4A5LA

Crystal structure of the thioredoxin reductase from entamoeba histolytica
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
313
structure length
313
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
molecule keywords THIOREDOXIN REDUCTASE
total genus 93
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a5lA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a5lA02
2AQJA 1REOA 1VQWA 1PBBA 1BF3A 3NYEA 3DK8A 2WP6A 4CBQA 3QFBA 3VR8A 4CNJA 4YTNA 4J36A 4UDPA 2XCGA 4MJWA 3AYLA 3SM8A 4XWZA 4ZCDA 4D03A 1S2YA 4PABA 2WOVA 2X50A 2YG6A 3GMCA 4U8OA 2CFYA 3L1RA 5EB4A 2YM2A 1O95A 3FG2P 1ZK7A 4B66A 4CCQA 4NEWA 4B68A 1KNPA 2YG3A 3UKFA 4N9XA 3S61A 1EL5A 2EQ8A 4K5SA 1GPEA 5KXJA 1F8SA 4U2TA 3AYJA 5JCNA 4UDQA 1O5WA 2EQ7A 1OJAA 2R0PA 3RP6A 3C4NA 3GYJA 3AE9A 3NH3X 2C73A 3NG7X 1H84A 3ALJA 3FMWA 1GTEA 3V3NA 1GOSA 3AE5A 4EQSA 3B3RA 5JCLA 2X99A 1RYIA 3BI2A 2TMDA 2YR6A 1GEUA 5DBJA 1CJ3A 3Q9TA 2OLNA 2F5ZA 4H7UA 1H6VA 2WPEA 2ZBWA 2B7RA 2E5VA 1NAAA 3CN8A 1E7PA 3T37A 3AD9B 2Y6QA 2DKIA 2Z5YA 4GR1A 3RP8A 5IPYA 3FPZA 4BJYA 4JNAA 4U8NA 4CY6A 1JRYA 1FCDA 2GF3A 1ZDLA 3CTYA 2Q0LA 1GT8A 3DK9A 4J34A 4RG4A 4XXGA 2Q6UA 2C65A 2H88A 4H4TA 4USRA 3NK0X 1PDHA 1XDIA 2R0CA 3V76A 2YLRA 2Y6RA 3DJDA 1D4DA 4USQA 5J60A 2GR2A 3P1WA 3VRDB 4BJZA 1ELIA 1NHSA 4YSHA 2WEUA 4EIQA 4A9WA 1F3PA 3ATRA 2UZZA 4REKA 3NYFA 2VRLA 3UKQA 3VQRA 1JOAA 5IQ4A 5CKUA 1PBDA 4D04A 3CNPA 2XLTA 4A79A 1E39A 3COXA 3DJGX 3GDNA 1P2HA 2GAGB 2IVDA 3AE3A 1BGJA 1GREA 1GNDA 1H82A 2GMHA 3AEDA 3GSIA 3EAOA 5U1OA 2JKCA 1XPQA 1IUTA 4NEVA 2QCUA 4AT2A 4K8DA 2WHDA 4A99A 3NT6A 1CJCA 2WBAA 3V3OA 4EMIA 4BK1A 1Y56A 4YT0A 3NIXA 2BABA 3BHKA 4BK3A 2YVJA 2V6OA 4Z24A 3NTAA 2VRMA 2YM1A 3AEGA 2GB0A 1DJNA 4H4YA 1OJTA 5IQ1A 2WDVA 1DOEA 3KPFA 3NLCA 3G5QA 1CC2A 4C3YA 4J31A 1AOGA 2WS3A 5HXIA 1GERA 3CIRA 2C76A 3GRSA 3LZXA 4A6NA 4GDPA 3EF6A 4YKFA 3F8RA 4M52A 3G5RA 4AOXA 2AAQA 1IUWA 5U63A 1ZMCA 3H8IA 1M64A 1FL2A 3GYIA 5KRQA 2ZZ0A 4B69A 1QLBA 3QSMA 4YSXA 2XVFA 2HQMA 2B9YA 1COYA 1YQ3A 2C7GA 1D4CA 2C72A 3ABVA 4DNAA 2WOIA 2OA1A 3II4A 4J56A 5KVHA 4J57A 1O94A 4NZHA 5CQFA 1CBOA 1D7LA 4OPTA 1Z6LA 4TM3A 4JY2A 4GCMA 1PXCA 4FDCB 4WX1A 4NTDA 3AE6A 5JCMA 5M10A 1N4UA 1GSNA 2CULA 3AE2A 2YR4A 1H86A 2WP5A 3UKKA 1GETA 2VOUA 4GRTA 3GWFA 4ICYA 1VG9A 2ARDA 1JRZA 1PBEA 2PYXA 4U8PA 1E1NA 5J7XA 2C66A 2BK3A 1B4VA 1DXLA 4Z2TA 2GV8A 1MOKA 1JNZA 2GH5A 3KA7A 1KDGA 2GQWA 3CPIG 4JQ9A 3H4KA 4U8JA 4Z2RA 3AEAA 3F8DA 1GXFA 4H4QA 1E1MA 2ACZA 1NEKA 4DGKA 4NTEA 2YVGA 4C5OA 1L9EA 1PJ7A 5BVAA 3AE8A 5KVIA 4YTPA 4UP3A 4H2QA 2GRTA 3I3LA 4HB9A 2WDRA 1H83A 4RSLA 1FEAA 1GTHA 1NHRA 2WU2A 4FK1A 3UKPA 3L8KA 2BS3A 3UOXA 3GWDA 3M13A 1Q1WA 3CNSA 2BS2A 2B9WA 1TDOA 3CGBA 2WPFA 4H4XA 2FJEA 3UKHA 1KSUA 1UKVG 3LOVA 1E1KA 2JB1A 3CPHG 2VQ7A 3M0OA 3CPJG 2QA1A 3H8LA 4H4UA 1PXAA 1S3BA 1GRBA 3K7MX 3C96A 3GD4A 3HZLA 4TM4A 3AECA 1GRHA 2YLSA 1DJQA 3P4RA 3Q6JA 3R9UA 2BK4A 5KOWA 4X9MA 1ZKQA 1EL9A 3UKLA 4J2WA 5GRTA 2WQYA 2X3NA 1ZX9A 2YR5A 3BNUA 1PS9A 2GEWA 3GD3A 3NYCA 3LADA 4CY8A 2RGJA 3NNEA 1K0JA 2C67A 1CJ2A 2XVHA 1FECA 2VZ2A 2XLPA 1FEBA 3AE1A 2FJDA 4GF7A 3QSSA 4TM1A 3ICTA 3NK2X 2YLZA 1ZOYA 1NPXA 2OLOA 3JSKA 4JDRA 3K7TA 5C3JA 1EL7A 4OVIA 3NRNA 3K7QX 4H2RA 4P9SA 1LQUA 2YG4A 3S5WA 1CF3A 2OAMA 3ISHA 2V60A 3AE7A 2WESA 3PS9A 4I58A 1N1PA 2R0GA 3NKSA 2APGA 5HHFA 1LTXR 3BI5A 4A5LA 1ONFA 5BUKA 3SQPA 4B64A 1BWCA 2YLXA 3ZYXA 2GMJA 3RHAA 4WCTA 4B63A 1DNCA 3CGCA 4X9NA 4H4VA 4IA6A 4TLXA 3AEEA 5GSNA 5FS9A 2XFUA 2YQUA 1BKWA 2C3CA 3P4SA 4B67A 3AB1A 4YSYA 1EL8A 1VRQB 1PN0A 2DKHA 4AT0A 1BGNA 2WU5A 1B5QA 1F8WA 2YLTA 1QJDA 3IC9A 1JEHA 1IUUA 4U8LA 4Z44A 3GDPA 3AD7B 2BA9A 2YWLA 5FS6A 3UTHA 4A65A 4RG3A 1IUSA 3CNJA 3ICRA 4B1BA 3DMEA 1KNRA 4YXDA 1YQ4A 4H2NA 2QAEA 4LIIA 1PHHA 1K0LA 1FOHA 5KOXA 1IJHA 1GALA 4J33A 1L9CA 1JU2A 3URHA 3ITJA 1PBCA 1DODA 3OZ2A 4CRTA 1TDFA 2BC1A 3NN6X 4H2PA 2BS4A 1IUVA 2XDOA 3IHGA 1KF6A 4HA6A 3C4AA 1TDKA 3GMBA 3NK1X 4KPRA 1GRGA 1TYPA 1TDNA 2V3BA 4IVMB 2VVLA 3AEFA 3QVPA 3UTFA 3CGDA 4BURA 2XVEA 5FS8A 1RP0A 5BULA 1RSGA 4EQRA 4H4RA 4B65A 4A6NB 1N4WA 2JB3A 2X8HA 1JRXA 4YKGA 3SFEA 1TRBA 3BHFA 1MXTA 1NHPA 3PVCA 4U2SA 3RP7A 2EQ9A 1Q1RA 5TR3A 4CNKA 4O5QA 3EANA 2YAUA 2XYOA 2CDUA 3K30A 2GVCA 3PO7A 4EM4A 4H4WA 1NG3A 4K2XA 1Y0PA 1YQZA 3IHMA 4JN9A 1M6IA 4X4JA 5EOWA 4TM0A 1XHCA 1LJ1A 3NN0X 2YLWA 1VG0A 2YG7A 2R46A 1K4QA 4ZN0A 1JNRA 2AR8A 4YSZA 3AE4A 3SFDA 2Z5XA 2ZZCA 1DOCA 3NTDA 4IA5A 4XWRA 4A7AA 2GR1A 1L9DA 1CC4A 3KD9A 3VR9A 1H81A 1ZOVA 1PBFA 1PXBA 5JCIA 2V61A 3FIMB 3QFAA 4Y4NA 1KSSA 1LVLA 4Y4LA 3GRTA 4IV9A 1K0IA 2A87A 3VRAA 2GAHB 2PHHA 3EPTA 3UP4A 1P2EA 3LZWA 2XFOA 2A8XA 4O5UA 4YWOA 4OPCA 1GESA 4E0VA 4GUVA 2WETA 2QA2A 4H4PA 2V5ZA 5LV9A 3P4PA 1B37A 2H89A 1W4XA 4AP3A 3D1CA 1E1LA 3UKAA 3AWIA 2X8CA 4NTCA 1NHQA 5U25A 5C2TA 1S3EA 1KFYA 4JY3A 3KKJA 2C64A 2BC0A 2B7SA 1QO8A 1B8SA 3LB8A 2XLSA 5FS7A 3LXDA 3ICSA 4EQXA 3DJEA 4YTMA 2R4JA 3D8XA 1CJ4A 1YKJA 4FX9A 1EBDA 2BXSA 5EBKA 2C3DA 4C74A 3KU9A 2FBWA 3KVEA 1HYUA 3CNTA 4ECHA 2GR3A 1BZLA 2YG5A 3UTEA 4EM3A 3AYIA 4JNQA 1IUXA 2WDQA 2C75A 1ZMDA 1ZP0A 1OJCA 2R45A 4FK1C 3NGCX 2E4GA 3CNDA 4LU6A 3UOVA 3DGZA 2XVJA 4ZCCA 4Y4MA 3OC4A 3UP5A 1PJ6A 1SEZA 3ADAB 3E1TA 3M12A 2O9ZA 2BK5A 1XANA 1MO9A 3RNMA 1TDEA 5EB5A 2XFPA 1L0VA 4Z26A 2IIDA 3LJPA 2BCPA 2XFQA 4OPIA 5FMHA 3REDA 3UCLA 5HY5A 1CC6A 3DA1A 1F6MA 3O0HA 4Z25A 4OCGA 1NENA 2RABA 1Q9IA 2NVKX 2E1MA 3DGHA 5ER0A 2Q0KA 3ALMA 3WE0A 2CVJA 4AP1A 4Z2UA 1H7WA 3P4QA 2YVFA 4KX6A 4EIPA 4OPLA 4EQWA 1D4EA 1GRAA 2FJBA 3QJ4A 3I6DA 2JK6A 3VRBA 4C3XA 1CL0A 5KWFA 4BV6A 2XLUA 4U8MA 4U8KA 3SGLA 1NDAA 1F8RA 3AXBA 4AOSA 2BYBA 4K5RA 2A89A 2C70A 2OALA 2W0HA 4OPUA 4OPDA 3ATQA 1H7XA 1S2QA 2XLRA 3BNMA 1Y56B 4EMJA 1ZY8A 1VDCA 4C77A 3AD8B 1OJDA 1GRFA 3KLJA 1NG4A 2XVIA 3QVRA 3DK4A 5M0ZA 1DOBA 2R9ZA 2VVLG 4Z43A 1LQTA 1OJ9A 1YY5A 2IVEA 1LPFA 2BCGG 2NPXA 3DH9A 4OPGA 1CHUA 4UDRA 5HYMA 4BK2A 1D5TA 4U2LA 2XFNA 2WOWA 4LA1A 3FBSA 1X31B 2R4EA 3B6DA 2RGOA 1V59A 2RGHA 4CCRA 2I0ZA 4TLZA 5JCKA 1D7YA 2JAEA 2GQFA 3AEBA 1TYTA 2J3NA 4I59A 2V3AA 4GDEA 2WP9A 1E6EA 3CGEA 4IVOB 2Q7VA 2B9XA 2BXRA 1N4VA 2FJAA 2X8GA 4DSHA 1LV0A 4H50A 3ALLA 3UOYA 2WPCA 5L46A 2JB2A 3DJJA 4H4ZA 2BACA 2EQ6A 4K7ZA 4DSGA 3UTGA 4EMWA 4ADWA 3BI4A 4K22A 1PJ5A 1GRTA 3P9UA 2TPRA 4H4SA 4PAAA 4U8IA 3G5SA 2JBVA 2VQBA 3F8PA 5BRTA 3IF9A 4APNA 3UOZA 2GR0A 3NHOX 1GV4A 3ZDNA 3IWAA 2VVMA 2ZZBA 3QSEA 2B76A
chains in the Genus database with same CATH superfamily
2AQJA 1REOA 1VQWA 1PBBA 1BF3A 3NYEA 3DK8A 2WP6A 4CBQA 3QFBA 3VR8A 4CNJA 4YTNA 4J36A 4UDPA 3SZFA 2XCGA 4MJWA 3AYLA 3SM8A 4XWZA 4ZCDA 4D03A 1S2YA 4PABA 2WOVA 2X50A 2YG6A 3GMCA 4U8OA 2CFYA 3L1RA 5EB4A 2YM2A 1O95A 3FG2P 1ZK7A 4B66A 4CCQA 4NEWA 4B68A 1KNPA 2YG3A 3UKFA 3SX6A 4N9XA 3S61A 1EL5A 2EQ8A 4K5SA 1GPEA 5KXJA 1F8SA 4U2TA 3AYJA 5JCNA 4UDQA 1O5WA 2EQ7A 1OJAA 2R0PA 3RP6A 3C4NA 3GYJA 3AE9A 3NH3X 2C73A 3NG7X 1H84A 3ALJA 3FMWA 1GTEA 3V3NA 1GOSA 3AE5A 4EQSA 3B3RA 5JCLA 2X99A 1RYIA 3BI2A 2TMDA 2YR6A 4NNJA 1GEUA 5DBJA 1CJ3A 3Q9TA 2OLNA 2F5ZA 4H7UA 1H6VA 2WPEA 2ZBWA 2B7RA 2E5VA 1NAAA 3CN8A 1E7PA 3T37A 3AD9B 2Y6QA 2DKIA 2Z5YA 4GR1A 3RP8A 5IPYA 3FPZA 4BJYA 4JNAA 4U8NA 2BRAA 4CY6A 1JRYA 1FCDA 2GF3A 1ZDLA 3CTYA 2Q0LA 1GT8A 3DK9A 4J34A 4RG4A 4XXGA 2Q6UA 2C65A 2H88A 4H4TA 4USRA 3SY4A 3NK0X 1PDHA 1XDIA 2R0CA 3V76A 2YLRA 2Y6RA 3DJDA 1D4DA 4USQA 5J60A 2GR2A 3P1WA 3VRDB 4BJZA 1ELIA 1NHSA 4YSHA 2WEUA 4EIQA 4A9WA 1F3PA 3ATRA 2UZZA 4REKA 3NYFA 2VRLA 3UKQA 3VQRA 1JOAA 5IQ4A 5CKUA 1PBDA 4D04A 3CNPA 2XLTA 4A79A 1E39A 3COXA 3DJGX 3GDNA 1P2HA 2GAGB 2IVDA 5KMRA 3AE3A 1BGJA 1GREA 1GNDA 1H82A 2GMHA 3AEDA 3GSIA 3EAOA 5U1OA 2JKCA 1XPQA 1IUTA 4NEVA 2QCUA 4AT2A 4G9KA 2WHDA 4K8DA 4A99A 3NT6A 1CJCA 2WBAA 3V3OA 4EMIA 4BK1A 2BRYA 1Y56A 4YT0A 3NIXA 2BABA 3BHKA 4BK3A 2YVJA 2V6OA 4Z24A 3NTAA 2VRMA 2YM1A 3AEGA 2GB0A 1DJNA 4H4YA 1OJTA 5IQ1A 2WDVA 1DOEA 3KPFA 3NLCA 3G5QA 1CC2A 4C3YA 4J31A 1AOGA 2WS3A 5HXIA 1GERA 3CIRA 2C76A 3GRSA 3LZXA 4A6NA 4GDPA 3EF6A 4YKFA 3F8RA 4M52A 3G5RA 4AOXA 2AAQA 1IUWA 5U63A 1ZMCA 3H8IA 1M64A 1FL2A 3GYIA 5KRQA 2ZZ0A 4B69A 1QLBA 3QSMA 4YSXA 2XVFA 2HQMA 2B9YA 1COYA 1YQ3A 2C7GA 1D4CA 2C72A 3ABVA 4DNAA 2WOIA 2OA1A 3II4A 4J56A 5KVHA 4J57A 1O94A 4NZHA 5CQFA 1CBOA 1D7LA 4OPTA 1Z6LA 4TM3A 4JY2A 4GCMA 1PXCA 4FDCB 4WX1A 4NTDA 3AE6A 5JCMA 5M10A 1N4UA 1GSNA 2CULA 3AE2A 2YR4A 1H86A 2WP5A 3UKKA 1GETA 2VOUA 4GRTA 3T14A 3GWFA 4ICYA 1VG9A 2ARDA 1JRZA 1PBEA 2PYXA 4U8PA 1E1NA 5J7XA 2C66A 2BK3A 1B4VA 1DXLA 4NWZA 4Z2TA 2GV8A 1MOKA 1JNZA 2GH5A 3KA7A 1KDGA 2GQWA 3CPIG 4JQ9A 3H4KA 4U8JA 4Z2RA 3AEAA 3F8DA 1GXFA 4H4QA 4GAPA 1E1MA 2ACZA 1NEKA 5KMQA 4DGKA 4NTEA 2YVGA 4C5OA 1L9EA 1PJ7A 3T2KA 3AE8A 5BVAA 5KVIA 4YTPA 4UP3A 4H2QA 2GRTA 3I3LA 4HB9A 5KNLA 2WDRA 1H83A 5KMPA 3T2YA 4RSLA 1FEAA 1GTHA 1NHRA 2WU2A 4FK1A 3UKPA 3L8KA 2BS3A 3UOXA 3GWDA 3M13A 1Q1WA 3CNSA 2BS2A 2B9WA 1TDOA 3CGBA 2WPFA 4H4XA 2FJEA 3UKHA 1KSUA 1UKVG 3LOVA 1E1KA 2JB1A 3CPHG 2VQ7A 3M0OA 3CPJG 2QA1A 3H8LA 4H4UA 1PXAA 1S3BA 1GRBA 3K7MX 3C96A 3GD4A 3HZLA 4TM4A 3AECA 1GRHA 2YLSA 1DJQA 3P4RA 3Q6JA 3R9UA 2BK4A 5KOWA 4X9MA 1ZKQA 1EL9A 3UKLA 4J2WA 5GRTA 2WQYA 2X3NA 1ZX9A 2YR5A 3BNUA 1PS9A 2GEWA 3GD3A 3NYCA 3LADA 4CY8A 2RGJA 3NNEA 1K0JA 2C67A 1CJ2A 2XVHA 1FECA 2VZ2A 2XLPA 1FEBA 3AE1A 2FJDA 4GF7A 3QSSA 4TM1A 3ICTA 3NK2X 2YLZA 1ZOYA 1NPXA 2OLOA 3JSKA 4JDRA 3K7TA 5C3JA 1EL7A 3KPKA 3NRNA 3K7QX 4H2RA 4OVIA 4P9SA 1LQUA 2YG4A 3HYXA 1CF3A 2OAMA 4II3A 3ISHA 3S5WA 2V60A 3AE7A 2WESA 3PS9A 4I58A 1N1PA 2R0GA 3NKSA 2APGA 5HHFA 1LTXR 3BI5A 4A5LA 1ONFA 5BUKA 3SQPA 4B64A 1BWCA 2YLXA 3ZYXA 2GMJA 3RHAA 4WCTA 4B63A 1DNCA 3CGCA 4X9NA 4H4VA 4IA6A 4TLXA 3AEEA 5GSNA 3SZWA 5FS9A 2XFUA 2YQUA 1BKWA 2C3CA 3P4SA 4B67A 3AB1A 4YSYA 1EL8A 1VRQB 1PN0A 2DKHA 3HYWA 4AT0A 1BGNA 2WU5A 1B5QA 1F8WA 2YLTA 1QJDA 3IC9A 1JEHA 1IUUA 4U8LA 4Z44A 3GDPA 3AD7B 2BA9A 2YWLA 5FS6A 3UTHA 4A65A 4RG3A 1IUSA 3CNJA 3ICRA 4B1BA 3DMEA 1KNRA 4YXDA 1YQ4A 4H2NA 2QAEA 4LIIA 1PHHA 1K0LA 1FOHA 5KOXA 1IJHA 1GALA 4J33A 1L9CA 1JU2A 3URHA 3ITJA 1PBCA 1DODA 3OZ2A 4CRTA 1TDFA 2BC1A 3NN6X 4H2PA 2BS4A 1IUVA 2XDOA 3IHGA 1KF6A 4HA6A 3C4AA 1TDKA 3GMBA 3NK1X 4KPRA 1GRGA 1TYPA 1TDNA 3SXIA 2V3BA 4IVMB 2VVLA 3AEFA 3QVPA 3UTFA 3CGDA 4BURA 2XVEA 5FS8A 1RP0A 5BULA 1RSGA 4EQRA 4H4RA 3SZ0A 4B65A 4A6NB 1N4WA 2JB3A 2X8HA 1JRXA 4YKGA 3SFEA 1TRBA 3BHFA 3GYXA 3CMMA 1MXTA 3HYVA 3T0KA 1NHPA 3PVCA 4U2SA 3RP7A 2EQ9A 1Q1RA 5TR3A 4CNKA 4O5QA 3EANA 2YAUA 2XYOA 2CDUA 3K30A 2GVCA 3PO7A 4EM4A 4H4WA 1NG3A 4K2XA 1Y0PA 1YQZA 3IHMA 4JN9A 1M6IA 4X4JA 5EOWA 4TM0A 1XHCA 1LJ1A 3NN0X 2YLWA 1VG0A 2YG7A 2R46A 1K4QA 4ZN0A 1JNRA 2AR8A 4YSZA 3AE4A 3SFDA 4G74A 2Z5XA 2ZZCA 1DOCA 3NTDA 4IA5A 4XWRA 4A7AA 2GR1A 1L9DA 1CC4A 3KD9A 3VR9A 1H81A 1ZOVA 1PBFA 1PXBA 5JCIA 2V61A 3FIMB 3QFAA 4Y4NA 1KSSA 1LVLA 4Y4LA 3GRTA 4IV9A 1K0IA 2A87A 3VRAA 3SYIA 2GAHB 2PHHA 3EPTA 3UP4A 1P2EA 3LZWA 5KMSA 2XFOA 2A8XA 4O5UA 4YWOA 4OPCA 1GESA 4E0VA 4GUVA 2WETA 2QA2A 4H4PA 2V5ZA 5LV9A 3P4PA 1B37A 2H89A 1W4XA 4AP3A 3D1CA 1E1LA 3UKAA 3AWIA 2X8CA 4NTCA 1NHQA 5U25A 5C2TA 1S3EA 1KFYA 4JY3A 3KKJA 2C64A 2BC0A 2B7SA 3T31A 1QO8A 1B8SA 3LB8A 2XLSA 5FS7A 3LXDA 3ICSA 4EQXA 3DJEA 4YTMA 2R4JA 3D8XA 1CJ4A 1YKJA 4FX9A 1EBDA 2BXSA 5EBKA 2C3DA 4C74A 3KU9A 2FBWA 3KVEA 1HYUA 3CNTA 4ECHA 2GR3A 1BZLA 2YG5A 3UTEA 4EM3A 3AYIA 4JNQA 1IUXA 2WDQA 2C75A 4II2A 1ZMDA 2C4CA 1ZP0A 1OJCA 2R45A 4FK1C 3NGCX 2E4GA 3CNDA 4LU6A 3UOVA 3DGZA 2XVJA 4ZCCA 4Y4MA 3OC4A 3UP5A 1PJ6A 1SEZA 3ADAB 3E1TA 3M12A 2O9ZA 2BK5A 1XANA 1MO9A 3RNMA 3SZCA 1TDEA 5EB5A 2XFPA 1L0VA 4Z26A 2IIDA 3LJPA 2BCPA 2XFQA 4OPIA 5FMHA 3REDA 3UCLA 5HY5A 4GAVA 1CC6A 3DA1A 1F6MA 3O0HA 4G6HA 4OCGA 1NENA 2RABA 4Z25A 1Q9IA 2NVKX 2E1MA 3DGHA 5ER0A 2Q0KA 3ALMA 3WE0A 2CVJA 4AP1A 4Z2UA 1H7WA 3P4QA 2YVFA 4KX6A 4EIPA 4OPLA 4EQWA 1D4EA 1GRAA 2FJBA 3QJ4A 3I6DA 2JK6A 3VRBA 4C3XA 1CL0A 5KWFA 4BV6A 2XLUA 4U8MA 4U8KA 3SGLA 1NDAA 1F8RA 3AXBA 4AOSA 2BYBA 4K5RA 2A89A 2C70A 2OALA 2W0HA 4OPUA 4OPDA 3ATQA 1H7XA 1S2QA 2XLRA 3BNMA 1Y56B 4EMJA 1ZY8A 1VDCA 4C77A 3AD8B 1OJDA 1GRFA 3KLJA 1NG4A 2XVIA 3QVRA 3DK4A 5M0ZA 1DOBA 2R9ZA 2VVLG 4Z43A 1LQTA 3T2ZA 1OJ9A 1YY5A 2IVEA 1LPFA 2BCGG 2NPXA 3DH9A 4OPGA 1CHUA 4UDRA 5HYMA 4BK2A 1D5TA 4U2LA 2XFNA 2WOWA 4LA1A 3FBSA 1X31B 2R4EA 3B6DA 2RGOA 1V59A 2RGHA 4CCRA 2I0ZA 4TLZA 5JCKA 1D7YA 2JAEA 2GQFA 3AEBA 1TYTA 2J3NA 4I59A 2V3AA 4GDEA 2WP9A 1E6EA 3CGEA 4IVOB 2Q7VA 2B9XA 2BXRA 1N4VA 2FJAA 2X8GA 4DSHA 1LV0A 4H50A 3ALLA 3UOYA 2WPCA 5L46A 2JB2A 3DJJA 4H4ZA 2BACA 2EQ6A 4K7ZA 4DSGA 3UTGA 4EMWA 4ADWA 3BI4A 4K22A 1PJ5A 1GRTA 3P9UA 2TPRA 4H4SA 4PAAA 4U8IA 3G5SA 2JBVA 2VQBA 3F8PA 5BRTA 3IF9A 4APNA 3UOZA 2GR0A 3NHOX 1GV4A 4G6GA 3ZDNA 3IWAA 2VVMA 4G73A 2ZZBA 3QSEA 2B76A
chains in the Genus database with same CATH topology
2AQJA 1REOA 1VQWA 1PBBA 1BF3A 3NYEA 3DK8A 2WP6A 4CBQA 3QFBA 3VR8A 4CNJA 4YTNA 4J36A 4UDPA 3SZFA 2XCGA 4MJWA 3AYLA 3SM8A 4XWZA 4ZCDA 4D03A 1S2YA 4PABA 2WOVA 2X50A 2YG6A 3GMCA 4U8OA 2CFYA 3L1RA 5EB4A 2YM2A 1O95A 3FG2P 1ZK7A 4B66A 4CCQA 4NEWA 4B68A 1KNPA 2YG3A 3UKFA 3SX6A 4N9XA 3S61A 1EL5A 2EQ8A 4K5SA 1GPEA 5KXJA 1F8SA 4U2TA 3AYJA 5JCNA 4UDQA 1O5WA 2EQ7A 1OJAA 2R0PA 3RP6A 3C4NA 3GYJA 3AE9A 3NH3X 2C73A 3NG7X 1H84A 3ALJA 3FMWA 1GTEA 3V3NA 1GOSA 3AE5A 4EQSA 3B3RA 5JCLA 2X99A 1RYIA 3BI2A 2TMDA 2YR6A 4NNJA 1GEUA 5DBJA 1CJ3A 3Q9TA 2OLNA 2F5ZA 4H7UA 1H6VA 2WPEA 2ZBWA 2B7RA 2E5VA 1NAAA 3CN8A 1E7PA 3T37A 3AD9B 2Y6QA 2DKIA 2Z5YA 4GR1A 3RP8A 5IPYA 3FPZA 4BJYA 4JNAA 4U8NA 2BRAA 4CY6A 1JRYA 1FCDA 2GF3A 1ZDLA 3CTYA 2Q0LA 1GT8A 3DK9A 4J34A 4RG4A 4XXGA 2Q6UA 2C65A 2H88A 4H4TA 4USRA 3SY4A 3NK0X 1PDHA 1XDIA 2R0CA 3V76A 2YLRA 2Y6RA 3DJDA 1D4DA 4USQA 5J60A 2GR2A 3P1WA 3VRDB 4BJZA 1ELIA 1NHSA 4YSHA 2WEUA 4EIQA 4A9WA 1F3PA 3ATRA 2UZZA 4REKA 3NYFA 2VRLA 3UKQA 3VQRA 1JOAA 5IQ4A 5CKUA 1PBDA 4D04A 3CNPA 2XLTA 4A79A 1E39A 3COXA 3DJGX 3GDNA 1P2HA 2GAGB 2IVDA 5KMRA 3AE3A 1BGJA 1GREA 1GNDA 1H82A 2GMHA 3AEDA 3GSIA 3EAOA 5U1OA 2JKCA 1XPQA 1IUTA 4NEVA 2QCUA 4AT2A 4G9KA 2WHDA 4K8DA 4A99A 3NT6A 1CJCA 2WBAA 3V3OA 4EMIA 4BK1A 2BRYA 1Y56A 4YT0A 3NIXA 2BABA 3BHKA 4BK3A 2YVJA 2V6OA 4Z24A 3NTAA 2VRMA 2YM1A 3AEGA 2GB0A 1DJNA 4H4YA 1OJTA 5IQ1A 2WDVA 1DOEA 3KPFA 3NLCA 3G5QA 1CC2A 4C3YA 4J31A 1AOGA 2WS3A 5HXIA 1GERA 3CIRA 2C76A 3GRSA 3LZXA 4A6NA 4GDPA 3EF6A 4YKFA 3F8RA 4M52A 3G5RA 4AOXA 2AAQA 1IUWA 5U63A 1ZMCA 3H8IA 1M64A 1FL2A 3GYIA 5KRQA 2ZZ0A 4B69A 1QLBA 3QSMA 4YSXA 2XVFA 2HQMA 2B9YA 1COYA 1YQ3A 2C7GA 1D4CA 2C72A 3ABVA 4DNAA 2WOIA 2OA1A 3II4A 4J56A 5KVHA 4J57A 1O94A 4NZHA 5CQFA 1CBOA 1D7LA 4OPTA 1Z6LA 4TM3A 4JY2A 4GCMA 1PXCA 4FDCB 4WX1A 4NTDA 3AE6A 5JCMA 5M10A 1N4UA 1GSNA 2CULA 3AE2A 2YR4A 1H86A 2WP5A 3UKKA 1GETA 2VOUA 4GRTA 3T14A 3GWFA 4ICYA 1VG9A 2ARDA 1JRZA 1PBEA 2PYXA 4U8PA 1E1NA 5J7XA 2C66A 2BK3A 1B4VA 1DXLA 4NWZA 4Z2TA 2GV8A 1MOKA 1JNZA 2GH5A 3KA7A 1KDGA 2GQWA 3CPIG 4JQ9A 3H4KA 4U8JA 4Z2RA 3AEAA 3F8DA 1GXFA 4H4QA 4GAPA 1E1MA 2ACZA 1NEKA 5KMQA 4DGKA 4NTEA 2YVGA 4C5OA 1L9EA 1PJ7A 3T2KA 3AE8A 5BVAA 5KVIA 4YTPA 4UP3A 4H2QA 2GRTA 3I3LA 4HB9A 5KNLA 2WDRA 1H83A 5KMPA 3T2YA 4RSLA 1FEAA 1GTHA 1NHRA 2WU2A 4FK1A 3UKPA 3L8KA 2BS3A 3UOXA 3GWDA 3M13A 1Q1WA 3CNSA 2BS2A 2B9WA 1TDOA 3CGBA 2WPFA 4H4XA 2FJEA 3UKHA 1KSUA 1UKVG 3LOVA 1E1KA 2JB1A 3CPHG 2VQ7A 3M0OA 3CPJG 2QA1A 3H8LA 4H4UA 1PXAA 1S3BA 1GRBA 3K7MX 3C96A 3GD4A 3HZLA 4TM4A 3AECA 1GRHA 2YLSA 1DJQA 3P4RA 3Q6JA 3R9UA 2BK4A 5KOWA 4X9MA 1ZKQA 1EL9A 3UKLA 4J2WA 5GRTA 2WQYA 2X3NA 1ZX9A 2YR5A 3BNUA 1PS9A 2GEWA 3GD3A 3NYCA 3LADA 4CY8A 2RGJA 3NNEA 1K0JA 2C67A 1CJ2A 2XVHA 1FECA 2VZ2A 2XLPA 1FEBA 3AE1A 2FJDA 4GF7A 3QSSA 4TM1A 3ICTA 3NK2X 2YLZA 1ZOYA 1NPXA 2OLOA 3JSKA 4JDRA 3K7TA 5C3JA 1EL7A 3KPKA 3NRNA 3K7QX 4H2RA 4OVIA 4P9SA 1LQUA 2YG4A 3HYXA 1CF3A 2OAMA 4II3A 3ISHA 3S5WA 2V60A 3AE7A 2WESA 3PS9A 4I58A 1N1PA 2R0GA 3NKSA 2APGA 5HHFA 1LTXR 3BI5A 4A5LA 1ONFA 5BUKA 3SQPA 4B64A 1BWCA 2YLXA 3ZYXA 2GMJA 3RHAA 4WCTA 4B63A 1DNCA 3CGCA 4X9NA 4H4VA 4IA6A 4TLXA 3AEEA 5GSNA 3SZWA 5FS9A 2XFUA 2YQUA 1BKWA 2C3CA 3P4SA 4B67A 3AB1A 4YSYA 1EL8A 1VRQB 1PN0A 2DKHA 3HYWA 4AT0A 1BGNA 2WU5A 1B5QA 1F8WA 2YLTA 1QJDA 3IC9A 1JEHA 1IUUA 4U8LA 4Z44A 3GDPA 3AD7B 2BA9A 2YWLA 5FS6A 3UTHA 4A65A 4RG3A 1IUSA 3CNJA 3ICRA 4B1BA 3DMEA 1KNRA 4YXDA 1YQ4A 4H2NA 2QAEA 4LIIA 1PHHA 1K0LA 1FOHA 5KOXA 1IJHA 1GALA 4J33A 1L9CA 1JU2A 3URHA 3ITJA 1PBCA 1DODA 3OZ2A 4CRTA 1TDFA 2BC1A 3NN6X 4H2PA 2BS4A 1IUVA 2XDOA 3IHGA 1KF6A 4HA6A 3C4AA 1TDKA 3GMBA 3NK1X 4KPRA 1GRGA 1TYPA 1TDNA 3SXIA 2V3BA 4IVMB 2VVLA 3AEFA 3QVPA 3UTFA 3CGDA 4BURA 2XVEA 5FS8A 1RP0A 5BULA 1RSGA 4EQRA 4H4RA 3SZ0A 4B65A 4A6NB 1N4WA 2JB3A 2X8HA 1JRXA 4YKGA 3SFEA 1TRBA 3BHFA 3GYXA 3CMMA 1MXTA 3HYVA 3T0KA 1NHPA 3PVCA 4U2SA 3RP7A 2EQ9A 1Q1RA 5TR3A 4CNKA 4O5QA 3EANA 2YAUA 2XYOA 2CDUA 3K30A 2GVCA 3PO7A 4EM4A 4H4WA 1NG3A 4K2XA 1Y0PA 1YQZA 3IHMA 4JN9A 1M6IA 4X4JA 5EOWA 4TM0A 1XHCA 1LJ1A 3NN0X 2YLWA 1VG0A 2YG7A 2R46A 1K4QA 4ZN0A 1JNRA 2AR8A 4YSZA 3AE4A 3SFDA 4G74A 2Z5XA 2ZZCA 1DOCA 3NTDA 4IA5A 4XWRA 4A7AA 2GR1A 1L9DA 1CC4A 3KD9A 3VR9A 1H81A 1ZOVA 1PBFA 1PXBA 5JCIA 2V61A 3FIMB 3QFAA 4Y4NA 1KSSA 1LVLA 4Y4LA 3GRTA 4IV9A 1K0IA 2A87A 3VRAA 3SYIA 2GAHB 2PHHA 3EPTA 3UP4A 1P2EA 3LZWA 5KMSA 2XFOA 2A8XA 4O5UA 4YWOA 4OPCA 1GESA 4E0VA 4GUVA 2WETA 2QA2A 4H4PA 2V5ZA 5LV9A 3P4PA 1B37A 2H89A 1W4XA 4AP3A 3D1CA 1E1LA 3UKAA 3AWIA 2X8CA 4NTCA 1NHQA 5U25A 5C2TA 1S3EA 1KFYA 4JY3A 3KKJA 2C64A 2BC0A 2B7SA 3T31A 1QO8A 1B8SA 3LB8A 2XLSA 5FS7A 3LXDA 3ICSA 4EQXA 3DJEA 4YTMA 2R4JA 3D8XA 1CJ4A 1YKJA 4FX9A 1EBDA 2BXSA 5EBKA 2C3DA 4C74A 3KU9A 2FBWA 3KVEA 1HYUA 3CNTA 4ECHA 2GR3A 1BZLA 2YG5A 3UTEA 4EM3A 3AYIA 4JNQA 1IUXA 2WDQA 2C75A 4II2A 1ZMDA 2C4CA 1ZP0A 1OJCA 2R45A 4FK1C 3NGCX 2E4GA 3CNDA 4LU6A 3UOVA 3DGZA 2XVJA 4ZCCA 4Y4MA 3OC4A 3UP5A 1PJ6A 1SEZA 3ADAB 3E1TA 3M12A 2O9ZA 2BK5A 1XANA 1MO9A 3RNMA 3SZCA 1TDEA 5EB5A 2XFPA 1L0VA 4Z26A 2IIDA 3LJPA 2BCPA 2XFQA 4OPIA 5FMHA 3REDA 3UCLA 5HY5A 4GAVA 1CC6A 3DA1A 1F6MA 3O0HA 4G6HA 4OCGA 1NENA 2RABA 4Z25A 1Q9IA 2NVKX 2E1MA 3DGHA 5ER0A 2Q0KA 3ALMA 3WE0A 2CVJA 4AP1A 4Z2UA 1H7WA 3P4QA 2YVFA 4KX6A 4EIPA 4OPLA 4EQWA 1D4EA 1GRAA 2FJBA 3QJ4A 3I6DA 2JK6A 3VRBA 4C3XA 1CL0A 5KWFA 4BV6A 2XLUA 4U8MA 4U8KA 3SGLA 1NDAA 1F8RA 3AXBA 4AOSA 2BYBA 4K5RA 2A89A 2C70A 2OALA 2W0HA 4OPUA 4OPDA 3ATQA 1H7XA 1S2QA 2XLRA 3BNMA 1Y56B 4EMJA 1ZY8A 1VDCA 4C77A 3AD8B 1OJDA 1GRFA 3KLJA 1NG4A 2XVIA 3QVRA 3DK4A 5M0ZA 1DOBA 2R9ZA 2VVLG 4Z43A 1LQTA 3T2ZA 1OJ9A 1YY5A 2IVEA 1LPFA 2BCGG 2NPXA 3DH9A 4OPGA 1CHUA 4UDRA 5HYMA 4BK2A 1D5TA 4U2LA 2XFNA 2WOWA 4LA1A 3FBSA 1X31B 2R4EA 3B6DA 2RGOA 1V59A 2RGHA 4CCRA 2I0ZA 4TLZA 5JCKA 1D7YA 2JAEA 2GQFA 3AEBA 1TYTA 2J3NA 4I59A 2V3AA 4GDEA 2WP9A 1E6EA 3CGEA 4IVOB 2Q7VA 2B9XA 2BXRA 1N4VA 2FJAA 2X8GA 4DSHA 1LV0A 4H50A 3ALLA 3UOYA 2WPCA 5L46A 2JB2A 3DJJA 4H4ZA 2BACA 2EQ6A 4K7ZA 4DSGA 3UTGA 4EMWA 4ADWA 3BI4A 4K22A 1PJ5A 1GRTA 3P9UA 2TPRA 4H4SA 4PAAA 4U8IA 3G5SA 2JBVA 2VQBA 3F8PA 5BRTA 3IF9A 4APNA 3UOZA 2GR0A 3NHOX 1GV4A 4G6GA 3ZDNA 3IWAA 2VVMA 4G73A 2ZZBA 3QSEA 2B76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQJ A;  1REO A;  1VQW A;  1PBB A;  1BF3 A;  3NYE A;  3DK8 A;  2WP6 A;  4CBQ A;  3QFB A;  3VR8 A;  4CNJ A;  4YTN A;  4J36 A;  4UDP A;  2XCG A;  4MJW A;  3AYL A;  3SM8 A;  4XWZ A;  4ZCD A;  4D03 A;  1S2Y A;  4PAB A;  2WOV A;  2X50 A;  2YG6 A;  3GMC A;  4U8O A;  2CFY A;  3L1R A;  5EB4 A;  2YM2 A;  1O95 A;  3FG2 P;  1ZK7 A;  4B66 A;  4CCQ A;  4NEW A;  4B68 A;  1KNP A;  2YG3 A;  3UKF A;  4N9X A;  3S61 A;  1EL5 A;  2EQ8 A;  4K5S A;  1GPE A;  5KXJ A;  1F8S A;  4U2T A;  3AYJ A;  5JCN A;  4UDQ A;  1O5W A;  2EQ7 A;  1OJA A;  2R0P A;  3RP6 A;  3C4N A;  3GYJ A;  3AE9 A;  3NH3 X;  2C73 A;  3NG7 X;  1H84 A;  3ALJ A;  3FMW A;  1GTE A;  3V3N A;  1GOS A;  3AE5 A;  4EQS A;  3B3R A;  5JCL A;  2X99 A;  1RYI A;  3BI2 A;  2TMD A;  2YR6 A;  1GEU A;  5DBJ A;  1CJ3 A;  3Q9T A;  2OLN A;  2F5Z A;  4H7U A;  1H6V A;  2WPE A;  2ZBW A;  2B7R A;  2E5V A;  1NAA A;  3CN8 A;  1E7P A;  3T37 A;  3AD9 B;  2Y6Q A;  2DKI A;  2Z5Y A;  4GR1 A;  3RP8 A;  5IPY A;  3FPZ A;  4BJY A;  4JNA A;  4U8N A;  4CY6 A;  1JRY A;  1FCD A;  2GF3 A;  1ZDL A;  3CTY A;  2Q0L A;  1GT8 A;  3DK9 A;  4J34 A;  4RG4 A;  4XXG A;  2Q6U A;  2C65 A;  2H88 A;  4H4T A;  4USR A;  3NK0 X;  1PDH A;  1XDI A;  2R0C A;  3V76 A;  2YLR A;  2Y6R A;  3DJD A;  1D4D A;  4USQ A;  5J60 A;  2GR2 A;  3P1W A;  3VRD B;  4BJZ A;  1ELI A;  1NHS A;  4YSH A;  2WEU A;  4EIQ A;  4A9W A;  1F3P A;  3ATR A;  2UZZ A;  4REK A;  3NYF A;  2VRL A;  3UKQ A;  3VQR A;  1JOA A;  5IQ4 A;  5CKU A;  1PBD A;  4D04 A;  3CNP A;  2XLT A;  4A79 A;  1E39 A;  3COX A;  3DJG X;  3GDN A;  1P2H A;  2GAG B;  2IVD A;  3AE3 A;  1BGJ A;  1GRE A;  1GND A;  1H82 A;  2GMH A;  3AED A;  3GSI A;  3EAO A;  5U1O A;  2JKC A;  1XPQ A;  1IUT A;  4NEV A;  2QCU A;  4AT2 A;  4K8D A;  2WHD A;  4A99 A;  3NT6 A;  1CJC A;  2WBA A;  3V3O A;  4EMI A;  4BK1 A;  1Y56 A;  4YT0 A;  3NIX A;  2BAB A;  3BHK A;  4BK3 A;  2YVJ A;  2V6O A;  4Z24 A;  3NTA A;  2VRM A;  2YM1 A;  3AEG A;  2GB0 A;  1DJN A;  4H4Y A;  1OJT A;  5IQ1 A;  2WDV A;  1DOE A;  3KPF A;  3NLC A;  3G5Q A;  1CC2 A;  4C3Y A;  4J31 A;  1AOG A;  2WS3 A;  5HXI A;  1GER A;  3CIR A;  2C76 A;  3GRS A;  3LZX A;  4A6N A;  4GDP A;  3EF6 A;  4YKF A;  3F8R A;  4M52 A;  3G5R A;  4AOX A;  2AAQ A;  1IUW A;  5U63 A;  1ZMC A;  3H8I A;  1M64 A;  1FL2 A;  3GYI A;  5KRQ A;  2ZZ0 A;  4B69 A;  1QLB A;  3QSM A;  4YSX A;  2XVF A;  2HQM A;  2B9Y A;  1COY A;  1YQ3 A;  2C7G A;  1D4C A;  2C72 A;  3ABV A;  4DNA A;  2WOI A;  2OA1 A;  3II4 A;  4J56 A;  5KVH A;  4J57 A;  1O94 A;  4NZH A;  5CQF A;  1CBO A;  1D7L A;  4OPT A;  1Z6L A;  4TM3 A;  4JY2 A;  4GCM A;  1PXC A;  4FDC B;  4WX1 A;  4NTD A;  3AE6 A;  5JCM A;  5M10 A;  1N4U A;  1GSN A;  2CUL A;  3AE2 A;  2YR4 A;  1H86 A;  2WP5 A;  3UKK A;  1GET A;  2VOU A;  4GRT A;  3GWF A;  4ICY A;  1VG9 A;  2ARD A;  1JRZ A;  1PBE A;  2PYX A;  4U8P A;  1E1N A;  5J7X A;  2C66 A;  2BK3 A;  1B4V A;  1DXL A;  4Z2T A;  2GV8 A;  1MOK A;  1JNZ A;  2GH5 A;  3KA7 A;  1KDG A;  2GQW A;  3CPI G;  4JQ9 A;  3H4K A;  4U8J A;  4Z2R A;  3AEA A;  3F8D A;  1GXF A;  4H4Q A;  1E1M A;  2ACZ A;  1NEK A;  4DGK A;  4NTE A;  2YVG A;  4C5O A;  1L9E A;  1PJ7 A;  5BVA A;  3AE8 A;  5KVI A;  4YTP A;  4UP3 A;  4H2Q A;  2GRT A;  3I3L A;  4HB9 A;  2WDR A;  1H83 A;  4RSL A;  1FEA A;  1GTH A;  1NHR A;  2WU2 A;  4FK1 A;  3UKP A;  3L8K A;  2BS3 A;  3UOX A;  3GWD A;  3M13 A;  1Q1W A;  3CNS A;  2BS2 A;  2B9W A;  1TDO A;  3CGB A;  2WPF A;  4H4X A;  2FJE A;  3UKH A;  1KSU A;  1UKV G;  3LOV A;  1E1K A;  2JB1 A;  3CPH G;  2VQ7 A;  3M0O A;  3CPJ G;  2QA1 A;  3H8L A;  4H4U A;  1PXA A;  1S3B A;  1GRB A;  3K7M X;  3C96 A;  3GD4 A;  3HZL A;  4TM4 A;  3AEC A;  1GRH A;  2YLS A;  1DJQ A;  3P4R A;  3Q6J A;  3R9U A;  2BK4 A;  5KOW A;  4X9M A;  1ZKQ A;  1EL9 A;  3UKL A;  4J2W A;  5GRT A;  2WQY A;  2X3N A;  1ZX9 A;  2YR5 A;  3BNU A;  1PS9 A;  2GEW A;  3GD3 A;  3NYC A;  3LAD A;  4CY8 A;  2RGJ A;  3NNE A;  1K0J A;  2C67 A;  1CJ2 A;  2XVH A;  1FEC A;  2VZ2 A;  2XLP A;  1FEB A;  3AE1 A;  2FJD A;  4GF7 A;  3QSS A;  4TM1 A;  3ICT A;  3NK2 X;  2YLZ A;  1ZOY A;  1NPX A;  2OLO A;  3JSK A;  4JDR A;  3K7T A;  5C3J A;  1EL7 A;  4OVI A;  3NRN A;  3K7Q X;  4H2R A;  4P9S A;  1LQU A;  2YG4 A;  3S5W A;  1CF3 A;  2OAM A;  3ISH A;  2V60 A;  3AE7 A;  2WES A;  3PS9 A;  4I58 A;  1N1P A;  2R0G A;  3NKS A;  2APG A;  5HHF A;  1LTX R;  3BI5 A;  4A5L A;  1ONF A;  5BUK A;  3SQP A;  4B64 A;  1BWC A;  2YLX A;  3ZYX A;  2GMJ A;  3RHA A;  4WCT A;  4B63 A;  1DNC A;  3CGC A;  4X9N A;  4H4V A;  4IA6 A;  4TLX A;  3AEE A;  5GSN A;  5FS9 A;  2XFU A;  2YQU A;  1BKW A;  2C3C A;  3P4S A;  4B67 A;  3AB1 A;  4YSY A;  1EL8 A;  1VRQ B;  1PN0 A;  2DKH A;  4AT0 A;  1BGN A;  2WU5 A;  1B5Q A;  1F8W A;  2YLT A;  1QJD A;  3IC9 A;  1JEH A;  1IUU A;  4U8L A;  4Z44 A;  3GDP A;  3AD7 B;  2BA9 A;  2YWL A;  5FS6 A;  3UTH A;  4A65 A;  4RG3 A;  1IUS A;  3CNJ A;  3ICR A;  4B1B A;  3DME A;  1KNR A;  4YXD A;  1YQ4 A;  4H2N A;  2QAE A;  4LII A;  1PHH A;  1K0L A;  1FOH A;  5KOX A;  1IJH A;  1GAL A;  4J33 A;  1L9C A;  1JU2 A;  3URH A;  3ITJ A;  1PBC A;  1DOD A;  3OZ2 A;  4CRT A;  1TDF A;  2BC1 A;  3NN6 X;  4H2P A;  2BS4 A;  1IUV A;  2XDO A;  3IHG A;  1KF6 A;  4HA6 A;  3C4A A;  1TDK A;  3GMB A;  3NK1 X;  4KPR A;  1GRG A;  1TYP A;  1TDN A;  2V3B A;  4IVM B;  2VVL A;  3AEF A;  3QVP A;  3UTF A;  3CGD A;  4BUR A;  2XVE A;  5FS8 A;  1RP0 A;  5BUL A;  1RSG A;  4EQR A;  4H4R A;  4B65 A;  4A6N B;  1N4W A;  2JB3 A;  2X8H A;  1JRX A;  4YKG A;  3SFE A;  1TRB A;  3BHF A;  1MXT A;  1NHP A;  3PVC A;  4U2S A;  3RP7 A;  2EQ9 A;  1Q1R A;  5TR3 A;  4CNK A;  4O5Q A;  3EAN A;  2YAU A;  2XYO A;  2CDU A;  3K30 A;  2GVC A;  3PO7 A;  4EM4 A;  4H4W A;  1NG3 A;  4K2X A;  1Y0P A;  1YQZ A;  3IHM A;  4JN9 A;  1M6I A;  4X4J A;  5EOW A;  4TM0 A;  1XHC A;  1LJ1 A;  3NN0 X;  2YLW A;  1VG0 A;  2YG7 A;  2R46 A;  1K4Q A;  4ZN0 A;  1JNR A;  2AR8 A;  4YSZ A;  3AE4 A;  3SFD A;  2Z5X A;  2ZZC A;  1DOC A;  3NTD A;  4IA5 A;  4XWR A;  4A7A A;  2GR1 A;  1L9D A;  1CC4 A;  3KD9 A;  3VR9 A;  1H81 A;  1ZOV A;  1PBF A;  1PXB A;  5JCI A;  2V61 A;  3FIM B;  3QFA A;  4Y4N A;  1KSS A;  1LVL A;  4Y4L A;  3GRT A;  4IV9 A;  1K0I A;  2A87 A;  3VRA A;  2GAH B;  2PHH A;  3EPT A;  3UP4 A;  1P2E A;  3LZW A;  2XFO A;  2A8X A;  4O5U A;  4YWO A;  4OPC A;  1GES A;  4E0V A;  4GUV A;  2WET A;  2QA2 A;  4H4P A;  2V5Z A;  5LV9 A;  3P4P A;  1B37 A;  2H89 A;  1W4X A;  4AP3 A;  3D1C A;  1E1L A;  3UKA A;  3AWI A;  2X8C A;  4NTC A;  1NHQ A;  5U25 A;  5C2T A;  1S3E A;  1KFY A;  4JY3 A;  3KKJ A;  2C64 A;  2BC0 A;  2B7S A;  1QO8 A;  1B8S A;  3LB8 A;  2XLS A;  5FS7 A;  3LXD A;  3ICS A;  4EQX A;  3DJE A;  4YTM A;  2R4J A;  3D8X A;  1CJ4 A;  1YKJ A;  4FX9 A;  1EBD A;  2BXS A;  5EBK A;  2C3D A;  4C74 A;  3KU9 A;  2FBW A;  3KVE A;  1HYU A;  3CNT A;  4ECH A;  2GR3 A;  1BZL A;  2YG5 A;  3UTE A;  4EM3 A;  3AYI A;  4JNQ A;  1IUX A;  2WDQ A;  2C75 A;  1ZMD A;  1ZP0 A;  1OJC A;  2R45 A;  4FK1 C;  3NGC X;  2E4G A;  3CND A;  4LU6 A;  3UOV A;  3DGZ A;  2XVJ A;  4ZCC A;  4Y4M A;  3OC4 A;  3UP5 A;  1PJ6 A;  1SEZ A;  3ADA B;  3E1T A;  3M12 A;  2O9Z A;  2BK5 A;  1XAN A;  1MO9 A;  3RNM A;  1TDE A;  5EB5 A;  2XFP A;  1L0V A;  4Z26 A;  2IID A;  3LJP A;  2BCP A;  2XFQ A;  4OPI A;  5FMH A;  3RED A;  3UCL A;  5HY5 A;  1CC6 A;  3DA1 A;  1F6M A;  3O0H A;  4Z25 A;  4OCG A;  1NEN A;  2RAB A;  1Q9I A;  2NVK X;  2E1M A;  3DGH A;  5ER0 A;  2Q0K A;  3ALM A;  3WE0 A;  2CVJ A;  4AP1 A;  4Z2U A;  1H7W A;  3P4Q A;  2YVF A;  4KX6 A;  4EIP A;  4OPL A;  4EQW A;  1D4E A;  1GRA A;  2FJB A;  3QJ4 A;  3I6D A;  2JK6 A;  3VRB A;  4C3X A;  1CL0 A;  5KWF A;  4BV6 A;  2XLU A;  4U8M A;  4U8K A;  3SGL A;  1NDA A;  1F8R A;  3AXB A;  4AOS A;  2BYB A;  4K5R A;  2A89 A;  2C70 A;  2OAL A;  2W0H A;  4OPU A;  4OPD A;  3ATQ A;  1H7X A;  1S2Q A;  2XLR A;  3BNM A;  1Y56 B;  4EMJ A;  1ZY8 A;  1VDC A;  4C77 A;  3AD8 B;  1OJD A;  1GRF A;  3KLJ A;  1NG4 A;  2XVI A;  3QVR A;  3DK4 A;  5M0Z A;  1DOB A;  2R9Z A;  2VVL G;  4Z43 A;  1LQT A;  1OJ9 A;  1YY5 A;  2IVE A;  1LPF A;  2BCG G;  2NPX A;  3DH9 A;  4OPG A;  1CHU A;  4UDR A;  5HYM A;  4BK2 A;  1D5T A;  4U2L A;  2XFN A;  2WOW A;  4LA1 A;  3FBS A;  1X31 B;  2R4E A;  3B6D A;  2RGO A;  1V59 A;  2RGH A;  4CCR A;  2I0Z A;  4TLZ A;  5JCK A;  1D7Y A;  2JAE A;  2GQF A;  3AEB A;  1TYT A;  2J3N A;  4I59 A;  2V3A A;  4GDE A;  2WP9 A;  1E6E A;  3CGE A;  4IVO B;  2Q7V A;  2B9X A;  2BXR A;  1N4V A;  2FJA A;  2X8G A;  4DSH A;  1LV0 A;  4H50 A;  3ALL A;  3UOY A;  2WPC A;  5L46 A;  2JB2 A;  3DJJ A;  4H4Z A;  2BAC A;  2EQ6 A;  4K7Z A;  4DSG A;  3UTG A;  4EMW A;  4ADW A;  3BI4 A;  4K22 A;  1PJ5 A;  1GRT A;  3P9U A;  2TPR A;  4H4S A;  4PAA A;  4U8I A;  3G5S A;  2JBV A;  2VQB A;  3F8P A;  5BRT A;  3IF9 A;  4APN A;  3UOZ A;  2GR0 A;  3NHO X;  1GV4 A;  3ZDN A;  3IWA A;  2VVM A;  2ZZB A;  3QSE A;  2B76 A; 
#chains in the Genus database with same CATH topology
 2AQJ A;  1REO A;  1VQW A;  1PBB A;  1BF3 A;  3NYE A;  3DK8 A;  2WP6 A;  4CBQ A;  3QFB A;  3VR8 A;  4CNJ A;  4YTN A;  4J36 A;  4UDP A;  3SZF A;  2XCG A;  4MJW A;  3AYL A;  3SM8 A;  4XWZ A;  4ZCD A;  4D03 A;  1S2Y A;  4PAB A;  2WOV A;  2X50 A;  2YG6 A;  3GMC A;  4U8O A;  2CFY A;  3L1R A;  5EB4 A;  2YM2 A;  1O95 A;  3FG2 P;  1ZK7 A;  4B66 A;  4CCQ A;  4NEW A;  4B68 A;  1KNP A;  2YG3 A;  3UKF A;  3SX6 A;  4N9X A;  3S61 A;  1EL5 A;  2EQ8 A;  4K5S A;  1GPE A;  5KXJ A;  1F8S A;  4U2T A;  3AYJ A;  5JCN A;  4UDQ A;  1O5W A;  2EQ7 A;  1OJA A;  2R0P A;  3RP6 A;  3C4N A;  3GYJ A;  3AE9 A;  3NH3 X;  2C73 A;  3NG7 X;  1H84 A;  3ALJ A;  3FMW A;  1GTE A;  3V3N A;  1GOS A;  3AE5 A;  4EQS A;  3B3R A;  5JCL A;  2X99 A;  1RYI A;  3BI2 A;  2TMD A;  2YR6 A;  4NNJ A;  1GEU A;  5DBJ A;  1CJ3 A;  3Q9T A;  2OLN A;  2F5Z A;  4H7U A;  1H6V A;  2WPE A;  2ZBW A;  2B7R A;  2E5V A;  1NAA A;  3CN8 A;  1E7P A;  3T37 A;  3AD9 B;  2Y6Q A;  2DKI A;  2Z5Y A;  4GR1 A;  3RP8 A;  5IPY A;  3FPZ A;  4BJY A;  4JNA A;  4U8N A;  2BRA A;  4CY6 A;  1JRY A;  1FCD A;  2GF3 A;  1ZDL A;  3CTY A;  2Q0L A;  1GT8 A;  3DK9 A;  4J34 A;  4RG4 A;  4XXG A;  2Q6U A;  2C65 A;  2H88 A;  4H4T A;  4USR A;  3SY4 A;  3NK0 X;  1PDH A;  1XDI A;  2R0C A;  3V76 A;  2YLR A;  2Y6R A;  3DJD A;  1D4D A;  4USQ A;  5J60 A;  2GR2 A;  3P1W A;  3VRD B;  4BJZ A;  1ELI A;  1NHS A;  4YSH A;  2WEU A;  4EIQ A;  4A9W A;  1F3P A;  3ATR A;  2UZZ A;  4REK A;  3NYF A;  2VRL A;  3UKQ A;  3VQR A;  1JOA A;  5IQ4 A;  5CKU A;  1PBD A;  4D04 A;  3CNP A;  2XLT A;  4A79 A;  1E39 A;  3COX A;  3DJG X;  3GDN A;  1P2H A;  2GAG B;  2IVD A;  5KMR A;  3AE3 A;  1BGJ A;  1GRE A;  1GND A;  1H82 A;  2GMH A;  3AED A;  3GSI A;  3EAO A;  5U1O A;  2JKC A;  1XPQ A;  1IUT A;  4NEV A;  2QCU A;  4AT2 A;  4G9K A;  2WHD A;  4K8D A;  4A99 A;  3NT6 A;  1CJC A;  2WBA A;  3V3O A;  4EMI A;  4BK1 A;  2BRY A;  1Y56 A;  4YT0 A;  3NIX A;  2BAB A;  3BHK A;  4BK3 A;  2YVJ A;  2V6O A;  4Z24 A;  3NTA A;  2VRM A;  2YM1 A;  3AEG A;  2GB0 A;  1DJN A;  4H4Y A;  1OJT A;  5IQ1 A;  2WDV A;  1DOE A;  3KPF A;  3NLC A;  3G5Q A;  1CC2 A;  4C3Y A;  4J31 A;  1AOG A;  2WS3 A;  5HXI A;  1GER A;  3CIR A;  2C76 A;  3GRS A;  3LZX A;  4A6N A;  4GDP A;  3EF6 A;  4YKF A;  3F8R A;  4M52 A;  3G5R A;  4AOX A;  2AAQ A;  1IUW A;  5U63 A;  1ZMC A;  3H8I A;  1M64 A;  1FL2 A;  3GYI A;  5KRQ A;  2ZZ0 A;  4B69 A;  1QLB A;  3QSM A;  4YSX A;  2XVF A;  2HQM A;  2B9Y A;  1COY A;  1YQ3 A;  2C7G A;  1D4C A;  2C72 A;  3ABV A;  4DNA A;  2WOI A;  2OA1 A;  3II4 A;  4J56 A;  5KVH A;  4J57 A;  1O94 A;  4NZH A;  5CQF A;  1CBO A;  1D7L A;  4OPT A;  1Z6L A;  4TM3 A;  4JY2 A;  4GCM A;  1PXC A;  4FDC B;  4WX1 A;  4NTD A;  3AE6 A;  5JCM A;  5M10 A;  1N4U A;  1GSN A;  2CUL A;  3AE2 A;  2YR4 A;  1H86 A;  2WP5 A;  3UKK A;  1GET A;  2VOU A;  4GRT A;  3T14 A;  3GWF A;  4ICY A;  1VG9 A;  2ARD A;  1JRZ A;  1PBE A;  2PYX A;  4U8P A;  1E1N A;  5J7X A;  2C66 A;  2BK3 A;  1B4V A;  1DXL A;  4NWZ A;  4Z2T A;  2GV8 A;  1MOK A;  1JNZ A;  2GH5 A;  3KA7 A;  1KDG A;  2GQW A;  3CPI G;  4JQ9 A;  3H4K A;  4U8J A;  4Z2R A;  3AEA A;  3F8D A;  1GXF A;  4H4Q A;  4GAP A;  1E1M A;  2ACZ A;  1NEK A;  5KMQ A;  4DGK A;  4NTE A;  2YVG A;  4C5O A;  1L9E A;  1PJ7 A;  3T2K A;  3AE8 A;  5BVA A;  5KVI A;  4YTP A;  4UP3 A;  4H2Q A;  2GRT A;  3I3L A;  4HB9 A;  5KNL A;  2WDR A;  1H83 A;  5KMP A;  3T2Y A;  4RSL A;  1FEA A;  1GTH A;  1NHR A;  2WU2 A;  4FK1 A;  3UKP A;  3L8K A;  2BS3 A;  3UOX A;  3GWD A;  3M13 A;  1Q1W A;  3CNS A;  2BS2 A;  2B9W A;  1TDO A;  3CGB A;  2WPF A;  4H4X A;  2FJE A;  3UKH A;  1KSU A;  1UKV G;  3LOV A;  1E1K A;  2JB1 A;  3CPH G;  2VQ7 A;  3M0O A;  3CPJ G;  2QA1 A;  3H8L A;  4H4U A;  1PXA A;  1S3B A;  1GRB A;  3K7M X;  3C96 A;  3GD4 A;  3HZL A;  4TM4 A;  3AEC A;  1GRH A;  2YLS A;  1DJQ A;  3P4R A;  3Q6J A;  3R9U A;  2BK4 A;  5KOW A;  4X9M A;  1ZKQ A;  1EL9 A;  3UKL A;  4J2W A;  5GRT A;  2WQY A;  2X3N A;  1ZX9 A;  2YR5 A;  3BNU A;  1PS9 A;  2GEW A;  3GD3 A;  3NYC A;  3LAD A;  4CY8 A;  2RGJ A;  3NNE A;  1K0J A;  2C67 A;  1CJ2 A;  2XVH A;  1FEC A;  2VZ2 A;  2XLP A;  1FEB A;  3AE1 A;  2FJD A;  4GF7 A;  3QSS A;  4TM1 A;  3ICT A;  3NK2 X;  2YLZ A;  1ZOY A;  1NPX A;  2OLO A;  3JSK A;  4JDR A;  3K7T A;  5C3J A;  1EL7 A;  3KPK A;  3NRN A;  3K7Q X;  4H2R A;  4OVI A;  4P9S A;  1LQU A;  2YG4 A;  3HYX A;  1CF3 A;  2OAM A;  4II3 A;  3ISH A;  3S5W A;  2V60 A;  3AE7 A;  2WES A;  3PS9 A;  4I58 A;  1N1P A;  2R0G A;  3NKS A;  2APG A;  5HHF A;  1LTX R;  3BI5 A;  4A5L A;  1ONF A;  5BUK A;  3SQP A;  4B64 A;  1BWC A;  2YLX A;  3ZYX A;  2GMJ A;  3RHA A;  4WCT A;  4B63 A;  1DNC A;  3CGC A;  4X9N A;  4H4V A;  4IA6 A;  4TLX A;  3AEE A;  5GSN A;  3SZW A;  5FS9 A;  2XFU A;  2YQU A;  1BKW A;  2C3C A;  3P4S A;  4B67 A;  3AB1 A;  4YSY A;  1EL8 A;  1VRQ B;  1PN0 A;  2DKH A;  3HYW A;  4AT0 A;  1BGN A;  2WU5 A;  1B5Q A;  1F8W A;  2YLT A;  1QJD A;  3IC9 A;  1JEH A;  1IUU A;  4U8L A;  4Z44 A;  3GDP A;  3AD7 B;  2BA9 A;  2YWL A;  5FS6 A;  3UTH A;  4A65 A;  4RG3 A;  1IUS A;  3CNJ A;  3ICR A;  4B1B A;  3DME A;  1KNR A;  4YXD A;  1YQ4 A;  4H2N A;  2QAE A;  4LII A;  1PHH A;  1K0L A;  1FOH A;  5KOX A;  1IJH A;  1GAL A;  4J33 A;  1L9C A;  1JU2 A;  3URH A;  3ITJ A;  1PBC A;  1DOD A;  3OZ2 A;  4CRT A;  1TDF A;  2BC1 A;  3NN6 X;  4H2P A;  2BS4 A;  1IUV A;  2XDO A;  3IHG A;  1KF6 A;  4HA6 A;  3C4A A;  1TDK A;  3GMB A;  3NK1 X;  4KPR A;  1GRG A;  1TYP A;  1TDN A;  3SXI A;  2V3B A;  4IVM B;  2VVL A;  3AEF A;  3QVP A;  3UTF A;  3CGD A;  4BUR A;  2XVE A;  5FS8 A;  1RP0 A;  5BUL A;  1RSG A;  4EQR A;  4H4R A;  3SZ0 A;  4B65 A;  4A6N B;  1N4W A;  2JB3 A;  2X8H A;  1JRX A;  4YKG A;  3SFE A;  1TRB A;  3BHF A;  3GYX A;  3CMM A;  1MXT A;  3HYV A;  3T0K A;  1NHP A;  3PVC A;  4U2S A;  3RP7 A;  2EQ9 A;  1Q1R A;  5TR3 A;  4CNK A;  4O5Q A;  3EAN A;  2YAU A;  2XYO A;  2CDU A;  3K30 A;  2GVC A;  3PO7 A;  4EM4 A;  4H4W A;  1NG3 A;  4K2X A;  1Y0P A;  1YQZ A;  3IHM A;  4JN9 A;  1M6I A;  4X4J A;  5EOW A;  4TM0 A;  1XHC A;  1LJ1 A;  3NN0 X;  2YLW A;  1VG0 A;  2YG7 A;  2R46 A;  1K4Q A;  4ZN0 A;  1JNR A;  2AR8 A;  4YSZ A;  3AE4 A;  3SFD A;  4G74 A;  2Z5X A;  2ZZC A;  1DOC A;  3NTD A;  4IA5 A;  4XWR A;  4A7A A;  2GR1 A;  1L9D A;  1CC4 A;  3KD9 A;  3VR9 A;  1H81 A;  1ZOV A;  1PBF A;  1PXB A;  5JCI A;  2V61 A;  3FIM B;  3QFA A;  4Y4N A;  1KSS A;  1LVL A;  4Y4L A;  3GRT A;  4IV9 A;  1K0I A;  2A87 A;  3VRA A;  3SYI A;  2GAH B;  2PHH A;  3EPT A;  3UP4 A;  1P2E A;  3LZW A;  5KMS A;  2XFO A;  2A8X A;  4O5U A;  4YWO A;  4OPC A;  1GES A;  4E0V A;  4GUV A;  2WET A;  2QA2 A;  4H4P A;  2V5Z A;  5LV9 A;  3P4P A;  1B37 A;  2H89 A;  1W4X A;  4AP3 A;  3D1C A;  1E1L A;  3UKA A;  3AWI A;  2X8C A;  4NTC A;  1NHQ A;  5U25 A;  5C2T A;  1S3E A;  1KFY A;  4JY3 A;  3KKJ A;  2C64 A;  2BC0 A;  2B7S A;  3T31 A;  1QO8 A;  1B8S A;  3LB8 A;  2XLS A;  5FS7 A;  3LXD A;  3ICS A;  4EQX A;  3DJE A;  4YTM A;  2R4J A;  3D8X A;  1CJ4 A;  1YKJ A;  4FX9 A;  1EBD A;  2BXS A;  5EBK A;  2C3D A;  4C74 A;  3KU9 A;  2FBW A;  3KVE A;  1HYU A;  3CNT A;  4ECH A;  2GR3 A;  1BZL A;  2YG5 A;  3UTE A;  4EM3 A;  3AYI A;  4JNQ A;  1IUX A;  2WDQ A;  2C75 A;  4II2 A;  1ZMD A;  2C4C A;  1ZP0 A;  1OJC A;  2R45 A;  4FK1 C;  3NGC X;  2E4G A;  3CND A;  4LU6 A;  3UOV A;  3DGZ A;  2XVJ A;  4ZCC A;  4Y4M A;  3OC4 A;  3UP5 A;  1PJ6 A;  1SEZ A;  3ADA B;  3E1T A;  3M12 A;  2O9Z A;  2BK5 A;  1XAN A;  1MO9 A;  3RNM A;  3SZC A;  1TDE A;  5EB5 A;  2XFP A;  1L0V A;  4Z26 A;  2IID A;  3LJP A;  2BCP A;  2XFQ A;  4OPI A;  5FMH A;  3RED A;  3UCL A;  5HY5 A;  4GAV A;  1CC6 A;  3DA1 A;  1F6M A;  3O0H A;  4G6H A;  4OCG A;  1NEN A;  2RAB A;  4Z25 A;  1Q9I A;  2NVK X;  2E1M A;  3DGH A;  5ER0 A;  2Q0K A;  3ALM A;  3WE0 A;  2CVJ A;  4AP1 A;  4Z2U A;  1H7W A;  3P4Q A;  2YVF A;  4KX6 A;  4EIP A;  4OPL A;  4EQW A;  1D4E A;  1GRA A;  2FJB A;  3QJ4 A;  3I6D A;  2JK6 A;  3VRB A;  4C3X A;  1CL0 A;  5KWF A;  4BV6 A;  2XLU A;  4U8M A;  4U8K A;  3SGL A;  1NDA A;  1F8R A;  3AXB A;  4AOS A;  2BYB A;  4K5R A;  2A89 A;  2C70 A;  2OAL A;  2W0H A;  4OPU A;  4OPD A;  3ATQ A;  1H7X A;  1S2Q A;  2XLR A;  3BNM A;  1Y56 B;  4EMJ A;  1ZY8 A;  1VDC A;  4C77 A;  3AD8 B;  1OJD A;  1GRF A;  3KLJ A;  1NG4 A;  2XVI A;  3QVR A;  3DK4 A;  5M0Z A;  1DOB A;  2R9Z A;  2VVL G;  4Z43 A;  1LQT A;  3T2Z A;  1OJ9 A;  1YY5 A;  2IVE A;  1LPF A;  2BCG G;  2NPX A;  3DH9 A;  4OPG A;  1CHU A;  4UDR A;  5HYM A;  4BK2 A;  1D5T A;  4U2L A;  2XFN A;  2WOW A;  4LA1 A;  3FBS A;  1X31 B;  2R4E A;  3B6D A;  2RGO A;  1V59 A;  2RGH A;  4CCR A;  2I0Z A;  4TLZ A;  5JCK A;  1D7Y A;  2JAE A;  2GQF A;  3AEB A;  1TYT A;  2J3N A;  4I59 A;  2V3A A;  4GDE A;  2WP9 A;  1E6E A;  3CGE A;  4IVO B;  2Q7V A;  2B9X A;  2BXR A;  1N4V A;  2FJA A;  2X8G A;  4DSH A;  1LV0 A;  4H50 A;  3ALL A;  3UOY A;  2WPC A;  5L46 A;  2JB2 A;  3DJJ A;  4H4Z A;  2BAC A;  2EQ6 A;  4K7Z A;  4DSG A;  3UTG A;  4EMW A;  4ADW A;  3BI4 A;  4K22 A;  1PJ5 A;  1GRT A;  3P9U A;  2TPR A;  4H4S A;  4PAA A;  4U8I A;  3G5S A;  2JBV A;  2VQB A;  3F8P A;  5BRT A;  3IF9 A;  4APN A;  3UOZ A;  2GR0 A;  3NHO X;  1GV4 A;  4G6G A;  3ZDN A;  3IWA A;  2VVM A;  4G73 A;  2ZZB A;  3QSE A;  2B76 A; 
#chains in the Genus database with same CATH homology
 2AQJ A;  1REO A;  1VQW A;  1PBB A;  1BF3 A;  3NYE A;  3DK8 A;  2WP6 A;  4CBQ A;  3QFB A;  3VR8 A;  4CNJ A;  4YTN A;  4J36 A;  4UDP A;  3SZF A;  2XCG A;  4MJW A;  3AYL A;  3SM8 A;  4XWZ A;  4ZCD A;  4D03 A;  1S2Y A;  4PAB A;  2WOV A;  2X50 A;  2YG6 A;  3GMC A;  4U8O A;  2CFY A;  3L1R A;  5EB4 A;  2YM2 A;  1O95 A;  3FG2 P;  1ZK7 A;  4B66 A;  4CCQ A;  4NEW A;  4B68 A;  1KNP A;  2YG3 A;  3UKF A;  3SX6 A;  4N9X A;  3S61 A;  1EL5 A;  2EQ8 A;  4K5S A;  1GPE A;  5KXJ A;  1F8S A;  4U2T A;  3AYJ A;  5JCN A;  4UDQ A;  1O5W A;  2EQ7 A;  1OJA A;  2R0P A;  3RP6 A;  3C4N A;  3GYJ A;  3AE9 A;  3NH3 X;  2C73 A;  3NG7 X;  1H84 A;  3ALJ A;  3FMW A;  1GTE A;  3V3N A;  1GOS A;  3AE5 A;  4EQS A;  3B3R A;  5JCL A;  2X99 A;  1RYI A;  3BI2 A;  2TMD A;  2YR6 A;  4NNJ A;  1GEU A;  5DBJ A;  1CJ3 A;  3Q9T A;  2OLN A;  2F5Z A;  4H7U A;  1H6V A;  2WPE A;  2ZBW A;  2B7R A;  2E5V A;  1NAA A;  3CN8 A;  1E7P A;  3T37 A;  3AD9 B;  2Y6Q A;  2DKI A;  2Z5Y A;  4GR1 A;  3RP8 A;  5IPY A;  3FPZ A;  4BJY A;  4JNA A;  4U8N A;  2BRA A;  4CY6 A;  1JRY A;  1FCD A;  2GF3 A;  1ZDL A;  3CTY A;  2Q0L A;  1GT8 A;  3DK9 A;  4J34 A;  4RG4 A;  4XXG A;  2Q6U A;  2C65 A;  2H88 A;  4H4T A;  4USR A;  3SY4 A;  3NK0 X;  1PDH A;  1XDI A;  2R0C A;  3V76 A;  2YLR A;  2Y6R A;  3DJD A;  1D4D A;  4USQ A;  5J60 A;  2GR2 A;  3P1W A;  3VRD B;  4BJZ A;  1ELI A;  1NHS A;  4YSH A;  2WEU A;  4EIQ A;  4A9W A;  1F3P A;  3ATR A;  2UZZ A;  4REK A;  3NYF A;  2VRL A;  3UKQ A;  3VQR A;  1JOA A;  5IQ4 A;  5CKU A;  1PBD A;  4D04 A;  3CNP A;  2XLT A;  4A79 A;  1E39 A;  3COX A;  3DJG X;  3GDN A;  1P2H A;  2GAG B;  2IVD A;  5KMR A;  3AE3 A;  1BGJ A;  1GRE A;  1GND A;  1H82 A;  2GMH A;  3AED A;  3GSI A;  3EAO A;  5U1O A;  2JKC A;  1XPQ A;  1IUT A;  4NEV A;  2QCU A;  4AT2 A;  4G9K A;  2WHD A;  4K8D A;  4A99 A;  3NT6 A;  1CJC A;  2WBA A;  3V3O A;  4EMI A;  4BK1 A;  2BRY A;  1Y56 A;  4YT0 A;  3NIX A;  2BAB A;  3BHK A;  4BK3 A;  2YVJ A;  2V6O A;  4Z24 A;  3NTA A;  2VRM A;  2YM1 A;  3AEG A;  2GB0 A;  1DJN A;  4H4Y A;  1OJT A;  5IQ1 A;  2WDV A;  1DOE A;  3KPF A;  3NLC A;  3G5Q A;  1CC2 A;  4C3Y A;  4J31 A;  1AOG A;  2WS3 A;  5HXI A;  1GER A;  3CIR A;  2C76 A;  3GRS A;  3LZX A;  4A6N A;  4GDP A;  3EF6 A;  4YKF A;  3F8R A;  4M52 A;  3G5R A;  4AOX A;  2AAQ A;  1IUW A;  5U63 A;  1ZMC A;  3H8I A;  1M64 A;  1FL2 A;  3GYI A;  5KRQ A;  2ZZ0 A;  4B69 A;  1QLB A;  3QSM A;  4YSX A;  2XVF A;  2HQM A;  2B9Y A;  1COY A;  1YQ3 A;  2C7G A;  1D4C A;  2C72 A;  3ABV A;  4DNA A;  2WOI A;  2OA1 A;  3II4 A;  4J56 A;  5KVH A;  4J57 A;  1O94 A;  4NZH A;  5CQF A;  1CBO A;  1D7L A;  4OPT A;  1Z6L A;  4TM3 A;  4JY2 A;  4GCM A;  1PXC A;  4FDC B;  4WX1 A;  4NTD A;  3AE6 A;  5JCM A;  5M10 A;  1N4U A;  1GSN A;  2CUL A;  3AE2 A;  2YR4 A;  1H86 A;  2WP5 A;  3UKK A;  1GET A;  2VOU A;  4GRT A;  3T14 A;  3GWF A;  4ICY A;  1VG9 A;  2ARD A;  1JRZ A;  1PBE A;  2PYX A;  4U8P A;  1E1N A;  5J7X A;  2C66 A;  2BK3 A;  1B4V A;  1DXL A;  4NWZ A;  4Z2T A;  2GV8 A;  1MOK A;  1JNZ A;  2GH5 A;  3KA7 A;  1KDG A;  2GQW A;  3CPI G;  4JQ9 A;  3H4K A;  4U8J A;  4Z2R A;  3AEA A;  3F8D A;  1GXF A;  4H4Q A;  4GAP A;  1E1M A;  2ACZ A;  1NEK A;  5KMQ A;  4DGK A;  4NTE A;  2YVG A;  4C5O A;  1L9E A;  1PJ7 A;  3T2K A;  3AE8 A;  5BVA A;  5KVI A;  4YTP A;  4UP3 A;  4H2Q A;  2GRT A;  3I3L A;  4HB9 A;  5KNL A;  2WDR A;  1H83 A;  5KMP A;  3T2Y A;  4RSL A;  1FEA A;  1GTH A;  1NHR A;  2WU2 A;  4FK1 A;  3UKP A;  3L8K A;  2BS3 A;  3UOX A;  3GWD A;  3M13 A;  1Q1W A;  3CNS A;  2BS2 A;  2B9W A;  1TDO A;  3CGB A;  2WPF A;  4H4X A;  2FJE A;  3UKH A;  1KSU A;  1UKV G;  3LOV A;  1E1K A;  2JB1 A;  3CPH G;  2VQ7 A;  3M0O A;  3CPJ G;  2QA1 A;  3H8L A;  4H4U A;  1PXA A;  1S3B A;  1GRB A;  3K7M X;  3C96 A;  3GD4 A;  3HZL A;  4TM4 A;  3AEC A;  1GRH A;  2YLS A;  1DJQ A;  3P4R A;  3Q6J A;  3R9U A;  2BK4 A;  5KOW A;  4X9M A;  1ZKQ A;  1EL9 A;  3UKL A;  4J2W A;  5GRT A;  2WQY A;  2X3N A;  1ZX9 A;  2YR5 A;  3BNU A;  1PS9 A;  2GEW A;  3GD3 A;  3NYC A;  3LAD A;  4CY8 A;  2RGJ A;  3NNE A;  1K0J A;  2C67 A;  1CJ2 A;  2XVH A;  1FEC A;  2VZ2 A;  2XLP A;  1FEB A;  3AE1 A;  2FJD A;  4GF7 A;  3QSS A;  4TM1 A;  3ICT A;  3NK2 X;  2YLZ A;  1ZOY A;  1NPX A;  2OLO A;  3JSK A;  4JDR A;  3K7T A;  5C3J A;  1EL7 A;  3KPK A;  3NRN A;  3K7Q X;  4H2R A;  4OVI A;  4P9S A;  1LQU A;  2YG4 A;  3HYX A;  1CF3 A;  2OAM A;  4II3 A;  3ISH A;  3S5W A;  2V60 A;  3AE7 A;  2WES A;  3PS9 A;  4I58 A;  1N1P A;  2R0G A;  3NKS A;  2APG A;  5HHF A;  1LTX R;  3BI5 A;  4A5L A;  1ONF A;  5BUK A;  3SQP A;  4B64 A;  1BWC A;  2YLX A;  3ZYX A;  2GMJ A;  3RHA A;  4WCT A;  4B63 A;  1DNC A;  3CGC A;  4X9N A;  4H4V A;  4IA6 A;  4TLX A;  3AEE A;  5GSN A;  3SZW A;  5FS9 A;  2XFU A;  2YQU A;  1BKW A;  2C3C A;  3P4S A;  4B67 A;  3AB1 A;  4YSY A;  1EL8 A;  1VRQ B;  1PN0 A;  2DKH A;  3HYW A;  4AT0 A;  1BGN A;  2WU5 A;  1B5Q A;  1F8W A;  2YLT A;  1QJD A;  3IC9 A;  1JEH A;  1IUU A;  4U8L A;  4Z44 A;  3GDP A;  3AD7 B;  2BA9 A;  2YWL A;  5FS6 A;  3UTH A;  4A65 A;  4RG3 A;  1IUS A;  3CNJ A;  3ICR A;  4B1B A;  3DME A;  1KNR A;  4YXD A;  1YQ4 A;  4H2N A;  2QAE A;  4LII A;  1PHH A;  1K0L A;  1FOH A;  5KOX A;  1IJH A;  1GAL A;  4J33 A;  1L9C A;  1JU2 A;  3URH A;  3ITJ A;  1PBC A;  1DOD A;  3OZ2 A;  4CRT A;  1TDF A;  2BC1 A;  3NN6 X;  4H2P A;  2BS4 A;  1IUV A;  2XDO A;  3IHG A;  1KF6 A;  4HA6 A;  3C4A A;  1TDK A;  3GMB A;  3NK1 X;  4KPR A;  1GRG A;  1TYP A;  1TDN A;  3SXI A;  2V3B A;  4IVM B;  2VVL A;  3AEF A;  3QVP A;  3UTF A;  3CGD A;  4BUR A;  2XVE A;  5FS8 A;  1RP0 A;  5BUL A;  1RSG A;  4EQR A;  4H4R A;  3SZ0 A;  4B65 A;  4A6N B;  1N4W A;  2JB3 A;  2X8H A;  1JRX A;  4YKG A;  3SFE A;  1TRB A;  3BHF A;  3GYX A;  3CMM A;  1MXT A;  3HYV A;  3T0K A;  1NHP A;  3PVC A;  4U2S A;  3RP7 A;  2EQ9 A;  1Q1R A;  5TR3 A;  4CNK A;  4O5Q A;  3EAN A;  2YAU A;  2XYO A;  2CDU A;  3K30 A;  2GVC A;  3PO7 A;  4EM4 A;  4H4W A;  1NG3 A;  4K2X A;  1Y0P A;  1YQZ A;  3IHM A;  4JN9 A;  1M6I A;  4X4J A;  5EOW A;  4TM0 A;  1XHC A;  1LJ1 A;  3NN0 X;  2YLW A;  1VG0 A;  2YG7 A;  2R46 A;  1K4Q A;  4ZN0 A;  1JNR A;  2AR8 A;  4YSZ A;  3AE4 A;  3SFD A;  4G74 A;  2Z5X A;  2ZZC A;  1DOC A;  3NTD A;  4IA5 A;  4XWR A;  4A7A A;  2GR1 A;  1L9D A;  1CC4 A;  3KD9 A;  3VR9 A;  1H81 A;  1ZOV A;  1PBF A;  1PXB A;  5JCI A;  2V61 A;  3FIM B;  3QFA A;  4Y4N A;  1KSS A;  1LVL A;  4Y4L A;  3GRT A;  4IV9 A;  1K0I A;  2A87 A;  3VRA A;  3SYI A;  2GAH B;  2PHH A;  3EPT A;  3UP4 A;  1P2E A;  3LZW A;  5KMS A;  2XFO A;  2A8X A;  4O5U A;  4YWO A;  4OPC A;  1GES A;  4E0V A;  4GUV A;  2WET A;  2QA2 A;  4H4P A;  2V5Z A;  5LV9 A;  3P4P A;  1B37 A;  2H89 A;  1W4X A;  4AP3 A;  3D1C A;  1E1L A;  3UKA A;  3AWI A;  2X8C A;  4NTC A;  1NHQ A;  5U25 A;  5C2T A;  1S3E A;  1KFY A;  4JY3 A;  3KKJ A;  2C64 A;  2BC0 A;  2B7S A;  3T31 A;  1QO8 A;  1B8S A;  3LB8 A;  2XLS A;  5FS7 A;  3LXD A;  3ICS A;  4EQX A;  3DJE A;  4YTM A;  2R4J A;  3D8X A;  1CJ4 A;  1YKJ A;  4FX9 A;  1EBD A;  2BXS A;  5EBK A;  2C3D A;  4C74 A;  3KU9 A;  2FBW A;  3KVE A;  1HYU A;  3CNT A;  4ECH A;  2GR3 A;  1BZL A;  2YG5 A;  3UTE A;  4EM3 A;  3AYI A;  4JNQ A;  1IUX A;  2WDQ A;  2C75 A;  4II2 A;  1ZMD A;  2C4C A;  1ZP0 A;  1OJC A;  2R45 A;  4FK1 C;  3NGC X;  2E4G A;  3CND A;  4LU6 A;  3UOV A;  3DGZ A;  2XVJ A;  4ZCC A;  4Y4M A;  3OC4 A;  3UP5 A;  1PJ6 A;  1SEZ A;  3ADA B;  3E1T A;  3M12 A;  2O9Z A;  2BK5 A;  1XAN A;  1MO9 A;  3RNM A;  3SZC A;  1TDE A;  5EB5 A;  2XFP A;  1L0V A;  4Z26 A;  2IID A;  3LJP A;  2BCP A;  2XFQ A;  4OPI A;  5FMH A;  3RED A;  3UCL A;  5HY5 A;  4GAV A;  1CC6 A;  3DA1 A;  1F6M A;  3O0H A;  4G6H A;  4OCG A;  1NEN A;  2RAB A;  4Z25 A;  1Q9I A;  2NVK X;  2E1M A;  3DGH A;  5ER0 A;  2Q0K A;  3ALM A;  3WE0 A;  2CVJ A;  4AP1 A;  4Z2U A;  1H7W A;  3P4Q A;  2YVF A;  4KX6 A;  4EIP A;  4OPL A;  4EQW A;  1D4E A;  1GRA A;  2FJB A;  3QJ4 A;  3I6D A;  2JK6 A;  3VRB A;  4C3X A;  1CL0 A;  5KWF A;  4BV6 A;  2XLU A;  4U8M A;  4U8K A;  3SGL A;  1NDA A;  1F8R A;  3AXB A;  4AOS A;  2BYB A;  4K5R A;  2A89 A;  2C70 A;  2OAL A;  2W0H A;  4OPU A;  4OPD A;  3ATQ A;  1H7X A;  1S2Q A;  2XLR A;  3BNM A;  1Y56 B;  4EMJ A;  1ZY8 A;  1VDC A;  4C77 A;  3AD8 B;  1OJD A;  1GRF A;  3KLJ A;  1NG4 A;  2XVI A;  3QVR A;  3DK4 A;  5M0Z A;  1DOB A;  2R9Z A;  2VVL G;  4Z43 A;  1LQT A;  3T2Z A;  1OJ9 A;  1YY5 A;  2IVE A;  1LPF A;  2BCG G;  2NPX A;  3DH9 A;  4OPG A;  1CHU A;  4UDR A;  5HYM A;  4BK2 A;  1D5T A;  4U2L A;  2XFN A;  2WOW A;  4LA1 A;  3FBS A;  1X31 B;  2R4E A;  3B6D A;  2RGO A;  1V59 A;  2RGH A;  4CCR A;  2I0Z A;  4TLZ A;  5JCK A;  1D7Y A;  2JAE A;  2GQF A;  3AEB A;  1TYT A;  2J3N A;  4I59 A;  2V3A A;  4GDE A;  2WP9 A;  1E6E A;  3CGE A;  4IVO B;  2Q7V A;  2B9X A;  2BXR A;  1N4V A;  2FJA A;  2X8G A;  4DSH A;  1LV0 A;  4H50 A;  3ALL A;  3UOY A;  2WPC A;  5L46 A;  2JB2 A;  3DJJ A;  4H4Z A;  2BAC A;  2EQ6 A;  4K7Z A;  4DSG A;  3UTG A;  4EMW A;  4ADW A;  3BI4 A;  4K22 A;  1PJ5 A;  1GRT A;  3P9U A;  2TPR A;  4H4S A;  4PAA A;  4U8I A;  3G5S A;  2JBV A;  2VQB A;  3F8P A;  5BRT A;  3IF9 A;  4APN A;  3UOZ A;  2GR0 A;  3NHO X;  1GV4 A;  4G6G A;  3ZDN A;  3IWA A;  2VVM A;  4G73 A;  2ZZB A;  3QSE A;  2B76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...