1F8RA

Crystal structure of l-amino acid oxidase from calloselasma rhodostoma complexed with citrate
Total Genus 171
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
171
sequence length
483
structure length
483
Chain Sequence
RNPLAECFQENDYEEFLEIARNGLKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLEASERPGGRVRTYRNEEAGWYANLGPMRLPEKHRIVREYIRKFDLRLNEFSQENDNAWYFIKNIRKKVGEVKKDPGLLKYPVKPSEAGKSAGQLYEESLGKVVEELKRTNCSYILNKYDTYSTKEYLIKEGDLSPGAVDMIGDLLNEDSGYYVSFIESLKHDDIFAYEKRFDEIVDGMDKLPTAMYRDIQDKVHFNAQVIKIQQNDQKVTVVYETLSKETPSVTADYVIVCTTSRAVRLIKFNPPLLPKKAHALRSVHYRSGTKIFLTCTTKFWEDDGIHGGKSTTDLPSRFIYYPNHNFTNGVGVIIAYGIGDDANFFQALDFKDCADIVFNDLSLIHQLPKKDIQSFCYPSVIQKWSLDKYAMGGITTFTPYQFQHFSDPLTASQGRIYFAGEYTAQAHGWIDSTIKSGLRAARDVNLASEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-AMINO ACID OXIDASE
publication title The structure of L-amino acid oxidase reveals the substrate trajectory into an enantiomerically conserved active site.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 171
structure length 483
sequence length 483
chains with identical sequence B, C, D
ec nomenclature ec 1.4.3.2: L-amino-acid oxidase.
pdb deposition date 2000-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01593 Amino_oxidase Flavin containing amine oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.405.10 Mainly Alpha Orthogonal Bundle Guanine Nucleotide Dissociation Inhibitor; domain 1 Guanine Nucleotide Dissociation Inhibitor, domain 1 1f8rA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1f8rA02
3.90.660.10 Alpha Beta Alpha-Beta Complex Polyamine Oxidase; Chain A, domain 2 Polyamine Oxidase; Chain A, domain 2 1f8rA01
1DOEA 1PBBA 2GR3A 1GSNA 2OLOA 2YLRA 4AP1A 4EQXA 3IF9A 3NGCX 4A6NA 1H7XA 2WHDA 1ZK7A 4GF7A 4Z24A 5U63A 1OJDA 4PAAA 1PJ5A 4B68A 1PS9A 1XDIA 4NZHA 1ZMDA 2BS2A 3F8PA 4OVIA 1GTEA 4BV6A 1GRBA 1NHPA 2GB0A 2C66A 3P9UA 3AD9B 1EL9A 1O95A 3GYJA 1HYUA 2FJBA 3QFBA 4JY3A 2EQ6A 3GMCA 3RP7A 2GMJA 4NTCA 3GDPA 2WOIA 4EMWA 1E1NA 1FOHA 3NN6X 1F8RA 4BK1A 1QO8A 4EMJA 2TMDA 4XWZA 4AOSA 2CULA 1DJQA 1D4CA 2YG3A 2NVKX 2H89A 5GSNA 4KPRA 3I3LA 2WP6A 1L9DA 3UCLA 2E5VA 1DXLA 1S3EA 3NYEA 3UTEA 1N4UA 4ECHA 4B69A 4CNKA 3AE1A 2RGJA 2YR6A 5L46A 2E1MA 4YSXA 2E4GA 3CNSA 2X3NA 4H4TA 2BXSA 4U8IA 3DJJA 4YTPA 5LV9A 3LADA 4UDPA 3K7TA 2Q0LA 1BF3A 3UKFA 2BS4A 1GPEA 2B7RA 2XYOA 3DA1A 3DJEA 3V3OA 4CCRA 1KNRA 3LZXA 2A87A 4PABA 2X99A 4GUVA 2B9YA 3AE5A 4H4ZA 3VQRA 1NG4A 1D7LA 3ALJA 3KPFA 3II4A 1D4EA 3D8XA 3PS9A 3AEBA 3RP8A 4Z43A 2YVJA 1IUTA 3AE7A 4D04A 4H7UA 1S2QA 1GESA 3T37A 3CNPA 3DH9A 1B5QA 4J31A 1JU2A 3NTDA 3QSSA 3F8DA 1TRBA 4NTEA 4Z2TA 4C3YA 1ONFA 1KNPA 1CHUA 3NLCA 5IQ4A 1V59A 3DJGX 3CGDA 4M52A 4NTDA 4I59A 5BULA 2GV8A 3GD3A 1ZOVA 4GCMA 3SGLA 2X50A 3C96A 2C3CA 3REDA 3ALLA 1E1LA 4JQ9A 2YAUA 2BCPA 3I6DA 3AD8B 3D1CA 3ICSA 2AQJA 4Y4LA 1E1MA 2BK3A 5EB5A 4DSGA 5HXIA 3FG2P 3UP5A 1NPXA 5IQ1A 3ATQA 1PJ6A 4H4XA 4J2WA 1LQTA 3ZDNA 2C73A 2BK4A 3NNEA 3GWDA 4FK1C 2BC0A 3UTFA 4OPGA 3KD9A 2YQUA 1NDAA 1YQ4A 3AB1A 4IV9A 4ZCDA 5KOXA 1DOCA 3AE8A 2C64A 1F6MA 4MJWA 3BI2A 3P4QA 1CJCA 3AYIA 3GD4A 1NENA 4K8DA 4DGKA 1PN0A 2CFYA 2JAEA 3HZLA 3NKSA 2R9ZA 5FS9A 3R9UA 4U8NA 1W4XA 2JKCA 3RP6A 1CF3A 5GRTA 3H4KA 2BXRA 2C70A 3AEAA 2WESA 3K30A 3AE3A 3FIMB 4YTMA 3ISHA 1E39A 1PBEA 3AE6A 5HHFA 2WP9A 1NHRA 4P9SA 1NAAA 1JNRA 2WOWA 3BNMA 4H4QA 1JRZA 1ZX9A 3AXBA 5J7XA 2XVFA 1CC6A 4B63A 3L8KA 2X8HA 3QVRA 1GERA 3DK8A 1EL8A 2PHHA 2GAHB 4A9WA 3OZ2A 5JCMA 4JNAA 4H4VA 2V60A 4Y4MA 4IA6A 1YQZA 1H84A 1PDHA 2DKIA 1GALA 2EQ9A 1TDFA 5FMHA 2BA9A 4RG3A 1PXBA 3DK9A 3SFEA 4OCGA 3VRBA 3AYJA 1IUWA 1GRTA 4YSHA 2BC1A 4XWRA 1E6EA 1GT8A 1YKJA 3K7MX 5DBJA 1GRFA 1O94A 1JRXA 1GXFA 1L0VA 3AEDA 5M10A 1OJCA 2ZZ0A 3EAOA 4USQA 4K7ZA 3CGBA 2FJEA 3FPZA 1DNCA 4IA5A 1YQ3A 1IUSA 2GR1A 2VQ7A 1CBOA 4A79A 4U8JA 2YLTA 1Y56B 2XLUA 1VQWA 1BGJA 4CRTA 3NK1X 1N1PA 3G5QA 5C2TA 2YR4A 1OJAA 2FBWA 4X4JA 2JK6A 2WP5A 1F8SA 1JNZA 1KFYA 2YVGA 2AR8A 5EB4A 4YSZA 3E1TA 3GRSA 3AEFA 1MXTA 2GR2A 3CIRA 2WDVA 3M13A 1LTXR 4A7AA 1P2EA 5FS7A 4B65A 4K2XA 1BZLA 1Z6LA 2R0GA 3VR8A 4WCTA 1CJ4A 2V5ZA 3P1WA 1FEAA 3EPTA 3P4PA 1ZY8A 2R45A 2YLSA 3M12A 4K5SA 4J56A 2WU2A 3KA7A 2B7SA 1KSSA 1TYTA 4FX9A 4AT2A 3NT6A 5CKUA 2XVIA 4IVMB 4TM0A 2C75A 3BHKA 2XFPA 1EBDA 4Z2UA 4N9XA 4ADWA 4REKA 2WPFA 1ELIA 2VRLA 4JN9A 3LXDA 1ZMCA 2JBVA 1XPQA 3NN0X 4ZCCA 2QAEA 1TDOA 2GVCA 4GDPA 2PYXA 3PO7A 1BKWA 3UKKA 3ZYXA 4WX1A 4YT0A 4YKGA 1NG3A 1N4WA 2GAGB 2J3NA 2WQYA 3V76A 2XVJA 3QJ4A 4HB9A 1E7PA 2Y6QA 3F8RA 5IPYA 2RGHA 3UKHA 1PBDA 2JB2A 1LQUA 4BJYA 4U8MA 2QCUA 2XLPA 3G5RA 1IJHA 2H88A 2YR5A 4BK3A 1LVLA 2QA2A 2V6OA 2YG6A 1N4VA 4H2PA 1IUUA 4Y4NA 1TDKA 3UP4A 1DOBA 3NYCA 1GOSA 2XVEA 1L9CA 3AEEA 4USRA 2ZBWA 2JB1A 3H8LA 1PBFA 2O9ZA 1JEHA 3COXA 4O5UA 5J60A 5KRQA 4U8KA 2VVLA 3CN8A 3LJPA 3CPHG 2XLSA 3UTGA 5FS8A 2WS3A 4TLXA 2BABA 1ZP0A 2F5ZA 4EM3A 2OALA 2R0CA 2YLXA 4U8OA 2ZZCA 1REOA 2V3BA 2YLZA 3SM8A 4EIPA 2WPCA 2VRMA 2ARDA 2A8XA 2WEUA 2WDRA 1CC2A 1OJTA 3Q9TA 1M64A 2X8CA 1YY5A 5BVAA 3CNTA 1FEBA 4K5RA 1TYPA 1Y56A 2W0HA 5KOWA 5KVHA 1VG0A 4TLZA 1NHSA 5TR3A 4ZN0A 4A99A 2XFOA 4H50A 4LIIA 1CC4A 4X9MA 2XFQA 1PBCA 4YKFA 1VRQB 2BK5A 3CGCA 4C3XA 1KF6A 3NK2X 1DJNA 4OPDA 2QA1A 1NHQA 3NH3X 2WBAA 4H2RA 3UOXA 2XFUA 2FJDA 2GMHA 1NEKA 2IIDA 4H4RA 1IUXA 1GNDA 3K7QX 3IC9A 3G5SA 2C3DA 4JDRA 3GRTA 2OLNA 4EM4A 3GSIA 1TDEA 3AWIA 5EOWA 2WPEA 4B1BA 1FL2A 3AYLA 4I58A 4AOXA 2AAQA 2B9WA 1D7YA 5BUKA 1D5TA 1Y0PA 3ATRA 4B67A 2YG5A 3KU9A 2VZ2A 3DGZA 1H81A 2CDUA 3NG7X 1OJ9A 2Q7VA 1GV4A 5M0ZA 1PXCA 2APGA 2B9XA 4APNA 5HYMA 3S5WA 3AECA 3AE9A 4GR1A 5JCKA 3ALMA 2C76A 3KLJA 2GH5A 3ABVA 4JY2A 3DK4A 4U2LA 3WE0A 4YTNA 1B4VA 2V3AA 1JRYA 1X31B 5CQFA 2WOVA 4UDQA 3UOZA 1EL5A 4YXDA 1PHHA 3SFDA 2CVJA 2BCGG 2R4EA 4YWOA 4X9NA 4EQWA 5EBKA 2EQ8A 4FDCB 1P2HA 2VVLG 3C4AA 2VQBA 3L1RA 5ER0A 5HY5A 3B3RA 1K4QA 1LJ1A 3GYIA 3DGHA 2R4JA 3GWFA 2YVFA 3S61A 2A89A 1H82A 1ZOYA 3DMEA 4C74A 2R46A 3Q6JA 4EMIA 5BRTA 3UOVA 1UKVG 3CNDA 2IVDA 1JOAA 3NHOX 3UKAA 2YG7A 3GMBA 3BNUA 1MO9A 1KDGA 1QJDA 4EQRA 3C4NA 4J57A 4J34A 3CPIG 1H6VA 2ZZBA 3KVEA 3CNJA 3DJDA 2C7GA 3UTHA 4ICYA 2GRTA 2WU5A 4JNQA 4AP3A 4OPUA 3P4SA 1CJ3A 2GEWA 1ZDLA 1LPFA 4A65A 2UZZA 2YWLA 2VOUA 1SEZA 2OAMA 3NIXA 3UKLA 4XXGA 2Z5XA 3IHMA 3SQPA 3NRNA 4K22A 4C5OA 3CPJG 2GR0A 2WETA 3AE2A 4TM1A 2JB3A 1GRHA 1B8SA 3PVCA 4HA6A 4A6NB 3CGEA 5JCLA 3AD7B 1H86A 3NTAA 4U8LA 1RYIA 4CCQA 3LB8A 2XLTA 1FECA 1PJ7A 1MOKA 3VR9A 1M6IA 4CBQA 1ZKQA 3URHA 2Q6UA 4GRTA 4A5LA 4UP3A 2HQMA 4U2TA 3ICTA 4D03A 4Z25A 4J33A 1PXAA 4YSYA 1S2YA 1CJ2A 4E0VA 3FMWA 1GETA 4EQSA 4H4PA 2C72A 1BWCA 1S3BA 2YM2A 2X8GA 3FBSA 3B6DA 4NEVA 3H8IA 2XVHA 4C77A 3V3NA 1FCDA 3EANA 4NEWA 1LV0A 2GQFA 2GQWA 1D4DA 1K0IA 3UKQA 5KWFA 2RABA 3NK0X 2BS3A 3ITJA 2OA1A 4GDEA 1QLBA 1Q1RA 3BI5A 2B76A 1VDCA 2BYBA 4BJZA 3AEGA 2TPRA 4RSLA 3VRDB 5JCIA 4RG4A 4OPTA 1GRAA 3GDNA 3RHAA 3LOVA 4UDRA 4AT0A 3RNMA 1GEUA 4CY6A 3CTYA 2Q0KA 4H2QA 4DSHA 1TDNA 2XDOA 3JSKA 4OPIA 5C3JA 2GF3A 4LU6A 5U25A 2XFNA 3ICRA 2XCGA 1BGNA 1IUVA 1VG9A 1H7WA 2XLRA 3ADAB 4FK1A 4LA1A 5KVIA 1RSGA 1Q9IA 3UKPA 2EQ7A 4H4SA 1H83A 5JCNA 1L9EA 2WDQA 5KXJA 4KX6A 3QSEA 4J36A 1GRGA 1Q1WA 3VRAA 2YM1A 4DNAA 1AOGA 2C67A 4CNJA 1XANA 2IVEA 2YLWA 4H4YA 1CL0A 1F3PA 4OPCA 1EL7A 3IWAA 3O0HA 1COYA 1K0LA 4TM4A 3BHFA 2C65A 1RP0A 3KKJA 2Z5YA 3UOYA 2BACA 4H4UA 3IHGA 3QVPA 4CY8A 4H4WA 1GTHA 1B37A 1O5WA 5U1OA 2DKHA 3OC4A 2Y6RA 4B66A 1E1KA 1DODA 1XHCA 1F8WA 2RGOA 2V61A 3QFAA 4Z44A 4U2SA 2ACZA 1KSUA 3BI4A 2YG4A 4U8PA 4H2NA 4Z26A 3QSMA 3NYFA 4B64A 3AE4A 4IVOB 1GREA 4O5QA 4TM3A 4BK2A 2FJAA 2NPXA 4Z2RA 5FS6A 2VVMA 4EIQA 4OPLA 3M0OA 3LZWA 2I0ZA 4BURA 1K0JA 2R0PA 3EF6A 3P4RA
chains in the Genus database with same CATH superfamily
1DOEA 1PBBA 2GR3A 1GSNA 2OLOA 2YLRA 4AP1A 4EQXA 3IF9A 3NGCX 4A6NA 1H7XA 2WHDA 1ZK7A 4GF7A 4Z24A 5U63A 1OJDA 4PAAA 1PJ5A 4B68A 1PS9A 3SZ0A 1XDIA 4NZHA 1ZMDA 2BS2A 3F8PA 4OVIA 1GTEA 4BV6A 1GRBA 1NHPA 2GB0A 2C66A 3P9UA 3AD9B 1EL9A 1O95A 3GYJA 1HYUA 2FJBA 3QFBA 4JY3A 2EQ6A 3GMCA 3RP7A 2GMJA 4G6HA 4NTCA 3GDPA 2WOIA 4EMWA 1E1NA 1FOHA 3NN6X 1F8RA 4BK1A 1QO8A 4EMJA 2TMDA 4XWZA 4AOSA 2CULA 1DJQA 1D4CA 2YG3A 2NVKX 2H89A 5GSNA 4KPRA 3I3LA 2WP6A 1L9DA 3UCLA 2E5VA 1DXLA 1S3EA 3NYEA 3UTEA 1N4UA 4ECHA 4G9KA 4B69A 4CNKA 3AE1A 2RGJA 2YR6A 5L46A 2E1MA 4YSXA 2E4GA 3CNSA 2X3NA 4H4TA 2BXSA 4U8IA 3DJJA 4II2A 4YTPA 5LV9A 3LADA 4UDPA 3K7TA 2Q0LA 1BF3A 3UKFA 2BS4A 1GPEA 2B7RA 2XYOA 3DA1A 3DJEA 3V3OA 4CCRA 1KNRA 3LZXA 2A87A 4PABA 2X99A 4GUVA 3SX6A 2B9YA 5KNLA 3AE5A 4H4ZA 3VQRA 1NG4A 1D7LA 3ALJA 4NNJA 3KPFA 3II4A 1D4EA 3D8XA 3PS9A 3AEBA 3RP8A 4Z43A 2YVJA 1IUTA 3AE7A 4D04A 4H7UA 1S2QA 1GESA 3T37A 3CNPA 3DH9A 1B5QA 4J31A 1JU2A 3NTDA 3HYXA 3QSSA 3F8DA 1TRBA 4NTEA 4Z2TA 3T0KA 4C3YA 1ONFA 1KNPA 1CHUA 3NLCA 5IQ4A 1V59A 3DJGX 3CGDA 4M52A 4NTDA 4I59A 5BULA 2GV8A 3GD3A 1ZOVA 4GCMA 5KMRA 3SGLA 2X50A 3C96A 2C3CA 3REDA 3ALLA 1E1LA 4JQ9A 2YAUA 2BCPA 3I6DA 3AD8B 3D1CA 3ICSA 2AQJA 4Y4LA 1E1MA 2BK3A 5EB5A 4DSGA 5HXIA 3FG2P 3UP5A 1NPXA 5IQ1A 3ATQA 1PJ6A 4H4XA 4J2WA 1LQTA 3ZDNA 2C73A 2BK4A 3NNEA 3GWDA 4FK1C 2BC0A 3UTFA 4OPGA 3KD9A 2YQUA 1NDAA 1YQ4A 4IV9A 3AB1A 4ZCDA 5KOXA 3SYIA 1DOCA 3AE8A 2C64A 1F6MA 4MJWA 3BI2A 3P4QA 1CJCA 3GYXA 3AYIA 3GD4A 1NENA 4K8DA 4DGKA 1PN0A 2CFYA 2JAEA 3HZLA 3NKSA 2R9ZA 5FS9A 3R9UA 3SY4A 4U8NA 1W4XA 2JKCA 3RP6A 1CF3A 5GRTA 3H4KA 2BXRA 2C70A 3AEAA 2WESA 3K30A 3AE3A 3FIMB 4YTMA 3ISHA 1E39A 1PBEA 3AE6A 5HHFA 2WP9A 1NHRA 4P9SA 1NAAA 1JNRA 2WOWA 3BNMA 4H4QA 1JRZA 1ZX9A 3AXBA 5J7XA 2XVFA 1CC6A 2C4CA 4B63A 3L8KA 2X8HA 3QVRA 1GERA 3DK8A 1EL8A 2PHHA 2GAHB 4A9WA 3OZ2A 5JCMA 4JNAA 4H4VA 2V60A 4Y4MA 4IA6A 3T31A 1YQZA 1H84A 1PDHA 2DKIA 1GALA 2EQ9A 1TDFA 5FMHA 2BA9A 4RG3A 1PXBA 3DK9A 3SFEA 4OCGA 3VRBA 3AYJA 1IUWA 1GRTA 3T2YA 4YSHA 2BC1A 4XWRA 1E6EA 1GT8A 1YKJA 3K7MX 5DBJA 1GRFA 1O94A 1JRXA 1GXFA 1L0VA 3AEDA 5M10A 1OJCA 2ZZ0A 3EAOA 4USQA 4K7ZA 3CGBA 2FJEA 3FPZA 1DNCA 4IA5A 1YQ3A 1IUSA 2GR1A 2VQ7A 1CBOA 4A79A 4U8JA 2YLTA 1Y56B 2XLUA 1VQWA 1BGJA 4CRTA 3NK1X 1N1PA 3G5QA 5C2TA 2YR4A 1OJAA 2FBWA 4X4JA 2JK6A 2WP5A 1F8SA 1JNZA 1KFYA 2YVGA 2AR8A 3HYWA 5EB4A 4YSZA 3E1TA 3GRSA 3AEFA 1MXTA 2GR2A 3CIRA 2WDVA 3M13A 1LTXR 4A7AA 1P2EA 5FS7A 4B65A 4K2XA 1BZLA 1Z6LA 2R0GA 3VR8A 4WCTA 1CJ4A 2V5ZA 3P1WA 1FEAA 3EPTA 3P4PA 1ZY8A 2R45A 2YLSA 3M12A 4K5SA 4J56A 2WU2A 3KA7A 2B7SA 1KSSA 1TYTA 4FX9A 4AT2A 3NT6A 5CKUA 2XVIA 4IVMB 4TM0A 2C75A 3BHKA 2XFPA 1EBDA 4Z2UA 4N9XA 4ADWA 4REKA 2WPFA 1ELIA 2VRLA 4JN9A 3LXDA 1ZMCA 4G74A 2JBVA 1XPQA 3NN0X 4ZCCA 2QAEA 1TDOA 2GVCA 4GDPA 2PYXA 3PO7A 1BKWA 3UKKA 3ZYXA 4WX1A 4YT0A 4YKGA 1NG3A 1N4WA 2GAGB 2J3NA 2WQYA 3V76A 2XVJA 3QJ4A 4HB9A 1E7PA 5KMQA 2Y6QA 3F8RA 5IPYA 4G6GA 2RGHA 3UKHA 5KMPA 1PBDA 2JB2A 1LQUA 4BJYA 4U8MA 2QCUA 2XLPA 3G5RA 1IJHA 2H88A 2YR5A 4BK3A 1LVLA 2QA2A 2V6OA 2YG6A 1N4VA 4H2PA 1IUUA 4Y4NA 1TDKA 3UP4A 1DOBA 3NYCA 3SZCA 1GOSA 2XVEA 1L9CA 3AEEA 4USRA 2ZBWA 2JB1A 3H8LA 1PBFA 2O9ZA 1JEHA 3COXA 4O5UA 5J60A 5KRQA 4U8KA 2VVLA 3CN8A 3LJPA 3CPHG 2XLSA 3UTGA 5FS8A 2WS3A 4TLXA 2BABA 1ZP0A 2F5ZA 4EM3A 2OALA 2R0CA 2YLXA 4U8OA 2ZZCA 1REOA 2V3BA 2YLZA 3SM8A 4EIPA 2WPCA 2VRMA 2ARDA 2A8XA 2WEUA 2WDRA 1CC2A 1OJTA 3Q9TA 1M64A 2X8CA 1YY5A 5BVAA 3CNTA 1FEBA 4K5RA 1TYPA 1Y56A 2W0HA 5KOWA 5KVHA 1VG0A 4TLZA 1NHSA 5TR3A 4ZN0A 4A99A 2XFOA 4H50A 4LIIA 1CC4A 4X9MA 2XFQA 1PBCA 4YKFA 1VRQB 2BK5A 3CGCA 4C3XA 1KF6A 3NK2X 1DJNA 4OPDA 2BRYA 2QA1A 1NHQA 3NH3X 2WBAA 4H2RA 3UOXA 2XFUA 2FJDA 2GMHA 1NEKA 2IIDA 4H4RA 1IUXA 1GNDA 3K7QX 3IC9A 3G5SA 2C3DA 4JDRA 3GRTA 2OLNA 4EM4A 3GSIA 1TDEA 3AWIA 5EOWA 2WPEA 4B1BA 1FL2A 3AYLA 4I58A 4AOXA 2AAQA 2B9WA 1D7YA 5BUKA 1D5TA 1Y0PA 3ATRA 4B67A 2YG5A 3KU9A 2VZ2A 3DGZA 1H81A 2CDUA 3NG7X 1OJ9A 2Q7VA 1GV4A 5M0ZA 1PXCA 3T14A 2APGA 2B9XA 4APNA 5HYMA 3S5WA 3AECA 3AE9A 4GR1A 5KMSA 5JCKA 3ALMA 2C76A 3KLJA 2GH5A 3ABVA 3WE0A 3DK4A 4JY2A 4U2LA 3T2ZA 1B4VA 4YTNA 2V3AA 1JRYA 1X31B 5CQFA 2WOVA 4UDQA 3UOZA 1EL5A 4YXDA 1PHHA 3SFDA 2CVJA 2BCGG 2R4EA 4YWOA 3CMMA 4X9NA 4EQWA 5EBKA 2EQ8A 4FDCB 1P2HA 2VVLG 3C4AA 2VQBA 3L1RA 5ER0A 4NWZA 5HY5A 3B3RA 1K4QA 1LJ1A 3GYIA 3DGHA 2R4JA 3GWFA 2YVFA 3S61A 2A89A 3SXIA 1H82A 1ZOYA 3DMEA 4C74A 2R46A 3Q6JA 4EMIA 5BRTA 3UOVA 1UKVG 3CNDA 2IVDA 1JOAA 3NHOX 3UKAA 2YG7A 3GMBA 3BNUA 1MO9A 1KDGA 1QJDA 4EQRA 3C4NA 4J57A 4J34A 3CPIG 1H6VA 2ZZBA 3KVEA 3CNJA 3DJDA 2C7GA 3UTHA 4ICYA 2GRTA 2WU5A 4JNQA 4AP3A 4OPUA 3P4SA 1CJ3A 2GEWA 1ZDLA 1LPFA 4A65A 2UZZA 2YWLA 2VOUA 1SEZA 2OAMA 3NIXA 3UKLA 4XXGA 2Z5XA 3IHMA 3SQPA 3NRNA 4K22A 4C5OA 3CPJG 2GR0A 2WETA 3AE2A 4TM1A 2JB3A 1GRHA 4GAVA 1B8SA 3PVCA 4HA6A 4A6NB 3CGEA 5JCLA 3AD7B 1H86A 3NTAA 4U8LA 1RYIA 4CCQA 3LB8A 3KPKA 2XLTA 1FECA 1PJ7A 3HYVA 1MOKA 2BRAA 3VR9A 1M6IA 4CBQA 1ZKQA 3URHA 2Q6UA 4GRTA 4A5LA 4UP3A 2HQMA 4U2TA 3ICTA 4GAPA 4D03A 4Z25A 4J33A 1PXAA 4YSYA 1S2YA 1CJ2A 4E0VA 3FMWA 1GETA 4EQSA 4H4PA 2C72A 1BWCA 1S3BA 2YM2A 2X8GA 3FBSA 3B6DA 4G73A 4NEVA 3SZWA 3H8IA 2XVHA 4C77A 3V3NA 1FCDA 3EANA 4NEWA 1LV0A 2GQFA 2GQWA 1D4DA 1K0IA 3UKQA 5KWFA 2RABA 3NK0X 2BS3A 3ITJA 2OA1A 4GDEA 3T2KA 1QLBA 1Q1RA 3BI5A 2B76A 1VDCA 2BYBA 4BJZA 3AEGA 2TPRA 4RSLA 3VRDB 5JCIA 4RG4A 4OPTA 1GRAA 3GDNA 3RHAA 3LOVA 4UDRA 4AT0A 3RNMA 1GEUA 3SZFA 3CTYA 2Q0KA 4H2QA 4CY6A 4DSHA 1TDNA 2XDOA 3JSKA 4OPIA 5C3JA 2GF3A 4LU6A 5U25A 2XFNA 3ICRA 2XCGA 1BGNA 1IUVA 1VG9A 1H7WA 2XLRA 3ADAB 4FK1A 4LA1A 5KVIA 1RSGA 1Q9IA 3UKPA 2EQ7A 4H4SA 1H83A 5JCNA 1L9EA 2WDQA 5KXJA 4KX6A 3QSEA 4J36A 1GRGA 1Q1WA 3VRAA 2YM1A 4DNAA 1AOGA 2C67A 4CNJA 1XANA 2IVEA 2YLWA 4H4YA 1CL0A 1F3PA 4OPCA 1EL7A 3IWAA 3O0HA 1COYA 1K0LA 4TM4A 3BHFA 2C65A 1RP0A 3KKJA 2Z5YA 3UOYA 2BACA 4II3A 4H4UA 3IHGA 3QVPA 4CY8A 4H4WA 1GTHA 1B37A 1O5WA 5U1OA 2DKHA 3OC4A 2Y6RA 4B66A 1E1KA 1DODA 1XHCA 1F8WA 2RGOA 2V61A 3QFAA 4Z44A 4U2SA 2ACZA 1KSUA 3BI4A 2YG4A 4U8PA 4H2NA 4Z26A 3QSMA 3NYFA 4B64A 3AE4A 4IVOB 1GREA 4O5QA 4TM3A 4BK2A 2FJAA 2NPXA 4Z2RA 5FS6A 2VVMA 4EIQA 4OPLA 3M0OA 3LZWA 2I0ZA 4BURA 1K0JA 2R0PA 3EF6A 3P4RA
chains in the Genus database with same CATH topology
1DOEA 1PBBA 2GR3A 1GSNA 2OLOA 2YLRA 4AP1A 4EQXA 3IF9A 3NGCX 4A6NA 1H7XA 2WHDA 1ZK7A 4GF7A 4Z24A 5U63A 1OJDA 4PAAA 1PJ5A 4B68A 1PS9A 3SZ0A 1XDIA 4NZHA 1ZMDA 2BS2A 3F8PA 4OVIA 1GTEA 4BV6A 1GRBA 1NHPA 2GB0A 2C66A 3P9UA 3AD9B 1EL9A 1O95A 3GYJA 1HYUA 2FJBA 3QFBA 4JY3A 2EQ6A 3GMCA 3RP7A 2GMJA 4G6HA 4NTCA 3GDPA 2WOIA 4EMWA 1E1NA 1FOHA 3NN6X 1F8RA 4BK1A 1QO8A 4EMJA 2TMDA 4XWZA 4AOSA 2CULA 1DJQA 1D4CA 2YG3A 2NVKX 2H89A 5GSNA 4KPRA 3I3LA 2WP6A 1L9DA 3UCLA 2E5VA 1DXLA 1S3EA 3NYEA 3UTEA 1N4UA 4ECHA 4G9KA 4B69A 4CNKA 3AE1A 2RGJA 2YR6A 5L46A 2E1MA 4YSXA 2E4GA 3CNSA 2X3NA 4H4TA 2BXSA 4U8IA 3DJJA 4II2A 4YTPA 5LV9A 3LADA 4UDPA 3K7TA 2Q0LA 1BF3A 3UKFA 2BS4A 1GPEA 2B7RA 2XYOA 3DA1A 3DJEA 3V3OA 4CCRA 1KNRA 3LZXA 2A87A 4PABA 2X99A 4GUVA 3SX6A 2B9YA 5KNLA 3AE5A 4H4ZA 3VQRA 1NG4A 1D7LA 3ALJA 4NNJA 3KPFA 3II4A 1D4EA 3D8XA 3PS9A 3AEBA 3RP8A 4Z43A 2YVJA 1IUTA 3AE7A 4D04A 4H7UA 1S2QA 1GESA 3T37A 3CNPA 3DH9A 1B5QA 4J31A 1JU2A 3NTDA 3HYXA 3QSSA 3F8DA 1TRBA 4NTEA 4Z2TA 3T0KA 4C3YA 1ONFA 1KNPA 1CHUA 3NLCA 5IQ4A 1V59A 3DJGX 3CGDA 4M52A 4NTDA 4I59A 5BULA 2GV8A 3GD3A 1ZOVA 4GCMA 5KMRA 3SGLA 2X50A 3C96A 2C3CA 3REDA 3ALLA 1E1LA 4JQ9A 2YAUA 2BCPA 3I6DA 3AD8B 3D1CA 3ICSA 2AQJA 4Y4LA 1E1MA 2BK3A 5EB5A 4DSGA 5HXIA 3FG2P 3UP5A 1NPXA 5IQ1A 3ATQA 1PJ6A 4H4XA 4J2WA 1LQTA 3ZDNA 2C73A 2BK4A 3NNEA 3GWDA 4FK1C 2BC0A 3UTFA 4OPGA 3KD9A 2YQUA 1NDAA 1YQ4A 3AB1A 4IV9A 4ZCDA 5KOXA 3SYIA 1DOCA 3AE8A 2C64A 1F6MA 4MJWA 3BI2A 3P4QA 1CJCA 3GYXA 3AYIA 3GD4A 1NENA 4K8DA 4DGKA 1PN0A 2CFYA 2JAEA 3HZLA 3NKSA 2R9ZA 5FS9A 3R9UA 3SY4A 4U8NA 1W4XA 2JKCA 3RP6A 1CF3A 5GRTA 3H4KA 2BXRA 2C70A 3AEAA 2WESA 3K30A 3AE3A 3FIMB 4YTMA 3ISHA 1E39A 1PBEA 3AE6A 5HHFA 2WP9A 1NHRA 4P9SA 1NAAA 1JNRA 2WOWA 3BNMA 4H4QA 1JRZA 1ZX9A 3AXBA 5J7XA 2XVFA 1CC6A 2C4CA 4B63A 3L8KA 2X8HA 3QVRA 1GERA 3DK8A 1EL8A 2PHHA 2GAHB 4A9WA 3OZ2A 5JCMA 4JNAA 4H4VA 2V60A 4Y4MA 4IA6A 3T31A 1YQZA 1H84A 1PDHA 2DKIA 1GALA 2EQ9A 1TDFA 5FMHA 2BA9A 4RG3A 1PXBA 3DK9A 3SFEA 4OCGA 3VRBA 3AYJA 1IUWA 1GRTA 3T2YA 4YSHA 2BC1A 4XWRA 1E6EA 1GT8A 1YKJA 3K7MX 5DBJA 1GRFA 1O94A 1JRXA 1GXFA 1L0VA 3AEDA 5M10A 1OJCA 2ZZ0A 3EAOA 4USQA 4K7ZA 3CGBA 2FJEA 3FPZA 1DNCA 4IA5A 1YQ3A 1IUSA 2GR1A 2VQ7A 1CBOA 4A79A 4U8JA 2YLTA 1Y56B 2XLUA 1VQWA 1BGJA 4CRTA 3NK1X 1N1PA 3G5QA 5C2TA 2YR4A 1OJAA 2FBWA 4X4JA 2JK6A 2WP5A 1F8SA 1JNZA 1KFYA 2YVGA 2AR8A 3HYWA 5EB4A 4YSZA 3E1TA 3GRSA 3AEFA 1MXTA 2GR2A 3CIRA 2WDVA 3M13A 1LTXR 4A7AA 1P2EA 5FS7A 4B65A 4K2XA 1BZLA 1Z6LA 2R0GA 3VR8A 4WCTA 1CJ4A 2V5ZA 3P1WA 1FEAA 3EPTA 3P4PA 1ZY8A 2R45A 2YLSA 3M12A 4K5SA 4J56A 2WU2A 3KA7A 2B7SA 1KSSA 1TYTA 4FX9A 4AT2A 3NT6A 5CKUA 2XVIA 4IVMB 4TM0A 2C75A 3BHKA 2XFPA 1EBDA 4Z2UA 4N9XA 4ADWA 4REKA 2WPFA 1ELIA 2VRLA 4JN9A 3LXDA 1ZMCA 4G74A 2JBVA 1XPQA 3NN0X 4ZCCA 2QAEA 1TDOA 2GVCA 4GDPA 2PYXA 3PO7A 1BKWA 3UKKA 3ZYXA 4WX1A 4YT0A 4YKGA 1NG3A 1N4WA 2GAGB 2J3NA 2WQYA 3V76A 2XVJA 3QJ4A 4HB9A 1E7PA 5KMQA 2Y6QA 3F8RA 5IPYA 4G6GA 2RGHA 3UKHA 5KMPA 1PBDA 2JB2A 1LQUA 4BJYA 4U8MA 2QCUA 2XLPA 3G5RA 1IJHA 2H88A 2YR5A 4BK3A 1LVLA 2QA2A 2V6OA 2YG6A 1N4VA 4H2PA 1IUUA 4Y4NA 1TDKA 3UP4A 1DOBA 3NYCA 3SZCA 1GOSA 2XVEA 1L9CA 3AEEA 4USRA 2ZBWA 2JB1A 3H8LA 1PBFA 2O9ZA 1JEHA 3COXA 4O5UA 5J60A 5KRQA 4U8KA 2VVLA 3CN8A 3LJPA 3CPHG 2XLSA 3UTGA 5FS8A 2WS3A 4TLXA 2BABA 1ZP0A 2F5ZA 4EM3A 2OALA 2R0CA 2YLXA 4U8OA 2ZZCA 1REOA 2V3BA 2YLZA 3SM8A 4EIPA 2WPCA 2VRMA 2ARDA 2A8XA 2WEUA 2WDRA 1CC2A 1OJTA 3Q9TA 1M64A 2X8CA 1YY5A 5BVAA 3CNTA 1FEBA 4K5RA 1TYPA 1Y56A 2W0HA 5KOWA 5KVHA 1VG0A 4TLZA 1NHSA 5TR3A 4ZN0A 4A99A 2XFOA 4H50A 4LIIA 1CC4A 4X9MA 2XFQA 1PBCA 4YKFA 1VRQB 2BK5A 3CGCA 4C3XA 1KF6A 3NK2X 1DJNA 4OPDA 2BRYA 2QA1A 1NHQA 3NH3X 2WBAA 4H2RA 3UOXA 2XFUA 2FJDA 2GMHA 1NEKA 2IIDA 4H4RA 1IUXA 1GNDA 3K7QX 3IC9A 3G5SA 2C3DA 4JDRA 3GRTA 2OLNA 4EM4A 3GSIA 1TDEA 3AWIA 5EOWA 2WPEA 4B1BA 1FL2A 3AYLA 4I58A 4AOXA 2AAQA 2B9WA 1D7YA 5BUKA 1D5TA 1Y0PA 3ATRA 4B67A 2YG5A 3KU9A 2VZ2A 3DGZA 1H81A 2CDUA 3NG7X 1OJ9A 2Q7VA 1GV4A 5M0ZA 1PXCA 3T14A 2APGA 2B9XA 4APNA 5HYMA 3S5WA 3AECA 3AE9A 4GR1A 5KMSA 5JCKA 3ALMA 2C76A 3KLJA 2GH5A 3ABVA 4JY2A 3DK4A 4U2LA 3T2ZA 3WE0A 1B4VA 4YTNA 2V3AA 1JRYA 1X31B 5CQFA 2WOVA 4UDQA 3UOZA 1EL5A 4YXDA 1PHHA 3SFDA 2CVJA 2BCGG 2R4EA 4YWOA 3CMMA 4X9NA 4EQWA 5EBKA 2EQ8A 4FDCB 1P2HA 2VVLG 3C4AA 2VQBA 3L1RA 5ER0A 4NWZA 5HY5A 3B3RA 1K4QA 1LJ1A 3GYIA 3DGHA 2R4JA 3GWFA 2YVFA 3S61A 2A89A 3SXIA 1H82A 1ZOYA 3DMEA 4C74A 2R46A 3Q6JA 4EMIA 5BRTA 3UOVA 1UKVG 3CNDA 2IVDA 1JOAA 3NHOX 3UKAA 2YG7A 3GMBA 3BNUA 1MO9A 1KDGA 1QJDA 4EQRA 3C4NA 4J57A 4J34A 3CPIG 1H6VA 2ZZBA 3KVEA 3CNJA 3DJDA 2C7GA 3UTHA 4ICYA 2GRTA 2WU5A 4JNQA 4AP3A 4OPUA 3P4SA 1CJ3A 2GEWA 1ZDLA 1LPFA 4A65A 2UZZA 2YWLA 2VOUA 1SEZA 2OAMA 3NIXA 3UKLA 4XXGA 2Z5XA 3IHMA 3SQPA 3NRNA 4K22A 4C5OA 3CPJG 2GR0A 2WETA 3AE2A 4TM1A 2JB3A 1GRHA 4GAVA 1B8SA 3PVCA 4HA6A 4A6NB 3CGEA 5JCLA 3AD7B 1H86A 3NTAA 4U8LA 1RYIA 4CCQA 3LB8A 3KPKA 2XLTA 1FECA 1PJ7A 3HYVA 1MOKA 2BRAA 3VR9A 1M6IA 4CBQA 1ZKQA 3URHA 2Q6UA 4GRTA 4A5LA 4UP3A 2HQMA 4U2TA 3ICTA 4GAPA 4D03A 4Z25A 4J33A 1PXAA 4YSYA 1S2YA 1CJ2A 4E0VA 3FMWA 1GETA 4EQSA 4H4PA 2C72A 1BWCA 1S3BA 2YM2A 2X8GA 3FBSA 3B6DA 4G73A 4NEVA 3SZWA 3H8IA 2XVHA 4C77A 3V3NA 1FCDA 3EANA 4NEWA 1LV0A 2GQFA 2GQWA 1D4DA 1K0IA 3UKQA 5KWFA 2RABA 3NK0X 2BS3A 3ITJA 2OA1A 4GDEA 3T2KA 1QLBA 1Q1RA 3BI5A 2B76A 1VDCA 2BYBA 4BJZA 3AEGA 2TPRA 4RSLA 3VRDB 5JCIA 4RG4A 4OPTA 1GRAA 3GDNA 3RHAA 3LOVA 4UDRA 4AT0A 3RNMA 1GEUA 3SZFA 3CTYA 2Q0KA 4H2QA 4CY6A 4DSHA 1TDNA 2XDOA 3JSKA 4OPIA 5C3JA 2GF3A 4LU6A 5U25A 2XFNA 3ICRA 2XCGA 1BGNA 1IUVA 1VG9A 1H7WA 2XLRA 3ADAB 4FK1A 4LA1A 5KVIA 1RSGA 1Q9IA 3UKPA 2EQ7A 4H4SA 1H83A 5JCNA 1L9EA 2WDQA 5KXJA 4KX6A 3QSEA 4J36A 1GRGA 1Q1WA 3VRAA 2YM1A 4DNAA 1AOGA 2C67A 4CNJA 1XANA 2IVEA 2YLWA 4H4YA 1CL0A 1F3PA 4OPCA 1EL7A 3IWAA 3O0HA 1COYA 1K0LA 4TM4A 3BHFA 2C65A 1RP0A 3KKJA 2Z5YA 3UOYA 2BACA 4II3A 4H4UA 3IHGA 3QVPA 4CY8A 4H4WA 1GTHA 1B37A 1O5WA 5U1OA 2DKHA 3OC4A 2Y6RA 4B66A 1E1KA 1DODA 1XHCA 1F8WA 2RGOA 2V61A 3QFAA 4Z44A 4U2SA 2ACZA 1KSUA 3BI4A 2YG4A 4U8PA 4H2NA 4Z26A 3QSMA 3NYFA 4B64A 3AE4A 4IVOB 1GREA 4O5QA 4TM3A 4BK2A 2FJAA 2NPXA 4Z2RA 5FS6A 2VVMA 4EIQA 4OPLA 3M0OA 3LZWA 2I0ZA 4BURA 1K0JA 2R0PA 3EF6A 3P4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOE A;  1PBB A;  2GR3 A;  1GSN A;  2OLO A;  2YLR A;  4AP1 A;  4EQX A;  3IF9 A;  3NGC X;  4A6N A;  1H7X A;  2WHD A;  1ZK7 A;  4GF7 A;  4Z24 A;  5U63 A;  1OJD A;  4PAA A;  1PJ5 A;  4B68 A;  1PS9 A;  1XDI A;  4NZH A;  1ZMD A;  2BS2 A;  3F8P A;  4OVI A;  1GTE A;  4BV6 A;  1GRB A;  1NHP A;  2GB0 A;  2C66 A;  3P9U A;  3AD9 B;  1EL9 A;  1O95 A;  3GYJ A;  1HYU A;  2FJB A;  3QFB A;  4JY3 A;  2EQ6 A;  3GMC A;  3RP7 A;  2GMJ A;  4NTC A;  3GDP A;  2WOI A;  4EMW A;  1E1N A;  1FOH A;  3NN6 X;  1F8R A;  4BK1 A;  1QO8 A;  4EMJ A;  2TMD A;  4XWZ A;  4AOS A;  2CUL A;  1DJQ A;  1D4C A;  2YG3 A;  2NVK X;  2H89 A;  5GSN A;  4KPR A;  3I3L A;  2WP6 A;  1L9D A;  3UCL A;  2E5V A;  1DXL A;  1S3E A;  3NYE A;  3UTE A;  1N4U A;  4ECH A;  4B69 A;  4CNK A;  3AE1 A;  2RGJ A;  2YR6 A;  5L46 A;  2E1M A;  4YSX A;  2E4G A;  3CNS A;  2X3N A;  4H4T A;  2BXS A;  4U8I A;  3DJJ A;  4YTP A;  5LV9 A;  3LAD A;  4UDP A;  3K7T A;  2Q0L A;  1BF3 A;  3UKF A;  2BS4 A;  1GPE A;  2B7R A;  2XYO A;  3DA1 A;  3DJE A;  3V3O A;  4CCR A;  1KNR A;  3LZX A;  2A87 A;  4PAB A;  2X99 A;  4GUV A;  2B9Y A;  3AE5 A;  4H4Z A;  3VQR A;  1NG4 A;  1D7L A;  3ALJ A;  3KPF A;  3II4 A;  1D4E A;  3D8X A;  3PS9 A;  3AEB A;  3RP8 A;  4Z43 A;  2YVJ A;  1IUT A;  3AE7 A;  4D04 A;  4H7U A;  1S2Q A;  1GES A;  3T37 A;  3CNP A;  3DH9 A;  1B5Q A;  4J31 A;  1JU2 A;  3NTD A;  3QSS A;  3F8D A;  1TRB A;  4NTE A;  4Z2T A;  4C3Y A;  1ONF A;  1KNP A;  1CHU A;  3NLC A;  5IQ4 A;  1V59 A;  3DJG X;  3CGD A;  4M52 A;  4NTD A;  4I59 A;  5BUL A;  2GV8 A;  3GD3 A;  1ZOV A;  4GCM A;  3SGL A;  2X50 A;  3C96 A;  2C3C A;  3RED A;  3ALL A;  1E1L A;  4JQ9 A;  2YAU A;  2BCP A;  3I6D A;  3AD8 B;  3D1C A;  3ICS A;  2AQJ A;  4Y4L A;  1E1M A;  2BK3 A;  5EB5 A;  4DSG A;  5HXI A;  3FG2 P;  3UP5 A;  1NPX A;  5IQ1 A;  3ATQ A;  1PJ6 A;  4H4X A;  4J2W A;  1LQT A;  3ZDN A;  2C73 A;  2BK4 A;  3NNE A;  3GWD A;  4FK1 C;  2BC0 A;  3UTF A;  4OPG A;  3KD9 A;  2YQU A;  1NDA A;  1YQ4 A;  3AB1 A;  4IV9 A;  4ZCD A;  5KOX A;  1DOC A;  3AE8 A;  2C64 A;  1F6M A;  4MJW A;  3BI2 A;  3P4Q A;  1CJC A;  3AYI A;  3GD4 A;  1NEN A;  4K8D A;  4DGK A;  1PN0 A;  2CFY A;  2JAE A;  3HZL A;  3NKS A;  2R9Z A;  5FS9 A;  3R9U A;  4U8N A;  1W4X A;  2JKC A;  3RP6 A;  1CF3 A;  5GRT A;  3H4K A;  2BXR A;  2C70 A;  3AEA A;  2WES A;  3K30 A;  3AE3 A;  3FIM B;  4YTM A;  3ISH A;  1E39 A;  1PBE A;  3AE6 A;  5HHF A;  2WP9 A;  1NHR A;  4P9S A;  1NAA A;  1JNR A;  2WOW A;  3BNM A;  4H4Q A;  1JRZ A;  1ZX9 A;  3AXB A;  5J7X A;  2XVF A;  1CC6 A;  4B63 A;  3L8K A;  2X8H A;  3QVR A;  1GER A;  3DK8 A;  1EL8 A;  2PHH A;  2GAH B;  4A9W A;  3OZ2 A;  5JCM A;  4JNA A;  4H4V A;  2V60 A;  4Y4M A;  4IA6 A;  1YQZ A;  1H84 A;  1PDH A;  2DKI A;  1GAL A;  2EQ9 A;  1TDF A;  5FMH A;  2BA9 A;  4RG3 A;  1PXB A;  3DK9 A;  3SFE A;  4OCG A;  3VRB A;  3AYJ A;  1IUW A;  1GRT A;  4YSH A;  2BC1 A;  4XWR A;  1E6E A;  1GT8 A;  1YKJ A;  3K7M X;  5DBJ A;  1GRF A;  1O94 A;  1JRX A;  1GXF A;  1L0V A;  3AED A;  5M10 A;  1OJC A;  2ZZ0 A;  3EAO A;  4USQ A;  4K7Z A;  3CGB A;  2FJE A;  3FPZ A;  1DNC A;  4IA5 A;  1YQ3 A;  1IUS A;  2GR1 A;  2VQ7 A;  1CBO A;  4A79 A;  4U8J A;  2YLT A;  1Y56 B;  2XLU A;  1VQW A;  1BGJ A;  4CRT A;  3NK1 X;  1N1P A;  3G5Q A;  5C2T A;  2YR4 A;  1OJA A;  2FBW A;  4X4J A;  2JK6 A;  2WP5 A;  1F8S A;  1JNZ A;  1KFY A;  2YVG A;  2AR8 A;  5EB4 A;  4YSZ A;  3E1T A;  3GRS A;  3AEF A;  1MXT A;  2GR2 A;  3CIR A;  2WDV A;  3M13 A;  1LTX R;  4A7A A;  1P2E A;  5FS7 A;  4B65 A;  4K2X A;  1BZL A;  1Z6L A;  2R0G A;  3VR8 A;  4WCT A;  1CJ4 A;  2V5Z A;  3P1W A;  1FEA A;  3EPT A;  3P4P A;  1ZY8 A;  2R45 A;  2YLS A;  3M12 A;  4K5S A;  4J56 A;  2WU2 A;  3KA7 A;  2B7S A;  1KSS A;  1TYT A;  4FX9 A;  4AT2 A;  3NT6 A;  5CKU A;  2XVI A;  4IVM B;  4TM0 A;  2C75 A;  3BHK A;  2XFP A;  1EBD A;  4Z2U A;  4N9X A;  4ADW A;  4REK A;  2WPF A;  1ELI A;  2VRL A;  4JN9 A;  3LXD A;  1ZMC A;  2JBV A;  1XPQ A;  3NN0 X;  4ZCC A;  2QAE A;  1TDO A;  2GVC A;  4GDP A;  2PYX A;  3PO7 A;  1BKW A;  3UKK A;  3ZYX A;  4WX1 A;  4YT0 A;  4YKG A;  1NG3 A;  1N4W A;  2GAG B;  2J3N A;  2WQY A;  3V76 A;  2XVJ A;  3QJ4 A;  4HB9 A;  1E7P A;  2Y6Q A;  3F8R A;  5IPY A;  2RGH A;  3UKH A;  1PBD A;  2JB2 A;  1LQU A;  4BJY A;  4U8M A;  2QCU A;  2XLP A;  3G5R A;  1IJH A;  2H88 A;  2YR5 A;  4BK3 A;  1LVL A;  2QA2 A;  2V6O A;  2YG6 A;  1N4V A;  4H2P A;  1IUU A;  4Y4N A;  1TDK A;  3UP4 A;  1DOB A;  3NYC A;  1GOS A;  2XVE A;  1L9C A;  3AEE A;  4USR A;  2ZBW A;  2JB1 A;  3H8L A;  1PBF A;  2O9Z A;  1JEH A;  3COX A;  4O5U A;  5J60 A;  5KRQ A;  4U8K A;  2VVL A;  3CN8 A;  3LJP A;  3CPH G;  2XLS A;  3UTG A;  5FS8 A;  2WS3 A;  4TLX A;  2BAB A;  1ZP0 A;  2F5Z A;  4EM3 A;  2OAL A;  2R0C A;  2YLX A;  4U8O A;  2ZZC A;  1REO A;  2V3B A;  2YLZ A;  3SM8 A;  4EIP A;  2WPC A;  2VRM A;  2ARD A;  2A8X A;  2WEU A;  2WDR A;  1CC2 A;  1OJT A;  3Q9T A;  1M64 A;  2X8C A;  1YY5 A;  5BVA A;  3CNT A;  1FEB A;  4K5R A;  1TYP A;  1Y56 A;  2W0H A;  5KOW A;  5KVH A;  1VG0 A;  4TLZ A;  1NHS A;  5TR3 A;  4ZN0 A;  4A99 A;  2XFO A;  4H50 A;  4LII A;  1CC4 A;  4X9M A;  2XFQ A;  1PBC A;  4YKF A;  1VRQ B;  2BK5 A;  3CGC A;  4C3X A;  1KF6 A;  3NK2 X;  1DJN A;  4OPD A;  2QA1 A;  1NHQ A;  3NH3 X;  2WBA A;  4H2R A;  3UOX A;  2XFU A;  2FJD A;  2GMH A;  1NEK A;  2IID A;  4H4R A;  1IUX A;  1GND A;  3K7Q X;  3IC9 A;  3G5S A;  2C3D A;  4JDR A;  3GRT A;  2OLN A;  4EM4 A;  3GSI A;  1TDE A;  3AWI A;  5EOW A;  2WPE A;  4B1B A;  1FL2 A;  3AYL A;  4I58 A;  4AOX A;  2AAQ A;  2B9W A;  1D7Y A;  5BUK A;  1D5T A;  1Y0P A;  3ATR A;  4B67 A;  2YG5 A;  3KU9 A;  2VZ2 A;  3DGZ A;  1H81 A;  2CDU A;  3NG7 X;  1OJ9 A;  2Q7V A;  1GV4 A;  5M0Z A;  1PXC A;  2APG A;  2B9X A;  4APN A;  5HYM A;  3S5W A;  3AEC A;  3AE9 A;  4GR1 A;  5JCK A;  3ALM A;  2C76 A;  3KLJ A;  2GH5 A;  3ABV A;  4JY2 A;  3DK4 A;  4U2L A;  3WE0 A;  4YTN A;  1B4V A;  2V3A A;  1JRY A;  1X31 B;  5CQF A;  2WOV A;  4UDQ A;  3UOZ A;  1EL5 A;  4YXD A;  1PHH A;  3SFD A;  2CVJ A;  2BCG G;  2R4E A;  4YWO A;  4X9N A;  4EQW A;  5EBK A;  2EQ8 A;  4FDC B;  1P2H A;  2VVL G;  3C4A A;  2VQB A;  3L1R A;  5ER0 A;  5HY5 A;  3B3R A;  1K4Q A;  1LJ1 A;  3GYI A;  3DGH A;  2R4J A;  3GWF A;  2YVF A;  3S61 A;  2A89 A;  1H82 A;  1ZOY A;  3DME A;  4C74 A;  2R46 A;  3Q6J A;  4EMI A;  5BRT A;  3UOV A;  1UKV G;  3CND A;  2IVD A;  1JOA A;  3NHO X;  3UKA A;  2YG7 A;  3GMB A;  3BNU A;  1MO9 A;  1KDG A;  1QJD A;  4EQR A;  3C4N A;  4J57 A;  4J34 A;  3CPI G;  1H6V A;  2ZZB A;  3KVE A;  3CNJ A;  3DJD A;  2C7G A;  3UTH A;  4ICY A;  2GRT A;  2WU5 A;  4JNQ A;  4AP3 A;  4OPU A;  3P4S A;  1CJ3 A;  2GEW A;  1ZDL A;  1LPF A;  4A65 A;  2UZZ A;  2YWL A;  2VOU A;  1SEZ A;  2OAM A;  3NIX A;  3UKL A;  4XXG A;  2Z5X A;  3IHM A;  3SQP A;  3NRN A;  4K22 A;  4C5O A;  3CPJ G;  2GR0 A;  2WET A;  3AE2 A;  4TM1 A;  2JB3 A;  1GRH A;  1B8S A;  3PVC A;  4HA6 A;  4A6N B;  3CGE A;  5JCL A;  3AD7 B;  1H86 A;  3NTA A;  4U8L A;  1RYI A;  4CCQ A;  3LB8 A;  2XLT A;  1FEC A;  1PJ7 A;  1MOK A;  3VR9 A;  1M6I A;  4CBQ A;  1ZKQ A;  3URH A;  2Q6U A;  4GRT A;  4A5L A;  4UP3 A;  2HQM A;  4U2T A;  3ICT A;  4D03 A;  4Z25 A;  4J33 A;  1PXA A;  4YSY A;  1S2Y A;  1CJ2 A;  4E0V A;  3FMW A;  1GET A;  4EQS A;  4H4P A;  2C72 A;  1BWC A;  1S3B A;  2YM2 A;  2X8G A;  3FBS A;  3B6D A;  4NEV A;  3H8I A;  2XVH A;  4C77 A;  3V3N A;  1FCD A;  3EAN A;  4NEW A;  1LV0 A;  2GQF A;  2GQW A;  1D4D A;  1K0I A;  3UKQ A;  5KWF A;  2RAB A;  3NK0 X;  2BS3 A;  3ITJ A;  2OA1 A;  4GDE A;  1QLB A;  1Q1R A;  3BI5 A;  2B76 A;  1VDC A;  2BYB A;  4BJZ A;  3AEG A;  2TPR A;  4RSL A;  3VRD B;  5JCI A;  4RG4 A;  4OPT A;  1GRA A;  3GDN A;  3RHA A;  3LOV A;  4UDR A;  4AT0 A;  3RNM A;  1GEU A;  4CY6 A;  3CTY A;  2Q0K A;  4H2Q A;  4DSH A;  1TDN A;  2XDO A;  3JSK A;  4OPI A;  5C3J A;  2GF3 A;  4LU6 A;  5U25 A;  2XFN A;  3ICR A;  2XCG A;  1BGN A;  1IUV A;  1VG9 A;  1H7W A;  2XLR A;  3ADA B;  4FK1 A;  4LA1 A;  5KVI A;  1RSG A;  1Q9I A;  3UKP A;  2EQ7 A;  4H4S A;  1H83 A;  5JCN A;  1L9E A;  2WDQ A;  5KXJ A;  4KX6 A;  3QSE A;  4J36 A;  1GRG A;  1Q1W A;  3VRA A;  2YM1 A;  4DNA A;  1AOG A;  2C67 A;  4CNJ A;  1XAN A;  2IVE A;  2YLW A;  4H4Y A;  1CL0 A;  1F3P A;  4OPC A;  1EL7 A;  3IWA A;  3O0H A;  1COY A;  1K0L A;  4TM4 A;  3BHF A;  2C65 A;  1RP0 A;  3KKJ A;  2Z5Y A;  3UOY A;  2BAC A;  4H4U A;  3IHG A;  3QVP A;  4CY8 A;  4H4W A;  1GTH A;  1B37 A;  1O5W A;  5U1O A;  2DKH A;  3OC4 A;  2Y6R A;  4B66 A;  1E1K A;  1DOD A;  1XHC A;  1F8W A;  2RGO A;  2V61 A;  3QFA A;  4Z44 A;  4U2S A;  2ACZ A;  1KSU A;  3BI4 A;  2YG4 A;  4U8P A;  4H2N A;  4Z26 A;  3QSM A;  3NYF A;  4B64 A;  3AE4 A;  4IVO B;  1GRE A;  4O5Q A;  4TM3 A;  4BK2 A;  2FJA A;  2NPX A;  4Z2R A;  5FS6 A;  2VVM A;  4EIQ A;  4OPL A;  3M0O A;  3LZW A;  2I0Z A;  4BUR A;  1K0J A;  2R0P A;  3EF6 A;  3P4R A; 
#chains in the Genus database with same CATH topology
 1DOE A;  1PBB A;  2GR3 A;  1GSN A;  2OLO A;  2YLR A;  4AP1 A;  4EQX A;  3IF9 A;  3NGC X;  4A6N A;  1H7X A;  2WHD A;  1ZK7 A;  4GF7 A;  4Z24 A;  5U63 A;  1OJD A;  4PAA A;  1PJ5 A;  4B68 A;  1PS9 A;  3SZ0 A;  1XDI A;  4NZH A;  1ZMD A;  2BS2 A;  3F8P A;  4OVI A;  1GTE A;  4BV6 A;  1GRB A;  1NHP A;  2GB0 A;  2C66 A;  3P9U A;  3AD9 B;  1EL9 A;  1O95 A;  3GYJ A;  1HYU A;  2FJB A;  3QFB A;  4JY3 A;  2EQ6 A;  3GMC A;  3RP7 A;  2GMJ A;  4G6H A;  4NTC A;  3GDP A;  2WOI A;  4EMW A;  1E1N A;  1FOH A;  3NN6 X;  1F8R A;  4BK1 A;  1QO8 A;  4EMJ A;  2TMD A;  4XWZ A;  4AOS A;  2CUL A;  1DJQ A;  1D4C A;  2YG3 A;  2NVK X;  2H89 A;  5GSN A;  4KPR A;  3I3L A;  2WP6 A;  1L9D A;  3UCL A;  2E5V A;  1DXL A;  1S3E A;  3NYE A;  3UTE A;  1N4U A;  4ECH A;  4G9K A;  4B69 A;  4CNK A;  3AE1 A;  2RGJ A;  2YR6 A;  5L46 A;  2E1M A;  4YSX A;  2E4G A;  3CNS A;  2X3N A;  4H4T A;  2BXS A;  4U8I A;  3DJJ A;  4II2 A;  4YTP A;  5LV9 A;  3LAD A;  4UDP A;  3K7T A;  2Q0L A;  1BF3 A;  3UKF A;  2BS4 A;  1GPE A;  2B7R A;  2XYO A;  3DA1 A;  3DJE A;  3V3O A;  4CCR A;  1KNR A;  3LZX A;  2A87 A;  4PAB A;  2X99 A;  4GUV A;  3SX6 A;  2B9Y A;  5KNL A;  3AE5 A;  4H4Z A;  3VQR A;  1NG4 A;  1D7L A;  3ALJ A;  4NNJ A;  3KPF A;  3II4 A;  1D4E A;  3D8X A;  3PS9 A;  3AEB A;  3RP8 A;  4Z43 A;  2YVJ A;  1IUT A;  3AE7 A;  4D04 A;  4H7U A;  1S2Q A;  1GES A;  3T37 A;  3CNP A;  3DH9 A;  1B5Q A;  4J31 A;  1JU2 A;  3NTD A;  3HYX A;  3QSS A;  3F8D A;  1TRB A;  4NTE A;  4Z2T A;  3T0K A;  4C3Y A;  1ONF A;  1KNP A;  1CHU A;  3NLC A;  5IQ4 A;  1V59 A;  3DJG X;  3CGD A;  4M52 A;  4NTD A;  4I59 A;  5BUL A;  2GV8 A;  3GD3 A;  1ZOV A;  4GCM A;  5KMR A;  3SGL A;  2X50 A;  3C96 A;  2C3C A;  3RED A;  3ALL A;  1E1L A;  4JQ9 A;  2YAU A;  2BCP A;  3I6D A;  3AD8 B;  3D1C A;  3ICS A;  2AQJ A;  4Y4L A;  1E1M A;  2BK3 A;  5EB5 A;  4DSG A;  5HXI A;  3FG2 P;  3UP5 A;  1NPX A;  5IQ1 A;  3ATQ A;  1PJ6 A;  4H4X A;  4J2W A;  1LQT A;  3ZDN A;  2C73 A;  2BK4 A;  3NNE A;  3GWD A;  4FK1 C;  2BC0 A;  3UTF A;  4OPG A;  3KD9 A;  2YQU A;  1NDA A;  1YQ4 A;  4IV9 A;  3AB1 A;  4ZCD A;  5KOX A;  3SYI A;  1DOC A;  3AE8 A;  2C64 A;  1F6M A;  4MJW A;  3BI2 A;  3P4Q A;  1CJC A;  3GYX A;  3AYI A;  3GD4 A;  1NEN A;  4K8D A;  4DGK A;  1PN0 A;  2CFY A;  2JAE A;  3HZL A;  3NKS A;  2R9Z A;  5FS9 A;  3R9U A;  3SY4 A;  4U8N A;  1W4X A;  2JKC A;  3RP6 A;  1CF3 A;  5GRT A;  3H4K A;  2BXR A;  2C70 A;  3AEA A;  2WES A;  3K30 A;  3AE3 A;  3FIM B;  4YTM A;  3ISH A;  1E39 A;  1PBE A;  3AE6 A;  5HHF A;  2WP9 A;  1NHR A;  4P9S A;  1NAA A;  1JNR A;  2WOW A;  3BNM A;  4H4Q A;  1JRZ A;  1ZX9 A;  3AXB A;  5J7X A;  2XVF A;  1CC6 A;  2C4C A;  4B63 A;  3L8K A;  2X8H A;  3QVR A;  1GER A;  3DK8 A;  1EL8 A;  2PHH A;  2GAH B;  4A9W A;  3OZ2 A;  5JCM A;  4JNA A;  4H4V A;  2V60 A;  4Y4M A;  4IA6 A;  3T31 A;  1YQZ A;  1H84 A;  1PDH A;  2DKI A;  1GAL A;  2EQ9 A;  1TDF A;  5FMH A;  2BA9 A;  4RG3 A;  1PXB A;  3DK9 A;  3SFE A;  4OCG A;  3VRB A;  3AYJ A;  1IUW A;  1GRT A;  3T2Y A;  4YSH A;  2BC1 A;  4XWR A;  1E6E A;  1GT8 A;  1YKJ A;  3K7M X;  5DBJ A;  1GRF A;  1O94 A;  1JRX A;  1GXF A;  1L0V A;  3AED A;  5M10 A;  1OJC A;  2ZZ0 A;  3EAO A;  4USQ A;  4K7Z A;  3CGB A;  2FJE A;  3FPZ A;  1DNC A;  4IA5 A;  1YQ3 A;  1IUS A;  2GR1 A;  2VQ7 A;  1CBO A;  4A79 A;  4U8J A;  2YLT A;  1Y56 B;  2XLU A;  1VQW A;  1BGJ A;  4CRT A;  3NK1 X;  1N1P A;  3G5Q A;  5C2T A;  2YR4 A;  1OJA A;  2FBW A;  4X4J A;  2JK6 A;  2WP5 A;  1F8S A;  1JNZ A;  1KFY A;  2YVG A;  2AR8 A;  3HYW A;  5EB4 A;  4YSZ A;  3E1T A;  3GRS A;  3AEF A;  1MXT A;  2GR2 A;  3CIR A;  2WDV A;  3M13 A;  1LTX R;  4A7A A;  1P2E A;  5FS7 A;  4B65 A;  4K2X A;  1BZL A;  1Z6L A;  2R0G A;  3VR8 A;  4WCT A;  1CJ4 A;  2V5Z A;  3P1W A;  1FEA A;  3EPT A;  3P4P A;  1ZY8 A;  2R45 A;  2YLS A;  3M12 A;  4K5S A;  4J56 A;  2WU2 A;  3KA7 A;  2B7S A;  1KSS A;  1TYT A;  4FX9 A;  4AT2 A;  3NT6 A;  5CKU A;  2XVI A;  4IVM B;  4TM0 A;  2C75 A;  3BHK A;  2XFP A;  1EBD A;  4Z2U A;  4N9X A;  4ADW A;  4REK A;  2WPF A;  1ELI A;  2VRL A;  4JN9 A;  3LXD A;  1ZMC A;  4G74 A;  2JBV A;  1XPQ A;  3NN0 X;  4ZCC A;  2QAE A;  1TDO A;  2GVC A;  4GDP A;  2PYX A;  3PO7 A;  1BKW A;  3UKK A;  3ZYX A;  4WX1 A;  4YT0 A;  4YKG A;  1NG3 A;  1N4W A;  2GAG B;  2J3N A;  2WQY A;  3V76 A;  2XVJ A;  3QJ4 A;  4HB9 A;  1E7P A;  5KMQ A;  2Y6Q A;  3F8R A;  5IPY A;  4G6G A;  2RGH A;  3UKH A;  5KMP A;  1PBD A;  2JB2 A;  1LQU A;  4BJY A;  4U8M A;  2QCU A;  2XLP A;  3G5R A;  1IJH A;  2H88 A;  2YR5 A;  4BK3 A;  1LVL A;  2QA2 A;  2V6O A;  2YG6 A;  1N4V A;  4H2P A;  1IUU A;  4Y4N A;  1TDK A;  3UP4 A;  1DOB A;  3NYC A;  3SZC A;  1GOS A;  2XVE A;  1L9C A;  3AEE A;  4USR A;  2ZBW A;  2JB1 A;  3H8L A;  1PBF A;  2O9Z A;  1JEH A;  3COX A;  4O5U A;  5J60 A;  5KRQ A;  4U8K A;  2VVL A;  3CN8 A;  3LJP A;  3CPH G;  2XLS A;  3UTG A;  5FS8 A;  2WS3 A;  4TLX A;  2BAB A;  1ZP0 A;  2F5Z A;  4EM3 A;  2OAL A;  2R0C A;  2YLX A;  4U8O A;  2ZZC A;  1REO A;  2V3B A;  2YLZ A;  3SM8 A;  4EIP A;  2WPC A;  2VRM A;  2ARD A;  2A8X A;  2WEU A;  2WDR A;  1CC2 A;  1OJT A;  3Q9T A;  1M64 A;  2X8C A;  1YY5 A;  5BVA A;  3CNT A;  1FEB A;  4K5R A;  1TYP A;  1Y56 A;  2W0H A;  5KOW A;  5KVH A;  1VG0 A;  4TLZ A;  1NHS A;  5TR3 A;  4ZN0 A;  4A99 A;  2XFO A;  4H50 A;  4LII A;  1CC4 A;  4X9M A;  2XFQ A;  1PBC A;  4YKF A;  1VRQ B;  2BK5 A;  3CGC A;  4C3X A;  1KF6 A;  3NK2 X;  1DJN A;  4OPD A;  2BRY A;  2QA1 A;  1NHQ A;  3NH3 X;  2WBA A;  4H2R A;  3UOX A;  2XFU A;  2FJD A;  2GMH A;  1NEK A;  2IID A;  4H4R A;  1IUX A;  1GND A;  3K7Q X;  3IC9 A;  3G5S A;  2C3D A;  4JDR A;  3GRT A;  2OLN A;  4EM4 A;  3GSI A;  1TDE A;  3AWI A;  5EOW A;  2WPE A;  4B1B A;  1FL2 A;  3AYL A;  4I58 A;  4AOX A;  2AAQ A;  2B9W A;  1D7Y A;  5BUK A;  1D5T A;  1Y0P A;  3ATR A;  4B67 A;  2YG5 A;  3KU9 A;  2VZ2 A;  3DGZ A;  1H81 A;  2CDU A;  3NG7 X;  1OJ9 A;  2Q7V A;  1GV4 A;  5M0Z A;  1PXC A;  3T14 A;  2APG A;  2B9X A;  4APN A;  5HYM A;  3S5W A;  3AEC A;  3AE9 A;  4GR1 A;  5KMS A;  5JCK A;  3ALM A;  2C76 A;  3KLJ A;  2GH5 A;  3ABV A;  3WE0 A;  3DK4 A;  4JY2 A;  4U2L A;  3T2Z A;  1B4V A;  4YTN A;  2V3A A;  1JRY A;  1X31 B;  5CQF A;  2WOV A;  4UDQ A;  3UOZ A;  1EL5 A;  4YXD A;  1PHH A;  3SFD A;  2CVJ A;  2BCG G;  2R4E A;  4YWO A;  3CMM A;  4X9N A;  4EQW A;  5EBK A;  2EQ8 A;  4FDC B;  1P2H A;  2VVL G;  3C4A A;  2VQB A;  3L1R A;  5ER0 A;  4NWZ A;  5HY5 A;  3B3R A;  1K4Q A;  1LJ1 A;  3GYI A;  3DGH A;  2R4J A;  3GWF A;  2YVF A;  3S61 A;  2A89 A;  3SXI A;  1H82 A;  1ZOY A;  3DME A;  4C74 A;  2R46 A;  3Q6J A;  4EMI A;  5BRT A;  3UOV A;  1UKV G;  3CND A;  2IVD A;  1JOA A;  3NHO X;  3UKA A;  2YG7 A;  3GMB A;  3BNU A;  1MO9 A;  1KDG A;  1QJD A;  4EQR A;  3C4N A;  4J57 A;  4J34 A;  3CPI G;  1H6V A;  2ZZB A;  3KVE A;  3CNJ A;  3DJD A;  2C7G A;  3UTH A;  4ICY A;  2GRT A;  2WU5 A;  4JNQ A;  4AP3 A;  4OPU A;  3P4S A;  1CJ3 A;  2GEW A;  1ZDL A;  1LPF A;  4A65 A;  2UZZ A;  2YWL A;  2VOU A;  1SEZ A;  2OAM A;  3NIX A;  3UKL A;  4XXG A;  2Z5X A;  3IHM A;  3SQP A;  3NRN A;  4K22 A;  4C5O A;  3CPJ G;  2GR0 A;  2WET A;  3AE2 A;  4TM1 A;  2JB3 A;  1GRH A;  4GAV A;  1B8S A;  3PVC A;  4HA6 A;  4A6N B;  3CGE A;  5JCL A;  3AD7 B;  1H86 A;  3NTA A;  4U8L A;  1RYI A;  4CCQ A;  3LB8 A;  3KPK A;  2XLT A;  1FEC A;  1PJ7 A;  3HYV A;  1MOK A;  2BRA A;  3VR9 A;  1M6I A;  4CBQ A;  1ZKQ A;  3URH A;  2Q6U A;  4GRT A;  4A5L A;  4UP3 A;  2HQM A;  4U2T A;  3ICT A;  4GAP A;  4D03 A;  4Z25 A;  4J33 A;  1PXA A;  4YSY A;  1S2Y A;  1CJ2 A;  4E0V A;  3FMW A;  1GET A;  4EQS A;  4H4P A;  2C72 A;  1BWC A;  1S3B A;  2YM2 A;  2X8G A;  3FBS A;  3B6D A;  4G73 A;  4NEV A;  3SZW A;  3H8I A;  2XVH A;  4C77 A;  3V3N A;  1FCD A;  3EAN A;  4NEW A;  1LV0 A;  2GQF A;  2GQW A;  1D4D A;  1K0I A;  3UKQ A;  5KWF A;  2RAB A;  3NK0 X;  2BS3 A;  3ITJ A;  2OA1 A;  4GDE A;  3T2K A;  1QLB A;  1Q1R A;  3BI5 A;  2B76 A;  1VDC A;  2BYB A;  4BJZ A;  3AEG A;  2TPR A;  4RSL A;  3VRD B;  5JCI A;  4RG4 A;  4OPT A;  1GRA A;  3GDN A;  3RHA A;  3LOV A;  4UDR A;  4AT0 A;  3RNM A;  1GEU A;  3SZF A;  3CTY A;  2Q0K A;  4H2Q A;  4CY6 A;  4DSH A;  1TDN A;  2XDO A;  3JSK A;  4OPI A;  5C3J A;  2GF3 A;  4LU6 A;  5U25 A;  2XFN A;  3ICR A;  2XCG A;  1BGN A;  1IUV A;  1VG9 A;  1H7W A;  2XLR A;  3ADA B;  4FK1 A;  4LA1 A;  5KVI A;  1RSG A;  1Q9I A;  3UKP A;  2EQ7 A;  4H4S A;  1H83 A;  5JCN A;  1L9E A;  2WDQ A;  5KXJ A;  4KX6 A;  3QSE A;  4J36 A;  1GRG A;  1Q1W A;  3VRA A;  2YM1 A;  4DNA A;  1AOG A;  2C67 A;  4CNJ A;  1XAN A;  2IVE A;  2YLW A;  4H4Y A;  1CL0 A;  1F3P A;  4OPC A;  1EL7 A;  3IWA A;  3O0H A;  1COY A;  1K0L A;  4TM4 A;  3BHF A;  2C65 A;  1RP0 A;  3KKJ A;  2Z5Y A;  3UOY A;  2BAC A;  4II3 A;  4H4U A;  3IHG A;  3QVP A;  4CY8 A;  4H4W A;  1GTH A;  1B37 A;  1O5W A;  5U1O A;  2DKH A;  3OC4 A;  2Y6R A;  4B66 A;  1E1K A;  1DOD A;  1XHC A;  1F8W A;  2RGO A;  2V61 A;  3QFA A;  4Z44 A;  4U2S A;  2ACZ A;  1KSU A;  3BI4 A;  2YG4 A;  4U8P A;  4H2N A;  4Z26 A;  3QSM A;  3NYF A;  4B64 A;  3AE4 A;  4IVO B;  1GRE A;  4O5Q A;  4TM3 A;  4BK2 A;  2FJA A;  2NPX A;  4Z2R A;  5FS6 A;  2VVM A;  4EIQ A;  4OPL A;  3M0O A;  3LZW A;  2I0Z A;  4BUR A;  1K0J A;  2R0P A;  3EF6 A;  3P4R A; 
#chains in the Genus database with same CATH homology
 1DOE A;  1PBB A;  2GR3 A;  1GSN A;  2OLO A;  2YLR A;  4AP1 A;  4EQX A;  3IF9 A;  3NGC X;  4A6N A;  1H7X A;  2WHD A;  1ZK7 A;  4GF7 A;  4Z24 A;  5U63 A;  1OJD A;  4PAA A;  1PJ5 A;  4B68 A;  1PS9 A;  3SZ0 A;  1XDI A;  4NZH A;  1ZMD A;  2BS2 A;  3F8P A;  4OVI A;  1GTE A;  4BV6 A;  1GRB A;  1NHP A;  2GB0 A;  2C66 A;  3P9U A;  3AD9 B;  1EL9 A;  1O95 A;  3GYJ A;  1HYU A;  2FJB A;  3QFB A;  4JY3 A;  2EQ6 A;  3GMC A;  3RP7 A;  2GMJ A;  4G6H A;  4NTC A;  3GDP A;  2WOI A;  4EMW A;  1E1N A;  1FOH A;  3NN6 X;  1F8R A;  4BK1 A;  1QO8 A;  4EMJ A;  2TMD A;  4XWZ A;  4AOS A;  2CUL A;  1DJQ A;  1D4C A;  2YG3 A;  2NVK X;  2H89 A;  5GSN A;  4KPR A;  3I3L A;  2WP6 A;  1L9D A;  3UCL A;  2E5V A;  1DXL A;  1S3E A;  3NYE A;  3UTE A;  1N4U A;  4ECH A;  4G9K A;  4B69 A;  4CNK A;  3AE1 A;  2RGJ A;  2YR6 A;  5L46 A;  2E1M A;  4YSX A;  2E4G A;  3CNS A;  2X3N A;  4H4T A;  2BXS A;  4U8I A;  3DJJ A;  4II2 A;  4YTP A;  5LV9 A;  3LAD A;  4UDP A;  3K7T A;  2Q0L A;  1BF3 A;  3UKF A;  2BS4 A;  1GPE A;  2B7R A;  2XYO A;  3DA1 A;  3DJE A;  3V3O A;  4CCR A;  1KNR A;  3LZX A;  2A87 A;  4PAB A;  2X99 A;  4GUV A;  3SX6 A;  2B9Y A;  5KNL A;  3AE5 A;  4H4Z A;  3VQR A;  1NG4 A;  1D7L A;  3ALJ A;  4NNJ A;  3KPF A;  3II4 A;  1D4E A;  3D8X A;  3PS9 A;  3AEB A;  3RP8 A;  4Z43 A;  2YVJ A;  1IUT A;  3AE7 A;  4D04 A;  4H7U A;  1S2Q A;  1GES A;  3T37 A;  3CNP A;  3DH9 A;  1B5Q A;  4J31 A;  1JU2 A;  3NTD A;  3HYX A;  3QSS A;  3F8D A;  1TRB A;  4NTE A;  4Z2T A;  3T0K A;  4C3Y A;  1ONF A;  1KNP A;  1CHU A;  3NLC A;  5IQ4 A;  1V59 A;  3DJG X;  3CGD A;  4M52 A;  4NTD A;  4I59 A;  5BUL A;  2GV8 A;  3GD3 A;  1ZOV A;  4GCM A;  5KMR A;  3SGL A;  2X50 A;  3C96 A;  2C3C A;  3RED A;  3ALL A;  1E1L A;  4JQ9 A;  2YAU A;  2BCP A;  3I6D A;  3AD8 B;  3D1C A;  3ICS A;  2AQJ A;  4Y4L A;  1E1M A;  2BK3 A;  5EB5 A;  4DSG A;  5HXI A;  3FG2 P;  3UP5 A;  1NPX A;  5IQ1 A;  3ATQ A;  1PJ6 A;  4H4X A;  4J2W A;  1LQT A;  3ZDN A;  2C73 A;  2BK4 A;  3NNE A;  3GWD A;  4FK1 C;  2BC0 A;  3UTF A;  4OPG A;  3KD9 A;  2YQU A;  1NDA A;  1YQ4 A;  3AB1 A;  4IV9 A;  4ZCD A;  5KOX A;  3SYI A;  1DOC A;  3AE8 A;  2C64 A;  1F6M A;  4MJW A;  3BI2 A;  3P4Q A;  1CJC A;  3GYX A;  3AYI A;  3GD4 A;  1NEN A;  4K8D A;  4DGK A;  1PN0 A;  2CFY A;  2JAE A;  3HZL A;  3NKS A;  2R9Z A;  5FS9 A;  3R9U A;  3SY4 A;  4U8N A;  1W4X A;  2JKC A;  3RP6 A;  1CF3 A;  5GRT A;  3H4K A;  2BXR A;  2C70 A;  3AEA A;  2WES A;  3K30 A;  3AE3 A;  3FIM B;  4YTM A;  3ISH A;  1E39 A;  1PBE A;  3AE6 A;  5HHF A;  2WP9 A;  1NHR A;  4P9S A;  1NAA A;  1JNR A;  2WOW A;  3BNM A;  4H4Q A;  1JRZ A;  1ZX9 A;  3AXB A;  5J7X A;  2XVF A;  1CC6 A;  2C4C A;  4B63 A;  3L8K A;  2X8H A;  3QVR A;  1GER A;  3DK8 A;  1EL8 A;  2PHH A;  2GAH B;  4A9W A;  3OZ2 A;  5JCM A;  4JNA A;  4H4V A;  2V60 A;  4Y4M A;  4IA6 A;  3T31 A;  1YQZ A;  1H84 A;  1PDH A;  2DKI A;  1GAL A;  2EQ9 A;  1TDF A;  5FMH A;  2BA9 A;  4RG3 A;  1PXB A;  3DK9 A;  3SFE A;  4OCG A;  3VRB A;  3AYJ A;  1IUW A;  1GRT A;  3T2Y A;  4YSH A;  2BC1 A;  4XWR A;  1E6E A;  1GT8 A;  1YKJ A;  3K7M X;  5DBJ A;  1GRF A;  1O94 A;  1JRX A;  1GXF A;  1L0V A;  3AED A;  5M10 A;  1OJC A;  2ZZ0 A;  3EAO A;  4USQ A;  4K7Z A;  3CGB A;  2FJE A;  3FPZ A;  1DNC A;  4IA5 A;  1YQ3 A;  1IUS A;  2GR1 A;  2VQ7 A;  1CBO A;  4A79 A;  4U8J A;  2YLT A;  1Y56 B;  2XLU A;  1VQW A;  1BGJ A;  4CRT A;  3NK1 X;  1N1P A;  3G5Q A;  5C2T A;  2YR4 A;  1OJA A;  2FBW A;  4X4J A;  2JK6 A;  2WP5 A;  1F8S A;  1JNZ A;  1KFY A;  2YVG A;  2AR8 A;  3HYW A;  5EB4 A;  4YSZ A;  3E1T A;  3GRS A;  3AEF A;  1MXT A;  2GR2 A;  3CIR A;  2WDV A;  3M13 A;  1LTX R;  4A7A A;  1P2E A;  5FS7 A;  4B65 A;  4K2X A;  1BZL A;  1Z6L A;  2R0G A;  3VR8 A;  4WCT A;  1CJ4 A;  2V5Z A;  3P1W A;  1FEA A;  3EPT A;  3P4P A;  1ZY8 A;  2R45 A;  2YLS A;  3M12 A;  4K5S A;  4J56 A;  2WU2 A;  3KA7 A;  2B7S A;  1KSS A;  1TYT A;  4FX9 A;  4AT2 A;  3NT6 A;  5CKU A;  2XVI A;  4IVM B;  4TM0 A;  2C75 A;  3BHK A;  2XFP A;  1EBD A;  4Z2U A;  4N9X A;  4ADW A;  4REK A;  2WPF A;  1ELI A;  2VRL A;  4JN9 A;  3LXD A;  1ZMC A;  4G74 A;  2JBV A;  1XPQ A;  3NN0 X;  4ZCC A;  2QAE A;  1TDO A;  2GVC A;  4GDP A;  2PYX A;  3PO7 A;  1BKW A;  3UKK A;  3ZYX A;  4WX1 A;  4YT0 A;  4YKG A;  1NG3 A;  1N4W A;  2GAG B;  2J3N A;  2WQY A;  3V76 A;  2XVJ A;  3QJ4 A;  4HB9 A;  1E7P A;  5KMQ A;  2Y6Q A;  3F8R A;  5IPY A;  4G6G A;  2RGH A;  3UKH A;  5KMP A;  1PBD A;  2JB2 A;  1LQU A;  4BJY A;  4U8M A;  2QCU A;  2XLP A;  3G5R A;  1IJH A;  2H88 A;  2YR5 A;  4BK3 A;  1LVL A;  2QA2 A;  2V6O A;  2YG6 A;  1N4V A;  4H2P A;  1IUU A;  4Y4N A;  1TDK A;  3UP4 A;  1DOB A;  3NYC A;  3SZC A;  1GOS A;  2XVE A;  1L9C A;  3AEE A;  4USR A;  2ZBW A;  2JB1 A;  3H8L A;  1PBF A;  2O9Z A;  1JEH A;  3COX A;  4O5U A;  5J60 A;  5KRQ A;  4U8K A;  2VVL A;  3CN8 A;  3LJP A;  3CPH G;  2XLS A;  3UTG A;  5FS8 A;  2WS3 A;  4TLX A;  2BAB A;  1ZP0 A;  2F5Z A;  4EM3 A;  2OAL A;  2R0C A;  2YLX A;  4U8O A;  2ZZC A;  1REO A;  2V3B A;  2YLZ A;  3SM8 A;  4EIP A;  2WPC A;  2VRM A;  2ARD A;  2A8X A;  2WEU A;  2WDR A;  1CC2 A;  1OJT A;  3Q9T A;  1M64 A;  2X8C A;  1YY5 A;  5BVA A;  3CNT A;  1FEB A;  4K5R A;  1TYP A;  1Y56 A;  2W0H A;  5KOW A;  5KVH A;  1VG0 A;  4TLZ A;  1NHS A;  5TR3 A;  4ZN0 A;  4A99 A;  2XFO A;  4H50 A;  4LII A;  1CC4 A;  4X9M A;  2XFQ A;  1PBC A;  4YKF A;  1VRQ B;  2BK5 A;  3CGC A;  4C3X A;  1KF6 A;  3NK2 X;  1DJN A;  4OPD A;  2BRY A;  2QA1 A;  1NHQ A;  3NH3 X;  2WBA A;  4H2R A;  3UOX A;  2XFU A;  2FJD A;  2GMH A;  1NEK A;  2IID A;  4H4R A;  1IUX A;  1GND A;  3K7Q X;  3IC9 A;  3G5S A;  2C3D A;  4JDR A;  3GRT A;  2OLN A;  4EM4 A;  3GSI A;  1TDE A;  3AWI A;  5EOW A;  2WPE A;  4B1B A;  1FL2 A;  3AYL A;  4I58 A;  4AOX A;  2AAQ A;  2B9W A;  1D7Y A;  5BUK A;  1D5T A;  1Y0P A;  3ATR A;  4B67 A;  2YG5 A;  3KU9 A;  2VZ2 A;  3DGZ A;  1H81 A;  2CDU A;  3NG7 X;  1OJ9 A;  2Q7V A;  1GV4 A;  5M0Z A;  1PXC A;  3T14 A;  2APG A;  2B9X A;  4APN A;  5HYM A;  3S5W A;  3AEC A;  3AE9 A;  4GR1 A;  5KMS A;  5JCK A;  3ALM A;  2C76 A;  3KLJ A;  2GH5 A;  3ABV A;  4JY2 A;  3DK4 A;  4U2L A;  3T2Z A;  3WE0 A;  1B4V A;  4YTN A;  2V3A A;  1JRY A;  1X31 B;  5CQF A;  2WOV A;  4UDQ A;  3UOZ A;  1EL5 A;  4YXD A;  1PHH A;  3SFD A;  2CVJ A;  2BCG G;  2R4E A;  4YWO A;  3CMM A;  4X9N A;  4EQW A;  5EBK A;  2EQ8 A;  4FDC B;  1P2H A;  2VVL G;  3C4A A;  2VQB A;  3L1R A;  5ER0 A;  4NWZ A;  5HY5 A;  3B3R A;  1K4Q A;  1LJ1 A;  3GYI A;  3DGH A;  2R4J A;  3GWF A;  2YVF A;  3S61 A;  2A89 A;  3SXI A;  1H82 A;  1ZOY A;  3DME A;  4C74 A;  2R46 A;  3Q6J A;  4EMI A;  5BRT A;  3UOV A;  1UKV G;  3CND A;  2IVD A;  1JOA A;  3NHO X;  3UKA A;  2YG7 A;  3GMB A;  3BNU A;  1MO9 A;  1KDG A;  1QJD A;  4EQR A;  3C4N A;  4J57 A;  4J34 A;  3CPI G;  1H6V A;  2ZZB A;  3KVE A;  3CNJ A;  3DJD A;  2C7G A;  3UTH A;  4ICY A;  2GRT A;  2WU5 A;  4JNQ A;  4AP3 A;  4OPU A;  3P4S A;  1CJ3 A;  2GEW A;  1ZDL A;  1LPF A;  4A65 A;  2UZZ A;  2YWL A;  2VOU A;  1SEZ A;  2OAM A;  3NIX A;  3UKL A;  4XXG A;  2Z5X A;  3IHM A;  3SQP A;  3NRN A;  4K22 A;  4C5O A;  3CPJ G;  2GR0 A;  2WET A;  3AE2 A;  4TM1 A;  2JB3 A;  1GRH A;  4GAV A;  1B8S A;  3PVC A;  4HA6 A;  4A6N B;  3CGE A;  5JCL A;  3AD7 B;  1H86 A;  3NTA A;  4U8L A;  1RYI A;  4CCQ A;  3LB8 A;  3KPK A;  2XLT A;  1FEC A;  1PJ7 A;  3HYV A;  1MOK A;  2BRA A;  3VR9 A;  1M6I A;  4CBQ A;  1ZKQ A;  3URH A;  2Q6U A;  4GRT A;  4A5L A;  4UP3 A;  2HQM A;  4U2T A;  3ICT A;  4GAP A;  4D03 A;  4Z25 A;  4J33 A;  1PXA A;  4YSY A;  1S2Y A;  1CJ2 A;  4E0V A;  3FMW A;  1GET A;  4EQS A;  4H4P A;  2C72 A;  1BWC A;  1S3B A;  2YM2 A;  2X8G A;  3FBS A;  3B6D A;  4G73 A;  4NEV A;  3SZW A;  3H8I A;  2XVH A;  4C77 A;  3V3N A;  1FCD A;  3EAN A;  4NEW A;  1LV0 A;  2GQF A;  2GQW A;  1D4D A;  1K0I A;  3UKQ A;  5KWF A;  2RAB A;  3NK0 X;  2BS3 A;  3ITJ A;  2OA1 A;  4GDE A;  3T2K A;  1QLB A;  1Q1R A;  3BI5 A;  2B76 A;  1VDC A;  2BYB A;  4BJZ A;  3AEG A;  2TPR A;  4RSL A;  3VRD B;  5JCI A;  4RG4 A;  4OPT A;  1GRA A;  3GDN A;  3RHA A;  3LOV A;  4UDR A;  4AT0 A;  3RNM A;  1GEU A;  3SZF A;  3CTY A;  2Q0K A;  4H2Q A;  4CY6 A;  4DSH A;  1TDN A;  2XDO A;  3JSK A;  4OPI A;  5C3J A;  2GF3 A;  4LU6 A;  5U25 A;  2XFN A;  3ICR A;  2XCG A;  1BGN A;  1IUV A;  1VG9 A;  1H7W A;  2XLR A;  3ADA B;  4FK1 A;  4LA1 A;  5KVI A;  1RSG A;  1Q9I A;  3UKP A;  2EQ7 A;  4H4S A;  1H83 A;  5JCN A;  1L9E A;  2WDQ A;  5KXJ A;  4KX6 A;  3QSE A;  4J36 A;  1GRG A;  1Q1W A;  3VRA A;  2YM1 A;  4DNA A;  1AOG A;  2C67 A;  4CNJ A;  1XAN A;  2IVE A;  2YLW A;  4H4Y A;  1CL0 A;  1F3P A;  4OPC A;  1EL7 A;  3IWA A;  3O0H A;  1COY A;  1K0L A;  4TM4 A;  3BHF A;  2C65 A;  1RP0 A;  3KKJ A;  2Z5Y A;  3UOY A;  2BAC A;  4II3 A;  4H4U A;  3IHG A;  3QVP A;  4CY8 A;  4H4W A;  1GTH A;  1B37 A;  1O5W A;  5U1O A;  2DKH A;  3OC4 A;  2Y6R A;  4B66 A;  1E1K A;  1DOD A;  1XHC A;  1F8W A;  2RGO A;  2V61 A;  3QFA A;  4Z44 A;  4U2S A;  2ACZ A;  1KSU A;  3BI4 A;  2YG4 A;  4U8P A;  4H2N A;  4Z26 A;  3QSM A;  3NYF A;  4B64 A;  3AE4 A;  4IVO B;  1GRE A;  4O5Q A;  4TM3 A;  4BK2 A;  2FJA A;  2NPX A;  4Z2R A;  5FS6 A;  2VVM A;  4EIQ A;  4OPL A;  3M0O A;  3LZW A;  2I0Z A;  4BUR A;  1K0J A;  2R0P A;  3EF6 A;  3P4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...