;  3ADA B;  4BUR A;  1D4E A;  3H8I A;  4HA6 A;  1LTX R;  1GTH A;  1FOH A;  5KOX A;  4ADW A;  2VOU A;  1E7P A;  3AE1 A;  5FS8 A;  4Z25 A;  1XAN A;  4REK A;  5TR3 A;  1YQ3 A;  1CC4 A;  1DJN A;  4K2X A;  4GCM A;  4XWZ A;  2GQW A;  1TRB A;  2Y6Q A;  4FX9 A;  4UDR A;  1PJ5 A;  1ZKQ A;  4J33 A;  2R4J A;  3NKS A;  1B37 A;  1D7L A;  4OPD A;  4J36 A;  1PHH A;  4CBQ A;  1ZX9 A;  3G5R A;  1JU2 A;  2V6O A;  3DJG X;  3GYI A;  3O0H A;  2AQJ A;  1TDO A;  3CNP A;  4CCR A;  1ONF A;  4JY2 A;  1GXF A;  2YM1 A;  3JSK A;  3DME A;  5KMQ A;  1GRH A;  2V3B A;  3VR8 A;  4O5U A;  4YTP A;  2WP6 A;  4TM4 A;  5JCI A;  3Q9T A;  1KFY A;  2YLX A;  4K7Z A;  2V60 A;  3NK1 X;  1B4V A;  3KU9 A;  3CPH G;  3CPJ G;  1KNP A;  1ZMC A;  2Z5X A;  1O94 A;  2VRM A;  1K0J A;  1FEC A;  2GAG B;  4J34 A;  4LII A;  4APN A;  2WDQ A;  1EBD A;  3CN8 A;  3BHF A;  3P4Q A;  4TLX A;  2F5Z A;  1W4X A;  3CGB A;  1IUV A;  4CNJ A;  4H4R A;  1F8S A;  2X99 A;  3QSS A;  4H2R A;  3PS9 A;  3KVE A;  4ZCD A;  3RP7 A;  4A9W A;  4II2 A;  1NHQ A;  2PHH A;  4AOX A;  4A5L A;  1NEN A;  4P9S A;  5IQ1 A;  3URH A;  2GR0 A;  1B8S A;  4J2W A;  4YWO A;  3UOZ A;  3DJD A;  4CCQ A;  3AWI A;  2JBV A;  3GSI A;  4H4W A;  2VQB A;  3AXB A;  2BXR A;  1GEU A;  3B6D A;  3PO7 A;  2YG3 A;  1GRF A;  3NN0 X;  1LJ1 A;  1CHU A;  4ICY A;  1XHC A;  1MXT A;  1EL8 A;  4YSY A;  3LXD A;  1VRQ B;  2YG5 A;  1RSG A;  3NK0 X;  1M6I A;  3LZW A;  5FS6 A;  1FEB A;  1H83 A;  2Z5Y A;  3C4N A;  1GV4 A;  4PAB A;  4U8L A;  4EIQ A;  4CRT A;  4Z43 A;  1H84 A;  3M13 A;  4U8O A;  4WCT A;  3QFB A;  3F8R A;  4H4Y A;  2O9Z A;  4BK2 A;  1DXL A;  1ZMD A;  4DSG A;  4DSH A;  2UZZ A;  3AYJ A;  5JCL A;  3NYC A;  2WBA A;  4USR A;  2RGO A;  4H7U A;  2YR6 A;  4B66 A;  2VZ2 A;  2BCP A;  2XLT A;  4WX1 A;  2YR5 A;  4C5O A;  2GEW A;  4LU6 A;  3T2K A;  3KD9 A;  2GMH A;  3RHA A;  1D7Y A;  5FS7 A;  2C72 A;  5JCK A;  2ACZ A;  2B9W A;  1H81 A;  2WP5 A;  1B5Q A;  2C67 A;  3CNJ A;  4NEW A;  3T2Z A;  1Y56 A;  4YT0 A;  3S61 A;  4NZH A;  3UP5 A;  1L9E A;  1DJQ A;  1CC2 A;  1H7X A;  3DK9 A;  3FPZ A;  4H50 A;  3D8X A;  3QFA A;  5EB5 A;  4X9M A;  5JCM A;  3SFE A;  1E1N A;  1PBC A;  2R0G A;  5ER0 A;  5EB4 A;  2BK5 A;  2VVM A;  5KWF A;  3UP4 A;  3CND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...