4A5LA

Crystal structure of the thioredoxin reductase from entamoeba histolytica
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
313
structure length
313
Chain Sequence
SNIHDVVIIGSGPAAHTAAIYLGRSSLKPVMYEGFMAGGVAAGGQLTTTTIIENFPGFPNGIDGNELMMNMRTQSEKYGTTIITETIDHVDFSTQPFKLFTEEGKEVLTKSVIIATGATAKRMHVPGEDKYWQNGVSACAICDGAVPIFRNKVLMVVGGGDAAMEEALHLTKYGSKVIILHRRDAFRASKTMQERVLNHPKIEVIWNSELVELEGDGDLLNGAKIHNLVSGEYKVVPVAGLFYAIGHSPNSKFLGGQVKTADDGYILTEGPKTSVDGVFACGDVCDRVYRQAIVAAGSGCMAALSCEKWLQTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THIOREDOXIN REDUCTASE
publication title X-Ray Structures of Thioredoxin and Thioredoxin Reductase from Entamoeba Histolytica and Prevailing Hypothesis of the Mechanism of Auranofin Action.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Oxidoreductase
total genus 93
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 1.8.1.9: Thioredoxin-disulfide reductase.
pdb deposition date 2011-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a5lA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 4a5lA02
3KVEA 2JB2A 1ZX9A 3UTGA 2WPEA 3CNJA 2XDOA 3EAOA 2C3DA 5J60A 1GRAA 1H7WA 4NTCA 3RHAA 1O5WA 4CCRA 2C70A 1BWCA 3ALMA 4H4TA 2FJAA 3ISHA 1KDGA 2W0HA 4USQA 1M6IA 1NENA 2XLPA 3PVCA 2BK5A 3DMEA 4JNAA 3D1CA 2R0PA 1L9DA 3NG7X 4YKGA 4FK1C 4U8LA 4EMIA 2C67A 4BURA 3PS9A 2YR4A 1DJQA 2GR1A 3GSIA 3CNDA 2QA2A 4H4SA 5BUKA 2HQMA 3IHGA 3UOYA 1TDNA 1N4VA 4GUVA 4DSGA 4Z26A 2FBWA 4TM1A 4K5RA 4NTEA 2IIDA 2XLSA 1F8RA 4J36A 4JY3A 1PJ7A 2VVLA 1IJHA 2EQ6A 1H83A 4Z43A 2WOWA 2BXSA 1NPXA 1CC2A 1GERA 2GEWA 3ALLA 3BHKA 2Q7VA 2BYBA 4J56A 1GNDA 2YVGA 1ZKQA 2C3CA 2ZZBA 1GV4A 1TDEA 1XANA 3CPHG 3VR8A 3UOZA 2WPFA 4GDEA 3UKFA 4Z2RA 4A65A 4YT0A 2V5ZA 4Z2TA 1GOSA 2JB3A 1NHQA 2Z5XA 1GRBA 4USRA 1D7YA 4H4PA 4BK1A 1IUWA 1TRBA 3ICRA 3AYJA 1PXAA 1DNCA 2Q0KA 3QSSA 3AEGA 3ITJA 3UP4A 5KRQA 2TMDA 4B67A 2WP9A 2UZZA 1KSSA 1TDKA 2PHHA 3QVPA 2XCGA 5JCIA 1EL9A 3GWDA 2X3NA 3CNTA 4JQ9A 1S3EA 2ARDA 4BV6A 2GVCA 4YSHA 5KXJA 1NDAA 2A8XA 1N4WA 2IVEA 4UDPA 3EPTA 4NEWA 1ZP0A 3RNMA 4RG4A 4D03A 2YG6A 1S2YA 4IA5A 2VOUA 3ADAB 2YR5A 4K2XA 2WS3A 2B9YA 1Y0PA 4Y4MA 4LIIA 1O95A 3SFEA 1F8WA 2WETA 1ZOVA 5IQ1A 4E0VA 4NZHA 3WE0A 3G5QA 1JU2A 4FDCB 1F6MA 2OA1A 1L0VA 2YG4A 5HXIA 2H89A 2YLRA 1NHPA 3B6DA 1KNPA 1KSUA 4XXGA 3IF9A 3AYLA 1EL5A 3BI4A 3KPFA 4JDRA 5EB5A 3AE9A 2YM1A 4XWRA 3SQPA 3K7QX 4B1BA 3GD3A 1IUSA 3ABVA 3LOVA 3I6DA 4B69A 1BZLA 2XFOA 3JSKA 3NYCA 4OPCA 2B7RA 5HYMA 1D4CA 1H82A 1ZMDA 2ZBWA 3BNUA 1NG3A 1PN0A 1IUVA 4YTPA 2OAMA 4U8NA 5JCNA 4AOXA 1KF6A 3E1TA 5U25A 4DGKA 2WHDA 2XFNA 5C2TA 2GF3A 3CNPA 4YWOA 5M10A 4JNQA 2C73A 4Y4NA 3AD8B 1F8SA 4PAAA 4OPTA 4B65A 5BVAA 4C3XA 1K0IA 1Q1WA 1GXFA 5KVIA 3VQRA 1W4XA 1Y56A 3SFDA 2YG7A 3RP8A 3S5WA 3GRTA 1PBCA 1L9CA 3AECA 3DGHA 2APGA 1GTEA 3H8LA 2YG3A 4B63A 3F8DA 3CGEA 5FS6A 3UKAA 4ICYA 4XWZA 4YTNA 3AEFA 2R45A 1ZY8A 4BJYA 3UCLA 2R0GA 3NK1X 3AE3A 4BK3A 1GT8A 1ZOYA 3KA7A 4A9WA 4Y4LA 1FECA 4GRTA 2O9ZA 2WBAA 3G5RA 1CL0A 2GQWA 4H4ZA 1CJCA 1F3PA 3K7TA 2GMJA 4AP3A 1H6VA 3AE1A 1QLBA 1NAAA 3NGCX 3V3NA 1MO9A 3AEAA 4H50A 2A87A 3I3LA 1PJ6A 4CY6A 1YQZA 4K7ZA 2CULA 3S61A 3NHOX 2XVEA 3NYEA 4X9MA 3UOXA 1DOCA 1O94A 3M12A 4RSLA 2Z5YA 4FK1A 2V60A 5M0ZA 4APNA 2FJDA 2FJEA 3AB1A 2YWLA 2GAHB 3IC9A 3NK2X 4H7UA 2AR8A 1JOAA 4N9XA 2WOVA 1L9EA 3EF6A 2OLNA 4IVMB 1GRTA 2EQ9A 2QAEA 2AQJA 3P1WA 4IV9A 3GMCA 1VDCA 3AYIA 1H86A 4J34A 4NEVA 3UKKA 4A6NB 1PHHA 3AE6A 3UKQA 3FBSA 4C5OA 4YSXA 4ZN0A 2VQ7A 4U8JA 1EL7A 3NYFA 4J57A 2V3BA 4H4UA 1RSGA 3O0HA 1K0LA 2C65A 5JCLA 3BHFA 4CNKA 4CY8A 2CFYA 3K7MX 4H4XA 4CRTA 5BRTA 4P9SA 3L8KA 4IVOB 5U1OA 4A6NA 1CC4A 3M13A 1CC6A 4O5UA 2X8GA 4EM4A 2BS2A 3KU9A 2VZ2A 4TM0A 4I58A 4YTMA 3GYJA 4YSYA 1D7LA 1PBEA 2RABA 2XFUA 3AWIA 4X4JA 4J31A 1IUTA 1ZDLA 3GMBA 3SM8A 3V76A 2EQ8A 4U8PA 2E4GA 1PJ5A 1VQWA 2VRLA 3OZ2A 3P4PA 4CBQA 4D04A 1CF3A 2AAQA 1BGNA 1GSNA 4AOSA 1LPFA 1E1LA 1BGJA 2WDQA 3AEBA 4A79A 2BC1A 1CBOA 4J2WA 2BK3A 4OPIA 3VRDB 4Z2UA 1B5QA 1CJ2A 3GRSA 1PXCA 2OLOA 2V61A 4H4WA 5KOWA 1E1NA 4JN9A 2GRTA 2BS4A 1XHCA 2R9ZA 1PBDA 1GEUA 3QSMA 2WU2A 4TLZA 2H88A 2GR2A 1NHSA 1UKVG 2B7SA 2Q0LA 5GRTA 4RG3A 2VRMA 1DXLA 1YY5A 3DA1A 4UP3A 1ELIA 1VRQB 3CPIG 3C96A 4EQSA 1DODA 1LQTA 3QJ4A 1COYA 3LADA 3CGBA 5KOXA 3VR9A 2YLTA 2YVJA 4A7AA 4H2NA 5HY5A 4OPLA 3SGLA 4EQWA 3GDNA 5ER0A 1GRFA 2WPCA 3Q6JA 2WDVA 3CN8A 5IPYA 1FEBA 2R4JA 1PDHA 1MOKA 1D4DA 3Q9TA 5GSNA 2A89A 4JY2A 3AE5A 3IHMA 4WX1A 1S3BA 5FMHA 4ADWA 2XVFA 4YSZA 3NN6X 1NEKA 1S2QA 2C76A 2BS3A 3F8PA 3QFAA 3UKHA 2DKHA 3DJJA 2BCGG 4B66A 3PO7A 4K5SA 3RP7A 3GWFA 5DBJA 3NKSA 3L1RA 3FG2P 2BACA 3R9UA 4PABA 2R4EA 4CNJA 1XDIA 3AEDA 2F5ZA 1GETA 3QFBA 1LQUA 3BI5A 2R0CA 3AEEA 2R46A 4YXDA 4U8OA 4EMJA 3FMWA 3RP6A 2QA1A 1SEZA 5L46A 2IVDA 1FL2A 3OC4A 4UDRA 3K30A 2YLZA 3FPZA 5JCKA 1EBDA 4A99A 4AP1A 2QCUA 4C3YA 2BCPA 1V59A 2CVJA 1GREA 1PS9A 2GH5A 2XVIA 2GV8A 2WESA 2BC0A 1Q9IA 3CGDA 4J33A 3AD9B 5FS9A 4GR1A 1TDFA 1H7XA 4OPGA 3NTDA 1FCDA 1JNZA 3LZWA 1ONFA 1ZMCA 3AE7A 1LVLA 2Q6UA 4CCQA 2YQUA 3B3RA 3BNMA 2ACZA 4H2PA 3LB8A 4KPRA 1IUXA 4OCGA 3UTFA 4A5LA 4LA1A 3UOVA 3UP5A 1GPEA 3ZDNA 5EBKA 2GQFA 3P4QA 2V6OA 3ICTA 3VRAA 3DJGX 2JBVA 5IQ4A 3CGCA 1K0JA 4U2SA 3VRBA 2OALA 2GMHA 2E1MA 2YVFA 1OJDA 1ZK7A 3H8IA 2PYXA 3NT6A 4H4QA 3UKLA 3ATRA 4H4VA 4ZCCA 3UTHA 1DOBA 1DJNA 4HA6A 1IUUA 1YQ4A 1OJTA 3LXDA 1D4EA 3DK8A 3AE4A 2YLXA 1E39A 2XLRA 2GB0A 2NPXA 1BF3A 2WP5A 4EIQA 1H81A 2FJBA 5JCMA 1JEHA 1YQ3A 1PBBA 2XVHA 2DKIA 1REOA 1KFYA 2VVMA 2ZZCA 1P2EA 2RGHA 1FEAA 4KX6A 4B64A 4OPUA 4EQRA 1VG0A 1XPQA 5FS7A 2XLUA 3HZLA 4H2RA 3ALJA 4TLXA 2X8HA 4C74A 5FS8A 2WDRA 3H4KA 2GR3A 3DK9A 4U2LA 1JNRA 3P4SA 1B8SA 3DJDA 3GYIA 3GD4A 4MJWA 4U8KA 1N1PA 1CJ3A 1MXTA 2XVJA 3QVRA 1E1KA 4H2QA 1KNRA 1LV0A 2B9WA 3AE2A 1DOEA 3NH3X 3DGZA 4AT0A 1E1MA 1OJ9A 4Z24A 4YKFA 1NHRA 1LJ1A 3GDPA 1CJ4A 1E7PA 2YG5A 1RYIA 1PXBA 2C72A 3C4NA 3AD7B 3COXA 4EM3A 2WP6A 2GR0A 5LV9A 4I59A 3AXBA 1NG4A 2JK6A 4B68A 3T37A 3BI2A 4EMWA 4NTDA 4BK2A 2EQ7A 3REDA 2X99A 1P2HA 1HYUA 4AT2A 2C66A 5TR3A 4HB9A 1LTXR 2VVLG 1D5TA 3P4RA 3EANA 1AOGA 3NK0X 5U63A 1GESA 1YKJA 2WQYA 2X50A 2V3AA 1TYPA 3KKJA 3CNSA 1GRGA 2C75A 1TDOA 2JKCA 4FX9A 4REKA 4K8DA 2BXRA 1GTHA 4O5QA 1H84A 3QSEA 3ATQA 1M64A 4U2TA 1B37A 2WU5A 2XFQA 2ZZ0A 4IA6A 5BULA 5KWFA 3URHA 2TPRA 2YAUA 3NTAA 2Y6RA 4TM3A 3F8RA 1JRYA 2I0ZA 4GCMA 4OPDA 2XYOA 5KVHA 2GAGB 4H4RA 4DSHA 3NN0X 2J3NA 4M52A 1JRXA 1PBFA 4K22A 2C64A 2RGJA 3D8XA 5CKUA 1OJCA 2JB1A 2XFPA 3CTYA 3ICSA 3NNEA 1QJDA 1Y56B 3G5SA 3M0OA 3LJPA 3NLCA 4U8IA 3DJEA 1EL8A 1GALA 1JRZA 1OJAA 2WEUA 3P9UA 4GF7A 3DH9A 4UDQA 2C7GA 4TM4A 2NVKX 2YR6A 4WCTA 4C77A 3CIRA 1FOHA 4X9NA 5EB4A 1X31B 1Z6LA 3DK4A 3AE8A 3FIMB 4EQXA 3NIXA 4DNAA 2E5VA 3UKPA 1BKWA 4ZCDA 2X8CA 4EIPA 4H4YA 2RGOA 5J7XA 3LZXA 1K4QA 3V3OA 3ZYXA 4Z25A 3C4AA 2VQBA 3NRNA 4ECHA 1CHUA 3CPJG 2YLSA 1GRHA 3II4A 5CQFA 2YLWA 1VG9A 2BABA 3KLJA 1RP0A 2B9XA 4U8MA 1TYTA 1Q1RA 2JAEA 4GDPA 4BJZA 1QO8A 4Z44A 2XLTA 4OVIA 1B4VA 2WOIA 3UTEA 5C3JA 2BA9A 3KD9A 3IWAA 5HHFA 2YM2A 2CDUA 5EOWA 2BK4A 2Y6QA 2B76A 1N4UA 4LU6A 1E6EA
chains in the Genus database with same CATH superfamily
3KVEA 2JB2A 1ZX9A 3UTGA 2WPEA 3CNJA 2XDOA 3EAOA 2C3DA 5J60A 1GRAA 1H7WA 4NTCA 3RHAA 1O5WA 4CCRA 2C70A 1BWCA 3ALMA 4H4TA 2FJAA 3ISHA 1KDGA 3T0KA 2W0HA 4USQA 1M6IA 1NENA 2XLPA 3PVCA 2BK5A 3DMEA 4JNAA 3D1CA 2R0PA 1L9DA 3NG7X 4YKGA 4FK1C 3GYXA 4U8LA 4EMIA 2C67A 4BURA 3PS9A 2YR4A 1DJQA 2GR1A 3GSIA 3CNDA 2QA2A 4H4SA 5BUKA 2HQMA 3IHGA 3UOYA 3T31A 1TDNA 1N4VA 4GUVA 4DSGA 4Z26A 2FBWA 4TM1A 4K5RA 4NTEA 2IIDA 2XLSA 1F8RA 4J36A 4JY3A 1PJ7A 2VVLA 1IJHA 2EQ6A 1H83A 4Z43A 2WOWA 3SZ0A 2BXSA 1NPXA 1CC2A 1GERA 2GEWA 3ALLA 3BHKA 2Q7VA 2BYBA 4J56A 3T2ZA 1GNDA 2YVGA 1ZKQA 2C3CA 2ZZBA 1GV4A 1TDEA 1XANA 3CPHG 3VR8A 3UOZA 2WPFA 4GDEA 3UKFA 4Z2RA 4A65A 4YT0A 2V5ZA 5KMPA 4Z2TA 1GOSA 2JB3A 1NHQA 2Z5XA 1GRBA 3SXIA 4USRA 1D7YA 4H4PA 4BK1A 1IUWA 1TRBA 3ICRA 5KMSA 3AYJA 1PXAA 1DNCA 2Q0KA 3QSSA 3AEGA 3ITJA 3UP4A 5KRQA 2TMDA 4B67A 2WP9A 2UZZA 4GAPA 1KSSA 1TDKA 2PHHA 3QVPA 2XCGA 5JCIA 1EL9A 3GWDA 2X3NA 3CNTA 4JQ9A 1S3EA 2ARDA 4BV6A 2GVCA 4YSHA 5KXJA 1NDAA 2A8XA 1N4WA 2IVEA 4UDPA 3EPTA 4NEWA 1ZP0A 3RNMA 4RG4A 4D03A 2YG6A 1S2YA 4IA5A 2VOUA 3ADAB 2YR5A 4K2XA 2WS3A 2B9YA 1Y0PA 4Y4MA 4LIIA 1O95A 5KNLA 3SFEA 1F8WA 2WETA 1ZOVA 5IQ1A 4E0VA 4NZHA 3WE0A 3G5QA 1JU2A 4FDCB 1F6MA 2OA1A 1L0VA 2YG4A 3HYVA 5HXIA 2H89A 2YLRA 1NHPA 3B6DA 1KNPA 1KSUA 4XXGA 3IF9A 3AYLA 1EL5A 3BI4A 3KPFA 4JDRA 5EB5A 3AE9A 2YM1A 4XWRA 3SQPA 3K7QX 4B1BA 3GD3A 1IUSA 3ABVA 3LOVA 3I6DA 4B69A 1BZLA 2XFOA 3JSKA 3NYCA 4OPCA 2B7RA 5HYMA 1D4CA 1H82A 1ZMDA 2ZBWA 3BNUA 1NG3A 1PN0A 1IUVA 4YTPA 2OAMA 4U8NA 4NWZA 5JCNA 4AOXA 1KF6A 3E1TA 5U25A 4DGKA 2WHDA 2XFNA 5C2TA 2GF3A 3CNPA 4YWOA 5M10A 4JNQA 2C73A 4Y4NA 3AD8B 1F8SA 4PAAA 4OPTA 4B65A 5BVAA 4C3XA 1K0IA 1Q1WA 1GXFA 3SZWA 5KVIA 3VQRA 1W4XA 3T14A 1Y56A 3SFDA 2YG7A 3RP8A 3S5WA 3GRTA 3CMMA 1PBCA 1L9CA 3AECA 3DGHA 2APGA 1GTEA 3H8LA 5KMQA 2YG3A 3T2YA 4B63A 3F8DA 3T2KA 3CGEA 5FS6A 3UKAA 4ICYA 4XWZA 4YTNA 3AEFA 2R45A 1ZY8A 4BJYA 3UCLA 2R0GA 3NK1X 3AE3A 3HYWA 1GT8A 1ZOYA 3KA7A 4BK3A 4A9WA 4Y4LA 1FECA 4GRTA 2O9ZA 2WBAA 3G5RA 1CL0A 2GQWA 4H4ZA 1CJCA 1F3PA 3K7TA 2GMJA 4AP3A 1H6VA 3AE1A 1QLBA 1NAAA 3NGCX 3V3NA 1MO9A 3AEAA 3SZCA 4H50A 2A87A 4IV9A 3I3LA 1PJ6A 4CY6A 1YQZA 4K7ZA 2CULA 3S61A 3NHOX 2XVEA 3NYEA 4X9MA 3UOXA 1DOCA 1O94A 3M12A 4RSLA 2Z5YA 4FK1A 2V60A 5M0ZA 4APNA 2FJDA 2FJEA 3AB1A 2YWLA 2GAHB 3IC9A 3NK2X 4H7UA 2AR8A 1JOAA 4N9XA 2WOVA 1L9EA 3EF6A 2OLNA 4IVMB 1GRTA 2EQ9A 2QAEA 2AQJA 3P1WA 4GAVA 3GMCA 1VDCA 3AYIA 1H86A 4J34A 4NEVA 3UKKA 4A6NB 1PHHA 3AE6A 3UKQA 3FBSA 4C5OA 4YSXA 4ZN0A 2VQ7A 4U8JA 1EL7A 3NYFA 3SY4A 4J57A 2V3BA 4H4UA 1RSGA 3O0HA 1K0LA 2C65A 4II3A 5JCLA 3BHFA 4CNKA 4CY8A 2CFYA 3K7MX 4H4XA 4CRTA 5BRTA 4P9SA 3L8KA 4IVOB 5U1OA 4A6NA 1CC4A 3M13A 1CC6A 4O5UA 2X8GA 4EM4A 2BS2A 3KU9A 2VZ2A 4TM0A 4I58A 4YTMA 3GYJA 4YSYA 1D7LA 1PBEA 2RABA 2XFUA 3AWIA 4X4JA 4J31A 1IUTA 1ZDLA 3GMBA 3SM8A 3V76A 2EQ8A 4U8PA 2E4GA 1PJ5A 1VQWA 2VRLA 3OZ2A 3P4PA 4CBQA 4D04A 1CF3A 2AAQA 1BGNA 1GSNA 4AOSA 1LPFA 1E1LA 1BGJA 2WDQA 3AEBA 4A79A 2BC1A 1CBOA 4J2WA 2BK3A 4OPIA 3VRDB 4Z2UA 1B5QA 1CJ2A 3GRSA 1PXCA 2OLOA 2V61A 4H4WA 5KOWA 1E1NA 4JN9A 2GRTA 2BS4A 1XHCA 2R9ZA 1PBDA 1GEUA 3QSMA 2WU2A 4TLZA 2H88A 2GR2A 1NHSA 1UKVG 2B7SA 2Q0LA 5GRTA 4RG3A 2VRMA 1DXLA 1YY5A 3DA1A 4UP3A 1ELIA 1VRQB 3CPIG 3C96A 4EQSA 1DODA 1LQTA 3QJ4A 1COYA 3LADA 3CGBA 5KOXA 3VR9A 2YLTA 2YVJA 4A7AA 4H2NA 5HY5A 4OPLA 3SGLA 2BRYA 4EQWA 3GDNA 5ER0A 1GRFA 2WPCA 3Q6JA 2WDVA 3CN8A 5IPYA 1FEBA 2R4JA 1PDHA 1MOKA 1D4DA 3Q9TA 5GSNA 2A89A 4JY2A 3AE5A 3IHMA 4WX1A 1S3BA 5FMHA 4ADWA 2XVFA 4YSZA 3NN6X 1NEKA 1S2QA 2C76A 2BS3A 3F8PA 3QFAA 3UKHA 2DKHA 3DJJA 2BCGG 4B66A 3PO7A 4K5SA 3RP7A 3GWFA 5DBJA 3NKSA 3L1RA 3FG2P 2BACA 3R9UA 4PABA 2R4EA 4CNJA 1XDIA 3AEDA 2F5ZA 1GETA 3QFBA 1LQUA 3BI5A 2R0CA 3AEEA 2R46A 4YXDA 4U8OA 4EMJA 3FMWA 3RP6A 2C4CA 2QA1A 1SEZA 5L46A 2IVDA 1FL2A 3OC4A 4UDRA 3K30A 2YLZA 3FPZA 5JCKA 1EBDA 4A99A 4AP1A 2QCUA 4C3YA 2BCPA 1V59A 2CVJA 1GREA 1PS9A 2GH5A 2XVIA 3SYIA 2GV8A 2WESA 2BC0A 1Q9IA 3CGDA 4J33A 3AD9B 5FS9A 4GR1A 1TDFA 1H7XA 4OPGA 3NTDA 1FCDA 1JNZA 3LZWA 1ONFA 1ZMCA 3AE7A 1LVLA 2Q6UA 4CCQA 2YQUA 3B3RA 3BNMA 2ACZA 4H2PA 3LB8A 4KPRA 1IUXA 4OCGA 3UTFA 4A5LA 4LA1A 3UOVA 3UP5A 1GPEA 3ZDNA 5EBKA 2GQFA 3P4QA 2V6OA 3ICTA 3VRAA 3DJGX 2JBVA 5IQ4A 3CGCA 1K0JA 4U2SA 3VRBA 2OALA 2GMHA 2E1MA 2YVFA 1OJDA 1ZK7A 3H8IA 2PYXA 3NT6A 4H4QA 3UKLA 3ATRA 4H4VA 4ZCCA 3UTHA 1DOBA 1DJNA 4HA6A 1IUUA 1YQ4A 1OJTA 3LXDA 1D4EA 3DK8A 3AE4A 2YLXA 1E39A 2XLRA 2GB0A 2NPXA 4G6HA 1BF3A 2WP5A 4EIQA 1H81A 2FJBA 5JCMA 1JEHA 1YQ3A 1PBBA 2XVHA 2DKIA 1REOA 1KFYA 2VVMA 2ZZCA 1P2EA 2RGHA 1FEAA 4KX6A 4B64A 4OPUA 4EQRA 1VG0A 3KPKA 1XPQA 5FS7A 2XLUA 3SX6A 4G6GA 3HZLA 4H2RA 3ALJA 4TLXA 2X8HA 4C74A 5FS8A 2WDRA 3H4KA 2GR3A 3DK9A 4U2LA 1JNRA 3P4SA 1B8SA 3DJDA 3GYIA 3GD4A 4MJWA 4U8KA 1N1PA 1CJ3A 1MXTA 2XVJA 3QVRA 1E1KA 4H2QA 4II2A 1KNRA 1LV0A 2B9WA 3AE2A 4G73A 1DOEA 3NH3X 3DGZA 4AT0A 1E1MA 1OJ9A 4Z24A 4YKFA 1NHRA 1LJ1A 3GDPA 1CJ4A 1E7PA 2YG5A 1RYIA 1PXBA 2C72A 3C4NA 3AD7B 3COXA 4EM3A 2WP6A 2GR0A 5LV9A 4I59A 3AXBA 1NG4A 2JK6A 4B68A 3T37A 3BI2A 4EMWA 4NTDA 4BK2A 2EQ7A 3REDA 2X99A 1P2HA 1HYUA 4AT2A 2C66A 5TR3A 4HB9A 1LTXR 2VVLG 1D5TA 3P4RA 3EANA 1AOGA 3NK0X 5U63A 1GESA 1YKJA 2WQYA 2X50A 2V3AA 1TYPA 3KKJA 3CNSA 5KMRA 1GRGA 2C75A 1TDOA 2JKCA 4FX9A 4REKA 4K8DA 2BXRA 1GTHA 4O5QA 1H84A 3QSEA 4NNJA 3ATQA 1M64A 4U2TA 1B37A 2WU5A 2XFQA 2ZZ0A 4IA6A 5BULA 5KWFA 4G74A 3URHA 2TPRA 2YAUA 3NTAA 2Y6RA 4TM3A 3HYXA 3F8RA 1JRYA 2I0ZA 4GCMA 4OPDA 2XYOA 5KVHA 2GAGB 4H4RA 4DSHA 3NN0X 2J3NA 4M52A 1JRXA 1PBFA 4K22A 2C64A 2BRAA 2RGJA 3D8XA 5CKUA 1OJCA 2JB1A 2XFPA 3CTYA 3ICSA 3NNEA 1QJDA 1Y56B 3G5SA 3M0OA 3LJPA 3NLCA 4U8IA 3DJEA 1EL8A 1GALA 1JRZA 1OJAA 2WEUA 3P9UA 4GF7A 3DH9A 4UDQA 2C7GA 4TM4A 2NVKX 2YR6A 4WCTA 4C77A 3CIRA 1FOHA 4X9NA 5EB4A 1X31B 1Z6LA 3DK4A 3AE8A 3FIMB 4EQXA 3SZFA 3NIXA 4DNAA 2E5VA 3UKPA 1BKWA 4ZCDA 2X8CA 4EIPA 4H4YA 2RGOA 5J7XA 3LZXA 1K4QA 3V3OA 3ZYXA 4Z25A 3C4AA 2VQBA 3NRNA 4ECHA 1CHUA 3CPJG 2YLSA 1GRHA 3II4A 5CQFA 2YLWA 1VG9A 2BABA 3KLJA 1RP0A 2B9XA 4U8MA 4G9KA 1TYTA 1Q1RA 2JAEA 4GDPA 4BJZA 1QO8A 4Z44A 2XLTA 4OVIA 1B4VA 2WOIA 3UTEA 5C3JA 2BA9A 3KD9A 3IWAA 5HHFA 2YM2A 2CDUA 5EOWA 2BK4A 2Y6QA 2B76A 1N4UA 4LU6A 1E6EA
chains in the Genus database with same CATH topology
3KVEA 2JB2A 1ZX9A 3UTGA 2WPEA 3CNJA 2XDOA 3EAOA 2C3DA 5J60A 1GRAA 1H7WA 4NTCA 3RHAA 1O5WA 4CCRA 2C70A 1BWCA 3ALMA 4H4TA 2FJAA 3ISHA 1KDGA 3T0KA 2W0HA 4USQA 1M6IA 1NENA 2XLPA 3PVCA 2BK5A 3DMEA 4JNAA 3D1CA 2R0PA 1L9DA 3NG7X 4YKGA 4FK1C 3GYXA 4U8LA 4EMIA 2C67A 4BURA 3PS9A 2YR4A 1DJQA 2GR1A 3GSIA 3CNDA 2QA2A 4H4SA 5BUKA 2HQMA 3IHGA 3UOYA 3T31A 1TDNA 1N4VA 4GUVA 4DSGA 4Z26A 2FBWA 4TM1A 4K5RA 4NTEA 2IIDA 2XLSA 1F8RA 4J36A 4JY3A 1PJ7A 2VVLA 1IJHA 2EQ6A 1H83A 4Z43A 2WOWA 3SZ0A 2BXSA 1NPXA 1CC2A 1GERA 2GEWA 3ALLA 3BHKA 2Q7VA 2BYBA 4J56A 3T2ZA 1GNDA 2YVGA 1ZKQA 2C3CA 2ZZBA 1GV4A 1TDEA 1XANA 3CPHG 3VR8A 3UOZA 2WPFA 4GDEA 3UKFA 4Z2RA 4A65A 4YT0A 2V5ZA 5KMPA 4Z2TA 1GOSA 2JB3A 1NHQA 2Z5XA 1GRBA 3SXIA 4USRA 1D7YA 4H4PA 4BK1A 1IUWA 1TRBA 3ICRA 5KMSA 3AYJA 1PXAA 1DNCA 2Q0KA 3QSSA 3AEGA 3ITJA 3UP4A 5KRQA 2TMDA 4B67A 2WP9A 2UZZA 4GAPA 1KSSA 1TDKA 2PHHA 3QVPA 2XCGA 5JCIA 1EL9A 3GWDA 2X3NA 3CNTA 4JQ9A 1S3EA 2ARDA 4BV6A 2GVCA 4YSHA 5KXJA 1NDAA 2A8XA 1N4WA 2IVEA 4UDPA 3EPTA 4NEWA 1ZP0A 3RNMA 4RG4A 4D03A 2YG6A 1S2YA 4IA5A 2VOUA 3ADAB 2YR5A 4K2XA 2WS3A 2B9YA 1Y0PA 4Y4MA 4LIIA 1O95A 5KNLA 3SFEA 1F8WA 2WETA 1ZOVA 5IQ1A 4E0VA 4NZHA 3WE0A 3G5QA 1JU2A 4FDCB 1F6MA 2OA1A 1L0VA 2YG4A 3HYVA 5HXIA 2H89A 2YLRA 1NHPA 3B6DA 1KNPA 1KSUA 4XXGA 3IF9A 3AYLA 1EL5A 3BI4A 3KPFA 4JDRA 5EB5A 3AE9A 2YM1A 4XWRA 3SQPA 3K7QX 4B1BA 3GD3A 1IUSA 3ABVA 3LOVA 3I6DA 4B69A 1BZLA 2XFOA 3JSKA 3NYCA 4OPCA 2B7RA 5HYMA 1D4CA 1H82A 1ZMDA 2ZBWA 3BNUA 1NG3A 1PN0A 1IUVA 4YTPA 2OAMA 4U8NA 4NWZA 5JCNA 4AOXA 1KF6A 3E1TA 5U25A 4DGKA 2WHDA 2XFNA 5C2TA 2GF3A 3CNPA 4YWOA 5M10A 4JNQA 2C73A 4Y4NA 3AD8B 1F8SA 4PAAA 4OPTA 4B65A 5BVAA 4C3XA 1K0IA 1Q1WA 1GXFA 3SZWA 5KVIA 3VQRA 1W4XA 3T14A 1Y56A 3SFDA 2YG7A 3RP8A 3S5WA 3GRTA 3CMMA 1PBCA 1L9CA 3AECA 3DGHA 2APGA 1GTEA 3H8LA 5KMQA 2YG3A 3T2YA 4B63A 3F8DA 3T2KA 3CGEA 5FS6A 3UKAA 4ICYA 4XWZA 4YTNA 3AEFA 2R45A 1ZY8A 4BJYA 3UCLA 2R0GA 3NK1X 3AE3A 3HYWA 1GT8A 1ZOYA 3KA7A 4BK3A 4A9WA 4Y4LA 1FECA 4GRTA 2O9ZA 2WBAA 3G5RA 1CL0A 2GQWA 4H4ZA 1CJCA 1F3PA 3K7TA 2GMJA 4AP3A 1H6VA 3AE1A 1QLBA 1NAAA 3NGCX 3V3NA 1MO9A 3AEAA 3SZCA 4H50A 2A87A 4IV9A 3I3LA 1PJ6A 4CY6A 1YQZA 4K7ZA 2CULA 3S61A 3NHOX 2XVEA 3NYEA 4X9MA 3UOXA 1DOCA 1O94A 3M12A 4RSLA 2Z5YA 4FK1A 2V60A 5M0ZA 4APNA 2FJDA 2FJEA 3AB1A 2YWLA 2GAHB 3IC9A 3NK2X 4H7UA 2AR8A 1JOAA 4N9XA 2WOVA 1L9EA 3EF6A 2OLNA 4IVMB 1GRTA 2EQ9A 2QAEA 2AQJA 3P1WA 4GAVA 3GMCA 1VDCA 3AYIA 1H86A 4J34A 4NEVA 3UKKA 4A6NB 1PHHA 3AE6A 3UKQA 3FBSA 4C5OA 4YSXA 4ZN0A 2VQ7A 4U8JA 1EL7A 3NYFA 3SY4A 4J57A 2V3BA 4H4UA 1RSGA 3O0HA 1K0LA 2C65A 4II3A 5JCLA 3BHFA 4CNKA 4CY8A 2CFYA 3K7MX 4H4XA 4CRTA 5BRTA 4P9SA 3L8KA 4IVOB 5U1OA 4A6NA 1CC4A 3M13A 1CC6A 4O5UA 2X8GA 4EM4A 2BS2A 3KU9A 2VZ2A 4TM0A 4I58A 4YTMA 3GYJA 4YSYA 1D7LA 1PBEA 2RABA 2XFUA 3AWIA 4X4JA 4J31A 1IUTA 1ZDLA 3GMBA 3SM8A 3V76A 2EQ8A 4U8PA 2E4GA 1PJ5A 1VQWA 2VRLA 3OZ2A 3P4PA 4CBQA 4D04A 1CF3A 2AAQA 1BGNA 1GSNA 4AOSA 1LPFA 1E1LA 1BGJA 2WDQA 3AEBA 4A79A 2BC1A 1CBOA 4J2WA 2BK3A 4OPIA 3VRDB 4Z2UA 1B5QA 1CJ2A 3GRSA 1PXCA 2OLOA 2V61A 4H4WA 5KOWA 1E1NA 4JN9A 2GRTA 2BS4A 1XHCA 2R9ZA 1PBDA 1GEUA 3QSMA 2WU2A 4TLZA 2H88A 2GR2A 1NHSA 1UKVG 2B7SA 2Q0LA 5GRTA 4RG3A 2VRMA 1DXLA 1YY5A 3DA1A 4UP3A 1ELIA 1VRQB 3CPIG 3C96A 4EQSA 1DODA 1LQTA 3QJ4A 1COYA 3LADA 3CGBA 5KOXA 3VR9A 2YLTA 2YVJA 4A7AA 4H2NA 5HY5A 4OPLA 3SGLA 2BRYA 4EQWA 3GDNA 5ER0A 1GRFA 2WPCA 3Q6JA 2WDVA 3CN8A 5IPYA 1FEBA 2R4JA 1PDHA 1MOKA 1D4DA 3Q9TA 5GSNA 2A89A 4JY2A 3AE5A 3IHMA 4WX1A 1S3BA 5FMHA 4ADWA 2XVFA 4YSZA 3NN6X 1NEKA 1S2QA 2C76A 2BS3A 3F8PA 3QFAA 3UKHA 2DKHA 3DJJA 2BCGG 4B66A 3PO7A 4K5SA 3RP7A 3GWFA 5DBJA 3NKSA 3L1RA 3FG2P 2BACA 3R9UA 4PABA 2R4EA 4CNJA 1XDIA 3AEDA 2F5ZA 1GETA 3QFBA 1LQUA 3BI5A 2R0CA 3AEEA 2R46A 4YXDA 4U8OA 4EMJA 3FMWA 3RP6A 2C4CA 2QA1A 1SEZA 5L46A 2IVDA 1FL2A 3OC4A 4UDRA 3K30A 2YLZA 3FPZA 5JCKA 1EBDA 4A99A 4AP1A 2QCUA 4C3YA 2BCPA 1V59A 2CVJA 1GREA 1PS9A 2GH5A 2XVIA 3SYIA 2GV8A 2WESA 2BC0A 1Q9IA 3CGDA 4J33A 3AD9B 5FS9A 4GR1A 1TDFA 1H7XA 4OPGA 3NTDA 1FCDA 1JNZA 3LZWA 1ONFA 1ZMCA 3AE7A 1LVLA 2Q6UA 4CCQA 2YQUA 3B3RA 3BNMA 2ACZA 4H2PA 3LB8A 4KPRA 1IUXA 4OCGA 3UTFA 4A5LA 4LA1A 3UOVA 3UP5A 1GPEA 3ZDNA 5EBKA 2GQFA 3P4QA 2V6OA 3ICTA 3VRAA 3DJGX 2JBVA 5IQ4A 3CGCA 1K0JA 4U2SA 3VRBA 2OALA 2GMHA 2E1MA 2YVFA 1OJDA 1ZK7A 3H8IA 2PYXA 3NT6A 4H4QA 3UKLA 3ATRA 4H4VA 4ZCCA 3UTHA 1DOBA 1DJNA 4HA6A 1IUUA 1YQ4A 1OJTA 3LXDA 1D4EA 3DK8A 3AE4A 2YLXA 1E39A 2XLRA 2GB0A 2NPXA 4G6HA 1BF3A 2WP5A 4EIQA 1H81A 2FJBA 5JCMA 1JEHA 1YQ3A 1PBBA 2XVHA 2DKIA 1REOA 1KFYA 2VVMA 2ZZCA 1P2EA 2RGHA 1FEAA 4KX6A 4B64A 4OPUA 4EQRA 1VG0A 3KPKA 1XPQA 5FS7A 2XLUA 3SX6A 4G6GA 3HZLA 4H2RA 3ALJA 4TLXA 2X8HA 4C74A 5FS8A 2WDRA 3H4KA 2GR3A 3DK9A 4U2LA 1JNRA 3P4SA 1B8SA 3DJDA 3GYIA 3GD4A 4MJWA 4U8KA 1N1PA 1CJ3A 1MXTA 2XVJA 3QVRA 1E1KA 4H2QA 4II2A 1KNRA 1LV0A 2B9WA 3AE2A 4G73A 1DOEA 3NH3X 3DGZA 4AT0A 1E1MA 1OJ9A 4Z24A 4YKFA 1NHRA 1LJ1A 3GDPA 1CJ4A 1E7PA 2YG5A 1RYIA 1PXBA 2C72A 3C4NA 3AD7B 3COXA 4EM3A 2WP6A 2GR0A 5LV9A 4I59A 3AXBA 1NG4A 2JK6A 4B68A 3T37A 3BI2A 4EMWA 4NTDA 4BK2A 2EQ7A 3REDA 2X99A 1P2HA 1HYUA 4AT2A 2C66A 5TR3A 4HB9A 1LTXR 2VVLG 1D5TA 3P4RA 3EANA 1AOGA 3NK0X 5U63A 1GESA 1YKJA 2WQYA 2X50A 2V3AA 1TYPA 3KKJA 3CNSA 5KMRA 1GRGA 2C75A 1TDOA 2JKCA 4FX9A 4REKA 4K8DA 2BXRA 1GTHA 4O5QA 1H84A 3QSEA 4NNJA 3ATQA 1M64A 4U2TA 1B37A 2WU5A 2XFQA 2ZZ0A 4IA6A 5BULA 5KWFA 4G74A 3URHA 2TPRA 2YAUA 3NTAA 2Y6RA 4TM3A 3HYXA 3F8RA 1JRYA 2I0ZA 4GCMA 4OPDA 2XYOA 5KVHA 2GAGB 4H4RA 4DSHA 3NN0X 2J3NA 4M52A 1JRXA 1PBFA 4K22A 2C64A 2BRAA 2RGJA 3D8XA 5CKUA 1OJCA 2JB1A 2XFPA 3CTYA 3ICSA 3NNEA 1QJDA 1Y56B 3G5SA 3M0OA 3LJPA 3NLCA 4U8IA 3DJEA 1EL8A 1GALA 1JRZA 1OJAA 2WEUA 3P9UA 4GF7A 3DH9A 4UDQA 2C7GA 4TM4A 2NVKX 2YR6A 4WCTA 4C77A 3CIRA 1FOHA 4X9NA 5EB4A 1X31B 1Z6LA 3DK4A 3AE8A 3FIMB 4EQXA 3SZFA 3NIXA 4DNAA 2E5VA 3UKPA 1BKWA 4ZCDA 2X8CA 4EIPA 4H4YA 2RGOA 5J7XA 3LZXA 1K4QA 3V3OA 3ZYXA 4Z25A 3C4AA 2VQBA 3NRNA 4ECHA 1CHUA 3CPJG 2YLSA 1GRHA 3II4A 5CQFA 2YLWA 1VG9A 2BABA 3KLJA 1RP0A 2B9XA 4U8MA 4G9KA 1TYTA 1Q1RA 2JAEA 4GDPA 4BJZA 1QO8A 4Z44A 2XLTA 4OVIA 1B4VA 2WOIA 3UTEA 5C3JA 2BA9A 3KD9A 3IWAA 5HHFA 2YM2A 2CDUA 5EOWA 2BK4A 2Y6QA 2B76A 1N4UA 4LU6A 1E6EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KVE A;  2JB2 A;  1ZX9 A;  3UTG A;  2WPE A;  3CNJ A;  2XDO A;  3EAO A;  2C3D A;  5J60 A;  1GRA A;  1H7W A;  4NTC A;  3RHA A;  1O5W A;  4CCR A;  2C70 A;  1BWC A;  3ALM A;  4H4T A;  2FJA A;  3ISH A;  1KDG A;  2W0H A;  4USQ A;  1M6I A;  1NEN A;  2XLP A;  3PVC A;  2BK5 A;  3DME A;  4JNA A;  3D1C A;  2R0P A;  1L9D A;  3NG7 X;  4YKG A;  4FK1 C;  4U8L A;  4EMI A;  2C67 A;  4BUR A;  3PS9 A;  2YR4 A;  1DJQ A;  2GR1 A;  3GSI A;  3CND A;  2QA2 A;  4H4S A;  5BUK A;  2HQM A;  3IHG A;  3UOY A;  1TDN A;  1N4V A;  4GUV A;  4DSG A;  4Z26 A;  2FBW A;  4TM1 A;  4K5R A;  4NTE A;  2IID A;  2XLS A;  1F8R A;  4J36 A;  4JY3 A;  1PJ7 A;  2VVL A;  1IJH A;  2EQ6 A;  1H83 A;  4Z43 A;  2WOW A;  2BXS A;  1NPX A;  1CC2 A;  1GER A;  2GEW A;  3ALL A;  3BHK A;  2Q7V A;  2BYB A;  4J56 A;  1GND A;  2YVG A;  1ZKQ A;  2C3C A;  2ZZB A;  1GV4 A;  1TDE A;  1XAN A;  3CPH G;  3VR8 A;  3UOZ A;  2WPF A;  4GDE A;  3UKF A;  4Z2R A;  4A65 A;  4YT0 A;  2V5Z A;  4Z2T A;  1GOS A;  2JB3 A;  1NHQ A;  2Z5X A;  1GRB A;  4USR A;  1D7Y A;  4H4P A;  4BK1 A;  1IUW A;  1TRB A;  3ICR A;  3AYJ A;  1PXA A;  1DNC A;  2Q0K A;  3QSS A;  3AEG A;  3ITJ A;  3UP4 A;  5KRQ A;  2TMD A;  4B67 A;  2WP9 A;  2UZZ A;  1KSS A;  1TDK A;  2PHH A;  3QVP A;  2XCG A;  5JCI A;  1EL9 A;  3GWD A;  2X3N A;  3CNT A;  4JQ9 A;  1S3E A;  2ARD A;  4BV6 A;  2GVC A;  4YSH A;  5KXJ A;  1NDA A;  2A8X A;  1N4W A;  2IVE A;  4UDP A;  3EPT A;  4NEW A;  1ZP0 A;  3RNM A;  4RG4 A;  4D03 A;  2YG6 A;  1S2Y A;  4IA5 A;  2VOU A;  3ADA B;  2YR5 A;  4K2X A;  2WS3 A;  2B9Y A;  1Y0P A;  4Y4M A;  4LII A;  1O95 A;  3SFE A;  1F8W A;  2WET A;  1ZOV A;  5IQ1 A;  4E0V A;  4NZH A;  3WE0 A;  3G5Q A;  1JU2 A;  4FDC B;  1F6M A;  2OA1 A;  1L0V A;  2YG4 A;  5HXI A;  2H89 A;  2YLR A;  1NHP A;  3B6D A;  1KNP A;  1KSU A;  4XXG A;  3IF9 A;  3AYL A;  1EL5 A;  3BI4 A;  3KPF A;  4JDR A;  5EB5 A;  3AE9 A;  2YM1 A;  4XWR A;  3SQP A;  3K7Q X;  4B1B A;  3GD3 A;  1IUS A;  3ABV A;  3LOV A;  3I6D A;  4B69 A;  1BZL A;  2XFO A;  3JSK A;  3NYC A;  4OPC A;  2B7R A;  5HYM A;  1D4C A;  1H82 A;  1ZMD A;  2ZBW A;  3BNU A;  1NG3 A;  1PN0 A;  1IUV A;  4YTP A;  2OAM A;  4U8N A;  5JCN A;  4AOX A;  1KF6 A;  3E1T A;  5U25 A;  4DGK A;  2WHD A;  2XFN A;  5C2T A;  2GF3 A;  3CNP A;  4YWO A;  5M10 A;  4JNQ A;  2C73 A;  4Y4N A;  3AD8 B;  1F8S A;  4PAA A;  4OPT A;  4B65 A;  5BVA A;  4C3X A;  1K0I A;  1Q1W A;  1GXF A;  5KVI A;  3VQR A;  1W4X A;  1Y56 A;  3SFD A;  2YG7 A;  3RP8 A;  3S5W A;  3GRT A;  1PBC A;  1L9C A;  3AEC A;  3DGH A;  2APG A;  1GTE A;  3H8L A;  2YG3 A;  4B63 A;  3F8D A;  3CGE A;  5FS6 A;  3UKA A;  4ICY A;  4XWZ A;  4YTN A;  3AEF A;  2R45 A;  1ZY8 A;  4BJY A;  3UCL A;  2R0G A;  3NK1 X;  3AE3 A;  4BK3 A;  1GT8 A;  1ZOY A;  3KA7 A;  4A9W A;  4Y4L A;  1FEC A;  4GRT A;  2O9Z A;  2WBA A;  3G5R A;  1CL0 A;  2GQW A;  4H4Z A;  1CJC A;  1F3P A;  3K7T A;  2GMJ A;  4AP3 A;  1H6V A;  3AE1 A;  1QLB A;  1NAA A;  3NGC X;  3V3N A;  1MO9 A;  3AEA A;  4H50 A;  2A87 A;  3I3L A;  1PJ6 A;  4CY6 A;  1YQZ A;  4K7Z A;  2CUL A;  3S61 A;  3NHO X;  2XVE A;  3NYE A;  4X9M A;  3UOX A;  1DOC A;  1O94 A;  3M12 A;  4RSL A;  2Z5Y A;  4FK1 A;  2V60 A;  5M0Z A;  4APN A;  2FJD A;  2FJE A;  3AB1 A;  2YWL A;  2GAH B;  3IC9 A;  3NK2 X;  4H7U A;  2AR8 A;  1JOA A;  4N9X A;  2WOV A;  1L9E A;  3EF6 A;  2OLN A;  4IVM B;  1GRT A;  2EQ9 A;  2QAE A;  2AQJ A;  3P1W A;  4IV9 A;  3GMC A;  1VDC A;  3AYI A;  1H86 A;  4J34 A;  4NEV A;  3UKK A;  4A6N B;  1PHH A;  3AE6 A;  3UKQ A;  3FBS A;  4C5O A;  4YSX A;  4ZN0 A;  2VQ7 A;  4U8J A;  1EL7 A;  3NYF A;  4J57 A;  2V3B A;  4H4U A;  1RSG A;  3O0H A;  1K0L A;  2C65 A;  5JCL A;  3BHF A;  4CNK A;  4CY8 A;  2CFY A;  3K7M X;  4H4X A;  4CRT A;  5BRT A;  4P9S A;  3L8K A;  4IVO B;  5U1O A;  4A6N A;  1CC4 A;  3M13 A;  1CC6 A;  4O5U A;  2X8G A;  4EM4 A;  2BS2 A;  3KU9 A;  2VZ2 A;  4TM0 A;  4I58 A;  4YTM A;  3GYJ A;  4YSY A;  1D7L A;  1PBE A;  2RAB A;  2XFU A;  3AWI A;  4X4J A;  4J31 A;  1IUT A;  1ZDL A;  3GMB A;  3SM8 A;  3V76 A;  2EQ8 A;  4U8P A;  2E4G A;  1PJ5 A;  1VQW A;  2VRL A;  3OZ2 A;  3P4P A;  4CBQ A;  4D04 A;  1CF3 A;  2AAQ A;  1BGN A;  1GSN A;  4AOS A;  1LPF A;  1E1L A;  1BGJ A;  2WDQ A;  3AEB A;  4A79 A;  2BC1 A;  1CBO A;  4J2W A;  2BK3 A;  4OPI A;  3VRD B;  4Z2U A;  1B5Q A;  1CJ2 A;  3GRS A;  1PXC A;  2OLO A;  2V61 A;  4H4W A;  5KOW A;  1E1N A;  4JN9 A;  2GRT A;  2BS4 A;  1XHC A;  2R9Z A;  1PBD A;  1GEU A;  3QSM A;  2WU2 A;  4TLZ A;  2H88 A;  2GR2 A;  1NHS A;  1UKV G;  2B7S A;  2Q0L A;  5GRT A;  4RG3 A;  2VRM A;  1DXL A;  1YY5 A;  3DA1 A;  4UP3 A;  1ELI A;  1VRQ B;  3CPI G;  3C96 A;  4EQS A;  1DOD A;  1LQT A;  3QJ4 A;  1COY A;  3LAD A;  3CGB A;  5KOX A;  3VR9 A;  2YLT A;  2YVJ A;  4A7A A;  4H2N A;  5HY5 A;  4OPL A;  3SGL A;  4EQW A;  3GDN A;  5ER0 A;  1GRF A;  2WPC A;  3Q6J A;  2WDV A;  3CN8 A;  5IPY A;  1FEB A;  2R4J A;  1PDH A;  1MOK A;  1D4D A;  3Q9T A;  5GSN A;  2A89 A;  4JY2 A;  3AE5 A;  3IHM A;  4WX1 A;  1S3B A;  5FMH A;  4ADW A;  2XVF A;  4YSZ A;  3NN6 X;  1NEK A;  1S2Q A;  2C76 A;  2BS3 A;  3F8P A;  3QFA A;  3UKH A;  2DKH A;  3DJJ A;  2BCG G;  4B66 A;  3PO7 A;  4K5S A;  3RP7 A;  3GWF A;  5DBJ A;  3NKS A;  3L1R A;  3FG2 P;  2BAC A;  3R9U A;  4PAB A;  2R4E A;  4CNJ A;  1XDI A;  3AED A;  2F5Z A;  1GET A;  3QFB A;  1LQU A;  3BI5 A;  2R0C A;  3AEE A;  2R46 A;  4YXD A;  4U8O A;  4EMJ A;  3FMW A;  3RP6 A;  2QA1 A;  1SEZ A;  5L46 A;  2IVD A;  1FL2 A;  3OC4 A;  4UDR A;  3K30 A;  2YLZ A;  3FPZ A;  5JCK A;  1EBD A;  4A99 A;  4AP1 A;  2QCU A;  4C3Y A;  2BCP A;  1V59 A;  2CVJ A;  1GRE A;  1PS9 A;  2GH5 A;  2XVI A;  2GV8 A;  2WES A;  2BC0 A;  1Q9I A;  3CGD A;  4J33 A;  3AD9 B;  5FS9 A;  4GR1 A;  1TDF A;  1H7X A;  4OPG A;  3NTD A;  1FCD A;  1JNZ A;  3LZW A;  1ONF A;  1ZMC A;  3AE7 A;  1LVL A;  2Q6U A;  4CCQ A;  2YQU A;  3B3R A;  3BNM A;  2ACZ A;  4H2P A;  3LB8 A;  4KPR A;  1IUX A;  4OCG A;  3UTF A;  4A5L A;  4LA1 A;  3UOV A;  3UP5 A;  1GPE A;  3ZDN A;  5EBK A;  2GQF A;  3P4Q A;  2V6O A;  3ICT A;  3VRA A;  3DJG X;  2JBV A;  5IQ4 A;  3CGC A;  1K0J A;  4U2S A;  3VRB A;  2OAL A;  2GMH A;  2E1M A;  2YVF A;  1OJD A;  1ZK7 A;  3H8I A;  2PYX A;  3NT6 A;  4H4Q A;  3UKL A;  3ATR A;  4H4V A;  4ZCC A;  3UTH A;  1DOB A;  1DJN A;  4HA6 A;  1IUU A;  1YQ4 A;  1OJT A;  3LXD A;  1D4E A;  3DK8 A;  3AE4 A;  2YLX A;  1E39 A;  2XLR A;  2GB0 A;  2NPX A;  1BF3 A;  2WP5 A;  4EIQ A;  1H81 A;  2FJB A;  5JCM A;  1JEH A;  1YQ3 A;  1PBB A;  2XVH A;  2DKI A;  1REO A;  1KFY A;  2VVM A;  2ZZC A;  1P2E A;  2RGH A;  1FEA A;  4KX6 A;  4B64 A;  4OPU A;  4EQR A;  1VG0 A;  1XPQ A;  5FS7 A;  2XLU A;  3HZL A;  4H2R A;  3ALJ A;  4TLX A;  2X8H A;  4C74 A;  5FS8 A;  2WDR A;  3H4K A;  2GR3 A;  3DK9 A;  4U2L A;  1JNR A;  3P4S A;  1B8S A;  3DJD A;  3GYI A;  3GD4 A;  4MJW A;  4U8K A;  1N1P A;  1CJ3 A;  1MXT A;  2XVJ A;  3QVR A;  1E1K A;  4H2Q A;  1KNR A;  1LV0 A;  2B9W A;  3AE2 A;  1DOE A;  3NH3 X;  3DGZ A;  4AT0 A;  1E1M A;  1OJ9 A;  4Z24 A;  4YKF A;  1NHR A;  1LJ1 A;  3GDP A;  1CJ4 A;  1E7P A;  2YG5 A;  1RYI A;  1PXB A;  2C72 A;  3C4N A;  3AD7 B;  3COX A;  4EM3 A;  2WP6 A;  2GR0 A;  5LV9 A;  4I59 A;  3AXB A;  1NG4 A;  2JK6 A;  4B68 A;  3T37 A;  3BI2 A;  4EMW A;  4NTD A;  4BK2 A;  2EQ7 A;  3RED A;  2X99 A;  1P2H A;  1HYU A;  4AT2 A;  2C66 A;  5TR3 A;  4HB9 A;  1LTX R;  2VVL G;  1D5T A;  3P4R A;  3EAN A;  1AOG A;  3NK0 X;  5U63 A;  1GES A;  1YKJ A;  2WQY A;  2X50 A;  2V3A A;  1TYP A;  3KKJ A;  3CNS A;  1GRG A;  2C75 A;  1TDO A;  2JKC A;  4FX9 A;  4REK A;  4K8D A;  2BXR A;  1GTH A;  4O5Q A;  1H84 A;  3QSE A;  3ATQ A;  1M64 A;  4U2T A;  1B37 A;  2WU5 A;  2XFQ A;  2ZZ0 A;  4IA6 A;  5BUL A;  5KWF A;  3URH A;  2TPR A;  2YAU A;  3NTA A;  2Y6R A;  4TM3 A;  3F8R A;  1JRY A;  2I0Z A;  4GCM A;  4OPD A;  2XYO A;  5KVH A;  2GAG B;  4H4R A;  4DSH A;  3NN0 X;  2J3N A;  4M52 A;  1JRX A;  1PBF A;  4K22 A;  2C64 A;  2RGJ A;  3D8X A;  5CKU A;  1OJC A;  2JB1 A;  2XFP A;  3CTY A;  3ICS A;  3NNE A;  1QJD A;  1Y56 B;  3G5S A;  3M0O A;  3LJP A;  3NLC A;  4U8I A;  3DJE A;  1EL8 A;  1GAL A;  1JRZ A;  1OJA A;  2WEU A;  3P9U A;  4GF7 A;  3DH9 A;  4UDQ A;  2C7G A;  4TM4 A;  2NVK X;  2YR6 A;  4WCT A;  4C77 A;  3CIR A;  1FOH A;  4X9N A;  5EB4 A;  1X31 B;  1Z6L A;  3DK4 A;  3AE8 A;  3FIM B;  4EQX A;  3NIX A;  4DNA A;  2E5V A;  3UKP A;  1BKW A;  4ZCD A;  2X8C A;  4EIP A;  4H4Y A;  2RGO A;  5J7X A;  3LZX A;  1K4Q A;  3V3O A;  3ZYX A;  4Z25 A;  3C4A A;  2VQB A;  3NRN A;  4ECH A;  1CHU A;  3CPJ G;  2YLS A;  1GRH A;  3II4 A;  5CQF A;  2YLW A;  1VG9 A;  2BAB A;  3KLJ A;  1RP0 A;  2B9X A;  4U8M A;  1TYT A;  1Q1R A;  2JAE A;  4GDP A;  4BJZ A;  1QO8 A;  4Z44 A;  2XLT A;  4OVI A;  1B4V A;  2WOI A;  3UTE A;  5C3J A;  2BA9 A;  3KD9 A;  3IWA A;  5HHF A;  2YM2 A;  2CDU A;  5EOW A;  2BK4 A;  2Y6Q A;  2B76 A;  1N4U A;  4LU6 A;  1E6E A; 
#chains in the Genus database with same CATH topology
 3KVE A;  2JB2 A;  1ZX9 A;  3UTG A;  2WPE A;  3CNJ A;  2XDO A;  3EAO A;  2C3D A;  5J60 A;  1GRA A;  1H7W A;  4NTC A;  3RHA A;  1O5W A;  4CCR A;  2C70 A;  1BWC A;  3ALM A;  4H4T A;  2FJA A;  3ISH A;  1KDG A;  3T0K A;  2W0H A;  4USQ A;  1M6I A;  1NEN A;  2XLP A;  3PVC A;  2BK5 A;  3DME A;  4JNA A;  3D1C A;  2R0P A;  1L9D A;  3NG7 X;  4YKG A;  4FK1 C;  3GYX A;  4U8L A;  4EMI A;  2C67 A;  4BUR A;  3PS9 A;  2YR4 A;  1DJQ A;  2GR1 A;  3GSI A;  3CND A;  2QA2 A;  4H4S A;  5BUK A;  2HQM A;  3IHG A;  3UOY A;  3T31 A;  1TDN A;  1N4V A;  4GUV A;  4DSG A;  4Z26 A;  2FBW A;  4TM1 A;  4K5R A;  4NTE A;  2IID A;  2XLS A;  1F8R A;  4J36 A;  4JY3 A;  1PJ7 A;  2VVL A;  1IJH A;  2EQ6 A;  1H83 A;  4Z43 A;  2WOW A;  3SZ0 A;  2BXS A;  1NPX A;  1CC2 A;  1GER A;  2GEW A;  3ALL A;  3BHK A;  2Q7V A;  2BYB A;  4J56 A;  3T2Z A;  1GND A;  2YVG A;  1ZKQ A;  2C3C A;  2ZZB A;  1GV4 A;  1TDE A;  1XAN A;  3CPH G;  3VR8 A;  3UOZ A;  2WPF A;  4GDE A;  3UKF A;  4Z2R A;  4A65 A;  4YT0 A;  2V5Z A;  5KMP A;  4Z2T A;  1GOS A;  2JB3 A;  1NHQ A;  2Z5X A;  1GRB A;  3SXI A;  4USR A;  1D7Y A;  4H4P A;  4BK1 A;  1IUW A;  1TRB A;  3ICR A;  5KMS A;  3AYJ A;  1PXA A;  1DNC A;  2Q0K A;  3QSS A;  3AEG A;  3ITJ A;  3UP4 A;  5KRQ A;  2TMD A;  4B67 A;  2WP9 A;  2UZZ A;  4GAP A;  1KSS A;  1TDK A;  2PHH A;  3QVP A;  2XCG A;  5JCI A;  1EL9 A;  3GWD A;  2X3N A;  3CNT A;  4JQ9 A;  1S3E A;  2ARD A;  4BV6 A;  2GVC A;  4YSH A;  5KXJ A;  1NDA A;  2A8X A;  1N4W A;  2IVE A;  4UDP A;  3EPT A;  4NEW A;  1ZP0 A;  3RNM A;  4RG4 A;  4D03 A;  2YG6 A;  1S2Y A;  4IA5 A;  2VOU A;  3ADA B;  2YR5 A;  4K2X A;  2WS3 A;  2B9Y A;  1Y0P A;  4Y4M A;  4LII A;  1O95 A;  5KNL A;  3SFE A;  1F8W A;  2WET A;  1ZOV A;  5IQ1 A;  4E0V A;  4NZH A;  3WE0 A;  3G5Q A;  1JU2 A;  4FDC B;  1F6M A;  2OA1 A;  1L0V A;  2YG4 A;  3HYV A;  5HXI A;  2H89 A;  2YLR A;  1NHP A;  3B6D A;  1KNP A;  1KSU A;  4XXG A;  3IF9 A;  3AYL A;  1EL5 A;  3BI4 A;  3KPF A;  4JDR A;  5EB5 A;  3AE9 A;  2YM1 A;  4XWR A;  3SQP A;  3K7Q X;  4B1B A;  3GD3 A;  1IUS A;  3ABV A;  3LOV A;  3I6D A;  4B69 A;  1BZL A;  2XFO A;  3JSK A;  3NYC A;  4OPC A;  2B7R A;  5HYM A;  1D4C A;  1H82 A;  1ZMD A;  2ZBW A;  3BNU A;  1NG3 A;  1PN0 A;  1IUV A;  4YTP A;  2OAM A;  4U8N A;  4NWZ A;  5JCN A;  4AOX A;  1KF6 A;  3E1T A;  5U25 A;  4DGK A;  2WHD A;  2XFN A;  5C2T A;  2GF3 A;  3CNP A;  4YWO A;  5M10 A;  4JNQ A;  2C73 A;  4Y4N A;  3AD8 B;  1F8S A;  4PAA A;  4OPT A;  4B65 A;  5BVA A;  4C3X A;  1K0I A;  1Q1W A;  1GXF A;  3SZW A;  5KVI A;  3VQR A;  1W4X A;  3T14 A;  1Y56 A;  3SFD A;  2YG7 A;  3RP8 A;  3S5W A;  3GRT A;  3CMM A;  1PBC A;  1L9C A;  3AEC A;  3DGH A;  2APG A;  1GTE A;  3H8L A;  5KMQ A;  2YG3 A;  3T2Y A;  4B63 A;  3F8D A;  3T2K A;  3CGE A;  5FS6 A;  3UKA A;  4ICY A;  4XWZ A;  4YTN A;  3AEF A;  2R45 A;  1ZY8 A;  4BJY A;  3UCL A;  2R0G A;  3NK1 X;  3AE3 A;  3HYW A;  1GT8 A;  1ZOY A;  3KA7 A;  4BK3 A;  4A9W A;  4Y4L A;  1FEC A;  4GRT A;  2O9Z A;  2WBA A;  3G5R A;  1CL0 A;  2GQW A;  4H4Z A;  1CJC A;  1F3P A;  3K7T A;  2GMJ A;  4AP3 A;  1H6V A;  3AE1 A;  1QLB A;  1NAA A;  3NGC X;  3V3N A;  1MO9 A;  3AEA A;  3SZC A;  4H50 A;  2A87 A;  4IV9 A;  3I3L A;  1PJ6 A;  4CY6 A;  1YQZ A;  4K7Z A;  2CUL A;  3S61 A;  3NHO X;  2XVE A;  3NYE A;  4X9M A;  3UOX A;  1DOC A;  1O94 A;  3M12 A;  4RSL A;  2Z5Y A;  4FK1 A;  2V60 A;  5M0Z A;  4APN A;  2FJD A;  2FJE A;  3AB1 A;  2YWL A;  2GAH B;  3IC9 A;  3NK2 X;  4H7U A;  2AR8 A;  1JOA A;  4N9X A;  2WOV A;  1L9E A;  3EF6 A;  2OLN A;  4IVM B;  1GRT A;  2EQ9 A;  2QAE A;  2AQJ A;  3P1W A;  4GAV A;  3GMC A;  1VDC A;  3AYI A;  1H86 A;  4J34 A;  4NEV A;  3UKK A;  4A6N B;  1PHH A;  3AE6 A;  3UKQ A;  3FBS A;  4C5O A;  4YSX A;  4ZN0 A;  2VQ7 A;  4U8J A;  1EL7 A;  3NYF A;  3SY4 A;  4J57 A;  2V3B A;  4H4U A;  1RSG A;  3O0H A;  1K0L A;  2C65 A;  4II3 A;  5JCL A;  3BHF A;  4CNK A;  4CY8 A;  2CFY A;  3K7M X;  4H4X A;  4CRT A;  5BRT A;  4P9S A;  3L8K A;  4IVO B;  5U1O A;  4A6N A;  1CC4 A;  3M13 A;  1CC6 A;  4O5U A;  2X8G A;  4EM4 A;  2BS2 A;  3KU9 A;  2VZ2 A;  4TM0 A;  4I58 A;  4YTM A;  3GYJ A;  4YSY A;  1D7L A;  1PBE A;  2RAB A;  2XFU A;  3AWI A;  4X4J A;  4J31 A;  1IUT A;  1ZDL A;  3GMB A;  3SM8 A;  3V76 A;  2EQ8 A;  4U8P A;  2E4G A;  1PJ5 A;  1VQW A;  2VRL A;  3OZ2 A;  3P4P A;  4CBQ A;  4D04 A;  1CF3 A;  2AAQ A;  1BGN A;  1GSN A;  4AOS A;  1LPF A;  1E1L A;  1BGJ A;  2WDQ A;  3AEB A;  4A79 A;  2BC1 A;  1CBO A;  4J2W A;  2BK3 A;  4OPI A;  3VRD B;  4Z2U A;  1B5Q A;  1CJ2 A;  3GRS A;  1PXC A;  2OLO A;  2V61 A;  4H4W A;  5KOW A;  1E1N A;  4JN9 A;  2GRT A;  2BS4 A;  1XHC A;  2R9Z A;  1PBD A;  1GEU A;  3QSM A;  2WU2 A;  4TLZ A;  2H88 A;  2GR2 A;  1NHS A;  1UKV G;  2B7S A;  2Q0L A;  5GRT A;  4RG3 A;  2VRM A;  1DXL A;  1YY5 A;  3DA1 A;  4UP3 A;  1ELI A;  1VRQ B;  3CPI G;  3C96 A;  4EQS A;  1DOD A;  1LQT A;  3QJ4 A;  1COY A;  3LAD A;  3CGB A;  5KOX A;  3VR9 A;  2YLT A;  2YVJ A;  4A7A A;  4H2N A;  5HY5 A;  4OPL A;  3SGL A;  2BRY A;  4EQW A;  3GDN A;  5ER0 A;  1GRF A;  2WPC A;  3Q6J A;  2WDV A;  3CN8 A;  5IPY A;  1FEB A;  2R4J A;  1PDH A;  1MOK A;  1D4D A;  3Q9T A;  5GSN A;  2A89 A;  4JY2 A;  3AE5 A;  3IHM A;  4WX1 A;  1S3B A;  5FMH A;  4ADW A;  2XVF A;  4YSZ A;  3NN6 X;  1NEK A;  1S2Q A;  2C76 A;  2BS3 A;  3F8P A;  3QFA A;  3UKH A;  2DKH A;  3DJJ A;  2BCG G;  4B66 A;  3PO7 A;  4K5S A;  3RP7 A;  3GWF A;  5DBJ A;  3NKS A;  3L1R A;  3FG2 P;  2BAC A;  3R9U A;  4PAB A;  2R4E A;  4CNJ A;  1XDI A;  3AED A;  2F5Z A;  1GET A;  3QFB A;  1LQU A;  3BI5 A;  2R0C A;  3AEE A;  2R46 A;  4YXD A;  4U8O A;  4EMJ A;  3FMW A;  3RP6 A;  2C4C A;  2QA1 A;  1SEZ A;  5L46 A;  2IVD A;  1FL2 A;  3OC4 A;  4UDR A;  3K30 A;  2YLZ A;  3FPZ A;  5JCK A;  1EBD A;  4A99 A;  4AP1 A;  2QCU A;  4C3Y A;  2BCP A;  1V59 A;  2CVJ A;  1GRE A;  1PS9 A;  2GH5 A;  2XVI A;  3SYI A;  2GV8 A;  2WES A;  2BC0 A;  1Q9I A;  3CGD A;  4J33 A;  3AD9 B;  5FS9 A;  4GR1 A;  1TDF A;  1H7X A;  4OPG A;  3NTD A;  1FCD A;  1JNZ A;  3LZW A;  1ONF A;  1ZMC A;  3AE7 A;  1LVL A;  2Q6U A;  4CCQ A;  2YQU A;  3B3R A;  3BNM A;  2ACZ A;  4H2P A;  3LB8 A;  4KPR A;  1IUX A;  4OCG A;  3UTF A;  4A5L A;  4LA1 A;  3UOV A;  3UP5 A;  1GPE A;  3ZDN A;  5EBK A;  2GQF A;  3P4Q A;  2V6O A;  3ICT A;  3VRA A;  3DJG X;  2JBV A;  5IQ4 A;  3CGC A;  1K0J A;  4U2S A;  3VRB A;  2OAL A;  2GMH A;  2E1M A;  2YVF A;  1OJD A;  1ZK7 A;  3H8I A;  2PYX A;  3NT6 A;  4H4Q A;  3UKL A;  3ATR A;  4H4V A;  4ZCC A;  3UTH A;  1DOB A;  1DJN A;  4HA6 A;  1IUU A;  1YQ4 A;  1OJT A;  3LXD A;  1D4E A;  3DK8 A;  3AE4 A;  2YLX A;  1E39 A;  2XLR A;  2GB0 A;  2NPX A;  4G6H A;  1BF3 A;  2WP5 A;  4EIQ A;  1H81 A;  2FJB A;  5JCM A;  1JEH A;  1YQ3 A;  1PBB A;  2XVH A;  2DKI A;  1REO A;  1KFY A;  2VVM A;  2ZZC A;  1P2E A;  2RGH A;  1FEA A;  4KX6 A;  4B64 A;  4OPU A;  4EQR A;  1VG0 A;  3KPK A;  1XPQ A;  5FS7 A;  2XLU A;  3SX6 A;  4G6G A;  3HZL A;  4H2R A;  3ALJ A;  4TLX A;  2X8H A;  4C74 A;  5FS8 A;  2WDR A;  3H4K A;  2GR3 A;  3DK9 A;  4U2L A;  1JNR A;  3P4S A;  1B8S A;  3DJD A;  3GYI A;  3GD4 A;  4MJW A;  4U8K A;  1N1P A;  1CJ3 A;  1MXT A;  2XVJ A;  3QVR A;  1E1K A;  4H2Q A;  4II2 A;  1KNR A;  1LV0 A;  2B9W A;  3AE2 A;  4G73 A;  1DOE A;  3NH3 X;  3DGZ A;  4AT0 A;  1E1M A;  1OJ9 A;  4Z24 A;  4YKF A;  1NHR A;  1LJ1 A;  3GDP A;  1CJ4 A;  1E7P A;  2YG5 A;  1RYI A;  1PXB A;  2C72 A;  3C4N A;  3AD7 B;  3COX A;  4EM3 A;  2WP6 A;  2GR0 A;  5LV9 A;  4I59 A;  3AXB A;  1NG4 A;  2JK6 A;  4B68 A;  3T37 A;  3BI2 A;  4EMW A;  4NTD A;  4BK2 A;  2EQ7 A;  3RED A;  2X99 A;  1P2H A;  1HYU A;  4AT2 A;  2C66 A;  5TR3 A;  4HB9 A;  1LTX R;  2VVL G;  1D5T A;  3P4R A;  3EAN A;  1AOG A;  3NK0 X;  5U63 A;  1GES A;  1YKJ A;  2WQY A;  2X50 A;  2V3A A;  1TYP A;  3KKJ A;  3CNS A;  5KMR A;  1GRG A;  2C75 A;  1TDO A;  2JKC A;  4FX9 A;  4REK A;  4K8D A;  2BXR A;  1GTH A;  4O5Q A;  1H84 A;  3QSE A;  4NNJ A;  3ATQ A;  1M64 A;  4U2T A;  1B37 A;  2WU5 A;  2XFQ A;  2ZZ0 A;  4IA6 A;  5BUL A;  5KWF A;  4G74 A;  3URH A;  2TPR A;  2YAU A;  3NTA A;  2Y6R A;  4TM3 A;  3HYX A;  3F8R A;  1JRY A;  2I0Z A;  4GCM A;  4OPD A;  2XYO A;  5KVH A;  2GAG B;  4H4R A;  4DSH A;  3NN0 X;  2J3N A;  4M52 A;  1JRX A;  1PBF A;  4K22 A;  2C64 A;  2BRA A;  2RGJ A;  3D8X A;  5CKU A;  1OJC A;  2JB1 A;  2XFP A;  3CTY A;  3ICS A;  3NNE A;  1QJD A;  1Y56 B;  3G5S A;  3M0O A;  3LJP A;  3NLC A;  4U8I A;  3DJE A;  1EL8 A;  1GAL A;  1JRZ A;  1OJA A;  2WEU A;  3P9U A;  4GF7 A;  3DH9 A;  4UDQ A;  2C7G A;  4TM4 A;  2NVK X;  2YR6 A;  4WCT A;  4C77 A;  3CIR A;  1FOH A;  4X9N A;  5EB4 A;  1X31 B;  1Z6L A;  3DK4 A;  3AE8 A;  3FIM B;  4EQX A;  3SZF A;  3NIX A;  4DNA A;  2E5V A;  3UKP A;  1BKW A;  4ZCD A;  2X8C A;  4EIP A;  4H4Y A;  2RGO A;  5J7X A;  3LZX A;  1K4Q A;  3V3O A;  3ZYX A;  4Z25 A;  3C4A A;  2VQB A;  3NRN A;  4ECH A;  1CHU A;  3CPJ G;  2YLS A;  1GRH A;  3II4 A;  5CQF A;  2YLW A;  1VG9 A;  2BAB A;  3KLJ A;  1RP0 A;  2B9X A;  4U8M A;  4G9K A;  1TYT A;  1Q1R A;  2JAE A;  4GDP A;  4BJZ A;  1QO8 A;  4Z44 A;  2XLT A;  4OVI A;  1B4V A;  2WOI A;  3UTE A;  5C3J A;  2BA9 A;  3KD9 A;  3IWA A;  5HHF A;  2YM2 A;  2CDU A;  5EOW A;  2BK4 A;  2Y6Q A;  2B76 A;  1N4U A;  4LU6 A;  1E6E A; 
#chains in the Genus database with same CATH homology
 3KVE A;  2JB2 A;  1ZX9 A;  3UTG A;  2WPE A;  3CNJ A;  2XDO A;  3EAO A;  2C3D A;  5J60 A;  1GRA A;  1H7W A;  4NTC A;  3RHA A;  1O5W A;  4CCR A;  2C70 A;  1BWC A;  3ALM A;  4H4T A;  2FJA A;  3ISH A;  1KDG A;  3T0K A;  2W0H A;  4USQ A;  1M6I A;  1NEN A;  2XLP A;  3PVC A;  2BK5 A;  3DME A;  4JNA A;  3D1C A;  2R0P A;  1L9D A;  3NG7 X;  4YKG A;  4FK1 C;  3GYX A;  4U8L A;  4EMI A;  2C67 A;  4BUR A;  3PS9 A;  2YR4 A;  1DJQ A;  2GR1 A;  3GSI A;  3CND A;  2QA2 A;  4H4S A;  5BUK A;  2HQM A;  3IHG A;  3UOY A;  3T31 A;  1TDN A;  1N4V A;  4GUV A;  4DSG A;  4Z26 A;  2FBW A;  4TM1 A;  4K5R A;  4NTE A;  2IID A;  2XLS A;  1F8R A;  4J36 A;  4JY3 A;  1PJ7 A;  2VVL A;  1IJH A;  2EQ6 A;  1H83 A;  4Z43 A;  2WOW A;  3SZ0 A;  2BXS A;  1NPX A;  1CC2 A;  1GER A;  2GEW A;  3ALL A;  3BHK A;  2Q7V A;  2BYB A;  4J56 A;  3T2Z A;  1GND A;  2YVG A;  1ZKQ A;  2C3C A;  2ZZB A;  1GV4 A;  1TDE A;  1XAN A;  3CPH G;  3VR8 A;  3UOZ A;  2WPF A;  4GDE A;  3UKF A;  4Z2R A;  4A65 A;  4YT0 A;  2V5Z A;  5KMP A;  4Z2T A;  1GOS A;  2JB3 A;  1NHQ A;  2Z5X A;  1GRB A;  3SXI A;  4USR A;  1D7Y A;  4H4P A;  4BK1 A;  1IUW A;  1TRB A;  3ICR A;  5KMS A;  3AYJ A;  1PXA A;  1DNC A;  2Q0K A;  3QSS A;  3AEG A;  3ITJ A;  3UP4 A;  5KRQ A;  2TMD A;  4B67 A;  2WP9 A;  2UZZ A;  4GAP A;  1KSS A;  1TDK A;  2PHH A;  3QVP A;  2XCG A;  5JCI A;  1EL9 A;  3GWD A;  2X3N A;  3CNT A;  4JQ9 A;  1S3E A;  2ARD A;  4BV6 A;  2GVC A;  4YSH A;  5KXJ A;  1NDA A;  2A8X A;  1N4W A;  2IVE A;  4UDP A;  3EPT A;  4NEW A;  1ZP0 A;  3RNM A;  4RG4 A;  4D03 A;  2YG6 A;  1S2Y A;  4IA5 A;  2VOU A;  3ADA B;  2YR5 A;  4K2X A;  2WS3 A;  2B9Y A;  1Y0P A;  4Y4M A;  4LII A;  1O95 A;  5KNL A;  3SFE A;  1F8W A;  2WET A;  1ZOV A;  5IQ1 A;  4E0V A;  4NZH A;  3WE0 A;  3G5Q A;  1JU2 A;  4FDC B;  1F6M A;  2OA1 A;  1L0V A;  2YG4 A;  3HYV A;  5HXI A;  2H89 A;  2YLR A;  1NHP A;  3B6D A;  1KNP A;  1KSU A;  4XXG A;  3IF9 A;  3AYL A;  1EL5 A;  3BI4 A;  3KPF A;  4JDR A;  5EB5 A;  3AE9 A;  2YM1 A;  4XWR A;  3SQP A;  3K7Q X;  4B1B A;  3GD3 A;  1IUS A;  3ABV A;  3LOV A;  3I6D A;  4B69 A;  1BZL A;  2XFO A;  3JSK A;  3NYC A;  4OPC A;  2B7R A;  5HYM A;  1D4C A;  1H82 A;  1ZMD A;  2ZBW A;  3BNU A;  1NG3 A;  1PN0 A;  1IUV A;  4YTP A;  2OAM A;  4U8N A;  4NWZ A;  5JCN A;  4AOX A;  1KF6 A;  3E1T A;  5U25 A;  4DGK A;  2WHD A;  2XFN A;  5C2T A;  2GF3 A;  3CNP A;  4YWO A;  5M10 A;  4JNQ A;  2C73 A;  4Y4N A;  3AD8 B;  1F8S A;  4PAA A;  4OPT A;  4B65 A;  5BVA A;  4C3X A;  1K0I A;  1Q1W A;  1GXF A;  3SZW A;  5KVI A;  3VQR A;  1W4X A;  3T14 A;  1Y56 A;  3SFD A;  2YG7 A;  3RP8 A;  3S5W A;  3GRT A;  3CMM A;  1PBC A;  1L9C A;  3AEC A;  3DGH A;  2APG A;  1GTE A;  3H8L A;  5KMQ A;  2YG3 A;  3T2Y A;  4B63 A;  3F8D A;  3T2K A;  3CGE A;  5FS6 A;  3UKA A;  4ICY A;  4XWZ A;  4YTN A;  3AEF A;  2R45 A;  1ZY8 A;  4BJY A;  3UCL A;  2R0G A;  3NK1 X;  3AE3 A;  3HYW A;  1GT8 A;  1ZOY A;  3KA7 A;  4BK3 A;  4A9W A;  4Y4L A;  1FEC A;  4GRT A;  2O9Z A;  2WBA A;  3G5R A;  1CL0 A;  2GQW A;  4H4Z A;  1CJC A;  1F3P A;  3K7T A;  2GMJ A;  4AP3 A;  1H6V A;  3AE1 A;  1QLB A;  1NAA A;  3NGC X;  3V3N A;  1MO9 A;  3AEA A;  3SZC A;  4H50 A;  2A87 A;  4IV9 A;  3I3L A;  1PJ6 A;  4CY6 A;  1YQZ A;  4K7Z A;  2CUL A;  3S61 A;  3NHO X;  2XVE A;  3NYE A;  4X9M A;  3UOX A;  1DOC A;  1O94 A;  3M12 A;  4RSL A;  2Z5Y A;  4FK1 A;  2V60 A;  5M0Z A;  4APN A;  2FJD A;  2FJE A;  3AB1 A;  2YWL A;  2GAH B;  3IC9 A;  3NK2 X;  4H7U A;  2AR8 A;  1JOA A;  4N9X A;  2WOV A;  1L9E A;  3EF6 A;  2OLN A;  4IVM B;  1GRT A;  2EQ9 A;  2QAE A;  2AQJ A;  3P1W A;  4GAV A;  3GMC A;  1VDC A;  3AYI A;  1H86 A;  4J34 A;  4NEV A;  3UKK A;  4A6N B;  1PHH A;  3AE6 A;  3UKQ A;  3FBS A;  4C5O A;  4YSX A;  4ZN0 A;  2VQ7 A;  4U8J A;  1EL7 A;  3NYF A;  3SY4 A;  4J57 A;  2V3B A;  4H4U A;  1RSG A;  3O0H A;  1K0L A;  2C65 A;  4II3 A;  5JCL A;  3BHF A;  4CNK A;  4CY8 A;  2CFY A;  3K7M X;  4H4X A;  4CRT A;  5BRT A;  4P9S A;  3L8K A;  4IVO B;  5U1O A;  4A6N A;  1CC4 A;  3M13 A;  1CC6 A;  4O5U A;  2X8G A;  4EM4 A;  2BS2 A;  3KU9 A;  2VZ2 A;  4TM0 A;  4I58 A;  4YTM A;  3GYJ A;  4YSY A;  1D7L A;  1PBE A;  2RAB A;  2XFU A;  3AWI A;  4X4J A;  4J31 A;  1IUT A;  1ZDL A;  3GMB A;  3SM8 A;  3V76 A;  2EQ8 A;  4U8P A;  2E4G A;  1PJ5 A;  1VQW A;  2VRL A;  3OZ2 A;  3P4P A;  4CBQ A;  4D04 A;  1CF3 A;  2AAQ A;  1BGN A;  1GSN A;  4AOS A;  1LPF A;  1E1L A;  1BGJ A;  2WDQ A;  3AEB A;  4A79 A;  2BC1 A;  1CBO A;  4J2W A;  2BK3 A;  4OPI A;  3VRD B;  4Z2U A;  1B5Q A;  1CJ2 A;  3GRS A;  1PXC A;  2OLO A;  2V61 A;  4H4W A;  5KOW A;  1E1N A;  4JN9 A;  2GRT A;  2BS4 A;  1XHC A;  2R9Z A;  1PBD A;  1GEU A;  3QSM A;  2WU2 A;  4TLZ A;  2H88 A;  2GR2 A;  1NHS A;  1UKV G;  2B7S A;  2Q0L A;  5GRT A;  4RG3 A;  2VRM A;  1DXL A;  1YY5 A;  3DA1 A;  4UP3 A;  1ELI A;  1VRQ B;  3CPI G;  3C96 A;  4EQS A;  1DOD A;  1LQT A;  3QJ4 A;  1COY A;  3LAD A;  3CGB A;  5KOX A;  3VR9 A;  2YLT A;  2YVJ A;  4A7A A;  4H2N A;  5HY5 A;  4OPL A;  3SGL A;  2BRY A;  4EQW A;  3GDN A;  5ER0 A;  1GRF A;  2WPC A;  3Q6J A;  2WDV A;  3CN8 A;  5IPY A;  1FEB A;  2R4J A;  1PDH A;  1MOK A;  1D4D A;  3Q9T A;  5GSN A;  2A89 A;  4JY2 A;  3AE5 A;  3IHM A;  4WX1 A;  1S3B A;  5FMH A;  4ADW A;  2XVF A;  4YSZ A;  3NN6 X;  1NEK A;  1S2Q A;  2C76 A;  2BS3 A;  3F8P A;  3QFA A;  3UKH A;  2DKH A;  3DJJ A;  2BCG G;  4B66 A;  3PO7 A;  4K5S A;  3RP7 A;  3GWF A;  5DBJ A;  3NKS A;  3L1R A;  3FG2 P;  2BAC A;  3R9U A;  4PAB A;  2R4E A;  4CNJ A;  1XDI A;  3AED A;  2F5Z A;  1GET A;  3QFB A;  1LQU A;  3BI5 A;  2R0C A;  3AEE A;  2R46 A;  4YXD A;  4U8O A;  4EMJ A;  3FMW A;  3RP6 A;  2C4C A;  2QA1 A;  1SEZ A;  5L46 A;  2IVD A;  1FL2 A;  3OC4 A;  4UDR A;  3K30 A;  2YLZ A;  3FPZ A;  5JCK A;  1EBD A;  4A99 A;  4AP1 A;  2QCU A;  4C3Y A;  2BCP A;  1V59 A;  2CVJ A;  1GRE A;  1PS9 A;  2GH5 A;  2XVI A;  3SYI A;  2GV8 A;  2WES A;  2BC0 A;  1Q9I A;  3CGD A;  4J33 A;  3AD9 B;  5FS9 A;  4GR1 A;  1TDF A;  1H7X A;  4OPG A;  3NTD A;  1FCD A;  1JNZ A;  3LZW A;  1ONF A;  1ZMC A;  3AE7 A;  1LVL A;  2Q6U A;  4CCQ A;  2YQU A;  3B3R A;  3BNM A;  2ACZ A;  4H2P A;  3LB8 A;  4KPR A;  1IUX A;  4OCG A;  3UTF A;  4A5L A;  4LA1 A;  3UOV A;  3UP5 A;  1GPE A;  3ZDN A;  5EBK A;  2GQF A;  3P4Q A;  2V6O A;  3ICT A;  3VRA A;  3DJG X;  2JBV A;  5IQ4 A;  3CGC A;  1K0J A;  4U2S A;  3VRB A;  2OAL A;  2GMH A;  2E1M A;  2YVF A;  1OJD A;  1ZK7 A;  3H8I A;  2PYX A;  3NT6 A;  4H4Q A;  3UKL A;  3ATR A;  4H4V A;  4ZCC A;  3UTH A;  1DOB A;  1DJN A;  4HA6 A;  1IUU A;  1YQ4 A;  1OJT A;  3LXD A;  1D4E A;  3DK8 A;  3AE4 A;  2YLX A;  1E39 A;  2XLR A;  2GB0 A;  2NPX A;  4G6H A;  1BF3 A;  2WP5 A;  4EIQ A;  1H81 A;  2FJB A;  5JCM A;  1JEH A;  1YQ3 A;  1PBB A;  2XVH A;  2DKI A;  1REO A;  1KFY A;  2VVM A;  2ZZC A;  1P2E A;  2RGH A;  1FEA A;  4KX6 A;  4B64 A;  4OPU A;  4EQR A;  1VG0 A;  3KPK A;  1XPQ A;  5FS7 A;  2XLU A;  3SX6 A;  4G6G A;  3HZL A;  4H2R A;  3ALJ A;  4TLX A;  2X8H A;  4C74 A;  5FS8 A;  2WDR A;  3H4K A;  2GR3 A;  3DK9 A;  4U2L A;  1JNR A;  3P4S A;  1B8S A;  3DJD A;  3GYI A;  3GD4 A;  4MJW A;  4U8K A;  1N1P A;  1CJ3 A;  1MXT A;  2XVJ A;  3QVR A;  1E1K A;  4H2Q A;  4II2 A;  1KNR A;  1LV0 A;  2B9W A;  3AE2 A;  4G73 A;  1DOE A;  3NH3 X;  3DGZ A;  4AT0 A;  1E1M A;  1OJ9 A;  4Z24 A;  4YKF A;  1NHR A;  1LJ1 A;  3GDP A;  1CJ4 A;  1E7P A;  2YG5 A;  1RYI A;  1PXB A;  2C72 A;  3C4N A;  3AD7 B;  3COX A;  4EM3 A;  2WP6 A;  2GR0 A;  5LV9 A;  4I59 A;  3AXB A;  1NG4 A;  2JK6 A;  4B68 A;  3T37 A;  3BI2 A;  4EMW A;  4NTD A;  4BK2 A;  2EQ7 A;  3RED A;  2X99 A;  1P2H A;  1HYU A;  4AT2 A;  2C66 A;  5TR3 A;  4HB9 A;  1LTX R;  2VVL G;  1D5T A;  3P4R A;  3EAN A;  1AOG A;  3NK0 X;  5U63 A;  1GES A;  1YKJ A;  2WQY A;  2X50 A;  2V3A A;  1TYP A;  3KKJ A;  3CNS A;  5KMR A;  1GRG A;  2C75 A;  1TDO A;  2JKC A;  4FX9 A;  4REK A;  4K8D A;  2BXR A;  1GTH A;  4O5Q A;  1H84 A;  3QSE A;  4NNJ A;  3ATQ A;  1M64 A;  4U2T A;  1B37 A;  2WU5 A;  2XFQ A;  2ZZ0 A;  4IA6 A;  5BUL A;  5KWF A;  4G74 A;  3URH A;  2TPR A;  2YAU A;  3NTA A;  2Y6R A;  4TM3 A;  3HYX A;  3F8R A;  1JRY A;  2I0Z A;  4GCM A;  4OPD A;  2XYO A;  5KVH A;  2GAG B;  4H4R A;  4DSH A;  3NN0 X;  2J3N A;  4M52 A;  1JRX A;  1PBF A;  4K22 A;  2C64 A;  2BRA A;  2RGJ A;  3D8X A;  5CKU A;  1OJC A;  2JB1 A;  2XFP A;  3CTY A;  3ICS A;  3NNE A;  1QJD A;  1Y56 B;  3G5S A;  3M0O A;  3LJP A;  3NLC A;  4U8I A;  3DJE A;  1EL8 A;  1GAL A;  1JRZ A;  1OJA A;  2WEU A;  3P9U A;  4GF7 A;  3DH9 A;  4UDQ A;  2C7G A;  4TM4 A;  2NVK X;  2YR6 A;  4WCT A;  4C77 A;  3CIR A;  1FOH A;  4X9N A;  5EB4 A;  1X31 B;  1Z6L A;  3DK4 A;  3AE8 A;  3FIM B;  4EQX A;  3SZF A;  3NIX A;  4DNA A;  2E5V A;  3UKP A;  1BKW A;  4ZCD A;  2X8C A;  4EIP A;  4H4Y A;  2RGO A;  5J7X A;  3LZX A;  1K4Q A;  3V3O A;  3ZYX A;  4Z25 A;  3C4A A;  2VQB A;  3NRN A;  4ECH A;  1CHU A;  3CPJ G;  2YLS A;  1GRH A;  3II4 A;  5CQF A;  2YLW A;  1VG9 A;  2BAB A;  3KLJ A;  1RP0 A;  2B9X A;  4U8M A;  4G9K A;  1TYT A;  1Q1R A;  2JAE A;  4GDP A;  4BJZ A;  1QO8 A;  4Z44 A;  2XLT A;  4OVI A;  1B4V A;  2WOI A;  3UTE A;  5C3J A;  2BA9 A;  3KD9 A;  3IWA A;  5HHF A;  2YM2 A;  2CDU A;  5EOW A;  2BK4 A;  2Y6Q A;  2B76 A;  1N4U A;  4LU6 A;  1E6E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...