4A5LA

Crystal structure of the thioredoxin reductase from entamoeba histolytica
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
313
structure length
313
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
total genus 93
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a5lA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a5lA02
1COYA 1ZP0A 3BNUA 3RNMA 2C3DA 2JAEA 2O9ZA 3BI2A 3KD9A 1ZMCA 4USRA 3UKHA 2ZZBA 3SFEA 3K7MX 4UP3A 3AEGA 1E1LA 3UOYA 4YTMA 3NH3X 1FECA 3CNSA 2H89A 2C70A 1TDEA 1P2HA 2TPRA 1EL8A 3DK8A 3GSIA 4U2LA 2R0PA 2I0ZA 4CY6A 1NDAA 1ZMDA 1OJTA 2WOIA 1IUTA 3I6DA 1S3EA 3BI4A 2YQUA 2R46A 5BUKA 2WU5A 3CNTA 2VVLG 1NG3A 3DJJA 3CNDA 2XDOA 3RP6A 3DMEA 2VQBA 3P9UA 1BKWA 5KRQA 3CNPA 2V60A 2HQMA 2GF3A 1PXBA 1D7YA 1PXAA 2PHHA 4H50A 4EIQA 2BA9A 2WP5A 4Z2RA 1GRBA 1BGJA 3R9UA 5TR3A 2V5ZA 4K5RA 5FS9A 4AP3A 4C3YA 2GR1A 2VRLA 4YXDA 4XWZA 5HY5A 2V61A 4XXGA 3ALMA 2B76A 4CCQA 4A5LA 4B63A 3SFDA 3GDPA 2YAUA 2OLOA 1YQ3A 2C66A 3BHKA 1GOSA 1FOHA 1JRYA 4I59A 4ADWA 4JY3A 3IF9A 3M0OA 1YQZA 3BI5A 4XWRA 4OPUA 3GMCA 4A6NB 4YTNA 1GPEA 1PBFA 1H82A 2YVGA 1GTHA 2XFOA 1CF3A 3AWIA 3L8KA 1D7LA 4DSGA 3C96A 5KOWA 4JY2A 3UKKA 2XLSA 4N9XA 1RYIA 2XLPA 1LQTA 1QJDA 3COXA 1B37A 2A8XA 4IA5A 2A87A 3NTAA 3LJPA 2WPFA 2X3NA 4TLXA 2Z5YA 1L9CA 3AE2A 1H7WA 2X8CA 3KPFA 5EBKA 1S3BA 2FJAA 5JCNA 2YLWA 2JKCA 3KU9A 5JCMA 4IV9A 1E6EA 4U2TA 3LOVA 4J31A 4H2QA 3LB8A 3SGLA 4YT0A 5J7XA 2YG4A 1N4WA 3NYFA 4H4UA 2OLNA 3Q9TA 1M64A 1RSGA 4O5UA 1JNZA 1ZDLA 2WU2A 1GT8A 3NNEA 2BXRA 4JNQA 2GQWA 4YWOA 4B64A 3QJ4A 3H8IA 2QAEA 4OPCA 1L9DA 2DKHA 2WDVA 2YG6A 5HYMA 3M13A 2C73A 2WPCA 2Q0LA 3RHAA 1VDCA 2XVFA 5EB4A 1B4VA 2XVEA 3B3RA 3D8XA 1EL5A 2QA2A 4ECHA 2GR0A 4BK3A 4TM3A 4NZHA 2ZZ0A 2Q0KA 3UKLA 5U1OA 3AYJA 1KSUA 3F8DA 1L0VA 1KDGA 4YTPA 4K7ZA 2GB0A 4NEVA 4H4PA 4K5SA 3RP7A 2IIDA 1EBDA 4H4XA 1CC6A 2IVDA 1GRTA 4NTDA 5KOXA 1D4EA 2XLUA 3AECA 3EANA 1K4QA 3NG7X 3NYCA 1YKJA 4NEWA 4Z24A 5C3JA 2C3CA 3VR9A 1PS9A 3IWAA 2WOWA 4H4WA 3BHFA 1BWCA 3NHOX 3P4SA 4H4YA 5FS7A 1XPQA 4TM1A 3NLCA 3GRTA 3ICTA 3OC4A 4DSHA 4TLZA 1DJNA 1IUXA 4H2PA 3ICRA 2JBVA 3V3OA 4APNA 3AEAA 4A6NA 1N4UA 1O95A 2XVHA 4JDRA 4H4SA 2F5ZA 2YR4A 3AYLA 3FIMB 3UKPA 1LV0A 3GD3A 3UTFA 3CGBA 4PABA 4NTCA 3DK4A 1TDOA 3AB1A 3H8LA 3GWFA 4K2XA 3AE3A 3M12A 1LPFA 4GR1A 2YR5A 3VQRA 4EIPA 2R0CA 2XFPA 4ZCDA 1DODA 4FK1C 2WBAA 1TRBA 4YSHA 3VRAA 4C3XA 4YKGA 2GRTA 4NTEA 3S61A 2WQYA 2BYBA 5KVHA 1BF3A 1Y56B 2WDQA 3O0HA 2CULA 2GR2A 4J36A 2WEUA 2YG3A 3FPZA 3QVRA 4EM3A 4C5OA 1ZX9A 1FEBA 1RP0A 2WDRA 4H4ZA 2BACA 3G5RA 2Z5XA 2CFYA 3AEBA 4Z44A 3S5WA 1X31B 4OPLA 5M10A 5KVIA 2R9ZA 2GQFA 1GERA 2VRMA 4M52A 4DNAA 3IC9A 3KKJA 1QLBA 1P2EA 2CVJA 3DGZA 4U8PA 2BS3A 3OZ2A 1REOA 3AEDA 4AOXA 1F6MA 5IQ1A 1M6IA 1Y0PA 4GUVA 4JNAA 5JCIA 2J3NA 5IPYA 2WP6A 1CJ4A 4BJZA 4GF7A 5BULA 1NG4A 3KA7A 4B67A 1GALA 2C65A 3NIXA 1PJ7A 5ER0A 3ATQA 4J56A 1CBOA 3LXDA 4YSYA 5KWFA 1K0LA 1QO8A 2B9XA 2FJBA 5U25A 3NK1X 1YQ4A 2BCPA 1D4DA 1D4CA 4LIIA 4H4RA 1CJ3A 1NHPA 2GVCA 2WS3A 5FS8A 4Z25A 3AD9B 2APGA 4BJYA 3LADA 4OCGA 2XFQA 3AYIA 1JOAA 1E1NA 1N4VA 1ZK7A 4H4TA 1HYUA 2BXSA 4ZN0A 1N1PA 4CRTA 4EMJA 1H83A 5J60A 1AOGA 2QA1A 4EQXA 4FK1A 2VOUA 3GMBA 2WPEA 3AE5A 3NN6X 1PXCA 3UOVA 2H88A 3C4NA 1IUSA 2CDUA 1CC2A 1S2QA 2XFNA 4EMWA 3ZYXA 1V59A 2B7SA 3UKAA 4U8JA 4RG3A 2C67A 3II4A 5LV9A 3EAOA 2Y6QA 1DOEA 2AR8A 2AAQA 3NT6A 1IUUA 4A9WA 2YG5A 2YLSA 4H4VA 2YM1A 4YKFA 4PAAA 2RGJA 1O5WA 3CIRA 1Y56A 3NTDA 1ZKQA 1MXTA 3LZWA 3NKSA 5JCKA 3P4QA 4DGKA 2YVFA 4FDCB 2GAHB 2BS4A 3NYEA 4P9SA 3UP5A 2WESA 2TMDA 4A7AA 2GEWA 3PO7A 4UDQA 2BK4A 3GD4A 2XVIA 4Y4MA 5BRTA 3DGHA 2C76A 3DH9A 3ICSA 3UTHA 3F8PA 4GDEA 4TM0A 3QSEA 4EM4A 1JNRA 3UOXA 1GRAA 1LQUA 2A89A 2X99A 1JRXA 1IUWA 3LZXA 1ELIA 3K7TA 4U8OA 4EQSA 1DJQA 3UTEA 1EL9A 1K0IA 3REDA 2EQ7A 4KX6A 3KLJA 4REKA 1NHRA 3UTGA 2ARDA 3FBSA 1TYTA 3DK9A 1VG0A 1GV4A 5HXIA 2PYXA 2B9WA 1CJCA 3V3NA 1O94A 3VR8A 4BK2A 1XHCA 4GDPA 3UOZA 1Q1RA 3CNJA 3GYJA 2JB2A 1TDKA 5GSNA 1GESA 4Y4NA 2BABA 1CJ2A 2X50A 2FJDA 2BS2A 1H7XA 3P4RA 3QSSA 5CKUA 2RGHA 2C72A 3B6DA 4AOSA 2GMHA 4U8LA 5EOWA 2JB3A 1JRZA 1Z6LA 2OAMA 2R4EA 2YVJA 4B65A 4BURA 5JCLA 2E4GA 4IVMB 2XLTA 1TDNA 1KFYA 3ITJA 4LU6A 3CGCA 1JU2A 1PBEA 1ZOVA 2YWLA 1OJAA 4A79A 1F8SA 2VQ7A 5DBJA 2C64A 2ZZCA 1E1MA 1CL0A 1S2YA 4Z43A 2X8GA 2YG7A 1B8SA 1PBCA 1ONFA 2R45A 4UDPA 2EQ9A 2IVEA 3QFBA 4Y4LA 1CHUA 3UP4A 2YM2A 3AE7A 3AE9A 2GAGB 4J57A 4J34A 1FEAA 4OPIA 1SEZA 1VQWA 3AEEA 3CPIG 4H4QA 1PJ6A 2R0GA 2W0HA 4CNJA 3AE4A 2B9YA 1CC4A 4A65A 2C75A 4JN9A 1GSNA 3GDNA 4E0VA 2GR3A 1LJ1A 4CCRA 4H7UA 3GWDA 4KPRA 1F8WA 2YR6A 1GRHA 4Z2UA 1MO9A 1OJDA 4X4JA 3V76A 3IHGA 3K30A 2WOVA 3PVCA 3SQPA 1XDIA 4U8KA 3P1WA 2RABA 1MOKA 1D5TA 4EMIA 1F3PA 3CGEA 3EF6A 1OJ9A 3I3LA 3H4KA 2VVMA 5KXJA 4B66A 4TM4A 2WP9A 2ACZA 3CN8A 1PHHA 4J33A 1LTXR 2Q7VA 4WX1A 4H2RA 2RGOA 3CPHG 4U8NA 1NENA 2YLXA 2YLTA 4RSLA 4RG4A 5U63A 1GETA 4YSZA 4WCTA 4Z26A 2OALA 3AD8B 3GRSA 4B69A 4OPDA 4AT2A 4C77A 1KF6A 3C4AA 2C7GA 2DKIA 1OJCA 2UZZA 2B7RA 1H86A 3CPJG 3UKQA 2WETA 3VRDB 3D1CA 4Z2TA 3IHMA 3ISHA 1TYPA 3FMWA 4ICYA 2XCGA 1E7PA 5FS6A 2XVJA 3ABVA 3Q6JA 1KSSA 1ZOYA 1Q1WA 2FBWA 1KNRA 1FL2A 3CGDA 1DXLA 3PS9A 4I58A 1NPXA 4OVIA 1PN0A 2X8HA 3NGCX 1PJ5A 4HB9A 1GXFA 3ALJA 2V6OA 4MJWA 4B68A 4U2SA 3AE6A 1GREA 1JEHA 4HA6A 4U8IA 1DOBA 3G5SA 5FMHA 1YY5A 5M0ZA 1VRQB 2GMJA 5BVAA 4X9MA 2E1MA 4BK1A 1UKVG 2BCGG 4GCMA 1NEKA 4FX9A 3NN0X 4O5QA 3URHA 4CNKA 3ALLA 4AP1A 3HZLA 3JSKA 1BGNA 3UCLA 1KNPA 2V3AA 4K8DA 1H81A 5EB5A 3E1TA 1DNCA 2BK3A 1EL7A 4IA6A 3K7QX 3NK0X 3NK2X 4IVOB 2YLZA 3SM8A 4B1BA 2XLRA 3P4PA 4USQA 2BC1A 1GNDA 1E39A 1PBDA 1VG9A 3CTYA 3KVEA 2EQ6A 2FJEA 4H2NA 2BK5A 1GRGA 3DJGX 4A99A 4CBQA 1IUVA 1DOCA 3F8RA 4D03A 2YLRA 1E1KA 2XYOA 1F8RA 2NPXA 4EQRA 3UKFA 4BV6A 3RP8A 3G5QA 1H84A 3AEFA 5HHFA 1BZLA 5L46A 1NHQA 4AT0A 1K0JA 2ZBWA 3QVPA 2VVLA 1B5QA 4GRTA 4CY8A 3ADAB 2GV8A 2QCUA 3ATRA 2R4JA 4D04A 1IJHA 1L9EA 2E5VA 5C2TA 1ZY8A 3ZDNA 1GRFA 4YSXA 1XANA 1GTEA 2OA1A 3AD7B 3DJDA 4LA1A 4ZCCA 3AE1A 3DA1A 3EPTA 2GH5A 4EQWA 5IQ4A 2JK6A 4OPTA 2AQJA 3AE8A 1W4XA 2VZ2A 2JB1A 4U8MA 4X9NA 4C74A 4K22A 2BC0A 3L1RA 1PDHA 2V3BA 1Q9IA 4J2WA 3GYIA 3VRBA 3WE0A 1LVLA 4JQ9A 1NAAA 2EQ8A 2Y6RA 1H6VA 1TDFA 1PBBA 2WHDA 2XFUA 2Q6UA 2NVKX 3FG2P 3QFAA 3AXBA 5GRTA 3DJEA 3QSMA 1GEUA 3NRNA 4OPGA 5CQFA 1FCDA 4UDRA 1NHSA 3T37A 3BNMA
chains in the Genus database with same CATH superfamily
1COYA 1ZP0A 3BNUA 3RNMA 2C3DA 2JAEA 2O9ZA 3BI2A 3KD9A 1ZMCA 4USRA 3UKHA 2ZZBA 3SFEA 3K7MX 4UP3A 3AEGA 1E1LA 3UOYA 4YTMA 3NH3X 1FECA 3CNSA 2H89A 2C70A 1TDEA 1P2HA 2TPRA 1EL8A 3DK8A 3GSIA 4U2LA 2R0PA 2I0ZA 4CY6A 1NDAA 1ZMDA 1OJTA 2WOIA 1IUTA 3I6DA 1S3EA 3BI4A 2YQUA 2R46A 5BUKA 2WU5A 3CNTA 2VVLG 1NG3A 3DJJA 3CNDA 2XDOA 3RP6A 3DMEA 2VQBA 3P9UA 1BKWA 2BRAA 3CNPA 5KRQA 2V60A 2HQMA 2GF3A 1PXBA 1D7YA 1PXAA 2PHHA 4H50A 4EIQA 5KMSA 2BA9A 2WP5A 4Z2RA 1GRBA 1BGJA 3R9UA 5TR3A 2V5ZA 4K5RA 5FS9A 4AP3A 4C3YA 2GR1A 2VRLA 4YXDA 4XWZA 5HY5A 2V61A 4XXGA 3ALMA 2B76A 4CCQA 4A5LA 4B63A 3SFDA 3GDPA 2YAUA 2OLOA 1YQ3A 2C66A 3BHKA 1GOSA 1FOHA 1JRYA 4I59A 3HYWA 4ADWA 4JY3A 3IF9A 3M0OA 1YQZA 3BI5A 4XWRA 4OPUA 3GMCA 4A6NB 4YTNA 1GPEA 1PBFA 1H82A 2YVGA 1GTHA 2XFOA 1CF3A 3AWIA 3L8KA 1D7LA 4DSGA 3C96A 5KOWA 4JY2A 3UKKA 2XLSA 4N9XA 1RYIA 2XLPA 1LQTA 3SXIA 1QJDA 3COXA 1B37A 2A8XA 4IA5A 2A87A 3NTAA 3LJPA 2WPFA 2X3NA 4TLXA 2Z5YA 1L9CA 3AE2A 1H7WA 2X8CA 3KPFA 5EBKA 1S3BA 2FJAA 5JCNA 2YLWA 2JKCA 3KU9A 5JCMA 4IV9A 1E6EA 4U2TA 3LOVA 4J31A 4H2QA 3LB8A 3SGLA 4YT0A 5J7XA 2YG4A 1N4WA 3NYFA 4H4UA 2OLNA 3Q9TA 1M64A 1RSGA 4O5UA 1JNZA 1ZDLA 2WU2A 1GT8A 3NNEA 2BXRA 4JNQA 2GQWA 4YWOA 4B64A 3QJ4A 3H8IA 3T14A 2QAEA 4OPCA 1L9DA 2DKHA 2WDVA 2YG6A 5HYMA 3M13A 2C73A 2WPCA 2Q0LA 3RHAA 1VDCA 2XVFA 5EB4A 1B4VA 2XVEA 3B3RA 3D8XA 1EL5A 2QA2A 4ECHA 2GR0A 4BK3A 4TM3A 4NZHA 2ZZ0A 2Q0KA 3UKLA 4G9KA 5U1OA 3AYJA 1KSUA 3F8DA 1L0VA 1KDGA 4YTPA 4K7ZA 2GB0A 4NEVA 4H4PA 4K5SA 3RP7A 2IIDA 1EBDA 4H4XA 3SYIA 1CC6A 2IVDA 1GRTA 4NTDA 5KOXA 1D4EA 2XLUA 3AECA 3EANA 1K4QA 3NG7X 3NYCA 1YKJA 4NEWA 4Z24A 5C3JA 2C3CA 3VR9A 1PS9A 3IWAA 2WOWA 4H4WA 3BHFA 1BWCA 3NHOX 3P4SA 4H4YA 5FS7A 1XPQA 4TM1A 3NLCA 3GRTA 3ICTA 3SZFA 3OC4A 4DSHA 4TLZA 1DJNA 1IUXA 4H2PA 3ICRA 2JBVA 3V3OA 4APNA 3AEAA 4A6NA 1N4UA 1O95A 3T2YA 2XVHA 4JDRA 4H4SA 2F5ZA 2YR4A 3T2KA 3AYLA 3FIMB 3UKPA 1LV0A 3GD3A 3UTFA 3CGBA 4PABA 4NTCA 3DK4A 1TDOA 3AB1A 3H8LA 4NNJA 3GWFA 4K2XA 3AE3A 3M12A 1LPFA 4GR1A 2YR5A 3VQRA 4EIPA 2R0CA 2XFPA 4ZCDA 1DODA 4FK1C 2WBAA 1TRBA 3HYXA 4YSHA 3VRAA 4C3XA 4YKGA 2GRTA 4NTEA 3S61A 2WQYA 2BYBA 5KVHA 1BF3A 1Y56B 2WDQA 3O0HA 2CULA 2GR2A 4J36A 2WEUA 2YG3A 3FPZA 3QVRA 4EM3A 4C5OA 3SX6A 1ZX9A 1FEBA 1RP0A 2WDRA 4H4ZA 4II3A 2BACA 3G5RA 2Z5XA 2CFYA 3AEBA 4Z44A 3S5WA 1X31B 4OPLA 5M10A 5KVIA 2R9ZA 2GQFA 1GERA 2VRMA 4M52A 4DNAA 3IC9A 3KKJA 1QLBA 1P2EA 2CVJA 3DGZA 4U8PA 2BS3A 3OZ2A 1REOA 3AEDA 4AOXA 1F6MA 5IQ1A 1M6IA 1Y0PA 4GUVA 4JNAA 5JCIA 2J3NA 5IPYA 2WP6A 4II2A 1CJ4A 4BJZA 4GF7A 5BULA 1NG4A 3KA7A 4B67A 1GALA 2C65A 3NIXA 1PJ7A 5ER0A 3ATQA 4J56A 3T2ZA 1CBOA 3LXDA 4YSYA 5KWFA 1K0LA 1QO8A 2B9XA 2FJBA 5U25A 3T31A 3NK1X 1YQ4A 2BCPA 5KMQA 3CMMA 1D4DA 1D4CA 4LIIA 4H4RA 1CJ3A 1NHPA 2GVCA 2WS3A 5FS8A 4Z25A 3AD9B 2APGA 4BJYA 3LADA 4OCGA 2XFQA 3AYIA 1JOAA 4G6HA 1E1NA 1N4VA 1ZK7A 4H4TA 1HYUA 2BXSA 4ZN0A 1N1PA 4CRTA 4EMJA 1H83A 5J60A 1AOGA 2QA1A 4EQXA 4FK1A 2VOUA 3GMBA 2WPEA 3AE5A 3NN6X 1PXCA 3UOVA 2H88A 3C4NA 1IUSA 2CDUA 1CC2A 1S2QA 2XFNA 4GAVA 3ZYXA 4EMWA 1V59A 2B7SA 3UKAA 4U8JA 4RG3A 2C67A 3II4A 5LV9A 3EAOA 2Y6QA 1DOEA 2AR8A 2AAQA 3NT6A 1IUUA 4A9WA 2YG5A 2YLSA 4H4VA 2YM1A 4YKFA 4PAAA 2RGJA 1O5WA 3CIRA 1Y56A 3NTDA 1ZKQA 1MXTA 3LZWA 3NKSA 5JCKA 2BRYA 3P4QA 4DGKA 5KMRA 2YVFA 4FDCB 2GAHB 2BS4A 3NYEA 4P9SA 3UP5A 2WESA 2TMDA 4A7AA 2GEWA 3PO7A 4UDQA 2BK4A 3GD4A 2XVIA 4Y4MA 5BRTA 3DGHA 2C76A 3DH9A 3ICSA 3UTHA 3F8PA 4GDEA 4TM0A 3QSEA 4EM4A 1JNRA 3UOXA 1GRAA 1LQUA 2A89A 2X99A 1JRXA 1IUWA 3LZXA 1ELIA 3K7TA 4U8OA 4EQSA 1DJQA 3UTEA 1EL9A 1K0IA 3REDA 2EQ7A 4KX6A 3KLJA 4REKA 1NHRA 3UTGA 2ARDA 3FBSA 1TYTA 3SZCA 3DK9A 1VG0A 1GV4A 5HXIA 2PYXA 2B9WA 1CJCA 3V3NA 1O94A 3VR8A 4BK2A 1XHCA 4GDPA 3UOZA 1Q1RA 3CNJA 3GYJA 2JB2A 1TDKA 5GSNA 1GESA 4Y4NA 2BABA 1CJ2A 2X50A 2FJDA 2BS2A 1H7XA 3P4RA 5KMPA 3QSSA 5CKUA 2RGHA 2C72A 3B6DA 4AOSA 2GMHA 4U8LA 5EOWA 2JB3A 1JRZA 1Z6LA 2OAMA 2R4EA 2YVJA 4B65A 4BURA 5JCLA 2E4GA 4IVMB 2XLTA 1TDNA 1KFYA 3ITJA 4LU6A 3CGCA 1JU2A 3T0KA 1PBEA 1ZOVA 5KNLA 2YWLA 1OJAA 4A79A 1F8SA 2VQ7A 5DBJA 2C64A 2ZZCA 1E1MA 4NWZA 1CL0A 1S2YA 4Z43A 2X8GA 2YG7A 1B8SA 1PBCA 1ONFA 2R45A 4UDPA 2EQ9A 2IVEA 3QFBA 4Y4LA 1CHUA 3UP4A 2YM2A 3AE7A 3AE9A 2GAGB 4J57A 4J34A 1FEAA 4OPIA 1SEZA 1VQWA 3AEEA 3CPIG 4H4QA 1PJ6A 2R0GA 2W0HA 4CNJA 3AE4A 2B9YA 1CC4A 4A65A 2C75A 4JN9A 1GSNA 3GDNA 4E0VA 2GR3A 1LJ1A 4CCRA 4H7UA 3GWDA 4KPRA 1F8WA 2YR6A 1GRHA 4Z2UA 1MO9A 1OJDA 4X4JA 3V76A 3IHGA 3SY4A 3K30A 2WOVA 3PVCA 3SQPA 1XDIA 4U8KA 3P1WA 2RABA 1MOKA 1D5TA 4EMIA 1F3PA 3CGEA 3EF6A 1OJ9A 3I3LA 3H4KA 2VVMA 5KXJA 4B66A 4TM4A 2WP9A 2ACZA 3CN8A 1PHHA 4J33A 1LTXR 2Q7VA 4WX1A 4H2RA 2RGOA 3CPHG 4U8NA 1NENA 2YLXA 2YLTA 4RSLA 4RG4A 5U63A 1GETA 4YSZA 4WCTA 4Z26A 2OALA 3AD8B 3GRSA 4B69A 4OPDA 4AT2A 4C77A 1KF6A 3C4AA 2C7GA 2DKIA 1OJCA 2UZZA 2B7RA 1H86A 3CPJG 3UKQA 2WETA 3VRDB 3D1CA 4Z2TA 3IHMA 3ISHA 1TYPA 3FMWA 4ICYA 2XCGA 1E7PA 5FS6A 2XVJA 3ABVA 3Q6JA 3HYVA 1KSSA 1ZOYA 1Q1WA 2C4CA 2FBWA 1KNRA 4GAPA 1FL2A 3CGDA 1DXLA 3PS9A 4I58A 1NPXA 4OVIA 1PN0A 2X8HA 3NGCX 1PJ5A 4HB9A 1GXFA 3ALJA 3SZWA 2V6OA 4MJWA 4B68A 4U2SA 3AE6A 1GREA 1JEHA 4HA6A 4U8IA 1DOBA 3G5SA 5FMHA 1YY5A 5M0ZA 1VRQB 2GMJA 5BVAA 4X9MA 2E1MA 4BK1A 1UKVG 2BCGG 4GCMA 1NEKA 4FX9A 3NN0X 4O5QA 3URHA 4CNKA 3ALLA 4AP1A 3HZLA 3JSKA 1BGNA 3UCLA 1KNPA 2V3AA 4K8DA 1H81A 5EB5A 3GYXA 3E1TA 1DNCA 2BK3A 1EL7A 4IA6A 3K7QX 3NK0X 3NK2X 4IVOB 2YLZA 3SM8A 4B1BA 2XLRA 3P4PA 4USQA 2BC1A 1GNDA 1E39A 1PBDA 1VG9A 3CTYA 3KVEA 3KPKA 2EQ6A 2FJEA 4H2NA 2BK5A 1GRGA 3DJGX 4A99A 4CBQA 1IUVA 1DOCA 3F8RA 4D03A 2YLRA 1E1KA 2XYOA 1F8RA 2NPXA 4EQRA 3UKFA 4BV6A 3RP8A 3G5QA 1H84A 3AEFA 5HHFA 1BZLA 5L46A 1NHQA 4AT0A 1K0JA 2ZBWA 3QVPA 2VVLA 1B5QA 4GRTA 4CY8A 3ADAB 2GV8A 2QCUA 4G6GA 3ATRA 4G73A 2R4JA 4D04A 1IJHA 1L9EA 2E5VA 5C2TA 1ZY8A 3ZDNA 4G74A 1GRFA 3SZ0A 4YSXA 1XANA 1GTEA 2OA1A 3AD7B 3DJDA 4LA1A 4ZCCA 3AE1A 3DA1A 3EPTA 2GH5A 4EQWA 5IQ4A 2JK6A 4OPTA 2AQJA 3AE8A 1W4XA 2VZ2A 2JB1A 4U8MA 4X9NA 4C74A 4K22A 2BC0A 3L1RA 1PDHA 2V3BA 1Q9IA 4J2WA 3GYIA 3VRBA 3WE0A 1LVLA 4JQ9A 1NAAA 2EQ8A 2Y6RA 1H6VA 1TDFA 1PBBA 2WHDA 2XFUA 2Q6UA 2NVKX 3FG2P 3QFAA 3AXBA 5GRTA 3DJEA 3QSMA 1GEUA 3NRNA 4OPGA 5CQFA 1FCDA 4UDRA 1NHSA 3T37A 3BNMA
chains in the Genus database with same CATH topology
1COYA 1ZP0A 3BNUA 3RNMA 2C3DA 2JAEA 2O9ZA 3BI2A 3KD9A 1ZMCA 4USRA 3UKHA 2ZZBA 3SFEA 3K7MX 4UP3A 3AEGA 1E1LA 3UOYA 4YTMA 3NH3X 1FECA 3CNSA 2H89A 2C70A 1TDEA 1P2HA 2TPRA 1EL8A 3DK8A 3GSIA 4U2LA 2R0PA 2I0ZA 4CY6A 1NDAA 1ZMDA 1OJTA 2WOIA 1IUTA 3I6DA 1S3EA 3BI4A 2YQUA 2R46A 5BUKA 2WU5A 3CNTA 2VVLG 1NG3A 3DJJA 3CNDA 2XDOA 3RP6A 3DMEA 2VQBA 3P9UA 1BKWA 2BRAA 3CNPA 5KRQA 2V60A 2HQMA 2GF3A 1PXBA 1D7YA 1PXAA 2PHHA 4H50A 4EIQA 5KMSA 2BA9A 2WP5A 4Z2RA 1GRBA 1BGJA 3R9UA 5TR3A 2V5ZA 4K5RA 5FS9A 4AP3A 4C3YA 2GR1A 2VRLA 4YXDA 4XWZA 5HY5A 2V61A 4XXGA 3ALMA 2B76A 4CCQA 4A5LA 4B63A 3SFDA 3GDPA 2YAUA 2OLOA 1YQ3A 2C66A 3BHKA 1GOSA 1FOHA 1JRYA 4I59A 3HYWA 4ADWA 4JY3A 3IF9A 3M0OA 1YQZA 3BI5A 4XWRA 4OPUA 3GMCA 4A6NB 4YTNA 1GPEA 1PBFA 1H82A 2YVGA 1GTHA 2XFOA 1CF3A 3AWIA 3L8KA 1D7LA 4DSGA 3C96A 5KOWA 4JY2A 3UKKA 2XLSA 4N9XA 1RYIA 2XLPA 1LQTA 3SXIA 1QJDA 3COXA 1B37A 2A8XA 4IA5A 2A87A 3NTAA 3LJPA 2WPFA 2X3NA 4TLXA 2Z5YA 1L9CA 3AE2A 1H7WA 2X8CA 3KPFA 5EBKA 1S3BA 2FJAA 5JCNA 2YLWA 2JKCA 3KU9A 5JCMA 4IV9A 1E6EA 4U2TA 3LOVA 4J31A 4H2QA 3LB8A 3SGLA 4YT0A 5J7XA 2YG4A 1N4WA 3NYFA 4H4UA 2OLNA 3Q9TA 1M64A 1RSGA 4O5UA 1JNZA 1ZDLA 2WU2A 1GT8A 3NNEA 2BXRA 4JNQA 2GQWA 4YWOA 4B64A 3QJ4A 3H8IA 3T14A 2QAEA 4OPCA 1L9DA 2DKHA 2WDVA 2YG6A 5HYMA 3M13A 2C73A 2WPCA 2Q0LA 3RHAA 1VDCA 2XVFA 5EB4A 1B4VA 2XVEA 3B3RA 3D8XA 1EL5A 2QA2A 4ECHA 2GR0A 4BK3A 4TM3A 4NZHA 2ZZ0A 2Q0KA 3UKLA 4G9KA 5U1OA 3AYJA 1KSUA 3F8DA 1L0VA 1KDGA 4YTPA 4K7ZA 2GB0A 4NEVA 4H4PA 4K5SA 3RP7A 2IIDA 1EBDA 4H4XA 3SYIA 1CC6A 2IVDA 1GRTA 4NTDA 5KOXA 1D4EA 2XLUA 3AECA 3EANA 1K4QA 3NG7X 3NYCA 1YKJA 4NEWA 4Z24A 5C3JA 2C3CA 3VR9A 1PS9A 3IWAA 2WOWA 4H4WA 3BHFA 1BWCA 3NHOX 3P4SA 4H4YA 5FS7A 1XPQA 4TM1A 3NLCA 3GRTA 3ICTA 3SZFA 3OC4A 4DSHA 4TLZA 1DJNA 1IUXA 4H2PA 3ICRA 2JBVA 3V3OA 4APNA 3AEAA 4A6NA 1N4UA 1O95A 3T2YA 2XVHA 4JDRA 4H4SA 2F5ZA 2YR4A 3T2KA 3AYLA 3FIMB 3UKPA 1LV0A 3GD3A 3UTFA 3CGBA 4PABA 4NTCA 3DK4A 1TDOA 3AB1A 3H8LA 4NNJA 3GWFA 4K2XA 3AE3A 3M12A 1LPFA 4GR1A 2YR5A 3VQRA 4EIPA 2R0CA 2XFPA 4ZCDA 1DODA 4FK1C 2WBAA 1TRBA 3HYXA 4YSHA 3VRAA 4C3XA 4YKGA 2GRTA 4NTEA 3S61A 2WQYA 2BYBA 5KVHA 1BF3A 1Y56B 2WDQA 3O0HA 2CULA 2GR2A 4J36A 2WEUA 2YG3A 3FPZA 3QVRA 4EM3A 4C5OA 3SX6A 1ZX9A 1FEBA 1RP0A 2WDRA 4H4ZA 4II3A 2BACA 3G5RA 2Z5XA 2CFYA 3AEBA 4Z44A 3S5WA 1X31B 4OPLA 5M10A 5KVIA 2R9ZA 2GQFA 1GERA 2VRMA 4M52A 4DNAA 3IC9A 3KKJA 1QLBA 1P2EA 2CVJA 3DGZA 4U8PA 2BS3A 3OZ2A 1REOA 3AEDA 4AOXA 1F6MA 5IQ1A 1M6IA 1Y0PA 4GUVA 4JNAA 5JCIA 2J3NA 5IPYA 2WP6A 4II2A 1CJ4A 4BJZA 4GF7A 5BULA 1NG4A 3KA7A 4B67A 1GALA 2C65A 3NIXA 1PJ7A 5ER0A 3ATQA 4J56A 3T2ZA 1CBOA 3LXDA 4YSYA 5KWFA 1K0LA 1QO8A 2B9XA 2FJBA 5U25A 3T31A 3NK1X 1YQ4A 2BCPA 5KMQA 3CMMA 1D4DA 1D4CA 4LIIA 4H4RA 1CJ3A 1NHPA 2GVCA 2WS3A 5FS8A 4Z25A 3AD9B 2APGA 4BJYA 3LADA 4OCGA 2XFQA 3AYIA 1JOAA 4G6HA 1E1NA 1N4VA 1ZK7A 4H4TA 1HYUA 2BXSA 4ZN0A 1N1PA 4CRTA 4EMJA 1H83A 5J60A 1AOGA 2QA1A 4EQXA 4FK1A 2VOUA 3GMBA 2WPEA 3AE5A 3NN6X 1PXCA 3UOVA 2H88A 3C4NA 1IUSA 2CDUA 1CC2A 1S2QA 2XFNA 4GAVA 3ZYXA 4EMWA 1V59A 2B7SA 3UKAA 4U8JA 4RG3A 2C67A 3II4A 5LV9A 3EAOA 2Y6QA 1DOEA 2AR8A 2AAQA 3NT6A 1IUUA 4A9WA 2YG5A 2YLSA 4H4VA 2YM1A 4YKFA 4PAAA 2RGJA 1O5WA 3CIRA 1Y56A 3NTDA 1ZKQA 1MXTA 3LZWA 3NKSA 5JCKA 2BRYA 3P4QA 4DGKA 5KMRA 2YVFA 4FDCB 2GAHB 2BS4A 3NYEA 4P9SA 3UP5A 2WESA 2TMDA 4A7AA 2GEWA 3PO7A 4UDQA 2BK4A 3GD4A 2XVIA 4Y4MA 5BRTA 3DGHA 2C76A 3DH9A 3ICSA 3UTHA 3F8PA 4GDEA 4TM0A 3QSEA 4EM4A 1JNRA 3UOXA 1GRAA 1LQUA 2A89A 2X99A 1JRXA 1IUWA 3LZXA 1ELIA 3K7TA 4U8OA 4EQSA 1DJQA 3UTEA 1EL9A 1K0IA 3REDA 2EQ7A 4KX6A 3KLJA 4REKA 1NHRA 3UTGA 2ARDA 3FBSA 1TYTA 3SZCA 3DK9A 1VG0A 1GV4A 5HXIA 2PYXA 2B9WA 1CJCA 3V3NA 1O94A 3VR8A 4BK2A 1XHCA 4GDPA 3UOZA 1Q1RA 3CNJA 3GYJA 2JB2A 1TDKA 5GSNA 1GESA 4Y4NA 2BABA 1CJ2A 2X50A 2FJDA 2BS2A 1H7XA 3P4RA 5KMPA 3QSSA 5CKUA 2RGHA 2C72A 3B6DA 4AOSA 2GMHA 4U8LA 5EOWA 2JB3A 1JRZA 1Z6LA 2OAMA 2R4EA 2YVJA 4B65A 4BURA 5JCLA 2E4GA 4IVMB 2XLTA 1TDNA 1KFYA 3ITJA 4LU6A 3CGCA 1JU2A 3T0KA 1PBEA 1ZOVA 5KNLA 2YWLA 1OJAA 4A79A 1F8SA 2VQ7A 5DBJA 2C64A 2ZZCA 1E1MA 4NWZA 1CL0A 1S2YA 4Z43A 2X8GA 2YG7A 1B8SA 1PBCA 1ONFA 2R45A 4UDPA 2EQ9A 2IVEA 3QFBA 4Y4LA 1CHUA 3UP4A 2YM2A 3AE7A 3AE9A 2GAGB 4J57A 4J34A 1FEAA 4OPIA 1SEZA 1VQWA 3AEEA 3CPIG 4H4QA 1PJ6A 2R0GA 2W0HA 4CNJA 3AE4A 2B9YA 1CC4A 4A65A 2C75A 4JN9A 1GSNA 3GDNA 4E0VA 2GR3A 1LJ1A 4CCRA 4H7UA 3GWDA 4KPRA 1F8WA 2YR6A 1GRHA 4Z2UA 1MO9A 1OJDA 4X4JA 3V76A 3IHGA 3SY4A 3K30A 2WOVA 3PVCA 3SQPA 1XDIA 4U8KA 3P1WA 2RABA 1MOKA 1D5TA 4EMIA 1F3PA 3CGEA 3EF6A 1OJ9A 3I3LA 3H4KA 2VVMA 5KXJA 4B66A 4TM4A 2WP9A 2ACZA 3CN8A 1PHHA 4J33A 1LTXR 2Q7VA 4WX1A 4H2RA 2RGOA 3CPHG 4U8NA 1NENA 2YLXA 2YLTA 4RSLA 4RG4A 5U63A 1GETA 4YSZA 4WCTA 4Z26A 2OALA 3AD8B 3GRSA 4B69A 4OPDA 4AT2A 4C77A 1KF6A 3C4AA 2C7GA 2DKIA 1OJCA 2UZZA 2B7RA 1H86A 3CPJG 3UKQA 2WETA 3VRDB 3D1CA 4Z2TA 3IHMA 3ISHA 1TYPA 3FMWA 4ICYA 2XCGA 1E7PA 5FS6A 2XVJA 3ABVA 3Q6JA 3HYVA 1KSSA 1ZOYA 1Q1WA 2C4CA 2FBWA 1KNRA 4GAPA 1FL2A 3CGDA 1DXLA 3PS9A 4I58A 1NPXA 4OVIA 1PN0A 2X8HA 3NGCX 1PJ5A 4HB9A 1GXFA 3ALJA 3SZWA 2V6OA 4MJWA 4B68A 4U2SA 3AE6A 1GREA 1JEHA 4HA6A 4U8IA 1DOBA 3G5SA 5FMHA 1YY5A 5M0ZA 1VRQB 2GMJA 5BVAA 4X9MA 2E1MA 4BK1A 1UKVG 2BCGG 4GCMA 1NEKA 4FX9A 3NN0X 4O5QA 3URHA 4CNKA 3ALLA 4AP1A 3HZLA 3JSKA 1BGNA 3UCLA 1KNPA 2V3AA 4K8DA 1H81A 5EB5A 3GYXA 3E1TA 1DNCA 2BK3A 1EL7A 4IA6A 3K7QX 3NK0X 3NK2X 4IVOB 2YLZA 3SM8A 4B1BA 2XLRA 3P4PA 4USQA 2BC1A 1GNDA 1E39A 1PBDA 1VG9A 3CTYA 3KVEA 3KPKA 2EQ6A 2FJEA 4H2NA 2BK5A 1GRGA 3DJGX 4A99A 4CBQA 1IUVA 1DOCA 3F8RA 4D03A 2YLRA 1E1KA 2XYOA 1F8RA 2NPXA 4EQRA 3UKFA 4BV6A 3RP8A 3G5QA 1H84A 3AEFA 5HHFA 1BZLA 5L46A 1NHQA 4AT0A 1K0JA 2ZBWA 3QVPA 2VVLA 1B5QA 4GRTA 4CY8A 3ADAB 2GV8A 2QCUA 4G6GA 3ATRA 4G73A 2R4JA 4D04A 1IJHA 1L9EA 2E5VA 5C2TA 1ZY8A 3ZDNA 4G74A 1GRFA 3SZ0A 4YSXA 1XANA 1GTEA 2OA1A 3AD7B 3DJDA 4LA1A 4ZCCA 3AE1A 3DA1A 3EPTA 2GH5A 4EQWA 5IQ4A 2JK6A 4OPTA 2AQJA 3AE8A 1W4XA 2VZ2A 2JB1A 4U8MA 4X9NA 4C74A 4K22A 2BC0A 3L1RA 1PDHA 2V3BA 1Q9IA 4J2WA 3GYIA 3VRBA 3WE0A 1LVLA 4JQ9A 1NAAA 2EQ8A 2Y6RA 1H6VA 1TDFA 1PBBA 2WHDA 2XFUA 2Q6UA 2NVKX 3FG2P 3QFAA 3AXBA 5GRTA 3DJEA 3QSMA 1GEUA 3NRNA 4OPGA 5CQFA 1FCDA 4UDRA 1NHSA 3T37A 3BNMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COY A;  1ZP0 A;  3BNU A;  3RNM A;  2C3D A;  2JAE A;  2O9Z A;  3BI2 A;  3KD9 A;  1ZMC A;  4USR A;  3UKH A;  2ZZB A;  3SFE A;  3K7M X;  4UP3 A;  3AEG A;  1E1L A;  3UOY A;  4YTM A;  3NH3 X;  1FEC A;  3CNS A;  2H89 A;  2C70 A;  1TDE A;  1P2H A;  2TPR A;  1EL8 A;  3DK8 A;  3GSI A;  4U2L A;  2R0P A;  2I0Z A;  4CY6 A;  1NDA A;  1ZMD A;  1OJT A;  2WOI A;  1IUT A;  3I6D A;  1S3E A;  3BI4 A;  2YQU A;  2R46 A;  5BUK A;  2WU5 A;  3CNT A;  2VVL G;  1NG3 A;  3DJJ A;  3CND A;  2XDO A;  3RP6 A;  3DME A;  2VQB A;  3P9U A;  1BKW A;  5KRQ A;  3CNP A;  2V60 A;  2HQM A;  2GF3 A;  1PXB A;  1D7Y A;  1PXA A;  2PHH A;  4H50 A;  4EIQ A;  2BA9 A;  2WP5 A;  4Z2R A;  1GRB A;  1BGJ A;  3R9U A;  5TR3 A;  2V5Z A;  4K5R A;  5FS9 A;  4AP3 A;  4C3Y A;  2GR1 A;  2VRL A;  4YXD A;  4XWZ A;  5HY5 A;  2V61 A;  4XXG A;  3ALM A;  2B76 A;  4CCQ A;  4A5L A;  4B63 A;  3SFD A;  3GDP A;  2YAU A;  2OLO A;  1YQ3 A;  2C66 A;  3BHK A;  1GOS A;  1FOH A;  1JRY A;  4I59 A;  4ADW A;  4JY3 A;  3IF9 A;  3M0O A;  1YQZ A;  3BI5 A;  4XWR A;  4OPU A;  3GMC A;  4A6N B;  4YTN A;  1GPE A;  1PBF A;  1H82 A;  2YVG A;  1GTH A;  2XFO A;  1CF3 A;  3AWI A;  3L8K A;  1D7L A;  4DSG A;  3C96 A;  5KOW A;  4JY2 A;  3UKK A;  2XLS A;  4N9X A;  1RYI A;  2XLP A;  1LQT A;  1QJD A;  3COX A;  1B37 A;  2A8X A;  4IA5 A;  2A87 A;  3NTA A;  3LJP A;  2WPF A;  2X3N A;  4TLX A;  2Z5Y A;  1L9C A;  3AE2 A;  1H7W A;  2X8C A;  3KPF A;  5EBK A;  1S3B A;  2FJA A;  5JCN A;  2YLW A;  2JKC A;  3KU9 A;  5JCM A;  4IV9 A;  1E6E A;  4U2T A;  3LOV A;  4J31 A;  4H2Q A;  3LB8 A;  3SGL A;  4YT0 A;  5J7X A;  2YG4 A;  1N4W A;  3NYF A;  4H4U A;  2OLN A;  3Q9T A;  1M64 A;  1RSG A;  4O5U A;  1JNZ A;  1ZDL A;  2WU2 A;  1GT8 A;  3NNE A;  2BXR A;  4JNQ A;  2GQW A;  4YWO A;  4B64 A;  3QJ4 A;  3H8I A;  2QAE A;  4OPC A;  1L9D A;  2DKH A;  2WDV A;  2YG6 A;  5HYM A;  3M13 A;  2C73 A;  2WPC A;  2Q0L A;  3RHA A;  1VDC A;  2XVF A;  5EB4 A;  1B4V A;  2XVE A;  3B3R A;  3D8X A;  1EL5 A;  2QA2 A;  4ECH A;  2GR0 A;  4BK3 A;  4TM3 A;  4NZH A;  2ZZ0 A;  2Q0K A;  3UKL A;  5U1O A;  3AYJ A;  1KSU A;  3F8D A;  1L0V A;  1KDG A;  4YTP A;  4K7Z A;  2GB0 A;  4NEV A;  4H4P A;  4K5S A;  3RP7 A;  2IID A;  1EBD A;  4H4X A;  1CC6 A;  2IVD A;  1GRT A;  4NTD A;  5KOX A;  1D4E A;  2XLU A;  3AEC A;  3EAN A;  1K4Q A;  3NG7 X;  3NYC A;  1YKJ A;  4NEW A;  4Z24 A;  5C3J A;  2C3C A;  3VR9 A;  1PS9 A;  3IWA A;  2WOW A;  4H4W A;  3BHF A;  1BWC A;  3NHO X;  3P4S A;  4H4Y A;  5FS7 A;  1XPQ A;  4TM1 A;  3NLC A;  3GRT A;  3ICT A;  3OC4 A;  4DSH A;  4TLZ A;  1DJN A;  1IUX A;  4H2P A;  3ICR A;  2JBV A;  3V3O A;  4APN A;  3AEA A;  4A6N A;  1N4U A;  1O95 A;  2XVH A;  4JDR A;  4H4S A;  2F5Z A;  2YR4 A;  3AYL A;  3FIM B;  3UKP A;  1LV0 A;  3GD3 A;  3UTF A;  3CGB A;  4PAB A;  4NTC A;  3DK4 A;  1TDO A;  3AB1 A;  3H8L A;  3GWF A;  4K2X A;  3AE3 A;  3M12 A;  1LPF A;  4GR1 A;  2YR5 A;  3VQR A;  4EIP A;  2R0C A;  2XFP A;  4ZCD A;  1DOD A;  4FK1 C;  2WBA A;  1TRB A;  4YSH A;  3VRA A;  4C3X A;  4YKG A;  2GRT A;  4NTE A;  3S61 A;  2WQY A;  2BYB A;  5KVH A;  1BF3 A;  1Y56 B;  2WDQ A;  3O0H A;  2CUL A;  2GR2 A;  4J36 A;  2WEU A;  2YG3 A;  3FPZ A;  3QVR A;  4EM3 A;  4C5O A;  1ZX9 A;  1FEB A;  1RP0 A;  2WDR A;  4H4Z A;  2BAC A;  3G5R A;  2Z5X A;  2CFY A;  3AEB A;  4Z44 A;  3S5W A;  1X31 B;  4OPL A;  5M10 A;  5KVI A;  2R9Z A;  2GQF A;  1GER A;  2VRM A;  4M52 A;  4DNA A;  3IC9 A;  3KKJ A;  1QLB A;  1P2E A;  2CVJ A;  3DGZ A;  4U8P A;  2BS3 A;  3OZ2 A;  1REO A;  3AED A;  4AOX A;  1F6M A;  5IQ1 A;  1M6I A;  1Y0P A;  4GUV A;  4JNA A;  5JCI A;  2J3N A;  5IPY A;  2WP6 A;  1CJ4 A;  4BJZ A;  4GF7 A;  5BUL A;  1NG4 A;  3KA7 A;  4B67 A;  1GAL A;  2C65 A;  3NIX A;  1PJ7 A;  5ER0 A;  3ATQ A;  4J56 A;  1CBO A;  3LXD A;  4YSY A;  5KWF A;  1K0L A;  1QO8 A;  2B9X A;  2FJB A;  5U25 A;  3NK1 X;  1YQ4 A;  2BCP A;  1D4D A;  1D4C A;  4LII A;  4H4R A;  1CJ3 A;  1NHP A;  2GVC A;  2WS3 A;  5FS8 A;  4Z25 A;  3AD9 B;  2APG A;  4BJY A;  3LAD A;  4OCG A;  2XFQ A;  3AYI A;  1JOA A;  1E1N A;  1N4V A;  1ZK7 A;  4H4T A;  1HYU A;  2BXS A;  4ZN0 A;  1N1P A;  4CRT A;  4EMJ A;  1H83 A;  5J60 A;  1AOG A;  2QA1 A;  4EQX A;  4FK1 A;  2VOU A;  3GMB A;  2WPE A;  3AE5 A;  3NN6 X;  1PXC A;  3UOV A;  2H88 A;  3C4N A;  1IUS A;  2CDU A;  1CC2 A;  1S2Q A;  2XFN A;  4EMW A;  3ZYX A;  1V59 A;  2B7S A;  3UKA A;  4U8J A;  4RG3 A;  2C67 A;  3II4 A;  5LV9 A;  3EAO A;  2Y6Q A;  1DOE A;  2AR8 A;  2AAQ A;  3NT6 A;  1IUU A;  4A9W A;  2YG5 A;  2YLS A;  4H4V A;  2YM1 A;  4YKF A;  4PAA A;  2RGJ A;  1O5W A;  3CIR A;  1Y56 A;  3NTD A;  1ZKQ A;  1MXT A;  3LZW A;  3NKS A;  5JCK A;  3P4Q A;  4DGK A;  2YVF A;  4FDC B;  2GAH B;  2BS4 A;  3NYE A;  4P9S A;  3UP5 A;  2WES A;  2TMD A;  4A7A A;  2GEW A;  3PO7 A;  4UDQ A;  2BK4 A;  3GD4 A;  2XVI A;  4Y4M A;  5BRT A;  3DGH A;  2C76 A;  3DH9 A;  3ICS A;  3UTH A;  3F8P A;  4GDE A;  4TM0 A;  3QSE A;  4EM4 A;  1JNR A;  3UOX A;  1GRA A;  1LQU A;  2A89 A;  2X99 A;  1JRX A;  1IUW A;  3LZX A;  1ELI A;  3K7T A;  4U8O A;  4EQS A;  1DJQ A;  3UTE A;  1EL9 A;  1K0I A;  3RED A;  2EQ7 A;  4KX6 A;  3KLJ A;  4REK A;  1NHR A;  3UTG A;  2ARD A;  3FBS A;  1TYT A;  3DK9 A;  1VG0 A;  1GV4 A;  5HXI A;  2PYX A;  2B9W A;  1CJC A;  3V3N A;  1O94 A;  3VR8 A;  4BK2 A;  1XHC A;  4GDP A;  3UOZ A;  1Q1R A;  3CNJ A;  3GYJ A;  2JB2 A;  1TDK A;  5GSN A;  1GES A;  4Y4N A;  2BAB A;  1CJ2 A;  2X50 A;  2FJD A;  2BS2 A;  1H7X A;  3P4R A;  3QSS A;  5CKU A;  2RGH A;  2C72 A;  3B6D A;  4AOS A;  2GMH A;  4U8L A;  5EOW A;  2JB3 A;  1JRZ A;  1Z6L A;  2OAM A;  2R4E A;  2YVJ A;  4B65 A;  4BUR A;  5JCL A;  2E4G A;  4IVM B;  2XLT A;  1TDN A;  1KFY A;  3ITJ A;  4LU6 A;  3CGC A;  1JU2 A;  1PBE A;  1ZOV A;  2YWL A;  1OJA A;  4A79 A;  1F8S A;  2VQ7 A;  5DBJ A;  2C64 A;  2ZZC A;  1E1M A;  1CL0 A;  1S2Y A;  4Z43 A;  2X8G A;  2YG7 A;  1B8S A;  1PBC A;  1ONF A;  2R45 A;  4UDP A;  2EQ9 A;  2IVE A;  3QFB A;  4Y4L A;  1CHU A;  3UP4 A;  2YM2 A;  3AE7 A;  3AE9 A;  2GAG B;  4J57 A;  4J34 A;  1FEA A;  4OPI A;  1SEZ A;  1VQW A;  3AEE A;  3CPI G;  4H4Q A;  1PJ6 A;  2R0G A;  2W0H A;  4CNJ A;  3AE4 A;  2B9Y A;  1CC4 A;  4A65 A;  2C75 A;  4JN9 A;  1GSN A;  3GDN A;  4E0V A;  2GR3 A;  1LJ1 A;  4CCR A;  4H7U A;  3GWD A;  4KPR A;  1F8W A;  2YR6 A;  1GRH A;  4Z2U A;  1MO9 A;  1OJD A;  4X4J A;  3V76 A;  3IHG A;  3K30 A;  2WOV A;  3PVC A;  3SQP A;  1XDI A;  4U8K A;  3P1W A;  2RAB A;  1MOK A;  1D5T A;  4EMI A;  1F3P A;  3CGE A;  3EF6 A;  1OJ9 A;  3I3L A;  3H4K A;  2VVM A;  5KXJ A;  4B66 A;  4TM4 A;  2WP9 A;  2ACZ A;  3CN8 A;  1PHH A;  4J33 A;  1LTX R;  2Q7V A;  4WX1 A;  4H2R A;  2RGO A;  3CPH G;  4U8N A;  1NEN A;  2YLX A;  2YLT A;  4RSL A;  4RG4 A;  5U63 A;  1GET A;  4YSZ A;  4WCT A;  4Z26 A;  2OAL A;  3AD8 B;  3GRS A;  4B69 A;  4OPD A;  4AT2 A;  4C77 A;  1KF6 A;  3C4A A;  2C7G A;  2DKI A;  1OJC A;  2UZZ A;  2B7R A;  1H86 A;  3CPJ G;  3UKQ A;  2WET A;  3VRD B;  3D1C A;  4Z2T A;  3IHM A;  3ISH A;  1TYP A;  3FMW A;  4ICY A;  2XCG A;  1E7P A;  5FS6 A;  2XVJ A;  3ABV A;  3Q6J A;  1KSS A;  1ZOY A;  1Q1W A;  2FBW A;  1KNR A;  1FL2 A;  3CGD A;  1DXL A;  3PS9 A;  4I58 A;  1NPX A;  4OVI A;  1PN0 A;  2X8H A;  3NGC X;  1PJ5 A;  4HB9 A;  1GXF A;  3ALJ A;  2V6O A;  4MJW A;  4B68 A;  4U2S A;  3AE6 A;  1GRE A;  1JEH A;  4HA6 A;  4U8I A;  1DOB A;  3G5S A;  5FMH A;  1YY5 A;  5M0Z A;  1VRQ B;  2GMJ A;  5BVA A;  4X9M A;  2E1M A;  4BK1 A;  1UKV G;  2BCG G;  4GCM A;  1NEK A;  4FX9 A;  3NN0 X;  4O5Q A;  3URH A;  4CNK A;  3ALL A;  4AP1 A;  3HZL A;  3JSK A;  1BGN A;  3UCL A;  1KNP A;  2V3A A;  4K8D A;  1H81 A;  5EB5 A;  3E1T A;  1DNC A;  2BK3 A;  1EL7 A;  4IA6 A;  3K7Q X;  3NK0 X;  3NK2 X;  4IVO B;  2YLZ A;  3SM8 A;  4B1B A;  2XLR A;  3P4P A;  4USQ A;  2BC1 A;  1GND A;  1E39 A;  1PBD A;  1VG9 A;  3CTY A;  3KVE A;  2EQ6 A;  2FJE A;  4H2N A;  2BK5 A;  1GRG A;  3DJG X;  4A99 A;  4CBQ A;  1IUV A;  1DOC A;  3F8R A;  4D03 A;  2YLR A;  1E1K A;  2XYO A;  1F8R A;  2NPX A;  4EQR A;  3UKF A;  4BV6 A;  3RP8 A;  3G5Q A;  1H84 A;  3AEF A;  5HHF A;  1BZL A;  5L46 A;  1NHQ A;  4AT0 A;  1K0J A;  2ZBW A;  3QVP A;  2VVL A;  1B5Q A;  4GRT A;  4CY8 A;  3ADA B;  2GV8 A;  2QCU A;  3ATR A;  2R4J A;  4D04 A;  1IJH A;  1L9E A;  2E5V A;  5C2T A;  1ZY8 A;  3ZDN A;  1GRF A;  4YSX A;  1XAN A;  1GTE A;  2OA1 A;  3AD7 B;  3DJD A;  4LA1 A;  4ZCC A;  3AE1 A;  3DA1 A;  3EPT A;  2GH5 A;  4EQW A;  5IQ4 A;  2JK6 A;  4OPT A;  2AQJ A;  3AE8 A;  1W4X A;  2VZ2 A;  2JB1 A;  4U8M A;  4X9N A;  4C74 A;  4K22 A;  2BC0 A;  3L1R A;  1PDH A;  2V3B A;  1Q9I A;  4J2W A;  3GYI A;  3VRB A;  3WE0 A;  1LVL A;  4JQ9 A;  1NAA A;  2EQ8 A;  2Y6R A;  1H6V A;  1TDF A;  1PBB A;  2WHD A;  2XFU A;  2Q6U A;  2NVK X;  3FG2 P;  3QFA A;  3AXB A;  5GRT A;  3DJE A;  3QSM A;  1GEU A;  3NRN A;  4OPG A;  5CQF A;  1FCD A;  4UDR A;  1NHS A;  3T37 A;  3BNM A; 
#chains in the Genus database with same CATH topology
 1COY A;  1ZP0 A;  3BNU A;  3RNM A;  2C3D A;  2JAE A;  2O9Z A;  3BI2 A;  3KD9 A;  1ZMC A;  4USR A;  3UKH A;  2ZZB A;  3SFE A;  3K7M X;  4UP3 A;  3AEG A;  1E1L A;  3UOY A;  4YTM A;  3NH3 X;  1FEC A;  3CNS A;  2H89 A;  2C70 A;  1TDE A;  1P2H A;  2TPR A;  1EL8 A;  3DK8 A;  3GSI A;  4U2L A;  2R0P A;  2I0Z A;  4CY6 A;  1NDA A;  1ZMD A;  1OJT A;  2WOI A;  1IUT A;  3I6D A;  1S3E A;  3BI4 A;  2YQU A;  2R46 A;  5BUK A;  2WU5 A;  3CNT A;  2VVL G;  1NG3 A;  3DJJ A;  3CND A;  2XDO A;  3RP6 A;  3DME A;  2VQB A;  3P9U A;  1BKW A;  2BRA A;  3CNP A;  5KRQ A;  2V60 A;  2HQM A;  2GF3 A;  1PXB A;  1D7Y A;  1PXA A;  2PHH A;  4H50 A;  4EIQ A;  5KMS A;  2BA9 A;  2WP5 A;  4Z2R A;  1GRB A;  1BGJ A;  3R9U A;  5TR3 A;  2V5Z A;  4K5R A;  5FS9 A;  4AP3 A;  4C3Y A;  2GR1 A;  2VRL A;  4YXD A;  4XWZ A;  5HY5 A;  2V61 A;  4XXG A;  3ALM A;  2B76 A;  4CCQ A;  4A5L A;  4B63 A;  3SFD A;  3GDP A;  2YAU A;  2OLO A;  1YQ3 A;  2C66 A;  3BHK A;  1GOS A;  1FOH A;  1JRY A;  4I59 A;  3HYW A;  4ADW A;  4JY3 A;  3IF9 A;  3M0O A;  1YQZ A;  3BI5 A;  4XWR A;  4OPU A;  3GMC A;  4A6N B;  4YTN A;  1GPE A;  1PBF A;  1H82 A;  2YVG A;  1GTH A;  2XFO A;  1CF3 A;  3AWI A;  3L8K A;  1D7L A;  4DSG A;  3C96 A;  5KOW A;  4JY2 A;  3UKK A;  2XLS A;  4N9X A;  1RYI A;  2XLP A;  1LQT A;  3SXI A;  1QJD A;  3COX A;  1B37 A;  2A8X A;  4IA5 A;  2A87 A;  3NTA A;  3LJP A;  2WPF A;  2X3N A;  4TLX A;  2Z5Y A;  1L9C A;  3AE2 A;  1H7W A;  2X8C A;  3KPF A;  5EBK A;  1S3B A;  2FJA A;  5JCN A;  2YLW A;  2JKC A;  3KU9 A;  5JCM A;  4IV9 A;  1E6E A;  4U2T A;  3LOV A;  4J31 A;  4H2Q A;  3LB8 A;  3SGL A;  4YT0 A;  5J7X A;  2YG4 A;  1N4W A;  3NYF A;  4H4U A;  2OLN A;  3Q9T A;  1M64 A;  1RSG A;  4O5U A;  1JNZ A;  1ZDL A;  2WU2 A;  1GT8 A;  3NNE A;  2BXR A;  4JNQ A;  2GQW A;  4YWO A;  4B64 A;  3QJ4 A;  3H8I A;  3T14 A;  2QAE A;  4OPC A;  1L9D A;  2DKH A;  2WDV A;  2YG6 A;  5HYM A;  3M13 A;  2C73 A;  2WPC A;  2Q0L A;  3RHA A;  1VDC A;  2XVF A;  5EB4 A;  1B4V A;  2XVE A;  3B3R A;  3D8X A;  1EL5 A;  2QA2 A;  4ECH A;  2GR0 A;  4BK3 A;  4TM3 A;  4NZH A;  2ZZ0 A;  2Q0K A;  3UKL A;  4G9K A;  5U1O A;  3AYJ A;  1KSU A;  3F8D A;  1L0V A;  1KDG A;  4YTP A;  4K7Z A;  2GB0 A;  4NEV A;  4H4P A;  4K5S A;  3RP7 A;  2IID A;  1EBD A;  4H4X A;  3SYI A;  1CC6 A;  2IVD A;  1GRT A;  4NTD A;  5KOX A;  1D4E A;  2XLU A;  3AEC A;  3EAN A;  1K4Q A;  3NG7 X;  3NYC A;  1YKJ A;  4NEW A;  4Z24 A;  5C3J A;  2C3C A;  3VR9 A;  1PS9 A;  3IWA A;  2WOW A;  4H4W A;  3BHF A;  1BWC A;  3NHO X;  3P4S A;  4H4Y A;  5FS7 A;  1XPQ A;  4TM1 A;  3NLC A;  3GRT A;  3ICT A;  3SZF A;  3OC4 A;  4DSH A;  4TLZ A;  1DJN A;  1IUX A;  4H2P A;  3ICR A;  2JBV A;  3V3O A;  4APN A;  3AEA A;  4A6N A;  1N4U A;  1O95 A;  3T2Y A;  2XVH A;  4JDR A;  4H4S A;  2F5Z A;  2YR4 A;  3T2K A;  3AYL A;  3FIM B;  3UKP A;  1LV0 A;  3GD3 A;  3UTF A;  3CGB A;  4PAB A;  4NTC A;  3DK4 A;  1TDO A;  3AB1 A;  3H8L A;  4NNJ A;  3GWF A;  4K2X A;  3AE3 A;  3M12 A;  1LPF A;  4GR1 A;  2YR5 A;  3VQR A;  4EIP A;  2R0C A;  2XFP A;  4ZCD A;  1DOD A;  4FK1 C;  2WBA A;  1TRB A;  3HYX A;  4YSH A;  3VRA A;  4C3X A;  4YKG A;  2GRT A;  4NTE A;  3S61 A;  2WQY A;  2BYB A;  5KVH A;  1BF3 A;  1Y56 B;  2WDQ A;  3O0H A;  2CUL A;  2GR2 A;  4J36 A;  2WEU A;  2YG3 A;  3FPZ A;  3QVR A;  4EM3 A;  4C5O A;  3SX6 A;  1ZX9 A;  1FEB A;  1RP0 A;  2WDR A;  4H4Z A;  4II3 A;  2BAC A;  3G5R A;  2Z5X A;  2CFY A;  3AEB A;  4Z44 A;  3S5W A;  1X31 B;  4OPL A;  5M10 A;  5KVI A;  2R9Z A;  2GQF A;  1GER A;  2VRM A;  4M52 A;  4DNA A;  3IC9 A;  3KKJ A;  1QLB A;  1P2E A;  2CVJ A;  3DGZ A;  4U8P A;  2BS3 A;  3OZ2 A;  1REO A;  3AED A;  4AOX A;  1F6M A;  5IQ1 A;  1M6I A;  1Y0P A;  4GUV A;  4JNA A;  5JCI A;  2J3N A;  5IPY A;  2WP6 A;  4II2 A;  1CJ4 A;  4BJZ A;  4GF7 A;  5BUL A;  1NG4 A;  3KA7 A;  4B67 A;  1GAL A;  2C65 A;  3NIX A;  1PJ7 A;  5ER0 A;  3ATQ A;  4J56 A;  3T2Z A;  1CBO A;  3LXD A;  4YSY A;  5KWF A;  1K0L A;  1QO8 A;  2B9X A;  2FJB A;  5U25 A;  3T31 A;  3NK1 X;  1YQ4 A;  2BCP A;  5KMQ A;  3CMM A;  1D4D A;  1D4C A;  4LII A;  4H4R A;  1CJ3 A;  1NHP A;  2GVC A;  2WS3 A;  5FS8 A;  4Z25 A;  3AD9 B;  2APG A;  4BJY A;  3LAD A;  4OCG A;  2XFQ A;  3AYI A;  1JOA A;  4G6H A;  1E1N A;  1N4V A;  1ZK7 A;  4H4T A;  1HYU A;  2BXS A;  4ZN0 A;  1N1P A;  4CRT A;  4EMJ A;  1H83 A;  5J60 A;  1AOG A;  2QA1 A;  4EQX A;  4FK1 A;  2VOU A;  3GMB A;  2WPE A;  3AE5 A;  3NN6 X;  1PXC A;  3UOV A;  2H88 A;  3C4N A;  1IUS A;  2CDU A;  1CC2 A;  1S2Q A;  2XFN A;  4GAV A;  3ZYX A;  4EMW A;  1V59 A;  2B7S A;  3UKA A;  4U8J A;  4RG3 A;  2C67 A;  3II4 A;  5LV9 A;  3EAO A;  2Y6Q A;  1DOE A;  2AR8 A;  2AAQ A;  3NT6 A;  1IUU A;  4A9W A;  2YG5 A;  2YLS A;  4H4V A;  2YM1 A;  4YKF A;  4PAA A;  2RGJ A;  1O5W A;  3CIR A;  1Y56 A;  3NTD A;  1ZKQ A;  1MXT A;  3LZW A;  3NKS A;  5JCK A;  2BRY A;  3P4Q A;  4DGK A;  5KMR A;  2YVF A;  4FDC B;  2GAH B;  2BS4 A;  3NYE A;  4P9S A;  3UP5 A;  2WES A;  2TMD A;  4A7A A;  2GEW A;  3PO7 A;  4UDQ A;  2BK4 A;  3GD4 A;  2XVI A;  4Y4M A;  5BRT A;  3DGH A;  2C76 A;  3DH9 A;  3ICS A;  3UTH A;  3F8P A;  4GDE A;  4TM0 A;  3QSE A;  4EM4 A;  1JNR A;  3UOX A;  1GRA A;  1LQU A;  2A89 A;  2X99 A;  1JRX A;  1IUW A;  3LZX A;  1ELI A;  3K7T A;  4U8O A;  4EQS A;  1DJQ A;  3UTE A;  1EL9 A;  1K0I A;  3RED A;  2EQ7 A;  4KX6 A;  3KLJ A;  4REK A;  1NHR A;  3UTG A;  2ARD A;  3FBS A;  1TYT A;  3SZC A;  3DK9 A;  1VG0 A;  1GV4 A;  5HXI A;  2PYX A;  2B9W A;  1CJC A;  3V3N A;  1O94 A;  3VR8 A;  4BK2 A;  1XHC A;  4GDP A;  3UOZ A;  1Q1R A;  3CNJ A;  3GYJ A;  2JB2 A;  1TDK A;  5GSN A;  1GES A;  4Y4N A;  2BAB A;  1CJ2 A;  2X50 A;  2FJD A;  2BS2 A;  1H7X A;  3P4R A;  5KMP A;  3QSS A;  5CKU A;  2RGH A;  2C72 A;  3B6D A;  4AOS A;  2GMH A;  4U8L A;  5EOW A;  2JB3 A;  1JRZ A;  1Z6L A;  2OAM A;  2R4E A;  2YVJ A;  4B65 A;  4BUR A;  5JCL A;  2E4G A;  4IVM B;  2XLT A;  1TDN A;  1KFY A;  3ITJ A;  4LU6 A;  3CGC A;  1JU2 A;  3T0K A;  1PBE A;  1ZOV A;  5KNL A;  2YWL A;  1OJA A;  4A79 A;  1F8S A;  2VQ7 A;  5DBJ A;  2C64 A;  2ZZC A;  1E1M A;  4NWZ A;  1CL0 A;  1S2Y A;  4Z43 A;  2X8G A;  2YG7 A;  1B8S A;  1PBC A;  1ONF A;  2R45 A;  4UDP A;  2EQ9 A;  2IVE A;  3QFB A;  4Y4L A;  1CHU A;  3UP4 A;  2YM2 A;  3AE7 A;  3AE9 A;  2GAG B;  4J57 A;  4J34 A;  1FEA A;  4OPI A;  1SEZ A;  1VQW A;  3AEE A;  3CPI G;  4H4Q A;  1PJ6 A;  2R0G A;  2W0H A;  4CNJ A;  3AE4 A;  2B9Y A;  1CC4 A;  4A65 A;  2C75 A;  4JN9 A;  1GSN A;  3GDN A;  4E0V A;  2GR3 A;  1LJ1 A;  4CCR A;  4H7U A;  3GWD A;  4KPR A;  1F8W A;  2YR6 A;  1GRH A;  4Z2U A;  1MO9 A;  1OJD A;  4X4J A;  3V76 A;  3IHG A;  3SY4 A;  3K30 A;  2WOV A;  3PVC A;  3SQP A;  1XDI A;  4U8K A;  3P1W A;  2RAB A;  1MOK A;  1D5T A;  4EMI A;  1F3P A;  3CGE A;  3EF6 A;  1OJ9 A;  3I3L A;  3H4K A;  2VVM A;  5KXJ A;  4B66 A;  4TM4 A;  2WP9 A;  2ACZ A;  3CN8 A;  1PHH A;  4J33 A;  1LTX R;  2Q7V A;  4WX1 A;  4H2R A;  2RGO A;  3CPH G;  4U8N A;  1NEN A;  2YLX A;  2YLT A;  4RSL A;  4RG4 A;  5U63 A;  1GET A;  4YSZ A;  4WCT A;  4Z26 A;  2OAL A;  3AD8 B;  3GRS A;  4B69 A;  4OPD A;  4AT2 A;  4C77 A;  1KF6 A;  3C4A A;  2C7G A;  2DKI A;  1OJC A;  2UZZ A;  2B7R A;  1H86 A;  3CPJ G;  3UKQ A;  2WET A;  3VRD B;  3D1C A;  4Z2T A;  3IHM A;  3ISH A;  1TYP A;  3FMW A;  4ICY A;  2XCG A;  1E7P A;  5FS6 A;  2XVJ A;  3ABV A;  3Q6J A;  3HYV A;  1KSS A;  1ZOY A;  1Q1W A;  2C4C A;  2FBW A;  1KNR A;  4GAP A;  1FL2 A;  3CGD A;  1DXL A;  3PS9 A;  4I58 A;  1NPX A;  4OVI A;  1PN0 A;  2X8H A;  3NGC X;  1PJ5 A;  4HB9 A;  1GXF A;  3ALJ A;  3SZW A;  2V6O A;  4MJW A;  4B68 A;  4U2S A;  3AE6 A;  1GRE A;  1JEH A;  4HA6 A;  4U8I A;  1DOB A;  3G5S A;  5FMH A;  1YY5 A;  5M0Z A;  1VRQ B;  2GMJ A;  5BVA A;  4X9M A;  2E1M A;  4BK1 A;  1UKV G;  2BCG G;  4GCM A;  1NEK A;  4FX9 A;  3NN0 X;  4O5Q A;  3URH A;  4CNK A;  3ALL A;  4AP1 A;  3HZL A;  3JSK A;  1BGN A;  3UCL A;  1KNP A;  2V3A A;  4K8D A;  1H81 A;  5EB5 A;  3GYX A;  3E1T A;  1DNC A;  2BK3 A;  1EL7 A;  4IA6 A;  3K7Q X;  3NK0 X;  3NK2 X;  4IVO B;  2YLZ A;  3SM8 A;  4B1B A;  2XLR A;  3P4P A;  4USQ A;  2BC1 A;  1GND A;  1E39 A;  1PBD A;  1VG9 A;  3CTY A;  3KVE A;  3KPK A;  2EQ6 A;  2FJE A;  4H2N A;  2BK5 A;  1GRG A;  3DJG X;  4A99 A;  4CBQ A;  1IUV A;  1DOC A;  3F8R A;  4D03 A;  2YLR A;  1E1K A;  2XYO A;  1F8R A;  2NPX A;  4EQR A;  3UKF A;  4BV6 A;  3RP8 A;  3G5Q A;  1H84 A;  3AEF A;  5HHF A;  1BZL A;  5L46 A;  1NHQ A;  4AT0 A;  1K0J A;  2ZBW A;  3QVP A;  2VVL A;  1B5Q A;  4GRT A;  4CY8 A;  3ADA B;  2GV8 A;  2QCU A;  4G6G A;  3ATR A;  4G73 A;  2R4J A;  4D04 A;  1IJH A;  1L9E A;  2E5V A;  5C2T A;  1ZY8 A;  3ZDN A;  4G74 A;  1GRF A;  3SZ0 A;  4YSX A;  1XAN A;  1GTE A;  2OA1 A;  3AD7 B;  3DJD A;  4LA1 A;  4ZCC A;  3AE1 A;  3DA1 A;  3EPT A;  2GH5 A;  4EQW A;  5IQ4 A;  2JK6 A;  4OPT A;  2AQJ A;  3AE8 A;  1W4X A;  2VZ2 A;  2JB1 A;  4U8M A;  4X9N A;  4C74 A;  4K22 A;  2BC0 A;  3L1R A;  1PDH A;  2V3B A;  1Q9I A;  4J2W A;  3GYI A;  3VRB A;  3WE0 A;  1LVL A;  4JQ9 A;  1NAA A;  2EQ8 A;  2Y6R A;  1H6V A;  1TDF A;  1PBB A;  2WHD A;  2XFU A;  2Q6U A;  2NVK X;  3FG2 P;  3QFA A;  3AXB A;  5GRT A;  3DJE A;  3QSM A;  1GEU A;  3NRN A;  4OPG A;  5CQF A;  1FCD A;  4UDR A;  1NHS A;  3T37 A;  3BNM A; 
#chains in the Genus database with same CATH homology
 1COY A;  1ZP0 A;  3BNU A;  3RNM A;  2C3D A;  2JAE A;  2O9Z A;  3BI2 A;  3KD9 A;  1ZMC A;  4USR A;  3UKH A;  2ZZB A;  3SFE A;  3K7M X;  4UP3 A;  3AEG A;  1E1L A;  3UOY A;  4YTM A;  3NH3 X;  1FEC A;  3CNS A;  2H89 A;  2C70 A;  1TDE A;  1P2H A;  2TPR A;  1EL8 A;  3DK8 A;  3GSI A;  4U2L A;  2R0P A;  2I0Z A;  4CY6 A;  1NDA A;  1ZMD A;  1OJT A;  2WOI A;  1IUT A;  3I6D A;  1S3E A;  3BI4 A;  2YQU A;  2R46 A;  5BUK A;  2WU5 A;  3CNT A;  2VVL G;  1NG3 A;  3DJJ A;  3CND A;  2XDO A;  3RP6 A;  3DME A;  2VQB A;  3P9U A;  1BKW A;  2BRA A;  3CNP A;  5KRQ A;  2V60 A;  2HQM A;  2GF3 A;  1PXB A;  1D7Y A;  1PXA A;  2PHH A;  4H50 A;  4EIQ A;  5KMS A;  2BA9 A;  2WP5 A;  4Z2R A;  1GRB A;  1BGJ A;  3R9U A;  5TR3 A;  2V5Z A;  4K5R A;  5FS9 A;  4AP3 A;  4C3Y A;  2GR1 A;  2VRL A;  4YXD A;  4XWZ A;  5HY5 A;  2V61 A;  4XXG A;  3ALM A;  2B76 A;  4CCQ A;  4A5L A;  4B63 A;  3SFD A;  3GDP A;  2YAU A;  2OLO A;  1YQ3 A;  2C66 A;  3BHK A;  1GOS A;  1FOH A;  1JRY A;  4I59 A;  3HYW A;  4ADW A;  4JY3 A;  3IF9 A;  3M0O A;  1YQZ A;  3BI5 A;  4XWR A;  4OPU A;  3GMC A;  4A6N B;  4YTN A;  1GPE A;  1PBF A;  1H82 A;  2YVG A;  1GTH A;  2XFO A;  1CF3 A;  3AWI A;  3L8K A;  1D7L A;  4DSG A;  3C96 A;  5KOW A;  4JY2 A;  3UKK A;  2XLS A;  4N9X A;  1RYI A;  2XLP A;  1LQT A;  3SXI A;  1QJD A;  3COX A;  1B37 A;  2A8X A;  4IA5 A;  2A87 A;  3NTA A;  3LJP A;  2WPF A;  2X3N A;  4TLX A;  2Z5Y A;  1L9C A;  3AE2 A;  1H7W A;  2X8C A;  3KPF A;  5EBK A;  1S3B A;  2FJA A;  5JCN A;  2YLW A;  2JKC A;  3KU9 A;  5JCM A;  4IV9 A;  1E6E A;  4U2T A;  3LOV A;  4J31 A;  4H2Q A;  3LB8 A;  3SGL A;  4YT0 A;  5J7X A;  2YG4 A;  1N4W A;  3NYF A;  4H4U A;  2OLN A;  3Q9T A;  1M64 A;  1RSG A;  4O5U A;  1JNZ A;  1ZDL A;  2WU2 A;  1GT8 A;  3NNE A;  2BXR A;  4JNQ A;  2GQW A;  4YWO A;  4B64 A;  3QJ4 A;  3H8I A;  3T14 A;  2QAE A;  4OPC A;  1L9D A;  2DKH A;  2WDV A;  2YG6 A;  5HYM A;  3M13 A;  2C73 A;  2WPC A;  2Q0L A;  3RHA A;  1VDC A;  2XVF A;  5EB4 A;  1B4V A;  2XVE A;  3B3R A;  3D8X A;  1EL5 A;  2QA2 A;  4ECH A;  2GR0 A;  4BK3 A;  4TM3 A;  4NZH A;  2ZZ0 A;  2Q0K A;  3UKL A;  4G9K A;  5U1O A;  3AYJ A;  1KSU A;  3F8D A;  1L0V A;  1KDG A;  4YTP A;  4K7Z A;  2GB0 A;  4NEV A;  4H4P A;  4K5S A;  3RP7 A;  2IID A;  1EBD A;  4H4X A;  3SYI A;  1CC6 A;  2IVD A;  1GRT A;  4NTD A;  5KOX A;  1D4E A;  2XLU A;  3AEC A;  3EAN A;  1K4Q A;  3NG7 X;  3NYC A;  1YKJ A;  4NEW A;  4Z24 A;  5C3J A;  2C3C A;  3VR9 A;  1PS9 A;  3IWA A;  2WOW A;  4H4W A;  3BHF A;  1BWC A;  3NHO X;  3P4S A;  4H4Y A;  5FS7 A;  1XPQ A;  4TM1 A;  3NLC A;  3GRT A;  3ICT A;  3SZF A;  3OC4 A;  4DSH A;  4TLZ A;  1DJN A;  1IUX A;  4H2P A;  3ICR A;  2JBV A;  3V3O A;  4APN A;  3AEA A;  4A6N A;  1N4U A;  1O95 A;  3T2Y A;  2XVH A;  4JDR A;  4H4S A;  2F5Z A;  2YR4 A;  3T2K A;  3AYL A;  3FIM B;  3UKP A;  1LV0 A;  3GD3 A;  3UTF A;  3CGB A;  4PAB A;  4NTC A;  3DK4 A;  1TDO A;  3AB1 A;  3H8L A;  4NNJ A;  3GWF A;  4K2X A;  3AE3 A;  3M12 A;  1LPF A;  4GR1 A;  2YR5 A;  3VQR A;  4EIP A;  2R0C A;  2XFP A;  4ZCD A;  1DOD A;  4FK1 C;  2WBA A;  1TRB A;  3HYX A;  4YSH A;  3VRA A;  4C3X A;  4YKG A;  2GRT A;  4NTE A;  3S61 A;  2WQY A;  2BYB A;  5KVH A;  1BF3 A;  1Y56 B;  2WDQ A;  3O0H A;  2CUL A;  2GR2 A;  4J36 A;  2WEU A;  2YG3 A;  3FPZ A;  3QVR A;  4EM3 A;  4C5O A;  3SX6 A;  1ZX9 A;  1FEB A;  1RP0 A;  2WDR A;  4H4Z A;  4II3 A;  2BAC A;  3G5R A;  2Z5X A;  2CFY A;  3AEB A;  4Z44 A;  3S5W A;  1X31 B;  4OPL A;  5M10 A;  5KVI A;  2R9Z A;  2GQF A;  1GER A;  2VRM A;  4M52 A;  4DNA A;  3IC9 A;  3KKJ A;  1QLB A;  1P2E A;  2CVJ A;  3DGZ A;  4U8P A;  2BS3 A;  3OZ2 A;  1REO A;  3AED A;  4AOX A;  1F6M A;  5IQ1 A;  1M6I A;  1Y0P A;  4GUV A;  4JNA A;  5JCI A;  2J3N A;  5IPY A;  2WP6 A;  4II2 A;  1CJ4 A;  4BJZ A;  4GF7 A;  5BUL A;  1NG4 A;  3KA7 A;  4B67 A;  1GAL A;  2C65 A;  3NIX A;  1PJ7 A;  5ER0 A;  3ATQ A;  4J56 A;  3T2Z A;  1CBO A;  3LXD A;  4YSY A;  5KWF A;  1K0L A;  1QO8 A;  2B9X A;  2FJB A;  5U25 A;  3T31 A;  3NK1 X;  1YQ4 A;  2BCP A;  5KMQ A;  3CMM A;  1D4D A;  1D4C A;  4LII A;  4H4R A;  1CJ3 A;  1NHP A;  2GVC A;  2WS3 A;  5FS8 A;  4Z25 A;  3AD9 B;  2APG A;  4BJY A;  3LAD A;  4OCG A;  2XFQ A;  3AYI A;  1JOA A;  4G6H A;  1E1N A;  1N4V A;  1ZK7 A;  4H4T A;  1HYU A;  2BXS A;  4ZN0 A;  1N1P A;  4CRT A;  4EMJ A;  1H83 A;  5J60 A;  1AOG A;  2QA1 A;  4EQX A;  4FK1 A;  2VOU A;  3GMB A;  2WPE A;  3AE5 A;  3NN6 X;  1PXC A;  3UOV A;  2H88 A;  3C4N A;  1IUS A;  2CDU A;  1CC2 A;  1S2Q A;  2XFN A;  4GAV A;  3ZYX A;  4EMW A;  1V59 A;  2B7S A;  3UKA A;  4U8J A;  4RG3 A;  2C67 A;  3II4 A;  5LV9 A;  3EAO A;  2Y6Q A;  1DOE A;  2AR8 A;  2AAQ A;  3NT6 A;  1IUU A;  4A9W A;  2YG5 A;  2YLS A;  4H4V A;  2YM1 A;  4YKF A;  4PAA A;  2RGJ A;  1O5W A;  3CIR A;  1Y56 A;  3NTD A;  1ZKQ A;  1MXT A;  3LZW A;  3NKS A;  5JCK A;  2BRY A;  3P4Q A;  4DGK A;  5KMR A;  2YVF A;  4FDC B;  2GAH B;  2BS4 A;  3NYE A;  4P9S A;  3UP5 A;  2WES A;  2TMD A;  4A7A A;  2GEW A;  3PO7 A;  4UDQ A;  2BK4 A;  3GD4 A;  2XVI A;  4Y4M A;  5BRT A;  3DGH A;  2C76 A;  3DH9 A;  3ICS A;  3UTH A;  3F8P A;  4GDE A;  4TM0 A;  3QSE A;  4EM4 A;  1JNR A;  3UOX A;  1GRA A;  1LQU A;  2A89 A;  2X99 A;  1JRX A;  1IUW A;  3LZX A;  1ELI A;  3K7T A;  4U8O A;  4EQS A;  1DJQ A;  3UTE A;  1EL9 A;  1K0I A;  3RED A;  2EQ7 A;  4KX6 A;  3KLJ A;  4REK A;  1NHR A;  3UTG A;  2ARD A;  3FBS A;  1TYT A;  3SZC A;  3DK9 A;  1VG0 A;  1GV4 A;  5HXI A;  2PYX A;  2B9W A;  1CJC A;  3V3N A;  1O94 A;  3VR8 A;  4BK2 A;  1XHC A;  4GDP A;  3UOZ A;  1Q1R A;  3CNJ A;  3GYJ A;  2JB2 A;  1TDK A;  5GSN A;  1GES A;  4Y4N A;  2BAB A;  1CJ2 A;  2X50 A;  2FJD A;  2BS2 A;  1H7X A;  3P4R A;  5KMP A;  3QSS A;  5CKU A;  2RGH A;  2C72 A;  3B6D A;  4AOS A;  2GMH A;  4U8L A;  5EOW A;  2JB3 A;  1JRZ A;  1Z6L A;  2OAM A;  2R4E A;  2YVJ A;  4B65 A;  4BUR A;  5JCL A;  2E4G A;  4IVM B;  2XLT A;  1TDN A;  1KFY A;  3ITJ A;  4LU6 A;  3CGC A;  1JU2 A;  3T0K A;  1PBE A;  1ZOV A;  5KNL A;  2YWL A;  1OJA A;  4A79 A;  1F8S A;  2VQ7 A;  5DBJ A;  2C64 A;  2ZZC A;  1E1M A;  4NWZ A;  1CL0 A;  1S2Y A;  4Z43 A;  2X8G A;  2YG7 A;  1B8S A;  1PBC A;  1ONF A;  2R45 A;  4UDP A;  2EQ9 A;  2IVE A;  3QFB A;  4Y4L A;  1CHU A;  3UP4 A;  2YM2 A;  3AE7 A;  3AE9 A;  2GAG B;  4J57 A;  4J34 A;  1FEA A;  4OPI A;  1SEZ A;  1VQW A;  3AEE A;  3CPI G;  4H4Q A;  1PJ6 A;  2R0G A;  2W0H A;  4CNJ A;  3AE4 A;  2B9Y A;  1CC4 A;  4A65 A;  2C75 A;  4JN9 A;  1GSN A;  3GDN A;  4E0V A;  2GR3 A;  1LJ1 A;  4CCR A;  4H7U A;  3GWD A;  4KPR A;  1F8W A;  2YR6 A;  1GRH A;  4Z2U A;  1MO9 A;  1OJD A;  4X4J A;  3V76 A;  3IHG A;  3SY4 A;  3K30 A;  2WOV A;  3PVC A;  3SQP A;  1XDI A;  4U8K A;  3P1W A;  2RAB A;  1MOK A;  1D5T A;  4EMI A;  1F3P A;  3CGE A;  3EF6 A;  1OJ9 A;  3I3L A;  3H4K A;  2VVM A;  5KXJ A;  4B66 A;  4TM4 A;  2WP9 A;  2ACZ A;  3CN8 A;  1PHH A;  4J33 A;  1LTX R;  2Q7V A;  4WX1 A;  4H2R A;  2RGO A;  3CPH G;  4U8N A;  1NEN A;  2YLX A;  2YLT A;  4RSL A;  4RG4 A;  5U63 A;  1GET A;  4YSZ A;  4WCT A;  4Z26 A;  2OAL A;  3AD8 B;  3GRS A;  4B69 A;  4OPD A;  4AT2 A;  4C77 A;  1KF6 A;  3C4A A;  2C7G A;  2DKI A;  1OJC A;  2UZZ A;  2B7R A;  1H86 A;  3CPJ G;  3UKQ A;  2WET A;  3VRD B;  3D1C A;  4Z2T A;  3IHM A;  3ISH A;  1TYP A;  3FMW A;  4ICY A;  2XCG A;  1E7P A;  5FS6 A;  2XVJ A;  3ABV A;  3Q6J A;  3HYV A;  1KSS A;  1ZOY A;  1Q1W A;  2C4C A;  2FBW A;  1KNR A;  4GAP A;  1FL2 A;  3CGD A;  1DXL A;  3PS9 A;  4I58 A;  1NPX A;  4OVI A;  1PN0 A;  2X8H A;  3NGC X;  1PJ5 A;  4HB9 A;  1GXF A;  3ALJ A;  3SZW A;  2V6O A;  4MJW A;  4B68 A;  4U2S A;  3AE6 A;  1GRE A;  1JEH A;  4HA6 A;  4U8I A;  1DOB A;  3G5S A;  5FMH A;  1YY5 A;  5M0Z A;  1VRQ B;  2GMJ A;  5BVA A;  4X9M A;  2E1M A;  4BK1 A;  1UKV G;  2BCG G;  4GCM A;  1NEK A;  4FX9 A;  3NN0 X;  4O5Q A;  3URH A;  4CNK A;  3ALL A;  4AP1 A;  3HZL A;  3JSK A;  1BGN A;  3UCL A;  1KNP A;  2V3A A;  4K8D A;  1H81 A;  5EB5 A;  3GYX A;  3E1T A;  1DNC A;  2BK3 A;  1EL7 A;  4IA6 A;  3K7Q X;  3NK0 X;  3NK2 X;  4IVO B;  2YLZ A;  3SM8 A;  4B1B A;  2XLR A;  3P4P A;  4USQ A;  2BC1 A;  1GND A;  1E39 A;  1PBD A;  1VG9 A;  3CTY A;  3KVE A;  3KPK A;  2EQ6 A;  2FJE A;  4H2N A;  2BK5 A;  1GRG A;  3DJG X;  4A99 A;  4CBQ A;  1IUV A;  1DOC A;  3F8R A;  4D03 A;  2YLR A;  1E1K A;  2XYO A;  1F8R A;  2NPX A;  4EQR A;  3UKF A;  4BV6 A;  3RP8 A;  3G5Q A;  1H84 A;  3AEF A;  5HHF A;  1BZL A;  5L46 A;  1NHQ A;  4AT0 A;  1K0J A;  2ZBW A;  3QVP A;  2VVL A;  1B5Q A;  4GRT A;  4CY8 A;  3ADA B;  2GV8 A;  2QCU A;  4G6G A;  3ATR A;  4G73 A;  2R4J A;  4D04 A;  1IJH A;  1L9E A;  2E5V A;  5C2T A;  1ZY8 A;  3ZDN A;  4G74 A;  1GRF A;  3SZ0 A;  4YSX A;  1XAN A;  1GTE A;  2OA1 A;  3AD7 B;  3DJD A;  4LA1 A;  4ZCC A;  3AE1 A;  3DA1 A;  3EPT A;  2GH5 A;  4EQW A;  5IQ4 A;  2JK6 A;  4OPT A;  2AQJ A;  3AE8 A;  1W4X A;  2VZ2 A;  2JB1 A;  4U8M A;  4X9N A;  4C74 A;  4K22 A;  2BC0 A;  3L1R A;  1PDH A;  2V3B A;  1Q9I A;  4J2W A;  3GYI A;  3VRB A;  3WE0 A;  1LVL A;  4JQ9 A;  1NAA A;  2EQ8 A;  2Y6R A;  1H6V A;  1TDF A;  1PBB A;  2WHD A;  2XFU A;  2Q6U A;  2NVK X;  3FG2 P;  3QFA A;  3AXB A;  5GRT A;  3DJE A;  3QSM A;  1GEU A;  3NRN A;  4OPG A;  5CQF A;  1FCD A;  4UDR A;  1NHS A;  3T37 A;  3BNM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...