3CTYA

Crystal structure of t. acidophilum thioredoxin reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
304
Chain Sequence
ERDFDVVIVGAGAAGFSAAVYAARSGFSVAILDKAVAGGLTAEAPLVENYLGFKSIVGSELAKLFADHAANYAKIREGVEVRSIKKTQGGFDIETNDDTYHAKYVIITTGTTHKHLGVKGESEYFGKGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCENAYVQEIKKRNIPYIMNAQVTEIVGDGKKVTGVKYKDRTTGEEKLIETDGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAGDVTSGNFAQIASAVGDGCKAALSLYSDSIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thioredoxin reductase
publication title Thioredoxin reductase from Thermoplasma acidophilum: a new twist on redox regulation.
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 93
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ctyA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ctyA02
3NG7X 2NPXA 3CTYA 1N1PA 4GDEA 4H2RA 3UKLA 2JB2A 1PN0A 4A9WA 4U8NA 2BA9A 3DK9A 1LPFA 3P4PA 3LXDA 1NDAA 4TM3A 1GERA 1TRBA 1FCDA 1KDGA 3RHAA 3VQRA 1PXCA 1DXLA 4NTEA 4PAAA 5BVAA 2WP5A 2GVCA 3NKSA 3GYJA 4U8OA 2R45A 1D5TA 3Q9TA 1GRHA 3UKFA 3GD3A 2C3DA 2QA2A 1IUUA 4H4RA 1NPXA 3BNMA 2H88A 2XFNA 2Y6QA 3AWIA 2C66A 3IHMA 3NN0X 4B64A 2YLZA 1GRTA 2AR8A 2YR5A 2XLPA 5U25A 3NK2X 4O5QA 1GRFA 3KLJA 4H4ZA 1K0LA 2BK4A 3BI5A 2BC0A 4ZCCA 4YSHA 2IIDA 4Z43A 3AEGA 2WPCA 3UOXA 2XVJA 4UDPA 2V61A 3CGCA 2Q6UA 4EMIA 3ALLA 3K30A 4H4TA 3E1TA 1E1NA 2GRTA 4YTMA 1CC2A 4N9XA 2BK3A 2GQWA 1ZOVA 3L8KA 1RP0A 2FJDA 3LADA 3UTFA 3D8XA 1KNPA 2AQJA 2WDQA 2DKHA 2VRLA 3KU9A 3QFAA 4OPDA 4DSGA 2YLTA 1L9EA 1YKJA 2XLRA 3DJEA 2ZZ0A 3V3NA 3DJJA 2GQFA 2W0HA 3AE1A 4AT2A 1Y56B 4Z25A 3AXBA 4A7AA 2C67A 2GR1A 2YG5A 3DMEA 3VRBA 3AE7A 4NEVA 2QCUA 1XDIA 3CGEA 2WP6A 3AD8B 1BZLA 2A8XA 2ZZCA 1KNRA 4ICYA 2FBWA 4U2LA 1H84A 4K5SA 1PHHA 1JNZA 4K22A 4TM1A 3NHOX 2WU5A 1LTXR 3SFDA 1DJQA 1O94A 1SEZA 2GV8A 1B4VA 3DGZA 4JNQA 1QJDA 1QO8A 2E4GA 3NNEA 4BK2A 1DODA 1CJCA 3KKJA 5C2TA 3URHA 1X31B 2V3BA 3AE6A 3T37A 2JAEA 4YTNA 1JRYA 2CVJA 1D4DA 3IHGA 1E39A 2PYXA 5JCLA 4ADWA 1QLBA 2GAHB 4CRTA 1NHPA 4GR1A 3VR9A 2YG3A 4YTPA 1TYTA 4U8KA 3AE5A 1E7PA 3GWDA 3NLCA 4RSLA 3RP7A 3REDA 2YAUA 3QSSA 1F8RA 1OJDA 5KWFA 1DOEA 1GSNA 2JB1A 5TR3A 1XANA 3UKAA 3I3LA 1OJAA 1ZMCA 1LJ1A 2GAGB 3ALJA 1GESA 3CNTA 2XFPA 1S2YA 3CPJG 1GRGA 2JK6A 2XLSA 5IQ1A 2V5ZA 4FX9A 1FECA 3UKPA 5DBJA 2E1MA 1CC4A 1Y56A 4JNAA 2QA1A 4XWZA 2GMJA 3UTEA 2CULA 1BF3A 1O5WA 2WDVA 3AE2A 4LU6A 4I58A 1D7LA 4IV9A 4OPLA 3V3OA 4YSYA 1N4WA 3QVPA 3QVRA 3VRDB 5LV9A 1DNCA 3ZDNA 1N4UA 3UOVA 1NHSA 1LQTA 3NYEA 4B68A 4EQXA 3H4KA 3AD7B 5FS9A 5EB5A 5BULA 1H81A 2Y6RA 3UCLA 3P9UA 4H2QA 2WHDA 3RP6A 3COXA 1E1MA 4J56A 3SFEA 2BS4A 1TDEA 1Z6LA 1DOBA 4U8PA 2GEWA 4USQA 4FDCB 1PJ7A 1Q1WA 4IVMB 1H82A 3D1CA 5JCNA 4NEWA 1E6EA 1XPQA 1L9CA 1REOA 4C74A 1CHUA 2UZZA 5KVHA 3AE3A 3CPHG 4OPUA 5KRQA 4M52A 4Z26A 4BJZA 3NTAA 1NHQA 2YLRA 2TPRA 3AE9A 3K7QX 4IA5A 3ZYXA 2VZ2A 1S2QA 4YSXA 3GRSA 4EMJA 2RGJA 3G5QA 3VRAA 1BGJA 1TDFA 3UOYA 4B67A 4DSHA 1PBCA 2YVGA 4ZN0A 1VDCA 1B8SA 1GNDA 2RGHA 4U2TA 1NEKA 4C3YA 1NHRA 2GMHA 3CNDA 4GDPA 4AOSA 5FS7A 1S3EA 3GMCA 4Y4LA 3FIMB 4K2XA 1PBDA 4APNA 4EM3A 1NG3A 4K7ZA 5CKUA 3CIRA 2C73A 1KSSA 3LZXA 1ZKQA 2VRMA 4U8IA 4H4SA 2WP9A 3P4RA 4H2PA 4C3XA 4AP1A 5EB4A 2Q7VA 1GOSA 2R9ZA 1GRBA 3H8LA 3OC4A 4H50A 4CBQA 1IUXA 2TMDA 2Q0LA 2WBAA 3EANA 1ZOYA 2HQMA 4Z2UA 4X9MA 1GV4A 1IUTA 2JBVA 2XDOA 1COYA 1BWCA 1PBEA 1YY5A 1FL2A 2XLUA 5HY5A 4X4JA 4UDRA 5J60A 1RYIA 4LIIA 3LJPA 4XXGA 4YKFA 3ATRA 2WPFA 1DJNA 1D7YA 1JRZA 3DJDA 2FJEA 3AB1A 2WS3A 1Q9IA 3HZLA 5HHFA 1CL0A 1LVLA 4Z24A 3NH3X 2YWLA 4P9SA 1GETA 1KF6A 5GSNA 5EBKA 1JRXA 1EL9A 3H8IA 4EQWA 2C70A 1ONFA 5JCIA 1PDHA 1VG0A 1YQ3A 2J3NA 3DK4A 2WOIA 1PJ5A 2Z5YA 3GD4A 2XVEA 3ABVA 1XHCA 4H4XA 3WE0A 5M10A 2X99A 2C65A 1KFYA 2BK5A 3G5RA 3CGBA 2C3CA 3V76A 1GXFA 3DJGX 4CCRA 2WPEA 1CF3A 3CNJA 2XCGA 3EPTA 4BK1A 3AE4A 3BNUA 4U8MA 1CJ4A 2BACA 2X50A 2C7GA 1LQUA 4H4QA 4A79A 4H7UA 3NT6A 4H4YA 1UKVG 1ZP0A 2B7RA 1GALA 4JY3A 3AD9B 4CY8A 2DKIA 2AAQA 5KXJA 2JB3A 1NG4A 2YLXA 3F8PA 3GMBA 2X3NA 3M0OA 1EL8A 3DH9A 2ARDA 4H4UA 3EF6A 3NN6X 5M0ZA 1PS9A 2BCGG 1OJ9A 5JCMA 3LZWA 1ZDLA 3FPZA 2OA1A 1LV0A 4B66A 2PHHA 2BXRA 1PBFA 2EQ9A 2BCPA 3BI4A 1JEHA 3CGDA 2VQBA 1PXBA 2Z5XA 1IJHA 1MO9A 2EQ6A 2WETA 2YG4A 3CNSA 2YVJA 4Z2TA 2Q0KA 1W4XA 4WX1A 2RGOA 3FBSA 2XFUA 3LB8A 1OJTA 3PO7A 4J34A 2BS3A 4JY2A 4RG4A 2GR0A 3GDPA 3AEDA 1JU2A 1VRQB 2XVFA 1H6VA 3R9UA 1K0JA 1JOAA 3QJ4A 2EQ8A 1OJCA 2GH5A 2ZBWA 3AEBA 1TDOA 4HB9A 4OPCA 3SGLA 4BK3A 3UOZA 1M6IA 4EQSA 1M64A 4FK1A 5HXIA 3OZ2A 4CNJA 3NGCX 1YQ4A 5HYMA 1VQWA 2QAEA 2CDUA 3CN8A 4Y4NA 1GREA 4NZHA 2B76A 2VQ7A 1K0IA 3KPFA 4REKA 3P4SA 2BC1A 3FG2P 2XLTA 4I59A 2OALA 4J36A 5KOWA 1O95A 4OCGA 3CPIG 1ZX9A 4OPIA 1PXAA 4RG3A 2YM2A 2RABA 3UKQA 3M13A 4U8JA 4B65A 2V6OA 3QFBA 3F8DA 3P4QA 2C76A 3VR8A 2B9XA 4J2WA 4UP3A 3RP8A 2B9WA 4WCTA 1NAAA 5KVIA 2YR4A 3KD9A 3K7TA 4LA1A 1MOKA 3P1WA 2YLWA 2V60A 1D4EA 3IC9A 4JQ9A 1CJ3A 3UKKA 3F8RA 3NK0X 4O5UA 3C4NA 4YXDA 2OLOA 2H89A 4J57A 4C5OA 4HA6A 2WU2A 2WESA 2XVIA 2GF3A 2WOWA 3II4A 3IF9A 3RNMA 4D03A 2A87A 2BYBA 3KVEA 1H83A 1GT8A 4A99A 1N4VA 2VOUA 5U1OA 4B1BA 4IA6A 1IUWA 1E1LA 5J7XA 3BHKA 3LOVA 4H4VA 2IVDA 4B69A 4YT0A 1S3BA 4UDQA 4CNKA 2R4EA 2R0PA 4PABA 3EAOA 1CC6A 1BGNA 3ICTA 4EIQA 1AOGA 4NTDA 4K8DA 3I6DA 4EQRA 3ALMA 4DGKA 3AEAA 1GTEA 4EIPA 1JNRA 1Q1RA 2XFOA 1RSGA 4AT0A 3QSMA 1CBOA 5GRTA 2GR3A 2R4JA 3M12A 4H2NA 2X8CA 4JN9A 3FMWA 4A65A 4ECHA 4BV6A 2O9ZA 3UP5A 2A89A 2BS2A 2R0CA 3ATQA 4TLXA 1ZY8A 3GRTA 4TM0A 4K5RA 4A5LA 4AOXA 4U8LA 1B5QA 4C77A 1GTHA 2C72A 1D4CA 5IQ4A 1F6MA 3UTGA 3UP4A 3AYJA 2FJAA 4TLZA 5BUKA 2IVEA 2R0GA 1F8SA 3ICRA 2R46A 1ELIA 2VVLA 2WDRA 1FEAA 2YLSA 3QSEA 3S5WA 2APGA 4MJWA 4A6NB 5KOXA 1NENA 2ZZBA 2YVFA 1ZK7A 1F8WA 2OAMA 2WQYA 3S61A 2CFYA 4YSZA 5L46A 5FS6A 4CY6A 3AEEA 3NYCA 3C96A 1H7WA 2BXSA 2JKCA 1H86A 1VG9A 1PJ6A 2BABA 3ISHA 3KA7A 2E5VA 4BURA 1L9DA 1Y0PA 2B9YA 3K7MX 4YWOA 3AYIA 1K4QA 1P2EA 3B6DA 3L1RA 1GPEA 3CNPA 2VVLG 1P2HA 2V3AA 3GDNA 2B7SA 4EM4A 1TDKA 1IUVA 2EQ7A 3DA1A 3G5SA 4H4WA 4ZCDA 1DOCA 3NK1X 1MXTA 3PS9A 4OPGA 2XVHA 1FEBA 4EMWA 3ICSA 1CJ2A 1EL7A 4GRTA 1EL5A 1TYPA 2YG7A 5ER0A 2YQUA 4USRA 3DGHA 3GYIA 3SQPA 3ITJA 1GEUA 2ACZA 3NYFA 4GF7A 4E0VA 3O0HA 1PBBA 2NVKX 2XFQA 4OVIA 3UKHA 5JCKA 4FK1C 2I0ZA 4D04A 4BJYA 1TDNA 3GWFA 4IVOB 1GRAA 3NTDA 1IUSA 4Z2RA 1FOHA 2YR6A 1ZMDA 3AECA 4OPTA 4A6NA 2OLNA 1E1KA 3AEFA 4J31A 1KSUA 4XWRA 5FMHA 3NRNA 3DK8A 3Q6JA 3AE8A 4KX6A 4X9NA 4Y4MA 2GR2A 4YKGA 4H4PA 3GSIA 3PVCA 3SM8A 2C64A 4J33A 4DNAA 2YM1A 1V59A 5FS8A 1B37A 4TM4A 5CQFA 2XYOA 5IPYA 3B3RA 3NIXA 2GB0A 3UTHA 2FJBA 5U63A 4U2SA 3ADAB 4B63A 2F5ZA 3JSKA 5BRTA 2WEUA 3AYLA 1BKWA 5C3JA 3C4AA 2WOVA 3IWAA 4CCQA 4NTCA 1F3PA 1H7XA 3BHFA 2X8HA 4GUVA 2C75A 1EBDA 2X8GA 2YG6A 4AP3A 1HYUA 2VVMA 4KPRA 4GCMA 4Z44A 1L0VA 4JDRA 1YQZA 3BI2A 5EOWA
chains in the Genus database with same CATH superfamily
3NG7X 2NPXA 5KNLA 3CTYA 1N1PA 4GDEA 4H2RA 3UKLA 2JB2A 1PN0A 4A9WA 4U8NA 2BA9A 3HYWA 3DK9A 1LPFA 3P4PA 3LXDA 1NDAA 2C4CA 4TM3A 1GERA 1TRBA 1FCDA 1KDGA 3RHAA 3VQRA 1PXCA 1DXLA 4NTEA 4PAAA 5BVAA 2WP5A 2GVCA 3NKSA 3HYXA 3GYJA 4U8OA 2R45A 1D5TA 3Q9TA 1GRHA 3UKFA 3GD3A 2C3DA 2QA2A 1IUUA 4H4RA 1NPXA 3BNMA 2H88A 2XFNA 2Y6QA 3AWIA 2C66A 3IHMA 3NN0X 4B64A 2YLZA 1GRTA 2AR8A 2YR5A 2XLPA 5U25A 3NK2X 4G9KA 4O5QA 1GRFA 3KLJA 4H4ZA 1K0LA 2BK4A 3BI5A 2BC0A 4GAVA 4ZCCA 2IIDA 4YSHA 3AEGA 2WPCA 3UOXA 2XVJA 4Z43A 4UDPA 2V61A 3CGCA 3SXIA 2Q6UA 4EMIA 3ALLA 3K30A 4H4TA 3E1TA 1E1NA 2GRTA 4YTMA 1CC2A 4N9XA 2BK3A 2GQWA 1ZOVA 3L8KA 1RP0A 2FJDA 3LADA 3UTFA 3D8XA 1KNPA 2AQJA 2WDQA 2DKHA 2VRLA 3KU9A 3QFAA 5KMSA 4OPDA 4DSGA 2YLTA 1L9EA 1YKJA 2XLRA 3DJEA 2ZZ0A 3V3NA 3DJJA 2GQFA 2W0HA 3AE1A 4AT2A 1Y56B 4Z25A 3AXBA 4A7AA 2C67A 2GR1A 2YG5A 3DMEA 3VRBA 3AE7A 4NEVA 2QCUA 1XDIA 3CGEA 2WP6A 3AD8B 1BZLA 2A8XA 2ZZCA 4II2A 1KNRA 4ICYA 2FBWA 4U2LA 1H84A 4K5SA 1PHHA 1JNZA 4K22A 4TM1A 3NHOX 2WU5A 1LTXR 3SFDA 1DJQA 1O94A 1SEZA 2GV8A 1B4VA 3DGZA 4JNQA 1QJDA 1QO8A 2E4GA 3NNEA 4BK2A 1DODA 1CJCA 3KKJA 5C2TA 3URHA 1X31B 2V3BA 3AE6A 3T37A 2JAEA 4YTNA 1JRYA 2CVJA 1D4DA 3IHGA 1E39A 2PYXA 5JCLA 4ADWA 1QLBA 2GAHB 3T31A 4CRTA 1NHPA 4GR1A 3VR9A 2YG3A 4YTPA 1TYTA 3T14A 4U8KA 3AE5A 1E7PA 3GWDA 3NLCA 4RSLA 3RP7A 3REDA 2YAUA 3QSSA 1F8RA 1OJDA 5KWFA 1DOEA 1GSNA 2JB1A 5TR3A 1XANA 3UKAA 3I3LA 1OJAA 1ZMCA 1LJ1A 2GAGB 3ALJA 1GESA 3CNTA 2XFPA 1S2YA 3CPJG 1GRGA 2JK6A 2XLSA 5IQ1A 2V5ZA 4FX9A 1FECA 3UKPA 5DBJA 2E1MA 1CC4A 1Y56A 4JNAA 2QA1A 4XWZA 3T2ZA 2GMJA 3UTEA 2CULA 1BF3A 1O5WA 2WDVA 3AE2A 4G6HA 4I58A 1D7LA 4IV9A 4LU6A 4OPLA 3V3OA 4YSYA 1N4WA 3QVPA 3QVRA 3VRDB 5LV9A 1DNCA 4II3A 3ZDNA 1N4UA 3UOVA 1NHSA 1LQTA 3NYEA 4B68A 4EQXA 3H4KA 3AD7B 5FS9A 5EB5A 5BULA 1H81A 2Y6RA 3UCLA 3P9UA 4H2QA 2WHDA 3RP6A 3COXA 1E1MA 4J56A 3SFEA 3SYIA 2BS4A 1TDEA 1Z6LA 1DOBA 4U8PA 2GEWA 4USQA 4FDCB 1PJ7A 1Q1WA 4IVMB 1H82A 3D1CA 5JCNA 4NEWA 1E6EA 1XPQA 1L9CA 1REOA 4C74A 1CHUA 2UZZA 5KVHA 3AE3A 3CPHG 4OPUA 5KRQA 4M52A 4Z26A 4BJZA 3NTAA 1NHQA 2YLRA 2TPRA 3AE9A 3K7QX 4IA5A 3ZYXA 2VZ2A 1S2QA 4YSXA 3GRSA 4EMJA 2RGJA 3G5QA 4G73A 3VRAA 1BGJA 1TDFA 3UOYA 4B67A 4DSHA 1PBCA 2YVGA 4ZN0A 1VDCA 1B8SA 1GNDA 2RGHA 4U2TA 1NEKA 4C3YA 1NHRA 2GMHA 3CNDA 4GDPA 4AOSA 5FS7A 1S3EA 3GMCA 4Y4LA 3FIMB 4K2XA 1PBDA 4APNA 4EM3A 1NG3A 4K7ZA 5CKUA 3CIRA 2C73A 1KSSA 3LZXA 1ZKQA 3SZ0A 2VRMA 4U8IA 4H4SA 2WP9A 3P4RA 4H2PA 4C3XA 4AP1A 5EB4A 2Q7VA 1GOSA 3SX6A 2R9ZA 1GRBA 3H8LA 3OC4A 4H50A 4CBQA 1IUXA 2TMDA 3SZCA 2Q0LA 2WBAA 3EANA 1ZOYA 2HQMA 4Z2UA 4X9MA 1GV4A 1IUTA 2JBVA 2XDOA 1COYA 1BWCA 1PBEA 1YY5A 1FL2A 3SY4A 3T2YA 2XLUA 5HY5A 4X4JA 4UDRA 5J60A 1RYIA 4LIIA 3LJPA 4XXGA 4YKFA 3ATRA 2WPFA 1DJNA 1D7YA 1JRZA 3DJDA 2FJEA 3AB1A 2WS3A 1Q9IA 3HZLA 5HHFA 1CL0A 1LVLA 4Z24A 3NH3X 2YWLA 4P9SA 1GETA 1KF6A 5GSNA 5EBKA 1JRXA 1EL9A 3H8IA 4EQWA 2C70A 1ONFA 5JCIA 1PDHA 1VG0A 1YQ3A 2J3NA 3DK4A 2WOIA 1PJ5A 2Z5YA 3GD4A 2XVEA 3ABVA 1XHCA 4H4XA 3WE0A 5M10A 2X99A 2C65A 1KFYA 2BK5A 3G5RA 3CGBA 2C3CA 3V76A 1GXFA 3DJGX 4NWZA 4CCRA 2WPEA 1CF3A 3CNJA 2XCGA 3EPTA 4BK1A 3AE4A 3BNUA 4U8MA 1CJ4A 2BACA 2X50A 2C7GA 1LQUA 4H4QA 4A79A 4H7UA 3NT6A 4H4YA 1UKVG 1ZP0A 2B7RA 1GALA 4JY3A 3AD9B 4CY8A 2DKIA 2AAQA 5KXJA 2JB3A 1NG4A 2YLXA 3F8PA 3GMBA 2X3NA 3M0OA 1EL8A 3DH9A 2ARDA 4H4UA 3EF6A 3NN6X 5M0ZA 1PS9A 2BCGG 1OJ9A 5JCMA 3LZWA 1ZDLA 3FPZA 2OA1A 1LV0A 4B66A 2PHHA 2BXRA 1PBFA 2EQ9A 2BCPA 3BI4A 1JEHA 3CGDA 2VQBA 1PXBA 2Z5XA 1IJHA 5KMRA 1MO9A 2EQ6A 2WETA 2YG4A 3CNSA 2YVJA 4Z2TA 2Q0KA 1W4XA 4WX1A 2RGOA 3FBSA 2XFUA 3LB8A 1OJTA 3PO7A 4J34A 2BS3A 4JY2A 4RG4A 2GR0A 3GDPA 3AEDA 1JU2A 1VRQB 2XVFA 1H6VA 3R9UA 1K0JA 1JOAA 3SZFA 3QJ4A 2EQ8A 1OJCA 2GH5A 2ZBWA 3AEBA 1TDOA 4HB9A 4OPCA 3SGLA 4BK3A 3UOZA 1M6IA 4EQSA 1M64A 4FK1A 5HXIA 3OZ2A 4CNJA 3NGCX 1YQ4A 5HYMA 1VQWA 2QAEA 2CDUA 3CN8A 4Y4NA 1GREA 4NZHA 2B76A 2VQ7A 1K0IA 3KPFA 4REKA 3P4SA 2BC1A 3FG2P 2XLTA 4I59A 2OALA 4J36A 5KOWA 1O95A 4OCGA 3CPIG 1ZX9A 4OPIA 1PXAA 4RG3A 2YM2A 2RABA 3UKQA 3M13A 4U8JA 4B65A 2V6OA 3QFBA 3F8DA 3P4QA 2C76A 3VR8A 2B9XA 4J2WA 4UP3A 3RP8A 2B9WA 4WCTA 1NAAA 5KVIA 2YR4A 3KD9A 3K7TA 4LA1A 1MOKA 3P1WA 2YLWA 2V60A 1D4EA 3IC9A 4JQ9A 1CJ3A 3UKKA 3F8RA 3NK0X 4O5UA 3C4NA 4YXDA 2OLOA 2H89A 4J57A 4C5OA 4HA6A 2WU2A 2WESA 2XVIA 2GF3A 2WOWA 3II4A 3IF9A 3RNMA 4D03A 2A87A 2BYBA 3KVEA 1H83A 1GT8A 4A99A 1N4VA 2VOUA 5U1OA 4B1BA 3HYVA 1IUWA 1E1LA 4IA6A 5J7XA 3BHKA 3LOVA 4H4VA 2IVDA 4B69A 4YT0A 1S3BA 4UDQA 4CNKA 2R4EA 2R0PA 4PABA 3EAOA 1CC6A 1BGNA 3ICTA 4EIQA 1AOGA 4NTDA 4K8DA 3I6DA 4EQRA 3ALMA 4DGKA 3AEAA 1GTEA 4EIPA 1JNRA 1Q1RA 2XFOA 1RSGA 4AT0A 3QSMA 3T2KA 1CBOA 5GRTA 2GR3A 2R4JA 3M12A 4H2NA 2X8CA 4JN9A 3FMWA 4A65A 4ECHA 4BV6A 2O9ZA 3UP5A 2A89A 3GYXA 2BS2A 2R0CA 3ATQA 4TLXA 1ZY8A 2BRAA 3GRTA 4TM0A 3SZWA 4K5RA 4A5LA 4AOXA 4U8LA 3T0KA 1B5QA 4C77A 1GTHA 4G6GA 2C72A 1D4CA 5IQ4A 1F6MA 3UTGA 3UP4A 3AYJA 2FJAA 4TLZA 5BUKA 2IVEA 2R0GA 1F8SA 3ICRA 2R46A 1ELIA 2VVLA 2WDRA 1FEAA 2YLSA 3QSEA 3S5WA 2APGA 4MJWA 4A6NB 5KOXA 1NENA 2ZZBA 2YVFA 1ZK7A 1F8WA 2OAMA 2WQYA 3S61A 3CMMA 2CFYA 4YSZA 5L46A 5FS6A 4CY6A 3AEEA 3NYCA 3C96A 1H7WA 2BXSA 2JKCA 1H86A 1VG9A 1PJ6A 2BABA 3ISHA 2BRYA 3KA7A 2E5VA 4BURA 1L9DA 1Y0PA 2B9YA 3K7MX 4YWOA 3AYIA 1K4QA 1P2EA 3B6DA 3L1RA 1GPEA 3CNPA 2VVLG 1P2HA 2V3AA 3GDNA 2B7SA 4EM4A 1TDKA 1IUVA 2EQ7A 3DA1A 3G5SA 4H4WA 4ZCDA 1DOCA 3NK1X 1MXTA 3PS9A 4OPGA 2XVHA 1FEBA 4EMWA 4G74A 3ICSA 1CJ2A 1EL7A 4GRTA 1EL5A 1TYPA 2YG7A 5ER0A 2YQUA 4USRA 3DGHA 3GYIA 3SQPA 3ITJA 1GEUA 2ACZA 3NYFA 4GF7A 4E0VA 3O0HA 1PBBA 2NVKX 2XFQA 4OVIA 3UKHA 5JCKA 4NNJA 4FK1C 2I0ZA 4D04A 4BJYA 1TDNA 3GWFA 4IVOB 1GRAA 3NTDA 1IUSA 4Z2RA 1FOHA 2YR6A 1ZMDA 3AECA 4OPTA 4A6NA 2OLNA 1E1KA 3AEFA 4J31A 1KSUA 4XWRA 5FMHA 5KMPA 3NRNA 3DK8A 3Q6JA 3AE8A 4KX6A 4X9NA 4Y4MA 2GR2A 4YKGA 4H4PA 3GSIA 3PVCA 3SM8A 2C64A 4J33A 4DNAA 2YM1A 1V59A 5FS8A 1B37A 4TM4A 5CQFA 2XYOA 3KPKA 5IPYA 3B3RA 3NIXA 2GB0A 3UTHA 2FJBA 5U63A 4U2SA 3ADAB 4B63A 2F5ZA 3JSKA 5BRTA 2WEUA 3AYLA 1BKWA 5C3JA 3C4AA 2WOVA 3IWAA 4CCQA 4NTCA 1F3PA 4GAPA 1H7XA 3BHFA 2X8HA 4GUVA 2C75A 1EBDA 2X8GA 2YG6A 4AP3A 5KMQA 1HYUA 2VVMA 4KPRA 4GCMA 4Z44A 1L0VA 4JDRA 1YQZA 3BI2A 5EOWA
chains in the Genus database with same CATH topology
3NG7X 2NPXA 5KNLA 3CTYA 1N1PA 4GDEA 4H2RA 3UKLA 2JB2A 1PN0A 4A9WA 4U8NA 2BA9A 3HYWA 3DK9A 1LPFA 3P4PA 3LXDA 1NDAA 2C4CA 4TM3A 1GERA 1TRBA 1FCDA 1KDGA 3RHAA 3VQRA 1PXCA 1DXLA 4NTEA 4PAAA 5BVAA 2WP5A 2GVCA 3NKSA 3HYXA 3GYJA 4U8OA 2R45A 1D5TA 3Q9TA 1GRHA 3UKFA 3GD3A 2C3DA 2QA2A 1IUUA 4H4RA 1NPXA 3BNMA 2H88A 2XFNA 2Y6QA 3AWIA 2C66A 3IHMA 3NN0X 4B64A 2YLZA 1GRTA 2AR8A 2YR5A 2XLPA 5U25A 3NK2X 4G9KA 4O5QA 1GRFA 3KLJA 4H4ZA 1K0LA 2BK4A 3BI5A 2BC0A 4GAVA 4ZCCA 2IIDA 4YSHA 3AEGA 2WPCA 3UOXA 2XVJA 4Z43A 4UDPA 2V61A 3CGCA 3SXIA 2Q6UA 4EMIA 3ALLA 3K30A 4H4TA 3E1TA 1E1NA 2GRTA 4YTMA 1CC2A 4N9XA 2BK3A 2GQWA 1ZOVA 3L8KA 1RP0A 2FJDA 3LADA 3UTFA 3D8XA 1KNPA 2AQJA 2WDQA 2DKHA 2VRLA 3KU9A 3QFAA 5KMSA 4OPDA 4DSGA 2YLTA 1L9EA 1YKJA 2XLRA 3DJEA 2ZZ0A 3V3NA 3DJJA 2GQFA 2W0HA 3AE1A 4AT2A 1Y56B 4Z25A 3AXBA 4A7AA 2C67A 2GR1A 2YG5A 3DMEA 3VRBA 3AE7A 4NEVA 2QCUA 1XDIA 3CGEA 2WP6A 3AD8B 1BZLA 2A8XA 2ZZCA 4II2A 1KNRA 4ICYA 2FBWA 4U2LA 1H84A 4K5SA 1PHHA 1JNZA 4K22A 4TM1A 3NHOX 2WU5A 1LTXR 3SFDA 1DJQA 1O94A 1SEZA 2GV8A 1B4VA 3DGZA 4JNQA 1QJDA 1QO8A 2E4GA 3NNEA 4BK2A 1DODA 1CJCA 3KKJA 5C2TA 3URHA 1X31B 2V3BA 3AE6A 3T37A 2JAEA 4YTNA 1JRYA 2CVJA 1D4DA 3IHGA 1E39A 2PYXA 5JCLA 4ADWA 1QLBA 2GAHB 3T31A 4CRTA 1NHPA 4GR1A 3VR9A 2YG3A 4YTPA 1TYTA 3T14A 4U8KA 3AE5A 1E7PA 3GWDA 3NLCA 4RSLA 3RP7A 3REDA 2YAUA 3QSSA 1F8RA 1OJDA 5KWFA 1DOEA 1GSNA 2JB1A 5TR3A 1XANA 3UKAA 3I3LA 1OJAA 1ZMCA 1LJ1A 2GAGB 3ALJA 1GESA 3CNTA 2XFPA 1S2YA 3CPJG 1GRGA 2JK6A 2XLSA 5IQ1A 2V5ZA 4FX9A 1FECA 3UKPA 5DBJA 2E1MA 1CC4A 1Y56A 4JNAA 2QA1A 4XWZA 3T2ZA 2GMJA 3UTEA 2CULA 1BF3A 1O5WA 2WDVA 3AE2A 4G6HA 4I58A 1D7LA 4IV9A 4LU6A 4OPLA 3V3OA 4YSYA 1N4WA 3QVPA 3QVRA 3VRDB 5LV9A 1DNCA 4II3A 3ZDNA 1N4UA 3UOVA 1NHSA 1LQTA 3NYEA 4B68A 4EQXA 3H4KA 3AD7B 5FS9A 5EB5A 5BULA 1H81A 2Y6RA 3UCLA 3P9UA 4H2QA 2WHDA 3RP6A 3COXA 1E1MA 4J56A 3SFEA 3SYIA 2BS4A 1TDEA 1Z6LA 1DOBA 4U8PA 2GEWA 4USQA 4FDCB 1PJ7A 1Q1WA 4IVMB 1H82A 3D1CA 5JCNA 4NEWA 1E6EA 1XPQA 1L9CA 1REOA 4C74A 1CHUA 2UZZA 5KVHA 3AE3A 3CPHG 4OPUA 5KRQA 4M52A 4Z26A 4BJZA 3NTAA 1NHQA 2YLRA 2TPRA 3AE9A 3K7QX 4IA5A 3ZYXA 2VZ2A 1S2QA 4YSXA 3GRSA 4EMJA 2RGJA 3G5QA 4G73A 3VRAA 1BGJA 1TDFA 3UOYA 4B67A 4DSHA 1PBCA 2YVGA 4ZN0A 1VDCA 1B8SA 1GNDA 2RGHA 4U2TA 1NEKA 4C3YA 1NHRA 2GMHA 3CNDA 4GDPA 4AOSA 5FS7A 1S3EA 3GMCA 4Y4LA 3FIMB 4K2XA 1PBDA 4APNA 4EM3A 1NG3A 4K7ZA 5CKUA 3CIRA 2C73A 1KSSA 3LZXA 1ZKQA 3SZ0A 2VRMA 4U8IA 4H4SA 2WP9A 3P4RA 4H2PA 4C3XA 4AP1A 5EB4A 2Q7VA 1GOSA 3SX6A 2R9ZA 1GRBA 3H8LA 3OC4A 4H50A 4CBQA 1IUXA 2TMDA 3SZCA 2Q0LA 2WBAA 3EANA 1ZOYA 2HQMA 4Z2UA 4X9MA 1GV4A 1IUTA 2JBVA 2XDOA 1COYA 1BWCA 1PBEA 1YY5A 1FL2A 3SY4A 3T2YA 2XLUA 5HY5A 4X4JA 4UDRA 5J60A 1RYIA 4LIIA 3LJPA 4XXGA 4YKFA 3ATRA 2WPFA 1DJNA 1D7YA 1JRZA 3DJDA 2FJEA 3AB1A 2WS3A 1Q9IA 3HZLA 5HHFA 1CL0A 1LVLA 4Z24A 3NH3X 2YWLA 4P9SA 1GETA 1KF6A 5GSNA 5EBKA 1JRXA 1EL9A 3H8IA 4EQWA 2C70A 1ONFA 5JCIA 1PDHA 1VG0A 1YQ3A 2J3NA 3DK4A 2WOIA 1PJ5A 2Z5YA 3GD4A 2XVEA 3ABVA 1XHCA 4H4XA 3WE0A 5M10A 2X99A 2C65A 1KFYA 2BK5A 3G5RA 3CGBA 2C3CA 3V76A 1GXFA 3DJGX 4NWZA 4CCRA 2WPEA 1CF3A 3CNJA 2XCGA 3EPTA 4BK1A 3AE4A 3BNUA 4U8MA 1CJ4A 2BACA 2X50A 2C7GA 1LQUA 4H4QA 4A79A 4H7UA 3NT6A 4H4YA 1UKVG 1ZP0A 2B7RA 1GALA 4JY3A 3AD9B 4CY8A 2DKIA 2AAQA 5KXJA 2JB3A 1NG4A 2YLXA 3F8PA 3GMBA 2X3NA 3M0OA 1EL8A 3DH9A 2ARDA 4H4UA 3EF6A 3NN6X 5M0ZA 1PS9A 2BCGG 1OJ9A 5JCMA 3LZWA 1ZDLA 3FPZA 2OA1A 1LV0A 4B66A 2PHHA 2BXRA 1PBFA 2EQ9A 2BCPA 3BI4A 1JEHA 3CGDA 2VQBA 1PXBA 2Z5XA 1IJHA 5KMRA 1MO9A 2EQ6A 2WETA 2YG4A 3CNSA 2YVJA 4Z2TA 2Q0KA 1W4XA 4WX1A 2RGOA 3FBSA 2XFUA 3LB8A 1OJTA 3PO7A 4J34A 2BS3A 4JY2A 4RG4A 2GR0A 3GDPA 3AEDA 1JU2A 1VRQB 2XVFA 1H6VA 3R9UA 1K0JA 1JOAA 3SZFA 3QJ4A 2EQ8A 1OJCA 2GH5A 2ZBWA 3AEBA 1TDOA 4HB9A 4OPCA 3SGLA 4BK3A 3UOZA 1M6IA 4EQSA 1M64A 4FK1A 5HXIA 3OZ2A 4CNJA 3NGCX 1YQ4A 5HYMA 1VQWA 2QAEA 2CDUA 3CN8A 4Y4NA 1GREA 4NZHA 2B76A 2VQ7A 1K0IA 3KPFA 4REKA 3P4SA 2BC1A 3FG2P 2XLTA 4I59A 2OALA 4J36A 5KOWA 1O95A 4OCGA 3CPIG 1ZX9A 4OPIA 1PXAA 4RG3A 2YM2A 2RABA 3UKQA 3M13A 4U8JA 4B65A 2V6OA 3QFBA 3F8DA 3P4QA 2C76A 3VR8A 2B9XA 4J2WA 4UP3A 3RP8A 2B9WA 4WCTA 1NAAA 5KVIA 2YR4A 3KD9A 3K7TA 4LA1A 1MOKA 3P1WA 2YLWA 2V60A 1D4EA 3IC9A 4JQ9A 1CJ3A 3UKKA 3F8RA 3NK0X 4O5UA 3C4NA 4YXDA 2OLOA 2H89A 4J57A 4C5OA 4HA6A 2WU2A 2WESA 2XVIA 2GF3A 2WOWA 3II4A 3IF9A 3RNMA 4D03A 2A87A 2BYBA 3KVEA 1H83A 1GT8A 4A99A 1N4VA 2VOUA 5U1OA 4B1BA 3HYVA 1IUWA 1E1LA 4IA6A 5J7XA 3BHKA 3LOVA 4H4VA 2IVDA 4B69A 4YT0A 1S3BA 4UDQA 4CNKA 2R4EA 2R0PA 4PABA 3EAOA 1CC6A 1BGNA 3ICTA 4EIQA 1AOGA 4NTDA 4K8DA 3I6DA 4EQRA 3ALMA 4DGKA 3AEAA 1GTEA 4EIPA 1JNRA 1Q1RA 2XFOA 1RSGA 4AT0A 3QSMA 3T2KA 1CBOA 5GRTA 2GR3A 2R4JA 3M12A 4H2NA 2X8CA 4JN9A 3FMWA 4A65A 4ECHA 4BV6A 2O9ZA 3UP5A 2A89A 3GYXA 2BS2A 2R0CA 3ATQA 4TLXA 1ZY8A 2BRAA 3GRTA 4TM0A 3SZWA 4K5RA 4A5LA 4AOXA 4U8LA 3T0KA 1B5QA 4C77A 1GTHA 4G6GA 2C72A 1D4CA 5IQ4A 1F6MA 3UTGA 3UP4A 3AYJA 2FJAA 4TLZA 5BUKA 2IVEA 2R0GA 1F8SA 3ICRA 2R46A 1ELIA 2VVLA 2WDRA 1FEAA 2YLSA 3QSEA 3S5WA 2APGA 4MJWA 4A6NB 5KOXA 1NENA 2ZZBA 2YVFA 1ZK7A 1F8WA 2OAMA 2WQYA 3S61A 3CMMA 2CFYA 4YSZA 5L46A 5FS6A 4CY6A 3AEEA 3NYCA 3C96A 1H7WA 2BXSA 2JKCA 1H86A 1VG9A 1PJ6A 2BABA 3ISHA 2BRYA 3KA7A 2E5VA 4BURA 1L9DA 1Y0PA 2B9YA 3K7MX 4YWOA 3AYIA 1K4QA 1P2EA 3B6DA 3L1RA 1GPEA 3CNPA 2VVLG 1P2HA 2V3AA 3GDNA 2B7SA 4EM4A 1TDKA 1IUVA 2EQ7A 3DA1A 3G5SA 4H4WA 4ZCDA 1DOCA 3NK1X 1MXTA 3PS9A 4OPGA 2XVHA 1FEBA 4EMWA 4G74A 3ICSA 1CJ2A 1EL7A 4GRTA 1EL5A 1TYPA 2YG7A 5ER0A 2YQUA 4USRA 3DGHA 3GYIA 3SQPA 3ITJA 1GEUA 2ACZA 3NYFA 4GF7A 4E0VA 3O0HA 1PBBA 2NVKX 2XFQA 4OVIA 3UKHA 5JCKA 4NNJA 4FK1C 2I0ZA 4D04A 4BJYA 1TDNA 3GWFA 4IVOB 1GRAA 3NTDA 1IUSA 4Z2RA 1FOHA 2YR6A 1ZMDA 3AECA 4OPTA 4A6NA 2OLNA 1E1KA 3AEFA 4J31A 1KSUA 4XWRA 5FMHA 5KMPA 3NRNA 3DK8A 3Q6JA 3AE8A 4KX6A 4X9NA 4Y4MA 2GR2A 4YKGA 4H4PA 3GSIA 3PVCA 3SM8A 2C64A 4J33A 4DNAA 2YM1A 1V59A 5FS8A 1B37A 4TM4A 5CQFA 2XYOA 3KPKA 5IPYA 3B3RA 3NIXA 2GB0A 3UTHA 2FJBA 5U63A 4U2SA 3ADAB 4B63A 2F5ZA 3JSKA 5BRTA 2WEUA 3AYLA 1BKWA 5C3JA 3C4AA 2WOVA 3IWAA 4CCQA 4NTCA 1F3PA 4GAPA 1H7XA 3BHFA 2X8HA 4GUVA 2C75A 1EBDA 2X8GA 2YG6A 4AP3A 5KMQA 1HYUA 2VVMA 4KPRA 4GCMA 4Z44A 1L0VA 4JDRA 1YQZA 3BI2A 5EOWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NG7 X;  2NPX A;  3CTY A;  1N1P A;  4GDE A;  4H2R A;  3UKL A;  2JB2 A;  1PN0 A;  4A9W A;  4U8N A;  2BA9 A;  3DK9 A;  1LPF A;  3P4P A;  3LXD A;  1NDA A;  4TM3 A;  1GER A;  1TRB A;  1FCD A;  1KDG A;  3RHA A;  3VQR A;  1PXC A;  1DXL A;  4NTE A;  4PAA A;  5BVA A;  2WP5 A;  2GVC A;  3NKS A;  3GYJ A;  4U8O A;  2R45 A;  1D5T A;  3Q9T A;  1GRH A;  3UKF A;  3GD3 A;  2C3D A;  2QA2 A;  1IUU A;  4H4R A;  1NPX A;  3BNM A;  2H88 A;  2XFN A;  2Y6Q A;  3AWI A;  2C66 A;  3IHM A;  3NN0 X;  4B64 A;  2YLZ A;  1GRT A;  2AR8 A;  2YR5 A;  2XLP A;  5U25 A;  3NK2 X;  4O5Q A;  1GRF A;  3KLJ A;  4H4Z A;  1K0L A;  2BK4 A;  3BI5 A;  2BC0 A;  4ZCC A;  4YSH A;  2IID A;  4Z43 A;  3AEG A;  2WPC A;  3UOX A;  2XVJ A;  4UDP A;  2V61 A;  3CGC A;  2Q6U A;  4EMI A;  3ALL A;  3K30 A;  4H4T A;  3E1T A;  1E1N A;  2GRT A;  4YTM A;  1CC2 A;  4N9X A;  2BK3 A;  2GQW A;  1ZOV A;  3L8K A;  1RP0 A;  2FJD A;  3LAD A;  3UTF A;  3D8X A;  1KNP A;  2AQJ A;  2WDQ A;  2DKH A;  2VRL A;  3KU9 A;  3QFA A;  4OPD A;  4DSG A;  2YLT A;  1L9E A;  1YKJ A;  2XLR A;  3DJE A;  2ZZ0 A;  3V3N A;  3DJJ A;  2GQF A;  2W0H A;  3AE1 A;  4AT2 A;  1Y56 B;  4Z25 A;  3AXB A;  4A7A A;  2C67 A;  2GR1 A;  2YG5 A;  3DME A;  3VRB A;  3AE7 A;  4NEV A;  2QCU A;  1XDI A;  3CGE A;  2WP6 A;  3AD8 B;  1BZL A;  2A8X A;  2ZZC A;  1KNR A;  4ICY A;  2FBW A;  4U2L A;  1H84 A;  4K5S A;  1PHH A;  1JNZ A;  4K22 A;  4TM1 A;  3NHO X;  2WU5 A;  1LTX R;  3SFD A;  1DJQ A;  1O94 A;  1SEZ A;  2GV8 A;  1B4V A;  3DGZ A;  4JNQ A;  1QJD A;  1QO8 A;  2E4G A;  3NNE A;  4BK2 A;  1DOD A;  1CJC A;  3KKJ A;  5C2T A;  3URH A;  1X31 B;  2V3B A;  3AE6 A;  3T37 A;  2JAE A;  4YTN A;  1JRY A;  2CVJ A;  1D4D A;  3IHG A;  1E39 A;  2PYX A;  5JCL A;  4ADW A;  1QLB A;  2GAH B;  4CRT A;  1NHP A;  4GR1 A;  3VR9 A;  2YG3 A;  4YTP A;  1TYT A;  4U8K A;  3AE5 A;  1E7P A;  3GWD A;  3NLC A;  4RSL A;  3RP7 A;  3RED A;  2YAU A;  3QSS A;  1F8R A;  1OJD A;  5KWF A;  1DOE A;  1GSN A;  2JB1 A;  5TR3 A;  1XAN A;  3UKA A;  3I3L A;  1OJA A;  1ZMC A;  1LJ1 A;  2GAG B;  3ALJ A;  1GES A;  3CNT A;  2XFP A;  1S2Y A;  3CPJ G;  1GRG A;  2JK6 A;  2XLS A;  5IQ1 A;  2V5Z A;  4FX9 A;  1FEC A;  3UKP A;  5DBJ A;  2E1M A;  1CC4 A;  1Y56 A;  4JNA A;  2QA1 A;  4XWZ A;  2GMJ A;  3UTE A;  2CUL A;  1BF3 A;  1O5W A;  2WDV A;  3AE2 A;  4LU6 A;  4I58 A;  1D7L A;  4IV9 A;  4OPL A;  3V3O A;  4YSY A;  1N4W A;  3QVP A;  3QVR A;  3VRD B;  5LV9 A;  1DNC A;  3ZDN A;  1N4U A;  3UOV A;  1NHS A;  1LQT A;  3NYE A;  4B68 A;  4EQX A;  3H4K A;  3AD7 B;  5FS9 A;  5EB5 A;  5BUL A;  1H81 A;  2Y6R A;  3UCL A;  3P9U A;  4H2Q A;  2WHD A;  3RP6 A;  3COX A;  1E1M A;  4J56 A;  3SFE A;  2BS4 A;  1TDE A;  1Z6L A;  1DOB A;  4U8P A;  2GEW A;  4USQ A;  4FDC B;  1PJ7 A;  1Q1W A;  4IVM B;  1H82 A;  3D1C A;  5JCN A;  4NEW A;  1E6E A;  1XPQ A;  1L9C A;  1REO A;  4C74 A;  1CHU A;  2UZZ A;  5KVH A;  3AE3 A;  3CPH G;  4OPU A;  5KRQ A;  4M52 A;  4Z26 A;  4BJZ A;  3NTA A;  1NHQ A;  2YLR A;  2TPR A;  3AE9 A;  3K7Q X;  4IA5 A;  3ZYX A;  2VZ2 A;  1S2Q A;  4YSX A;  3GRS A;  4EMJ A;  2RGJ A;  3G5Q A;  3VRA A;  1BGJ A;  1TDF A;  3UOY A;  4B67 A;  4DSH A;  1PBC A;  2YVG A;  4ZN0 A;  1VDC A;  1B8S A;  1GND A;  2RGH A;  4U2T A;  1NEK A;  4C3Y A;  1NHR A;  2GMH A;  3CND A;  4GDP A;  4AOS A;  5FS7 A;  1S3E A;  3GMC A;  4Y4L A;  3FIM B;  4K2X A;  1PBD A;  4APN A;  4EM3 A;  1NG3 A;  4K7Z A;  5CKU A;  3CIR A;  2C73 A;  1KSS A;  3LZX A;  1ZKQ A;  2VRM A;  4U8I A;  4H4S A;  2WP9 A;  3P4R A;  4H2P A;  4C3X A;  4AP1 A;  5EB4 A;  2Q7V A;  1GOS A;  2R9Z A;  1GRB A;  3H8L A;  3OC4 A;  4H50 A;  4CBQ A;  1IUX A;  2TMD A;  2Q0L A;  2WBA A;  3EAN A;  1ZOY A;  2HQM A;  4Z2U A;  4X9M A;  1GV4 A;  1IUT A;  2JBV A;  2XDO A;  1COY A;  1BWC A;  1PBE A;  1YY5 A;  1FL2 A;  2XLU A;  5HY5 A;  4X4J A;  4UDR A;  5J60 A;  1RYI A;  4LII A;  3LJP A;  4XXG A;  4YKF A;  3ATR A;  2WPF A;  1DJN A;  1D7Y A;  1JRZ A;  3DJD A;  2FJE A;  3AB1 A;  2WS3 A;  1Q9I A;  3HZL A;  5HHF A;  1CL0 A;  1LVL A;  4Z24 A;  3NH3 X;  2YWL A;  4P9S A;  1GET A;  1KF6 A;  5GSN A;  5EBK A;  1JRX A;  1EL9 A;  3H8I A;  4EQW A;  2C70 A;  1ONF A;  5JCI A;  1PDH A;  1VG0 A;  1YQ3 A;  2J3N A;  3DK4 A;  2WOI A;  1PJ5 A;  2Z5Y A;  3GD4 A;  2XVE A;  3ABV A;  1XHC A;  4H4X A;  3WE0 A;  5M10 A;  2X99 A;  2C65 A;  1KFY A;  2BK5 A;  3G5R A;  3CGB A;  2C3C A;  3V76 A;  1GXF A;  3DJG X;  4CCR A;  2WPE A;  1CF3 A;  3CNJ A;  2XCG A;  3EPT A;  4BK1 A;  3AE4 A;  3BNU A;  4U8M A;  1CJ4 A;  2BAC A;  2X50 A;  2C7G A;  1LQU A;  4H4Q A;  4A79 A;  4H7U A;  3NT6 A;  4H4Y A;  1UKV G;  1ZP0 A;  2B7R A;  1GAL A;  4JY3 A;  3AD9 B;  4CY8 A;  2DKI A;  2AAQ A;  5KXJ A;  2JB3 A;  1NG4 A;  2YLX A;  3F8P A;  3GMB A;  2X3N A;  3M0O A;  1EL8 A;  3DH9 A;  2ARD A;  4H4U A;  3EF6 A;  3NN6 X;  5M0Z A;  1PS9 A;  2BCG G;  1OJ9 A;  5JCM A;  3LZW A;  1ZDL A;  3FPZ A;  2OA1 A;  1LV0 A;  4B66 A;  2PHH A;  2BXR A;  1PBF A;  2EQ9 A;  2BCP A;  3BI4 A;  1JEH A;  3CGD A;  2VQB A;  1PXB A;  2Z5X A;  1IJH A;  1MO9 A;  2EQ6 A;  2WET A;  2YG4 A;  3CNS A;  2YVJ A;  4Z2T A;  2Q0K A;  1W4X A;  4WX1 A;  2RGO A;  3FBS A;  2XFU A;  3LB8 A;  1OJT A;  3PO7 A;  4J34 A;  2BS3 A;  4JY2 A;  4RG4 A;  2GR0 A;  3GDP A;  3AED A;  1JU2 A;  1VRQ B;  2XVF A;  1H6V A;  3R9U A;  1K0J A;  1JOA A;  3QJ4 A;  2EQ8 A;  1OJC A;  2GH5 A;  2ZBW A;  3AEB A;  1TDO A;  4HB9 A;  4OPC A;  3SGL A;  4BK3 A;  3UOZ A;  1M6I A;  4EQS A;  1M64 A;  4FK1 A;  5HXI A;  3OZ2 A;  4CNJ A;  3NGC X;  1YQ4 A;  5HYM A;  1VQW A;  2QAE A;  2CDU A;  3CN8 A;  4Y4N A;  1GRE A;  4NZH A;  2B76 A;  2VQ7 A;  1K0I A;  3KPF A;  4REK A;  3P4S A;  2BC1 A;  3FG2 P;  2XLT A;  4I59 A;  2OAL A;  4J36 A;  5KOW A;  1O95 A;  4OCG A;  3CPI G;  1ZX9 A;  4OPI A;  1PXA A;  4RG3 A;  2YM2 A;  2RAB A;  3UKQ A;  3M13 A;  4U8J A;  4B65 A;  2V6O A;  3QFB A;  3F8D A;  3P4Q A;  2C76 A;  3VR8 A;  2B9X A;  4J2W A;  4UP3 A;  3RP8 A;  2B9W A;  4WCT A;  1NAA A;  5KVI A;  2YR4 A;  3KD9 A;  3K7T A;  4LA1 A;  1MOK A;  3P1W A;  2YLW A;  2V60 A;  1D4E A;  3IC9 A;  4JQ9 A;  1CJ3 A;  3UKK A;  3F8R A;  3NK0 X;  4O5U A;  3C4N A;  4YXD A;  2OLO A;  2H89 A;  4J57 A;  4C5O A;  4HA6 A;  2WU2 A;  2WES A;  2XVI A;  2GF3 A;  2WOW A;  3II4 A;  3IF9 A;  3RNM A;  4D03 A;  2A87 A;  2BYB A;  3KVE A;  1H83 A;  1GT8 A;  4A99 A;  1N4V A;  2VOU A;  5U1O A;  4B1B A;  4IA6 A;  1IUW A;  1E1L A;  5J7X A;  3BHK A;  3LOV A;  4H4V A;  2IVD A;  4B69 A;  4YT0 A;  1S3B A;  4UDQ A;  4CNK A;  2R4E A;  2R0P A;  4PAB A;  3EAO A;  1CC6 A;  1BGN A;  3ICT A;  4EIQ A;  1AOG A;  4NTD A;  4K8D A;  3I6D A;  4EQR A;  3ALM A;  4DGK A;  3AEA A;  1GTE A;  4EIP A;  1JNR A;  1Q1R A;  2XFO A;  1RSG A;  4AT0 A;  3QSM A;  1CBO A;  5GRT A;  2GR3 A;  2R4J A;  3M12 A;  4H2N A;  2X8C A;  4JN9 A;  3FMW A;  4A65 A;  4ECH A;  4BV6 A;  2O9Z A;  3UP5 A;  2A89 A;  2BS2 A;  2R0C A;  3ATQ A;  4TLX A;  1ZY8 A;  3GRT A;  4TM0 A;  4K5R A;  4A5L A;  4AOX A;  4U8L A;  1B5Q A;  4C77 A;  1GTH A;  2C72 A;  1D4C A;  5IQ4 A;  1F6M A;  3UTG A;  3UP4 A;  3AYJ A;  2FJA A;  4TLZ A;  5BUK A;  2IVE A;  2R0G A;  1F8S A;  3ICR A;  2R46 A;  1ELI A;  2VVL A;  2WDR A;  1FEA A;  2YLS A;  3QSE A;  3S5W A;  2APG A;  4MJW A;  4A6N B;  5KOX A;  1NEN A;  2ZZB A;  2YVF A;  1ZK7 A;  1F8W A;  2OAM A;  2WQY A;  3S61 A;  2CFY A;  4YSZ A;  5L46 A;  5FS6 A;  4CY6 A;  3AEE A;  3NYC A;  3C96 A;  1H7W A;  2BXS A;  2JKC A;  1H86 A;  1VG9 A;  1PJ6 A;  2BAB A;  3ISH A;  3KA7 A;  2E5V A;  4BUR A;  1L9D A;  1Y0P A;  2B9Y A;  3K7M X;  4YWO A;  3AYI A;  1K4Q A;  1P2E A;  3B6D A;  3L1R A;  1GPE A;  3CNP A;  2VVL G;  1P2H A;  2V3A A;  3GDN A;  2B7S A;  4EM4 A;  1TDK A;  1IUV A;  2EQ7 A;  3DA1 A;  3G5S A;  4H4W A;  4ZCD A;  1DOC A;  3NK1 X;  1MXT A;  3PS9 A;  4OPG A;  2XVH A;  1FEB A;  4EMW A;  3ICS A;  1CJ2 A;  1EL7 A;  4GRT A;  1EL5 A;  1TYP A;  2YG7 A;  5ER0 A;  2YQU A;  4USR A;  3DGH A;  3GYI A;  3SQP A;  3ITJ A;  1GEU A;  2ACZ A;  3NYF A;  4GF7 A;  4E0V A;  3O0H A;  1PBB A;  2NVK X;  2XFQ A;  4OVI A;  3UKH A;  5JCK A;  4FK1 C;  2I0Z A;  4D04 A;  4BJY A;  1TDN A;  3GWF A;  4IVO B;  1GRA A;  3NTD A;  1IUS A;  4Z2R A;  1FOH A;  2YR6 A;  1ZMD A;  3AEC A;  4OPT A;  4A6N A;  2OLN A;  1E1K A;  3AEF A;  4J31 A;  1KSU A;  4XWR A;  5FMH A;  3NRN A;  3DK8 A;  3Q6J A;  3AE8 A;  4KX6 A;  4X9N A;  4Y4M A;  2GR2 A;  4YKG A;  4H4P A;  3GSI A;  3PVC A;  3SM8 A;  2C64 A;  4J33 A;  4DNA A;  2YM1 A;  1V59 A;  5FS8 A;  1B37 A;  4TM4 A;  5CQF A;  2XYO A;  5IPY A;  3B3R A;  3NIX A;  2GB0 A;  3UTH A;  2FJB A;  5U63 A;  4U2S A;  3ADA B;  4B63 A;  2F5Z A;  3JSK A;  5BRT A;  2WEU A;  3AYL A;  1BKW A;  5C3J A;  3C4A A;  2WOV A;  3IWA A;  4CCQ A;  4NTC A;  1F3P A;  1H7X A;  3BHF A;  2X8H A;  4GUV A;  2C75 A;  1EBD A;  2X8G A;  2YG6 A;  4AP3 A;  1HYU A;  2VVM A;  4KPR A;  4GCM A;  4Z44 A;  1L0V A;  4JDR A;  1YQZ A;  3BI2 A;  5EOW A; 
#chains in the Genus database with same CATH topology
 3NG7 X;  2NPX A;  5KNL A;  3CTY A;  1N1P A;  4GDE A;  4H2R A;  3UKL A;  2JB2 A;  1PN0 A;  4A9W A;  4U8N A;  2BA9 A;  3HYW A;  3DK9 A;  1LPF A;  3P4P A;  3LXD A;  1NDA A;  2C4C A;  4TM3 A;  1GER A;  1TRB A;  1FCD A;  1KDG A;  3RHA A;  3VQR A;  1PXC A;  1DXL A;  4NTE A;  4PAA A;  5BVA A;  2WP5 A;  2GVC A;  3NKS A;  3HYX A;  3GYJ A;  4U8O A;  2R45 A;  1D5T A;  3Q9T A;  1GRH A;  3UKF A;  3GD3 A;  2C3D A;  2QA2 A;  1IUU A;  4H4R A;  1NPX A;  3BNM A;  2H88 A;  2XFN A;  2Y6Q A;  3AWI A;  2C66 A;  3IHM A;  3NN0 X;  4B64 A;  2YLZ A;  1GRT A;  2AR8 A;  2YR5 A;  2XLP A;  5U25 A;  3NK2 X;  4G9K A;  4O5Q A;  1GRF A;  3KLJ A;  4H4Z A;  1K0L A;  2BK4 A;  3BI5 A;  2BC0 A;  4GAV A;  4ZCC A;  2IID A;  4YSH A;  3AEG A;  2WPC A;  3UOX A;  2XVJ A;  4Z43 A;  4UDP A;  2V61 A;  3CGC A;  3SXI A;  2Q6U A;  4EMI A;  3ALL A;  3K30 A;  4H4T A;  3E1T A;  1E1N A;  2GRT A;  4YTM A;  1CC2 A;  4N9X A;  2BK3 A;  2GQW A;  1ZOV A;  3L8K A;  1RP0 A;  2FJD A;  3LAD A;  3UTF A;  3D8X A;  1KNP A;  2AQJ A;  2WDQ A;  2DKH A;  2VRL A;  3KU9 A;  3QFA A;  5KMS A;  4OPD A;  4DSG A;  2YLT A;  1L9E A;  1YKJ A;  2XLR A;  3DJE A;  2ZZ0 A;  3V3N A;  3DJJ A;  2GQF A;  2W0H A;  3AE1 A;  4AT2 A;  1Y56 B;  4Z25 A;  3AXB A;  4A7A A;  2C67 A;  2GR1 A;  2YG5 A;  3DME A;  3VRB A;  3AE7 A;  4NEV A;  2QCU A;  1XDI A;  3CGE A;  2WP6 A;  3AD8 B;  1BZL A;  2A8X A;  2ZZC A;  4II2 A;  1KNR A;  4ICY A;  2FBW A;  4U2L A;  1H84 A;  4K5S A;  1PHH A;  1JNZ A;  4K22 A;  4TM1 A;  3NHO X;  2WU5 A;  1LTX R;  3SFD A;  1DJQ A;  1O94 A;  1SEZ A;  2GV8 A;  1B4V A;  3DGZ A;  4JNQ A;  1QJD A;  1QO8 A;  2E4G A;  3NNE A;  4BK2 A;  1DOD A;  1CJC A;  3KKJ A;  5C2T A;  3URH A;  1X31 B;  2V3B A;  3AE6 A;  3T37 A;  2JAE A;  4YTN A;  1JRY A;  2CVJ A;  1D4D A;  3IHG A;  1E39 A;  2PYX A;  5JCL A;  4ADW A;  1QLB A;  2GAH B;  3T31 A;  4CRT A;  1NHP A;  4GR1 A;  3VR9 A;  2YG3 A;  4YTP A;  1TYT A;  3T14 A;  4U8K A;  3AE5 A;  1E7P A;  3GWD A;  3NLC A;  4RSL A;  3RP7 A;  3RED A;  2YAU A;  3QSS A;  1F8R A;  1OJD A;  5KWF A;  1DOE A;  1GSN A;  2JB1 A;  5TR3 A;  1XAN A;  3UKA A;  3I3L A;  1OJA A;  1ZMC A;  1LJ1 A;  2GAG B;  3ALJ A;  1GES A;  3CNT A;  2XFP A;  1S2Y A;  3CPJ G;  1GRG A;  2JK6 A;  2XLS A;  5IQ1 A;  2V5Z A;  4FX9 A;  1FEC A;  3UKP A;  5DBJ A;  2E1M A;  1CC4 A;  1Y56 A;  4JNA A;  2QA1 A;  4XWZ A;  3T2Z A;  2GMJ A;  3UTE A;  2CUL A;  1BF3 A;  1O5W A;  2WDV A;  3AE2 A;  4G6H A;  4I58 A;  1D7L A;  4IV9 A;  4LU6 A;  4OPL A;  3V3O A;  4YSY A;  1N4W A;  3QVP A;  3QVR A;  3VRD B;  5LV9 A;  1DNC A;  4II3 A;  3ZDN A;  1N4U A;  3UOV A;  1NHS A;  1LQT A;  3NYE A;  4B68 A;  4EQX A;  3H4K A;  3AD7 B;  5FS9 A;  5EB5 A;  5BUL A;  1H81 A;  2Y6R A;  3UCL A;  3P9U A;  4H2Q A;  2WHD A;  3RP6 A;  3COX A;  1E1M A;  4J56 A;  3SFE A;  3SYI A;  2BS4 A;  1TDE A;  1Z6L A;  1DOB A;  4U8P A;  2GEW A;  4USQ A;  4FDC B;  1PJ7 A;  1Q1W A;  4IVM B;  1H82 A;  3D1C A;  5JCN A;  4NEW A;  1E6E A;  1XPQ A;  1L9C A;  1REO A;  4C74 A;  1CHU A;  2UZZ A;  5KVH A;  3AE3 A;  3CPH G;  4OPU A;  5KRQ A;  4M52 A;  4Z26 A;  4BJZ A;  3NTA A;  1NHQ A;  2YLR A;  2TPR A;  3AE9 A;  3K7Q X;  4IA5 A;  3ZYX A;  2VZ2 A;  1S2Q A;  4YSX A;  3GRS A;  4EMJ A;  2RGJ A;  3G5Q A;  4G73 A;  3VRA A;  1BGJ A;  1TDF A;  3UOY A;  4B67 A;  4DSH A;  1PBC A;  2YVG A;  4ZN0 A;  1VDC A;  1B8S A;  1GND A;  2RGH A;  4U2T A;  1NEK A;  4C3Y A;  1NHR A;  2GMH A;  3CND A;  4GDP A;  4AOS A;  5FS7 A;  1S3E A;  3GMC A;  4Y4L A;  3FIM B;  4K2X A;  1PBD A;  4APN A;  4EM3 A;  1NG3 A;  4K7Z A;  5CKU A;  3CIR A;  2C73 A;  1KSS A;  3LZX A;  1ZKQ A;  3SZ0 A;  2VRM A;  4U8I A;  4H4S A;  2WP9 A;  3P4R A;  4H2P A;  4C3X A;  4AP1 A;  5EB4 A;  2Q7V A;  1GOS A;  3SX6 A;  2R9Z A;  1GRB A;  3H8L A;  3OC4 A;  4H50 A;  4CBQ A;  1IUX A;  2TMD A;  3SZC A;  2Q0L A;  2WBA A;  3EAN A;  1ZOY A;  2HQM A;  4Z2U A;  4X9M A;  1GV4 A;  1IUT A;  2JBV A;  2XDO A;  1COY A;  1BWC A;  1PBE A;  1YY5 A;  1FL2 A;  3SY4 A;  3T2Y A;  2XLU A;  5HY5 A;  4X4J A;  4UDR A;  5J60 A;  1RYI A;  4LII A;  3LJP A;  4XXG A;  4YKF A;  3ATR A;  2WPF A;  1DJN A;  1D7Y A;  1JRZ A;  3DJD A;  2FJE A;  3AB1 A;  2WS3 A;  1Q9I A;  3HZL A;  5HHF A;  1CL0 A;  1LVL A;  4Z24 A;  3NH3 X;  2YWL A;  4P9S A;  1GET A;  1KF6 A;  5GSN A;  5EBK A;  1JRX A;  1EL9 A;  3H8I A;  4EQW A;  2C70 A;  1ONF A;  5JCI A;  1PDH A;  1VG0 A;  1YQ3 A;  2J3N A;  3DK4 A;  2WOI A;  1PJ5 A;  2Z5Y A;  3GD4 A;  2XVE A;  3ABV A;  1XHC A;  4H4X A;  3WE0 A;  5M10 A;  2X99 A;  2C65 A;  1KFY A;  2BK5 A;  3G5R A;  3CGB A;  2C3C A;  3V76 A;  1GXF A;  3DJG X;  4NWZ A;  4CCR A;  2WPE A;  1CF3 A;  3CNJ A;  2XCG A;  3EPT A;  4BK1 A;  3AE4 A;  3BNU A;  4U8M A;  1CJ4 A;  2BAC A;  2X50 A;  2C7G A;  1LQU A;  4H4Q A;  4A79 A;  4H7U A;  3NT6 A;  4H4Y A;  1UKV G;  1ZP0 A;  2B7R A;  1GAL A;  4JY3 A;  3AD9 B;  4CY8 A;  2DKI A;  2AAQ A;  5KXJ A;  2JB3 A;  1NG4 A;  2YLX A;  3F8P A;  3GMB A;  2X3N A;  3M0O A;  1EL8 A;  3DH9 A;  2ARD A;  4H4U A;  3EF6 A;  3NN6 X;  5M0Z A;  1PS9 A;  2BCG G;  1OJ9 A;  5JCM A;  3LZW A;  1ZDL A;  3FPZ A;  2OA1 A;  1LV0 A;  4B66 A;  2PHH A;  2BXR A;  1PBF A;  2EQ9 A;  2BCP A;  3BI4 A;  1JEH A;  3CGD A;  2VQB A;  1PXB A;  2Z5X A;  1IJH A;  5KMR A;  1MO9 A;  2EQ6 A;  2WET A;  2YG4 A;  3CNS A;  2YVJ A;  4Z2T A;  2Q0K A;  1W4X A;  4WX1 A;  2RGO A;  3FBS A;  2XFU A;  3LB8 A;  1OJT A;  3PO7 A;  4J34 A;  2BS3 A;  4JY2 A;  4RG4 A;  2GR0 A;  3GDP A;  3AED A;  1JU2 A;  1VRQ B;  2XVF A;  1H6V A;  3R9U A;  1K0J A;  1JOA A;  3SZF A;  3QJ4 A;  2EQ8 A;  1OJC A;  2GH5 A;  2ZBW A;  3AEB A;  1TDO A;  4HB9 A;  4OPC A;  3SGL A;  4BK3 A;  3UOZ A;  1M6I A;  4EQS A;  1M64 A;  4FK1 A;  5HXI A;  3OZ2 A;  4CNJ A;  3NGC X;  1YQ4 A;  5HYM A;  1VQW A;  2QAE A;  2CDU A;  3CN8 A;  4Y4N A;  1GRE A;  4NZH A;  2B76 A;  2VQ7 A;  1K0I A;  3KPF A;  4REK A;  3P4S A;  2BC1 A;  3FG2 P;  2XLT A;  4I59 A;  2OAL A;  4J36 A;  5KOW A;  1O95 A;  4OCG A;  3CPI G;  1ZX9 A;  4OPI A;  1PXA A;  4RG3 A;  2YM2 A;  2RAB A;  3UKQ A;  3M13 A;  4U8J A;  4B65 A;  2V6O A;  3QFB A;  3F8D A;  3P4Q A;  2C76 A;  3VR8 A;  2B9X A;  4J2W A;  4UP3 A;  3RP8 A;  2B9W A;  4WCT A;  1NAA A;  5KVI A;  2YR4 A;  3KD9 A;  3K7T A;  4LA1 A;  1MOK A;  3P1W A;  2YLW A;  2V60 A;  1D4E A;  3IC9 A;  4JQ9 A;  1CJ3 A;  3UKK A;  3F8R A;  3NK0 X;  4O5U A;  3C4N A;  4YXD A;  2OLO A;  2H89 A;  4J57 A;  4C5O A;  4HA6 A;  2WU2 A;  2WES A;  2XVI A;  2GF3 A;  2WOW A;  3II4 A;  3IF9 A;  3RNM A;  4D03 A;  2A87 A;  2BYB A;  3KVE A;  1H83 A;  1GT8 A;  4A99 A;  1N4V A;  2VOU A;  5U1O A;  4B1B A;  3HYV A;  1IUW A;  1E1L A;  4IA6 A;  5J7X A;  3BHK A;  3LOV A;  4H4V A;  2IVD A;  4B69 A;  4YT0 A;  1S3B A;  4UDQ A;  4CNK A;  2R4E A;  2R0P A;  4PAB A;  3EAO A;  1CC6 A;  1BGN A;  3ICT A;  4EIQ A;  1AOG A;  4NTD A;  4K8D A;  3I6D A;  4EQR A;  3ALM A;  4DGK A;  3AEA A;  1GTE A;  4EIP A;  1JNR A;  1Q1R A;  2XFO A;  1RSG A;  4AT0 A;  3QSM A;  3T2K A;  1CBO A;  5GRT A;  2GR3 A;  2R4J A;  3M12 A;  4H2N A;  2X8C A;  4JN9 A;  3FMW A;  4A65 A;  4ECH A;  4BV6 A;  2O9Z A;  3UP5 A;  2A89 A;  3GYX A;  2BS2 A;  2R0C A;  3ATQ A;  4TLX A;  1ZY8 A;  2BRA A;  3GRT A;  4TM0 A;  3SZW A;  4K5R A;  4A5L A;  4AOX A;  4U8L A;  3T0K A;  1B5Q A;  4C77 A;  1GTH A;  4G6G A;  2C72 A;  1D4C A;  5IQ4 A;  1F6M A;  3UTG A;  3UP4 A;  3AYJ A;  2FJA A;  4TLZ A;  5BUK A;  2IVE A;  2R0G A;  1F8S A;  3ICR A;  2R46 A;  1ELI A;  2VVL A;  2WDR A;  1FEA A;  2YLS A;  3QSE A;  3S5W A;  2APG A;  4MJW A;  4A6N B;  5KOX A;  1NEN A;  2ZZB A;  2YVF A;  1ZK7 A;  1F8W A;  2OAM A;  2WQY A;  3S61 A;  3CMM A;  2CFY A;  4YSZ A;  5L46 A;  5FS6 A;  4CY6 A;  3AEE A;  3NYC A;  3C96 A;  1H7W A;  2BXS A;  2JKC A;  1H86 A;  1VG9 A;  1PJ6 A;  2BAB A;  3ISH A;  2BRY A;  3KA7 A;  2E5V A;  4BUR A;  1L9D A;  1Y0P A;  2B9Y A;  3K7M X;  4YWO A;  3AYI A;  1K4Q A;  1P2E A;  3B6D A;  3L1R A;  1GPE A;  3CNP A;  2VVL G;  1P2H A;  2V3A A;  3GDN A;  2B7S A;  4EM4 A;  1TDK A;  1IUV A;  2EQ7 A;  3DA1 A;  3G5S A;  4H4W A;  4ZCD A;  1DOC A;  3NK1 X;  1MXT A;  3PS9 A;  4OPG A;  2XVH A;  1FEB A;  4EMW A;  4G74 A;  3ICS A;  1CJ2 A;  1EL7 A;  4GRT A;  1EL5 A;  1TYP A;  2YG7 A;  5ER0 A;  2YQU A;  4USR A;  3DGH A;  3GYI A;  3SQP A;  3ITJ A;  1GEU A;  2ACZ A;  3NYF A;  4GF7 A;  4E0V A;  3O0H A;  1PBB A;  2NVK X;  2XFQ A;  4OVI A;  3UKH A;  5JCK A;  4NNJ A;  4FK1 C;  2I0Z A;  4D04 A;  4BJY A;  1TDN A;  3GWF A;  4IVO B;  1GRA A;  3NTD A;  1IUS A;  4Z2R A;  1FOH A;  2YR6 A;  1ZMD A;  3AEC A;  4OPT A;  4A6N A;  2OLN A;  1E1K A;  3AEF A;  4J31 A;  1KSU A;  4XWR A;  5FMH A;  5KMP A;  3NRN A;  3DK8 A;  3Q6J A;  3AE8 A;  4KX6 A;  4X9N A;  4Y4M A;  2GR2 A;  4YKG A;  4H4P A;  3GSI A;  3PVC A;  3SM8 A;  2C64 A;  4J33 A;  4DNA A;  2YM1 A;  1V59 A;  5FS8 A;  1B37 A;  4TM4 A;  5CQF A;  2XYO A;  3KPK A;  5IPY A;  3B3R A;  3NIX A;  2GB0 A;  3UTH A;  2FJB A;  5U63 A;  4U2S A;  3ADA B;  4B63 A;  2F5Z A;  3JSK A;  5BRT A;  2WEU A;  3AYL A;  1BKW A;  5C3J A;  3C4A A;  2WOV A;  3IWA A;  4CCQ A;  4NTC A;  1F3P A;  4GAP A;  1H7X A;  3BHF A;  2X8H A;  4GUV A;  2C75 A;  1EBD A;  2X8G A;  2YG6 A;  4AP3 A;  5KMQ A;  1HYU A;  2VVM A;  4KPR A;  4GCM A;  4Z44 A;  1L0V A;  4JDR A;  1YQZ A;  3BI2 A;  5EOW A; 
#chains in the Genus database with same CATH homology
 3NG7 X;  2NPX A;  5KNL A;  3CTY A;  1N1P A;  4GDE A;  4H2R A;  3UKL A;  2JB2 A;  1PN0 A;  4A9W A;  4U8N A;  2BA9 A;  3HYW A;  3DK9 A;  1LPF A;  3P4P A;  3LXD A;  1NDA A;  2C4C A;  4TM3 A;  1GER A;  1TRB A;  1FCD A;  1KDG A;  3RHA A;  3VQR A;  1PXC A;  1DXL A;  4NTE A;  4PAA A;  5BVA A;  2WP5 A;  2GVC A;  3NKS A;  3HYX A;  3GYJ A;  4U8O A;  2R45 A;  1D5T A;  3Q9T A;  1GRH A;  3UKF A;  3GD3 A;  2C3D A;  2QA2 A;  1IUU A;  4H4R A;  1NPX A;  3BNM A;  2H88 A;  2XFN A;  2Y6Q A;  3AWI A;  2C66 A;  3IHM A;  3NN0 X;  4B64 A;  2YLZ A;  1GRT A;  2AR8 A;  2YR5 A;  2XLP A;  5U25 A;  3NK2 X;  4G9K A;  4O5Q A;  1GRF A;  3KLJ A;  4H4Z A;  1K0L A;  2BK4 A;  3BI5 A;  2BC0 A;  4GAV A;  4ZCC A;  2IID A;  4YSH A;  3AEG A;  2WPC A;  3UOX A;  2XVJ A;  4Z43 A;  4UDP A;  2V61 A;  3CGC A;  3SXI A;  2Q6U A;  4EMI A;  3ALL A;  3K30 A;  4H4T A;  3E1T A;  1E1N A;  2GRT A;  4YTM A;  1CC2 A;  4N9X A;  2BK3 A;  2GQW A;  1ZOV A;  3L8K A;  1RP0 A;  2FJD A;  3LAD A;  3UTF A;  3D8X A;  1KNP A;  2AQJ A;  2WDQ A;  2DKH A;  2VRL A;  3KU9 A;  3QFA A;  5KMS A;  4OPD A;  4DSG A;  2YLT A;  1L9E A;  1YKJ A;  2XLR A;  3DJE A;  2ZZ0 A;  3V3N A;  3DJJ A;  2GQF A;  2W0H A;  3AE1 A;  4AT2 A;  1Y56 B;  4Z25 A;  3AXB A;  4A7A A;  2C67 A;  2GR1 A;  2YG5 A;  3DME A;  3VRB A;  3AE7 A;  4NEV A;  2QCU A;  1XDI A;  3CGE A;  2WP6 A;  3AD8 B;  1BZL A;  2A8X A;  2ZZC A;  4II2 A;  1KNR A;  4ICY A;  2FBW A;  4U2L A;  1H84 A;  4K5S A;  1PHH A;  1JNZ A;  4K22 A;  4TM1 A;  3NHO X;  2WU5 A;  1LTX R;  3SFD A;  1DJQ A;  1O94 A;  1SEZ A;  2GV8 A;  1B4V A;  3DGZ A;  4JNQ A;  1QJD A;  1QO8 A;  2E4G A;  3NNE A;  4BK2 A;  1DOD A;  1CJC A;  3KKJ A;  5C2T A;  3URH A;  1X31 B;  2V3B A;  3AE6 A;  3T37 A;  2JAE A;  4YTN A;  1JRY A;  2CVJ A;  1D4D A;  3IHG A;  1E39 A;  2PYX A;  5JCL A;  4ADW A;  1QLB A;  2GAH B;  3T31 A;  4CRT A;  1NHP A;  4GR1 A;  3VR9 A;  2YG3 A;  4YTP A;  1TYT A;  3T14 A;  4U8K A;  3AE5 A;  1E7P A;  3GWD A;  3NLC A;  4RSL A;  3RP7 A;  3RED A;  2YAU A;  3QSS A;  1F8R A;  1OJD A;  5KWF A;  1DOE A;  1GSN A;  2JB1 A;  5TR3 A;  1XAN A;  3UKA A;  3I3L A;  1OJA A;  1ZMC A;  1LJ1 A;  2GAG B;  3ALJ A;  1GES A;  3CNT A;  2XFP A;  1S2Y A;  3CPJ G;  1GRG A;  2JK6 A;  2XLS A;  5IQ1 A;  2V5Z A;  4FX9 A;  1FEC A;  3UKP A;  5DBJ A;  2E1M A;  1CC4 A;  1Y56 A;  4JNA A;  2QA1 A;  4XWZ A;  3T2Z A;  2GMJ A;  3UTE A;  2CUL A;  1BF3 A;  1O5W A;  2WDV A;  3AE2 A;  4G6H A;  4I58 A;  1D7L A;  4IV9 A;  4LU6 A;  4OPL A;  3V3O A;  4YSY A;  1N4W A;  3QVP A;  3QVR A;  3VRD B;  5LV9 A;  1DNC A;  4II3 A;  3ZDN A;  1N4U A;  3UOV A;  1NHS A;  1LQT A;  3NYE A;  4B68 A;  4EQX A;  3H4K A;  3AD7 B;  5FS9 A;  5EB5 A;  5BUL A;  1H81 A;  2Y6R A;  3UCL A;  3P9U A;  4H2Q A;  2WHD A;  3RP6 A;  3COX A;  1E1M A;  4J56 A;  3SFE A;  3SYI A;  2BS4 A;  1TDE A;  1Z6L A;  1DOB A;  4U8P A;  2GEW A;  4USQ A;  4FDC B;  1PJ7 A;  1Q1W A;  4IVM B;  1H82 A;  3D1C A;  5JCN A;  4NEW A;  1E6E A;  1XPQ A;  1L9C A;  1REO A;  4C74 A;  1CHU A;  2UZZ A;  5KVH A;  3AE3 A;  3CPH G;  4OPU A;  5KRQ A;  4M52 A;  4Z26 A;  4BJZ A;  3NTA A;  1NHQ A;  2YLR A;  2TPR A;  3AE9 A;  3K7Q X;  4IA5 A;  3ZYX A;  2VZ2 A;  1S2Q A;  4YSX A;  3GRS A;  4EMJ A;  2RGJ A;  3G5Q A;  4G73 A;  3VRA A;  1BGJ A;  1TDF A;  3UOY A;  4B67 A;  4DSH A;  1PBC A;  2YVG A;  4ZN0 A;  1VDC A;  1B8S A;  1GND A;  2RGH A;  4U2T A;  1NEK A;  4C3Y A;  1NHR A;  2GMH A;  3CND A;  4GDP A;  4AOS A;  5FS7 A;  1S3E A;  3GMC A;  4Y4L A;  3FIM B;  4K2X A;  1PBD A;  4APN A;  4EM3 A;  1NG3 A;  4K7Z A;  5CKU A;  3CIR A;  2C73 A;  1KSS A;  3LZX A;  1ZKQ A;  3SZ0 A;  2VRM A;  4U8I A;  4H4S A;  2WP9 A;  3P4R A;  4H2P A;  4C3X A;  4AP1 A;  5EB4 A;  2Q7V A;  1GOS A;  3SX6 A;  2R9Z A;  1GRB A;  3H8L A;  3OC4 A;  4H50 A;  4CBQ A;  1IUX A;  2TMD A;  3SZC A;  2Q0L A;  2WBA A;  3EAN A;  1ZOY A;  2HQM A;  4Z2U A;  4X9M A;  1GV4 A;  1IUT A;  2JBV A;  2XDO A;  1COY A;  1BWC A;  1PBE A;  1YY5 A;  1FL2 A;  3SY4 A;  3T2Y A;  2XLU A;  5HY5 A;  4X4J A;  4UDR A;  5J60 A;  1RYI A;  4LII A;  3LJP A;  4XXG A;  4YKF A;  3ATR A;  2WPF A;  1DJN A;  1D7Y A;  1JRZ A;  3DJD A;  2FJE A;  3AB1 A;  2WS3 A;  1Q9I A;  3HZL A;  5HHF A;  1CL0 A;  1LVL A;  4Z24 A;  3NH3 X;  2YWL A;  4P9S A;  1GET A;  1KF6 A;  5GSN A;  5EBK A;  1JRX A;  1EL9 A;  3H8I A;  4EQW A;  2C70 A;  1ONF A;  5JCI A;  1PDH A;  1VG0 A;  1YQ3 A;  2J3N A;  3DK4 A;  2WOI A;  1PJ5 A;  2Z5Y A;  3GD4 A;  2XVE A;  3ABV A;  1XHC A;  4H4X A;  3WE0 A;  5M10 A;  2X99 A;  2C65 A;  1KFY A;  2BK5 A;  3G5R A;  3CGB A;  2C3C A;  3V76 A;  1GXF A;  3DJG X;  4NWZ A;  4CCR A;  2WPE A;  1CF3 A;  3CNJ A;  2XCG A;  3EPT A;  4BK1 A;  3AE4 A;  3BNU A;  4U8M A;  1CJ4 A;  2BAC A;  2X50 A;  2C7G A;  1LQU A;  4H4Q A;  4A79 A;  4H7U A;  3NT6 A;  4H4Y A;  1UKV G;  1ZP0 A;  2B7R A;  1GAL A;  4JY3 A;  3AD9 B;  4CY8 A;  2DKI A;  2AAQ A;  5KXJ A;  2JB3 A;  1NG4 A;  2YLX A;  3F8P A;  3GMB A;  2X3N A;  3M0O A;  1EL8 A;  3DH9 A;  2ARD A;  4H4U A;  3EF6 A;  3NN6 X;  5M0Z A;  1PS9 A;  2BCG G;  1OJ9 A;  5JCM A;  3LZW A;  1ZDL A;  3FPZ A;  2OA1 A;  1LV0 A;  4B66 A;  2PHH A;  2BXR A;  1PBF A;  2EQ9 A;  2BCP A;  3BI4 A;  1JEH A;  3CGD A;  2VQB A;  1PXB A;  2Z5X A;  1IJH A;  5KMR A;  1MO9 A;  2EQ6 A;  2WET A;  2YG4 A;  3CNS A;  2YVJ A;  4Z2T A;  2Q0K A;  1W4X A;  4WX1 A;  2RGO A;  3FBS A;  2XFU A;  3LB8 A;  1OJT A;  3PO7 A;  4J34 A;  2BS3 A;  4JY2 A;  4RG4 A;  2GR0 A;  3GDP A;  3AED A;  1JU2 A;  1VRQ B;  2XVF A;  1H6V A;  3R9U A;  1K0J A;  1JOA A;  3SZF A;  3QJ4 A;  2EQ8 A;  1OJC A;  2GH5 A;  2ZBW A;  3AEB A;  1TDO A;  4HB9 A;  4OPC A;  3SGL A;  4BK3 A;  3UOZ A;  1M6I A;  4EQS A;  1M64 A;  4FK1 A;  5HXI A;  3OZ2 A;  4CNJ A;  3NGC X;  1YQ4 A;  5HYM A;  1VQW A;  2QAE A;  2CDU A;  3CN8 A;  4Y4N A;  1GRE A;  4NZH A;  2B76 A;  2VQ7 A;  1K0I A;  3KPF A;  4REK A;  3P4S A;  2BC1 A;  3FG2 P;  2XLT A;  4I59 A;  2OAL A;  4J36 A;  5KOW A;  1O95 A;  4OCG A;  3CPI G;  1ZX9 A;  4OPI A;  1PXA A;  4RG3 A;  2YM2 A;  2RAB A;  3UKQ A;  3M13 A;  4U8J A;  4B65 A;  2V6O A;  3QFB A;  3F8D A;  3P4Q A;  2C76 A;  3VR8 A;  2B9X A;  4J2W A;  4UP3 A;  3RP8 A;  2B9W A;  4WCT A;  1NAA A;  5KVI A;  2YR4 A;  3KD9 A;  3K7T A;  4LA1 A;  1MOK A;  3P1W A;  2YLW A;  2V60 A;  1D4E A;  3IC9 A;  4JQ9 A;  1CJ3 A;  3UKK A;  3F8R A;  3NK0 X;  4O5U A;  3C4N A;  4YXD A;  2OLO A;  2H89 A;  4J57 A;  4C5O A;  4HA6 A;  2WU2 A;  2WES A;  2XVI A;  2GF3 A;  2WOW A;  3II4 A;  3IF9 A;  3RNM A;  4D03 A;  2A87 A;  2BYB A;  3KVE A;  1H83 A;  1GT8 A;  4A99 A;  1N4V A;  2VOU A;  5U1O A;  4B1B A;  3HYV A;  1IUW A;  1E1L A;  4IA6 A;  5J7X A;  3BHK A;  3LOV A;  4H4V A;  2IVD A;  4B69 A;  4YT0 A;  1S3B A;  4UDQ A;  4CNK A;  2R4E A;  2R0P A;  4PAB A;  3EAO A;  1CC6 A;  1BGN A;  3ICT A;  4EIQ A;  1AOG A;  4NTD A;  4K8D A;  3I6D A;  4EQR A;  3ALM A;  4DGK A;  3AEA A;  1GTE A;  4EIP A;  1JNR A;  1Q1R A;  2XFO A;  1RSG A;  4AT0 A;  3QSM A;  3T2K A;  1CBO A;  5GRT A;  2GR3 A;  2R4J A;  3M12 A;  4H2N A;  2X8C A;  4JN9 A;  3FMW A;  4A65 A;  4ECH A;  4BV6 A;  2O9Z A;  3UP5 A;  2A89 A;  3GYX A;  2BS2 A;  2R0C A;  3ATQ A;  4TLX A;  1ZY8 A;  2BRA A;  3GRT A;  4TM0 A;  3SZW A;  4K5R A;  4A5L A;  4AOX A;  4U8L A;  3T0K A;  1B5Q A;  4C77 A;  1GTH A;  4G6G A;  2C72 A;  1D4C A;  5IQ4 A;  1F6M A;  3UTG A;  3UP4 A;  3AYJ A;  2FJA A;  4TLZ A;  5BUK A;  2IVE A;  2R0G A;  1F8S A;  3ICR A;  2R46 A;  1ELI A;  2VVL A;  2WDR A;  1FEA A;  2YLS A;  3QSE A;  3S5W A;  2APG A;  4MJW A;  4A6N B;  5KOX A;  1NEN A;  2ZZB A;  2YVF A;  1ZK7 A;  1F8W A;  2OAM A;  2WQY A;  3S61 A;  3CMM A;  2CFY A;  4YSZ A;  5L46 A;  5FS6 A;  4CY6 A;  3AEE A;  3NYC A;  3C96 A;  1H7W A;  2BXS A;  2JKC A;  1H86 A;  1VG9 A;  1PJ6 A;  2BAB A;  3ISH A;  2BRY A;  3KA7 A;  2E5V A;  4BUR A;  1L9D A;  1Y0P A;  2B9Y A;  3K7M X;  4YWO A;  3AYI A;  1K4Q A;  1P2E A;  3B6D A;  3L1R A;  1GPE A;  3CNP A;  2VVL G;  1P2H A;  2V3A A;  3GDN A;  2B7S A;  4EM4 A;  1TDK A;  1IUV A;  2EQ7 A;  3DA1 A;  3G5S A;  4H4W A;  4ZCD A;  1DOC A;  3NK1 X;  1MXT A;  3PS9 A;  4OPG A;  2XVH A;  1FEB A;  4EMW A;  4G74 A;  3ICS A;  1CJ2 A;  1EL7 A;  4GRT A;  1EL5 A;  1TYP A;  2YG7 A;  5ER0 A;  2YQU A;  4USR A;  3DGH A;  3GYI A;  3SQP A;  3ITJ A;  1GEU A;  2ACZ A;  3NYF A;  4GF7 A;  4E0V A;  3O0H A;  1PBB A;  2NVK X;  2XFQ A;  4OVI A;  3UKH A;  5JCK A;  4NNJ A;  4FK1 C;  2I0Z A;  4D04 A;  4BJY A;  1TDN A;  3GWF A;  4IVO B;  1GRA A;  3NTD A;  1IUS A;  4Z2R A;  1FOH A;  2YR6 A;  1ZMD A;  3AEC A;  4OPT A;  4A6N A;  2OLN A;  1E1K A;  3AEF A;  4J31 A;  1KSU A;  4XWR A;  5FMH A;  5KMP A;  3NRN A;  3DK8 A;  3Q6J A;  3AE8 A;  4KX6 A;  4X9N A;  4Y4M A;  2GR2 A;  4YKG A;  4H4P A;  3GSI A;  3PVC A;  3SM8 A;  2C64 A;  4J33 A;  4DNA A;  2YM1 A;  1V59 A;  5FS8 A;  1B37 A;  4TM4 A;  5CQF A;  2XYO A;  3KPK A;  5IPY A;  3B3R A;  3NIX A;  2GB0 A;  3UTH A;  2FJB A;  5U63 A;  4U2S A;  3ADA B;  4B63 A;  2F5Z A;  3JSK A;  5BRT A;  2WEU A;  3AYL A;  1BKW A;  5C3J A;  3C4A A;  2WOV A;  3IWA A;  4CCQ A;  4NTC A;  1F3P A;  4GAP A;  1H7X A;  3BHF A;  2X8H A;  4GUV A;  2C75 A;  1EBD A;  2X8G A;  2YG6 A;  4AP3 A;  5KMQ A;  1HYU A;  2VVM A;  4KPR A;  4GCM A;  4Z44 A;  1L0V A;  4JDR A;  1YQZ A;  3BI2 A;  5EOW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...