3CTYA

Crystal structure of t. acidophilum thioredoxin reductase
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
304
structure length
304
Chain Sequence
b'ERDFDVVIVGAGAAGFSAAVYAARSGFSVAILDKAVAGGLTAEAPLVENYLGFKSIVGSELAKLFADHAANYAKIREGVEVRSIKKTQGGFDIETNDDTYHAKYVIITTGTTHKHLGVKGESEYFGKGTSYCSTCDGYLFKGKRVVTIGGGNSGAIAAISMSEYVKNVTIIEYMPKYMCENAYVQEIKKRNIPYIMNAQVTEIVGDGKKVTGVKYKDRTTGEEKLIETDGVFIYVGLIPQTSFLKDSGVKLDERGYIVVDSRQRTSVPGVYAAGDVTSGNFAQIASAVGDGCKAALSLYSDSIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thioredoxin reductase
publication title Thioredoxin reductase from Thermoplasma acidophilum: a new twist on redox regulation.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Oxidoreductase
total genus 93
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ctyA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3ctyA02
4AT2A 1LVLA 4N9XA 1REOA 4U2LA 3AEDA 1TDEA 3GYIA 1CL0A 2Z5XA 4H4SA 1Y56B 4M52A 2C72A 3AYLA 1QLBA 1N4WA 2B9WA 3SGLA 4C3YA 1Y0PA 3I3LA 4A6NB 3RP7A 1QO8A 5BRTA 1FL2A 4U8JA 1NHPA 3UKQA 4J57A 2X3NA 3F8PA 3KA7A 2V3AA 3BNUA 3EANA 5JCMA 1H82A 5L46A 2GMHA 3CGDA 1IUWA 2XDOA 4CCQA 4USQA 2YG7A 2YVJA 4TM1A 4YTMA 3K7QX 5J7XA 5FS7A 4J33A 5GSNA 1PDHA 2C73A 3S5WA 4U8IA 2B7SA 2WP6A 3KLJA 1GREA 3K7MX 1BGJA 1PN0A 1ZY8A 2YG4A 4OPLA 4RG3A 3C4AA 1MO9A 1XHCA 2C76A 2XVIA 1O95A 3UKFA 4NTCA 4K8DA 2Q7VA 4FDCB 3ICSA 1RSGA 1ZK7A 1NHSA 4FX9A 3VRDB 4K5RA 1GRBA 1CJ3A 5U25A 4O5QA 3NIXA 5BUKA 3DK4A 2ZZCA 2B7RA 4B65A 4FK1C 2IVEA 4BURA 3IHMA 4GRTA 2VVMA 3KD9A 1HYUA 4ADWA 5U1OA 4D04A 1NPXA 2RABA 3CN8A 1DODA 4H50A 3AE6A 5ER0A 2E4GA 1LV0A 4EMJA 4H4RA 1GV4A 3SFDA 1PBBA 4REKA 3AYJA 4Z25A 2XLRA 2JB3A 4OPGA 4BJYA 5IQ4A 3DK8A 1F8WA 4TLXA 5KOXA 4CNKA 1IUVA 3L1RA 3UOZA 1H84A 3VR8A 2ACZA 2TPRA 1GALA 4OVIA 2OALA 3REDA 4KPRA 1XDIA 3ADAB 2B76A 1XANA 2XCGA 4J36A 1GRAA 4PAAA 1S2QA 2GEWA 3LJPA 3QVRA 1GTHA 3UKKA 3GD4A 5JCIA 1VQWA 1EBDA 4ZN0A 1EL8A 3CNJA 3BI4A 2WPCA 3LOVA 2JB1A 5DBJA 4E0VA 1JOAA 3G5SA 3C4NA 5JCKA 4NEVA 2GAHB 3P4RA 3UTFA 1JU2A 3LZWA 1CJCA 2PYXA 3D8XA 1GETA 3CPIG 4DSHA 3UKHA 1OJAA 3QSSA 1GSNA 1GTEA 4UDPA 1CC4A 1MXTA 4AOXA 4B67A 3BHFA 2BK4A 3H4KA 2ARDA 2XFQA 2CULA 2FJEA 3F8RA 4NTDA 4BK3A 3QJ4A 3PO7A 3VR9A 4GDEA 1NEKA 1OJTA 4A99A 4DSGA 1DJQA 2BS4A 2XLTA 2OA1A 3F8DA 3UKLA 1H83A 2QA2A 4X9NA 2Q0LA 2BS2A 2YVFA 3IC9A 2V6OA 3FPZA 4U8OA 3C96A 4JY2A 4WX1A 1FCDA 1TYPA 4ICYA 2DKHA 4DNAA 4IVMB 5CQFA 4YKGA 1PJ7A 1CJ2A 1KNRA 1GERA 4B64A 1KSSA 4CBQA 4EQXA 2C65A 4U8NA 1CBOA 2XLSA 3QFBA 2R4JA 2VQ7A 5C3JA 1BKWA 3T37A 3AYIA 1ZOVA 4Z44A 1YKJA 2C70A 2X99A 3NLCA 2YM2A 3GD3A 1NHQA 2GR1A 2VQBA 4MJWA 2VOUA 4USRA 4C5OA 4IV9A 1NG3A 3CPHG 2W0HA 3VRAA 5FS6A 4O5UA 2C67A 2V60A 4B63A 3KU9A 2WP9A 5CKUA 1VRQB 3UTGA 3CNPA 3CNDA 4TM3A 4A79A 1E1NA 1W4XA 3DJDA 3FMWA 3GDNA 4EMWA 2BC1A 4B68A 4Z2TA 5KOWA 4BK2A 3H8IA 2YVGA 1GT8A 4EQSA 3IF9A 3NN6X 1TDOA 2JBVA 3BHKA 2V61A 2AAQA 3FIMB 3AE9A 5KVHA 2JK6A 3R9UA 1F3PA 3V76A 1VDCA 2H88A 1EL5A 3NTDA 3GRTA 3UTHA 1FEAA 2YAUA 3ICRA 4H2RA 5HHFA 3AE3A 1K0JA 1LPFA 1X31B 2WOWA 4EM4A 1H6VA 4YT0A 5KVIA 1CF3A 3DA1A 3DGHA 1ONFA 4AT0A 4YSYA 2TMDA 2VRLA 3JSKA 2OAMA 2GF3A 3AD9B 3AEBA 3P4QA 4K2XA 3G5RA 1D7YA 2YG3A 3P4PA 4H4VA 2FJBA 3H8LA 4CCRA 1KFYA 2GR3A 2VZ2A 2BCGG 1YQ3A 4H4WA 2ZZ0A 5KWFA 1LQTA 3UP5A 3NH3X 1PJ6A 2WU2A 2BCPA 2GVCA 2YQUA 1S2YA 4A9WA 1B4VA 1GRFA 1D4CA 1ZDLA 3CNTA 1ZOYA 4BJZA 2Y6QA 4Z24A 1MOKA 4J56A 4OCGA 2QA1A 1YY5A 2I0ZA 3QFAA 3DJEA 2NVKX 4C74A 2GQWA 3UOVA 4X9MA 1PXAA 3UCLA 1TDKA 2YWLA 1D4DA 3NYCA 2R46A 4JQ9A 3AE8A 3KPFA 4H4QA 5KXJA 1D5TA 1D4EA 2YR5A 1BWCA 4OPTA 3LXDA 1TDFA 4YSZA 1E1LA 4EM3A 3KVEA 4EIPA 1KSUA 1B5QA 2EQ6A 4TM4A 2J3NA 2R4EA 3ITJA 2GMJA 4GDPA 3K7TA 5EB4A 5BULA 2YLWA 1GRTA 1M6IA 3ALMA 5HXIA 1Y56A 3Q6JA 1M64A 2WU5A 5TR3A 3ABVA 4A6NA 1DOCA 3DGZA 4H4ZA 4AOSA 4HA6A 3M13A 4KX6A 3RP6A 1L9DA 3UKPA 3UKAA 2BXSA 2YLSA 1PBEA 1GOSA 4B1BA 3NKSA 4YTNA 3NK0X 2XLPA 1AOGA 3NG7X 2X8CA 1PXCA 2BS3A 3LADA 2WS3A 2BA9A 5GRTA 3P9UA 3IWAA 3PS9A 1GNDA 4IVOB 3CGCA 5C2TA 1S3EA 5LV9A 1L9CA 1B37A 1FECA 1ZMDA 2XFPA 3RP8A 2JB2A 3FBSA 4I59A 4YSHA 2CDUA 3S61A 2UZZA 4AP3A 3GWFA 3AE2A 3HZLA 1N4VA 2RGOA 4GCMA 1E1MA 1IJHA 4D03A 4H4UA 1NHRA 2WPEA 3CTYA 3G5QA 1P2EA 4XXGA 2H89A 5J60A 3BI2A 2E1MA 4H4YA 1YQZA 4RSLA 2R0CA 1ELIA 3CPJG 4NTEA 3ATRA 1IUSA 2GH5A 1BZLA 4J34A 4EMIA 1GRGA 1EL7A 3K30A 1IUXA 2HQMA 4Z43A 2XVFA 3ALLA 4C77A 1H7WA 1CHUA 1TYTA 2V5ZA 3AD8B 3AEGA 2RGHA 4A5LA 4UDQA 1NENA 3II4A 1H7XA 4A65A 4EQWA 2WDRA 2EQ9A 4YSXA 5BVAA 4B69A 4YXDA 5FS8A 1S3BA 3WE0A 3SQPA 5M10A 4EIQA 5EOWA 2YLXA 4LA1A 2YG5A 2XLUA 3FG2P 2QCUA 2YR4A 1F8RA 2XVHA 3ICTA 4HB9A 4J2WA 1L0VA 3DJJA 1GEUA 2YM1A 4H2QA 4NEWA 3V3NA 5FMHA 1UKVG 3NGCX 4Y4NA 1E39A 3NT6A 3DK9A 1PBDA 1O5WA 3GMBA 2FJAA 3D1CA 5EB5A 2QAEA 2WDQA 2A8XA 2Y6RA 2EQ8A 2CVJA 4CNJA 4H4XA 1JRYA 1ZKQA 1PHHA 1RP0A 1IUUA 2VVLA 3LZXA 2XVJA 3ISHA 1K0LA 1E6EA 3NYEA 3PVCA 2XFNA 3KKJA 2XYOA 2V3BA 3Q9TA 1VG9A 3LB8A 2C3CA 1DOEA 2E5VA 3DJGX 4H4PA 1Q1WA 3VRBA 1NG4A 4H7UA 3SM8A 2IVDA 2C75A 1KF6A 3E1TA 3RHAA 2JKCA 4GUVA 4TLZA 2X8GA 2GQFA 4C3XA 3EPTA 3OC4A 1FOHA 2WBAA 4LIIA 2BK3A 1CC2A 4EQRA 3CGBA 1LJ1A 2VRMA 1SEZA 4FK1A 3UP4A 2B9XA 1NDAA 2YLZA 1JNRA 2ZZBA 4IA5A 2C3DA 2WPFA 1NAAA 3AXBA 2FJDA 4XWRA 1RYIA 2XFOA 2IIDA 1JEHA 2GB0A 4B66A 1PXBA 1JRXA 1K4QA 4YWOA 3NYFA 4OPCA 2AR8A 1PJ5A 1TRBA 1Q1RA 2BXRA 4LU6A 2R45A 4IA6A 1V59A 5EBKA 3QSEA 1FEBA 2Q6UA 2BYBA 3BNMA 3EF6A 4APNA 2APGA 2WOVA 3O0HA 4U8LA 5U63A 1H81A 3QVPA 1GPEA 2AQJA 4ZCCA 3P1WA 3M12A 2JAEA 1OJDA 3B6DA 1TDNA 4ECHA 1CC6A 4UP3A 2VVLG 3NTAA 3NNEA 4PABA 2FBWA 3AE1A 1Q9IA 2GV8A 4Z26A 1KDGA 3V3OA 2DKIA 3CGEA 2GR0A 2XFUA 2O9ZA 4JNAA 4K7ZA 5HY5A 4P9SA 5KRQA 3NK1X 3P4SA 2WESA 2YLRA 3UOXA 4WCTA 5IPYA 2F5ZA 1GESA 2BACA 3ALJA 1E7PA 2Z5YA 3AEEA 3AEFA 1GRHA 2CFYA 5JCNA 3AE7A 3NK2X 1ZP0A 4XWZA 2C64A 1P2HA 1PBFA 3AEAA 3CIRA 4Z2RA 2OLNA 1Z6LA 3DH9A 1BGNA 1L9EA 2WDVA 4YTPA 4CY8A 1N1PA 2YLTA 4DGKA 3GDPA 1XPQA 1EL9A 4YKFA 3GRSA 3RNMA 1GXFA 3DMEA 1N4UA 4X4JA 4U8PA 4A7AA 1DJNA 2GRTA 3NHOX 4JN9A 4Y4MA 1VG0A 1H86A 4UDRA 3AD7B 1DNCA 2BC0A 1DOBA 2WQYA 4U8MA 3ZYXA 3URHA 3BI5A 4U2SA 1COYA 1BF3A 3GSIA 2RGJA 4JNQA 5M0ZA 4Z2UA 4H2NA 2XVEA 3SFEA 5IQ1A 3GYJA 4OPIA 4BV6A 2PHHA 2WHDA 2X8HA 2BABA 2BK5A 3GWDA 1JNZA 2R0GA 1OJ9A 4I58A 2R9ZA 4AP1A 1CJ4A 2WEUA 2EQ7A 3NRNA 4K22A 4U8KA 1D7LA 2WETA 1PBCA 3CNSA 2C66A 4J31A 2Q0KA 3NN0X 1DXLA 3UOYA 4BK1A 4CY6A 4OPDA 4GF7A 1LQUA 2OLOA 4NZHA 3AECA 1O94A 2YG6A 2B9YA 4ZCDA 1ZX9A 3AE4A 3AE5A 3AB1A 2A89A 4OPUA 1ZMCA 3VQRA 2WOIA 3L8KA 4H2PA 1JRZA 3EAOA 1F6MA 3ATQA 4GR1A 3B3RA 4H4TA 4JY3A 4Y4LA 3ZDNA 1IUTA 3M0OA 1OJCA 2C7GA 3AWIA 2A87A 1YQ4A 2GAGB 4CRTA 3I6DA 5JCLA 2NPXA 1F8SA 5FS9A 3COXA 1K0IA 2ZBWA 3IHGA 1QJDA 1B8SA 1PS9A 4JDRA 3OZ2A 1LTXR 2R0PA 2GR2A 1KNPA 2YR6A 2X50A 1E1KA 2WP5A 3GMCA 3QSMA 4K5SA 4TM0A 3UTEA 4RG4A 5HYMA 4U2TA
chains in the Genus database with same CATH superfamily
4AT2A 1LVLA 4N9XA 1REOA 4U2LA 3AEDA 1TDEA 3GYIA 1CL0A 2Z5XA 4H4SA 3SYIA 1Y56B 4M52A 2C72A 3AYLA 1QLBA 1N4WA 2B9WA 3SGLA 4C3YA 1Y0PA 3I3LA 4A6NB 3RP7A 1QO8A 4G73A 5BRTA 1FL2A 4G9KA 4U8JA 1NHPA 3UKQA 4J57A 2X3NA 3F8PA 3KA7A 2V3AA 3BNUA 3EANA 5JCMA 1H82A 5L46A 2GMHA 3CGDA 1IUWA 2XDOA 4CCQA 4G74A 4USQA 2YG7A 2YVJA 3HYWA 4TM1A 3K7QX 4YTMA 5FS7A 5J7XA 3SZFA 4J33A 5GSNA 1PDHA 2C73A 3S5WA 3T31A 4U8IA 2B7SA 2WP6A 3KLJA 1GREA 3K7MX 1BGJA 1PN0A 1ZY8A 2YG4A 4OPLA 4RG3A 3C4AA 1MO9A 1XHCA 2C76A 2XVIA 1O95A 4GAVA 3UKFA 4NTCA 4K8DA 2Q7VA 4FDCB 3ICSA 1RSGA 1ZK7A 1NHSA 4FX9A 3VRDB 5KNLA 4K5RA 1GRBA 1CJ3A 5U25A 4O5QA 3NIXA 5BUKA 3DK4A 2ZZCA 2B7RA 4B65A 4FK1C 2IVEA 4BURA 3IHMA 4GRTA 2VVMA 3KD9A 1HYUA 4ADWA 5U1OA 4D04A 3SX6A 1NPXA 2RABA 3CN8A 1DODA 4H50A 3AE6A 5ER0A 2E4GA 1LV0A 3SZCA 4EMJA 4H4RA 1GV4A 3SFDA 1PBBA 4REKA 3AYJA 4Z25A 2XLRA 2JB3A 4OPGA 4BJYA 5IQ4A 3DK8A 1F8WA 4TLXA 5KOXA 4CNKA 1IUVA 3L1RA 3UOZA 1H84A 3VR8A 2ACZA 4GAPA 2TPRA 1GALA 4OVIA 2OALA 3REDA 4KPRA 1XDIA 3ADAB 3T14A 2B76A 1XANA 2XCGA 4J36A 1GRAA 4PAAA 1S2QA 2GEWA 3LJPA 3QVRA 1GTHA 3UKKA 3GD4A 5JCIA 1VQWA 1EBDA 4ZN0A 2BRYA 1EL8A 3CNJA 3BI4A 2WPCA 2BRAA 2JB1A 3LOVA 5DBJA 4E0VA 1JOAA 3G5SA 3C4NA 5JCKA 4NEVA 2GAHB 3P4RA 3SZWA 3UTFA 1JU2A 3LZWA 1CJCA 2PYXA 3D8XA 1GETA 3CPIG 4DSHA 3UKHA 1OJAA 3QSSA 1GSNA 1GTEA 4UDPA 1CC4A 1MXTA 4AOXA 4B67A 3BHFA 2BK4A 3H4KA 2ARDA 2XFQA 2CULA 2FJEA 3F8RA 4NTDA 4BK3A 3QJ4A 3PO7A 3VR9A 4GDEA 1NEKA 1OJTA 4A99A 4DSGA 1DJQA 2BS4A 2XLTA 2OA1A 3F8DA 3UKLA 1H83A 2QA2A 4X9NA 2Q0LA 2BS2A 2YVFA 3IC9A 2V6OA 3FPZA 4U8OA 3C96A 4JY2A 4WX1A 1FCDA 1TYPA 4ICYA 2DKHA 4DNAA 4IVMB 5CQFA 4YKGA 1PJ7A 1CJ2A 1KNRA 1GERA 3GYXA 4B64A 1KSSA 4CBQA 4EQXA 2C65A 4U8NA 1CBOA 2XLSA 5KMQA 3QFBA 2R4JA 2VQ7A 5C3JA 1BKWA 3T37A 3AYIA 1ZOVA 4Z44A 1YKJA 2C70A 2X99A 3NLCA 2YM2A 3T2ZA 3GD3A 1NHQA 2GR1A 2VQBA 4MJWA 2VOUA 4USRA 4C5OA 4IV9A 1NG3A 3CPHG 2W0HA 3VRAA 5FS6A 4O5UA 5KMPA 2C67A 2V60A 4B63A 3KU9A 2WP9A 5CKUA 1VRQB 3UTGA 3CNPA 3CNDA 4TM3A 4A79A 1E1NA 1W4XA 3DJDA 3FMWA 3GDNA 4EMWA 2BC1A 4B68A 4Z2TA 5KOWA 4BK2A 3H8IA 2YVGA 1GT8A 4EQSA 3IF9A 3NN6X 1TDOA 2JBVA 3BHKA 2V61A 2AAQA 3FIMB 3AE9A 5KVHA 2JK6A 4NWZA 1F3PA 3R9UA 3V76A 1VDCA 2H88A 1EL5A 3HYXA 3GRTA 3NTDA 1FEAA 2YAUA 3ICRA 4H2RA 3UTHA 5HHFA 3AE3A 1K0JA 1LPFA 1X31B 2WOWA 4EM4A 1H6VA 4YT0A 5KVIA 1CF3A 3DA1A 3DGHA 1ONFA 4AT0A 4YSYA 2TMDA 2VRLA 3JSKA 2OAMA 2GF3A 3AD9B 3AEBA 3P4QA 4K2XA 3G5RA 1D7YA 2YG3A 3P4PA 4H4VA 2FJBA 3H8LA 4CCRA 1KFYA 2GR3A 2VZ2A 2BCGG 1YQ3A 4H4WA 2ZZ0A 5KWFA 1LQTA 3UP5A 3NH3X 1PJ6A 2WU2A 2BCPA 2GVCA 2YQUA 1S2YA 4A9WA 1B4VA 1GRFA 1D4CA 1ZDLA 3CNTA 1ZOYA 4BJZA 2Y6QA 4Z24A 1MOKA 4J56A 4OCGA 2QA1A 1YY5A 2I0ZA 3QFAA 3DJEA 2NVKX 4II3A 4C74A 2GQWA 3UOVA 4X9MA 1PXAA 3UCLA 1TDKA 2YWLA 1D4DA 3NYCA 2R46A 4JQ9A 3AE8A 3KPFA 4H4QA 5KXJA 1D5TA 1D4EA 2YR5A 1BWCA 4OPTA 3LXDA 1TDFA 4YSZA 1E1LA 4EM3A 3KVEA 3SXIA 1KSUA 4EIPA 1B5QA 2EQ6A 4TM4A 2J3NA 2R4EA 3ITJA 2GMJA 4GDPA 3K7TA 5EB4A 5BULA 2YLWA 1GRTA 1M6IA 3ALMA 5HXIA 1Y56A 3Q6JA 1M64A 2WU5A 5TR3A 3ABVA 4A6NA 1DOCA 3DGZA 4H4ZA 4AOSA 4HA6A 3M13A 4KX6A 3RP6A 1L9DA 3UKPA 3UKAA 2BXSA 2YLSA 1PBEA 1GOSA 4B1BA 3NKSA 4YTNA 3NK0X 2XLPA 1AOGA 3NG7X 2X8CA 1PXCA 2BS3A 3LADA 2WS3A 2BA9A 5GRTA 3P9UA 3IWAA 3PS9A 1GNDA 4IVOB 3CGCA 4II2A 5C2TA 1S3EA 5LV9A 1L9CA 1B37A 1FECA 1ZMDA 2XFPA 3RP8A 2JB2A 3FBSA 4I59A 4YSHA 2CDUA 3S61A 2UZZA 4AP3A 3GWFA 3AE2A 3HZLA 1N4VA 2RGOA 4GCMA 1E1MA 1IJHA 4D03A 4G6GA 1NHRA 2WPEA 3CTYA 3G5QA 4H4UA 1P2EA 4XXGA 2H89A 5J60A 3BI2A 2E1MA 4H4YA 1YQZA 4RSLA 5KMRA 2R0CA 1ELIA 3CPJG 4NTEA 3ATRA 1IUSA 2GH5A 1BZLA 4J34A 4EMIA 1GRGA 1EL7A 3K30A 1IUXA 2C4CA 2HQMA 4Z43A 2XVFA 3ALLA 4C77A 1H7WA 1CHUA 1TYTA 2V5ZA 3AD8B 3AEGA 2RGHA 4A5LA 4UDQA 1NENA 3II4A 1H7XA 4A65A 4EQWA 2WDRA 2EQ9A 4YSXA 5BVAA 4B69A 4YXDA 5FS8A 1S3BA 3WE0A 3SQPA 5M10A 4EIQA 5EOWA 2YLXA 4LA1A 2YG5A 5KMSA 2XLUA 3FG2P 2QCUA 2YR4A 1F8RA 2XVHA 3ICTA 4HB9A 4J2WA 1L0VA 3DJJA 1GEUA 2YM1A 4H2QA 4NEWA 3V3NA 5FMHA 1UKVG 3NGCX 4Y4NA 1E39A 3NT6A 3DK9A 1PBDA 1O5WA 3GMBA 2FJAA 3D1CA 5EB5A 2QAEA 2WDQA 2A8XA 2Y6RA 2EQ8A 2CVJA 4CNJA 4H4XA 1JRYA 1ZKQA 1PHHA 1RP0A 1IUUA 2VVLA 3LZXA 2XVJA 3ISHA 1K0LA 1E6EA 3NYEA 3PVCA 2XFNA 3KKJA 2XYOA 2V3BA 3Q9TA 1VG9A 3LB8A 2C3CA 4G6HA 1DOEA 2E5VA 3DJGX 4H4PA 1Q1WA 3VRBA 1NG4A 4H7UA 3SM8A 2IVDA 2C75A 1KF6A 3E1TA 3RHAA 2JKCA 3CMMA 4GUVA 4TLZA 2X8GA 2GQFA 4C3XA 3EPTA 3OC4A 1FOHA 2WBAA 4LIIA 2BK3A 1CC2A 4EQRA 3CGBA 1LJ1A 2VRMA 1SEZA 4FK1A 3UP4A 3T2KA 2B9XA 1NDAA 2YLZA 1JNRA 2ZZBA 4IA5A 2C3DA 2WPFA 1NAAA 3AXBA 2FJDA 4XWRA 1RYIA 2XFOA 2IIDA 1JEHA 2GB0A 4B66A 1PXBA 1JRXA 1K4QA 4YWOA 3NYFA 4OPCA 2AR8A 1PJ5A 1TRBA 1Q1RA 2BXRA 4LU6A 2R45A 4IA6A 1V59A 5EBKA 3QSEA 1FEBA 2Q6UA 2BYBA 3BNMA 3EF6A 4APNA 2APGA 2WOVA 3O0HA 4U8LA 5U63A 1H81A 3SY4A 3QVPA 1GPEA 2AQJA 4ZCCA 3P1WA 3M12A 2JAEA 1OJDA 3B6DA 1TDNA 4ECHA 1CC6A 4UP3A 2VVLG 3NTAA 3NNEA 4PABA 2FBWA 3AE1A 1Q9IA 2GV8A 4Z26A 1KDGA 3V3OA 2DKIA 3CGEA 2GR0A 2XFUA 2O9ZA 4JNAA 4K7ZA 5HY5A 4P9SA 5KRQA 3NK1X 3P4SA 2WESA 2YLRA 3UOXA 4WCTA 5IPYA 2F5ZA 1GESA 2BACA 3ALJA 3T2YA 1E7PA 2Z5YA 3AEEA 3AEFA 1GRHA 2CFYA 5JCNA 3AE7A 3NK2X 1ZP0A 4XWZA 2C64A 1P2HA 1PBFA 3AEAA 3CIRA 4Z2RA 2OLNA 1Z6LA 3DH9A 1BGNA 1L9EA 2WDVA 4YTPA 4CY8A 1N1PA 2YLTA 4DGKA 3GDPA 1XPQA 1EL9A 3KPKA 4YKFA 3GRSA 3RNMA 1GXFA 3DMEA 1N4UA 4X4JA 4U8PA 4A7AA 1DJNA 2GRTA 3NHOX 4JN9A 4Y4MA 1VG0A 1H86A 4UDRA 3AD7B 1DNCA 2BC0A 4NNJA 1DOBA 2WQYA 4U8MA 3ZYXA 3URHA 3BI5A 4U2SA 1COYA 1BF3A 3GSIA 2RGJA 4JNQA 5M0ZA 4Z2UA 4H2NA 2XVEA 3SFEA 5IQ1A 3GYJA 4OPIA 4BV6A 2PHHA 2WHDA 2X8HA 2BABA 2BK5A 3GWDA 1JNZA 2R0GA 1OJ9A 4I58A 2R9ZA 4AP1A 1CJ4A 2WEUA 2EQ7A 3NRNA 4K22A 4U8KA 1D7LA 2WETA 1PBCA 3SZ0A 3CNSA 2C66A 4J31A 2Q0KA 3NN0X 1DXLA 3UOYA 4BK1A 4CY6A 3HYVA 4OPDA 4GF7A 1LQUA 2OLOA 4NZHA 3AECA 3T0KA 1O94A 2YG6A 2B9YA 4ZCDA 1ZX9A 3AE4A 3AE5A 3AB1A 2A89A 4OPUA 1ZMCA 3VQRA 2WOIA 3L8KA 4H2PA 1JRZA 3EAOA 1F6MA 3ATQA 4GR1A 3B3RA 4H4TA 4JY3A 4Y4LA 3ZDNA 1IUTA 3M0OA 1OJCA 2C7GA 3AWIA 2A87A 1YQ4A 2GAGB 4CRTA 3I6DA 5JCLA 2NPXA 1F8SA 5FS9A 3COXA 1K0IA 2ZBWA 3IHGA 1QJDA 1B8SA 1PS9A 4JDRA 3OZ2A 1LTXR 2R0PA 2GR2A 1KNPA 2YR6A 2X50A 1E1KA 2WP5A 3GMCA 3QSMA 4K5SA 4TM0A 3UTEA 4RG4A 5HYMA 4U2TA
chains in the Genus database with same CATH topology
4AT2A 1LVLA 4N9XA 1REOA 4U2LA 3AEDA 1TDEA 3GYIA 1CL0A 2Z5XA 4H4SA 3SYIA 1Y56B 4M52A 2C72A 3AYLA 1QLBA 1N4WA 2B9WA 3SGLA 4C3YA 1Y0PA 3I3LA 4A6NB 3RP7A 1QO8A 4G73A 5BRTA 1FL2A 4G9KA 4U8JA 1NHPA 3UKQA 4J57A 2X3NA 3F8PA 3KA7A 2V3AA 3BNUA 3EANA 5JCMA 1H82A 5L46A 2GMHA 3CGDA 1IUWA 2XDOA 4CCQA 4G74A 4USQA 2YG7A 2YVJA 3HYWA 4TM1A 3K7QX 4YTMA 5FS7A 5J7XA 3SZFA 4J33A 5GSNA 1PDHA 2C73A 3S5WA 3T31A 4U8IA 2B7SA 2WP6A 3KLJA 1GREA 3K7MX 1BGJA 1PN0A 1ZY8A 2YG4A 4OPLA 4RG3A 3C4AA 1MO9A 1XHCA 2C76A 2XVIA 1O95A 4GAVA 3UKFA 4NTCA 4K8DA 2Q7VA 4FDCB 3ICSA 1RSGA 1ZK7A 1NHSA 4FX9A 3VRDB 5KNLA 4K5RA 1GRBA 1CJ3A 5U25A 4O5QA 3NIXA 5BUKA 3DK4A 2ZZCA 2B7RA 4B65A 4FK1C 2IVEA 4BURA 3IHMA 4GRTA 2VVMA 3KD9A 1HYUA 4ADWA 5U1OA 4D04A 3SX6A 1NPXA 2RABA 3CN8A 1DODA 4H50A 3AE6A 5ER0A 2E4GA 1LV0A 3SZCA 4EMJA 4H4RA 1GV4A 3SFDA 1PBBA 4REKA 3AYJA 4Z25A 2XLRA 2JB3A 4OPGA 4BJYA 5IQ4A 3DK8A 1F8WA 4TLXA 5KOXA 4CNKA 1IUVA 3L1RA 3UOZA 1H84A 3VR8A 2ACZA 4GAPA 2TPRA 1GALA 4OVIA 2OALA 3REDA 4KPRA 1XDIA 3ADAB 3T14A 2B76A 1XANA 2XCGA 4J36A 1GRAA 4PAAA 1S2QA 2GEWA 3LJPA 3QVRA 1GTHA 3UKKA 3GD4A 5JCIA 1VQWA 1EBDA 4ZN0A 2BRYA 1EL8A 3CNJA 3BI4A 2WPCA 2BRAA 2JB1A 3LOVA 5DBJA 4E0VA 1JOAA 3G5SA 3C4NA 5JCKA 4NEVA 2GAHB 3P4RA 3SZWA 3UTFA 1JU2A 3LZWA 1CJCA 2PYXA 3D8XA 1GETA 3CPIG 4DSHA 3UKHA 1OJAA 3QSSA 1GSNA 1GTEA 4UDPA 1CC4A 1MXTA 4AOXA 4B67A 3BHFA 2BK4A 3H4KA 2ARDA 2XFQA 2CULA 2FJEA 3F8RA 4NTDA 4BK3A 3QJ4A 3PO7A 3VR9A 4GDEA 1NEKA 1OJTA 4A99A 4DSGA 1DJQA 2BS4A 2XLTA 2OA1A 3F8DA 3UKLA 1H83A 2QA2A 4X9NA 2Q0LA 2BS2A 2YVFA 3IC9A 2V6OA 3FPZA 4U8OA 3C96A 4JY2A 4WX1A 1FCDA 1TYPA 4ICYA 2DKHA 4DNAA 4IVMB 5CQFA 4YKGA 1PJ7A 1CJ2A 1KNRA 1GERA 3GYXA 4B64A 1KSSA 4CBQA 4EQXA 2C65A 4U8NA 1CBOA 2XLSA 5KMQA 3QFBA 2R4JA 2VQ7A 5C3JA 1BKWA 3T37A 3AYIA 1ZOVA 4Z44A 1YKJA 2C70A 2X99A 3NLCA 2YM2A 3T2ZA 3GD3A 1NHQA 2GR1A 2VQBA 4MJWA 2VOUA 4USRA 4C5OA 4IV9A 1NG3A 3CPHG 2W0HA 3VRAA 5FS6A 4O5UA 5KMPA 2C67A 2V60A 4B63A 3KU9A 2WP9A 5CKUA 1VRQB 3UTGA 3CNPA 3CNDA 4TM3A 4A79A 1E1NA 1W4XA 3DJDA 3FMWA 3GDNA 4EMWA 2BC1A 4B68A 4Z2TA 5KOWA 4BK2A 3H8IA 2YVGA 1GT8A 4EQSA 3IF9A 3NN6X 1TDOA 2JBVA 3BHKA 2V61A 2AAQA 3FIMB 3AE9A 5KVHA 2JK6A 4NWZA 1F3PA 3R9UA 3V76A 1VDCA 2H88A 1EL5A 3HYXA 3GRTA 3NTDA 1FEAA 2YAUA 3ICRA 4H2RA 3UTHA 5HHFA 3AE3A 1K0JA 1LPFA 1X31B 2WOWA 4EM4A 1H6VA 4YT0A 5KVIA 1CF3A 3DA1A 3DGHA 1ONFA 4AT0A 4YSYA 2TMDA 2VRLA 3JSKA 2OAMA 2GF3A 3AD9B 3AEBA 3P4QA 4K2XA 3G5RA 1D7YA 2YG3A 3P4PA 4H4VA 2FJBA 3H8LA 4CCRA 1KFYA 2GR3A 2VZ2A 2BCGG 1YQ3A 4H4WA 2ZZ0A 5KWFA 1LQTA 3UP5A 3NH3X 1PJ6A 2WU2A 2BCPA 2GVCA 2YQUA 1S2YA 4A9WA 1B4VA 1GRFA 1D4CA 1ZDLA 3CNTA 1ZOYA 4BJZA 2Y6QA 4Z24A 1MOKA 4J56A 4OCGA 2QA1A 1YY5A 2I0ZA 3QFAA 3DJEA 2NVKX 4II3A 4C74A 2GQWA 3UOVA 4X9MA 1PXAA 3UCLA 1TDKA 2YWLA 1D4DA 3NYCA 2R46A 4JQ9A 3AE8A 3KPFA 4H4QA 5KXJA 1D5TA 1D4EA 2YR5A 1BWCA 4OPTA 3LXDA 1TDFA 4YSZA 1E1LA 4EM3A 3KVEA 3SXIA 1KSUA 4EIPA 1B5QA 2EQ6A 4TM4A 2J3NA 2R4EA 3ITJA 2GMJA 4GDPA 3K7TA 5EB4A 5BULA 2YLWA 1GRTA 1M6IA 3ALMA 5HXIA 1Y56A 3Q6JA 1M64A 2WU5A 5TR3A 3ABVA 4A6NA 1DOCA 3DGZA 4H4ZA 4AOSA 4HA6A 3M13A 4KX6A 3RP6A 1L9DA 3UKPA 3UKAA 2BXSA 2YLSA 1PBEA 1GOSA 4B1BA 3NKSA 4YTNA 3NK0X 2XLPA 1AOGA 3NG7X 2X8CA 1PXCA 2BS3A 3LADA 2WS3A 2BA9A 5GRTA 3P9UA 3IWAA 3PS9A 1GNDA 4IVOB 3CGCA 4II2A 5C2TA 1S3EA 5LV9A 1L9CA 1B37A 1FECA 1ZMDA 2XFPA 3RP8A 2JB2A 3FBSA 4I59A 4YSHA 2CDUA 3S61A 2UZZA 4AP3A 3GWFA 3AE2A 3HZLA 1N4VA 2RGOA 4GCMA 1E1MA 1IJHA 4D03A 4G6GA 1NHRA 2WPEA 3CTYA 3G5QA 4H4UA 1P2EA 4XXGA 2H89A 5J60A 3BI2A 2E1MA 4H4YA 1YQZA 4RSLA 5KMRA 2R0CA 1ELIA 3CPJG 4NTEA 3ATRA 1IUSA 2GH5A 1BZLA 4J34A 4EMIA 1GRGA 1EL7A 3K30A 1IUXA 2C4CA 2HQMA 4Z43A 2XVFA 3ALLA 4C77A 1H7WA 1CHUA 1TYTA 2V5ZA 3AD8B 3AEGA 2RGHA 4A5LA 4UDQA 1NENA 3II4A 1H7XA 4A65A 4EQWA 2WDRA 2EQ9A 4YSXA 5BVAA 4B69A 4YXDA 5FS8A 1S3BA 3WE0A 3SQPA 5M10A 4EIQA 5EOWA 2YLXA 4LA1A 2YG5A 5KMSA 2XLUA 3FG2P 2QCUA 2YR4A 1F8RA 2XVHA 3ICTA 4HB9A 4J2WA 1L0VA 3DJJA 1GEUA 2YM1A 4H2QA 4NEWA 3V3NA 5FMHA 1UKVG 3NGCX 4Y4NA 1E39A 3NT6A 3DK9A 1PBDA 1O5WA 3GMBA 2FJAA 3D1CA 5EB5A 2QAEA 2WDQA 2A8XA 2Y6RA 2EQ8A 2CVJA 4CNJA 4H4XA 1JRYA 1ZKQA 1PHHA 1RP0A 1IUUA 2VVLA 3LZXA 2XVJA 3ISHA 1K0LA 1E6EA 3NYEA 3PVCA 2XFNA 3KKJA 2XYOA 2V3BA 3Q9TA 1VG9A 3LB8A 2C3CA 4G6HA 1DOEA 2E5VA 3DJGX 4H4PA 1Q1WA 3VRBA 1NG4A 4H7UA 3SM8A 2IVDA 2C75A 1KF6A 3E1TA 3RHAA 2JKCA 3CMMA 4GUVA 4TLZA 2X8GA 2GQFA 4C3XA 3EPTA 3OC4A 1FOHA 2WBAA 4LIIA 2BK3A 1CC2A 4EQRA 3CGBA 1LJ1A 2VRMA 1SEZA 4FK1A 3UP4A 3T2KA 2B9XA 1NDAA 2YLZA 1JNRA 2ZZBA 4IA5A 2C3DA 2WPFA 1NAAA 3AXBA 2FJDA 4XWRA 1RYIA 2XFOA 2IIDA 1JEHA 2GB0A 4B66A 1PXBA 1JRXA 1K4QA 4YWOA 3NYFA 4OPCA 2AR8A 1PJ5A 1TRBA 1Q1RA 2BXRA 4LU6A 2R45A 4IA6A 1V59A 5EBKA 3QSEA 1FEBA 2Q6UA 2BYBA 3BNMA 3EF6A 4APNA 2APGA 2WOVA 3O0HA 4U8LA 5U63A 1H81A 3SY4A 3QVPA 1GPEA 2AQJA 4ZCCA 3P1WA 3M12A 2JAEA 1OJDA 3B6DA 1TDNA 4ECHA 1CC6A 4UP3A 2VVLG 3NTAA 3NNEA 4PABA 2FBWA 3AE1A 1Q9IA 2GV8A 4Z26A 1KDGA 3V3OA 2DKIA 3CGEA 2GR0A 2XFUA 2O9ZA 4JNAA 4K7ZA 5HY5A 4P9SA 5KRQA 3NK1X 3P4SA 2WESA 2YLRA 3UOXA 4WCTA 5IPYA 2F5ZA 1GESA 2BACA 3ALJA 3T2YA 1E7PA 2Z5YA 3AEEA 3AEFA 1GRHA 2CFYA 5JCNA 3AE7A 3NK2X 1ZP0A 4XWZA 2C64A 1P2HA 1PBFA 3AEAA 3CIRA 4Z2RA 2OLNA 1Z6LA 3DH9A 1BGNA 1L9EA 2WDVA 4YTPA 4CY8A 1N1PA 2YLTA 4DGKA 3GDPA 1XPQA 1EL9A 3KPKA 4YKFA 3GRSA 3RNMA 1GXFA 3DMEA 1N4UA 4X4JA 4U8PA 4A7AA 1DJNA 2GRTA 3NHOX 4JN9A 4Y4MA 1VG0A 1H86A 4UDRA 3AD7B 1DNCA 2BC0A 4NNJA 1DOBA 2WQYA 4U8MA 3ZYXA 3URHA 3BI5A 4U2SA 1COYA 1BF3A 3GSIA 2RGJA 4JNQA 5M0ZA 4Z2UA 4H2NA 2XVEA 3SFEA 5IQ1A 3GYJA 4OPIA 4BV6A 2PHHA 2WHDA 2X8HA 2BABA 2BK5A 3GWDA 1JNZA 2R0GA 1OJ9A 4I58A 2R9ZA 4AP1A 1CJ4A 2WEUA 2EQ7A 3NRNA 4K22A 4U8KA 1D7LA 2WETA 1PBCA 3SZ0A 3CNSA 2C66A 4J31A 2Q0KA 3NN0X 1DXLA 3UOYA 4BK1A 4CY6A 3HYVA 4OPDA 4GF7A 1LQUA 2OLOA 4NZHA 3AECA 3T0KA 1O94A 2YG6A 2B9YA 4ZCDA 1ZX9A 3AE4A 3AE5A 3AB1A 2A89A 4OPUA 1ZMCA 3VQRA 2WOIA 3L8KA 4H2PA 1JRZA 3EAOA 1F6MA 3ATQA 4GR1A 3B3RA 4H4TA 4JY3A 4Y4LA 3ZDNA 1IUTA 3M0OA 1OJCA 2C7GA 3AWIA 2A87A 1YQ4A 2GAGB 4CRTA 3I6DA 5JCLA 2NPXA 1F8SA 5FS9A 3COXA 1K0IA 2ZBWA 3IHGA 1QJDA 1B8SA 1PS9A 4JDRA 3OZ2A 1LTXR 2R0PA 2GR2A 1KNPA 2YR6A 2X50A 1E1KA 2WP5A 3GMCA 3QSMA 4K5SA 4TM0A 3UTEA 4RG4A 5HYMA 4U2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT2 A;  1LVL A;  4N9X A;  1REO A;  4U2L A;  3AED A;  1TDE A;  3GYI A;  1CL0 A;  2Z5X A;  4H4S A;  1Y56 B;  4M52 A;  2C72 A;  3AYL A;  1QLB A;  1N4W A;  2B9W A;  3SGL A;  4C3Y A;  1Y0P A;  3I3L A;  4A6N B;  3RP7 A;  1QO8 A;  5BRT A;  1FL2 A;  4U8J A;  1NHP A;  3UKQ A;  4J57 A;  2X3N A;  3F8P A;  3KA7 A;  2V3A A;  3BNU A;  3EAN A;  5JCM A;  1H82 A;  5L46 A;  2GMH A;  3CGD A;  1IUW A;  2XDO A;  4CCQ A;  4USQ A;  2YG7 A;  2YVJ A;  4TM1 A;  4YTM A;  3K7Q X;  5J7X A;  5FS7 A;  4J33 A;  5GSN A;  1PDH A;  2C73 A;  3S5W A;  4U8I A;  2B7S A;  2WP6 A;  3KLJ A;  1GRE A;  3K7M X;  1BGJ A;  1PN0 A;  1ZY8 A;  2YG4 A;  4OPL A;  4RG3 A;  3C4A A;  1MO9 A;  1XHC A;  2C76 A;  2XVI A;  1O95 A;  3UKF A;  4NTC A;  4K8D A;  2Q7V A;  4FDC B;  3ICS A;  1RSG A;  1ZK7 A;  1NHS A;  4FX9 A;  3VRD B;  4K5R A;  1GRB A;  1CJ3 A;  5U25 A;  4O5Q A;  3NIX A;  5BUK A;  3DK4 A;  2ZZC A;  2B7R A;  4B65 A;  4FK1 C;  2IVE A;  4BUR A;  3IHM A;  4GRT A;  2VVM A;  3KD9 A;  1HYU A;  4ADW A;  5U1O A;  4D04 A;  1NPX A;  2RAB A;  3CN8 A;  1DOD A;  4H50 A;  3AE6 A;  5ER0 A;  2E4G A;  1LV0 A;  4EMJ A;  4H4R A;  1GV4 A;  3SFD A;  1PBB A;  4REK A;  3AYJ A;  4Z25 A;  2XLR A;  2JB3 A;  4OPG A;  4BJY A;  5IQ4 A;  3DK8 A;  1F8W A;  4TLX A;  5KOX A;  4CNK A;  1IUV A;  3L1R A;  3UOZ A;  1H84 A;  3VR8 A;  2ACZ A;  2TPR A;  1GAL A;  4OVI A;  2OAL A;  3RED A;  4KPR A;  1XDI A;  3ADA B;  2B76 A;  1XAN A;  2XCG A;  4J36 A;  1GRA A;  4PAA A;  1S2Q A;  2GEW A;  3LJP A;  3QVR A;  1GTH A;  3UKK A;  3GD4 A;  5JCI A;  1VQW A;  1EBD A;  4ZN0 A;  1EL8 A;  3CNJ A;  3BI4 A;  2WPC A;  3LOV A;  2JB1 A;  5DBJ A;  4E0V A;  1JOA A;  3G5S A;  3C4N A;  5JCK A;  4NEV A;  2GAH B;  3P4R A;  3UTF A;  1JU2 A;  3LZW A;  1CJC A;  2PYX A;  3D8X A;  1GET A;  3CPI G;  4DSH A;  3UKH A;  1OJA A;  3QSS A;  1GSN A;  1GTE A;  4UDP A;  1CC4 A;  1MXT A;  4AOX A;  4B67 A;  3BHF A;  2BK4 A;  3H4K A;  2ARD A;  2XFQ A;  2CUL A;  2FJE A;  3F8R A;  4NTD A;  4BK3 A;  3QJ4 A;  3PO7 A;  3VR9 A;  4GDE A;  1NEK A;  1OJT A;  4A99 A;  4DSG A;  1DJQ A;  2BS4 A;  2XLT A;  2OA1 A;  3F8D A;  3UKL A;  1H83 A;  2QA2 A;  4X9N A;  2Q0L A;  2BS2 A;  2YVF A;  3IC9 A;  2V6O A;  3FPZ A;  4U8O A;  3C96 A;  4JY2 A;  4WX1 A;  1FCD A;  1TYP A;  4ICY A;  2DKH A;  4DNA A;  4IVM B;  5CQF A;  4YKG A;  1PJ7 A;  1CJ2 A;  1KNR A;  1GER A;  4B64 A;  1KSS A;  4CBQ A;  4EQX A;  2C65 A;  4U8N A;  1CBO A;  2XLS A;  3QFB A;  2R4J A;  2VQ7 A;  5C3J A;  1BKW A;  3T37 A;  3AYI A;  1ZOV A;  4Z44 A;  1YKJ A;  2C70 A;  2X99 A;  3NLC A;  2YM2 A;  3GD3 A;  1NHQ A;  2GR1 A;  2VQB A;  4MJW A;  2VOU A;  4USR A;  4C5O A;  4IV9 A;  1NG3 A;  3CPH G;  2W0H A;  3VRA A;  5FS6 A;  4O5U A;  2C67 A;  2V60 A;  4B63 A;  3KU9 A;  2WP9 A;  5CKU A;  1VRQ B;  3UTG A;  3CNP A;  3CND A;  4TM3 A;  4A79 A;  1E1N A;  1W4X A;  3DJD A;  3FMW A;  3GDN A;  4EMW A;  2BC1 A;  4B68 A;  4Z2T A;  5KOW A;  4BK2 A;  3H8I A;  2YVG A;  1GT8 A;  4EQS A;  3IF9 A;  3NN6 X;  1TDO A;  2JBV A;  3BHK A;  2V61 A;  2AAQ A;  3FIM B;  3AE9 A;  5KVH A;  2JK6 A;  3R9U A;  1F3P A;  3V76 A;  1VDC A;  2H88 A;  1EL5 A;  3NTD A;  3GRT A;  3UTH A;  1FEA A;  2YAU A;  3ICR A;  4H2R A;  5HHF A;  3AE3 A;  1K0J A;  1LPF A;  1X31 B;  2WOW A;  4EM4 A;  1H6V A;  4YT0 A;  5KVI A;  1CF3 A;  3DA1 A;  3DGH A;  1ONF A;  4AT0 A;  4YSY A;  2TMD A;  2VRL A;  3JSK A;  2OAM A;  2GF3 A;  3AD9 B;  3AEB A;  3P4Q A;  4K2X A;  3G5R A;  1D7Y A;  2YG3 A;  3P4P A;  4H4V A;  2FJB A;  3H8L A;  4CCR A;  1KFY A;  2GR3 A;  2VZ2 A;  2BCG G;  1YQ3 A;  4H4W A;  2ZZ0 A;  5KWF A;  1LQT A;  3UP5 A;  3NH3 X;  1PJ6 A;  2WU2 A;  2BCP A;  2GVC A;  2YQU A;  1S2Y A;  4A9W A;  1B4V A;  1GRF A;  1D4C A;  1ZDL A;  3CNT A;  1ZOY A;  4BJZ A;  2Y6Q A;  4Z24 A;  1MOK A;  4J56 A;  4OCG A;  2QA1 A;  1YY5 A;  2I0Z A;  3QFA A;  3DJE A;  2NVK X;  4C74 A;  2GQW A;  3UOV A;  4X9M A;  1PXA A;  3UCL A;  1TDK A;  2YWL A;  1D4D A;  3NYC A;  2R46 A;  4JQ9 A;  3AE8 A;  3KPF A;  4H4Q A;  5KXJ A;  1D5T A;  1D4E A;  2YR5 A;  1BWC A;  4OPT A;  3LXD A;  1TDF A;  4YSZ A;  1E1L A;  4EM3 A;  3KVE A;  4EIP A;  1KSU A;  1B5Q A;  2EQ6 A;  4TM4 A;  2J3N A;  2R4E A;  3ITJ A;  2GMJ A;  4GDP A;  3K7T A;  5EB4 A;  5BUL A;  2YLW A;  1GRT A;  1M6I A;  3ALM A;  5HXI A;  1Y56 A;  3Q6J A;  1M64 A;  2WU5 A;  5TR3 A;  3ABV A;  4A6N A;  1DOC A;  3DGZ A;  4H4Z A;  4AOS A;  4HA6 A;  3M13 A;  4KX6 A;  3RP6 A;  1L9D A;  3UKP A;  3UKA A;  2BXS A;  2YLS A;  1PBE A;  1GOS A;  4B1B A;  3NKS A;  4YTN A;  3NK0 X;  2XLP A;  1AOG A;  3NG7 X;  2X8C A;  1PXC A;  2BS3 A;  3LAD A;  2WS3 A;  2BA9 A;  5GRT A;  3P9U A;  3IWA A;  3PS9 A;  1GND A;  4IVO B;  3CGC A;  5C2T A;  1S3E A;  5LV9 A;  1L9C A;  1B37 A;  1FEC A;  1ZMD A;  2XFP A;  3RP8 A;  2JB2 A;  3FBS A;  4I59 A;  4YSH A;  2CDU A;  3S61 A;  2UZZ A;  4AP3 A;  3GWF A;  3AE2 A;  3HZL A;  1N4V A;  2RGO A;  4GCM A;  1E1M A;  1IJH A;  4D03 A;  4H4U A;  1NHR A;  2WPE A;  3CTY A;  3G5Q A;  1P2E A;  4XXG A;  2H89 A;  5J60 A;  3BI2 A;  2E1M A;  4H4Y A;  1YQZ A;  4RSL A;  2R0C A;  1ELI A;  3CPJ G;  4NTE A;  3ATR A;  1IUS A;  2GH5 A;  1BZL A;  4J34 A;  4EMI A;  1GRG A;  1EL7 A;  3K30 A;  1IUX A;  2HQM A;  4Z43 A;  2XVF A;  3ALL A;  4C77 A;  1H7W A;  1CHU A;  1TYT A;  2V5Z A;  3AD8 B;  3AEG A;  2RGH A;  4A5L A;  4UDQ A;  1NEN A;  3II4 A;  1H7X A;  4A65 A;  4EQW A;  2WDR A;  2EQ9 A;  4YSX A;  5BVA A;  4B69 A;  4YXD A;  5FS8 A;  1S3B A;  3WE0 A;  3SQP A;  5M10 A;  4EIQ A;  5EOW A;  2YLX A;  4LA1 A;  2YG5 A;  2XLU A;  3FG2 P;  2QCU A;  2YR4 A;  1F8R A;  2XVH A;  3ICT A;  4HB9 A;  4J2W A;  1L0V A;  3DJJ A;  1GEU A;  2YM1 A;  4H2Q A;  4NEW A;  3V3N A;  5FMH A;  1UKV G;  3NGC X;  4Y4N A;  1E39 A;  3NT6 A;  3DK9 A;  1PBD A;  1O5W A;  3GMB A;  2FJA A;  3D1C A;  5EB5 A;  2QAE A;  2WDQ A;  2A8X A;  2Y6R A;  2EQ8 A;  2CVJ A;  4CNJ A;  4H4X A;  1JRY A;  1ZKQ A;  1PHH A;  1RP0 A;  1IUU A;  2VVL A;  3LZX A;  2XVJ A;  3ISH A;  1K0L A;  1E6E A;  3NYE A;  3PVC A;  2XFN A;  3KKJ A;  2XYO A;  2V3B A;  3Q9T A;  1VG9 A;  3LB8 A;  2C3C A;  1DOE A;  2E5V A;  3DJG X;  4H4P A;  1Q1W A;  3VRB A;  1NG4 A;  4H7U A;  3SM8 A;  2IVD A;  2C75 A;  1KF6 A;  3E1T A;  3RHA A;  2JKC A;  4GUV A;  4TLZ A;  2X8G A;  2GQF A;  4C3X A;  3EPT A;  3OC4 A;  1FOH A;  2WBA A;  4LII A;  2BK3 A;  1CC2 A;  4EQR A;  3CGB A;  1LJ1 A;  2VRM A;  1SEZ A;  4FK1 A;  3UP4 A;  2B9X A;  1NDA A;  2YLZ A;  1JNR A;  2ZZB A;  4IA5 A;  2C3D A;  2WPF A;  1NAA A;  3AXB A;  2FJD A;  4XWR A;  1RYI A;  2XFO A;  2IID A;  1JEH A;  2GB0 A;  4B66 A;  1PXB A;  1JRX A;  1K4Q A;  4YWO A;  3NYF A;  4OPC A;  2AR8 A;  1PJ5 A;  1TRB A;  1Q1R A;  2BXR A;  4LU6 A;  2R45 A;  4IA6 A;  1V59 A;  5EBK A;  3QSE A;  1FEB A;  2Q6U A;  2BYB A;  3BNM A;  3EF6 A;  4APN A;  2APG A;  2WOV A;  3O0H A;  4U8L A;  5U63 A;  1H81 A;  3QVP A;  1GPE A;  2AQJ A;  4ZCC A;  3P1W A;  3M12 A;  2JAE A;  1OJD A;  3B6D A;  1TDN A;  4ECH A;  1CC6 A;  4UP3 A;  2VVL G;  3NTA A;  3NNE A;  4PAB A;  2FBW A;  3AE1 A;  1Q9I A;  2GV8 A;  4Z26 A;  1KDG A;  3V3O A;  2DKI A;  3CGE A;  2GR0 A;  2XFU A;  2O9Z A;  4JNA A;  4K7Z A;  5HY5 A;  4P9S A;  5KRQ A;  3NK1 X;  3P4S A;  2WES A;  2YLR A;  3UOX A;  4WCT A;  5IPY A;  2F5Z A;  1GES A;  2BAC A;  3ALJ A;  1E7P A;  2Z5Y A;  3AEE A;  3AEF A;  1GRH A;  2CFY A;  5JCN A;  3AE7 A;  3NK2 X;  1ZP0 A;  4XWZ A;  2C64 A;  1P2H A;  1PBF A;  3AEA A;  3CIR A;  4Z2R A;  2OLN A;  1Z6L A;  3DH9 A;  1BGN A;  1L9E A;  2WDV A;  4YTP A;  4CY8 A;  1N1P A;  2YLT A;  4DGK A;  3GDP A;  1XPQ A;  1EL9 A;  4YKF A;  3GRS A;  3RNM A;  1GXF A;  3DME A;  1N4U A;  4X4J A;  4U8P A;  4A7A A;  1DJN A;  2GRT A;  3NHO X;  4JN9 A;  4Y4M A;  1VG0 A;  1H86 A;  4UDR A;  3AD7 B;  1DNC A;  2BC0 A;  1DOB A;  2WQY A;  4U8M A;  3ZYX A;  3URH A;  3BI5 A;  4U2S A;  1COY A;  1BF3 A;  3GSI A;  2RGJ A;  4JNQ A;  5M0Z A;  4Z2U A;  4H2N A;  2XVE A;  3SFE A;  5IQ1 A;  3GYJ A;  4OPI A;  4BV6 A;  2PHH A;  2WHD A;  2X8H A;  2BAB A;  2BK5 A;  3GWD A;  1JNZ A;  2R0G A;  1OJ9 A;  4I58 A;  2R9Z A;  4AP1 A;  1CJ4 A;  2WEU A;  2EQ7 A;  3NRN A;  4K22 A;  4U8K A;  1D7L A;  2WET A;  1PBC A;  3CNS A;  2C66 A;  4J31 A;  2Q0K A;  3NN0 X;  1DXL A;  3UOY A;  4BK1 A;  4CY6 A;  4OPD A;  4GF7 A;  1LQU A;  2OLO A;  4NZH A;  3AEC A;  1O94 A;  2YG6 A;  2B9Y A;  4ZCD A;  1ZX9 A;  3AE4 A;  3AE5 A;  3AB1 A;  2A89 A;  4OPU A;  1ZMC A;  3VQR A;  2WOI A;  3L8K A;  4H2P A;  1JRZ A;  3EAO A;  1F6M A;  3ATQ A;  4GR1 A;  3B3R A;  4H4T A;  4JY3 A;  4Y4L A;  3ZDN A;  1IUT A;  3M0O A;  1OJC A;  2C7G A;  3AWI A;  2A87 A;  1YQ4 A;  2GAG B;  4CRT A;  3I6D A;  5JCL A;  2NPX A;  1F8S A;  5FS9 A;  3COX A;  1K0I A;  2ZBW A;  3IHG A;  1QJD A;  1B8S A;  1PS9 A;  4JDR A;  3OZ2 A;  1LTX R;  2R0P A;  2GR2 A;  1KNP A;  2YR6 A;  2X50 A;  1E1K A;  2WP5 A;  3GMC A;  3QSM A;  4K5S A;  4TM0 A;  3UTE A;  4RG4 A;  5HYM A;  4U2T A; 
#chains in the Genus database with same CATH topology
 4AT2 A;  1LVL A;  4N9X A;  1REO A;  4U2L A;  3AED A;  1TDE A;  3GYI A;  1CL0 A;  2Z5X A;  4H4S A;  3SYI A;  1Y56 B;  4M52 A;  2C72 A;  3AYL A;  1QLB A;  1N4W A;  2B9W A;  3SGL A;  4C3Y A;  1Y0P A;  3I3L A;  4A6N B;  3RP7 A;  1QO8 A;  4G73 A;  5BRT A;  1FL2 A;  4G9K A;  4U8J A;  1NHP A;  3UKQ A;  4J57 A;  2X3N A;  3F8P A;  3KA7 A;  2V3A A;  3BNU A;  3EAN A;  5JCM A;  1H82 A;  5L46 A;  2GMH A;  3CGD A;  1IUW A;  2XDO A;  4CCQ A;  4G74 A;  4USQ A;  2YG7 A;  2YVJ A;  3HYW A;  4TM1 A;  3K7Q X;  4YTM A;  5FS7 A;  5J7X A;  3SZF A;  4J33 A;  5GSN A;  1PDH A;  2C73 A;  3S5W A;  3T31 A;  4U8I A;  2B7S A;  2WP6 A;  3KLJ A;  1GRE A;  3K7M X;  1BGJ A;  1PN0 A;  1ZY8 A;  2YG4 A;  4OPL A;  4RG3 A;  3C4A A;  1MO9 A;  1XHC A;  2C76 A;  2XVI A;  1O95 A;  4GAV A;  3UKF A;  4NTC A;  4K8D A;  2Q7V A;  4FDC B;  3ICS A;  1RSG A;  1ZK7 A;  1NHS A;  4FX9 A;  3VRD B;  5KNL A;  4K5R A;  1GRB A;  1CJ3 A;  5U25 A;  4O5Q A;  3NIX A;  5BUK A;  3DK4 A;  2ZZC A;  2B7R A;  4B65 A;  4FK1 C;  2IVE A;  4BUR A;  3IHM A;  4GRT A;  2VVM A;  3KD9 A;  1HYU A;  4ADW A;  5U1O A;  4D04 A;  3SX6 A;  1NPX A;  2RAB A;  3CN8 A;  1DOD A;  4H50 A;  3AE6 A;  5ER0 A;  2E4G A;  1LV0 A;  3SZC A;  4EMJ A;  4H4R A;  1GV4 A;  3SFD A;  1PBB A;  4REK A;  3AYJ A;  4Z25 A;  2XLR A;  2JB3 A;  4OPG A;  4BJY A;  5IQ4 A;  3DK8 A;  1F8W A;  4TLX A;  5KOX A;  4CNK A;  1IUV A;  3L1R A;  3UOZ A;  1H84 A;  3VR8 A;  2ACZ A;  4GAP A;  2TPR A;  1GAL A;  4OVI A;  2OAL A;  3RED A;  4KPR A;  1XDI A;  3ADA B;  3T14 A;  2B76 A;  1XAN A;  2XCG A;  4J36 A;  1GRA A;  4PAA A;  1S2Q A;  2GEW A;  3LJP A;  3QVR A;  1GTH A;  3UKK A;  3GD4 A;  5JCI A;  1VQW A;  1EBD A;  4ZN0 A;  2BRY A;  1EL8 A;  3CNJ A;  3BI4 A;  2WPC A;  2BRA A;  2JB1 A;  3LOV A;  5DBJ A;  4E0V A;  1JOA A;  3G5S A;  3C4N A;  5JCK A;  4NEV A;  2GAH B;  3P4R A;  3SZW A;  3UTF A;  1JU2 A;  3LZW A;  1CJC A;  2PYX A;  3D8X A;  1GET A;  3CPI G;  4DSH A;  3UKH A;  1OJA A;  3QSS A;  1GSN A;  1GTE A;  4UDP A;  1CC4 A;  1MXT A;  4AOX A;  4B67 A;  3BHF A;  2BK4 A;  3H4K A;  2ARD A;  2XFQ A;  2CUL A;  2FJE A;  3F8R A;  4NTD A;  4BK3 A;  3QJ4 A;  3PO7 A;  3VR9 A;  4GDE A;  1NEK A;  1OJT A;  4A99 A;  4DSG A;  1DJQ A;  2BS4 A;  2XLT A;  2OA1 A;  3F8D A;  3UKL A;  1H83 A;  2QA2 A;  4X9N A;  2Q0L A;  2BS2 A;  2YVF A;  3IC9 A;  2V6O A;  3FPZ A;  4U8O A;  3C96 A;  4JY2 A;  4WX1 A;  1FCD A;  1TYP A;  4ICY A;  2DKH A;  4DNA A;  4IVM B;  5CQF A;  4YKG A;  1PJ7 A;  1CJ2 A;  1KNR A;  1GER A;  3GYX A;  4B64 A;  1KSS A;  4CBQ A;  4EQX A;  2C65 A;  4U8N A;  1CBO A;  2XLS A;  5KMQ A;  3QFB A;  2R4J A;  2VQ7 A;  5C3J A;  1BKW A;  3T37 A;  3AYI A;  1ZOV A;  4Z44 A;  1YKJ A;  2C70 A;  2X99 A;  3NLC A;  2YM2 A;  3T2Z A;  3GD3 A;  1NHQ A;  2GR1 A;  2VQB A;  4MJW A;  2VOU A;  4USR A;  4C5O A;  4IV9 A;  1NG3 A;  3CPH G;  2W0H A;  3VRA A;  5FS6 A;  4O5U A;  5KMP A;  2C67 A;  2V60 A;  4B63 A;  3KU9 A;  2WP9 A;  5CKU A;  1VRQ B;  3UTG A;  3CNP A;  3CND A;  4TM3 A;  4A79 A;  1E1N A;  1W4X A;  3DJD A;  3FMW A;  3GDN A;  4EMW A;  2BC1 A;  4B68 A;  4Z2T A;  5KOW A;  4BK2 A;  3H8I A;  2YVG A;  1GT8 A;  4EQS A;  3IF9 A;  3NN6 X;  1TDO A;  2JBV A;  3BHK A;  2V61 A;  2AAQ A;  3FIM B;  3AE9 A;  5KVH A;  2JK6 A;  4NWZ A;  1F3P A;  3R9U A;  3V76 A;  1VDC A;  2H88 A;  1EL5 A;  3HYX A;  3GRT A;  3NTD A;  1FEA A;  2YAU A;  3ICR A;  4H2R A;  3UTH A;  5HHF A;  3AE3 A;  1K0J A;  1LPF A;  1X31 B;  2WOW A;  4EM4 A;  1H6V A;  4YT0 A;  5KVI A;  1CF3 A;  3DA1 A;  3DGH A;  1ONF A;  4AT0 A;  4YSY A;  2TMD A;  2VRL A;  3JSK A;  2OAM A;  2GF3 A;  3AD9 B;  3AEB A;  3P4Q A;  4K2X A;  3G5R A;  1D7Y A;  2YG3 A;  3P4P A;  4H4V A;  2FJB A;  3H8L A;  4CCR A;  1KFY A;  2GR3 A;  2VZ2 A;  2BCG G;  1YQ3 A;  4H4W A;  2ZZ0 A;  5KWF A;  1LQT A;  3UP5 A;  3NH3 X;  1PJ6 A;  2WU2 A;  2BCP A;  2GVC A;  2YQU A;  1S2Y A;  4A9W A;  1B4V A;  1GRF A;  1D4C A;  1ZDL A;  3CNT A;  1ZOY A;  4BJZ A;  2Y6Q A;  4Z24 A;  1MOK A;  4J56 A;  4OCG A;  2QA1 A;  1YY5 A;  2I0Z A;  3QFA A;  3DJE A;  2NVK X;  4II3 A;  4C74 A;  2GQW A;  3UOV A;  4X9M A;  1PXA A;  3UCL A;  1TDK A;  2YWL A;  1D4D A;  3NYC A;  2R46 A;  4JQ9 A;  3AE8 A;  3KPF A;  4H4Q A;  5KXJ A;  1D5T A;  1D4E A;  2YR5 A;  1BWC A;  4OPT A;  3LXD A;  1TDF A;  4YSZ A;  1E1L A;  4EM3 A;  3KVE A;  3SXI A;  1KSU A;  4EIP A;  1B5Q A;  2EQ6 A;  4TM4 A;  2J3N A;  2R4E A;  3ITJ A;  2GMJ A;  4GDP A;  3K7T A;  5EB4 A;  5BUL A;  2YLW A;  1GRT A;  1M6I A;  3ALM A;  5HXI A;  1Y56 A;  3Q6J A;  1M64 A;  2WU5 A;  5TR3 A;  3ABV A;  4A6N A;  1DOC A;  3DGZ A;  4H4Z A;  4AOS A;  4HA6 A;  3M13 A;  4KX6 A;  3RP6 A;  1L9D A;  3UKP A;  3UKA A;  2BXS A;  2YLS A;  1PBE A;  1GOS A;  4B1B A;  3NKS A;  4YTN A;  3NK0 X;  2XLP A;  1AOG A;  3NG7 X;  2X8C A;  1PXC A;  2BS3 A;  3LAD A;  2WS3 A;  2BA9 A;  5GRT A;  3P9U A;  3IWA A;  3PS9 A;  1GND A;  4IVO B;  3CGC A;  4II2 A;  5C2T A;  1S3E A;  5LV9 A;  1L9C A;  1B37 A;  1FEC A;  1ZMD A;  2XFP A;  3RP8 A;  2JB2 A;  3FBS A;  4I59 A;  4YSH A;  2CDU A;  3S61 A;  2UZZ A;  4AP3 A;  3GWF A;  3AE2 A;  3HZL A;  1N4V A;  2RGO A;  4GCM A;  1E1M A;  1IJH A;  4D03 A;  4G6G A;  1NHR A;  2WPE A;  3CTY A;  3G5Q A;  4H4U A;  1P2E A;  4XXG A;  2H89 A;  5J60 A;  3BI2 A;  2E1M A;  4H4Y A;  1YQZ A;  4RSL A;  5KMR A;  2R0C A;  1ELI A;  3CPJ G;  4NTE A;  3ATR A;  1IUS A;  2GH5 A;  1BZL A;  4J34 A;  4EMI A;  1GRG A;  1EL7 A;  3K30 A;  1IUX A;  2C4C A;  2HQM A;  4Z43 A;  2XVF A;  3ALL A;  4C77 A;  1H7W A;  1CHU A;  1TYT A;  2V5Z A;  3AD8 B;  3AEG A;  2RGH A;  4A5L A;  4UDQ A;  1NEN A;  3II4 A;  1H7X A;  4A65 A;  4EQW A;  2WDR A;  2EQ9 A;  4YSX A;  5BVA A;  4B69 A;  4YXD A;  5FS8 A;  1S3B A;  3WE0 A;  3SQP A;  5M10 A;  4EIQ A;  5EOW A;  2YLX A;  4LA1 A;  2YG5 A;  5KMS A;  2XLU A;  3FG2 P;  2QCU A;  2YR4 A;  1F8R A;  2XVH A;  3ICT A;  4HB9 A;  4J2W A;  1L0V A;  3DJJ A;  1GEU A;  2YM1 A;  4H2Q A;  4NEW A;  3V3N A;  5FMH A;  1UKV G;  3NGC X;  4Y4N A;  1E39 A;  3NT6 A;  3DK9 A;  1PBD A;  1O5W A;  3GMB A;  2FJA A;  3D1C A;  5EB5 A;  2QAE A;  2WDQ A;  2A8X A;  2Y6R A;  2EQ8 A;  2CVJ A;  4CNJ A;  4H4X A;  1JRY A;  1ZKQ A;  1PHH A;  1RP0 A;  1IUU A;  2VVL A;  3LZX A;  2XVJ A;  3ISH A;  1K0L A;  1E6E A;  3NYE A;  3PVC A;  2XFN A;  3KKJ A;  2XYO A;  2V3B A;  3Q9T A;  1VG9 A;  3LB8 A;  2C3C A;  4G6H A;  1DOE A;  2E5V A;  3DJG X;  4H4P A;  1Q1W A;  3VRB A;  1NG4 A;  4H7U A;  3SM8 A;  2IVD A;  2C75 A;  1KF6 A;  3E1T A;  3RHA A;  2JKC A;  3CMM A;  4GUV A;  4TLZ A;  2X8G A;  2GQF A;  4C3X A;  3EPT A;  3OC4 A;  1FOH A;  2WBA A;  4LII A;  2BK3 A;  1CC2 A;  4EQR A;  3CGB A;  1LJ1 A;  2VRM A;  1SEZ A;  4FK1 A;  3UP4 A;  3T2K A;  2B9X A;  1NDA A;  2YLZ A;  1JNR A;  2ZZB A;  4IA5 A;  2C3D A;  2WPF A;  1NAA A;  3AXB A;  2FJD A;  4XWR A;  1RYI A;  2XFO A;  2IID A;  1JEH A;  2GB0 A;  4B66 A;  1PXB A;  1JRX A;  1K4Q A;  4YWO A;  3NYF A;  4OPC A;  2AR8 A;  1PJ5 A;  1TRB A;  1Q1R A;  2BXR A;  4LU6 A;  2R45 A;  4IA6 A;  1V59 A;  5EBK A;  3QSE A;  1FEB A;  2Q6U A;  2BYB A;  3BNM A;  3EF6 A;  4APN A;  2APG A;  2WOV A;  3O0H A;  4U8L A;  5U63 A;  1H81 A;  3SY4 A;  3QVP A;  1GPE A;  2AQJ A;  4ZCC A;  3P1W A;  3M12 A;  2JAE A;  1OJD A;  3B6D A;  1TDN A;  4ECH A;  1CC6 A;  4UP3 A;  2VVL G;  3NTA A;  3NNE A;  4PAB A;  2FBW A;  3AE1 A;  1Q9I A;  2GV8 A;  4Z26 A;  1KDG A;  3V3O A;  2DKI A;  3CGE A;  2GR0 A;  2XFU A;  2O9Z A;  4JNA A;  4K7Z A;  5HY5 A;  4P9S A;  5KRQ A;  3NK1 X;  3P4S A;  2WES A;  2YLR A;  3UOX A;  4WCT A;  5IPY A;  2F5Z A;  1GES A;  2BAC A;  3ALJ A;  3T2Y A;  1E7P A;  2Z5Y A;  3AEE A;  3AEF A;  1GRH A;  2CFY A;  5JCN A;  3AE7 A;  3NK2 X;  1ZP0 A;  4XWZ A;  2C64 A;  1P2H A;  1PBF A;  3AEA A;  3CIR A;  4Z2R A;  2OLN A;  1Z6L A;  3DH9 A;  1BGN A;  1L9E A;  2WDV A;  4YTP A;  4CY8 A;  1N1P A;  2YLT A;  4DGK A;  3GDP A;  1XPQ A;  1EL9 A;  3KPK A;  4YKF A;  3GRS A;  3RNM A;  1GXF A;  3DME A;  1N4U A;  4X4J A;  4U8P A;  4A7A A;  1DJN A;  2GRT A;  3NHO X;  4JN9 A;  4Y4M A;  1VG0 A;  1H86 A;  4UDR A;  3AD7 B;  1DNC A;  2BC0 A;  4NNJ A;  1DOB A;  2WQY A;  4U8M A;  3ZYX A;  3URH A;  3BI5 A;  4U2S A;  1COY A;  1BF3 A;  3GSI A;  2RGJ A;  4JNQ A;  5M0Z A;  4Z2U A;  4H2N A;  2XVE A;  3SFE A;  5IQ1 A;  3GYJ A;  4OPI A;  4BV6 A;  2PHH A;  2WHD A;  2X8H A;  2BAB A;  2BK5 A;  3GWD A;  1JNZ A;  2R0G A;  1OJ9 A;  4I58 A;  2R9Z A;  4AP1 A;  1CJ4 A;  2WEU A;  2EQ7 A;  3NRN A;  4K22 A;  4U8K A;  1D7L A;  2WET A;  1PBC A;  3SZ0 A;  3CNS A;  2C66 A;  4J31 A;  2Q0K A;  3NN0 X;  1DXL A;  3UOY A;  4BK1 A;  4CY6 A;  3HYV A;  4OPD A;  4GF7 A;  1LQU A;  2OLO A;  4NZH A;  3AEC A;  3T0K A;  1O94 A;  2YG6 A;  2B9Y A;  4ZCD A;  1ZX9 A;  3AE4 A;  3AE5 A;  3AB1 A;  2A89 A;  4OPU A;  1ZMC A;  3VQR A;  2WOI A;  3L8K A;  4H2P A;  1JRZ A;  3EAO A;  1F6M A;  3ATQ A;  4GR1 A;  3B3R A;  4H4T A;  4JY3 A;  4Y4L A;  3ZDN A;  1IUT A;  3M0O A;  1OJC A;  2C7G A;  3AWI A;  2A87 A;  1YQ4 A;  2GAG B;  4CRT A;  3I6D A;  5JCL A;  2NPX A;  1F8S A;  5FS9 A;  3COX A;  1K0I A;  2ZBW A;  3IHG A;  1QJD A;  1B8S A;  1PS9 A;  4JDR A;  3OZ2 A;  1LTX R;  2R0P A;  2GR2 A;  1KNP A;  2YR6 A;  2X50 A;  1E1K A;  2WP5 A;  3GMC A;  3QSM A;  4K5S A;  4TM0 A;  3UTE A;  4RG4 A;  5HYM A;  4U2T A; 
#chains in the Genus database with same CATH homology
 4AT2 A;  1LVL A;  4N9X A;  1REO A;  4U2L A;  3AED A;  1TDE A;  3GYI A;  1CL0 A;  2Z5X A;  4H4S A;  3SYI A;  1Y56 B;  4M52 A;  2C72 A;  3AYL A;  1QLB A;  1N4W A;  2B9W A;  3SGL A;  4C3Y A;  1Y0P A;  3I3L A;  4A6N B;  3RP7 A;  1QO8 A;  4G73 A;  5BRT A;  1FL2 A;  4G9K A;  4U8J A;  1NHP A;  3UKQ A;  4J57 A;  2X3N A;  3F8P A;  3KA7 A;  2V3A A;  3BNU A;  3EAN A;  5JCM A;  1H82 A;  5L46 A;  2GMH A;  3CGD A;  1IUW A;  2XDO A;  4CCQ A;  4G74 A;  4USQ A;  2YG7 A;  2YVJ A;  3HYW A;  4TM1 A;  3K7Q X;  4YTM A;  5FS7 A;  5J7X A;  3SZF A;  4J33 A;  5GSN A;  1PDH A;  2C73 A;  3S5W A;  3T31 A;  4U8I A;  2B7S A;  2WP6 A;  3KLJ A;  1GRE A;  3K7M X;  1BGJ A;  1PN0 A;  1ZY8 A;  2YG4 A;  4OPL A;  4RG3 A;  3C4A A;  1MO9 A;  1XHC A;  2C76 A;  2XVI A;  1O95 A;  4GAV A;  3UKF A;  4NTC A;  4K8D A;  2Q7V A;  4FDC B;  3ICS A;  1RSG A;  1ZK7 A;  1NHS A;  4FX9 A;  3VRD B;  5KNL A;  4K5R A;  1GRB A;  1CJ3 A;  5U25 A;  4O5Q A;  3NIX A;  5BUK A;  3DK4 A;  2ZZC A;  2B7R A;  4B65 A;  4FK1 C;  2IVE A;  4BUR A;  3IHM A;  4GRT A;  2VVM A;  3KD9 A;  1HYU A;  4ADW A;  5U1O A;  4D04 A;  3SX6 A;  1NPX A;  2RAB A;  3CN8 A;  1DOD A;  4H50 A;  3AE6 A;  5ER0 A;  2E4G A;  1LV0 A;  3SZC A;  4EMJ A;  4H4R A;  1GV4 A;  3SFD A;  1PBB A;  4REK A;  3AYJ A;  4Z25 A;  2XLR A;  2JB3 A;  4OPG A;  4BJY A;  5IQ4 A;  3DK8 A;  1F8W A;  4TLX A;  5KOX A;  4CNK A;  1IUV A;  3L1R A;  3UOZ A;  1H84 A;  3VR8 A;  2ACZ A;  4GAP A;  2TPR A;  1GAL A;  4OVI A;  2OAL A;  3RED A;  4KPR A;  1XDI A;  3ADA B;  3T14 A;  2B76 A;  1XAN A;  2XCG A;  4J36 A;  1GRA A;  4PAA A;  1S2Q A;  2GEW A;  3LJP A;  3QVR A;  1GTH A;  3UKK A;  3GD4 A;  5JCI A;  1VQW A;  1EBD A;  4ZN0 A;  2BRY A;  1EL8 A;  3CNJ A;  3BI4 A;  2WPC A;  2BRA A;  2JB1 A;  3LOV A;  5DBJ A;  4E0V A;  1JOA A;  3G5S A;  3C4N A;  5JCK A;  4NEV A;  2GAH B;  3P4R A;  3SZW A;  3UTF A;  1JU2 A;  3LZW A;  1CJC A;  2PYX A;  3D8X A;  1GET A;  3CPI G;  4DSH A;  3UKH A;  1OJA A;  3QSS A;  1GSN A;  1GTE A;  4UDP A;  1CC4 A;  1MXT A;  4AOX A;  4B67 A;  3BHF A;  2BK4 A;  3H4K A;  2ARD A;  2XFQ A;  2CUL A;  2FJE A;  3F8R A;  4NTD A;  4BK3 A;  3QJ4 A;  3PO7 A;  3VR9 A;  4GDE A;  1NEK A;  1OJT A;  4A99 A;  4DSG A;  1DJQ A;  2BS4 A;  2XLT A;  2OA1 A;  3F8D A;  3UKL A;  1H83 A;  2QA2 A;  4X9N A;  2Q0L A;  2BS2 A;  2YVF A;  3IC9 A;  2V6O A;  3FPZ A;  4U8O A;  3C96 A;  4JY2 A;  4WX1 A;  1FCD A;  1TYP A;  4ICY A;  2DKH A;  4DNA A;  4IVM B;  5CQF A;  4YKG A;  1PJ7 A;  1CJ2 A;  1KNR A;  1GER A;  3GYX A;  4B64 A;  1KSS A;  4CBQ A;  4EQX A;  2C65 A;  4U8N A;  1CBO A;  2XLS A;  5KMQ A;  3QFB A;  2R4J A;  2VQ7 A;  5C3J A;  1BKW A;  3T37 A;  3AYI A;  1ZOV A;  4Z44 A;  1YKJ A;  2C70 A;  2X99 A;  3NLC A;  2YM2 A;  3T2Z A;  3GD3 A;  1NHQ A;  2GR1 A;  2VQB A;  4MJW A;  2VOU A;  4USR A;  4C5O A;  4IV9 A;  1NG3 A;  3CPH G;  2W0H A;  3VRA A;  5FS6 A;  4O5U A;  5KMP A;  2C67 A;  2V60 A;  4B63 A;  3KU9 A;  2WP9 A;  5CKU A;  1VRQ B;  3UTG A;  3CNP A;  3CND A;  4TM3 A;  4A79 A;  1E1N A;  1W4X A;  3DJD A;  3FMW A;  3GDN A;  4EMW A;  2BC1 A;  4B68 A;  4Z2T A;  5KOW A;  4BK2 A;  3H8I A;  2YVG A;  1GT8 A;  4EQS A;  3IF9 A;  3NN6 X;  1TDO A;  2JBV A;  3BHK A;  2V61 A;  2AAQ A;  3FIM B;  3AE9 A;  5KVH A;  2JK6 A;  4NWZ A;  1F3P A;  3R9U A;  3V76 A;  1VDC A;  2H88 A;  1EL5 A;  3HYX A;  3GRT A;  3NTD A;  1FEA A;  2YAU A;  3ICR A;  4H2R A;  3UTH A;  5HHF A;  3AE3 A;  1K0J A;  1LPF A;  1X31 B;  2WOW A;  4EM4 A;  1H6V A;  4YT0 A;  5KVI A;  1CF3 A;  3DA1 A;  3DGH A;  1ONF A;  4AT0 A;  4YSY A;  2TMD A;  2VRL A;  3JSK A;  2OAM A;  2GF3 A;  3AD9 B;  3AEB A;  3P4Q A;  4K2X A;  3G5R A;  1D7Y A;  2YG3 A;  3P4P A;  4H4V A;  2FJB A;  3H8L A;  4CCR A;  1KFY A;  2GR3 A;  2VZ2 A;  2BCG G;  1YQ3 A;  4H4W A;  2ZZ0 A;  5KWF A;  1LQT A;  3UP5 A;  3NH3 X;  1PJ6 A;  2WU2 A;  2BCP A;  2GVC A;  2YQU A;  1S2Y A;  4A9W A;  1B4V A;  1GRF A;  1D4C A;  1ZDL A;  3CNT A;  1ZOY A;  4BJZ A;  2Y6Q A;  4Z24 A;  1MOK A;  4J56 A;  4OCG A;  2QA1 A;  1YY5 A;  2I0Z A;  3QFA A;  3DJE A;  2NVK X;  4II3 A;  4C74 A;  2GQW A;  3UOV A;  4X9M A;  1PXA A;  3UCL A;  1TDK A;  2YWL A;  1D4D A;  3NYC A;  2R46 A;  4JQ9 A;  3AE8 A;  3KPF A;  4H4Q A;  5KXJ A;  1D5T A;  1D4E A;  2YR5 A;  1BWC A;  4OPT A;  3LXD A;  1TDF A;  4YSZ A;  1E1L A;  4EM3 A;  3KVE A;  3SXI A;  1KSU A;  4EIP A;  1B5Q A;  2EQ6 A;  4TM4 A;  2J3N A;  2R4E A;  3ITJ A;  2GMJ A;  4GDP A;  3K7T A;  5EB4 A;  5BUL A;  2YLW A;  1GRT A;  1M6I A;  3ALM A;  5HXI A;  1Y56 A;  3Q6J A;  1M64 A;  2WU5 A;  5TR3 A;  3ABV A;  4A6N A;  1DOC A;  3DGZ A;  4H4Z A;  4AOS A;  4HA6 A;  3M13 A;  4KX6 A;  3RP6 A;  1L9D A;  3UKP A;  3UKA A;  2BXS A;  2YLS A;  1PBE A;  1GOS A;  4B1B A;  3NKS A;  4YTN A;  3NK0 X;  2XLP A;  1AOG A;  3NG7 X;  2X8C A;  1PXC A;  2BS3 A;  3LAD A;  2WS3 A;  2BA9 A;  5GRT A;  3P9U A;  3IWA A;  3PS9 A;  1GND A;  4IVO B;  3CGC A;  4II2 A;  5C2T A;  1S3E A;  5LV9 A;  1L9C A;  1B37 A;  1FEC A;  1ZMD A;  2XFP A;  3RP8 A;  2JB2 A;  3FBS A;  4I59 A;  4YSH A;  2CDU A;  3S61 A;  2UZZ A;  4AP3 A;  3GWF A;  3AE2 A;  3HZL A;  1N4V A;  2RGO A;  4GCM A;  1E1M A;  1IJH A;  4D03 A;  4G6G A;  1NHR A;  2WPE A;  3CTY A;  3G5Q A;  4H4U A;  1P2E A;  4XXG A;  2H89 A;  5J60 A;  3BI2 A;  2E1M A;  4H4Y A;  1YQZ A;  4RSL A;  5KMR A;  2R0C A;  1ELI A;  3CPJ G;  4NTE A;  3ATR A;  1IUS A;  2GH5 A;  1BZL A;  4J34 A;  4EMI A;  1GRG A;  1EL7 A;  3K30 A;  1IUX A;  2C4C A;  2HQM A;  4Z43 A;  2XVF A;  3ALL A;  4C77 A;  1H7W A;  1CHU A;  1TYT A;  2V5Z A;  3AD8 B;  3AEG A;  2RGH A;  4A5L A;  4UDQ A;  1NEN A;  3II4 A;  1H7X A;  4A65 A;  4EQW A;  2WDR A;  2EQ9 A;  4YSX A;  5BVA A;  4B69 A;  4YXD A;  5FS8 A;  1S3B A;  3WE0 A;  3SQP A;  5M10 A;  4EIQ A;  5EOW A;  2YLX A;  4LA1 A;  2YG5 A;  5KMS A;  2XLU A;  3FG2 P;  2QCU A;  2YR4 A;  1F8R A;  2XVH A;  3ICT A;  4HB9 A;  4J2W A;  1L0V A;  3DJJ A;  1GEU A;  2YM1 A;  4H2Q A;  4NEW A;  3V3N A;  5FMH A;  1UKV G;  3NGC X;  4Y4N A;  1E39 A;  3NT6 A;  3DK9 A;  1PBD A;  1O5W A;  3GMB A;  2FJA A;  3D1C A;  5EB5 A;  2QAE A;  2WDQ A;  2A8X A;  2Y6R A;  2EQ8 A;  2CVJ A;  4CNJ A;  4H4X A;  1JRY A;  1ZKQ A;  1PHH A;  1RP0 A;  1IUU A;  2VVL A;  3LZX A;  2XVJ A;  3ISH A;  1K0L A;  1E6E A;  3NYE A;  3PVC A;  2XFN A;  3KKJ A;  2XYO A;  2V3B A;  3Q9T A;  1VG9 A;  3LB8 A;  2C3C A;  4G6H A;  1DOE A;  2E5V A;  3DJG X;  4H4P A;  1Q1W A;  3VRB A;  1NG4 A;  4H7U A;  3SM8 A;  2IVD A;  2C75 A;  1KF6 A;  3E1T A;  3RHA A;  2JKC A;  3CMM A;  4GUV A;  4TLZ A;  2X8G A;  2GQF A;  4C3X A;  3EPT A;  3OC4 A;  1FOH A;  2WBA A;  4LII A;  2BK3 A;  1CC2 A;  4EQR A;  3CGB A;  1LJ1 A;  2VRM A;  1SEZ A;  4FK1 A;  3UP4 A;  3T2K A;  2B9X A;  1NDA A;  2YLZ A;  1JNR A;  2ZZB A;  4IA5 A;  2C3D A;  2WPF A;  1NAA A;  3AXB A;  2FJD A;  4XWR A;  1RYI A;  2XFO A;  2IID A;  1JEH A;  2GB0 A;  4B66 A;  1PXB A;  1JRX A;  1K4Q A;  4YWO A;  3NYF A;  4OPC A;  2AR8 A;  1PJ5 A;  1TRB A;  1Q1R A;  2BXR A;  4LU6 A;  2R45 A;  4IA6 A;  1V59 A;  5EBK A;  3QSE A;  1FEB A;  2Q6U A;  2BYB A;  3BNM A;  3EF6 A;  4APN A;  2APG A;  2WOV A;  3O0H A;  4U8L A;  5U63 A;  1H81 A;  3SY4 A;  3QVP A;  1GPE A;  2AQJ A;  4ZCC A;  3P1W A;  3M12 A;  2JAE A;  1OJD A;  3B6D A;  1TDN A;  4ECH A;  1CC6 A;  4UP3 A;  2VVL G;  3NTA A;  3NNE A;  4PAB A;  2FBW A;  3AE1 A;  1Q9I A;  2GV8 A;  4Z26 A;  1KDG A;  3V3O A;  2DKI A;  3CGE A;  2GR0 A;  2XFU A;  2O9Z A;  4JNA A;  4K7Z A;  5HY5 A;  4P9S A;  5KRQ A;  3NK1 X;  3P4S A;  2WES A;  2YLR A;  3UOX A;  4WCT A;  5IPY A;  2F5Z A;  1GES A;  2BAC A;  3ALJ A;  3T2Y A;  1E7P A;  2Z5Y A;  3AEE A;  3AEF A;  1GRH A;  2CFY A;  5JCN A;  3AE7 A;  3NK2 X;  1ZP0 A;  4XWZ A;  2C64 A;  1P2H A;  1PBF A;  3AEA A;  3CIR A;  4Z2R A;  2OLN A;  1Z6L A;  3DH9 A;  1BGN A;  1L9E A;  2WDV A;  4YTP A;  4CY8 A;  1N1P A;  2YLT A;  4DGK A;  3GDP A;  1XPQ A;  1EL9 A;  3KPK A;  4YKF A;  3GRS A;  3RNM A;  1GXF A;  3DME A;  1N4U A;  4X4J A;  4U8P A;  4A7A A;  1DJN A;  2GRT A;  3NHO X;  4JN9 A;  4Y4M A;  1VG0 A;  1H86 A;  4UDR A;  3AD7 B;  1DNC A;  2BC0 A;  4NNJ A;  1DOB A;  2WQY A;  4U8M A;  3ZYX A;  3URH A;  3BI5 A;  4U2S A;  1COY A;  1BF3 A;  3GSI A;  2RGJ A;  4JNQ A;  5M0Z A;  4Z2U A;  4H2N A;  2XVE A;  3SFE A;  5IQ1 A;  3GYJ A;  4OPI A;  4BV6 A;  2PHH A;  2WHD A;  2X8H A;  2BAB A;  2BK5 A;  3GWD A;  1JNZ A;  2R0G A;  1OJ9 A;  4I58 A;  2R9Z A;  4AP1 A;  1CJ4 A;  2WEU A;  2EQ7 A;  3NRN A;  4K22 A;  4U8K A;  1D7L A;  2WET A;  1PBC A;  3SZ0 A;  3CNS A;  2C66 A;  4J31 A;  2Q0K A;  3NN0 X;  1DXL A;  3UOY A;  4BK1 A;  4CY6 A;  3HYV A;  4OPD A;  4GF7 A;  1LQU A;  2OLO A;  4NZH A;  3AEC A;  3T0K A;  1O94 A;  2YG6 A;  2B9Y A;  4ZCD A;  1ZX9 A;  3AE4 A;  3AE5 A;  3AB1 A;  2A89 A;  4OPU A;  1ZMC A;  3VQR A;  2WOI A;  3L8K A;  4H2P A;  1JRZ A;  3EAO A;  1F6M A;  3ATQ A;  4GR1 A;  3B3R A;  4H4T A;  4JY3 A;  4Y4L A;  3ZDN A;  1IUT A;  3M0O A;  1OJC A;  2C7G A;  3AWI A;  2A87 A;  1YQ4 A;  2GAG B;  4CRT A;  3I6D A;  5JCL A;  2NPX A;  1F8S A;  5FS9 A;  3COX A;  1K0I A;  2ZBW A;  3IHG A;  1QJD A;  1B8S A;  1PS9 A;  4JDR A;  3OZ2 A;  1LTX R;  2R0P A;  2GR2 A;  1KNP A;  2YR6 A;  2X50 A;  1E1K A;  2WP5 A;  3GMC A;  3QSM A;  4K5S A;  4TM0 A;  3UTE A;  4RG4 A;  5HYM A;  4U2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...